2DYMA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-46) complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
285
structure length
254
Chain Sequence
b'AHMNDIKQLLWNGELNVLVSIDPSFEIAVLRIRVPRETYLVNYMPLIWNKIKSYFWFEHNKTPIPWNYPVGVLFDCLAGFTTSFENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTTFRISQPTISMTGVNPTLKDIEGDILDVKDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy protein 5
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover/protein turnover
total genus 72
structure length 254
sequence length 285
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dymA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dymA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dymA01
3L08A 5D2MB 2ZZPB 3B08A 3MJWA 4W9LA 1V49A 2KX3A 2N9PC 4EOYA 3B0AA 3QA8A 5GMVA 2GBKA 5CX3A 4ZRKA 3N32A 1R4NI 2DYOA 3JSVA 4ZRJA 2LWPA 4WJPA 1WI0A 3GOEA 2M17A 5D94A 4RM9A 3QHTA 4GOCA 4RMAA 3KUZA 4K7UA 2DZMA 3VTWA 3VHTC 4ANUA 1L7YA 4LJOB 2VRRB 3RT3B 1V81A 3Q3FA 2N7EA 3ZTDA 2K25A 1YQBA 4J6IA 2YVCA 1OGWA 3OLMD 2G45B 3T9LA 2KC1A 2I1KA 1YD8U 2WX0A 2ZPYA 3NY5A 2A5UA 3PGEA 1V9JA 3QARA 2JPHA 1WM3A 1J19A 3TCAA 2KDEB 2L8JA 1BT0A 2KDIA 3VQIA 4K1RB 1H4RA 3KH0A 3NS8A 3EC8A 3V6EB 3ZIMA 2LZ6A 2AL6A 1XQQA 2FIFA 3QCAA 4MJSB 2C7MB 4HCNB 4MGYE 5DPTA 1WXSA 2FCSA 4II3B 2HJ8A 3PV1A 3L16A 4YL8A 2G4DB 2MBQA 2XK5A 1WE7A 3DVNU 2MBEA 4EZKA 1A5RA 1LXDA 3DPDA 1RFAA 2O6VD 5AZFA 2ZVNA 4MGKE 1WM2A 3V61A 2IY0B 3IFWB 4KZ0A 4W9IA 4GIVA 4B9KA 2G3QB 2GOWA 3GZNI 4G3XB 1E8WA 2JY6A 5BO4B 3H6NA 3SD5A 1D3ZA 3QAQA 1Z5SB 1WR6E 3PPAA 3UF8A 1P3QU 2IO2B 1IYFA 3PT2B 3OJ3A 3TIXA 4BVUC 3TL5A 1RAXA 4HCPB 4BBNF 2D2QA 4XZ4A 5FR6A 3KYDD 1K8RB 3AI5A 1WRDB 2KLGA 3ZLZA 1J8CA 3AULA 2FCMA 1RRBA 4A20A 2IBIB 2C60A 3IVFA 2L7RA 5CHWA 4F8CB 3H7PB 4AOFA 4KV2A 3M62B 5AZHA 4A3PA 4AUQC 5G55A 3MTNB 5E6NA 2AL3A 2M0XA 2K39A 4LDTD 2BYFA 1CMXB 3PRMB 4I6LB 4ICUA 1OEYA 2BWFA 2BF8B 5TR5A 2Z0EB 4ZRIA 2JVCA 3AU4A 2DZKA 4FADA 4IC7B 2KKCA 3VAWA 5C1ZA 3BY4B 3WAPA 3VH4B 2LI5A 2LXAA 4JIOU 1L2NA 2I1JA 3H9DA 3VH3B 1WXVA 2V4LA 1OQYA 1YX6B 2G4SA 4DHZE 2N7DA 2WYQA 3ZNZB 2NCNA 2LGYA 1S3SG 3A9JA 1WZ3A 1P0RA 5D6JB 2K6DB 2J0MA 1PQSA 1Q1OA 3ALBA 1LM8B 2GBNA 4XX5A 2CHZA 1LFDA 3ZVVA 1F9JA 5DPWA 3HM3A 2EMSA 1E5WA 4PS7A 3IG3A 4GN1A 4ZDVA 5J17A 1R4MI 2K1FA 4TV3A 4NJ7A 2GBRA 2NPTA 4TKNA 3ONSA 2FIDA 4EFOA 4WAAA 2IO0B 2NBVB 2M8SA 5JZEB 4GDLB 1V86A 2DYMA 3PTFC 4W9GA 1WJ4A 2C5LC 1V80A 2MP2B 3LDZE 3PHWB 3TJPA 4MELA 1V5OA 3M3JA 3PSEB 3V60A 3X0WA 2QHOA 4GMVA 1XT9B 3KW5B 3R66C 2YLMA 3CF6E 2KVRA 3HIZA 3VVWB 1E8ZA 2LVPA 2N1VA 4HDQA 3ZRCA 2L0FA 3ECIA 5EDSA 1H8CA 2IZVB 2NPTB 2WWZA 4KSKC 4FJVB 2KWUB 2N9EB 4K81A 4EZLA 1WJUA 1ZW7A 1RLFA 4WQOB 2EKEC 1VD2A 3RD2A 2KWVB 2D07B 2KQSA 4KDIC 1TTNA 5JHBA 2KDFB 3QQ8B 3A33B 4WJQA 5CHVC 2KK8A 5KHOA 2MWSB 4AJYB 1E7UA 4FHKA 3HK0A 2HE7A 3NZSA 2D11A 4HK2A 2MBHA 5AZGA 3UQAA 4OVVA 4M8NA 1WIAA 4K7SA 2DAFA 3M95A 2WDTB 1UGMA 3ML9A 5DCNA 4MEMA 3VFKA 5J2RA 3WAOA 4MJSA 3JVZX 4MSMB 4E3CA 4A3OA 5LXHA 2NR2A 2JUOA 1WJ6A 4FHJA 3R7QA 4FN2A 2LVOA 2XEWA 5D7GA 2R2QA 4IWQA 4IWPA 4CHKA 3U30A 2BGFA 2KMAA 3DBRI 4BBNC 4EEWA 2JT4B 2KZRA 1NDDA 2ZPNA 5LLIA 3PZDA 3ZO5B 3X23A 2JRHA 1FXTB 3AXCA 3R3MA 2LGXA 2IY1B 2ZCBA 3NHEB 4W9KA 1YX5B 2KTFA 3N3KB 2Z0DB 2KC2A 3SU8X 4FBJB 3VUWA 2V1YA 3CSTA 3ZKJC 1JRUA 3CSFA 2ZCCA 5IA7A 1WZ0A 4G11A 5G2NA 4EZJA 1WJNA 2M4NA 2KJHB 5LXIB 2NBWB 4F7ZA 2NVUI 4N9F4 4GDKB 2EMTA 2UWQA 4GGQA 2D3GA 3ENEA 3ZNGC 3A1QB 4PS8A 1UELA 3H7PA 2FUHB 3QK0A 3C0RB 5C23A 2MBBB 2JXXA 3M63B 4KSLC 4PYUA 1SE9A 3NOBA 2LVQA 3Q3JA 4IM0A 4TUUA 2ZJDA 1S1QB 2KWCA 4KVGB 5DPSA 2JZZA 3ZDMC 3UQBA 3DVGX 2J7QB 2BYVE 1ZKHA 2JWZA 5DPRA 1WR1A 2FNJB 2V3SA 3OJ4B 3OAWA 1P1AA 2KTRB 3UGBB 2KXJA 4IWOA 3ZDTA 2K6QA 3DOWA 5E6OA 2KQ7A 3ZRFA 1TBEA 1V2YA 2DZJA 2CU1A 3EHVA 4II2B 3VXWA 4ANWA 4CO7A 4KZCA 3APFA 3D32A 4G0NB 3SHQA 4ZYNA 2AEHA 1WXMA 2LRUA 3KUDB 4NPNA 4P7IA 1QZEA 4W9EA 1WF9A 3KYCD 1YIWA 2PE6B 2RR9A 1MG8A 3SDLC 4MM3A 2RPQA 3V62A 1WH3A 2MW5A 3AU5A 2ASQA 2KNBA 2D10A 2B3AA 2NS5A 1C1YB 3NZUA 4LCDE 3RZFA 1WGYA 4WWPA 4GDLA 1KLVA 3MHSD 4E74A 1X1MA 2MP2A 4NAWA 2OJRA 3PRZA 1UBQA 2OOBB 3EECA 4HDOA 2KMCA 1V5TA 3ZUNA 2BKRB 2W9NA 1HE8A 1Z2MA 2KDBA 2DYBA 2K8HA 3U7DA 3PLVA 4GXBA 1WX8A 3DBLI 3L17A 2MCNB 2MQJA 4I6NB 2N4FA 2KOXA 3DDCB 3IBEA 4M8MA 2J0KA 1WGDA 1E7VA 2KX0A 4E71A 2BWES 4HLEA 4F1SA 3PHXB 2C7NB 2LRWA 4NAWB 3VTUA 1VCBA 2DHZA 3L54A 2DZIA 2ZNVB 2NBUA 1ISNA 2RD0A 4IUMB 1WX7A 4NJ6A 1UH6A 4KIKB 3UIPB 3W1SC 2MX2A 4DK5A 2ZNVC 1WFYA 2KANA 4IM3A 2O2VB 4ASWC 3RCZA 2BYEA 1I35A 1C3TA 3L10B 2LGDA 2KFKA 3I3TB 3PRPB 4BOZB 2CHXA 3ZNHB 5IAAC 4XC2A 2KD0A 1G6JA 1WE6A 4BKSA 3APCA 3L0WB 4EKUA 5E6PA 1OEYJ 2KO3A 4W9DA 2CKHB 4NQLB 3APDA 4JL9A 2KJRA 1GUAB 2N1WA 3TMPB 3K9OB 3WA0A 3JYUA 2CS4A 1KJTA 2M1MA 2CR5A 2LXCA 2LJ5A 4RM8A 3WALA 2KFKB 3W1YA 2L76A 3DCGA 4AJWA 2JF5A 1SGHA 1UD7A 1YJ1A 3IHPC 3PS6A 1WYWB 4LDTB 1KM7A 3ML8A 1GC7A 3U8ZA 1E8YA 1OTRB 4IM2A 2L3ZA 3VTVA 4WWOA 4GDKA 3HM6X 3ZTCA 1EUVB 4IW0A 1Q5WB 3A1QA 4AWJA 4HPMB 1UBIA 2AYOB 1U4AA 3VUYA 3R7RA 2ZEQA 2KJ6A 3QJZA 1WGRA 2WX1A 4URKA 4LJPB 4DWFA 2K8CA 1WMHA 2LASA 3PVLA 3DBSA 5L95C 3ZNID 1AARA 3B1LX 3ZW3A 4DHZB 3DVNV 3H1UA 3VUXA 1J0GA 2KFJA 2DAJA 4WWNA 2KTRA 1UZXB 2GBMA 4MGIE 1P98A 4K7WA 3T8MA 5JH5C 4G50A 1IP9A 4DHJB 3JSVB 4NY0A 1V6EA 3KUCB 2FCNA 5L83A 1E90A 2L05A 1WMHB 4W9CA 5JHAA 3P2BA 4BKGA 1I42A 1GG3A 4FA6A 3RULA 4PYZA 4B6WA 2HD5B 3O65B 4JQWC 4ANXA 4JGHB 4FLHA 1WGGA 4B95A 2N9XA 2C9WB 4FULA 2BKFA 4W9JA 1TZ1A 2K8BA 4W9FA 3JW0X 4AP4C 4KDLB 4TQ0A 4DDID 1WGHA 5J18A 3V6CB 2RSUA 2IYDB 4FJZA 2XK5B 1EO6A 2FAZA 4IG7B 2KHWB 3K9PB 4JLCA 4MH0E 4X57B 3DVGY 2FCQA 4WJNA 4HWIB 4BKTA 5AEKB 2MLBA 4GU2A 4DXAB 1GNUA 1WXAA 3UIOB 4CYEA 2MRPA 3A9KA 4BKSD 3A4SC 3BINA 2L00B 2L0TA 2CHWA 2XBBC 3W1SA 2IO3B 1T0YA 2C7HA 1EF1A 3WIMA 4HXDA 4DBGA 4FJYA 2RGFA 3A4RA 4KIKA 1LQBA 5HKHA 2MA9B 4DDGD 2KN5A 2R2OA 3LJ3A 2J0JA 2O2VA 4MSQB 1EF5A 2O6VA 2GMIC 3DBHI 1P9DU 2GBJA 3TBLD 4PS3A 2MBOA 3WAMA 4ICVA 4MDKE 4GB9A 3UINB 3A9KB 5CTRC 2JRIB 2KLCA 3VDZA 1WY8A 3QWZB 3RUIB 4MGZE 1SIFA 3CMMB 2DX5B 4WJOA 4EUTA 4W9HA 3KVFB 4DHJD 4GSWA 2PPHA 1E8XA 4I6PA 2O6VB 1Y8RC 3PREA 4OVUA 2Z59B 2LUEA 3RYTA 1NBFC 2JZ3B 2A4ZA 3HHMA 4NNJB 1M94A 3RZWC 4HJKA 1ZGUB 2HTHA 1Q0WB 2IO1B 2PE9A 4TQ1A 2MSED 3EFUA 3N30A 3QX1A 2Y5BB 3A9JB 3PLUA 4ANVA 5CHFA 2PEAA 2BPSA 2LD9A 4BOSC 3QC8B 1GJZA 1TGZB 5KHQA 1KOTA 4NQKE 1IPGA 4HPLB 3DQVA 3H7SA 3S2AA 2DENB 3QIJA 4HVBA 2AWTA 1NI2A 3L13A 1GC6A 2PJHA 2UYZB 4BFRA 3WANA 1XD3B 2ZVOA 2REXA 4M0WB 1WX9A
chains in the Genus database with same CATH superfamily
1JWAD 4MT5A 3V09A 4EOYA 3SFEB 3PZ8A 5CX3A 3N32A 1R4NI 2WXFA 5HI1A 5FUOA 1D5MC 3AE2B 2BYTA 5D94A 1MG4A 4RM9A 4RMAA 1XLQA 2NTSA 2DZMA 4M70B 2VRRB 5BMIA 1YQBA 4WURA 2G45B 1YD8U 2VUEA 2A5UA 3QARA 4TSSA 2BXGA 4K3CA 4GG2A 4G04A 3Q3NC 2NTTA 1E6EB 3KH0A 3ICXA 2GB1A 5AUKA 4HCNB 4MGYE 3SR6A 4YL8A 2G4DB 1ZDVA 1JQ4A 1WE7A 2WDRB 3DBRB 1E9MA 3VRAB 2O6VD 1IGCA 1WM2A 5G5HA 2V3NA 2G3QB 2GOWA 3GZNI 4G3XB 3MHZA 3SD5A 2ONQA 3QAQA 1Z5SB 1WR6E 1E7IA 2IO2B 1FXAA 3P4PB 4XYCA 4XZ4A 1J8CA 2KLGA 3ZLZA 1YNTE 2IBIB 1XLOA 5BYSA 4A3PA 3AB5A 1TY0A 1HTQA 2M0AA 2GRIA 1OFFA 1OEYA 4ZRIA 2JVCA 1QT9A 2G9HD 4JX1C 2KAJA 3LU6A 3WAPA 1P7FA 2LXAA 1GAQB 1C76A 2I1JA 4XDDA 1YX6B 1MHXA 1HA2A 2NCNA 2V4IB 1V1OA 4L1BA 1ZE3D 3EA6A 2IGGA 1YQ4B 1F9JA 1A70A 4TV3A 2LOQA 1JNBA 2LEKA 3AE8B 2BVCA 4B0EA 3NUHB 1MPEA 2M8SA 4GDLB 1V86A 5BPKA 2KACA 2WU2B 2Y5PA 1CJEA 3M3JA 3KW5B 3HIZA 1SE4A 2KVRA 3AEGB 2L0FA 5EDSA 1H8CA 2IZVB 2WWZA 2TSSA 4K81A 4ARCA 3AEEB 2DWQA 3AE6B 1VD2A 3RD2A 4P6VF 3GE8C 1KLUD 2KDFB 4AJYB 2WDVB 4WJQA 4FHKA 3SIVB 2HE7A 2D11A 2WGSA 1WIAA 2J52A 4OZBA 4DQOC 2WDTB 3G9KD 1CK1A 4XDCA 1UNSA 4S0RA 4EE2A 4A55A 1WJ6A 4FHJA 2CJNA 2JUHA 4IWPA 1E7HA 2ZPNA 1T0QC 3RMKC 3X23A 3R3MA 2LGXA 5IFOA 2WXGA 3P4RB 1JRUA 2Y3AA 2WXKA 4G11A 4EZJA 1K51A 2NQOA 1T5XD 3LB8C 4GGQA 1FPYA 1VJKA 3ZNGC 3RPFC 4H2AA 4IM0A 5TSSA 3UQBA 3GQUA 1S1QB 4KVGB 5DPSA 3ZDMC 3URYA 1ZXHA 1C79A 1E78A 4YT0B 4DM0A 3UGBB 1FM0D 4L23A 5E6OA 3AMZA 1TBEA 1V2YA 3EHVA 4W4UB 2JX5A 3RNEC 4LB9A 4K3BA 2WXLA 1V97A 2AEHA 4P7IA 1QZEA 1WF9A 1TKEA 1ET6A 4FXCA 2ASQA 2D10A 4LCDE 3LXFA 4WWPA 4GDLA 3WHSA 3O13A 4C00A 1KTKA 1V5TA 3ZUNA 1HE8A 2KDBA 5C2TB 4MM3B 3PLVA 4GXBA 1WX8A 2MCNB 2N4FA 2V9HA 3DDCB 2WS3B 4M8MA 2KX0A 4E71A 1UWXA 4HLEA 4F1SA 2C7NB 3VTUA 1VCBA 1HEZE 2LFIA 3FKYA 3AN1A 1ISNA 4NJ6A 3P1MA 2CKXA 2ZNVC 3NVMA 5HOZA 4IM3A 4ASWC 5IJFA 3FAHA 4C56C 1C3TA 2BXMA 4YSXB 4GDXA 2INPE 5GIPA 4G03A 1WE6A 3APCA 2WP9B 4EKUA 1TS5A 1Q10A 4NQLB 3AEDB 3APDA 2K3UA 2N1WA 2ZW0A 3WA0A 2N7JA 2CR5A 3WALA 4C4VB 2BXCA 3DCGA 3IHPC 1TF0A 2JYTA 4LNIA 4B0MA 1YN4A 1WXQA 4M01A 3VTVA 1E7BA 3ZTCA 1EUVB 1Q5WB 4ZBQA 4D7XA 3MHHB 1U4AA 2WXHA 2AX5A 3EFCA 4DWFA 2WDQB 2K8CA 1L0XB 5H8YE 5T8IA 2BBCA 5L95C 4DXFA 1GNJA 4A8XC 1UORA 2KFJA 2I38A 4MGIE 3OG5A 1E7PB 3JSVB 4HGKA 4NY0A 2FCNA 5L83A 3AECB 2VDBA 1IBXB 1WMHB 1PUTA 3ZJUA 1I42A 3RULA 4FLHA 3BVGA 4B95A 1MIVA 2C9WB 4FULA 1SE2A 1DGJA 4W9FA 3WHRA 2WXQA 4WQMA 1HXYD 2RDHA 3BWUD 4KDLB 4TQ0A 4DDID 4JWUC 1MUHA 2RSUA 4FJZA 3RNGC 1C77A 2QC8A 2KHWB 3K9PB 1FOUA 4MH0E 2VUFA 4HWIB 2BB6A 3GZNB 4ARIA 5EE1A 1O9XA 4CYEA 2H88B 3BINA 1Y56A 1F77A 1T0YA 2WXPA 1EF1A 3A4RA 1VLBA 2MA9B 5BYRA 4DDGD 3TEZA 3LJ3A 2O6VA 1P9DU 2GBJA 4ZBKA 3I63C 4GB9A 3A9KB 1E10A 4RNAA 2XN9C 4ZBRA 4KKIA 1C78A 4L2YA 1PGXA 1N60A 2PPHA 3BYYB 1C9FA 1L6UA 4OZCA 3DBHB 2A4ZA 4C4VA 5DBYA 3IAS1 3QX1A 3NVZA 4ANVA 5CHFA 3V03A 1WWTA 2LD9A 4M02A 1NENB 3HRDD 2PKOA 4QAYA 3DQVA 1SB3C 4HEA1 3S2AA 3AH7A 2JYEA 1TS2A 3KWVA 4FIPB 4BFRA 1FRDA 2K22A 4M0WB 5IIHA 3BPJA 4W9LA 2KX3A 5GMVA 1HA5A 2QMTA 3B2FA 2BT6A 2DYOA 3JSVA 4ZRJA 2RDBC 1MA9A 4WJPA 3GOEA 3QHTA 4GOCA 1H9ZA 3KUZA 1IBXA 1MHHE 2SAKA 4K7UA 1L7YA 4LJOB 3EUB2 3Q3FA 1OGWA 3T9LA 3HUIA 3NY5A 1J19A 2DBYA 3TCAA 2PW9A 1BT0A 3V6EB 3NS8A 3ZIMA 4MBEC 1XQQA 4MJSB 1TS4A 5GINA 2C7MB 1PDXA 1WXSA 4Z69A 2BB5A 2HJ8A 3PV1A 2EELA 1SBBB 1RYJA 4LUHA 3IFWB 2PLPA 4W9IA 2JY6A 3H6NA 5LNK1 3UF8A 1L0VB 4BVUC 3LU7A 1RAXA 4HCPB 4BBNF 2D2QA 1UGJA 3KYDD 4F5TA 3N1YC 3AULA 2FCMA 1RRBA 4A20A 1SIJA 2HDEA 1FXIA 4KV2A 4C80A 5G55A 5E6NA 4WH4A 3U4EG 2M56B 2K39A 2BYFA 5IKCM 1CMXB 3PRMB 1ROEA 2SEBD 1GPXA 4O1NA 2DZKA 1IJGA 4FADA 3FWBC 3VH4B 2DBWA 1PGBA 3Q8AA 3VH3B 1WXVA 2V4LA 2G4SA 2XW0A 2N7DA 2WYQA 4BY9C 2LGYA 5GIOA 5D6JB 3ALBA 4XX5A 2CHZA 1LFDA 3ZVVA 3HM3A 1E5WA 4PS7A 3IG3A 2MJDA 1QOFA 3ONSA 2FIDA 1DOIA 4M0WA 2MJ3A 4US8A 1F52A 1NI3A 3PTFC 1WJ4A 3LDZE 2MP2B 3TJPA 1BJ5A 3X0WA 3BK1A 3NJTA 1XT9B 3Q8BA 2KVZA 2E6XA 1R4MB 2WHIA 1E8ZA 3ZRCA 3IAM1 2Z8KA 2Y5CA 4FJVB 2E0XA 2QHBA 1WJUA 2N9KA 1I4QA 2XVQA 2EKEC 3DHIC 3GQXA 4KDIC 1TTNA 2JSVX 5KHOA 3A33B 2K0PA 4P16A 3HK0A 5AZGA 1SXTA 2MBHA 1WSPA 2XVVA 3UQAA 4M8NA 3RN9C 3ML9A 5DCNA 4CQNA 1ZUD2 3Q3MC 4MJSA 3ZXRA 2YEPB 2VH2A 1HK1A 3AEAB 2R2QA 4IWQA 2BGFA 2KMAA 1NDDA 2GLSA 1YX5B 2KTFA 1XF5L 5BMGA 4BAXA 3U2SC 3ZKJC 5IA7A 3DWMA 5G2NA 1WJNA 3B2GA 3FNMA 2KJHB 1MUSA 2NBWB 1XEEA 1E7GA 4WWMA 4N9F4 4GDKB 2UWQA 3A1QB 1FIQA 3ECPA 4PYUA 4N3ZA 2PIAA 2WXMA 2GI9A 3R8BA 2JZZA 2J7QB 2B76B 1ZKHA 4UDUC 1EU3A 3OAWA 2KTRB 4XWWA 3R2TA 2KXJA 4IWOA 3GA9L 1L0YB 3AE4B 3GB1A 5IO9A 1I7HA 4N6EB 4II2B 4KZCA 3APFA 4G0NB 3SHQA 4YTMB 4NPNA 3KUDB 2W3RA 4W9EA 2D3BA 4KGRA 2RR9A 3SDLC 3AU5A 2XVUA 5D3DA 2MP2A 4MH8A 4ZYSA 2OJRA 1VZ6A 3PRZA 2LJIA 3CWIA 1JRPA 2W9NA 4K2CA 2QJLA 1JWMD 3KLSX 4KKJA 3DBLI 2QSDA 2FBWB 3IBEA 2QMCA 2G1EA 2J0KA 2KWFA 5ID9A 1QQRA 3KQ4A 2AQ3B 3PHXB 1N5WA 4FJCB 5IOIA 4LB2A 3JRYA 1AYFA 2ZNVB 1PFDA 2NBUA 1UH6A 4KIKB 4DK5A 1SF0A 3E9SA 1WFYA 2KANA 2O2VB 1YOVB 3J9CA 3KWLA 3L10B 1FD6A 1GOZA 2OZBB 3IXSA 2DBXA 1FCCC 5E6PA 5EE0A 4W9DA 4L9QA 1BXTA 1GB4A 1QILA 2LXCA 3P63A 3PZ7A 2LQHA 1JWSD 4F5UA 2L76A 3SEBA 4C7ZA 2JF5A 1HTOA 3BK2A 1YJ1A 2KMMA 3PS6A 4DXGA 2ON8A 1GC7A 3U8ZA 4RGMA 3NMUA 4WWOA 4GDKA 3HM6X 3SQJA 4IW0A 1SJHD 2BW2A 3A1QA 4AWJA 1WYGA 4KX6B 3KIKA 3JQZA 1KDXA 2WX1A 4LJPB 2ICIA 3ZW3A 4DHZB 3DVNV 4LK0M 4P1BC 3VUXA 4USAA 4WWNA 2KTRA 5JH5C 1P98A 3T8MA 5IP4D 5IIUA 4N0UD 4DHJB 3NVVA 3KUCB 5AUIA 1HQRD 5C3JB 5JHAA 3P2BA 2VZKD 4D2KA 4LUFA 2HD5B 2FUG1 1WGGA 2PVOD 2AJEA 2N9XA 1PGAA 5BMHA 4ZRPA 1MM8A 3SIUB 1ZXIA 3JW0X 4AP4C 1MIYA 3FC4A 1BMLC 1WGHA 3BIID 2IYDB 2XK5B 1EO6A 2BS4B 4X57B 2KWDA 2LMCA 2RDGA 2HTME 1MJDA 4DXAB 2LGSA 5FK9C 2MRPA 3TSSA 4BKSD 2Q5WD 2L0TA 2CHWA 2XBBC 3I5JC 4IDIA 2IO3B 2C7HA 3AEFB 1JW9D 1BUIC 4KIKA 1LQBA 5HKHA 1STEA 2R2OA 2O2VA 4MSQB 1EF5A 2GMIC 2MBOA 4MDKE 3QWZB 4JWSC 3RUIB 1ACCA 2BXEA 3CMMB 4WJOA 3N20C 4W9HA 4F5SA 4YWGG 1E8XA 2O6VB 3PREA 3RYTA 2JZ3B 4NNJB 2HTHA 4TQ1A 2MSED 3EFUA 1KRHA 2BS2B 2V0GA 3ABVB 1HK4A 1KOTA 3H7SA 4GLSC 2AWTA 3U7ZA 1NI2A 3L13A 2MHJA 1GC6A 2PJHA 2UYZB 2ZVOA 2REXA 3L08A 5D2MB 1C4AA 1WRIA 3MJWA 1V49A 1F1HA 3B0AA 3QA8A 1N63A 2L52A 2EFDA 4ZRKA 4JK4A 3W2DA 3WHQA 2XVWA 5I4DA 2LWPA 1WI0A 4YTPB 3MC0B 3PO0A 3VTWA 4ANUA 3VHTC 2L1AA 1VRAB 3NVKA 1ZPSA 3TEXA 3RT3B 3ZTDA 2K25A 4ZUXV 2YVCA 4DHXB 3OLMD 4J3OD 2I1KA 2WX0A 2D3AA 1WM3A 1I4GA 1R4NB 2KDEB 2L8JA 1OQRA 4N0FD 4PK1A 4K1RB 1H4RA 3EC8A 2LZ6A 2AL6A 3QCAA 4IW2A 2X38A 2FCSA 1D5ZC 1E0ZA 2MBQA 2XK5A 1CQVA 4EZKA 2MBEA 1A5RA 3DPDA 1RFAA 5AZFA 1P7EA 4MGKE 3V61A 2IY0B 2I2ZA 4KZ0A 4B9KA 2IJ0A 3HVZA 1D3ZA 1EWCA 4LTUA 1QOBA 1FNWA 2WXNA 1IYFA 3OJ3A 3TL5A 2YEPF 5FR6A 1K8RB 1WRDB 2D5GA 5CHWA 4F8CB 1C4CA 4TMAB 3C8YA 2QEJC 2WXRA 3W5VB 1IUEA 4ICUA 2BF8B 5TR5A 3AM9A 4OTTA 3RNBC 4IC7B 2KKCA 5C1ZA 3BY4B 3EGRA 3ZJVA 3TEYA 3BVMA 3MC8A 4A9AA 4LNFA 1MFWA 1S3SG 4PT5A 2K6DB 4RFBA 2J0MA 1Q1OA 5DPWA 4ZDVA 4GN1A 3V3XA 4YXDB 1FFUA 2NPTA 3AE7B 1M4VA 1XLNA 5JZEB 2C5LC 1V80A 1NEKB 1N62A 3PSEB 2QHOA 4GMVA 2VZKB 1EM7A 3VR8B 2YLMA 3CF6E 2N1VA 4HDQA 3ECIA 4OZAA 3DBLB 3TDLA 2N9EB 4EZLA 1MVKA 1FNUA 1ZW7A 2J53A 4WQOB 2PTLA 1E7CA 3P4QB 5CHVC 1E7UA 1N6ZA 3NZSA 1YN3A 4OVVA 4K7SA 2DAFA 2J42A 1UGMA 1F0ZA 1FRRA 3JVZX 4A3OA 2KBZA 2NR2A 2JUOA 1MI0A 3GP7A 1NYQA 3R7QA 4FN2A 2XEWA 4RF1A 4CHKA 1AWDA 3U30A 4URKA 2BXAA 5LLIA 3ZO5B 2JRHA 1FXTB 3AXCA 3NHEB 3V08A 5ID7A 3SU8X 2Z0DB 3VUWA 3CSTA 2ZCCA 1XCQL 4ZRQA 4A6QA 2M4NA 3M99C 3RFZB 5LXIB 5BYQA 1FNVA 4F7ZA 2NVUI 1KW2A 2D3GA 3ENEA 1UUPA 1B1ZA 4PS8A 1UELA 2FUHB 3QK0A 2BXPA 4OR0A 1JALA 5D3IB 5C23A 2MBBB 1HK5A 2JXXA 3M63B 2V36A 3NVYA 3FWCC 1TS3A 4RCOA 3AV8A 2LVQA 3NOBA 3Q3JA 5GXGB 2ZJDA 2LHEA 3DVGX 4EMXA 1WR1A 1AN8A 1FEHA 2FNJB 2V3SA 3OJ4B 5HFYA 1P1AA 3RI7C 3P42A 3W9CB 3GE3C 3RNAC 3ZDTA 2K6QA 4ZOHC 2MEKA 1LGRA 2CU1A 4CO7A 4JPSA 4IOIE 1I4XA 2WXJA 4ZYNA 1UF0A 1LOTA 1E7EA 4YTNB 1YIWA 4N58A 3V62A 1WH3A 2MW5A 2LXSA 4US9A 3CX9A 2B3AA 2NS5A 1YJIA 3NZUA 2WNMA 1KLVA 3MHSD 2Z8IA 4NAWA 2K5PA 4RGOS 1UBQA 2KMCA 1Z2MA 2DYBA 1FFVA 3L17A 4PO0A 2KOXA 1WGDA 3B9MA 2BXHA 1E7VA 1I4HA 1TIFA 1YJJA 2Z8JA 2KQ4X 1VDVA 1WX7A 3W1SC 3UIPB 5EE9A 1IGDA 2BYEA 2CJOA 4K71A 2LGDA 2KFKA 3I3TB 3ZNHB 5IAAC 4XC2A 2KD0A 4BKSA 1OEYJ 2KO3A 2CKHB 5B5TA 4JL9A 2KJRA 1GUAB 5IN7A 1J7CA 3K9OB 2UU7A 2AQ2B 1KJTA 2OEDA 4WIPA 5FR3A 2LQIA 3BZDB 1T0RC 3W1YA 2YDFA 3DHHC 1UD7A 1ET9A 4G01A 1KM7A 1LO5D 4Q2JA 2BTEA 4IM2A 2L3ZA 4HJGE 3VR9B 4ZC6A 4HPMB 1UBIA 1GNIA 2AYOB 2N0SB 2ZEQA 2W3SA 3MP9A 3PVLA 2QDFA 1J0GA 4OW0A 3ETRA 2GBMA 2N9LA 2LXTA 1V6EA 2JWUA 1J7EA 3N9YC 3NRZA 2AGHB 1JWUD 4BKGA 1GG3A 4FA6A 4PYZA 4WA6B 2XW1A 4L9KA 1ESFA 3O65B 3BVZA 1V8CA 4JGHB 4JQWC 4ANXA 3ZQ4A 2BKFA 3T3OA 4W9JA 4BKEA 5HG2A 4S17A 2AQ1B 4P1CC 5J18A 1HZ5A 3V6CB 1JWBD 2FAZA 2FCQA 5AEKB 2KDMA 4GU2A 1QKZA 2QIEB 2XMOA 1GNUA 4XE0A 3Q6BA 2PMVA 3AEBB 5IIXA 3TUOA 3TEWA 4REZA 4DBGA 4HXDA 4FJYA 5G5GA 2RGFA 2ACZB 2KN5A 2J0JA 3DBHI 3ZXVA 3WAMA 4PS3A 1J7AA 1JROA 2JU6X 5CTRC 2L83A 2JRIB 3VDZA 1N5XA 4MGZE 5EE3A 1SIFA 2EFEA 1I4RA 1SB0A 4J2VA 4OVUA 2Z59B 1M94A 2PE9A 1OQQA 3N30A 1H5WA 3A9JB 4BOSC 1K53A 3QC8B 1GJZA 1TGZB 4YSZB 5KHQA 4NQKE 2DG5A 1E7FA 2DENB 2RPVA 1T6BX 1XCTL 2IGDA 1KF6B 4ITKA 1XD3B 3WANA 1SEBD 3A75A 2WXIA 2ZZPB 3B08A 2BXBA 2N9PC 2GBKA 2BXOA 2I30A 2M17A 3AE1B 1YMHE 1CZPA 1V81A 1R7SA 2N7EA 4J6IA 1J7BA 3MHSB 4M00A 3Q69A 2KC1A 2W82A 2ZPYA 2MH7A 1AW7A 3PGEA 1V9JA 2JPHA 2DLBA 3MC9A 3Q3OC 2KDIA 3VQIA 1F2RC 4HGMB 2FIFA 5IJ5A 2IGHA 2M19A 5DPTA 1D4BA 2BXLA 1DOYA 2D3CA 4II3B 3RNCC 3V05A 2WXOA 4XWTA 1SE3A 3L16A 4E99A 1TKYA 1XLPA 3DVNU 4LNNA 1LXDA 3AE3B 2ZVNA 1C4PA 2BXQA 3OWEB 4GIVA 1E8WA 5BO4B 2DBUA 3PPAA 1KLGD 3C19A 4NJCA 5HHDG 1P3QU 3PT2B 3TIXA 4AS1A 3CIRB 3AI5A 1JCKB 4ACFA 5MPOA 1WGKA 2C60A 3IVFA 2L7RA 1E7AA 3H7PB 3H8HA 4AOFA 3M62B 5AZHA 3H37A 4AUQC 3MTNB 2AL3A 2M0XA 1ENFA 1YQ3B 4LDTD 5DQFA 4I6LB 4JE3B 2BWFA 1EWYC 2Z0EB 2RMMA 3AU4A 1HK2A 1RFKA 3VAWA 2NNWA 2PVGC 2LI5A 3MJ5A 2INNE 1B9RA 4JIOU 4Z9OA 1L2NA 3H9DA 2W54A 1T3QA 1OQYA 4DHZE 3ZNZB 2QCZA 1K50A 4RGTA 3A9JA 2OJWA 1QF6A 1WZ3A 1P0RA 5H92C 1PQSA 3VRBB 1LM8B 2GBNA 3GS2A 1L4DB 2EMSA 5JXVA 5J17A 1R4MI 4OHJA 2E3TA 2K1FA 3T3NA 4NJ7A 1HK3A 2GBRA 4TKNA 1V1PB 4EFOA 4WAAA 2IO0B 2NBVB 2DYMA 4W9GA 1TZOA 3PHWB 4MELA 1V5OA 3V60A 2EKIA 3N1XC 2MJEA 4NZLB 3R66C 1VZ8A 2EFCA 3VVWB 2LVPA 1N61A 4C7YA 2NPTB 4KSKC 2DNFA 3P4SB 2JZPA 2KWUB 1RLFA 1FO4A 1TXUA 4RF0A 2KWVB 2D07B 2KYWA 2KQSA 2H89B 5JHBA 3DWGC 3QQ8B 2KK8A 2MWSB 1PYWD 1F2RI 4HK2A 3M95A 3NG0A 3NVIA 1XO3A 3BYTB 2BXKA 3Q8EA 4MEMA 3VFKA 3DHGC 5J2RA 4IKGA 4I9OA 3Q8FA 3WAOA 4MSMB 4E3CA 2JQRB 5LXHA 2KN4A 5IJEA 4N59A 3R2IA 2OHFA 2LVOA 1VZ7A 5D7GA 1BM0A 4BBNC 4EEWA 3DBRI 2JT4B 2KZRA 4HROA 3PZDA 4KGSA 4W9KA 3I57A 2ZCBA 2IY1B 2LUMA 1KXPD 3Q14C 4FBJB 3N3KB 2KC2A 1L6VA 2V1YA 2BQQA 3CSFA 1WZ0A 4IW1A 1SJED 2R61A 1QOGA 2EMTA 3U52E 1GB1A 3LYYA 1FMAD 3H7PA 1J78A 1KFYB 3C0RB 4KSLC 1SE9A 4TUUA 1RM6C 1XXGA 2KWCA 3NZ3A 2BYVE 2JWZA 5DPRA 1T0SC 3UI3A 1TJEA 1ZDXA 3DOWA 1QLBB 3MFGA 4RH6A 2KQ7A 3ZRFA 3FILB 2DZJA 3AE9B 4FK5B 3VXWA 4ANWA 3D32A 1D6EC 3WCQA 4ZHPA 1WXMA 2LRUA 2Z8LA 1BKEA 3KYCD 2PE6B 2WLBA 1MG8A 4WAFA 4MM3A 2RPQA 4A90A 2KNBA 1V1PA 1L5PA 2L32A 1C1YB 3E56A 3RZFA 1D5XC 1WGYA 2BXNA 4E74A 1X1MA 1KH0A 2BXFA 2OOBB 3EECA 4HDOA 4HRSA 1ZP0B 2BKRB 1K52A 3IT6B 2K8HA 3U7DA 4MACA 3Q8CA 2MQJA 4I6NB 3UIVA 1L4ZB 4S1YA 2LHDA 2OT3A 2BWES 2HJ1A 2LRWA 4NAWB 2XSIA 2DHZA 3L54A 4OTUA 1DYQA 2DZIA 2RD0A 4IUMB 2FE8A 2MX2A 1EU4A 1NYRA 3RCZA 1I35A 1NT2B 1UWMA 4BOZB 3PRPB 2CHXA 1G6JA 3L0WB 2NMQA 2J4XA 1MIWA 4HPPA 3TMPB 3JYUA 2CS4A 3RNFC 4RGNA 2M1MA 2V3PA 4OVZA 1VR9A 2LJ5A 2CU3A 4RM8A 2KFKB 2I2YA 4AJWA 4BZAA 1SGHA 5E6JA 1LNSA 1WYWB 4ZHOA 4LDTB 3ML8A 2GUTA 2K9XA 1E8YA 1OTRB 5GHKA 3KJLA 3H3AA 2VH1A 3VUYA 3R7RA 3LU8A 2KJ6A 2ROHA 1WGRA 3QJZA 1TYGB 4NAMA 1WMHA 2LASA 1TT5B 3DBSA 3ZNID 1AARA 1TKGA 3B1LX 4F5VA 3H1UA 3SFDB 2DAJA 4HKZE 1UZXB 1IP9A 4K7WA 4G50A 2WQYB 3A73A 1N5UA 1E90A 3FILA 3B9LA 4HKQA 4YSYB 2L05A 1JMLA 4W9CA 1VZSA 3B9JA 2ZW1A 1QOAA 4B6WA 2E0YA 2INCC 2IPKD 1TZ1A 2K8BA 4L8UA 3ZGZA 1VFIA 2K0NA 4LNOA 1DOXA 2LGIA 2JXTA 3L4PA 1SSNA 4KGTA 1AO6A 3NVWA 2BXIA 4IG7B 4JLCA 3DVGY 3ZJTA 4WJNA 4BKTA 2MLBA 4LA0A 2INDC 2EFHA 2W55A 4LLGM 1HZ6A 1WXAA 2QM6A 3UIOB 3A9KA 3A4SC 5FKAC 2L00B 3PLAA 4ZCGA 4C31B 3W1SA 3AE5B 3WIMA 1RWSA 4R3DA 1TY2A 2IDYA 3HVDA 1FCLA 3TBLD 4ICVA 3UINB 3ZYYX 1I4PA 2KLCA 1WY8A 2XNAC 3Q2AC 2QILA 3IT4B 2DX5B 4EUTA 1NVID 4OT2A 3KVFB 4DHJD 4GSWA 1YN5A 2X8XX 3I9V1 4I6PA 3W5UB 1Y8RC 2BX8A 2BXDA 2LUEA 1NBFC 1ZOYB 3HHMA 2BS3B 3RZWC 4HJKA 1ZGUB 1Q0WB 2IO1B 4LNKA 2Y5BB 3PLUA 2KT7A 2PEAA 2BPSA 4AQ7A 1IPGA 4HPLB 3NS1A 3QIJA 4HVBA 3N1ZC 4XGAB 2WU5B 1WX9A
chains in the Genus database with same CATH topology
1JWAD 4MT5A 3V09A 4EOYA 3SFEB 5CX3A 3PZ8A 3N32A 1R4NI 2WXFA 5HI1A 5FUOA 1D5MC 3AE2B 2BYTA 5D94A 4RM9A 4RMAA 1XLQA 2NTSA 2DZMA 4M70B 2VRRB 5BMIA 1YQBA 4WURA 2G45B 1YD8U 2VUEA 2A5UA 3QARA 4TSSA 2BXGA 4GG2A 4G04A 2NTTA 1E6EB 3KH0A 3ICXA 2GB1A 5AUKA 4HCNB 4MGYE 3SR6A 4YL8A 2G4DB 1ZDVA 1JQ4A 1WE7A 2WDRB 1E9MA 3VRAB 2O6VD 1IGCA 1WM2A 5G5HA 2V3NA 2G3QB 2GOWA 3GZNI 4G3XB 3MHZA 3SD5A 3QAQA 2ONQA 1Z5SB 1WR6E 1E7IA 2IO2B 1FXAA 3P4PB 4XZ4A 1J8CA 2KLGA 3ZLZA 2IBIB 1YNTE 1XLOA 5BYSA 4A3PA 3AB5A 1TY0A 2M0AA 2GRIA 1OFFA 1OEYA 4ZRIA 2JVCA 1QT9A 2G9HD 4JX1C 2KAJA 3LU6A 3WAPA 1P7FA 2LXAA 1GAQB 2I1JA 1C76A 4XDDA 1YX6B 2NCNA 1HA2A 1MHXA 2V4IB 1V1OA 4L1BA 1ZE3D 3EA6A 2IGGA 1YQ4B 1F9JA 1A70A 4TV3A 2LOQA 1JNBA 2LEKA 3AE8B 4B0EA 3NUHB 1MPEA 2M8SA 4GDLB 1V86A 5BPKA 2KACA 2WU2B 2Y5PA 1CJEA 3M3JA 3KW5B 3HIZA 2KVRA 1SE4A 3AEGB 2L0FA 5EDSA 1H8CA 2IZVB 2WWZA 2TSSA 4K81A 4ARCA 3AEEB 2DWQA 3AE6B 1VD2A 3RD2A 4P6VF 2KDFB 1KLUD 4AJYB 4WJQA 2WDVB 4FHKA 3SIVB 2HE7A 2D11A 1WIAA 2J52A 4OZBA 4DQOC 2WDTB 3G9KD 1CK1A 4XDCA 1UNSA 4EE2A 4A55A 1WJ6A 4FHJA 2CJNA 2JUHA 4IWPA 1E7HA 2ZPNA 3X23A 3R3MA 2LGXA 5IFOA 2WXGA 3P4RB 1JRUA 2Y3AA 2WXKA 4G11A 4EZJA 1K51A 2NQOA 1T5XD 4GGQA 3LB8C 3ZNGC 1VJKA 3RPFC 4H2AA 4IM0A 5TSSA 3UQBA 3GQUA 1S1QB 4KVGB 5DPSA 3ZDMC 3URYA 1ZXHA 1C79A 1E78A 4YT0B 3UGBB 1FM0D 4L23A 5E6OA 3AMZA 1TBEA 1V2YA 3EHVA 4W4UB 2JX5A 4LB9A 2WXLA 1V97A 2AEHA 4P7IA 1QZEA 1WF9A 1TKEA 1ET6A 4FXCA 2ASQA 2D10A 4LCDE 3LXFA 4WWPA 4GDLA 3WHSA 3O13A 1KTKA 1V5TA 3ZUNA 1HE8A 2KDBA 5C2TB 4MM3B 3PLVA 4GXBA 1WX8A 2MCNB 2N4FA 3DDCB 4M8MA 2WS3B 2KX0A 4E71A 4HLEA 1UWXA 4F1SA 2C7NB 3VTUA 1VCBA 1HEZE 2LFIA 3AN1A 1ISNA 4NJ6A 3P1MA 2CKXA 2ZNVC 3NVMA 5HOZA 4IM3A 4ASWC 5IJFA 3FAHA 4C56C 1C3TA 2BXMA 4YSXB 4GDXA 2INPE 5GIPA 4G03A 1WE6A 3APCA 4EKUA 2WP9B 1TS5A 1Q10A 4NQLB 3AEDB 3APDA 2K3UA 2N1WA 2ZW0A 3WA0A 2N7JA 2CR5A 3WALA 2BXCA 3DCGA 3IHPC 1TF0A 2JYTA 4B0MA 1YN4A 1WXQA 3VTVA 1E7BA 3ZTCA 1EUVB 1Q5WB 4ZBQA 3MHHB 1U4AA 2WXHA 2AX5A 4DWFA 2WDQB 2K8CA 1L0XB 5L95C 5H8YE 2BBCA 5T8IA 4DXFA 1GNJA 4A8XC 1UORA 2KFJA 2I38A 4MGIE 1E7PB 3JSVB 4HGKA 4NY0A 2FCNA 5L83A 3AECB 2VDBA 1IBXB 1WMHB 1PUTA 1I42A 3ZJUA 3RULA 4FLHA 3BVGA 4B95A 1MIVA 2C9WB 4FULA 1SE2A 1DGJA 4W9FA 3WHRA 2WXQA 4WQMA 1HXYD 2RDHA 3BWUD 4KDLB 4TQ0A 4DDID 4JWUC 2RSUA 4FJZA 1C77A 2KHWB 3K9PB 1FOUA 4MH0E 2VUFA 4HWIB 2BB6A 4ARIA 5EE1A 1O9XA 4CYEA 3BINA 2H88B 1Y56A 1F77A 1T0YA 2WXPA 1EF1A 3A4RA 1VLBA 2MA9B 5BYRA 4DDGD 3TEZA 3LJ3A 2O6VA 1P9DU 2GBJA 4ZBKA 4GB9A 3A9KB 1E10A 4RNAA 2XN9C 4ZBRA 4KKIA 1C78A 4L2YA 1PGXA 1N60A 2PPHA 3BYYB 1C9FA 1L6UA 4OZCA 2A4ZA 5DBYA 3IAS1 3QX1A 3NVZA 4ANVA 5CHFA 3V03A 2LD9A 1WWTA 1NENB 3HRDD 2PKOA 3DQVA 1SB3C 3S2AA 4HEA1 3AH7A 2JYEA 1TS2A 3KWVA 4FIPB 4BFRA 1FRDA 4M0WB 2K22A 5IIHA 4W9LA 2KX3A 5GMVA 1HA5A 2QMTA 3B2FA 2BT6A 2DYOA 3JSVA 4ZRJA 1MA9A 4WJPA 3GOEA 3QHTA 4GOCA 1H9ZA 3KUZA 1IBXA 4K7UA 1MHHE 2SAKA 1L7YA 4LJOB 3EUB2 3Q3FA 1OGWA 3T9LA 3HUIA 3NY5A 1J19A 2DBYA 3TCAA 2PW9A 1BT0A 3V6EB 3NS8A 3ZIMA 4MBEC 1XQQA 4MJSB 2C7MB 5GINA 1TS4A 1PDXA 1WXSA 4Z69A 2BB5A 2HJ8A 3PV1A 2EELA 1SBBB 1RYJA 4LUHA 3IFWB 2PLPA 4W9IA 2JY6A 3H6NA 5LNK1 3UF8A 1L0VB 4BVUC 3LU7A 1RAXA 4HCPB 4BBNF 2D2QA 1UGJA 3KYDD 4F5TA 3AULA 2FCMA 1RRBA 4A20A 1SIJA 2HDEA 1FXIA 4KV2A 4C80A 5G55A 5E6NA 4WH4A 3U4EG 2M56B 2K39A 2BYFA 1CMXB 3PRMB 1ROEA 2SEBD 1GPXA 4O1NA 2DZKA 1IJGA 4FADA 3FWBC 3VH4B 2DBWA 1PGBA 3Q8AA 3VH3B 1WXVA 2V4LA 2G4SA 2XW0A 2N7DA 2WYQA 4BY9C 2LGYA 5GIOA 5D6JB 3ALBA 4XX5A 2CHZA 1LFDA 3ZVVA 3HM3A 1E5WA 4PS7A 3IG3A 2MJDA 1QOFA 3ONSA 2FIDA 1DOIA 4M0WA 2MJ3A 4US8A 3PTFC 1NI3A 1WJ4A 3LDZE 2MP2B 3TJPA 1BJ5A 3X0WA 3BK1A 1XT9B 3Q8BA 2E6XA 1E8ZA 3ZRCA 3IAM1 2Z8KA 4FJVB 2Y5CA 2E0XA 2QHBA 1WJUA 2N9KA 1I4QA 2XVQA 2EKEC 3GQXA 4KDIC 1TTNA 2JSVX 5KHOA 3A33B 2K0PA 4P16A 3HK0A 5AZGA 1SXTA 2MBHA 1WSPA 2XVVA 3UQAA 4M8NA 3ML9A 5DCNA 4CQNA 1ZUD2 4MJSA 2YEPB 1HK1A 3AEAB 2R2QA 4IWQA 2BGFA 2KMAA 1NDDA 1YX5B 2KTFA 1XF5L 5BMGA 3U2SC 3ZKJC 5IA7A 3DWMA 5G2NA 1WJNA 3B2GA 3FNMA 2KJHB 2NBWB 1XEEA 1E7GA 4WWMA 4N9F4 4GDKB 2UWQA 3A1QB 1FIQA 4PYUA 4N3ZA 2PIAA 2WXMA 2GI9A 3R8BA 2JZZA 2J7QB 2B76B 1ZKHA 4UDUC 1EU3A 3OAWA 2KTRB 4XWWA 3R2TA 2KXJA 4IWOA 3GA9L 1L0YB 3AE4B 3GB1A 1I7HA 4N6EB 4II2B 4KZCA 3APFA 4G0NB 3SHQA 4YTMB 4NPNA 3KUDB 2W3RA 4W9EA 4KGRA 2RR9A 3SDLC 3AU5A 2XVUA 5D3DA 2MP2A 4MH8A 4ZYSA 2OJRA 3PRZA 1VZ6A 2LJIA 3CWIA 1JRPA 2W9NA 4K2CA 2QJLA 1JWMD 3KLSX 4KKJA 3DBLI 2QSDA 2FBWB 3IBEA 2QMCA 2G1EA 2J0KA 5ID9A 1QQRA 3KQ4A 2AQ3B 3PHXB 1N5WA 4FJCB 4LB2A 3JRYA 1AYFA 2ZNVB 1PFDA 2NBUA 1UH6A 4KIKB 4DK5A 1SF0A 3E9SA 1WFYA 2KANA 2O2VB 3J9CA 3L10B 3KWLA 1FD6A 1GOZA 2OZBB 3IXSA 2DBXA 1FCCC 5E6PA 5EE0A 4W9DA 4L9QA 1BXTA 1GB4A 1QILA 2LXCA 3P63A 3PZ7A 1JWSD 4F5UA 2L76A 3SEBA 4C7ZA 2JF5A 3BK2A 1YJ1A 2KMMA 3PS6A 4DXGA 2ON8A 1GC7A 3U8ZA 4RGMA 3NMUA 4WWOA 4GDKA 3HM6X 3SQJA 4IW0A 1SJHD 2BW2A 3A1QA 4AWJA 1WYGA 4KX6B 3KIKA 3JQZA 2WX1A 4LJPB 2ICIA 3ZW3A 4DHZB 3DVNV 4LK0M 3VUXA 4USAA 4WWNA 2KTRA 5JH5C 1P98A 3T8MA 5IIUA 4N0UD 4DHJB 3NVVA 3KUCB 5AUIA 1HQRD 5C3JB 5JHAA 3P2BA 2VZKD 4D2KA 4LUFA 2HD5B 2FUG1 1WGGA 2PVOD 2AJEA 2N9XA 1PGAA 5BMHA 4ZRPA 3SIUB 1ZXIA 3JW0X 4AP4C 1MIYA 3FC4A 1BMLC 1WGHA 3BIID 2IYDB 2XK5B 1EO6A 2BS4B 4X57B 2KWDA 2LMCA 2RDGA 2HTME 4DXAB 5FK9C 2MRPA 3TSSA 4BKSD 2Q5WD 2L0TA 2CHWA 2XBBC 4IDIA 2IO3B 2C7HA 3AEFB 1JW9D 1BUIC 4KIKA 1LQBA 5HKHA 1STEA 2R2OA 2O2VA 4MSQB 1EF5A 2GMIC 2MBOA 4MDKE 3QWZB 4JWSC 3RUIB 1ACCA 2BXEA 3CMMB 4WJOA 4W9HA 4F5SA 4YWGG 1E8XA 2O6VB 3PREA 3RYTA 2JZ3B 4NNJB 2HTHA 4TQ1A 2MSED 3EFUA 1KRHA 2BS2B 2V0GA 3ABVB 1HK4A 1KOTA 3H7SA 4GLSC 2AWTA 3U7ZA 1NI2A 3L13A 1GC6A 2PJHA 2UYZB 2ZVOA 2REXA 3L08A 5D2MB 1C4AA 1WRIA 3MJWA 1V49A 3B0AA 3QA8A 1N63A 2L52A 2EFDA 4ZRKA 4JK4A 3W2DA 3WHQA 2XVWA 5I4DA 2LWPA 1WI0A 4YTPB 3MC0B 3PO0A 3VTWA 4ANUA 3VHTC 2L1AA 1VRAB 3NVKA 1ZPSA 3TEXA 3RT3B 3ZTDA 2K25A 4ZUXV 2YVCA 4DHXB 3OLMD 4J3OD 2I1KA 2WX0A 1WM3A 1I4GA 2KDEB 2L8JA 1OQRA 4N0FD 4K1RB 1H4RA 3EC8A 2LZ6A 2AL6A 3QCAA 4IW2A 2X38A 2FCSA 1D5ZC 1E0ZA 2MBQA 2XK5A 1CQVA 4EZKA 2MBEA 1A5RA 3DPDA 1RFAA 5AZFA 4MGKE 1P7EA 3V61A 2IY0B 2I2ZA 4KZ0A 4B9KA 2IJ0A 3HVZA 1D3ZA 1EWCA 4LTUA 1QOBA 1FNWA 2WXNA 1IYFA 3OJ3A 3TL5A 2YEPF 5FR6A 1K8RB 1WRDB 2D5GA 5CHWA 4F8CB 1C4CA 4TMAB 3C8YA 2QEJC 2WXRA 3W5VB 1IUEA 4ICUA 2BF8B 5TR5A 3AM9A 4OTTA 4IC7B 2KKCA 5C1ZA 3BY4B 3EGRA 3ZJVA 3TEYA 3BVMA 4A9AA 1S3SG 4PT5A 2K6DB 4RFBA 2J0MA 1Q1OA 5DPWA 4ZDVA 4GN1A 3V3XA 4YXDB 1FFUA 2NPTA 3AE7B 1M4VA 1XLNA 5JZEB 2C5LC 1V80A 1NEKB 1N62A 3PSEB 2QHOA 4GMVA 2VZKB 1EM7A 3VR8B 2YLMA 3CF6E 2N1VA 4HDQA 3ECIA 4OZAA 3TDLA 2N9EB 4EZLA 1MVKA 1ZW7A 1FNUA 2J53A 4WQOB 2PTLA 1E7CA 3P4QB 5CHVC 1E7UA 3NZSA 1YN3A 4OVVA 4K7SA 2DAFA 2J42A 1UGMA 1F0ZA 1FRRA 3JVZX 4A3OA 2KBZA 2NR2A 2JUOA 1MI0A 3GP7A 1NYQA 3R7QA 4FN2A 2XEWA 4RF1A 4CHKA 1AWDA 3U30A 4URKA 2BXAA 5LLIA 3ZO5B 2JRHA 1FXTB 3AXCA 3SU8X 3V08A 5ID7A 3NHEB 2Z0DB 3VUWA 3CSTA 2ZCCA 1XCQL 4ZRQA 4A6QA 2M4NA 3M99C 3RFZB 5LXIB 5BYQA 4F7ZA 1FNVA 2NVUI 1KW2A 2D3GA 3ENEA 1UUPA 1B1ZA 4PS8A 1UELA 2FUHB 3QK0A 2BXPA 4OR0A 1JALA 5D3IB 5C23A 2MBBB 1HK5A 2JXXA 3M63B 2V36A 3NVYA 3FWCC 1TS3A 4RCOA 3NOBA 2LVQA 3Q3JA 3AV8A 5GXGB 2ZJDA 2LHEA 3DVGX 4EMXA 1WR1A 1AN8A 2FNJB 1FEHA 2V3SA 3OJ4B 5HFYA 1P1AA 3P42A 3W9CB 3ZDTA 2K6QA 4ZOHC 2MEKA 2CU1A 4CO7A 4JPSA 4IOIE 1I4XA 2WXJA 4ZYNA 1LOTA 1E7EA 4YTNB 1YIWA 4N58A 3V62A 1WH3A 2MW5A 4US9A 3CX9A 2B3AA 2NS5A 3NZUA 1YJIA 2WNMA 1KLVA 3MHSD 2Z8IA 4NAWA 2K5PA 4RGOS 1UBQA 2KMCA 1Z2MA 2DYBA 1FFVA 3L17A 4PO0A 2KOXA 1WGDA 3B9MA 2BXHA 1E7VA 1I4HA 1YJJA 2Z8JA 2KQ4X 1VDVA 1WX7A 3W1SC 3UIPB 5EE9A 1IGDA 2BYEA 2CJOA 4K71A 2LGDA 2KFKA 3I3TB 3ZNHB 5IAAC 4XC2A 2KD0A 4BKSA 1OEYJ 2KO3A 2CKHB 5B5TA 4JL9A 2KJRA 1GUAB 1J7CA 3K9OB 2AQ2B 1KJTA 2OEDA 4WIPA 5FR3A 3BZDB 3W1YA 2YDFA 1UD7A 1ET9A 4G01A 1KM7A 1LO5D 4Q2JA 2BTEA 4IM2A 2L3ZA 4HJGE 3VR9B 4ZC6A 4HPMB 1UBIA 1GNIA 2AYOB 2N0SB 2ZEQA 2W3SA 3MP9A 3PVLA 1J0GA 4OW0A 3ETRA 2GBMA 2N9LA 1V6EA 2JWUA 1J7EA 3N9YC 3NRZA 1JWUD 4BKGA 1GG3A 4FA6A 4PYZA 4WA6B 2XW1A 4L9KA 3O65B 4JQWC 4ANXA 1ESFA 4JGHB 1V8CA 3BVZA 3ZQ4A 2BKFA 3T3OA 4W9JA 4BKEA 5HG2A 2AQ1B 5J18A 3V6CB 1HZ5A 1JWBD 2FAZA 2FCQA 5AEKB 2KDMA 4GU2A 1QKZA 2QIEB 2XMOA 1GNUA 4XE0A 2PMVA 3AEBB 5IIXA 3TUOA 3TEWA 4REZA 4DBGA 4HXDA 4FJYA 5G5GA 2RGFA 2ACZB 2KN5A 2J0JA 3DBHI 3WAMA 4PS3A 1J7AA 1JROA 2JU6X 5CTRC 2L83A 2JRIB 3VDZA 1N5XA 4MGZE 5EE3A 1SIFA 2EFEA 1I4RA 4J2VA 4OVUA 2Z59B 1M94A 2PE9A 1OQQA 3N30A 1H5WA 3A9JB 4BOSC 3QC8B 1GJZA 1K53A 1TGZB 5KHQA 4YSZB 4NQKE 2DG5A 1E7FA 2DENB 2RPVA 1T6BX 1XCTL 2IGDA 1KF6B 3WANA 1XD3B 4ITKA 1SEBD 3A75A 2WXIA 2ZZPB 3B08A 2BXBA 2N9PC 2GBKA 2BXOA 2I30A 2M17A 3AE1B 1YMHE 1CZPA 1V81A 2N7EA 1R7SA 4J6IA 1J7BA 3MHSB 3Q69A 2KC1A 2ZPYA 3PGEA 2MH7A 1AW7A 2W82A 1V9JA 2JPHA 2DLBA 2KDIA 3VQIA 1F2RC 4HGMB 2FIFA 5IJ5A 2IGHA 2M19A 5DPTA 1D4BA 2BXLA 1DOYA 4II3B 3V05A 2WXOA 4XWTA 1SE3A 3L16A 4E99A 1TKYA 3DVNU 1XLPA 1LXDA 3AE3B 2ZVNA 1C4PA 2BXQA 4GIVA 3OWEB 1E8WA 5BO4B 2DBUA 3PPAA 1KLGD 4NJCA 5HHDG 1P3QU 3PT2B 3TIXA 4AS1A 3CIRB 3AI5A 1JCKB 5MPOA 1WGKA 2C60A 3IVFA 2L7RA 1E7AA 3H7PB 3H8HA 4AOFA 3M62B 5AZHA 3H37A 4AUQC 3MTNB 2AL3A 2M0XA 1ENFA 1YQ3B 4LDTD 5DQFA 4I6LB 4JE3B 2BWFA 2Z0EB 1EWYC 2RMMA 3AU4A 1HK2A 1RFKA 3VAWA 2NNWA 2PVGC 2LI5A 3MJ5A 2INNE 1B9RA 4JIOU 4Z9OA 1L2NA 3H9DA 2W54A 1T3QA 1OQYA 4DHZE 3ZNZB 1K50A 4RGTA 3A9JA 1QF6A 1WZ3A 1P0RA 5H92C 1PQSA 3VRBB 1LM8B 2GBNA 3GS2A 1L4DB 2EMSA 5JXVA 5J17A 1R4MI 4OHJA 2E3TA 2K1FA 3T3NA 4NJ7A 1HK3A 2GBRA 4TKNA 4EFOA 1V1PB 4WAAA 2IO0B 2NBVB 2DYMA 4W9GA 3PHWB 1TZOA 4MELA 1V5OA 3V60A 2EKIA 2MJEA 4NZLB 3R66C 1VZ8A 2EFCA 3VVWB 2LVPA 1N61A 4C7YA 2NPTB 4KSKC 3P4SB 2JZPA 2KWUB 1RLFA 1FO4A 1TXUA 4RF0A 2KWVB 2D07B 2KQSA 2H89B 5JHBA 3DWGC 3QQ8B 2KK8A 2MWSB 1PYWD 1F2RI 4HK2A 3M95A 3NVIA 1XO3A 3BYTB 2BXKA 4MEMA 3VFKA 3Q8EA 5J2RA 4IKGA 3WAOA 3Q8FA 4MSMB 4E3CA 5LXHA 2JQRB 2KN4A 5IJEA 4N59A 3R2IA 2OHFA 2LVOA 1VZ7A 5D7GA 1BM0A 4EEWA 4BBNC 3DBRI 2JT4B 2KZRA 4HROA 3PZDA 4KGSA 4W9KA 3I57A 2ZCBA 2IY1B 4FBJB 1KXPD 2LUMA 3N3KB 2KC2A 1L6VA 2V1YA 3CSFA 1WZ0A 4IW1A 1SJED 2R61A 1QOGA 2EMTA 3U52E 1GB1A 3LYYA 1FMAD 3H7PA 1J78A 1KFYB 3C0RB 4KSLC 1SE9A 4TUUA 1RM6C 1XXGA 2KWCA 3NZ3A 2BYVE 2JWZA 5DPRA 3UI3A 1TJEA 1ZDXA 3DOWA 1QLBB 3MFGA 4RH6A 2KQ7A 3ZRFA 3FILB 2DZJA 3AE9B 4FK5B 3VXWA 4ANWA 3D32A 1D6EC 3WCQA 4ZHPA 1WXMA 2LRUA 2Z8LA 1BKEA 3KYCD 2PE6B 2WLBA 1MG8A 4WAFA 4MM3A 2RPQA 4A90A 2KNBA 1V1PA 1L5PA 2L32A 1C1YB 3E56A 3RZFA 1D5XC 1WGYA 2BXNA 4E74A 1X1MA 1KH0A 2BXFA 2OOBB 3EECA 4HDOA 4HRSA 1ZP0B 2BKRB 1K52A 3IT6B 2K8HA 3U7DA 4MACA 3Q8CA 2MQJA 4I6NB 3UIVA 1L4ZB 4S1YA 2LHDA 2OT3A 2BWES 2LRWA 4NAWB 2XSIA 2DHZA 3L54A 4OTUA 2DZIA 1DYQA 2RD0A 4IUMB 2FE8A 2MX2A 1EU4A 1NYRA 3RCZA 1I35A 1NT2B 1UWMA 4BOZB 3PRPB 2CHXA 1G6JA 3L0WB 2NMQA 2J4XA 1MIWA 3TMPB 3JYUA 2CS4A 4RGNA 2M1MA 2V3PA 4OVZA 1VR9A 2LJ5A 4RM8A 2CU3A 2KFKB 2I2YA 4AJWA 1SGHA 5E6JA 1LNSA 1WYWB 4ZHOA 4LDTB 3ML8A 2K9XA 1E8YA 1OTRB 5GHKA 3KJLA 3H3AA 3VUYA 3R7RA 3LU8A 2KJ6A 2ROHA 1WGRA 3QJZA 1TYGB 4NAMA 1WMHA 2LASA 3DBSA 3ZNID 1AARA 3B1LX 1TKGA 4F5VA 3H1UA 3SFDB 2DAJA 4HKZE 1IP9A 1UZXB 4K7WA 4G50A 2WQYB 3A73A 1N5UA 1E90A 3FILA 3B9LA 4HKQA 4YSYB 2L05A 1JMLA 4W9CA 1VZSA 3B9JA 2ZW1A 1QOAA 4B6WA 2E0YA 2IPKD 1TZ1A 2K8BA 4L8UA 3ZGZA 1VFIA 1DOXA 2LGIA 2JXTA 3L4PA 1SSNA 4KGTA 1AO6A 3NVWA 2BXIA 4IG7B 4JLCA 3DVGY 3ZJTA 4WJNA 4BKTA 2MLBA 4LA0A 2EFHA 2W55A 4LLGM 1HZ6A 1WXAA 2QM6A 3UIOB 3A9KA 3A4SC 5FKAC 2L00B 3PLAA 4ZCGA 4C31B 3W1SA 3AE5B 3WIMA 1RWSA 4R3DA 1TY2A 2IDYA 3HVDA 1FCLA 3TBLD 4ICVA 3UINB 3ZYYX 1I4PA 2KLCA 1WY8A 2XNAC 2QILA 3IT4B 2DX5B 4EUTA 1NVID 4OT2A 3KVFB 4DHJD 4GSWA 1YN5A 3I9V1 4I6PA 3W5UB 1Y8RC 2BX8A 2BXDA 2LUEA 1NBFC 1ZOYB 3HHMA 2BS3B 3RZWC 4HJKA 1ZGUB 1Q0WB 2IO1B 2Y5BB 3PLUA 2PEAA 2BPSA 4AQ7A 1IPGA 4HPLB 3NS1A 3QIJA 4HVBA 2WU5B 1WX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L08 A;  5D2M B;  2ZZP B;  3B08 A;  3MJW A;  4W9L A;  1V49 A;  2KX3 A;  2N9P C;  4EOY A;  3B0A A;  3QA8 A;  5GMV A;  2GBK A;  5CX3 A;  4ZRK A;  3N32 A;  1R4N I;  2DYO A;  3JSV A;  4ZRJ A;  2LWP A;  4WJP A;  1WI0 A;  3GOE A;  2M17 A;  5D94 A;  4RM9 A;  3QHT A;  4GOC A;  4RMA A;  3KUZ A;  4K7U A;  2DZM A;  3VTW A;  3VHT C;  4ANU A;  1L7Y A;  4LJO B;  2VRR B;  3RT3 B;  1V81 A;  3Q3F A;  2N7E A;  3ZTD A;  2K25 A;  1YQB A;  4J6I A;  2YVC A;  1OGW A;  3OLM D;  2G45 B;  3T9L A;  2KC1 A;  2I1K A;  1YD8 U;  2WX0 A;  2ZPY A;  3NY5 A;  2A5U A;  3PGE A;  1V9J A;  3QAR A;  2JPH A;  1WM3 A;  1J19 A;  3TCA A;  2KDE B;  2L8J A;  1BT0 A;  2KDI A;  3VQI A;  4K1R B;  1H4R A;  3KH0 A;  3NS8 A;  3EC8 A;  3V6E B;  3ZIM A;  2LZ6 A;  2AL6 A;  1XQQ A;  2FIF A;  3QCA A;  4MJS B;  2C7M B;  4HCN B;  4MGY E;  5DPT A;  1WXS A;  2FCS A;  4II3 B;  2HJ8 A;  3PV1 A;  3L16 A;  4YL8 A;  2G4D B;  2MBQ A;  2XK5 A;  1WE7 A;  3DVN U;  2MBE A;  4EZK A;  1A5R A;  1LXD A;  3DPD A;  1RFA A;  2O6V D;  5AZF A;  2ZVN A;  4MGK E;  1WM2 A;  3V61 A;  2IY0 B;  3IFW B;  4KZ0 A;  4W9I A;  4GIV A;  4B9K A;  2G3Q B;  2GOW A;  3GZN I;  4G3X B;  1E8W A;  2JY6 A;  5BO4 B;  3H6N A;  3SD5 A;  1D3Z A;  3QAQ A;  1Z5S B;  1WR6 E;  3PPA A;  3UF8 A;  1P3Q U;  2IO2 B;  1IYF A;  3PT2 B;  3OJ3 A;  3TIX A;  4BVU C;  3TL5 A;  1RAX A;  4HCP B;  4BBN F;  2D2Q A;  4XZ4 A;  5FR6 A;  3KYD D;  1K8R B;  3AI5 A;  1WRD B;  2KLG A;  3ZLZ A;  1J8C A;  3AUL A;  2FCM A;  1RRB A;  4A20 A;  2IBI B;  2C60 A;  3IVF A;  2L7R A;  5CHW A;  4F8C B;  3H7P B;  4AOF A;  4KV2 A;  3M62 B;  5AZH A;  4A3P A;  4AUQ C;  5G55 A;  3MTN B;  5E6N A;  2AL3 A;  2M0X A;  2K39 A;  4LDT D;  2BYF A;  1CMX B;  3PRM B;  4I6L B;  4ICU A;  1OEY A;  2BWF A;  2BF8 B;  5TR5 A;  2Z0E B;  4ZRI A;  2JVC A;  3AU4 A;  2DZK A;  4FAD A;  4IC7 B;  2KKC A;  3VAW A;  5C1Z A;  3BY4 B;  3WAP A;  3VH4 B;  2LI5 A;  2LXA A;  4JIO U;  1L2N A;  2I1J A;  3H9D A;  3VH3 B;  1WXV A;  2V4L A;  1OQY A;  1YX6 B;  2G4S A;  4DHZ E;  2N7D A;  2WYQ A;  3ZNZ B;  2NCN A;  2LGY A;  1S3S G;  3A9J A;  1WZ3 A;  1P0R A;  5D6J B;  2K6D B;  2J0M A;  1PQS A;  1Q1O A;  3ALB A;  1LM8 B;  2GBN A;  4XX5 A;  2CHZ A;  1LFD A;  3ZVV A;  1F9J A;  5DPW A;  3HM3 A;  2EMS A;  1E5W A;  4PS7 A;  3IG3 A;  4GN1 A;  4ZDV A;  5J17 A;  1R4M I;  2K1F A;  4TV3 A;  4NJ7 A;  2GBR A;  2NPT A;  4TKN A;  3ONS A;  2FID A;  4EFO A;  4WAA A;  2IO0 B;  2NBV B;  2M8S A;  5JZE B;  4GDL B;  1V86 A;  2DYM A;  3PTF C;  4W9G A;  1WJ4 A;  2C5L C;  1V80 A;  2MP2 B;  3LDZ E;  3PHW B;  3TJP A;  4MEL A;  1V5O A;  3M3J A;  3PSE B;  3V60 A;  3X0W A;  2QHO A;  4GMV A;  1XT9 B;  3KW5 B;  3R66 C;  2YLM A;  3CF6 E;  2KVR A;  3HIZ A;  3VVW B;  1E8Z A;  2LVP A;  2N1V A;  4HDQ A;  3ZRC A;  2L0F A;  3ECI A;  5EDS A;  1H8C A;  2IZV B;  2NPT B;  2WWZ A;  4KSK C;  4FJV B;  2KWU B;  2N9E B;  4K81 A;  4EZL A;  1WJU A;  1ZW7 A;  1RLF A;  4WQO B;  2EKE C;  1VD2 A;  3RD2 A;  2KWV B;  2D07 B;  2KQS A;  4KDI C;  1TTN A;  5JHB A;  2KDF B;  3QQ8 B;  3A33 B;  4WJQ A;  5CHV C;  2KK8 A;  5KHO A;  2MWS B;  4AJY B;  1E7U A;  4FHK A;  3HK0 A;  2HE7 A;  3NZS A;  2D11 A;  4HK2 A;  2MBH A;  5AZG A;  3UQA A;  4OVV A;  4M8N A;  1WIA A;  4K7S A;  2DAF A;  3M95 A;  2WDT B;  1UGM A;  3ML9 A;  5DCN A;  4MEM A;  3VFK A;  5J2R A;  3WAO A;  4MJS A;  3JVZ X;  4MSM B;  4E3C A;  4A3O A;  5LXH A;  2NR2 A;  2JUO A;  1WJ6 A;  4FHJ A;  3R7Q A;  4FN2 A;  2LVO A;  2XEW A;  5D7G A;  2R2Q A;  4IWQ A;  4IWP A;  4CHK A;  3U30 A;  2BGF A;  2KMA A;  3DBR I;  4BBN C;  4EEW A;  2JT4 B;  2KZR A;  1NDD A;  2ZPN A;  5LLI A;  3PZD A;  3ZO5 B;  3X23 A;  2JRH A;  1FXT B;  3AXC A;  3R3M A;  2LGX A;  2IY1 B;  2ZCB A;  3NHE B;  4W9K A;  1YX5 B;  2KTF A;  3N3K B;  2Z0D B;  2KC2 A;  3SU8 X;  4FBJ B;  3VUW A;  2V1Y A;  3CST A;  3ZKJ C;  1JRU A;  3CSF A;  2ZCC A;  5IA7 A;  1WZ0 A;  4G11 A;  5G2N A;  4EZJ A;  1WJN A;  2M4N A;  2KJH B;  5LXI B;  2NBW B;  4F7Z A;  2NVU I;  4N9F 4;  4GDK B;  2EMT A;  2UWQ A;  4GGQ A;  2D3G A;  3ENE A;  3ZNG C;  3A1Q B;  4PS8 A;  1UEL A;  3H7P A;  2FUH B;  3QK0 A;  3C0R B;  5C23 A;  2MBB B;  2JXX A;  3M63 B;  4KSL C;  4PYU A;  1SE9 A;  3NOB A;  2LVQ A;  3Q3J A;  4IM0 A;  4TUU A;  2ZJD A;  1S1Q B;  2KWC A;  4KVG B;  5DPS A;  2JZZ A;  3ZDM C;  3UQB A;  3DVG X;  2J7Q B;  2BYV E;  1ZKH A;  2JWZ A;  5DPR A;  1WR1 A;  2FNJ B;  2V3S A;  3OJ4 B;  3OAW A;  1P1A A;  2KTR B;  3UGB B;  2KXJ A;  4IWO A;  3ZDT A;  2K6Q A;  3DOW A;  5E6O A;  2KQ7 A;  3ZRF A;  1TBE A;  1V2Y A;  2DZJ A;  2CU1 A;  3EHV A;  4II2 B;  3VXW A;  4ANW A;  4CO7 A;  4KZC A;  3APF A;  3D32 A;  4G0N B;  3SHQ A;  4ZYN A;  2AEH A;  1WXM A;  2LRU A;  3KUD B;  4NPN A;  4P7I A;  1QZE A;  4W9E A;  1WF9 A;  3KYC D;  1YIW A;  2PE6 B;  2RR9 A;  1MG8 A;  3SDL C;  4MM3 A;  2RPQ A;  3V62 A;  1WH3 A;  2MW5 A;  3AU5 A;  2ASQ A;  2KNB A;  2D10 A;  2B3A A;  2NS5 A;  1C1Y B;  3NZU A;  4LCD E;  3RZF A;  1WGY A;  4WWP A;  4GDL A;  1KLV A;  3MHS D;  4E74 A;  1X1M A;  2MP2 A;  4NAW A;  2OJR A;  3PRZ A;  1UBQ A;  2OOB B;  3EEC A;  4HDO A;  2KMC A;  1V5T A;  3ZUN A;  2BKR B;  2W9N A;  1HE8 A;  1Z2M A;  2KDB A;  2DYB A;  2K8H A;  3U7D A;  3PLV A;  4GXB A;  1WX8 A;  3DBL I;  3L17 A;  2MCN B;  2MQJ A;  4I6N B;  2N4F A;  2KOX A;  3DDC B;  3IBE A;  4M8M A;  2J0K A;  1WGD A;  1E7V A;  2KX0 A;  4E71 A;  2BWE S;  4HLE A;  4F1S A;  3PHX B;  2C7N B;  2LRW A;  4NAW B;  3VTU A;  1VCB A;  2DHZ A;  3L54 A;  2DZI A;  2ZNV B;  2NBU A;  1ISN A;  2RD0 A;  4IUM B;  1WX7 A;  4NJ6 A;  1UH6 A;  4KIK B;  3UIP B;  3W1S C;  2MX2 A;  4DK5 A;  2ZNV C;  1WFY A;  2KAN A;  4IM3 A;  2O2V B;  4ASW C;  3RCZ A;  2BYE A;  1I35 A;  1C3T A;  3L10 B;  2LGD A;  2KFK A;  3I3T B;  3PRP B;  4BOZ B;  2CHX A;  3ZNH B;  5IAA C;  4XC2 A;  2KD0 A;  1G6J A;  1WE6 A;  4BKS A;  3APC A;  3L0W B;  4EKU A;  5E6P A;  1OEY J;  2KO3 A;  4W9D A;  2CKH B;  4NQL B;  3APD A;  4JL9 A;  2KJR A;  1GUA B;  2N1W A;  3TMP B;  3K9O B;  3WA0 A;  3JYU A;  2CS4 A;  1KJT A;  2M1M A;  2CR5 A;  2LXC A;  2LJ5 A;  4RM8 A;  3WAL A;  2KFK B;  3W1Y A;  2L76 A;  3DCG A;  4AJW A;  2JF5 A;  1SGH A;  1UD7 A;  1YJ1 A;  3IHP C;  3PS6 A;  1WYW B;  4LDT B;  1KM7 A;  3ML8 A;  1GC7 A;  3U8Z A;  1E8Y A;  1OTR B;  4IM2 A;  2L3Z A;  3VTV A;  4WWO A;  4GDK A;  3HM6 X;  3ZTC A;  1EUV B;  4IW0 A;  1Q5W B;  3A1Q A;  4AWJ A;  4HPM B;  1UBI A;  2AYO B;  1U4A A;  3VUY A;  3R7R A;  2ZEQ A;  2KJ6 A;  3QJZ A;  1WGR A;  2WX1 A;  4URK A;  4LJP B;  4DWF A;  2K8C A;  1WMH A;  2LAS A;  3PVL A;  3DBS A;  5L95 C;  3ZNI D;  1AAR A;  3B1L X;  3ZW3 A;  4DHZ B;  3DVN V;  3H1U A;  3VUX A;  1J0G A;  2KFJ A;  2DAJ A;  4WWN A;  2KTR A;  1UZX B;  2GBM A;  4MGI E;  1P98 A;  4K7W A;  3T8M A;  5JH5 C;  4G50 A;  1IP9 A;  4DHJ B;  3JSV B;  4NY0 A;  1V6E A;  3KUC B;  2FCN A;  5L83 A;  1E90 A;  2L05 A;  1WMH B;  4W9C A;  5JHA A;  3P2B A;  4BKG A;  1I42 A;  1GG3 A;  4FA6 A;  3RUL A;  4PYZ A;  4B6W A;  2HD5 B;  3O65 B;  4JQW C;  4ANX A;  4JGH B;  4FLH A;  1WGG A;  4B95 A;  2N9X A;  2C9W B;  4FUL A;  2BKF A;  4W9J A;  1TZ1 A;  2K8B A;  4W9F A;  3JW0 X;  4AP4 C;  4KDL B;  4TQ0 A;  4DDI D;  1WGH A;  5J18 A;  3V6C B;  2RSU A;  2IYD B;  4FJZ A;  2XK5 B;  1EO6 A;  2FAZ A;  4IG7 B;  2KHW B;  3K9P B;  4JLC A;  4MH0 E;  4X57 B;  3DVG Y;  2FCQ A;  4WJN A;  4HWI B;  4BKT A;  5AEK B;  2MLB A;  4GU2 A;  4DXA B;  1GNU A;  1WXA A;  3UIO B;  4CYE A;  2MRP A;  3A9K A;  4BKS D;  3A4S C;  3BIN A;  2L00 B;  2L0T A;  2CHW A;  2XBB C;  3W1S A;  2IO3 B;  1T0Y A;  2C7H A;  1EF1 A;  3WIM A;  4HXD A;  4DBG A;  4FJY A;  2RGF A;  3A4R A;  4KIK A;  1LQB A;  5HKH A;  2MA9 B;  4DDG D;  2KN5 A;  2R2O A;  3LJ3 A;  2J0J A;  2O2V A;  4MSQ B;  1EF5 A;  2O6V A;  2GMI C;  3DBH I;  1P9D U;  2GBJ A;  3TBL D;  4PS3 A;  2MBO A;  3WAM A;  4ICV A;  4MDK E;  4GB9 A;  3UIN B;  3A9K B;  5CTR C;  2JRI B;  2KLC A;  3VDZ A;  1WY8 A;  3QWZ B;  3RUI B;  4MGZ E;  1SIF A;  3CMM B;  2DX5 B;  4WJO A;  4EUT A;  4W9H A;  3KVF B;  4DHJ D;  4GSW A;  2PPH A;  1E8X A;  4I6P A;  2O6V B;  1Y8R C;  3PRE A;  4OVU A;  2Z59 B;  2LUE A;  3RYT A;  1NBF C;  2JZ3 B;  2A4Z A;  3HHM A;  4NNJ B;  1M94 A;  3RZW C;  4HJK A;  1ZGU B;  2HTH A;  1Q0W B;  2IO1 B;  2PE9 A;  4TQ1 A;  2MSE D;  3EFU A;  3N30 A;  3QX1 A;  2Y5B B;  3A9J B;  3PLU A;  4ANV A;  5CHF A;  2PEA A;  2BPS A;  2LD9 A;  4BOS C;  3QC8 B;  1GJZ A;  1TGZ B;  5KHQ A;  1KOT A;  4NQK E;  1IPG A;  4HPL B;  3DQV A;  3H7S A;  3S2A A;  2DEN B;  3QIJ A;  4HVB A;  2AWT A;  1NI2 A;  3L13 A;  1GC6 A;  2PJH A;  2UYZ B;  4BFR A;  3WAN A;  1XD3 B;  2ZVO A;  2REX A;  4M0W B;  1WX9 A; 
#chains in the Genus database with same CATH topology
 1JWA D;  4MT5 A;  3V09 A;  4EOY A;  3SFE B;  3PZ8 A;  5CX3 A;  3N32 A;  1R4N I;  2WXF A;  5HI1 A;  5FUO A;  1D5M C;  3AE2 B;  2BYT A;  5D94 A;  1MG4 A;  4RM9 A;  4RMA A;  1XLQ A;  2NTS A;  2DZM A;  4M70 B;  2VRR B;  5BMI A;  1YQB A;  4WUR A;  2G45 B;  1YD8 U;  2VUE A;  2A5U A;  3QAR A;  4TSS A;  2BXG A;  4K3C A;  4GG2 A;  4G04 A;  3Q3N C;  2NTT A;  1E6E B;  3KH0 A;  3ICX A;  2GB1 A;  5AUK A;  4HCN B;  4MGY E;  3SR6 A;  4YL8 A;  2G4D B;  1ZDV A;  1JQ4 A;  1WE7 A;  2WDR B;  3DBR B;  1E9M A;  3VRA B;  2O6V D;  1IGC A;  1WM2 A;  5G5H A;  2V3N A;  2G3Q B;  2GOW A;  3GZN I;  4G3X B;  3MHZ A;  3SD5 A;  2ONQ A;  3QAQ A;  1Z5S B;  1WR6 E;  1E7I A;  2IO2 B;  1FXA A;  3P4P B;  4XYC A;  4XZ4 A;  1J8C A;  2KLG A;  3ZLZ A;  1YNT E;  2IBI B;  1XLO A;  5BYS A;  4A3P A;  3AB5 A;  1TY0 A;  1HTQ A;  2M0A A;  2GRI A;  1OFF A;  1OEY A;  4ZRI A;  2JVC A;  1QT9 A;  2G9H D;  4JX1 C;  2KAJ A;  3LU6 A;  3WAP A;  1P7F A;  2LXA A;  1GAQ B;  1C76 A;  2I1J A;  4XDD A;  1YX6 B;  1MHX A;  1HA2 A;  2NCN A;  2V4I B;  1V1O A;  4L1B A;  1ZE3 D;  3EA6 A;  2IGG A;  1YQ4 B;  1F9J A;  1A70 A;  4TV3 A;  2LOQ A;  1JNB A;  2LEK A;  3AE8 B;  2BVC A;  4B0E A;  3NUH B;  1MPE A;  2M8S A;  4GDL B;  1V86 A;  5BPK A;  2KAC A;  2WU2 B;  2Y5P A;  1CJE A;  3M3J A;  3KW5 B;  3HIZ A;  1SE4 A;  2KVR A;  3AEG B;  2L0F A;  5EDS A;  1H8C A;  2IZV B;  2WWZ A;  2TSS A;  4K81 A;  4ARC A;  3AEE B;  2DWQ A;  3AE6 B;  1VD2 A;  3RD2 A;  4P6V F;  3GE8 C;  1KLU D;  2KDF B;  4AJY B;  2WDV B;  4WJQ A;  4FHK A;  3SIV B;  2HE7 A;  2D11 A;  2WGS A;  1WIA A;  2J52 A;  4OZB A;  4DQO C;  2WDT B;  3G9K D;  1CK1 A;  4XDC A;  1UNS A;  4S0R A;  4EE2 A;  4A55 A;  1WJ6 A;  4FHJ A;  2CJN A;  2JUH A;  4IWP A;  1E7H A;  2ZPN A;  1T0Q C;  3RMK C;  3X23 A;  3R3M A;  2LGX A;  5IFO A;  2WXG A;  3P4R B;  1JRU A;  2Y3A A;  2WXK A;  4G11 A;  4EZJ A;  1K51 A;  2NQO A;  1T5X D;  3LB8 C;  4GGQ A;  1FPY A;  1VJK A;  3ZNG C;  3RPF C;  4H2A A;  4IM0 A;  5TSS A;  3UQB A;  3GQU A;  1S1Q B;  4KVG B;  5DPS A;  3ZDM C;  3URY A;  1ZXH A;  1C79 A;  1E78 A;  4YT0 B;  4DM0 A;  3UGB B;  1FM0 D;  4L23 A;  5E6O A;  3AMZ A;  1TBE A;  1V2Y A;  3EHV A;  4W4U B;  2JX5 A;  3RNE C;  4LB9 A;  4K3B A;  2WXL A;  1V97 A;  2AEH A;  4P7I A;  1QZE A;  1WF9 A;  1TKE A;  1ET6 A;  4FXC A;  2ASQ A;  2D10 A;  4LCD E;  3LXF A;  4WWP A;  4GDL A;  3WHS A;  3O13 A;  4C00 A;  1KTK A;  1V5T A;  3ZUN A;  1HE8 A;  2KDB A;  5C2T B;  4MM3 B;  3PLV A;  4GXB A;  1WX8 A;  2MCN B;  2N4F A;  2V9H A;  3DDC B;  2WS3 B;  4M8M A;  2KX0 A;  4E71 A;  1UWX A;  4HLE A;  4F1S A;  2C7N B;  3VTU A;  1VCB A;  1HEZ E;  2LFI A;  3FKY A;  3AN1 A;  1ISN A;  4NJ6 A;  3P1M A;  2CKX A;  2ZNV C;  3NVM A;  5HOZ A;  4IM3 A;  4ASW C;  5IJF A;  3FAH A;  4C56 C;  1C3T A;  2BXM A;  4YSX B;  4GDX A;  2INP E;  5GIP A;  4G03 A;  1WE6 A;  3APC A;  2WP9 B;  4EKU A;  1TS5 A;  1Q10 A;  4NQL B;  3AED B;  3APD A;  2K3U A;  2N1W A;  2ZW0 A;  3WA0 A;  2N7J A;  2CR5 A;  3WAL A;  4C4V B;  2BXC A;  3DCG A;  3IHP C;  1TF0 A;  2JYT A;  4LNI A;  4B0M A;  1YN4 A;  1WXQ A;  4M01 A;  3VTV A;  1E7B A;  3ZTC A;  1EUV B;  1Q5W B;  4ZBQ A;  4D7X A;  3MHH B;  1U4A A;  2WXH A;  2AX5 A;  3EFC A;  4DWF A;  2WDQ B;  2K8C A;  1L0X B;  5H8Y E;  5T8I A;  2BBC A;  5L95 C;  4DXF A;  1GNJ A;  4A8X C;  1UOR A;  2KFJ A;  2I38 A;  4MGI E;  3OG5 A;  1E7P B;  3JSV B;  4HGK A;  4NY0 A;  2FCN A;  5L83 A;  3AEC B;  2VDB A;  1IBX B;  1WMH B;  1PUT A;  3ZJU A;  1I42 A;  3RUL A;  4FLH A;  3BVG A;  4B95 A;  1MIV A;  2C9W B;  4FUL A;  1SE2 A;  1DGJ A;  4W9F A;  3WHR A;  2WXQ A;  4WQM A;  1HXY D;  2RDH A;  3BWU D;  4KDL B;  4TQ0 A;  4DDI D;  4JWU C;  1MUH A;  2RSU A;  4FJZ A;  3RNG C;  1C77 A;  2QC8 A;  2KHW B;  3K9P B;  1FOU A;  4MH0 E;  2VUF A;  4HWI B;  2BB6 A;  3GZN B;  4ARI A;  5EE1 A;  1O9X A;  4CYE A;  2H88 B;  3BIN A;  1Y56 A;  1F77 A;  1T0Y A;  2WXP A;  1EF1 A;  3A4R A;  1VLB A;  2MA9 B;  5BYR A;  4DDG D;  3TEZ A;  3LJ3 A;  2O6V A;  1P9D U;  2GBJ A;  4ZBK A;  3I63 C;  4GB9 A;  3A9K B;  1E10 A;  4RNA A;  2XN9 C;  4ZBR A;  4KKI A;  1C78 A;  4L2Y A;  1PGX A;  1N60 A;  2PPH A;  3BYY B;  1C9F A;  1L6U A;  4OZC A;  3DBH B;  2A4Z A;  4C4V A;  5DBY A;  3IAS 1;  3QX1 A;  3NVZ A;  4ANV A;  5CHF A;  3V03 A;  1WWT A;  2LD9 A;  4M02 A;  1NEN B;  3HRD D;  2PKO A;  4QAY A;  3DQV A;  1SB3 C;  4HEA 1;  3S2A A;  3AH7 A;  2JYE A;  1TS2 A;  3KWV A;  4FIP B;  4BFR A;  1FRD A;  2K22 A;  4M0W B;  5IIH A;  3BPJ A;  4W9L A;  2KX3 A;  5GMV A;  1HA5 A;  2QMT A;  3B2F A;  2BT6 A;  2DYO A;  3JSV A;  4ZRJ A;  2RDB C;  1MA9 A;  4WJP A;  3GOE A;  3QHT A;  4GOC A;  1H9Z A;  3KUZ A;  1IBX A;  1MHH E;  2SAK A;  4K7U A;  1L7Y A;  4LJO B;  3EUB 2;  3Q3F A;  1OGW A;  3T9L A;  3HUI A;  3NY5 A;  1J19 A;  2DBY A;  3TCA A;  2PW9 A;  1BT0 A;  3V6E B;  3NS8 A;  3ZIM A;  4MBE C;  1XQQ A;  4MJS B;  1TS4 A;  5GIN A;  2C7M B;  1PDX A;  1WXS A;  4Z69 A;  2BB5 A;  2HJ8 A;  3PV1 A;  2EEL A;  1SBB B;  1RYJ A;  4LUH A;  3IFW B;  2PLP A;  4W9I A;  2JY6 A;  3H6N A;  5LNK 1;  3UF8 A;  1L0V B;  4BVU C;  3LU7 A;  1RAX A;  4HCP B;  4BBN F;  2D2Q A;  1UGJ A;  3KYD D;  4F5T A;  3N1Y C;  3AUL A;  2FCM A;  1RRB A;  4A20 A;  1SIJ A;  2HDE A;  1FXI A;  4KV2 A;  4C80 A;  5G55 A;  5E6N A;  4WH4 A;  3U4E G;  2M56 B;  2K39 A;  2BYF A;  5IKC M;  1CMX B;  3PRM B;  1ROE A;  2SEB D;  1GPX A;  4O1N A;  2DZK A;  1IJG A;  4FAD A;  3FWB C;  3VH4 B;  2DBW A;  1PGB A;  3Q8A A;  3VH3 B;  1WXV A;  2V4L A;  2G4S A;  2XW0 A;  2N7D A;  2WYQ A;  4BY9 C;  2LGY A;  5GIO A;  5D6J B;  3ALB A;  4XX5 A;  2CHZ A;  1LFD A;  3ZVV A;  3HM3 A;  1E5W A;  4PS7 A;  3IG3 A;  2MJD A;  1QOF A;  3ONS A;  2FID A;  1DOI A;  4M0W A;  2MJ3 A;  4US8 A;  1F52 A;  1NI3 A;  3PTF C;  1WJ4 A;  3LDZ E;  2MP2 B;  3TJP A;  1BJ5 A;  3X0W A;  3BK1 A;  3NJT A;  1XT9 B;  3Q8B A;  2KVZ A;  2E6X A;  1R4M B;  2WHI A;  1E8Z A;  3ZRC A;  3IAM 1;  2Z8K A;  2Y5C A;  4FJV B;  2E0X A;  2QHB A;  1WJU A;  2N9K A;  1I4Q A;  2XVQ A;  2EKE C;  3DHI C;  3GQX A;  4KDI C;  1TTN A;  2JSV X;  5KHO A;  3A33 B;  2K0P A;  4P16 A;  3HK0 A;  5AZG A;  1SXT A;  2MBH A;  1WSP A;  2XVV A;  3UQA A;  4M8N A;  3RN9 C;  3ML9 A;  5DCN A;  4CQN A;  1ZUD 2;  3Q3M C;  4MJS A;  3ZXR A;  2YEP B;  2VH2 A;  1HK1 A;  3AEA B;  2R2Q A;  4IWQ A;  2BGF A;  2KMA A;  1NDD A;  2GLS A;  1YX5 B;  2KTF A;  1XF5 L;  5BMG A;  4BAX A;  3U2S C;  3ZKJ C;  5IA7 A;  3DWM A;  5G2N A;  1WJN A;  3B2G A;  3FNM A;  2KJH B;  1MUS A;  2NBW B;  1XEE A;  1E7G A;  4WWM A;  4N9F 4;  4GDK B;  2UWQ A;  3A1Q B;  1FIQ A;  3ECP A;  4PYU A;  4N3Z A;  2PIA A;  2WXM A;  2GI9 A;  3R8B A;  2JZZ A;  2J7Q B;  2B76 B;  1ZKH A;  4UDU C;  1EU3 A;  3OAW A;  2KTR B;  4XWW A;  3R2T A;  2KXJ A;  4IWO A;  3GA9 L;  1L0Y B;  3AE4 B;  3GB1 A;  5IO9 A;  1I7H A;  4N6E B;  4II2 B;  4KZC A;  3APF A;  4G0N B;  3SHQ A;  4YTM B;  4NPN A;  3KUD B;  2W3R A;  4W9E A;  2D3B A;  4KGR A;  2RR9 A;  3SDL C;  3AU5 A;  2XVU A;  5D3D A;  2MP2 A;  4MH8 A;  4ZYS A;  2OJR A;  1VZ6 A;  3PRZ A;  2LJI A;  3CWI A;  1JRP A;  2W9N A;  4K2C A;  2QJL A;  1JWM D;  3KLS X;  4KKJ A;  3DBL I;  2QSD A;  2FBW B;  3IBE A;  2QMC A;  2G1E A;  2J0K A;  2KWF A;  5ID9 A;  1QQR A;  3KQ4 A;  2AQ3 B;  3PHX B;  1N5W A;  4FJC B;  5IOI A;  4LB2 A;  3JRY A;  1AYF A;  2ZNV B;  1PFD A;  2NBU A;  1UH6 A;  4KIK B;  4DK5 A;  1SF0 A;  3E9S A;  1WFY A;  2KAN A;  2O2V B;  1YOV B;  3J9C A;  3KWL A;  3L10 B;  1FD6 A;  1GOZ A;  2OZB B;  3IXS A;  2DBX A;  1FCC C;  5E6P A;  5EE0 A;  4W9D A;  4L9Q A;  1BXT A;  1GB4 A;  1QIL A;  2LXC A;  3P63 A;  3PZ7 A;  2LQH A;  1JWS D;  4F5U A;  2L76 A;  3SEB A;  4C7Z A;  2JF5 A;  1HTO A;  3BK2 A;  1YJ1 A;  2KMM A;  3PS6 A;  4DXG A;  2ON8 A;  1GC7 A;  3U8Z A;  4RGM A;  3NMU A;  4WWO A;  4GDK A;  3HM6 X;  3SQJ A;  4IW0 A;  1SJH D;  2BW2 A;  3A1Q A;  4AWJ A;  1WYG A;  4KX6 B;  3KIK A;  3JQZ A;  1KDX A;  2WX1 A;  4LJP B;  2ICI A;  3ZW3 A;  4DHZ B;  3DVN V;  4LK0 M;  4P1B C;  3VUX A;  4USA A;  4WWN A;  2KTR A;  5JH5 C;  1P98 A;  3T8M A;  5IP4 D;  5IIU A;  4N0U D;  4DHJ B;  3NVV A;  3KUC B;  5AUI A;  1HQR D;  5C3J B;  5JHA A;  3P2B A;  2VZK D;  4D2K A;  4LUF A;  2HD5 B;  2FUG 1;  1WGG A;  2PVO D;  2AJE A;  2N9X A;  1PGA A;  5BMH A;  4ZRP A;  1MM8 A;  3SIU B;  1ZXI A;  3JW0 X;  4AP4 C;  1MIY A;  3FC4 A;  1BML C;  1WGH A;  3BII D;  2IYD B;  2XK5 B;  1EO6 A;  2BS4 B;  4X57 B;  2KWD A;  2LMC A;  2RDG A;  2HTM E;  1MJD A;  4DXA B;  2LGS A;  5FK9 C;  2MRP A;  3TSS A;  4BKS D;  2Q5W D;  2L0T A;  2CHW A;  2XBB C;  3I5J C;  4IDI A;  2IO3 B;  2C7H A;  3AEF B;  1JW9 D;  1BUI C;  4KIK A;  1LQB A;  5HKH A;  1STE A;  2R2O A;  2O2V A;  4MSQ B;  1EF5 A;  2GMI C;  2MBO A;  4MDK E;  3QWZ B;  4JWS C;  3RUI B;  1ACC A;  2BXE A;  3CMM B;  4WJO A;  3N20 C;  4W9H A;  4F5S A;  4YWG G;  1E8X A;  2O6V B;  3PRE A;  3RYT A;  2JZ3 B;  4NNJ B;  2HTH A;  4TQ1 A;  2MSE D;  3EFU A;  1KRH A;  2BS2 B;  2V0G A;  3ABV B;  1HK4 A;  1KOT A;  3H7S A;  4GLS C;  2AWT A;  3U7Z A;  1NI2 A;  3L13 A;  2MHJ A;  1GC6 A;  2PJH A;  2UYZ B;  2ZVO A;  2REX A;  3L08 A;  5D2M B;  1C4A A;  1WRI A;  3MJW A;  1V49 A;  1F1H A;  3B0A A;  3QA8 A;  1N63 A;  2L52 A;  2EFD A;  4ZRK A;  4JK4 A;  3W2D A;  3WHQ A;  2XVW A;  5I4D A;  2LWP A;  1WI0 A;  4YTP B;  3MC0 B;  3PO0 A;  3VTW A;  4ANU A;  3VHT C;  2L1A A;  1VRA B;  3NVK A;  1ZPS A;  3TEX A;  3RT3 B;  3ZTD A;  2K25 A;  4ZUX V;  2YVC A;  4DHX B;  3OLM D;  4J3O D;  2I1K A;  2WX0 A;  2D3A A;  1WM3 A;  1I4G A;  1R4N B;  2KDE B;  2L8J A;  1OQR A;  4N0F D;  4PK1 A;  4K1R B;  1H4R A;  3EC8 A;  2LZ6 A;  2AL6 A;  3QCA A;  4IW2 A;  2X38 A;  2FCS A;  1D5Z C;  1E0Z A;  2MBQ A;  2XK5 A;  1CQV A;  4EZK A;  2MBE A;  1A5R A;  3DPD A;  1RFA A;  5AZF A;  1P7E A;  4MGK E;  3V61 A;  2IY0 B;  2I2Z A;  4KZ0 A;  4B9K A;  2IJ0 A;  3HVZ A;  1D3Z A;  1EWC A;  4LTU A;  1QOB A;  1FNW A;  2WXN A;  1IYF A;  3OJ3 A;  3TL5 A;  2YEP F;  5FR6 A;  1K8R B;  1WRD B;  2D5G A;  5CHW A;  4F8C B;  1C4C A;  4TMA B;  3C8Y A;  2QEJ C;  2WXR A;  3W5V B;  1IUE A;  4ICU A;  2BF8 B;  5TR5 A;  3AM9 A;  4OTT A;  3RNB C;  4IC7 B;  2KKC A;  5C1Z A;  3BY4 B;  3EGR A;  3ZJV A;  3TEY A;  3BVM A;  3MC8 A;  4A9A A;  4LNF A;  1MFW A;  1S3S G;  4PT5 A;  2K6D B;  4RFB A;  2J0M A;  1Q1O A;  5DPW A;  4ZDV A;  4GN1 A;  3V3X A;  4YXD B;  1FFU A;  2NPT A;  3AE7 B;  1M4V A;  1XLN A;  5JZE B;  2C5L C;  1V80 A;  1NEK B;  1N62 A;  3PSE B;  2QHO A;  4GMV A;  2VZK B;  1EM7 A;  3VR8 B;  2YLM A;  3CF6 E;  2N1V A;  4HDQ A;  3ECI A;  4OZA A;  3DBL B;  3TDL A;  2N9E B;  4EZL A;  1MVK A;  1FNU A;  1ZW7 A;  2J53 A;  4WQO B;  2PTL A;  1E7C A;  3P4Q B;  5CHV C;  1E7U A;  1N6Z A;  3NZS A;  1YN3 A;  4OVV A;  4K7S A;  2DAF A;  2J42 A;  1UGM A;  1F0Z A;  1FRR A;  3JVZ X;  4A3O A;  2KBZ A;  2NR2 A;  2JUO A;  1MI0 A;  3GP7 A;  1NYQ A;  3R7Q A;  4FN2 A;  2XEW A;  4RF1 A;  4CHK A;  1AWD A;  3U30 A;  4URK A;  2BXA A;  5LLI A;  3ZO5 B;  2JRH A;  1FXT B;  3AXC A;  3NHE B;  3V08 A;  5ID7 A;  3SU8 X;  2Z0D B;  3VUW A;  3CST A;  2ZCC A;  1XCQ L;  4ZRQ A;  4A6Q A;  2M4N A;  3M99 C;  3RFZ B;  5LXI B;  5BYQ A;  1FNV A;  4F7Z A;  2NVU I;  1KW2 A;  2D3G A;  3ENE A;  1UUP A;  1B1Z A;  4PS8 A;  1UEL A;  2FUH B;  3QK0 A;  2BXP A;  4OR0 A;  1JAL A;  5D3I B;  5C23 A;  2MBB B;  1HK5 A;  2JXX A;  3M63 B;  2V36 A;  3NVY A;  3FWC C;  1TS3 A;  4RCO A;  3AV8 A;  2LVQ A;  3NOB A;  3Q3J A;  5GXG B;  2ZJD A;  2LHE A;  3DVG X;  4EMX A;  1WR1 A;  1AN8 A;  1FEH A;  2FNJ B;  2V3S A;  3OJ4 B;  5HFY A;  1P1A A;  3RI7 C;  3P42 A;  3W9C B;  3GE3 C;  3RNA C;  3ZDT A;  2K6Q A;  4ZOH C;  2MEK A;  1LGR A;  2CU1 A;  4CO7 A;  4JPS A;  4IOI E;  1I4X A;  2WXJ A;  4ZYN A;  1UF0 A;  1LOT A;  1E7E A;  4YTN B;  1YIW A;  4N58 A;  3V62 A;  1WH3 A;  2MW5 A;  2LXS A;  4US9 A;  3CX9 A;  2B3A A;  2NS5 A;  1YJI A;  3NZU A;  2WNM A;  1KLV A;  3MHS D;  2Z8I A;  4NAW A;  2K5P A;  4RGO S;  1UBQ A;  2KMC A;  1Z2M A;  2DYB A;  1FFV A;  3L17 A;  4PO0 A;  2KOX A;  1WGD A;  3B9M A;  2BXH A;  1E7V A;  1I4H A;  1TIF A;  1YJJ A;  2Z8J A;  2KQ4 X;  1VDV A;  1WX7 A;  3W1S C;  3UIP B;  5EE9 A;  1IGD A;  2BYE A;  2CJO A;  4K71 A;  2LGD A;  2KFK A;  3I3T B;  3ZNH B;  5IAA C;  4XC2 A;  2KD0 A;  4BKS A;  1OEY J;  2KO3 A;  2CKH B;  5B5T A;  4JL9 A;  2KJR A;  1GUA B;  5IN7 A;  1J7C A;  3K9O B;  2UU7 A;  2AQ2 B;  1KJT A;  2OED A;  4WIP A;  5FR3 A;  2LQI A;  3BZD B;  1T0R C;  3W1Y A;  2YDF A;  3DHH C;  1UD7 A;  1ET9 A;  4G01 A;  1KM7 A;  1LO5 D;  4Q2J A;  2BTE A;  4IM2 A;  2L3Z A;  4HJG E;  3VR9 B;  4ZC6 A;  4HPM B;  1UBI A;  1GNI A;  2AYO B;  2N0S B;  2ZEQ A;  2W3S A;  3MP9 A;  3PVL A;  2QDF A;  1J0G A;  4OW0 A;  3ETR A;  2GBM A;  2N9L A;  2LXT A;  1V6E A;  2JWU A;  1J7E A;  3N9Y C;  3NRZ A;  2AGH B;  1JWU D;  4BKG A;  1GG3 A;  4FA6 A;  4PYZ A;  4WA6 B;  2XW1 A;  4L9K A;  1ESF A;  3O65 B;  3BVZ A;  1V8C A;  4JGH B;  4JQW C;  4ANX A;  3ZQ4 A;  2BKF A;  3T3O A;  4W9J A;  4BKE A;  5HG2 A;  4S17 A;  2AQ1 B;  4P1C C;  5J18 A;  1HZ5 A;  3V6C B;  1JWB D;  2FAZ A;  2FCQ A;  5AEK B;  2KDM A;  4GU2 A;  1QKZ A;  2QIE B;  2XMO A;  1GNU A;  4XE0 A;  3Q6B A;  2PMV A;  3AEB B;  5IIX A;  3TUO A;  3TEW A;  4REZ A;  4DBG A;  4HXD A;  4FJY A;  5G5G A;  2RGF A;  2ACZ B;  2KN5 A;  2J0J A;  3DBH I;  3ZXV A;  3WAM A;  4PS3 A;  1J7A A;  1JRO A;  2JU6 X;  5CTR C;  2L83 A;  2JRI B;  3VDZ A;  1N5X A;  4MGZ E;  5EE3 A;  1SIF A;  2EFE A;  1I4R A;  1SB0 A;  4J2V A;  4OVU A;  2Z59 B;  1M94 A;  2PE9 A;  1OQQ A;  3N30 A;  1H5W A;  3A9J B;  4BOS C;  1K53 A;  3QC8 B;  1GJZ A;  1TGZ B;  4YSZ B;  5KHQ A;  4NQK E;  2DG5 A;  1E7F A;  2DEN B;  2RPV A;  1T6B X;  1XCT L;  2IGD A;  1KF6 B;  4ITK A;  1XD3 B;  3WAN A;  1SEB D;  3A75 A;  2WXI A;  2ZZP B;  3B08 A;  2BXB A;  2N9P C;  2GBK A;  2BXO A;  2I30 A;  2M17 A;  3AE1 B;  1YMH E;  1CZP A;  1V81 A;  1R7S A;  2N7E A;  4J6I A;  1J7B A;  3MHS B;  4M00 A;  3Q69 A;  2KC1 A;  2W82 A;  2ZPY A;  2MH7 A;  1AW7 A;  3PGE A;  1V9J A;  2JPH A;  2DLB A;  3MC9 A;  3Q3O C;  2KDI A;  3VQI A;  1F2R C;  4HGM B;  2FIF A;  5IJ5 A;  2IGH A;  2M19 A;  5DPT A;  1D4B A;  2BXL A;  1DOY A;  2D3C A;  4II3 B;  3RNC C;  3V05 A;  2WXO A;  4XWT A;  1SE3 A;  3L16 A;  4E99 A;  1TKY A;  1XLP A;  3DVN U;  4LNN A;  1LXD A;  3AE3 B;  2ZVN A;  1C4P A;  2BXQ A;  3OWE B;  4GIV A;  1E8W A;  5BO4 B;  2DBU A;  3PPA A;  1KLG D;  3C19 A;  4NJC A;  5HHD G;  1P3Q U;  3PT2 B;  3TIX A;  4AS1 A;  3CIR B;  3AI5 A;  1JCK B;  4ACF A;  5MPO A;  1WGK A;  2C60 A;  3IVF A;  2L7R A;  1E7A A;  3H7P B;  3H8H A;  4AOF A;  3M62 B;  5AZH A;  3H37 A;  4AUQ C;  3MTN B;  2AL3 A;  2M0X A;  1ENF A;  1YQ3 B;  4LDT D;  5DQF A;  4I6L B;  4JE3 B;  2BWF A;  1EWY C;  2Z0E B;  2RMM A;  3AU4 A;  1HK2 A;  1RFK A;  3VAW A;  2NNW A;  2PVG C;  2LI5 A;  3MJ5 A;  2INN E;  1B9R A;  4JIO U;  4Z9O A;  1L2N A;  3H9D A;  2W54 A;  1T3Q A;  1OQY A;  4DHZ E;  3ZNZ B;  2QCZ A;  1K50 A;  4RGT A;  3A9J A;  2OJW A;  1QF6 A;  1WZ3 A;  1P0R A;  5H92 C;  1PQS A;  3VRB B;  1LM8 B;  2GBN A;  3GS2 A;  1L4D B;  2EMS A;  5JXV A;  5J17 A;  1R4M I;  4OHJ A;  2E3T A;  2K1F A;  3T3N A;  4NJ7 A;  1HK3 A;  2GBR A;  4TKN A;  1V1P B;  4EFO A;  4WAA A;  2IO0 B;  2NBV B;  2DYM A;  4W9G A;  1TZO A;  3PHW B;  4MEL A;  1V5O A;  3V60 A;  2EKI A;  3N1X C;  2MJE A;  4NZL B;  3R66 C;  1VZ8 A;  2EFC A;  3VVW B;  2LVP A;  1N61 A;  4C7Y A;  2NPT B;  4KSK C;  2DNF A;  3P4S B;  2JZP A;  2KWU B;  1RLF A;  1FO4 A;  1TXU A;  4RF0 A;  2KWV B;  2D07 B;  2KYW A;  2KQS A;  2H89 B;  5JHB A;  3DWG C;  3QQ8 B;  2KK8 A;  2MWS B;  1PYW D;  1F2R I;  4HK2 A;  3M95 A;  3NG0 A;  3NVI A;  1XO3 A;  3BYT B;  2BXK A;  3Q8E A;  4MEM A;  3VFK A;  3DHG C;  5J2R A;  4IKG A;  4I9O A;  3Q8F A;  3WAO A;  4MSM B;  4E3C A;  2JQR B;  5LXH A;  2KN4 A;  5IJE A;  4N59 A;  3R2I A;  2OHF A;  2LVO A;  1VZ7 A;  5D7G A;  1BM0 A;  4BBN C;  4EEW A;  3DBR I;  2JT4 B;  2KZR A;  4HRO A;  3PZD A;  4KGS A;  4W9K A;  3I57 A;  2ZCB A;  2IY1 B;  2LUM A;  1KXP D;  3Q14 C;  4FBJ B;  3N3K B;  2KC2 A;  1L6V A;  2V1Y A;  2BQQ A;  3CSF A;  1WZ0 A;  4IW1 A;  1SJE D;  2R61 A;  1QOG A;  2EMT A;  3U52 E;  1GB1 A;  3LYY A;  1FMA D;  3H7P A;  1J78 A;  1KFY B;  3C0R B;  4KSL C;  1SE9 A;  4TUU A;  1RM6 C;  1XXG A;  2KWC A;  3NZ3 A;  2BYV E;  2JWZ A;  5DPR A;  1T0S C;  3UI3 A;  1TJE A;  1ZDX A;  3DOW A;  1QLB B;  3MFG A;  4RH6 A;  2KQ7 A;  3ZRF A;  3FIL B;  2DZJ A;  3AE9 B;  4FK5 B;  3VXW A;  4ANW A;  3D32 A;  1D6E C;  3WCQ A;  4ZHP A;  1WXM A;  2LRU A;  2Z8L A;  1BKE A;  3KYC D;  2PE6 B;  2WLB A;  1MG8 A;  4WAF A;  4MM3 A;  2RPQ A;  4A90 A;  2KNB A;  1V1P A;  1L5P A;  2L32 A;  1C1Y B;  3E56 A;  3RZF A;  1D5X C;  1WGY A;  2BXN A;  4E74 A;  1X1M A;  1KH0 A;  2BXF A;  2OOB B;  3EEC A;  4HDO A;  4HRS A;  1ZP0 B;  2BKR B;  1K52 A;  3IT6 B;  2K8H A;  3U7D A;  4MAC A;  3Q8C A;  2MQJ A;  4I6N B;  3UIV A;  1L4Z B;  4S1Y A;  2LHD A;  2OT3 A;  2BWE S;  2HJ1 A;  2LRW A;  4NAW B;  2XSI A;  2DHZ A;  3L54 A;  4OTU A;  1DYQ A;  2DZI A;  2RD0 A;  4IUM B;  2FE8 A;  2MX2 A;  1EU4 A;  1NYR A;  3RCZ A;  1I35 A;  1NT2 B;  1UWM A;  4BOZ B;  3PRP B;  2CHX A;  1G6J A;  3L0W B;  2NMQ A;  2J4X A;  1MIW A;  4HPP A;  3TMP B;  3JYU A;  2CS4 A;  3RNF C;  4RGN A;  2M1M A;  2V3P A;  4OVZ A;  1VR9 A;  2LJ5 A;  2CU3 A;  4RM8 A;  2KFK B;  2I2Y A;  4AJW A;  4BZA A;  1SGH A;  5E6J A;  1LNS A;  1WYW B;  4ZHO A;  4LDT B;  3ML8 A;  2GUT A;  2K9X A;  1E8Y A;  1OTR B;  5GHK A;  3KJL A;  3H3A A;  2VH1 A;  3VUY A;  3R7R A;  3LU8 A;  2KJ6 A;  2ROH A;  1WGR A;  3QJZ A;  1TYG B;  4NAM A;  1WMH A;  2LAS A;  1TT5 B;  3DBS A;  3ZNI D;  1AAR A;  1TKG A;  3B1L X;  4F5V A;  3H1U A;  3SFD B;  2DAJ A;  4HKZ E;  1UZX B;  1IP9 A;  4K7W A;  4G50 A;  2WQY B;  3A73 A;  1N5U A;  1E90 A;  3FIL A;  3B9L A;  4HKQ A;  4YSY B;  2L05 A;  1JML A;  4W9C A;  1VZS A;  3B9J A;  2ZW1 A;  1QOA A;  4B6W A;  2E0Y A;  2INC C;  2IPK D;  1TZ1 A;  2K8B A;  4L8U A;  3ZGZ A;  1VFI A;  2K0N A;  4LNO A;  1DOX A;  2LGI A;  2JXT A;  3L4P A;  1SSN A;  4KGT A;  1AO6 A;  3NVW A;  2BXI A;  4IG7 B;  4JLC A;  3DVG Y;  3ZJT A;  4WJN A;  4BKT A;  2MLB A;  4LA0 A;  2IND C;  2EFH A;  2W55 A;  4LLG M;  1HZ6 A;  1WXA A;  2QM6 A;  3UIO B;  3A9K A;  3A4S C;  5FKA C;  2L00 B;  3PLA A;  4ZCG A;  4C31 B;  3W1S A;  3AE5 B;  3WIM A;  1RWS A;  4R3D A;  1TY2 A;  2IDY A;  3HVD A;  1FCL A;  3TBL D;  4ICV A;  3UIN B;  3ZYY X;  1I4P A;  2KLC A;  1WY8 A;  2XNA C;  3Q2A C;  2QIL A;  3IT4 B;  2DX5 B;  4EUT A;  1NVI D;  4OT2 A;  3KVF B;  4DHJ D;  4GSW A;  1YN5 A;  2X8X X;  3I9V 1;  4I6P A;  3W5U B;  1Y8R C;  2BX8 A;  2BXD A;  2LUE A;  1NBF C;  1ZOY B;  3HHM A;  2BS3 B;  3RZW C;  4HJK A;  1ZGU B;  1Q0W B;  2IO1 B;  4LNK A;  2Y5B B;  3PLU A;  2KT7 A;  2PEA A;  2BPS A;  4AQ7 A;  1IPG A;  4HPL B;  3NS1 A;  3QIJ A;  4HVB A;  3N1Z C;  4XGA B;  2WU5 B;  1WX9 A; 
#chains in the Genus database with same CATH homology
 1JWA D;  4MT5 A;  3V09 A;  4EOY A;  3SFE B;  5CX3 A;  3PZ8 A;  3N32 A;  1R4N I;  2WXF A;  5HI1 A;  5FUO A;  1D5M C;  3AE2 B;  2BYT A;  5D94 A;  4RM9 A;  4RMA A;  1XLQ A;  2NTS A;  2DZM A;  4M70 B;  2VRR B;  5BMI A;  1YQB A;  4WUR A;  2G45 B;  1YD8 U;  2VUE A;  2A5U A;  3QAR A;  4TSS A;  2BXG A;  4GG2 A;  4G04 A;  2NTT A;  1E6E B;  3KH0 A;  3ICX A;  2GB1 A;  5AUK A;  4HCN B;  4MGY E;  3SR6 A;  4YL8 A;  2G4D B;  1ZDV A;  1JQ4 A;  1WE7 A;  2WDR B;  1E9M A;  3VRA B;  2O6V D;  1IGC A;  1WM2 A;  5G5H A;  2V3N A;  2G3Q B;  2GOW A;  3GZN I;  4G3X B;  3MHZ A;  3SD5 A;  3QAQ A;  2ONQ A;  1Z5S B;  1WR6 E;  1E7I A;  2IO2 B;  1FXA A;  3P4P B;  4XZ4 A;  1J8C A;  2KLG A;  3ZLZ A;  2IBI B;  1YNT E;  1XLO A;  5BYS A;  4A3P A;  3AB5 A;  1TY0 A;  2M0A A;  2GRI A;  1OFF A;  1OEY A;  4ZRI A;  2JVC A;  1QT9 A;  2G9H D;  4JX1 C;  2KAJ A;  3LU6 A;  3WAP A;  1P7F A;  2LXA A;  1GAQ B;  2I1J A;  1C76 A;  4XDD A;  1YX6 B;  2NCN A;  1HA2 A;  1MHX A;  2V4I B;  1V1O A;  4L1B A;  1ZE3 D;  3EA6 A;  2IGG A;  1YQ4 B;  1F9J A;  1A70 A;  4TV3 A;  2LOQ A;  1JNB A;  2LEK A;  3AE8 B;  4B0E A;  3NUH B;  1MPE A;  2M8S A;  4GDL B;  1V86 A;  5BPK A;  2KAC A;  2WU2 B;  2Y5P A;  1CJE A;  3M3J A;  3KW5 B;  3HIZ A;  2KVR A;  1SE4 A;  3AEG B;  2L0F A;  5EDS A;  1H8C A;  2IZV B;  2WWZ A;  2TSS A;  4K81 A;  4ARC A;  3AEE B;  2DWQ A;  3AE6 B;  1VD2 A;  3RD2 A;  4P6V F;  2KDF B;  1KLU D;  4AJY B;  4WJQ A;  2WDV B;  4FHK A;  3SIV B;  2HE7 A;  2D11 A;  1WIA A;  2J52 A;  4OZB A;  4DQO C;  2WDT B;  3G9K D;  1CK1 A;  4XDC A;  1UNS A;  4EE2 A;  4A55 A;  1WJ6 A;  4FHJ A;  2CJN A;  2JUH A;  4IWP A;  1E7H A;  2ZPN A;  3X23 A;  3R3M A;  2LGX A;  5IFO A;  2WXG A;  3P4R B;  1JRU A;  2Y3A A;  2WXK A;  4G11 A;  4EZJ A;  1K51 A;  2NQO A;  1T5X D;  4GGQ A;  3LB8 C;  3ZNG C;  1VJK A;  3RPF C;  4H2A A;  4IM0 A;  5TSS A;  3UQB A;  3GQU A;  1S1Q B;  4KVG B;  5DPS A;  3ZDM C;  3URY A;  1ZXH A;  1C79 A;  1E78 A;  4YT0 B;  3UGB B;  1FM0 D;  4L23 A;  5E6O A;  3AMZ A;  1TBE A;  1V2Y A;  3EHV A;  4W4U B;  2JX5 A;  4LB9 A;  2WXL A;  1V97 A;  2AEH A;  4P7I A;  1QZE A;  1WF9 A;  1TKE A;  1ET6 A;  4FXC A;  2ASQ A;  2D10 A;  4LCD E;  3LXF A;  4WWP A;  4GDL A;  3WHS A;  3O13 A;  1KTK A;  1V5T A;  3ZUN A;  1HE8 A;  2KDB A;  5C2T B;  4MM3 B;  3PLV A;  4GXB A;  1WX8 A;  2MCN B;  2N4F A;  3DDC B;  4M8M A;  2WS3 B;  2KX0 A;  4E71 A;  4HLE A;  1UWX A;  4F1S A;  2C7N B;  3VTU A;  1VCB A;  1HEZ E;  2LFI A;  3AN1 A;  1ISN A;  4NJ6 A;  3P1M A;  2CKX A;  2ZNV C;  3NVM A;  5HOZ A;  4IM3 A;  4ASW C;  5IJF A;  3FAH A;  4C56 C;  1C3T A;  2BXM A;  4YSX B;  4GDX A;  2INP E;  5GIP A;  4G03 A;  1WE6 A;  3APC A;  4EKU A;  2WP9 B;  1TS5 A;  1Q10 A;  4NQL B;  3AED B;  3APD A;  2K3U A;  2N1W A;  2ZW0 A;  3WA0 A;  2N7J A;  2CR5 A;  3WAL A;  2BXC A;  3DCG A;  3IHP C;  1TF0 A;  2JYT A;  4B0M A;  1YN4 A;  1WXQ A;  3VTV A;  1E7B A;  3ZTC A;  1EUV B;  1Q5W B;  4ZBQ A;  3MHH B;  1U4A A;  2WXH A;  2AX5 A;  4DWF A;  2WDQ B;  2K8C A;  1L0X B;  5L95 C;  5H8Y E;  2BBC A;  5T8I A;  4DXF A;  1GNJ A;  4A8X C;  1UOR A;  2KFJ A;  2I38 A;  4MGI E;  1E7P B;  3JSV B;  4HGK A;  4NY0 A;  2FCN A;  5L83 A;  3AEC B;  2VDB A;  1IBX B;  1WMH B;  1PUT A;  1I42 A;  3ZJU A;  3RUL A;  4FLH A;  3BVG A;  4B95 A;  1MIV A;  2C9W B;  4FUL A;  1SE2 A;  1DGJ A;  4W9F A;  3WHR A;  2WXQ A;  4WQM A;  1HXY D;  2RDH A;  3BWU D;  4KDL B;  4TQ0 A;  4DDI D;  4JWU C;  2RSU A;  4FJZ A;  1C77 A;  2KHW B;  3K9P B;  1FOU A;  4MH0 E;  2VUF A;  4HWI B;  2BB6 A;  4ARI A;  5EE1 A;  1O9X A;  4CYE A;  3BIN A;  2H88 B;  1Y56 A;  1F77 A;  1T0Y A;  2WXP A;  1EF1 A;  3A4R A;  1VLB A;  2MA9 B;  5BYR A;  4DDG D;  3TEZ A;  3LJ3 A;  2O6V A;  1P9D U;  2GBJ A;  4ZBK A;  4GB9 A;  3A9K B;  1E10 A;  4RNA A;  2XN9 C;  4ZBR A;  4KKI A;  1C78 A;  4L2Y A;  1PGX A;  1N60 A;  2PPH A;  3BYY B;  1C9F A;  1L6U A;  4OZC A;  2A4Z A;  5DBY A;  3IAS 1;  3QX1 A;  3NVZ A;  4ANV A;  5CHF A;  3V03 A;  2LD9 A;  1WWT A;  1NEN B;  3HRD D;  2PKO A;  3DQV A;  1SB3 C;  3S2A A;  4HEA 1;  3AH7 A;  2JYE A;  1TS2 A;  3KWV A;  4FIP B;  4BFR A;  1FRD A;  4M0W B;  2K22 A;  5IIH A;  4W9L A;  2KX3 A;  5GMV A;  1HA5 A;  2QMT A;  3B2F A;  2BT6 A;  2DYO A;  3JSV A;  4ZRJ A;  1MA9 A;  4WJP A;  3GOE A;  3QHT A;  4GOC A;  1H9Z A;  3KUZ A;  1IBX A;  4K7U A;  1MHH E;  2SAK A;  1L7Y A;  4LJO B;  3EUB 2;  3Q3F A;  1OGW A;  3T9L A;  3HUI A;  3NY5 A;  1J19 A;  2DBY A;  3TCA A;  2PW9 A;  1BT0 A;  3V6E B;  3NS8 A;  3ZIM A;  4MBE C;  1XQQ A;  4MJS B;  2C7M B;  5GIN A;  1TS4 A;  1PDX A;  1WXS A;  4Z69 A;  2BB5 A;  2HJ8 A;  3PV1 A;  2EEL A;  1SBB B;  1RYJ A;  4LUH A;  3IFW B;  2PLP A;  4W9I A;  2JY6 A;  3H6N A;  5LNK 1;  3UF8 A;  1L0V B;  4BVU C;  3LU7 A;  1RAX A;  4HCP B;  4BBN F;  2D2Q A;  1UGJ A;  3KYD D;  4F5T A;  3AUL A;  2FCM A;  1RRB A;  4A20 A;  1SIJ A;  2HDE A;  1FXI A;  4KV2 A;  4C80 A;  5G55 A;  5E6N A;  4WH4 A;  3U4E G;  2M56 B;  2K39 A;  2BYF A;  1CMX B;  3PRM B;  1ROE A;  2SEB D;  1GPX A;  4O1N A;  2DZK A;  1IJG A;  4FAD A;  3FWB C;  3VH4 B;  2DBW A;  1PGB A;  3Q8A A;  3VH3 B;  1WXV A;  2V4L A;  2G4S A;  2XW0 A;  2N7D A;  2WYQ A;  4BY9 C;  2LGY A;  5GIO A;  5D6J B;  3ALB A;  4XX5 A;  2CHZ A;  1LFD A;  3ZVV A;  3HM3 A;  1E5W A;  4PS7 A;  3IG3 A;  2MJD A;  1QOF A;  3ONS A;  2FID A;  1DOI A;  4M0W A;  2MJ3 A;  4US8 A;  3PTF C;  1NI3 A;  1WJ4 A;  3LDZ E;  2MP2 B;  3TJP A;  1BJ5 A;  3X0W A;  3BK1 A;  1XT9 B;  3Q8B A;  2E6X A;  1E8Z A;  3ZRC A;  3IAM 1;  2Z8K A;  4FJV B;  2Y5C A;  2E0X A;  2QHB A;  1WJU A;  2N9K A;  1I4Q A;  2XVQ A;  2EKE C;  3GQX A;  4KDI C;  1TTN A;  2JSV X;  5KHO A;  3A33 B;  2K0P A;  4P16 A;  3HK0 A;  5AZG A;  1SXT A;  2MBH A;  1WSP A;  2XVV A;  3UQA A;  4M8N A;  3ML9 A;  5DCN A;  4CQN A;  1ZUD 2;  4MJS A;  2YEP B;  1HK1 A;  3AEA B;  2R2Q A;  4IWQ A;  2BGF A;  2KMA A;  1NDD A;  1YX5 B;  2KTF A;  1XF5 L;  5BMG A;  3U2S C;  3ZKJ C;  5IA7 A;  3DWM A;  5G2N A;  1WJN A;  3B2G A;  3FNM A;  2KJH B;  2NBW B;  1XEE A;  1E7G A;  4WWM A;  4N9F 4;  4GDK B;  2UWQ A;  3A1Q B;  1FIQ A;  4PYU A;  4N3Z A;  2PIA A;  2WXM A;  2GI9 A;  3R8B A;  2JZZ A;  2J7Q B;  2B76 B;  1ZKH A;  4UDU C;  1EU3 A;  3OAW A;  2KTR B;  4XWW A;  3R2T A;  2KXJ A;  4IWO A;  3GA9 L;  1L0Y B;  3AE4 B;  3GB1 A;  1I7H A;  4N6E B;  4II2 B;  4KZC A;  3APF A;  4G0N B;  3SHQ A;  4YTM B;  4NPN A;  3KUD B;  2W3R A;  4W9E A;  4KGR A;  2RR9 A;  3SDL C;  3AU5 A;  2XVU A;  5D3D A;  2MP2 A;  4MH8 A;  4ZYS A;  2OJR A;  3PRZ A;  1VZ6 A;  2LJI A;  3CWI A;  1JRP A;  2W9N A;  4K2C A;  2QJL A;  1JWM D;  3KLS X;  4KKJ A;  3DBL I;  2QSD A;  2FBW B;  3IBE A;  2QMC A;  2G1E A;  2J0K A;  5ID9 A;  1QQR A;  3KQ4 A;  2AQ3 B;  3PHX B;  1N5W A;  4FJC B;  4LB2 A;  3JRY A;  1AYF A;  2ZNV B;  1PFD A;  2NBU A;  1UH6 A;  4KIK B;  4DK5 A;  1SF0 A;  3E9S A;  1WFY A;  2KAN A;  2O2V B;  3J9C A;  3L10 B;  3KWL A;  1FD6 A;  1GOZ A;  2OZB B;  3IXS A;  2DBX A;  1FCC C;  5E6P A;  5EE0 A;  4W9D A;  4L9Q A;  1BXT A;  1GB4 A;  1QIL A;  2LXC A;  3P63 A;  3PZ7 A;  1JWS D;  4F5U A;  2L76 A;  3SEB A;  4C7Z A;  2JF5 A;  3BK2 A;  1YJ1 A;  2KMM A;  3PS6 A;  4DXG A;  2ON8 A;  1GC7 A;  3U8Z A;  4RGM A;  3NMU A;  4WWO A;  4GDK A;  3HM6 X;  3SQJ A;  4IW0 A;  1SJH D;  2BW2 A;  3A1Q A;  4AWJ A;  1WYG A;  4KX6 B;  3KIK A;  3JQZ A;  2WX1 A;  4LJP B;  2ICI A;  3ZW3 A;  4DHZ B;  3DVN V;  4LK0 M;  3VUX A;  4USA A;  4WWN A;  2KTR A;  5JH5 C;  1P98 A;  3T8M A;  5IIU A;  4N0U D;  4DHJ B;  3NVV A;  3KUC B;  5AUI A;  1HQR D;  5C3J B;  5JHA A;  3P2B A;  2VZK D;  4D2K A;  4LUF A;  2HD5 B;  2FUG 1;  1WGG A;  2PVO D;  2AJE A;  2N9X A;  1PGA A;  5BMH A;  4ZRP A;  3SIU B;  1ZXI A;  3JW0 X;  4AP4 C;  1MIY A;  3FC4 A;  1BML C;  1WGH A;  3BII D;  2IYD B;  2XK5 B;  1EO6 A;  2BS4 B;  4X57 B;  2KWD A;  2LMC A;  2RDG A;  2HTM E;  4DXA B;  5FK9 C;  2MRP A;  3TSS A;  4BKS D;  2Q5W D;  2L0T A;  2CHW A;  2XBB C;  4IDI A;  2IO3 B;  2C7H A;  3AEF B;  1JW9 D;  1BUI C;  4KIK A;  1LQB A;  5HKH A;  1STE A;  2R2O A;  2O2V A;  4MSQ B;  1EF5 A;  2GMI C;  2MBO A;  4MDK E;  3QWZ B;  4JWS C;  3RUI B;  1ACC A;  2BXE A;  3CMM B;  4WJO A;  4W9H A;  4F5S A;  4YWG G;  1E8X A;  2O6V B;  3PRE A;  3RYT A;  2JZ3 B;  4NNJ B;  2HTH A;  4TQ1 A;  2MSE D;  3EFU A;  1KRH A;  2BS2 B;  2V0G A;  3ABV B;  1HK4 A;  1KOT A;  3H7S A;  4GLS C;  2AWT A;  3U7Z A;  1NI2 A;  3L13 A;  1GC6 A;  2PJH A;  2UYZ B;  2ZVO A;  2REX A;  3L08 A;  5D2M B;  1C4A A;  1WRI A;  3MJW A;  1V49 A;  3B0A A;  3QA8 A;  1N63 A;  2L52 A;  2EFD A;  4ZRK A;  4JK4 A;  3W2D A;  3WHQ A;  2XVW A;  5I4D A;  2LWP A;  1WI0 A;  4YTP B;  3MC0 B;  3PO0 A;  3VTW A;  4ANU A;  3VHT C;  2L1A A;  1VRA B;  3NVK A;  1ZPS A;  3TEX A;  3RT3 B;  3ZTD A;  2K25 A;  4ZUX V;  2YVC A;  4DHX B;  3OLM D;  4J3O D;  2I1K A;  2WX0 A;  1WM3 A;  1I4G A;  2KDE B;  2L8J A;  1OQR A;  4N0F D;  4K1R B;  1H4R A;  3EC8 A;  2LZ6 A;  2AL6 A;  3QCA A;  4IW2 A;  2X38 A;  2FCS A;  1D5Z C;  1E0Z A;  2MBQ A;  2XK5 A;  1CQV A;  4EZK A;  2MBE A;  1A5R A;  3DPD A;  1RFA A;  5AZF A;  4MGK E;  1P7E A;  3V61 A;  2IY0 B;  2I2Z A;  4KZ0 A;  4B9K A;  2IJ0 A;  3HVZ A;  1D3Z A;  1EWC A;  4LTU A;  1QOB A;  1FNW A;  2WXN A;  1IYF A;  3OJ3 A;  3TL5 A;  2YEP F;  5FR6 A;  1K8R B;  1WRD B;  2D5G A;  5CHW A;  4F8C B;  1C4C A;  4TMA B;  3C8Y A;  2QEJ C;  2WXR A;  3W5V B;  1IUE A;  4ICU A;  2BF8 B;  5TR5 A;  3AM9 A;  4OTT A;  4IC7 B;  2KKC A;  5C1Z A;  3BY4 B;  3EGR A;  3ZJV A;  3TEY A;  3BVM A;  4A9A A;  1S3S G;  4PT5 A;  2K6D B;  4RFB A;  2J0M A;  1Q1O A;  5DPW A;  4ZDV A;  4GN1 A;  3V3X A;  4YXD B;  1FFU A;  2NPT A;  3AE7 B;  1M4V A;  1XLN A;  5JZE B;  2C5L C;  1V80 A;  1NEK B;  1N62 A;  3PSE B;  2QHO A;  4GMV A;  2VZK B;  1EM7 A;  3VR8 B;  2YLM A;  3CF6 E;  2N1V A;  4HDQ A;  3ECI A;  4OZA A;  3TDL A;  2N9E B;  4EZL A;  1MVK A;  1ZW7 A;  1FNU A;  2J53 A;  4WQO B;  2PTL A;  1E7C A;  3P4Q B;  5CHV C;  1E7U A;  3NZS A;  1YN3 A;  4OVV A;  4K7S A;  2DAF A;  2J42 A;  1UGM A;  1F0Z A;  1FRR A;  3JVZ X;  4A3O A;  2KBZ A;  2NR2 A;  2JUO A;  1MI0 A;  3GP7 A;  1NYQ A;  3R7Q A;  4FN2 A;  2XEW A;  4RF1 A;  4CHK A;  1AWD A;  3U30 A;  4URK A;  2BXA A;  5LLI A;  3ZO5 B;  2JRH A;  1FXT B;  3AXC A;  3SU8 X;  3V08 A;  5ID7 A;  3NHE B;  2Z0D B;  3VUW A;  3CST A;  2ZCC A;  1XCQ L;  4ZRQ A;  4A6Q A;  2M4N A;  3M99 C;  3RFZ B;  5LXI B;  5BYQ A;  4F7Z A;  1FNV A;  2NVU I;  1KW2 A;  2D3G A;  3ENE A;  1UUP A;  1B1Z A;  4PS8 A;  1UEL A;  2FUH B;  3QK0 A;  2BXP A;  4OR0 A;  1JAL A;  5D3I B;  5C23 A;  2MBB B;  1HK5 A;  2JXX A;  3M63 B;  2V36 A;  3NVY A;  3FWC C;  1TS3 A;  4RCO A;  3NOB A;  2LVQ A;  3Q3J A;  3AV8 A;  5GXG B;  2ZJD A;  2LHE A;  3DVG X;  4EMX A;  1WR1 A;  1AN8 A;  2FNJ B;  1FEH A;  2V3S A;  3OJ4 B;  5HFY A;  1P1A A;  3P42 A;  3W9C B;  3ZDT A;  2K6Q A;  4ZOH C;  2MEK A;  2CU1 A;  4CO7 A;  4JPS A;  4IOI E;  1I4X A;  2WXJ A;  4ZYN A;  1LOT A;  1E7E A;  4YTN B;  1YIW A;  4N58 A;  3V62 A;  1WH3 A;  2MW5 A;  4US9 A;  3CX9 A;  2B3A A;  2NS5 A;  3NZU A;  1YJI A;  2WNM A;  1KLV A;  3MHS D;  2Z8I A;  4NAW A;  2K5P A;  4RGO S;  1UBQ A;  2KMC A;  1Z2M A;  2DYB A;  1FFV A;  3L17 A;  4PO0 A;  2KOX A;  1WGD A;  3B9M A;  2BXH A;  1E7V A;  1I4H A;  1YJJ A;  2Z8J A;  2KQ4 X;  1VDV A;  1WX7 A;  3W1S C;  3UIP B;  5EE9 A;  1IGD A;  2BYE A;  2CJO A;  4K71 A;  2LGD A;  2KFK A;  3I3T B;  3ZNH B;  5IAA C;  4XC2 A;  2KD0 A;  4BKS A;  1OEY J;  2KO3 A;  2CKH B;  5B5T A;  4JL9 A;  2KJR A;  1GUA B;  1J7C A;  3K9O B;  2AQ2 B;  1KJT A;  2OED A;  4WIP A;  5FR3 A;  3BZD B;  3W1Y A;  2YDF A;  1UD7 A;  1ET9 A;  4G01 A;  1KM7 A;  1LO5 D;  4Q2J A;  2BTE A;  4IM2 A;  2L3Z A;  4HJG E;  3VR9 B;  4ZC6 A;  4HPM B;  1UBI A;  1GNI A;  2AYO B;  2N0S B;  2ZEQ A;  2W3S A;  3MP9 A;  3PVL A;  1J0G A;  4OW0 A;  3ETR A;  2GBM A;  2N9L A;  1V6E A;  2JWU A;  1J7E A;  3N9Y C;  3NRZ A;  1JWU D;  4BKG A;  1GG3 A;  4FA6 A;  4PYZ A;  4WA6 B;  2XW1 A;  4L9K A;  3O65 B;  4JQW C;  4ANX A;  1ESF A;  4JGH B;  1V8C A;  3BVZ A;  3ZQ4 A;  2BKF A;  3T3O A;  4W9J A;  4BKE A;  5HG2 A;  2AQ1 B;  5J18 A;  3V6C B;  1HZ5 A;  1JWB D;  2FAZ A;  2FCQ A;  5AEK B;  2KDM A;  4GU2 A;  1QKZ A;  2QIE B;  2XMO A;  1GNU A;  4XE0 A;  2PMV A;  3AEB B;  5IIX A;  3TUO A;  3TEW A;  4REZ A;  4DBG A;  4HXD A;  4FJY A;  5G5G A;  2RGF A;  2ACZ B;  2KN5 A;  2J0J A;  3DBH I;  3WAM A;  4PS3 A;  1J7A A;  1JRO A;  2JU6 X;  5CTR C;  2L83 A;  2JRI B;  3VDZ A;  1N5X A;  4MGZ E;  5EE3 A;  1SIF A;  2EFE A;  1I4R A;  4J2V A;  4OVU A;  2Z59 B;  1M94 A;  2PE9 A;  1OQQ A;  3N30 A;  1H5W A;  3A9J B;  4BOS C;  3QC8 B;  1GJZ A;  1K53 A;  1TGZ B;  5KHQ A;  4YSZ B;  4NQK E;  2DG5 A;  1E7F A;  2DEN B;  2RPV A;  1T6B X;  1XCT L;  2IGD A;  1KF6 B;  3WAN A;  1XD3 B;  4ITK A;  1SEB D;  3A75 A;  2WXI A;  2ZZP B;  3B08 A;  2BXB A;  2N9P C;  2GBK A;  2BXO A;  2I30 A;  2M17 A;  3AE1 B;  1YMH E;  1CZP A;  1V81 A;  2N7E A;  1R7S A;  4J6I A;  1J7B A;  3MHS B;  3Q69 A;  2KC1 A;  2ZPY A;  3PGE A;  2MH7 A;  1AW7 A;  2W82 A;  1V9J A;  2JPH A;  2DLB A;  2KDI A;  3VQI A;  1F2R C;  4HGM B;  2FIF A;  5IJ5 A;  2IGH A;  2M19 A;  5DPT A;  1D4B A;  2BXL A;  1DOY A;  4II3 B;  3V05 A;  2WXO A;  4XWT A;  1SE3 A;  3L16 A;  4E99 A;  1TKY A;  3DVN U;  1XLP A;  1LXD A;  3AE3 B;  2ZVN A;  1C4P A;  2BXQ A;  4GIV A;  3OWE B;  1E8W A;  5BO4 B;  2DBU A;  3PPA A;  1KLG D;  4NJC A;  5HHD G;  1P3Q U;  3PT2 B;  3TIX A;  4AS1 A;  3CIR B;  3AI5 A;  1JCK B;  5MPO A;  1WGK A;  2C60 A;  3IVF A;  2L7R A;  1E7A A;  3H7P B;  3H8H A;  4AOF A;  3M62 B;  5AZH A;  3H37 A;  4AUQ C;  3MTN B;  2AL3 A;  2M0X A;  1ENF A;  1YQ3 B;  4LDT D;  5DQF A;  4I6L B;  4JE3 B;  2BWF A;  2Z0E B;  1EWY C;  2RMM A;  3AU4 A;  1HK2 A;  1RFK A;  3VAW A;  2NNW A;  2PVG C;  2LI5 A;  3MJ5 A;  2INN E;  1B9R A;  4JIO U;  4Z9O A;  1L2N A;  3H9D A;  2W54 A;  1T3Q A;  1OQY A;  4DHZ E;  3ZNZ B;  1K50 A;  4RGT A;  3A9J A;  1QF6 A;  1WZ3 A;  1P0R A;  5H92 C;  1PQS A;  3VRB B;  1LM8 B;  2GBN A;  3GS2 A;  1L4D B;  2EMS A;  5JXV A;  5J17 A;  1R4M I;  4OHJ A;  2E3T A;  2K1F A;  3T3N A;  4NJ7 A;  1HK3 A;  2GBR A;  4TKN A;  4EFO A;  1V1P B;  4WAA A;  2IO0 B;  2NBV B;  2DYM A;  4W9G A;  3PHW B;  1TZO A;  4MEL A;  1V5O A;  3V60 A;  2EKI A;  2MJE A;  4NZL B;  3R66 C;  1VZ8 A;  2EFC A;  3VVW B;  2LVP A;  1N61 A;  4C7Y A;  2NPT B;  4KSK C;  3P4S B;  2JZP A;  2KWU B;  1RLF A;  1FO4 A;  1TXU A;  4RF0 A;  2KWV B;  2D07 B;  2KQS A;  2H89 B;  5JHB A;  3DWG C;  3QQ8 B;  2KK8 A;  2MWS B;  1PYW D;  1F2R I;  4HK2 A;  3M95 A;  3NVI A;  1XO3 A;  3BYT B;  2BXK A;  4MEM A;  3VFK A;  3Q8E A;  5J2R A;  4IKG A;  3WAO A;  3Q8F A;  4MSM B;  4E3C A;  5LXH A;  2JQR B;  2KN4 A;  5IJE A;  4N59 A;  3R2I A;  2OHF A;  2LVO A;  1VZ7 A;  5D7G A;  1BM0 A;  4EEW A;  4BBN C;  3DBR I;  2JT4 B;  2KZR A;  4HRO A;  3PZD A;  4KGS A;  4W9K A;  3I57 A;  2ZCB A;  2IY1 B;  4FBJ B;  1KXP D;  2LUM A;  3N3K B;  2KC2 A;  1L6V A;  2V1Y A;  3CSF A;  1WZ0 A;  4IW1 A;  1SJE D;  2R61 A;  1QOG A;  2EMT A;  3U52 E;  1GB1 A;  3LYY A;  1FMA D;  3H7P A;  1J78 A;  1KFY B;  3C0R B;  4KSL C;  1SE9 A;  4TUU A;  1RM6 C;  1XXG A;  2KWC A;  3NZ3 A;  2BYV E;  2JWZ A;  5DPR A;  3UI3 A;  1TJE A;  1ZDX A;  3DOW A;  1QLB B;  3MFG A;  4RH6 A;  2KQ7 A;  3ZRF A;  3FIL B;  2DZJ A;  3AE9 B;  4FK5 B;  3VXW A;  4ANW A;  3D32 A;  1D6E C;  3WCQ A;  4ZHP A;  1WXM A;  2LRU A;  2Z8L A;  1BKE A;  3KYC D;  2PE6 B;  2WLB A;  1MG8 A;  4WAF A;  4MM3 A;  2RPQ A;  4A90 A;  2KNB A;  1V1P A;  1L5P A;  2L32 A;  1C1Y B;  3E56 A;  3RZF A;  1D5X C;  1WGY A;  2BXN A;  4E74 A;  1X1M A;  1KH0 A;  2BXF A;  2OOB B;  3EEC A;  4HDO A;  4HRS A;  1ZP0 B;  2BKR B;  1K52 A;  3IT6 B;  2K8H A;  3U7D A;  4MAC A;  3Q8C A;  2MQJ A;  4I6N B;  3UIV A;  1L4Z B;  4S1Y A;  2LHD A;  2OT3 A;  2BWE S;  2LRW A;  4NAW B;  2XSI A;  2DHZ A;  3L54 A;  4OTU A;  2DZI A;  1DYQ A;  2RD0 A;  4IUM B;  2FE8 A;  2MX2 A;  1EU4 A;  1NYR A;  3RCZ A;  1I35 A;  1NT2 B;  1UWM A;  4BOZ B;  3PRP B;  2CHX A;  1G6J A;  3L0W B;  2NMQ A;  2J4X A;  1MIW A;  3TMP B;  3JYU A;  2CS4 A;  4RGN A;  2M1M A;  2V3P A;  4OVZ A;  1VR9 A;  2LJ5 A;  4RM8 A;  2CU3 A;  2KFK B;  2I2Y A;  4AJW A;  1SGH A;  5E6J A;  1LNS A;  1WYW B;  4ZHO A;  4LDT B;  3ML8 A;  2K9X A;  1E8Y A;  1OTR B;  5GHK A;  3KJL A;  3H3A A;  3VUY A;  3R7R A;  3LU8 A;  2KJ6 A;  2ROH A;  1WGR A;  3QJZ A;  1TYG B;  4NAM A;  1WMH A;  2LAS A;  3DBS A;  3ZNI D;  1AAR A;  3B1L X;  1TKG A;  4F5V A;  3H1U A;  3SFD B;  2DAJ A;  4HKZ E;  1IP9 A;  1UZX B;  4K7W A;  4G50 A;  2WQY B;  3A73 A;  1N5U A;  1E90 A;  3FIL A;  3B9L A;  4HKQ A;  4YSY B;  2L05 A;  1JML A;  4W9C A;  1VZS A;  3B9J A;  2ZW1 A;  1QOA A;  4B6W A;  2E0Y A;  2IPK D;  1TZ1 A;  2K8B A;  4L8U A;  3ZGZ A;  1VFI A;  1DOX A;  2LGI A;  2JXT A;  3L4P A;  1SSN A;  4KGT A;  1AO6 A;  3NVW A;  2BXI A;  4IG7 B;  4JLC A;  3DVG Y;  3ZJT A;  4WJN A;  4BKT A;  2MLB A;  4LA0 A;  2EFH A;  2W55 A;  4LLG M;  1HZ6 A;  1WXA A;  2QM6 A;  3UIO B;  3A9K A;  3A4S C;  5FKA C;  2L00 B;  3PLA A;  4ZCG A;  4C31 B;  3W1S A;  3AE5 B;  3WIM A;  1RWS A;  4R3D A;  1TY2 A;  2IDY A;  3HVD A;  1FCL A;  3TBL D;  4ICV A;  3UIN B;  3ZYY X;  1I4P A;  2KLC A;  1WY8 A;  2XNA C;  2QIL A;  3IT4 B;  2DX5 B;  4EUT A;  1NVI D;  4OT2 A;  3KVF B;  4DHJ D;  4GSW A;  1YN5 A;  3I9V 1;  4I6P A;  3W5U B;  1Y8R C;  2BX8 A;  2BXD A;  2LUE A;  1NBF C;  1ZOY B;  3HHM A;  2BS3 B;  3RZW C;  4HJK A;  1ZGU B;  1Q0W B;  2IO1 B;  2Y5B B;  3PLU A;  2PEA A;  2BPS A;  4AQ7 A;  1IPG A;  4HPL B;  3NS1 A;  3QIJ A;  4HVB A;  2WU5 B;  1WX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...