2DYMA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-46) complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
285
structure length
254
Chain Sequence
AHMNDIKQLLWNGELNVLVSIDPSFEIAVLRIRVPRETYLVNYMPLIWNKIKSYFWFEHNKTPIPWNYPVGVLFDCLAGFTTSFENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTTFRISQPTISMTGVNPTLKDIEGDILDVKDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy protein 5
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover/protein turnover
total genus 72
structure length 254
sequence length 285
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dymA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dymA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dymA01
1C1YB 2HD5B 1RFAA 2KX3A 3HHMA 3O65B 2KZRA 2EKEC 4PS7A 4DDGD 1K8RB 3DBSA 2LXCA 4KSLC 2O2VA 3U7DA 1YIWA 4GXBA 4FN2A 3ZUNA 4RM9A 1WH3A 1E5WA 2DAFA 4W9HA 3VHTC 3PPAA 4FHKA 3A9KA 4BKGA 2GBNA 2KK8A 3ZNGC 3OLMD 1A5RA 4B95A 3NHEB 2FAZA 2KC1A 1V81A 2LVOA 3RZWC 2NVUI 1SGHA 2K39A 1U4AA 1WM2A 3QWZB 2KQ7A 3ECIA 4W9GA 4DHJB 4CHKA 4IUMB 4JL9A 4HCNB 4BOSC 3HIZA 4M0WB 4F8CB 4MGZE 1WY8A 3ONSA 2DYBA 3N3KB 1EF1A 2WWZA 2DZJA 3ZRCA 1Q0WB 1Z5SB 2KO3A 3A9JA 4M8MA 2G45B 2JUOA 2L0FA 4KZCA 3M3JA 2AYOB 2YLMA 3CSTA 1XQQA 4JIOU 4A20A 4E71A 4GGQA 2N4FA 1WZ3A 3AI5A 2PPHA 2BF8B 3A4RA 3L16A 4G11A 2YVCA 1G6JA 5AEKB 4I6NB 2MQJA 3X0WA 3Q3JA 4BKSD 1GC6A 2AL6A 2KWUB 3DQVA 3R7QA 4WWNA 5JZEB 5E6NA 1VD2A 1E7UA 2JY6A 4WWPA 1OGWA 1Q1OA 1H8CA 3KH0A 4FA6A 1SE9A 1J8CA 4HJKA 3V6CB 2KANA 4ANXA 1WMHA 2MA9B 3OJ3A 3QJZA 5DPSA 1WJ6A 2UYZB 3PRZA 1WJNA 1OEYA 4CO7A 4MDKE 4FJVB 4I6LB 4MGYE 4MGIE 2R2QA 2KX0A 2KHWB 4GSWA 2Y5BB 2JPHA 5JH5C 2M17A 4K1RB 2MRPA 3VVWB 1OTRB 3KW5B 2N7EA 3CMMB 3A1QA 1I35A 1HE8A 2ZVNA 4F1SA 2DZIA 2IBIB 2C7MB 3V62A 2KLGA 2IO2B 1EF5A 4ASWC 2JRHA 3WAPA 4JLCA 4WJNA 4YL8A 2I1JA 1NDDA 3ZVVA 3AXCA 2V1YA 5G2NA 1WXVA 3R3MA 2DX5B 1V80A 1WR1A 3DOWA 3K9OB 3PV1A 5DCNA 3RUIB 2J7QB 2ZNVC 1WGRA 2N9XA 3KUDB 3ML8A 2XK5A 1J19A 4ZRKA 4KSKC 3L13A 1TGZB 2VRRB 3APCA 2KDFB 4HCPB 4HPLB 4XZ4A 1TTNA 4IM2A 4FHJA 4HDQA 5L83A 2L7RA 5JHAA 3ML9A 3EECA 1S3SG 5AZHA 3UIPB 1SIFA 3PHXB 3M62B 1XD3B 5HKHA 4B9KA 3QC8B 4ICUA 1ZW7A 2FIFA 2GBMA 4WJOA 2MBHA 1OEYJ 3PVLA 1GUAB 3PLVA 2BWES 2KJRA 3ZKJC 2DHZA 5J18A 4ANVA 4LDTB 5D7GA 1OQYA 4GIVA 2KDBA 4W9IA 2IY0B 3VFKA 1PQSA 4BVUC 2IO0B 4TQ0A 3TCAA 1EO6A 4GU2A 4RM8A 3MTNB 2C9WB 1WIAA 2J0MA 2O6VD 5DPRA 1YX5B 3PTFC 2CS4A 2RPQA 4TUUA 4LCDE 4OVUA 4ANUA 3DCGA 2KOXA 2RD0A 2MBQA 2ZVOA 4HWIB 1ISNA 2WX0A 2QHOA 4IW0A 4HXDA 2DYOA 2GBJA 2M1MA 3ALBA 3RCZA 1V5TA 3RULA 3WALA 2HE7A 2PJHA 1WJ4A 3APDA 3DVNU 4MGKE 3IG3A 4K7WA 1WXSA 3S2AA 4ZDVA 2IZVB 2L05A 3W1YA 1AARA 1E8WA 3QQ8B 5JHBA 2Z0DB 4KIKB 4IC7B 3H7PB 3K9PB 4M8NA 1KOTA 2FNJB 1M94A 4AJYB 2K25A 1LFDA 1WX9A 2CU1A 2RSUA 3NZUA 4PS8A 3ZDMC 3AU4A 3M95A 1YD8U 3PSEB 5C23A 4DHZE 2KVRA 2LRWA 2N9PC 5FR6A 2K8CA 2LZ6A 2MBEA 3QHTA 4FULA 1I42A 3QA8A 4TQ1A 1P3QU 5IA7A 4FJYA 5TR5A 4WAAA 4MEMA 4BBNC 4E3CA 3SD5A 2FCSA 2HTHA 2ZEQA 3VUWA 4NQLB 1E8ZA 2D11A 3ZTCA 3PLUA 2HJ8A 2FCNA 2PEAA 3PS6A 1MG8A 2C5LC 3TBLD 3D32A 1D3ZA 2J0JA 4NAWB 3WAMA 3C0RB 2KDIA 3HM6X 2KDEB 3DVNV 2KJHB 2L0TA 4NJ7A 5CX3A 4URKA 4II3B 4WQOB 4KDIC 2AEHA 2KXJA 1IPGA 2IO3B 3RYTA 3DBRI 5J2RA 2MP2B 3KYCD 4DDID 2KTFA 1KJTA 3HM3A 1YX6B 3N30A 4LJPB 3DDCB 4NY0A 2WYQA 2LGXA 4DBGA 4WJPA 3DBHI 4EZJA 1GG3A 1V6EA 2NBWB 2WX1A 3DVGX 5D94A 2LRUA 3PT2B 3SDLC 4WWOA 4FJZA 1WE6A 3JW0X 1E90A 5E6OA 4PS3A 2ASQA 3NOBA 3B08A 4X57B 3SHQA 4MELA 4W9EA 1L2NA 2KFJA 1VCBA 4GDLB 2DYMA 2IYDB 3TJPA 2L00B 2PE9A 3OAWA 4ICVA 3UGBB 4FBJB 4DXAB 3Q3FA 4A3OA 4KV2A 2BWFA 2D07B 3UIOB 4JGHB 5KHOA 3NS8A 3ZLZA 2BPSA 5GMVA 1UD7A 3UQAA 1ZGUB 3PZDA 3DVGY 1UH6A 3IFWB 2LJ5A 2N9EB 2OOBB 5C1ZA 1RRBA 2C7HA 2LGDA 4K7UA 1WE7A 2K6QA 3UQBA 2LUEA 1TZ1A 3TIXA 3V6EB 1UBQA 5LXIB 1TBEA 3WAOA 1V49A 4HVBA 2JRIB 2N1VA 5G55A 3W1SC 2KTRB 1WJUA 1X1MA 4MSQB 2REXA 2DENB 2BYEA 3LDZE 3SU8X 4KDLB 3ZO5B 5AZGA 3TL5A 1WXMA 5AZFA 1WXAA 3DPDA 3VUXA 4AUQC 4EUTA 3VTUA 2MWSB 4KIKA 3I3TB 3H7PA 3L54A 3OJ4B 4DHZB 4FLHA 2IY1B 3H1UA 4XX5A 3GOEA 5DPTA 2I1KA 5IAAC 4HPMB 1NBFC 3R7RA 3QARA 1WGYA 1R4NI 4B6WA 2O6VB 1P9DU 2A5UA 3UF8A 4FADA 2DZMA 4F7ZA 3V60A 4JQWC 4IG7B 2ZPNA 1E8XA 2CHWA 2FCMA 2L3ZA 2C60A 4MJSB 3JYUA 5CHWA 1GC7A 4BBNF 1Y8RC 4EFOA 2JZZA 2MLBA 4I6PA 1E7VA 4LJOB 2KQSA 5LLIA 3RT3B 2JF5A 2NBVB 3PRMB 3QIJA 4WJQA 3RZFA 2JXXA 1FXTB 1P1AA 4PYZA 2B3AA 4EEWA 1WX7A 3P2BA 2GBRA 3EFUA 5CTRC 4AP4C 1RLFA 1WRDB 3N32A 4NAWA 2L8JA 2KN5A 2WDTB 2KKCA 4K7SA 4BKSA 3QK0A 4W9JA 1C3TA 1V9JA 3EHVA 1IP9A 2KWVB 1V5OA 1YJ1A 2PE6B 5D6JB 3TMPB 5DPWA 2JVCA 3WA0A 2MP2A 4RMAA 4CYEA 3ENEA 4MH0E 3VQIA 1NI2A 1Z2MA 4KZ0A 3T8MA 4DWFA 2ZNVB 4GDKB 1L7YA 2KMAA 4BKTA 2BKFA 2BYVE 2JZ3B 3LJ3A 2KWCA 2NPTB 3CF6E 3JSVB 2BKRB 2FIDA 1T0YA 1GJZA 5BO4B 4BOZB 1IYFA 4GMVA 2CHXA 1LQBA 3QAQA 2LGYA 5E6PA 3ZNID 3H9DA 2ZCBA 5L95C 2XBBC 2GOWA 4GDLA 1WGDA 2GMIC 2FCQA 3ZTDA 4DHJD 4GOCA 2K1FA 5LXHA 4HDOA 3H7SA 2RGFA 4G0NB 2MCNB 4G50A 3ZNZB 2V4LA 3A4SC 1R4MI 5EDSA 2JWZA 3A33B 2LASA 3M63B 3PGEA 3QX1A 2ZPYA 4W9DA 5J17A 2KFKB 1XT9B 3AU5A 4XC2A 3ZDTA 2JT4B 1E8YA 3DBLI 4NNJB 1H4RA 3VTVA 3R66C 2O2VB 1JRUA 2G4DB 3IBEA 2LI5A 3PREA 1WX8A 3WANA 2GBKA 3BINA 1WI0A 3VH4B 2NBUA 2EMSA 2ZCCA 3A9KB 1WM3A 5CHVC 1Q5WB 4ZYNA 2BYFA 4P7IA 3ZIMA 3H6NA 2NCNA 2V3SA 3CSFA 5KHQA 4ANWA 3ZNHB 2D10A 2KNBA 3MJWA 2FUHB 1WGGA 3JVZX 4IWQA 3U8ZA 2KTRA 3ZW3A 2AWTA 3BY4B 4NJ6A 3VXWA 3APFA 2A4ZA 3PHWB 4GN1A 2LVPA 1UGMA 2KJ6A 3AULA 3RD2A 2W9NA 3IHPC 4OVVA 2KMCA 1KM7A 2IO1B 2LXAA 2ZZPB 4A3PA 3L17A 1RAXA 1WYWB 2D3GA 4EOYA 1WFYA 1WGHA 4TV3A 3A9JB 4W9LA 3KVFB 3VTWA 3PRPB 2RR9A 2BGFA 3V61A 4DK5A 2LVQA 2O6VA 4II2B 3UINB 1BT0A 3ZRFA 2J0KA 2KD0A 2NS5A 2C7NB 3KUCB 2N7DA 4IM0A 3HK0A 2XEWA 4E74A 2Z59B 4MJSA 4NPNA 1EUVB 2CKHB 2K8HA 2R2OA 3VH3B 3QCAA 3WIMA 2M8SA 2UWQA 4EZKA 1P98A 2MX2A 4BFRA 4ZRJA 2MSED 4W9KA 4PYUA 4IWPA 1WMHB 1P0RA 2AL3A 2LWPA 1S1QB 1V86A 1V2YA 3VUYA 1UELA 1WF9A 4G3XB 2LD9A 4N9F4 3EC8A 4NQKE 4ZRIA 3U30A 4AJWA 3KUZA 4W9FA 5CHFA 3B0AA 4HLEA 1KLVA 1WZ0A 3A1QB 4W9CA 3T9LA 3VAWA 2D2QA 2Z0EB 4IWOA 1F9JA 2M4NA 3L10B 4AOFA 3NY5A 1LM8B 2CR5A 4TKNA 2OJRA 2CHZA 4GDKA 2ZJDA 1UZXB 1ZKHA 3NZSA 2EMTA 5D2MB 1QZEA 2NPTA 1GNUA 3B1LX 2MW5A 2KLCA 3JSVA 4LDTD 2KC2A 2G3QB 1J0GA 2XK5B 4IM3A 4K81A 2N1WA 2K6DB 4EKUA 4MM3A 2DZKA 3X23A 4J6IA 2K8BA 3L08A 4EZLA 2M0XA 3L0WB 2G4SA 2L76A 4MSMB 3VDZA 2DAJA 2MBOA 1CMXB 2NR2A 1YQBA 3GZNI 4GB9A 1UBIA 3W1SA 1LXDA 3IVFA 4AWJA 1WR6E 4HK2A 4KVGB 3MHSD 2KFKA 2MBBB 3KYDD
chains in the Genus database with same CATH superfamily
1BMLC 3HHMA 4DDGD 2AX5A 2DWQA 1STEA 2V3PA 2LXCA 4KSLC 1SJHD 1TY2A 4RM9A 1WH3A 1I7HA 2DAFA 4W9HA 3EGRA 5H8YE 3A9KA 1R4NB 3W5VB 4B95A 2FAZA 1RFKA 3Q8AA 1HA2A 2L1AA 1IGCA 4CQNA 3TEYA 1MIYA 4ZBKA 1D5XC 3AE3B 3ECIA 4HEA1 3AE7B 4JL9A 4BOSC 4YTNB 1DGJA 3IXSA 4MGZE 3ONSA 4XDDA 3N3KB 1QOAA 1EF1A 2HJ1A 3IT6B 3ZRCA 1N6ZA 2KO3A 2G45B 2JUOA 2QEJC 2L0FA 2BYTA 2AYOB 2YLMA 1XQQA 4A20A 4E71A 1WZ3A 1GNJA 2WP9B 3L16A 4G11A 2YVCA 3X0WA 3R7QA 1TY0A 1OGWA 1Q1OA 4HJKA 4ANXA 1WGKA 2MA9B 3P1MA 1I4HA 1NI3A 1LOTA 4CO7A 4FJVB 5E6JA 2BXFA 4MGIE 1B1ZA 2R2QA 2MRPA 3V03A 1QILA 1XO3A 1BUIC 2ZVNA 1J78A 2KLGA 2XMOA 2SEBD 1TKEA 1EU3A 2I1JA 2V1YA 5G2NA 1WXVA 2W3RA 4K3CA 4RGTA 2RPVA 3K9OB 3PV1A 3RUIB 1VJKA 2ZNVC 1WGRA 3KUDB 2L32A 3ML8A 4KSKC 1YJIA 1MPEA 1O9XA 1GB4A 4HPLB 4XZ4A 4IM2A 5EE1A 3EECA 4OTTA 2ROHA 1S3SG 1SIFA 4B9KA 2QSDA 1E7GA 2FE8A 1ZW7A 2FIFA 3OG5A 4WJOA 3PLVA 2BWES 5J18A 3VR8B 2JX5A 1NYQA 3WHSA 2V36A 1OQYA 4W9IA 3ZXRA 4YWGG 1PQSA 1GAQB 1ZUD2 3RN9C 4IW2A 3Q3OC 1FNWA 3GP7A 2N7JA 2WHIA 3BVMA 1TKGA 2BXBA 1VFIA 4OVUA 3DCGA 3P4QB 4HWIB 2WX0A 4HXDA 2GBJA 3ALBA 1LO5D 1WJ4A 3APDA 1BXTA 3W1YA 4GDXA 5JHBA 4IC7B 3FKYA 3H7PB 4M8NA 1R7SA 4RCOA 1KOTA 2WGSA 4PS8A 1N63A 3NZUA 3ZDMC 1K51A 3AM9A 4DHZE 2KVRA 2N9PC 2UU7A 2LZ6A 3QHTA 3NVWA 2WXNA 4FJYA 5TR5A 3SR6A 2BXKA 4BBNC 4E3CA 1D4BA 2EFHA 2ZEQA 1WYGA 1SJED 1NVID 2D11A 3PLUA 3SFDB 1PGXA 3TSSA 2N9LA 3GZNB 1GB1A 4RGOS 4WIPA 3C0RB 2KDIA 1YOVB 3LXFA 3FILB 2KJHB 2XVQA 1E7FA 4URKA 2JUHA 3DBRI 4FXCA 4US8A 3HM3A 1YX6B 1IUEA 1ZOYB 4LJPB 1OFFA 2LGXA 4DBGA 2ACZB 2K22A 4M01A 2BXGA 1GG3A 2NBWB 3PT2B 3SDLC 3RMKC 5BMHA 4IDIA 3CX9A 4X57B 3B08A 4MELA 3AMZA 4OZBA 1L2NA 1MHXA 2IYDB 4L23A 4ICVA 3UGBB 4B0EA 4DXAB 4R3DA 2BWFA 2PMVA 3TEZA 2PIAA 2WNMA 3LYYA 3ZLZA 2BPSA 1UD7A 3UQAA 2XW1A 2JYEA 1KTKA 5BYSA 3RNCC 5DBYA 1FOUA 1RRBA 2C7HA 4HPPA 3RNFC 2VUEA 4N58A 1PFDA 5LXIB 2JRIB 3W1SC 1VZ7A 2DENB 2REXA 3LDZE 4ZOHC 3ZO5B 1WXAA 3VTUA 2H88B 3H7PA 3L54A 2IY1B 5DPTA 3QARA 1WGYA 4B6WA 5C2TB 3BVZA 2CU3A 4LB2A 4FADA 3NVKA 4F7ZA 1ZP0B 1PYWD 2E3TA 2C60A 1K50A 5CHWA 1GC7A 1I4RA 2KAJA 5D3IB 1UWXA 4I6PA 1E7VA 3QIJA 2NBVB 4HRSA 2BB5A 3RZFA 1FXTB 4EEWA 5CTRC 2OJWA 4AP4C 2EELA 1VZ8A 2K0PA 2L8JA 4K7SA 4OZAA 3FILA 1FO4A 1V9JA 3EHVA 1YJ1A 2PE6B 3TMPB 1SE4A 2JVCA 1YMHE 3WA0A 4RMAA 4CYEA 4MH0E 3LU8A 3VQIA 1F0ZA 4PK1A 3T8MA 1TS4A 4GDKB 2KMAA 2DBXA 3FAHA 2NQOA 2JZ3B 2KWCA 3N20C 3U52E 3CF6E 4ZHPA 5IP4D 1GJZA 5BO4B 1JCKB 4BOZB 1VRAB 1P7FA 4GG2A 5IJFA 2XBBC 1E7CA 3KIKA 2L52A 4G50A 2KQ4X 2E0YA 1J7EA 1R4MI 1EU4A 2JQRB 4W9DA 3CIRB 3AU5A 1K52A 5ID7A 3NS1A 4NNJB 5IFOA 3MC9A 1QKZA 3U7ZA 2G4DB 1T6BX 2BXHA 3AEAB 5H92C 2DNFA 1WWTA 3BINA 2PVGC 2ZCCA 1IGDA 2WS3B 1Q5WB 2W54A 3BYYB 1ET9A 4P7IA 3H8HA 3H6NA 2NCNA 2V3SA 5KHQA 1L5PA 4ANWA 3ZNHB 2D10A 2FUHB 1WGGA 3VXWA 4NJ6A 1HK1A 2KJ6A 2LVPA 3RD2A 2W9NA 2BXPA 4OVVA 2D3BA 2KMCA 4K2CA 1WYWB 2D3GA 2N9KA 4TV3A 5IOIA 3KVFB 4XE0A 3PRPB 4HGMB 3O13A 4C56C 1BT0A 4C80A 2C7NB 2Z8KA 2IDYA 3AB5A 1EUVB 2CKHB 2K8HA 4KGTA 3VH3B 1WRIA 4RGNA 1P98A 2EKIA 1V97A 1WMHB 1HQRD 2AL3A 2LWPA 2YEPF 3ECPA 2LD9A 3EC8A 1HTQA 4S0RA 1KLVA 1WZ0A 1YN4A 2M19A 4PO0A 3VAWA 3ICXA 1L6UA 2Z0EB 4IWOA 2IJ0A 3L10B 1AYFA 3NY5A 1FXAA 4TKNA 4L9QA 1C4CA 4GDKA 4XYCA 2Z8LA 4G01A 1XLNA 2EMTA 1E7BA 5D2MB 5JXVA 2MW5A 2BQQA 2KC2A 4NJCA 1J0GA 4IM3A 2N1WA 3J9CA 4OT2A 3AE5B 2G4SA 4ITKA 1UBIA 4B0MA 3UIVA 3I9V1 3O65B 2KX3A 2KZRA 2EKEC 4PS7A 2CKXA 3ZUNA 3LU7A 1E5WA 2MEKA 4FHKA 2GBNA 3OLMD 3AEBB 1SGHA 1WM2A 4MBEC 4LUFA 4CHKA 1XXGA 3R2IA 3HIZA 1E78A 4OR0A 3JRYA 4RGMA 4ZRPA 2DZJA 1Q0WB 1HTOA 1KW2A 3CSTA 1JROA 2RDBC 4N0FD 2BB6A 1E0ZA 1JW9D 3ZYYX 2BVCA 2AL6A 1PGAA 1QLBB 5E6NA 1VD2A 1E7UA 2JY6A 4O1NA 1H8CA 1FFVA 1J8CA 3AEEB 1WMHA 2IGGA 3OJ3A 1WJ6A 4C00A 1OEYA 4NZLB 1E7IA 4MGYE 4GSWA 1OQRA 2AGHB 4K1RB 1OTRB 3N9YC 3CMMB 2KYWA 3RI7C 1I35A 2DZIA 3E56A 2C7MB 1ZE3D 4Z69A 2GRIA 2JRHA 3WAPA 1NDDA 3ZVVA 1CQVA 1J7AA 2E0XA 3AXCA 4YT0B 3R3MA 4TMAB 3H37A 4LNFA 4LA0A 5DCNA 1TKYA 4C31B 3RNGC 3DBHB 1J19A 2GI9A 4HROA 1TGZB 3U2SC 2BT6A 2BS4B 4HCPB 1TTNA 4F5SA 5GXGB 2L7RA 3MJ5A 5JHAA 2I38A 4ZUXV 3B9MA 1V1OA 2BXNA 2AQ1B 3DWGC 2Y3AA 4LK0M 5HKHA 1UWMA 2Y5CA 3QC8B 1ZXIA 4ARIA 5C3JB 2LQHA 4RNAA 2KJRA 1TS5A 4RF0A 5D7GA 1L0YB 1L4ZB 1AN8A 1MJDA 1EO6A 2OEDA 2C9WB 1WIAA 2PVOD 2WXQA 2QIEB 5T8IA 1TJEA 3AE1B 2RD0A 1ISNA 1CJEA 1PUTA 3DVNU 4MGKE 4F5TA 1AW7A 4K7WA 3S2AA 4ZDVA 3NVMA 4KX6B 1AARA 1E8WA 2Z0DB 3K9PB 3MP9A 2D5GA 2ON8A 3P63A 1HXYD 2CU1A 3AU4A 3M95A 1YD8U 2LRWA 4KGSA 2K8CA 2MBEA 4LNIA 1I42A 4RF1A 2V9HA 3QA8A 1MHHE 1P3QU 5IA7A 2PTLA 1FNVA 3SD5A 2FCSA 3AE2B 1H9ZA 3VUWA 3NVZA 2K5PA 1E8ZA 1JWMD 3ZTCA 1I4XA 3PS6A 2C5LC 1D3ZA 4F5VA 2J0JA 3WAMA 1UORA 3DVNV 4NJ7A 1SB0A 3RYTA 3FNMA 3BIID 3KYCD 3RNBC 4KGRA 2I30A 4W4UB 4EZJA 1V6EA 3FWCC 2WX1A 3DVGX 1KFYB 3DWMA 3JW0X 1E90A 1E6EB 2ASQA 5FR3A 2KFJA 3DHHC 1VCBA 3C8YA 4GDLB 2DYMA 2BW2A 2L00B 5EE3A 4FBJB 3DBLB 4KV2A 4DQOC 3IAM1 3FC4A 3Q14C 4YTPB 3DVGY 3IFWB 2ICIA 4Q2JA 2WDQB 2JYTA 2N9EB 2OOBB 5BMGA 4K7UA 1V8CA 2K6QA 3UQBA 1TZ1A 1C79A 3TIXA 1OQQA 4P1BC 1ZDVA 2KTRB 2QDFA 4YSZB 1RWSA 3E9SA 4KDLB 4LB9A 3EA6A 1WXMA 1C4AA 4EUTA 2V4IB 2R61A 2XNAC 3GE8C 3I3TB 4LNOA 3OJ4B 3BVGA 4XX5A 1NBFC 4I9OA 1WXQA 3SIVB 3IAS1 3ZJUA 1V1PB 2LXTA 1P9DU 2DZMA 4JQWC 1JALA 2FCMA 1TT5B 3JYUA 3AECB 3W5UB 2HDEA 2JZZA 4WURA 4LJOB 2KQSA 3RT3B 2JF5A 3L4PA 2JXXA 1WX7A 3P2BA 3EFUA 1RLFA 1WRDB 3N32A 4WAFA 1FPYA 1Y56A 2VH1A 2RDGA 3NRZA 2J52A 3AEDB 3C19A 5EE9A 2QHBA 4M02A 2X38A 3V3XA 4GLSC 2Z8JA 1Z2MA 4N59A 2E6XA 4EMXA 4DWFA 1H5WA 2BYVE 1HK4A 2NPTB 2NTSA 2BKRB 4ACFA 3BWUD 3ZNID 1BM0A 4MM3B 3H9DA 4ZCGA 2FUG1 2GOWA 4GDLA 1WGDA 3ZTDA 4GOCA 5LXHA 2RGFA 4G0NB 3VRAB 3ZNZB 3RFZB 3Q8FA 1JNBA 2JWZA 3M63B 2LASA 3MHZA 1SBBB 2KFKB 2JT4B 2O2VB 2BS2B 3SQJA 1SE2A 1E7PB 3IBEA 1WX8A 1F52A 3GQUA 2GBKA 3RNAC 2NBUA 2BTEA 1MFWA 2RMMA 4DM0A 1ZDXA 2KTRA 2BS3B 3KWLA 4L9KA 1MIWA 3APFA 1T0SC 1FCLA 1FNUA 5BYRA 3SFEB 3AEGB 2LEKA 2LXSA 1KM7A 4C7YA 4AS1A 1T0QC 2LXAA 1NYRA 2ZZPB 2EFEA 3GQXA 3VTWA 5HFYA 2RR9A 1V1PA 2CJNA 4II2B 3ZRFA 2LUMA 2J0KA 2W55A 2N7DA 4IM0A 3UI3A 1ESFA 4NPNA 4OTUA 3JQZA 1SIJA 4EZKA 3CWIA 4C4VB 4IWPA 5IJ5A 1P0RA 1S1QB 1V86A 1V2YA 2SAKA 2BXAA 1WF9A 2H89B 4NQKE 4ARCA 1VZSA 4W9FA 5GIPA 4HLEA 3A1QB 3T9LA 2BXQA 2M4NA 1XCQL 1LM8B 2OJRA 3AE4B 4JWUC 1MUHA 2BXDA 2RDHA 3I63C 3NZSA 2NPTA 1GNUA 4BY9C 1N62A 1XF5L 4LDTD 1NT2B 4K71A 4K81A 4AQ7A 4EE2A 2XVWA 4MM3A 2M56B 1YJJA 3TDLA 2I2YA 1D5MC 2K8BA 1FXIA 2LFIA 2MBOA 3PZ7A 1CMXB 4GB9A 3W1SA 3IVFA 1WR6E 4HK2A 4KVGB 3MHSD 2KFKA 1BKEA 2MBBB 2LHEA 3N1YC 2O2VA 4GXBA 3B9JA 4FN2A 2WXKA 4PT5A 5BMIA 5DQFA 4N6EB 5BPKA 4BKGA 4S1YA 3RPFC 1A5RA 2KC1A 2LVOA 1U4AA 3QWZB 3MC8A 2KQ7A 2LGIA 1QF6A 4LNNA 4HCNB 4M0WB 4F8CB 1WY8A 2WWZA 2XVVA 4FK5B 4BKEA 4HGKA 3A75A 4HKZE 1PDXA 2L83A 1FCCC 4GGQA 2N4FA 1SSNA 1HEZE 3A4RA 2PKOA 1T3QA 5AEKB 2INDC 3Q3JA 4BKSD 3DQVA 4DXFA 5JZEB 4L1BA 1KLGD 3N1XC 3KH0A 4FA6A 4C4VA 3V6CB 2KANA 4LLGM 3QJZA 5DPSA 2K3UA 1QQRA 3PRZA 1C76A 4MDKE 5IO9A 1SEBD 4OHJA 2KX0A 2Y5BB 4DHXB 2JPHA 2M17A 3VVWB 5JH5C 5IN7A 3KW5B 4REZA 2WXJA 2D3AA 3EUB2 3ABVB 3A1QA 1N5XA 4MACA 1HE8A 4F1SA 2IBIB 2XW0A 5TSSA 4ASWC 1R4MB 4JLCA 1EWYC 1YN5A 1V80A 1WR1A 3DOWA 1YNTE 2LQIA 1L4DB 3L13A 4ZHOA 2VRRB 3APCA 2KDFB 3P4SB 1E7AA 5HOZA 4FHJA 5L83A 1SXTA 4YSYB 2QILA 3I57A 3UIPB 3NVYA 3M62B 1XD3B 5IIXA 2MBHA 5IKCM 1OEYJ 2QCZA 3ZKJC 4L8UA 4ANVA 4LDTB 4GIVA 4S17A 2IY0B 3VFKA 1L0VB 4UDUC 5IJEA 2IO0B 2XVUA 2JZPA 4GU2A 3MTNB 2WXLA 2J0MA 2O6VD 1UGJA 3I5JC 4MT5A 5DPRA 4M0WA 3PTFC 2CS4A 3PLAA 2BX8A 2RPQA 3NUHB 3MHSB 1KRHA 2IPKD 2KOXA 4XDCA 1C78A 2QHOA 3RCZA 3RULA 3WALA 1V5TA 3Q69A 1IBXB 2PJHA 3B2FA 3IG3A 3MHHB 2L05A 1CZPA 4KIKB 3B2GA 3GS2A 4AJYB 1VDVA 1WX9A 2RSUA 3PSEB 4FULA 4TQ1A 2KVZA 4K3BA 1FM0D 1MUSA 3GA9L 1UF0A 1GNIA 2HJ8A 2FCNA 2PEAA 1NENB 2GB1A 1MG8A 3BK1A 3TBLD 4TSSA 2NTTA 2LGSA 2JSVX 2KACA 2Q5WD 3P4PB 4NAWB 3ZJTA 2KDEB 3EFCA 3DHIC 2L0TA 3M99C 4WQOB 4KDIC 1IPGA 2IO3B 2INCC 1HK2A 1FFUA 5J2RA 2MP2B 3KJLA 1N60A 2KTFA 1KJTA 4RFBA 2WLBA 2PW9A 1RYJA 3N30A 5EE0A 4NY0A 2WYQA 4WJPA 3DBHI 2WXRA 4G03A 2LRUA 1C4PA 4WWOA 4FJZA 1E10A 4JWSC 3LB8C 4P1CC 4PS3A 3SHQA 4W9EA 2KWDA 2MHJA 3H3AA 4A3OA 5KHOA 3NS8A 3V08A 3R8BA 2WXOA 3PZDA 1GPXA 3MC0B 1ET6A 1LGRA 2WQYB 5IIUA 2BXEA 1FRDA 1WE7A 1DOYA 2LUEA 3AV8A 1B9RA 3V6EB 3WAOA 2ONQA 1WJUA 1IBXA 1X1MA 1YQ4B 1MM8A 3SU8X 4D2KA 2AQ3B 5AZGA 4OZCA 3VUXA 4AUQC 1ZXHA 4KIKA 4WWMA 4XWWA 1QOGA 3GOEA 4HPMB 2WXHA 4WQMA 3HUIA 2QMTA 1R4NI 1LNSA 1D5ZC 2O6VB 3UF8A 1VR9A 1JMLA 2ZPNA 1E8XA 2L3ZA 2WU2B 1Y8RC 2M0AA 3N1ZC 5LLIA 3T3NA 4WJQA 4HKQA 4PYZA 1BJ5A 4YTMB 1E9MA 5B5TA 2GBRA 3VR9B 4NAWA 5MPOA 1TS2A 4BKSA 2V0GA 1C3TA 1IP9A 2KWVB 1V5OA 3SIUB 1N61A 2WDVB 3Q3NC 2MP2A 1TS3A 4KZ0A 1HK3A 2JXTA 2KWFA 2ZNVB 3Q6BA 1VLBA 4LTUA 3LJ3A 1XLQA 4J2VA 4M70B 3JSVB 1RM6C 2FIDA 1JWBD 2EFCA 1JRPA 1IYFA 4GMVA 5E6PA 5L95C 2LGYA 2ZCBA 1TIFA 4DHJD 3NG0A 2MCNB 3AH7A 2V4LA 4MH8A 5EDSA 3QX1A 3PGEA 2MH7A 2ZPYA 1XT9B 2JU6X 4XC2A 5FUOA 3HVZA 1E8YA 3DBLI 1H4RA 2W3SA 3VTVA 3ZQ4A 2QM6A 1F2RI 1C77A 1JRUA 2J53A 3PREA 3WANA 1WI0A 3VH4B 5CHVC 3TUOA 1WM3A 3ZIMA 3W9CB 3CSFA 3GE3C 4HJGE 1CK1A 3U8ZA 1JWSD 3ZW3A 1Q10A 2AWTA 1FD6A 2IO1B 4N0UD 3URYA 2LMCA 4A3PA 2K9XA 3L17A 4EOYA 2WXFA 4A8XC 1WGHA 3WCQA 3A9JB 2LHDA 5AUKA 1DYQA 2YEPB 1DOXA 4DK5A 2O6VA 3ZXVA 5GINA 1ROEA 2AJEA 4E74A 1KF6B 3WIMA 2M8SA 2MX2A 4BFRA 2MSED 1ACCA 5I4DA 4KKIA 1UELA 2DBUA 4G3XB 4ZRIA 1JQ4A 3U30A 5CHFA 4W9CA 3R2TA 1F1HA 3AE6B 2WXGA 2ZW1A 3NVIA 2CHZA 2ZJDA 1UZXB 5FKAC 1KH0A 1QZEA 3B1LX 2KLCA 1MIVA 4N3ZA 3JSVA 4USAA 1JWAD 2XK5B 1I4QA 2K6DB 1UNSA 4EKUA 2KN4A 3X23A 3W2DA 1SE3A 4J6IA 1IJGA 3L08A 4EZLA 3L0WB 3VDZA 2KBZA 2NR2A 1YQBA 3GZNI 5FK9C 4AWJA 1LXDA 4YXDB 1XLOA 4IOIE 1C1YB 2HD5B 1RFAA 1F2RC 1K8RB 3DBSA 3U7DA 1ZPSA 1YIWA 2V3NA 2J42A 5D3DA 3VHTC 3PPAA 5AUIA 2KK8A 3ZNGC 2WDRB 3NHEB 1V81A 3RZWC 2EFDA 2NVUI 2K39A 2J4XA 2PLPA 4W9GA 4DHJB 4IUMB 1MG4A 5HI1A 3AN1A 2DYBA 1XCTL 1Z5SB 3A9JA 4M8MA 3T3OA 4KZCA 3M3JA 4ZBRA 4JIOU 1SF0A 3AI5A 1T0RC 2PPHA 2B76B 2BF8B 1G6JA 4I6NB 2MQJA 3Q2AC 1L0XB 4LNKA 1GC6A 2KWUB 4WWNA 4M00A 3AE9B 4A6QA 4WWPA 2G9HD 1SE9A 2ZW0A 2BXIA 2WXIA 2UYZB 4ZYSA 2QC8A 1WJNA 4FJCB 4I6LB 2KHWB 2Y5PA 2N7EA 3KWVA 1JWUD 3V62A 2IO2B 1QOBA 1EF5A 4WJNA 4YL8A 1HK5A 2DX5B 3DBRB 5ID9A 2KMMA 3Q8BA 1M4VA 1AWDA 4ZC6A 3MFGA 2OT3A 2J7QB 2N9XA 3HVDA 2XK5A 2D3CA 4US9A 4ZRKA 3WHQA 4C7ZA 1N5UA 5GHKA 4JPSA 4HDQA 3P42A 2MJ3A 2VH2A 3ML9A 2BXCA 1HA5A 4ZRQA 5AZHA 3PHXB 2AQ2B 2QJLA 4ICUA 2GBMA 3PVLA 1GUAB 4P6VF 2DHZA 2BXLA 2KDBA 3Q3MC 2WU5B 4BVUC 4G04A 4TQ0A 3TCAA 4QAYA 5G5HA 4RM8A 2X8XX 4H2AA 2LOQA 1YX5B 3G9KD 4D7XA 4TUUA 3PZ8A 4LCDE 4ANUA 2MBQA 2ZVOA 1T5XD 4IW0A 2DYOA 2M1MA 2HE7A 4BZAA 1VZ6A 1AO6A 2BXMA 1WXSA 2IZVB 4J3OD 3QQ8B 3FWBC 1YN3A 2OHFA 3AE8B 1MVKA 2FNJB 1M94A 2K25A 1LFDA 4BAXA 2XSIA 5C23A 5FR6A 3ZJVA 3AEFB 5LNK1 4WAAA 4MEMA 2HTME 2HTHA 2VUFA 4NQLB 4WH4A 3NZ3A 3NVVA 3D32A 4FIPB 3HM6X 1NEKB 1XEEA 1KXPD 3ETRA 1C9FA 5CX3A 4II3B 2AEHA 2KXJA 5G5GA 1FEHA 3OWEB 4KKJA 3A73A 1KLUD 4DDID 3Q8CA 2TSSA 1KDXA 3DDCB 1ENFA 1K53A 2VZKD 1HZ5A 3IT4B 5D94A 4L2YA 4OW0A 4WA6B 1WE6A 5E6OA 3NOBA 3TJPA 3OAWA 2PE9A 5BYQA 3Q3FA 2D07B 2WXMA 3UIOB 4JGHB 1P7EA 5GMVA 1E7HA 1N5WA 1ZGUB 1UH6A 2LJ5A 2KT7A 5C1ZA 2LGDA 4XGAB 2FBWB 1UBQA 1TBEA 4HVBA 1V49A 2N1VA 5G55A 4MSQB 2GUTA 2BYEA 4JK4A 1A70A 3TL5A 1WSPA 5AZFA 2JWUA 3DPDA 3TEWA 1DOIA 2KDMA 2MWSB 4JE3B 2WXPA 4DHZB 4FLHA 3H1UA 2I1KA 5IAAC 3R7RA 2K0NA 3BYTB 2A5UA 1TYGB 3V60A 4IG7B 2NMQA 2CHWA 2MJEA 4MJSB 2DBYA 5HHDG 4BBNF 2XN9C 4EFOA 2MLBA 1TXUA 1L6VA 3PRMB 3HRDD 1P1AA 2IGDA 2B3AA 3KLSX 1PGBA 2MJDA 3B9LA 2KN5A 2WDTB 2GLSA 2KKCA 3QK0A 4W9JA 1TZOA 1UUPA 1EWCA 2DLBA 5D6JB 5DPWA 1MA9A 3ENEA 1NI2A 2I2ZA 3BPJA 1L7YA 4BKTA 2BKFA 2G1EA 2OZBB 1I4GA 1T0YA 2CHXA 1LQBA 3KQ4A 3QAQA 4IKGA 4RH6A 2GMIC 2FCQA 2K1FA 4HDOA 2BBCA 3H7SA 3WHRA 3A4SC 3A33B 3NMUA 5J17A 1QOFA 4ZBQA 3ZDTA 3R66C 2W82A 3U4EG 2VZKB 3VRBB 1SB3C 2LI5A 1F77A 1YQ3B 2EMSA 1FRRA 2N0SB 3A9KB 4ZYNA 3TEXA 2BYFA 4P16A 3PO0A 5GIOA 3DHGC 4IWQA 2KNBA 3MJWA 3JVZX 3BY4B 4YSXB 2CJOA 3ZGZA 2A4ZA 3PHWB 1GOZA 4GN1A 1UGMA 3AULA 1XLPA 3IHPC 4DXGA 1E7EA 1QT9A 4IW1A 4E99A 3V05A 1RAXA 1WFYA 4W9LA 3GB1A 4OVZA 2BGFA 3V61A 2LVQA 2VDBA 3NJTA 3UINB 3SEBA 2KD0A 1FMAD 2NS5A 3KUCB 1I4PA 3HK0A 2XEWA 2Z59B 2YDFA 2INNE 4MJSA 5IIHA 2Z8IA 2R2OA 3QCAA 2DG5A 2UWQA 4F5UA 4ZRJA 4W9KA 4PYUA 3Q8EA 3VUYA 4N9F4 4AJWA 3KUZA 5HG2A 4JX1C 1J7CA 2QMCA 3B0AA 4A90A 1EM7A 3BZDB 3RNEC 2D2QA 1F9JA 4AOFA 1FIQA 2CR5A 1MI0A 1ZKHA 4A9AA 1J7BA 4Z9OA 4NAMA 2LJIA 1TF0A 2G3QB 4A55A 4XWTA 2NNWA 3LU6A 2DZKA 2INPE 2DBWA 2M0XA 2BXOA 2L76A 4MSMB 2DAJA 3P4RB 1HZ6A 2IGHA 3V09A 1D6EC 4LUHA 3BK2A 3KYDD
chains in the Genus database with same CATH topology
4DDGD 3HHMA 1BMLC 2AX5A 2DWQA 1STEA 4KSLC 2LXCA 2V3PA 1SJHD 1TY2A 4RM9A 1WH3A 2DAFA 1I7HA 4W9HA 3EGRA 5H8YE 3A9KA 3W5VB 4B95A 2FAZA 1RFKA 3Q8AA 1HA2A 2L1AA 1IGCA 4CQNA 3TEYA 1MIYA 4ZBKA 3ECIA 1D5XC 3AE3B 4HEA1 3AE7B 4JL9A 4BOSC 4YTNB 1DGJA 3IXSA 4MGZE 3ONSA 4XDDA 3N3KB 1QOAA 1EF1A 3ZRCA 3IT6B 2KO3A 2G45B 2JUOA 2QEJC 2L0FA 2BYTA 2AYOB 2YLMA 1XQQA 4A20A 4E71A 1WZ3A 1GNJA 2WP9B 3L16A 4G11A 2YVCA 3X0WA 3R7QA 1TY0A 1OGWA 1Q1OA 4HJKA 4ANXA 1WGKA 2MA9B 3P1MA 1I4HA 1NI3A 1LOTA 4CO7A 4FJVB 5E6JA 2BXFA 4MGIE 1B1ZA 2R2QA 2MRPA 3V03A 1QILA 1XO3A 1BUIC 2ZVNA 1J78A 2KLGA 2XMOA 2SEBD 1TKEA 1EU3A 2I1JA 2V1YA 5G2NA 1WXVA 2W3RA 4RGTA 2RPVA 3K9OB 3PV1A 3RUIB 1VJKA 2ZNVC 1WGRA 3KUDB 2L32A 3ML8A 4KSKC 1YJIA 1MPEA 1O9XA 1GB4A 4HPLB 4XZ4A 4IM2A 5EE1A 3EECA 4OTTA 2ROHA 1S3SG 1SIFA 4B9KA 2QSDA 1E7GA 2FE8A 1ZW7A 2FIFA 4WJOA 3PLVA 2BWES 5J18A 3VR8B 2JX5A 1NYQA 3WHSA 2V36A 1OQYA 4W9IA 4YWGG 1PQSA 1GAQB 1ZUD2 4IW2A 1FNWA 3GP7A 2N7JA 3BVMA 1TKGA 2BXBA 1VFIA 4OVUA 3DCGA 4HWIB 3P4QB 2WX0A 4HXDA 2GBJA 3ALBA 1WJ4A 3APDA 1LO5D 1BXTA 3W1YA 4GDXA 5JHBA 4IC7B 3H7PB 4M8NA 1R7SA 1KOTA 4RCOA 4PS8A 1N63A 3NZUA 3ZDMC 1K51A 4DHZE 3AM9A 2KVRA 2N9PC 2LZ6A 3QHTA 3NVWA 2WXNA 4FJYA 5TR5A 3SR6A 2BXKA 4BBNC 4E3CA 1D4BA 2EFHA 2ZEQA 1WYGA 1SJED 1NVID 2D11A 3PLUA 3SFDB 1PGXA 3TSSA 2N9LA 1GB1A 4RGOS 4WIPA 3C0RB 2KDIA 3LXFA 3FILB 2KJHB 2XVQA 1E7FA 4URKA 2JUHA 3DBRI 4FXCA 4US8A 3HM3A 1YX6B 1IUEA 1ZOYB 4LJPB 1OFFA 2LGXA 4DBGA 2ACZB 2K22A 2BXGA 1GG3A 2NBWB 3PT2B 3SDLC 5BMHA 4IDIA 3CX9A 4X57B 3B08A 4MELA 3AMZA 4OZBA 1L2NA 1MHXA 2IYDB 4L23A 4ICVA 3UGBB 4B0EA 4DXAB 4R3DA 2BWFA 2PMVA 3TEZA 2PIAA 2WNMA 3LYYA 3ZLZA 2BPSA 1UD7A 3UQAA 2XW1A 2JYEA 1KTKA 5BYSA 5DBYA 1FOUA 1RRBA 2C7HA 2VUEA 4N58A 5LXIB 1PFDA 2JRIB 3W1SC 2REXA 2DENB 1VZ7A 3LDZE 4ZOHC 3ZO5B 1WXAA 3VTUA 2H88B 3H7PA 3L54A 2IY1B 5DPTA 3QARA 1WGYA 4B6WA 5C2TB 3BVZA 2CU3A 4LB2A 4FADA 3NVKA 4F7ZA 1ZP0B 1PYWD 2E3TA 2C60A 1K50A 5CHWA 1GC7A 1I4RA 2KAJA 5D3IB 1UWXA 4I6PA 1E7VA 3QIJA 2NBVB 4HRSA 2BB5A 3RZFA 1FXTB 4EEWA 5CTRC 4AP4C 2EELA 1VZ8A 2L8JA 2K0PA 4K7SA 4OZAA 3FILA 1FO4A 1V9JA 3EHVA 1YJ1A 2PE6B 3TMPB 1SE4A 2JVCA 3WA0A 4CYEA 4RMAA 1YMHE 4MH0E 3LU8A 3VQIA 1F0ZA 3T8MA 1TS4A 4GDKB 2KMAA 2DBXA 3FAHA 2NQOA 2JZ3B 2KWCA 3U52E 3CF6E 4ZHPA 1GJZA 5BO4B 4BOZB 1JCKB 1VRAB 1P7FA 4GG2A 5IJFA 2XBBC 1E7CA 3KIKA 2L52A 4G50A 2KQ4X 2E0YA 1J7EA 1R4MI 1EU4A 2JQRB 4W9DA 3CIRB 3AU5A 1K52A 5ID7A 4NNJB 3NS1A 5IFOA 1QKZA 3U7ZA 2G4DB 1T6BX 2BXHA 3AEAB 5H92C 1WWTA 3BINA 2ZCCA 2PVGC 1IGDA 2WS3B 1Q5WB 2W54A 3BYYB 1ET9A 4P7IA 3H8HA 3H6NA 2NCNA 2V3SA 5KHQA 1L5PA 4ANWA 3ZNHB 2D10A 2FUHB 1WGGA 3VXWA 4NJ6A 1HK1A 2KJ6A 2LVPA 3RD2A 2W9NA 2BXPA 4OVVA 2KMCA 4K2CA 1WYWB 2D3GA 2N9KA 4TV3A 3KVFB 4XE0A 3PRPB 4HGMB 3O13A 4C56C 1BT0A 4C80A 2C7NB 2Z8KA 2IDYA 3AB5A 1EUVB 2CKHB 2K8HA 3VH3B 4KGTA 1WRIA 4RGNA 1P98A 2EKIA 1V97A 1WMHB 1HQRD 2AL3A 2LWPA 2YEPF 2LD9A 3EC8A 1KLVA 1WZ0A 1YN4A 2M19A 4PO0A 3VAWA 3ICXA 2Z0EB 1L6UA 4IWOA 2IJ0A 3L10B 1AYFA 3NY5A 1FXAA 4TKNA 4L9QA 1C4CA 4GDKA 2Z8LA 4G01A 1XLNA 2EMTA 1E7BA 5D2MB 5JXVA 2MW5A 2KC2A 4NJCA 1J0GA 4IM3A 2N1WA 3J9CA 4OT2A 3AE5B 2G4SA 4ITKA 1UBIA 4B0MA 3UIVA 3I9V1 3O65B 2KX3A 2KZRA 2EKEC 4PS7A 2CKXA 3ZUNA 3LU7A 1E5WA 2MEKA 4FHKA 2GBNA 3OLMD 3AEBB 1SGHA 1WM2A 4MBEC 4LUFA 4CHKA 1XXGA 3R2IA 3HIZA 1E78A 4OR0A 3JRYA 4RGMA 4ZRPA 2DZJA 1Q0WB 1KW2A 3CSTA 1JROA 4N0FD 2BB6A 1E0ZA 1JW9D 3ZYYX 2AL6A 1PGAA 1QLBB 5E6NA 1VD2A 1E7UA 2JY6A 4O1NA 1H8CA 1FFVA 1J8CA 3AEEB 1WMHA 2IGGA 3OJ3A 1WJ6A 1OEYA 4NZLB 1E7IA 4MGYE 4GSWA 1OQRA 4K1RB 1OTRB 3N9YC 3CMMB 1I35A 2DZIA 3E56A 2C7MB 1ZE3D 4Z69A 2GRIA 2JRHA 3WAPA 1NDDA 3ZVVA 3AXCA 1CQVA 2E0XA 1J7AA 4YT0B 3R3MA 4TMAB 3H37A 5DCNA 4LA0A 1TKYA 4C31B 1J19A 2GI9A 4HROA 1TGZB 3U2SC 2BT6A 2BS4B 4HCPB 1TTNA 4F5SA 5GXGB 2L7RA 3MJ5A 5JHAA 2I38A 4ZUXV 3B9MA 1V1OA 2BXNA 2AQ1B 3DWGC 2Y3AA 4LK0M 5HKHA 1UWMA 3QC8B 2Y5CA 1ZXIA 4ARIA 5C3JB 4RNAA 2KJRA 1TS5A 4RF0A 5D7GA 1L0YB 1L4ZB 1AN8A 1EO6A 2OEDA 2C9WB 1WIAA 2PVOD 2WXQA 2QIEB 5T8IA 1TJEA 3AE1B 2RD0A 1ISNA 1CJEA 1PUTA 3DVNU 4MGKE 4F5TA 1AW7A 4K7WA 3S2AA 4ZDVA 3NVMA 4KX6B 1AARA 1E8WA 2Z0DB 3K9PB 3MP9A 2D5GA 2ON8A 3P63A 1HXYD 2CU1A 3AU4A 3M95A 1YD8U 2LRWA 4KGSA 2K8CA 2MBEA 1I42A 4RF1A 3QA8A 1MHHE 1P3QU 5IA7A 2PTLA 1FNVA 3SD5A 2FCSA 3AE2B 1H9ZA 3VUWA 3NVZA 2K5PA 1E8ZA 3ZTCA 1JWMD 1I4XA 3PS6A 2C5LC 1D3ZA 4F5VA 2J0JA 3WAMA 1UORA 3DVNV 4NJ7A 3RYTA 3FNMA 3BIID 3KYCD 4KGRA 2I30A 4W4UB 4EZJA 1V6EA 3FWCC 2WX1A 3DVGX 1KFYB 3DWMA 3JW0X 1E90A 1E6EB 2ASQA 5FR3A 2KFJA 1VCBA 3C8YA 4GDLB 2DYMA 2BW2A 2L00B 5EE3A 4FBJB 4KV2A 4DQOC 3IAM1 3FC4A 4YTPB 3DVGY 3IFWB 2ICIA 4Q2JA 2WDQB 2JYTA 2N9EB 2OOBB 5BMGA 4K7UA 2K6QA 3UQBA 1V8CA 1TZ1A 1C79A 3TIXA 1OQQA 1ZDVA 2KTRB 4YSZB 1RWSA 3E9SA 4KDLB 4LB9A 3EA6A 1WXMA 1C4AA 4EUTA 2V4IB 2R61A 2XNAC 3I3TB 3OJ4B 3BVGA 4XX5A 1NBFC 1WXQA 3SIVB 3IAS1 3ZJUA 1V1PB 1P9DU 2DZMA 4JQWC 1JALA 2FCMA 3JYUA 3AECB 3W5UB 2HDEA 2JZZA 4WURA 4LJOB 2KQSA 3RT3B 2JF5A 3L4PA 2JXXA 1WX7A 3P2BA 3EFUA 1RLFA 1WRDB 3N32A 4WAFA 1Y56A 2RDGA 3NRZA 2J52A 3AEDB 5EE9A 2QHBA 2X38A 3V3XA 4GLSC 2Z8JA 1Z2MA 4N59A 2E6XA 4EMXA 4DWFA 1H5WA 2BYVE 1HK4A 2NPTB 2NTSA 2BKRB 3BWUD 3ZNID 1BM0A 4MM3B 3H9DA 4ZCGA 2FUG1 2GOWA 4GDLA 1WGDA 3ZTDA 4GOCA 5LXHA 2RGFA 4G0NB 3VRAB 3ZNZB 3RFZB 3Q8FA 1JNBA 2JWZA 3M63B 2LASA 3MHZA 1SBBB 2KFKB 2JT4B 2O2VB 2BS2B 3SQJA 1SE2A 1E7PB 3IBEA 1WX8A 3GQUA 2GBKA 2NBUA 2BTEA 2RMMA 1ZDXA 2KTRA 2BS3B 3KWLA 4L9KA 1MIWA 3APFA 1FCLA 1FNUA 5BYRA 3SFEB 3AEGB 2LEKA 1KM7A 4C7YA 4AS1A 2LXAA 1NYRA 2EFEA 3GQXA 2ZZPB 3VTWA 5HFYA 2RR9A 1V1PA 2CJNA 4II2B 3ZRFA 2LUMA 2J0KA 2W55A 2N7DA 4IM0A 3UI3A 1ESFA 4NPNA 4OTUA 3JQZA 1SIJA 4EZKA 3CWIA 4IWPA 5IJ5A 1P0RA 1S1QB 1V86A 1V2YA 2SAKA 2BXAA 1WF9A 2H89B 4NQKE 4ARCA 1VZSA 4W9FA 5GIPA 4HLEA 3A1QB 3T9LA 2BXQA 2M4NA 1XCQL 1LM8B 2OJRA 3AE4B 4JWUC 2BXDA 2RDHA 3NZSA 2NPTA 1GNUA 4BY9C 1N62A 1XF5L 4LDTD 1NT2B 4K71A 4K81A 4AQ7A 4EE2A 2XVWA 4MM3A 2M56B 1YJJA 3TDLA 2I2YA 2K8BA 1D5MC 1FXIA 2LFIA 2MBOA 3PZ7A 1CMXB 4GB9A 3W1SA 3IVFA 1WR6E 4HK2A 4KVGB 3MHSD 2KFKA 1BKEA 2MBBB 2LHEA 2O2VA 4GXBA 4FN2A 3B9JA 2WXKA 4PT5A 5BMIA 5DQFA 4N6EB 5BPKA 4BKGA 4S1YA 3RPFC 1A5RA 2KC1A 2LVOA 1U4AA 3QWZB 2KQ7A 2LGIA 1QF6A 4HCNB 4M0WB 4F8CB 1WY8A 2WWZA 2XVVA 4FK5B 4BKEA 4HGKA 3A75A 4HKZE 1PDXA 2L83A 1FCCC 4GGQA 2N4FA 1SSNA 1HEZE 3A4RA 2PKOA 1T3QA 5AEKB 3Q3JA 4BKSD 3DQVA 4DXFA 5JZEB 4L1BA 1KLGD 3KH0A 4FA6A 3V6CB 2KANA 4LLGM 3QJZA 5DPSA 3PRZA 1QQRA 2K3UA 1C76A 4MDKE 1SEBD 4OHJA 2KX0A 2Y5BB 4DHXB 2JPHA 2M17A 3VVWB 5JH5C 3KW5B 4REZA 2WXJA 3EUB2 3ABVB 3A1QA 1N5XA 4MACA 1HE8A 4F1SA 2IBIB 2XW0A 4ASWC 5TSSA 4JLCA 1EWYC 1YN5A 1V80A 1WR1A 3DOWA 1YNTE 1L4DB 3L13A 4ZHOA 2VRRB 3APCA 2KDFB 3P4SB 1E7AA 5HOZA 4FHJA 5L83A 1SXTA 4YSYB 2QILA 3I57A 3UIPB 3NVYA 3M62B 1XD3B 5IIXA 2MBHA 1OEYJ 3ZKJC 4L8UA 4ANVA 4LDTB 4GIVA 2IY0B 3VFKA 1L0VB 4UDUC 5IJEA 2IO0B 2XVUA 2JZPA 4GU2A 3MTNB 2WXLA 2J0MA 2O6VD 5DPRA 1UGJA 4MT5A 4M0WA 3PTFC 2CS4A 3PLAA 2BX8A 2RPQA 3NUHB 3MHSB 1KRHA 2IPKD 2KOXA 4XDCA 1C78A 2QHOA 3RCZA 3RULA 3WALA 1V5TA 3Q69A 1IBXB 2PJHA 3B2FA 3IG3A 3MHHB 2L05A 1CZPA 4KIKB 3B2GA 3GS2A 4AJYB 1VDVA 1WX9A 2RSUA 3PSEB 4FULA 4TQ1A 1FM0D 3GA9L 1GNIA 2HJ8A 2FCNA 2PEAA 1NENB 2GB1A 1MG8A 3BK1A 3TBLD 4TSSA 2NTTA 3P4PB 2JSVX 2KACA 2Q5WD 4NAWB 3ZJTA 2KDEB 2L0TA 3M99C 4WQOB 4KDIC 1IPGA 2IO3B 1HK2A 1FFUA 5J2RA 2MP2B 3KJLA 1N60A 2KTFA 1KJTA 4RFBA 2WLBA 2PW9A 3N30A 1RYJA 5EE0A 4NY0A 2WYQA 4WJPA 3DBHI 2WXRA 4G03A 2LRUA 1C4PA 4WWOA 4FJZA 1E10A 4JWSC 3LB8C 4PS3A 3SHQA 4W9EA 2KWDA 3H3AA 4A3OA 5KHOA 3NS8A 3V08A 3R8BA 2WXOA 3PZDA 1GPXA 3MC0B 1ET6A 2WQYB 5IIUA 2BXEA 1FRDA 1WE7A 1DOYA 2LUEA 3AV8A 1B9RA 3V6EB 3WAOA 2ONQA 1WJUA 1IBXA 1X1MA 1YQ4B 3SU8X 4D2KA 2AQ3B 5AZGA 4OZCA 3VUXA 4AUQC 1ZXHA 4KIKA 4WWMA 4XWWA 1QOGA 3GOEA 4HPMB 2WXHA 4WQMA 3HUIA 2QMTA 1R4NI 1LNSA 1D5ZC 2O6VB 3UF8A 1VR9A 1JMLA 2ZPNA 1E8XA 2L3ZA 2WU2B 1Y8RC 2M0AA 5LLIA 3T3NA 4WJQA 4HKQA 4PYZA 1BJ5A 4YTMB 1E9MA 5B5TA 2GBRA 3VR9B 4NAWA 5MPOA 1TS2A 4BKSA 2V0GA 1C3TA 1IP9A 2KWVB 1V5OA 3SIUB 1N61A 2WDVB 2MP2A 1TS3A 4KZ0A 1HK3A 2JXTA 2ZNVB 1VLBA 4LTUA 3LJ3A 1XLQA 4J2VA 4M70B 3JSVB 2FIDA 1RM6C 1JWBD 2EFCA 1JRPA 1IYFA 5E6PA 4GMVA 5L95C 2LGYA 2ZCBA 4DHJD 2MCNB 3AH7A 2V4LA 4MH8A 5EDSA 3QX1A 3PGEA 2MH7A 2ZPYA 1XT9B 2JU6X 4XC2A 5FUOA 3HVZA 1E8YA 3DBLI 1H4RA 2W3SA 3VTVA 3ZQ4A 2QM6A 1F2RI 1C77A 1JRUA 2J53A 3PREA 3WANA 1WI0A 3VH4B 5CHVC 3TUOA 1WM3A 3ZIMA 3W9CB 3CSFA 4HJGE 1CK1A 3U8ZA 3ZW3A 1JWSD 1Q10A 2AWTA 1FD6A 2IO1B 4N0UD 3URYA 4A3PA 2LMCA 3L17A 4EOYA 2K9XA 2WXFA 4A8XC 1WGHA 3WCQA 3A9JB 2LHDA 5AUKA 1DYQA 2YEPB 1DOXA 4DK5A 2O6VA 5GINA 1ROEA 2AJEA 4E74A 1KF6B 3WIMA 2M8SA 2MX2A 4BFRA 2MSED 1ACCA 5I4DA 4KKIA 1UELA 2DBUA 4G3XB 4ZRIA 1JQ4A 3U30A 5CHFA 4W9CA 3R2TA 3AE6B 2WXGA 2ZW1A 3NVIA 2CHZA 2ZJDA 1UZXB 5FKAC 1KH0A 1QZEA 3B1LX 2KLCA 1MIVA 4N3ZA 3JSVA 4USAA 2XK5B 1JWAD 1I4QA 2K6DB 4EKUA 1UNSA 3X23A 2KN4A 3W2DA 1SE3A 4J6IA 1IJGA 3L08A 4EZLA 3L0WB 3VDZA 2KBZA 2NR2A 1YQBA 3GZNI 5FK9C 4AWJA 1LXDA 4YXDB 1XLOA 4IOIE 1C1YB 2HD5B 1RFAA 1F2RC 1K8RB 3DBSA 3U7DA 1ZPSA 1YIWA 2V3NA 2J42A 5D3DA 3VHTC 3PPAA 5AUIA 2KK8A 3ZNGC 2WDRB 3NHEB 1V81A 3RZWC 2EFDA 2NVUI 2K39A 2J4XA 4W9GA 4DHJB 2PLPA 4IUMB 5HI1A 3AN1A 2DYBA 1Z5SB 1XCTL 3A9JA 4M8MA 3T3OA 4KZCA 3M3JA 4ZBRA 4JIOU 1SF0A 3AI5A 2PPHA 2B76B 2BF8B 1G6JA 4I6NB 2MQJA 1L0XB 1GC6A 2KWUB 4WWNA 3AE9B 4A6QA 4WWPA 2G9HD 1SE9A 2ZW0A 2BXIA 2WXIA 2UYZB 4ZYSA 1WJNA 4FJCB 4I6LB 2KHWB 2Y5PA 2N7EA 3KWVA 3V62A 1JWUD 2IO2B 1QOBA 1EF5A 4WJNA 4YL8A 1HK5A 2DX5B 5ID9A 2KMMA 3Q8BA 1M4VA 4ZC6A 1AWDA 3MFGA 2OT3A 2J7QB 2N9XA 3HVDA 2XK5A 4US9A 4ZRKA 3WHQA 4C7ZA 1N5UA 5GHKA 4JPSA 4HDQA 3P42A 2MJ3A 3ML9A 2BXCA 1HA5A 4ZRQA 5AZHA 3PHXB 2AQ2B 4ICUA 2QJLA 2GBMA 3PVLA 1GUAB 4P6VF 2DHZA 2BXLA 2KDBA 2WU5B 4BVUC 4G04A 4TQ0A 3TCAA 5G5HA 4RM8A 4H2AA 2LOQA 1YX5B 3G9KD 4TUUA 3PZ8A 4LCDE 4ANUA 2MBQA 2ZVOA 4IW0A 1T5XD 2DYOA 2M1MA 2HE7A 1VZ6A 1AO6A 2BXMA 1WXSA 2IZVB 4J3OD 3QQ8B 3FWBC 1YN3A 2OHFA 3AE8B 1MVKA 2FNJB 1M94A 2K25A 1LFDA 2XSIA 5C23A 5FR6A 3ZJVA 3AEFB 5LNK1 4WAAA 4MEMA 2HTME 2HTHA 2VUFA 4NQLB 4WH4A 3NZ3A 3NVVA 3D32A 4FIPB 3HM6X 1NEKB 1XEEA 1KXPD 3ETRA 1C9FA 5CX3A 4II3B 2AEHA 2KXJA 5G5GA 1FEHA 3OWEB 4KKJA 3A73A 1KLUD 4DDID 3Q8CA 2TSSA 3DDCB 1ENFA 1K53A 2VZKD 1HZ5A 3IT4B 5D94A 4L2YA 4OW0A 4WA6B 1WE6A 5E6OA 3NOBA 3TJPA 3OAWA 2PE9A 5BYQA 3Q3FA 2D07B 2WXMA 3UIOB 4JGHB 1P7EA 5GMVA 1E7HA 1ZGUB 1N5WA 1UH6A 2LJ5A 5C1ZA 2LGDA 2FBWB 1UBQA 1TBEA 4HVBA 1V49A 2N1VA 5G55A 4MSQB 2BYEA 4JK4A 1A70A 3TL5A 1WSPA 5AZFA 3DPDA 2JWUA 3TEWA 1DOIA 2KDMA 2MWSB 4JE3B 2WXPA 4DHZB 4FLHA 3H1UA 2I1KA 5IAAC 3R7RA 3BYTB 2A5UA 3V60A 1TYGB 4IG7B 2NMQA 2CHWA 2MJEA 4MJSB 2DBYA 5HHDG 4BBNF 2XN9C 4EFOA 2MLBA 1TXUA 1L6VA 3PRMB 3HRDD 1P1AA 2IGDA 2B3AA 3KLSX 1PGBA 2MJDA 3B9LA 2KN5A 2WDTB 2KKCA 3QK0A 4W9JA 1TZOA 1UUPA 1EWCA 2DLBA 5D6JB 5DPWA 1MA9A 3ENEA 1NI2A 2I2ZA 1L7YA 4BKTA 2BKFA 2G1EA 2OZBB 1T0YA 1I4GA 2CHXA 1LQBA 3QAQA 3KQ4A 4IKGA 4RH6A 2GMIC 2FCQA 2K1FA 4HDOA 2BBCA 3H7SA 3WHRA 3A4SC 3A33B 3NMUA 5J17A 1QOFA 4ZBQA 3ZDTA 3R66C 2W82A 3U4EG 2VZKB 3VRBB 2LI5A 1SB3C 1F77A 1YQ3B 2EMSA 1FRRA 3A9KB 2N0SB 4ZYNA 3TEXA 2BYFA 4P16A 3PO0A 5GIOA 4IWQA 2KNBA 3MJWA 3JVZX 3BY4B 4YSXB 2CJOA 3ZGZA 2A4ZA 3PHWB 1GOZA 4GN1A 1UGMA 3AULA 1XLPA 3IHPC 4DXGA 1E7EA 1QT9A 4IW1A 4E99A 3V05A 1RAXA 1WFYA 4W9LA 3GB1A 4OVZA 2BGFA 3V61A 2LVQA 2VDBA 3UINB 3SEBA 2KD0A 1FMAD 2NS5A 3KUCB 1I4PA 3HK0A 2XEWA 2Z59B 2YDFA 4MJSA 2INNE 5IIHA 2Z8IA 2R2OA 3QCAA 2DG5A 2UWQA 4F5UA 4ZRJA 4W9KA 4PYUA 3Q8EA 3VUYA 4N9F4 4AJWA 3KUZA 5HG2A 4JX1C 1J7CA 2QMCA 3B0AA 4A90A 1EM7A 3BZDB 2D2QA 1F9JA 4AOFA 2CR5A 1FIQA 1MI0A 1ZKHA 4A9AA 1J7BA 4Z9OA 4NAMA 2LJIA 1TF0A 2G3QB 4A55A 4XWTA 2NNWA 3LU6A 2DZKA 2INPE 2DBWA 2M0XA 2BXOA 2L76A 4MSMB 2DAJA 3P4RB 1HZ6A 2IGHA 3V09A 1D6EC 4LUHA 3BK2A 3KYDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C1Y B;  2HD5 B;  1RFA A;  2KX3 A;  3HHM A;  3O65 B;  2KZR A;  2EKE C;  4PS7 A;  4DDG D;  1K8R B;  3DBS A;  2LXC A;  4KSL C;  2O2V A;  3U7D A;  1YIW A;  4GXB A;  4FN2 A;  3ZUN A;  4RM9 A;  1WH3 A;  1E5W A;  2DAF A;  4W9H A;  3VHT C;  3PPA A;  4FHK A;  3A9K A;  4BKG A;  2GBN A;  2KK8 A;  3ZNG C;  3OLM D;  1A5R A;  4B95 A;  3NHE B;  2FAZ A;  2KC1 A;  1V81 A;  2LVO A;  3RZW C;  2NVU I;  1SGH A;  2K39 A;  1U4A A;  1WM2 A;  3QWZ B;  2KQ7 A;  3ECI A;  4W9G A;  4DHJ B;  4CHK A;  4IUM B;  4JL9 A;  4HCN B;  4BOS C;  3HIZ A;  4M0W B;  4F8C B;  4MGZ E;  1WY8 A;  3ONS A;  2DYB A;  3N3K B;  1EF1 A;  2WWZ A;  2DZJ A;  3ZRC A;  1Q0W B;  1Z5S B;  2KO3 A;  3A9J A;  4M8M A;  2G45 B;  2JUO A;  2L0F A;  4KZC A;  3M3J A;  2AYO B;  2YLM A;  3CST A;  1XQQ A;  4JIO U;  4A20 A;  4E71 A;  4GGQ A;  2N4F A;  1WZ3 A;  3AI5 A;  2PPH A;  2BF8 B;  3A4R A;  3L16 A;  4G11 A;  2YVC A;  1G6J A;  5AEK B;  4I6N B;  2MQJ A;  3X0W A;  3Q3J A;  4BKS D;  1GC6 A;  2AL6 A;  2KWU B;  3DQV A;  3R7Q A;  4WWN A;  5JZE B;  5E6N A;  1VD2 A;  1E7U A;  2JY6 A;  4WWP A;  1OGW A;  1Q1O A;  1H8C A;  3KH0 A;  4FA6 A;  1SE9 A;  1J8C A;  4HJK A;  3V6C B;  2KAN A;  4ANX A;  1WMH A;  2MA9 B;  3OJ3 A;  3QJZ A;  5DPS A;  1WJ6 A;  2UYZ B;  3PRZ A;  1WJN A;  1OEY A;  4CO7 A;  4MDK E;  4FJV B;  4I6L B;  4MGY E;  4MGI E;  2R2Q A;  2KX0 A;  2KHW B;  4GSW A;  2Y5B B;  2JPH A;  5JH5 C;  2M17 A;  4K1R B;  2MRP A;  3VVW B;  1OTR B;  3KW5 B;  2N7E A;  3CMM B;  3A1Q A;  1I35 A;  1HE8 A;  2ZVN A;  4F1S A;  2DZI A;  2IBI B;  2C7M B;  3V62 A;  2KLG A;  2IO2 B;  1EF5 A;  4ASW C;  2JRH A;  3WAP A;  4JLC A;  4WJN A;  4YL8 A;  2I1J A;  1NDD A;  3ZVV A;  3AXC A;  2V1Y A;  5G2N A;  1WXV A;  3R3M A;  2DX5 B;  1V80 A;  1WR1 A;  3DOW A;  3K9O B;  3PV1 A;  5DCN A;  3RUI B;  2J7Q B;  2ZNV C;  1WGR A;  2N9X A;  3KUD B;  3ML8 A;  2XK5 A;  1J19 A;  4ZRK A;  4KSK C;  3L13 A;  1TGZ B;  2VRR B;  3APC A;  2KDF B;  4HCP B;  4HPL B;  4XZ4 A;  1TTN A;  4IM2 A;  4FHJ A;  4HDQ A;  5L83 A;  2L7R A;  5JHA A;  3ML9 A;  3EEC A;  1S3S G;  5AZH A;  3UIP B;  1SIF A;  3PHX B;  3M62 B;  1XD3 B;  5HKH A;  4B9K A;  3QC8 B;  4ICU A;  1ZW7 A;  2FIF A;  2GBM A;  4WJO A;  2MBH A;  1OEY J;  3PVL A;  1GUA B;  3PLV A;  2BWE S;  2KJR A;  3ZKJ C;  2DHZ A;  5J18 A;  4ANV A;  4LDT B;  5D7G A;  1OQY A;  4GIV A;  2KDB A;  4W9I A;  2IY0 B;  3VFK A;  1PQS A;  4BVU C;  2IO0 B;  4TQ0 A;  3TCA A;  1EO6 A;  4GU2 A;  4RM8 A;  3MTN B;  2C9W B;  1WIA A;  2J0M A;  2O6V D;  5DPR A;  1YX5 B;  3PTF C;  2CS4 A;  2RPQ A;  4TUU A;  4LCD E;  4OVU A;  4ANU A;  3DCG A;  2KOX A;  2RD0 A;  2MBQ A;  2ZVO A;  4HWI B;  1ISN A;  2WX0 A;  2QHO A;  4IW0 A;  4HXD A;  2DYO A;  2GBJ A;  2M1M A;  3ALB A;  3RCZ A;  1V5T A;  3RUL A;  3WAL A;  2HE7 A;  2PJH A;  1WJ4 A;  3APD A;  3DVN U;  4MGK E;  3IG3 A;  4K7W A;  1WXS A;  3S2A A;  4ZDV A;  2IZV B;  2L05 A;  3W1Y A;  1AAR A;  1E8W A;  3QQ8 B;  5JHB A;  2Z0D B;  4KIK B;  4IC7 B;  3H7P B;  3K9P B;  4M8N A;  1KOT A;  2FNJ B;  1M94 A;  4AJY B;  2K25 A;  1LFD A;  1WX9 A;  2CU1 A;  2RSU A;  3NZU A;  4PS8 A;  3ZDM C;  3AU4 A;  3M95 A;  1YD8 U;  3PSE B;  5C23 A;  4DHZ E;  2KVR A;  2LRW A;  2N9P C;  5FR6 A;  2K8C A;  2LZ6 A;  2MBE A;  3QHT A;  4FUL A;  1I42 A;  3QA8 A;  4TQ1 A;  1P3Q U;  5IA7 A;  4FJY A;  5TR5 A;  4WAA A;  4MEM A;  4BBN C;  4E3C A;  3SD5 A;  2FCS A;  2HTH A;  2ZEQ A;  3VUW A;  4NQL B;  1E8Z A;  2D11 A;  3ZTC A;  3PLU A;  2HJ8 A;  2FCN A;  2PEA A;  3PS6 A;  1MG8 A;  2C5L C;  3TBL D;  3D32 A;  1D3Z A;  2J0J A;  4NAW B;  3WAM A;  3C0R B;  2KDI A;  3HM6 X;  2KDE B;  3DVN V;  2KJH B;  2L0T A;  4NJ7 A;  5CX3 A;  4URK A;  4II3 B;  4WQO B;  4KDI C;  2AEH A;  2KXJ A;  1IPG A;  2IO3 B;  3RYT A;  3DBR I;  5J2R A;  2MP2 B;  3KYC D;  4DDI D;  2KTF A;  1KJT A;  3HM3 A;  1YX6 B;  3N30 A;  4LJP B;  3DDC B;  4NY0 A;  2WYQ A;  2LGX A;  4DBG A;  4WJP A;  3DBH I;  4EZJ A;  1GG3 A;  1V6E A;  2NBW B;  2WX1 A;  3DVG X;  5D94 A;  2LRU A;  3PT2 B;  3SDL C;  4WWO A;  4FJZ A;  1WE6 A;  3JW0 X;  1E90 A;  5E6O A;  4PS3 A;  2ASQ A;  3NOB A;  3B08 A;  4X57 B;  3SHQ A;  4MEL A;  4W9E A;  1L2N A;  2KFJ A;  1VCB A;  4GDL B;  2DYM A;  2IYD B;  3TJP A;  2L00 B;  2PE9 A;  3OAW A;  4ICV A;  3UGB B;  4FBJ B;  4DXA B;  3Q3F A;  4A3O A;  4KV2 A;  2BWF A;  2D07 B;  3UIO B;  4JGH B;  5KHO A;  3NS8 A;  3ZLZ A;  2BPS A;  5GMV A;  1UD7 A;  3UQA A;  1ZGU B;  3PZD A;  3DVG Y;  1UH6 A;  3IFW B;  2LJ5 A;  2N9E B;  2OOB B;  5C1Z A;  1RRB A;  2C7H A;  2LGD A;  4K7U A;  1WE7 A;  2K6Q A;  3UQB A;  2LUE A;  1TZ1 A;  3TIX A;  3V6E B;  1UBQ A;  5LXI B;  1TBE A;  3WAO A;  1V49 A;  4HVB A;  2JRI B;  2N1V A;  5G55 A;  3W1S C;  2KTR B;  1WJU A;  1X1M A;  4MSQ B;  2REX A;  2DEN B;  2BYE A;  3LDZ E;  3SU8 X;  4KDL B;  3ZO5 B;  5AZG A;  3TL5 A;  1WXM A;  5AZF A;  1WXA A;  3DPD A;  3VUX A;  4AUQ C;  4EUT A;  3VTU A;  2MWS B;  4KIK A;  3I3T B;  3H7P A;  3L54 A;  3OJ4 B;  4DHZ B;  4FLH A;  2IY1 B;  3H1U A;  4XX5 A;  3GOE A;  5DPT A;  2I1K A;  5IAA C;  4HPM B;  1NBF C;  3R7R A;  3QAR A;  1WGY A;  1R4N I;  4B6W A;  2O6V B;  1P9D U;  2A5U A;  3UF8 A;  4FAD A;  2DZM A;  4F7Z A;  3V60 A;  4JQW C;  4IG7 B;  2ZPN A;  1E8X A;  2CHW A;  2FCM A;  2L3Z A;  2C60 A;  4MJS B;  3JYU A;  5CHW A;  1GC7 A;  4BBN F;  1Y8R C;  4EFO A;  2JZZ A;  2MLB A;  4I6P A;  1E7V A;  4LJO B;  2KQS A;  5LLI A;  3RT3 B;  2JF5 A;  2NBV B;  3PRM B;  3QIJ A;  4WJQ A;  3RZF A;  2JXX A;  1FXT B;  1P1A A;  4PYZ A;  2B3A A;  4EEW A;  1WX7 A;  3P2B A;  2GBR A;  3EFU A;  5CTR C;  4AP4 C;  1RLF A;  1WRD B;  3N32 A;  4NAW A;  2L8J A;  2KN5 A;  2WDT B;  2KKC A;  4K7S A;  4BKS A;  3QK0 A;  4W9J A;  1C3T A;  1V9J A;  3EHV A;  1IP9 A;  2KWV B;  1V5O A;  1YJ1 A;  2PE6 B;  5D6J B;  3TMP B;  5DPW A;  2JVC A;  3WA0 A;  2MP2 A;  4RMA A;  4CYE A;  3ENE A;  4MH0 E;  3VQI A;  1NI2 A;  1Z2M A;  4KZ0 A;  3T8M A;  4DWF A;  2ZNV B;  4GDK B;  1L7Y A;  2KMA A;  4BKT A;  2BKF A;  2BYV E;  2JZ3 B;  3LJ3 A;  2KWC A;  2NPT B;  3CF6 E;  3JSV B;  2BKR B;  2FID A;  1T0Y A;  1GJZ A;  5BO4 B;  4BOZ B;  1IYF A;  4GMV A;  2CHX A;  1LQB A;  3QAQ A;  2LGY A;  5E6P A;  3ZNI D;  3H9D A;  2ZCB A;  5L95 C;  2XBB C;  2GOW A;  4GDL A;  1WGD A;  2GMI C;  2FCQ A;  3ZTD A;  4DHJ D;  4GOC A;  2K1F A;  5LXH A;  4HDO A;  3H7S A;  2RGF A;  4G0N B;  2MCN B;  4G50 A;  3ZNZ B;  2V4L A;  3A4S C;  1R4M I;  5EDS A;  2JWZ A;  3A33 B;  2LAS A;  3M63 B;  3PGE A;  3QX1 A;  2ZPY A;  4W9D A;  5J17 A;  2KFK B;  1XT9 B;  3AU5 A;  4XC2 A;  3ZDT A;  2JT4 B;  1E8Y A;  3DBL I;  4NNJ B;  1H4R A;  3VTV A;  3R66 C;  2O2V B;  1JRU A;  2G4D B;  3IBE A;  2LI5 A;  3PRE A;  1WX8 A;  3WAN A;  2GBK A;  3BIN A;  1WI0 A;  3VH4 B;  2NBU A;  2EMS A;  2ZCC A;  3A9K B;  1WM3 A;  5CHV C;  1Q5W B;  4ZYN A;  2BYF A;  4P7I A;  3ZIM A;  3H6N A;  2NCN A;  2V3S A;  3CSF A;  5KHQ A;  4ANW A;  3ZNH B;  2D10 A;  2KNB A;  3MJW A;  2FUH B;  1WGG A;  3JVZ X;  4IWQ A;  3U8Z A;  2KTR A;  3ZW3 A;  2AWT A;  3BY4 B;  4NJ6 A;  3VXW A;  3APF A;  2A4Z A;  3PHW B;  4GN1 A;  2LVP A;  1UGM A;  2KJ6 A;  3AUL A;  3RD2 A;  2W9N A;  3IHP C;  4OVV A;  2KMC A;  1KM7 A;  2IO1 B;  2LXA A;  2ZZP B;  4A3P A;  3L17 A;  1RAX A;  1WYW B;  2D3G A;  4EOY A;  1WFY A;  1WGH A;  4TV3 A;  3A9J B;  4W9L A;  3KVF B;  3VTW A;  3PRP B;  2RR9 A;  2BGF A;  3V61 A;  4DK5 A;  2LVQ A;  2O6V A;  4II2 B;  3UIN B;  1BT0 A;  3ZRF A;  2J0K A;  2KD0 A;  2NS5 A;  2C7N B;  3KUC B;  2N7D A;  4IM0 A;  3HK0 A;  2XEW A;  4E74 A;  2Z59 B;  4MJS A;  4NPN A;  1EUV B;  2CKH B;  2K8H A;  2R2O A;  3VH3 B;  3QCA A;  3WIM A;  2M8S A;  2UWQ A;  4EZK A;  1P98 A;  2MX2 A;  4BFR A;  4ZRJ A;  2MSE D;  4W9K A;  4PYU A;  4IWP A;  1WMH B;  1P0R A;  2AL3 A;  2LWP A;  1S1Q B;  1V86 A;  1V2Y A;  3VUY A;  1UEL A;  1WF9 A;  4G3X B;  2LD9 A;  4N9F 4;  3EC8 A;  4NQK E;  4ZRI A;  3U30 A;  4AJW A;  3KUZ A;  4W9F A;  5CHF A;  3B0A A;  4HLE A;  1KLV A;  1WZ0 A;  3A1Q B;  4W9C A;  3T9L A;  3VAW A;  2D2Q A;  2Z0E B;  4IWO A;  1F9J A;  2M4N A;  3L10 B;  4AOF A;  3NY5 A;  1LM8 B;  2CR5 A;  4TKN A;  2OJR A;  2CHZ A;  4GDK A;  2ZJD A;  1UZX B;  1ZKH A;  3NZS A;  2EMT A;  5D2M B;  1QZE A;  2NPT A;  1GNU A;  3B1L X;  2MW5 A;  2KLC A;  3JSV A;  4LDT D;  2KC2 A;  2G3Q B;  1J0G A;  2XK5 B;  4IM3 A;  4K81 A;  2N1W A;  2K6D B;  4EKU A;  4MM3 A;  2DZK A;  3X23 A;  4J6I A;  2K8B A;  3L08 A;  4EZL A;  2M0X A;  3L0W B;  2G4S A;  2L76 A;  4MSM B;  3VDZ A;  2DAJ A;  2MBO A;  1CMX B;  2NR2 A;  1YQB A;  3GZN I;  4GB9 A;  1UBI A;  3W1S A;  1LXD A;  3IVF A;  4AWJ A;  1WR6 E;  4HK2 A;  4KVG B;  3MHS D;  2KFK A;  2MBB B;  3KYD D; 
#chains in the Genus database with same CATH topology
 1BML C;  3HHM A;  4DDG D;  2AX5 A;  2DWQ A;  1STE A;  2V3P A;  2LXC A;  4KSL C;  1SJH D;  1TY2 A;  4RM9 A;  1WH3 A;  1I7H A;  2DAF A;  4W9H A;  3EGR A;  5H8Y E;  3A9K A;  1R4N B;  3W5V B;  4B95 A;  2FAZ A;  1RFK A;  3Q8A A;  1HA2 A;  2L1A A;  1IGC A;  4CQN A;  3TEY A;  1MIY A;  4ZBK A;  1D5X C;  3AE3 B;  3ECI A;  4HEA 1;  3AE7 B;  4JL9 A;  4BOS C;  4YTN B;  1DGJ A;  3IXS A;  4MGZ E;  3ONS A;  4XDD A;  3N3K B;  1QOA A;  1EF1 A;  2HJ1 A;  3IT6 B;  3ZRC A;  1N6Z A;  2KO3 A;  2G45 B;  2JUO A;  2QEJ C;  2L0F A;  2BYT A;  2AYO B;  2YLM A;  1XQQ A;  4A20 A;  4E71 A;  1WZ3 A;  1GNJ A;  2WP9 B;  3L16 A;  4G11 A;  2YVC A;  3X0W A;  3R7Q A;  1TY0 A;  1OGW A;  1Q1O A;  4HJK A;  4ANX A;  1WGK A;  2MA9 B;  3P1M A;  1I4H A;  1NI3 A;  1LOT A;  4CO7 A;  4FJV B;  5E6J A;  2BXF A;  4MGI E;  1B1Z A;  2R2Q A;  2MRP A;  3V03 A;  1QIL A;  1XO3 A;  1BUI C;  2ZVN A;  1J78 A;  2KLG A;  2XMO A;  2SEB D;  1TKE A;  1EU3 A;  2I1J A;  2V1Y A;  5G2N A;  1WXV A;  2W3R A;  4K3C A;  4RGT A;  2RPV A;  3K9O B;  3PV1 A;  3RUI B;  1VJK A;  2ZNV C;  1WGR A;  3KUD B;  2L32 A;  3ML8 A;  4KSK C;  1YJI A;  1MPE A;  1O9X A;  1GB4 A;  4HPL B;  4XZ4 A;  4IM2 A;  5EE1 A;  3EEC A;  4OTT A;  2ROH A;  1S3S G;  1SIF A;  4B9K A;  2QSD A;  1E7G A;  2FE8 A;  1ZW7 A;  2FIF A;  3OG5 A;  4WJO A;  3PLV A;  2BWE S;  5J18 A;  3VR8 B;  2JX5 A;  1NYQ A;  3WHS A;  2V36 A;  1OQY A;  4W9I A;  3ZXR A;  4YWG G;  1PQS A;  1GAQ B;  1ZUD 2;  3RN9 C;  4IW2 A;  3Q3O C;  1FNW A;  3GP7 A;  2N7J A;  2WHI A;  3BVM A;  1TKG A;  2BXB A;  1VFI A;  4OVU A;  3DCG A;  3P4Q B;  4HWI B;  2WX0 A;  4HXD A;  2GBJ A;  3ALB A;  1LO5 D;  1WJ4 A;  3APD A;  1BXT A;  3W1Y A;  4GDX A;  5JHB A;  4IC7 B;  3FKY A;  3H7P B;  4M8N A;  1R7S A;  4RCO A;  1KOT A;  2WGS A;  4PS8 A;  1N63 A;  3NZU A;  3ZDM C;  1K51 A;  3AM9 A;  4DHZ E;  2KVR A;  2N9P C;  2UU7 A;  2LZ6 A;  3QHT A;  3NVW A;  2WXN A;  4FJY A;  5TR5 A;  3SR6 A;  2BXK A;  4BBN C;  4E3C A;  1D4B A;  2EFH A;  2ZEQ A;  1WYG A;  1SJE D;  1NVI D;  2D11 A;  3PLU A;  3SFD B;  1PGX A;  3TSS A;  2N9L A;  3GZN B;  1GB1 A;  4RGO S;  4WIP A;  3C0R B;  2KDI A;  1YOV B;  3LXF A;  3FIL B;  2KJH B;  2XVQ A;  1E7F A;  4URK A;  2JUH A;  3DBR I;  4FXC A;  4US8 A;  3HM3 A;  1YX6 B;  1IUE A;  1ZOY B;  4LJP B;  1OFF A;  2LGX A;  4DBG A;  2ACZ B;  2K22 A;  4M01 A;  2BXG A;  1GG3 A;  2NBW B;  3PT2 B;  3SDL C;  3RMK C;  5BMH A;  4IDI A;  3CX9 A;  4X57 B;  3B08 A;  4MEL A;  3AMZ A;  4OZB A;  1L2N A;  1MHX A;  2IYD B;  4L23 A;  4ICV A;  3UGB B;  4B0E A;  4DXA B;  4R3D A;  2BWF A;  2PMV A;  3TEZ A;  2PIA A;  2WNM A;  3LYY A;  3ZLZ A;  2BPS A;  1UD7 A;  3UQA A;  2XW1 A;  2JYE A;  1KTK A;  5BYS A;  3RNC C;  5DBY A;  1FOU A;  1RRB A;  2C7H A;  4HPP A;  3RNF C;  2VUE A;  4N58 A;  1PFD A;  5LXI B;  2JRI B;  3W1S C;  1VZ7 A;  2DEN B;  2REX A;  3LDZ E;  4ZOH C;  3ZO5 B;  1WXA A;  3VTU A;  2H88 B;  3H7P A;  3L54 A;  2IY1 B;  5DPT A;  3QAR A;  1WGY A;  4B6W A;  5C2T B;  3BVZ A;  2CU3 A;  4LB2 A;  4FAD A;  3NVK A;  4F7Z A;  1ZP0 B;  1PYW D;  2E3T A;  2C60 A;  1K50 A;  5CHW A;  1GC7 A;  1I4R A;  2KAJ A;  5D3I B;  1UWX A;  4I6P A;  1E7V A;  3QIJ A;  2NBV B;  4HRS A;  2BB5 A;  3RZF A;  1FXT B;  4EEW A;  5CTR C;  2OJW A;  4AP4 C;  2EEL A;  1VZ8 A;  2K0P A;  2L8J A;  4K7S A;  4OZA A;  3FIL A;  1FO4 A;  1V9J A;  3EHV A;  1YJ1 A;  2PE6 B;  3TMP B;  1SE4 A;  2JVC A;  1YMH E;  3WA0 A;  4RMA A;  4CYE A;  4MH0 E;  3LU8 A;  3VQI A;  1F0Z A;  4PK1 A;  3T8M A;  1TS4 A;  4GDK B;  2KMA A;  2DBX A;  3FAH A;  2NQO A;  2JZ3 B;  2KWC A;  3N20 C;  3U52 E;  3CF6 E;  4ZHP A;  5IP4 D;  1GJZ A;  5BO4 B;  1JCK B;  4BOZ B;  1VRA B;  1P7F A;  4GG2 A;  5IJF A;  2XBB C;  1E7C A;  3KIK A;  2L52 A;  4G50 A;  2KQ4 X;  2E0Y A;  1J7E A;  1R4M I;  1EU4 A;  2JQR B;  4W9D A;  3CIR B;  3AU5 A;  1K52 A;  5ID7 A;  3NS1 A;  4NNJ B;  5IFO A;  3MC9 A;  1QKZ A;  3U7Z A;  2G4D B;  1T6B X;  2BXH A;  3AEA B;  5H92 C;  2DNF A;  1WWT A;  3BIN A;  2PVG C;  2ZCC A;  1IGD A;  2WS3 B;  1Q5W B;  2W54 A;  3BYY B;  1ET9 A;  4P7I A;  3H8H A;  3H6N A;  2NCN A;  2V3S A;  5KHQ A;  1L5P A;  4ANW A;  3ZNH B;  2D10 A;  2FUH B;  1WGG A;  3VXW A;  4NJ6 A;  1HK1 A;  2KJ6 A;  2LVP A;  3RD2 A;  2W9N A;  2BXP A;  4OVV A;  2D3B A;  2KMC A;  4K2C A;  1WYW B;  2D3G A;  2N9K A;  4TV3 A;  5IOI A;  3KVF B;  4XE0 A;  3PRP B;  4HGM B;  3O13 A;  4C56 C;  1BT0 A;  4C80 A;  2C7N B;  2Z8K A;  2IDY A;  3AB5 A;  1EUV B;  2CKH B;  2K8H A;  4KGT A;  3VH3 B;  1WRI A;  4RGN A;  1P98 A;  2EKI A;  1V97 A;  1WMH B;  1HQR D;  2AL3 A;  2LWP A;  2YEP F;  3ECP A;  2LD9 A;  3EC8 A;  1HTQ A;  4S0R A;  1KLV A;  1WZ0 A;  1YN4 A;  2M19 A;  4PO0 A;  3VAW A;  3ICX A;  1L6U A;  2Z0E B;  4IWO A;  2IJ0 A;  3L10 B;  1AYF A;  3NY5 A;  1FXA A;  4TKN A;  4L9Q A;  1C4C A;  4GDK A;  4XYC A;  2Z8L A;  4G01 A;  1XLN A;  2EMT A;  1E7B A;  5D2M B;  5JXV A;  2MW5 A;  2BQQ A;  2KC2 A;  4NJC A;  1J0G A;  4IM3 A;  2N1W A;  3J9C A;  4OT2 A;  3AE5 B;  2G4S A;  4ITK A;  1UBI A;  4B0M A;  3UIV A;  3I9V 1;  3O65 B;  2KX3 A;  2KZR A;  2EKE C;  4PS7 A;  2CKX A;  3ZUN A;  3LU7 A;  1E5W A;  2MEK A;  4FHK A;  2GBN A;  3OLM D;  3AEB B;  1SGH A;  1WM2 A;  4MBE C;  4LUF A;  4CHK A;  1XXG A;  3R2I A;  3HIZ A;  1E78 A;  4OR0 A;  3JRY A;  4RGM A;  4ZRP A;  2DZJ A;  1Q0W B;  1HTO A;  1KW2 A;  3CST A;  1JRO A;  2RDB C;  4N0F D;  2BB6 A;  1E0Z A;  1JW9 D;  3ZYY X;  2BVC A;  2AL6 A;  1PGA A;  1QLB B;  5E6N A;  1VD2 A;  1E7U A;  2JY6 A;  4O1N A;  1H8C A;  1FFV A;  1J8C A;  3AEE B;  1WMH A;  2IGG A;  3OJ3 A;  1WJ6 A;  4C00 A;  1OEY A;  4NZL B;  1E7I A;  4MGY E;  4GSW A;  1OQR A;  2AGH B;  4K1R B;  1OTR B;  3N9Y C;  3CMM B;  2KYW A;  3RI7 C;  1I35 A;  2DZI A;  3E56 A;  2C7M B;  1ZE3 D;  4Z69 A;  2GRI A;  2JRH A;  3WAP A;  1NDD A;  3ZVV A;  1CQV A;  1J7A A;  2E0X A;  3AXC A;  4YT0 B;  3R3M A;  4TMA B;  3H37 A;  4LNF A;  4LA0 A;  5DCN A;  1TKY A;  4C31 B;  3RNG C;  3DBH B;  1J19 A;  2GI9 A;  4HRO A;  1TGZ B;  3U2S C;  2BT6 A;  2BS4 B;  4HCP B;  1TTN A;  4F5S A;  5GXG B;  2L7R A;  3MJ5 A;  5JHA A;  2I38 A;  4ZUX V;  3B9M A;  1V1O A;  2BXN A;  2AQ1 B;  3DWG C;  2Y3A A;  4LK0 M;  5HKH A;  1UWM A;  2Y5C A;  3QC8 B;  1ZXI A;  4ARI A;  5C3J B;  2LQH A;  4RNA A;  2KJR A;  1TS5 A;  4RF0 A;  5D7G A;  1L0Y B;  1L4Z B;  1AN8 A;  1MJD A;  1EO6 A;  2OED A;  2C9W B;  1WIA A;  2PVO D;  2WXQ A;  2QIE B;  5T8I A;  1TJE A;  3AE1 B;  2RD0 A;  1ISN A;  1CJE A;  1PUT A;  3DVN U;  4MGK E;  4F5T A;  1AW7 A;  4K7W A;  3S2A A;  4ZDV A;  3NVM A;  4KX6 B;  1AAR A;  1E8W A;  2Z0D B;  3K9P B;  3MP9 A;  2D5G A;  2ON8 A;  3P63 A;  1HXY D;  2CU1 A;  3AU4 A;  3M95 A;  1YD8 U;  2LRW A;  4KGS A;  2K8C A;  2MBE A;  4LNI A;  1I42 A;  4RF1 A;  2V9H A;  3QA8 A;  1MHH E;  1P3Q U;  5IA7 A;  2PTL A;  1FNV A;  3SD5 A;  2FCS A;  3AE2 B;  1H9Z A;  3VUW A;  3NVZ A;  2K5P A;  1E8Z A;  1JWM D;  3ZTC A;  1I4X A;  3PS6 A;  2C5L C;  1D3Z A;  4F5V A;  2J0J A;  3WAM A;  1UOR A;  3DVN V;  4NJ7 A;  1SB0 A;  3RYT A;  3FNM A;  3BII D;  3KYC D;  3RNB C;  4KGR A;  2I30 A;  4W4U B;  4EZJ A;  1V6E A;  3FWC C;  2WX1 A;  3DVG X;  1KFY B;  3DWM A;  3JW0 X;  1E90 A;  1E6E B;  2ASQ A;  5FR3 A;  2KFJ A;  3DHH C;  1VCB A;  3C8Y A;  4GDL B;  2DYM A;  2BW2 A;  2L00 B;  5EE3 A;  4FBJ B;  3DBL B;  4KV2 A;  4DQO C;  3IAM 1;  3FC4 A;  3Q14 C;  4YTP B;  3DVG Y;  3IFW B;  2ICI A;  4Q2J A;  2WDQ B;  2JYT A;  2N9E B;  2OOB B;  5BMG A;  4K7U A;  1V8C A;  2K6Q A;  3UQB A;  1TZ1 A;  1C79 A;  3TIX A;  1OQQ A;  4P1B C;  1ZDV A;  2KTR B;  2QDF A;  4YSZ B;  1RWS A;  3E9S A;  4KDL B;  4LB9 A;  3EA6 A;  1WXM A;  1C4A A;  4EUT A;  2V4I B;  2R61 A;  2XNA C;  3GE8 C;  3I3T B;  4LNO A;  3OJ4 B;  3BVG A;  4XX5 A;  1NBF C;  4I9O A;  1WXQ A;  3SIV B;  3IAS 1;  3ZJU A;  1V1P B;  2LXT A;  1P9D U;  2DZM A;  4JQW C;  1JAL A;  2FCM A;  1TT5 B;  3JYU A;  3AEC B;  3W5U B;  2HDE A;  2JZZ A;  4WUR A;  4LJO B;  2KQS A;  3RT3 B;  2JF5 A;  3L4P A;  2JXX A;  1WX7 A;  3P2B A;  3EFU A;  1RLF A;  1WRD B;  3N32 A;  4WAF A;  1FPY A;  1Y56 A;  2VH1 A;  2RDG A;  3NRZ A;  2J52 A;  3AED B;  3C19 A;  5EE9 A;  2QHB A;  4M02 A;  2X38 A;  3V3X A;  4GLS C;  2Z8J A;  1Z2M A;  4N59 A;  2E6X A;  4EMX A;  4DWF A;  1H5W A;  2BYV E;  1HK4 A;  2NPT B;  2NTS A;  2BKR B;  4ACF A;  3BWU D;  3ZNI D;  1BM0 A;  4MM3 B;  3H9D A;  4ZCG A;  2FUG 1;  2GOW A;  4GDL A;  1WGD A;  3ZTD A;  4GOC A;  5LXH A;  2RGF A;  4G0N B;  3VRA B;  3ZNZ B;  3RFZ B;  3Q8F A;  1JNB A;  2JWZ A;  3M63 B;  2LAS A;  3MHZ A;  1SBB B;  2KFK B;  2JT4 B;  2O2V B;  2BS2 B;  3SQJ A;  1SE2 A;  1E7P B;  3IBE A;  1WX8 A;  1F52 A;  3GQU A;  2GBK A;  3RNA C;  2NBU A;  2BTE A;  1MFW A;  2RMM A;  4DM0 A;  1ZDX A;  2KTR A;  2BS3 B;  3KWL A;  4L9K A;  1MIW A;  3APF A;  1T0S C;  1FCL A;  1FNU A;  5BYR A;  3SFE B;  3AEG B;  2LEK A;  2LXS A;  1KM7 A;  4C7Y A;  4AS1 A;  1T0Q C;  2LXA A;  1NYR A;  2ZZP B;  2EFE A;  3GQX A;  3VTW A;  5HFY A;  2RR9 A;  1V1P A;  2CJN A;  4II2 B;  3ZRF A;  2LUM A;  2J0K A;  2W55 A;  2N7D A;  4IM0 A;  3UI3 A;  1ESF A;  4NPN A;  4OTU A;  3JQZ A;  1SIJ A;  4EZK A;  3CWI A;  4C4V B;  4IWP A;  5IJ5 A;  1P0R A;  1S1Q B;  1V86 A;  1V2Y A;  2SAK A;  2BXA A;  1WF9 A;  2H89 B;  4NQK E;  4ARC A;  1VZS A;  4W9F A;  5GIP A;  4HLE A;  3A1Q B;  3T9L A;  2BXQ A;  2M4N A;  1XCQ L;  1LM8 B;  2OJR A;  3AE4 B;  4JWU C;  1MUH A;  2BXD A;  2RDH A;  3I63 C;  3NZS A;  2NPT A;  1GNU A;  4BY9 C;  1N62 A;  1XF5 L;  4LDT D;  1NT2 B;  4K71 A;  4K81 A;  4AQ7 A;  4EE2 A;  2XVW A;  4MM3 A;  2M56 B;  1YJJ A;  3TDL A;  2I2Y A;  1D5M C;  2K8B A;  1FXI A;  2LFI A;  2MBO A;  3PZ7 A;  1CMX B;  4GB9 A;  3W1S A;  3IVF A;  1WR6 E;  4HK2 A;  4KVG B;  3MHS D;  2KFK A;  1BKE A;  2MBB B;  2LHE A;  3N1Y C;  2O2V A;  4GXB A;  3B9J A;  4FN2 A;  2WXK A;  4PT5 A;  5BMI A;  5DQF A;  4N6E B;  5BPK A;  4BKG A;  4S1Y A;  3RPF C;  1A5R A;  2KC1 A;  2LVO A;  1U4A A;  3QWZ B;  3MC8 A;  2KQ7 A;  2LGI A;  1QF6 A;  4LNN A;  4HCN B;  4M0W B;  4F8C B;  1WY8 A;  2WWZ A;  2XVV A;  4FK5 B;  4BKE A;  4HGK A;  3A75 A;  4HKZ E;  1PDX A;  2L83 A;  1FCC C;  4GGQ A;  2N4F A;  1SSN A;  1HEZ E;  3A4R A;  2PKO A;  1T3Q A;  5AEK B;  2IND C;  3Q3J A;  4BKS D;  3DQV A;  4DXF A;  5JZE B;  4L1B A;  1KLG D;  3N1X C;  3KH0 A;  4FA6 A;  4C4V A;  3V6C B;  2KAN A;  4LLG M;  3QJZ A;  5DPS A;  2K3U A;  1QQR A;  3PRZ A;  1C76 A;  4MDK E;  5IO9 A;  1SEB D;  4OHJ A;  2KX0 A;  2Y5B B;  4DHX B;  2JPH A;  2M17 A;  3VVW B;  5JH5 C;  5IN7 A;  3KW5 B;  4REZ A;  2WXJ A;  2D3A A;  3EUB 2;  3ABV B;  3A1Q A;  1N5X A;  4MAC A;  1HE8 A;  4F1S A;  2IBI B;  2XW0 A;  5TSS A;  4ASW C;  1R4M B;  4JLC A;  1EWY C;  1YN5 A;  1V80 A;  1WR1 A;  3DOW A;  1YNT E;  2LQI A;  1L4D B;  3L13 A;  4ZHO A;  2VRR B;  3APC A;  2KDF B;  3P4S B;  1E7A A;  5HOZ A;  4FHJ A;  5L83 A;  1SXT A;  4YSY B;  2QIL A;  3I57 A;  3UIP B;  3NVY A;  3M62 B;  1XD3 B;  5IIX A;  2MBH A;  5IKC M;  1OEY J;  2QCZ A;  3ZKJ C;  4L8U A;  4ANV A;  4LDT B;  4GIV A;  4S17 A;  2IY0 B;  3VFK A;  1L0V B;  4UDU C;  5IJE A;  2IO0 B;  2XVU A;  2JZP A;  4GU2 A;  3MTN B;  2WXL A;  2J0M A;  2O6V D;  1UGJ A;  3I5J C;  4MT5 A;  5DPR A;  4M0W A;  3PTF C;  2CS4 A;  3PLA A;  2BX8 A;  2RPQ A;  3NUH B;  3MHS B;  1KRH A;  2IPK D;  2KOX A;  4XDC A;  1C78 A;  2QHO A;  3RCZ A;  3RUL A;  3WAL A;  1V5T A;  3Q69 A;  1IBX B;  2PJH A;  3B2F A;  3IG3 A;  3MHH B;  2L05 A;  1CZP A;  4KIK B;  3B2G A;  3GS2 A;  4AJY B;  1VDV A;  1WX9 A;  2RSU A;  3PSE B;  4FUL A;  4TQ1 A;  2KVZ A;  4K3B A;  1FM0 D;  1MUS A;  3GA9 L;  1UF0 A;  1GNI A;  2HJ8 A;  2FCN A;  2PEA A;  1NEN B;  2GB1 A;  1MG8 A;  3BK1 A;  3TBL D;  4TSS A;  2NTT A;  2LGS A;  2JSV X;  2KAC A;  2Q5W D;  3P4P B;  4NAW B;  3ZJT A;  2KDE B;  3EFC A;  3DHI C;  2L0T A;  3M99 C;  4WQO B;  4KDI C;  1IPG A;  2IO3 B;  2INC C;  1HK2 A;  1FFU A;  5J2R A;  2MP2 B;  3KJL A;  1N60 A;  2KTF A;  1KJT A;  4RFB A;  2WLB A;  2PW9 A;  1RYJ A;  3N30 A;  5EE0 A;  4NY0 A;  2WYQ A;  4WJP A;  3DBH I;  2WXR A;  4G03 A;  2LRU A;  1C4P A;  4WWO A;  4FJZ A;  1E10 A;  4JWS C;  3LB8 C;  4P1C C;  4PS3 A;  3SHQ A;  4W9E A;  2KWD A;  2MHJ A;  3H3A A;  4A3O A;  5KHO A;  3NS8 A;  3V08 A;  3R8B A;  2WXO A;  3PZD A;  1GPX A;  3MC0 B;  1ET6 A;  1LGR A;  2WQY B;  5IIU A;  2BXE A;  1FRD A;  1WE7 A;  1DOY A;  2LUE A;  3AV8 A;  1B9R A;  3V6E B;  3WAO A;  2ONQ A;  1WJU A;  1IBX A;  1X1M A;  1YQ4 B;  1MM8 A;  3SU8 X;  4D2K A;  2AQ3 B;  5AZG A;  4OZC A;  3VUX A;  4AUQ C;  1ZXH A;  4KIK A;  4WWM A;  4XWW A;  1QOG A;  3GOE A;  4HPM B;  2WXH A;  4WQM A;  3HUI A;  2QMT A;  1R4N I;  1LNS A;  1D5Z C;  2O6V B;  3UF8 A;  1VR9 A;  1JML A;  2ZPN A;  1E8X A;  2L3Z A;  2WU2 B;  1Y8R C;  2M0A A;  3N1Z C;  5LLI A;  3T3N A;  4WJQ A;  4HKQ A;  4PYZ A;  1BJ5 A;  4YTM B;  1E9M A;  5B5T A;  2GBR A;  3VR9 B;  4NAW A;  5MPO A;  1TS2 A;  4BKS A;  2V0G A;  1C3T A;  1IP9 A;  2KWV B;  1V5O A;  3SIU B;  1N61 A;  2WDV B;  3Q3N C;  2MP2 A;  1TS3 A;  4KZ0 A;  1HK3 A;  2JXT A;  2KWF A;  2ZNV B;  3Q6B A;  1VLB A;  4LTU A;  3LJ3 A;  1XLQ A;  4J2V A;  4M70 B;  3JSV B;  1RM6 C;  2FID A;  1JWB D;  2EFC A;  1JRP A;  1IYF A;  4GMV A;  5E6P A;  5L95 C;  2LGY A;  2ZCB A;  1TIF A;  4DHJ D;  3NG0 A;  2MCN B;  3AH7 A;  2V4L A;  4MH8 A;  5EDS A;  3QX1 A;  3PGE A;  2MH7 A;  2ZPY A;  1XT9 B;  2JU6 X;  4XC2 A;  5FUO A;  3HVZ A;  1E8Y A;  3DBL I;  1H4R A;  2W3S A;  3VTV A;  3ZQ4 A;  2QM6 A;  1F2R I;  1C77 A;  1JRU A;  2J53 A;  3PRE A;  3WAN A;  1WI0 A;  3VH4 B;  5CHV C;  3TUO A;  1WM3 A;  3ZIM A;  3W9C B;  3CSF A;  3GE3 C;  4HJG E;  1CK1 A;  3U8Z A;  1JWS D;  3ZW3 A;  1Q10 A;  2AWT A;  1FD6 A;  2IO1 B;  4N0U D;  3URY A;  2LMC A;  4A3P A;  2K9X A;  3L17 A;  4EOY A;  2WXF A;  4A8X C;  1WGH A;  3WCQ A;  3A9J B;  2LHD A;  5AUK A;  1DYQ A;  2YEP B;  1DOX A;  4DK5 A;  2O6V A;  3ZXV A;  5GIN A;  1ROE A;  2AJE A;  4E74 A;  1KF6 B;  3WIM A;  2M8S A;  2MX2 A;  4BFR A;  2MSE D;  1ACC A;  5I4D A;  4KKI A;  1UEL A;  2DBU A;  4G3X B;  4ZRI A;  1JQ4 A;  3U30 A;  5CHF A;  4W9C A;  3R2T A;  1F1H A;  3AE6 B;  2WXG A;  2ZW1 A;  3NVI A;  2CHZ A;  2ZJD A;  1UZX B;  5FKA C;  1KH0 A;  1QZE A;  3B1L X;  2KLC A;  1MIV A;  4N3Z A;  3JSV A;  4USA A;  1JWA D;  2XK5 B;  1I4Q A;  2K6D B;  1UNS A;  4EKU A;  2KN4 A;  3X23 A;  3W2D A;  1SE3 A;  4J6I A;  1IJG A;  3L08 A;  4EZL A;  3L0W B;  3VDZ A;  2KBZ A;  2NR2 A;  1YQB A;  3GZN I;  5FK9 C;  4AWJ A;  1LXD A;  4YXD B;  1XLO A;  4IOI E;  1C1Y B;  2HD5 B;  1RFA A;  1F2R C;  1K8R B;  3DBS A;  3U7D A;  1ZPS A;  1YIW A;  2V3N A;  2J42 A;  5D3D A;  3VHT C;  3PPA A;  5AUI A;  2KK8 A;  3ZNG C;  2WDR B;  3NHE B;  1V81 A;  3RZW C;  2EFD A;  2NVU I;  2K39 A;  2J4X A;  2PLP A;  4W9G A;  4DHJ B;  4IUM B;  1MG4 A;  5HI1 A;  3AN1 A;  2DYB A;  1XCT L;  1Z5S B;  3A9J A;  4M8M A;  3T3O A;  4KZC A;  3M3J A;  4ZBR A;  4JIO U;  1SF0 A;  3AI5 A;  1T0R C;  2PPH A;  2B76 B;  2BF8 B;  1G6J A;  4I6N B;  2MQJ A;  3Q2A C;  1L0X B;  4LNK A;  1GC6 A;  2KWU B;  4WWN A;  4M00 A;  3AE9 B;  4A6Q A;  4WWP A;  2G9H D;  1SE9 A;  2ZW0 A;  2BXI A;  2WXI A;  2UYZ B;  4ZYS A;  2QC8 A;  1WJN A;  4FJC B;  4I6L B;  2KHW B;  2Y5P A;  2N7E A;  3KWV A;  1JWU D;  3V62 A;  2IO2 B;  1QOB A;  1EF5 A;  4WJN A;  4YL8 A;  1HK5 A;  2DX5 B;  3DBR B;  5ID9 A;  2KMM A;  3Q8B A;  1M4V A;  1AWD A;  4ZC6 A;  3MFG A;  2OT3 A;  2J7Q B;  2N9X A;  3HVD A;  2XK5 A;  2D3C A;  4US9 A;  4ZRK A;  3WHQ A;  4C7Z A;  1N5U A;  5GHK A;  4JPS A;  4HDQ A;  3P42 A;  2MJ3 A;  2VH2 A;  3ML9 A;  2BXC A;  1HA5 A;  4ZRQ A;  5AZH A;  3PHX B;  2AQ2 B;  2QJL A;  4ICU A;  2GBM A;  3PVL A;  1GUA B;  4P6V F;  2DHZ A;  2BXL A;  2KDB A;  3Q3M C;  2WU5 B;  4BVU C;  4G04 A;  4TQ0 A;  3TCA A;  4QAY A;  5G5H A;  4RM8 A;  2X8X X;  4H2A A;  2LOQ A;  1YX5 B;  3G9K D;  4D7X A;  4TUU A;  3PZ8 A;  4LCD E;  4ANU A;  2MBQ A;  2ZVO A;  1T5X D;  4IW0 A;  2DYO A;  2M1M A;  2HE7 A;  4BZA A;  1VZ6 A;  1AO6 A;  2BXM A;  1WXS A;  2IZV B;  4J3O D;  3QQ8 B;  3FWB C;  1YN3 A;  2OHF A;  3AE8 B;  1MVK A;  2FNJ B;  1M94 A;  2K25 A;  1LFD A;  4BAX A;  2XSI A;  5C23 A;  5FR6 A;  3ZJV A;  3AEF B;  5LNK 1;  4WAA A;  4MEM A;  2HTM E;  2HTH A;  2VUF A;  4NQL B;  4WH4 A;  3NZ3 A;  3NVV A;  3D32 A;  4FIP B;  3HM6 X;  1NEK B;  1XEE A;  1KXP D;  3ETR A;  1C9F A;  5CX3 A;  4II3 B;  2AEH A;  2KXJ A;  5G5G A;  1FEH A;  3OWE B;  4KKJ A;  3A73 A;  1KLU D;  4DDI D;  3Q8C A;  2TSS A;  1KDX A;  3DDC B;  1ENF A;  1K53 A;  2VZK D;  1HZ5 A;  3IT4 B;  5D94 A;  4L2Y A;  4OW0 A;  4WA6 B;  1WE6 A;  5E6O A;  3NOB A;  3TJP A;  3OAW A;  2PE9 A;  5BYQ A;  3Q3F A;  2D07 B;  2WXM A;  3UIO B;  4JGH B;  1P7E A;  5GMV A;  1E7H A;  1N5W A;  1ZGU B;  1UH6 A;  2LJ5 A;  2KT7 A;  5C1Z A;  2LGD A;  4XGA B;  2FBW B;  1UBQ A;  1TBE A;  4HVB A;  1V49 A;  2N1V A;  5G55 A;  4MSQ B;  2GUT A;  2BYE A;  4JK4 A;  1A70 A;  3TL5 A;  1WSP A;  5AZF A;  2JWU A;  3DPD A;  3TEW A;  1DOI A;  2KDM A;  2MWS B;  4JE3 B;  2WXP A;  4DHZ B;  4FLH A;  3H1U A;  2I1K A;  5IAA C;  3R7R A;  2K0N A;  3BYT B;  2A5U A;  1TYG B;  3V60 A;  4IG7 B;  2NMQ A;  2CHW A;  2MJE A;  4MJS B;  2DBY A;  5HHD G;  4BBN F;  2XN9 C;  4EFO A;  2MLB A;  1TXU A;  1L6V A;  3PRM B;  3HRD D;  1P1A A;  2IGD A;  2B3A A;  3KLS X;  1PGB A;  2MJD A;  3B9L A;  2KN5 A;  2WDT B;  2GLS A;  2KKC A;  3QK0 A;  4W9J A;  1TZO A;  1UUP A;  1EWC A;  2DLB A;  5D6J B;  5DPW A;  1MA9 A;  3ENE A;  1NI2 A;  2I2Z A;  3BPJ A;  1L7Y A;  4BKT A;  2BKF A;  2G1E A;  2OZB B;  1I4G A;  1T0Y A;  2CHX A;  1LQB A;  3KQ4 A;  3QAQ A;  4IKG A;  4RH6 A;  2GMI C;  2FCQ A;  2K1F A;  4HDO A;  2BBC A;  3H7S A;  3WHR A;  3A4S C;  3A33 B;  3NMU A;  5J17 A;  1QOF A;  4ZBQ A;  3ZDT A;  3R66 C;  2W82 A;  3U4E G;  2VZK B;  3VRB B;  1SB3 C;  2LI5 A;  1F77 A;  1YQ3 B;  2EMS A;  1FRR A;  2N0S B;  3A9K B;  4ZYN A;  3TEX A;  2BYF A;  4P16 A;  3PO0 A;  5GIO A;  3DHG C;  4IWQ A;  2KNB A;  3MJW A;  3JVZ X;  3BY4 B;  4YSX B;  2CJO A;  3ZGZ A;  2A4Z A;  3PHW B;  1GOZ A;  4GN1 A;  1UGM A;  3AUL A;  1XLP A;  3IHP C;  4DXG A;  1E7E A;  1QT9 A;  4IW1 A;  4E99 A;  3V05 A;  1RAX A;  1WFY A;  4W9L A;  3GB1 A;  4OVZ A;  2BGF A;  3V61 A;  2LVQ A;  2VDB A;  3NJT A;  3UIN B;  3SEB A;  2KD0 A;  1FMA D;  2NS5 A;  3KUC B;  1I4P A;  3HK0 A;  2XEW A;  2Z59 B;  2YDF A;  2INN E;  4MJS A;  5IIH A;  2Z8I A;  2R2O A;  3QCA A;  2DG5 A;  2UWQ A;  4F5U A;  4ZRJ A;  4W9K A;  4PYU A;  3Q8E A;  3VUY A;  4N9F 4;  4AJW A;  3KUZ A;  5HG2 A;  4JX1 C;  1J7C A;  2QMC A;  3B0A A;  4A90 A;  1EM7 A;  3BZD B;  3RNE C;  2D2Q A;  1F9J A;  4AOF A;  1FIQ A;  2CR5 A;  1MI0 A;  1ZKH A;  4A9A A;  1J7B A;  4Z9O A;  4NAM A;  2LJI A;  1TF0 A;  2G3Q B;  4A55 A;  4XWT A;  2NNW A;  3LU6 A;  2DZK A;  2INP E;  2DBW A;  2M0X A;  2BXO A;  2L76 A;  4MSM B;  2DAJ A;  3P4R B;  1HZ6 A;  2IGH A;  3V09 A;  1D6E C;  4LUH A;  3BK2 A;  3KYD D; 
#chains in the Genus database with same CATH homology
 4DDG D;  3HHM A;  1BML C;  2AX5 A;  2DWQ A;  1STE A;  4KSL C;  2LXC A;  2V3P A;  1SJH D;  1TY2 A;  4RM9 A;  1WH3 A;  2DAF A;  1I7H A;  4W9H A;  3EGR A;  5H8Y E;  3A9K A;  3W5V B;  4B95 A;  2FAZ A;  1RFK A;  3Q8A A;  1HA2 A;  2L1A A;  1IGC A;  4CQN A;  3TEY A;  1MIY A;  4ZBK A;  3ECI A;  1D5X C;  3AE3 B;  4HEA 1;  3AE7 B;  4JL9 A;  4BOS C;  4YTN B;  1DGJ A;  3IXS A;  4MGZ E;  3ONS A;  4XDD A;  3N3K B;  1QOA A;  1EF1 A;  3ZRC A;  3IT6 B;  2KO3 A;  2G45 B;  2JUO A;  2QEJ C;  2L0F A;  2BYT A;  2AYO B;  2YLM A;  1XQQ A;  4A20 A;  4E71 A;  1WZ3 A;  1GNJ A;  2WP9 B;  3L16 A;  4G11 A;  2YVC A;  3X0W A;  3R7Q A;  1TY0 A;  1OGW A;  1Q1O A;  4HJK A;  4ANX A;  1WGK A;  2MA9 B;  3P1M A;  1I4H A;  1NI3 A;  1LOT A;  4CO7 A;  4FJV B;  5E6J A;  2BXF A;  4MGI E;  1B1Z A;  2R2Q A;  2MRP A;  3V03 A;  1QIL A;  1XO3 A;  1BUI C;  2ZVN A;  1J78 A;  2KLG A;  2XMO A;  2SEB D;  1TKE A;  1EU3 A;  2I1J A;  2V1Y A;  5G2N A;  1WXV A;  2W3R A;  4RGT A;  2RPV A;  3K9O B;  3PV1 A;  3RUI B;  1VJK A;  2ZNV C;  1WGR A;  3KUD B;  2L32 A;  3ML8 A;  4KSK C;  1YJI A;  1MPE A;  1O9X A;  1GB4 A;  4HPL B;  4XZ4 A;  4IM2 A;  5EE1 A;  3EEC A;  4OTT A;  2ROH A;  1S3S G;  1SIF A;  4B9K A;  2QSD A;  1E7G A;  2FE8 A;  1ZW7 A;  2FIF A;  4WJO A;  3PLV A;  2BWE S;  5J18 A;  3VR8 B;  2JX5 A;  1NYQ A;  3WHS A;  2V36 A;  1OQY A;  4W9I A;  4YWG G;  1PQS A;  1GAQ B;  1ZUD 2;  4IW2 A;  1FNW A;  3GP7 A;  2N7J A;  3BVM A;  1TKG A;  2BXB A;  1VFI A;  4OVU A;  3DCG A;  4HWI B;  3P4Q B;  2WX0 A;  4HXD A;  2GBJ A;  3ALB A;  1WJ4 A;  3APD A;  1LO5 D;  1BXT A;  3W1Y A;  4GDX A;  5JHB A;  4IC7 B;  3H7P B;  4M8N A;  1R7S A;  1KOT A;  4RCO A;  4PS8 A;  1N63 A;  3NZU A;  3ZDM C;  1K51 A;  4DHZ E;  3AM9 A;  2KVR A;  2N9P C;  2LZ6 A;  3QHT A;  3NVW A;  2WXN A;  4FJY A;  5TR5 A;  3SR6 A;  2BXK A;  4BBN C;  4E3C A;  1D4B A;  2EFH A;  2ZEQ A;  1WYG A;  1SJE D;  1NVI D;  2D11 A;  3PLU A;  3SFD B;  1PGX A;  3TSS A;  2N9L A;  1GB1 A;  4RGO S;  4WIP A;  3C0R B;  2KDI A;  3LXF A;  3FIL B;  2KJH B;  2XVQ A;  1E7F A;  4URK A;  2JUH A;  3DBR I;  4FXC A;  4US8 A;  3HM3 A;  1YX6 B;  1IUE A;  1ZOY B;  4LJP B;  1OFF A;  2LGX A;  4DBG A;  2ACZ B;  2K22 A;  2BXG A;  1GG3 A;  2NBW B;  3PT2 B;  3SDL C;  5BMH A;  4IDI A;  3CX9 A;  4X57 B;  3B08 A;  4MEL A;  3AMZ A;  4OZB A;  1L2N A;  1MHX A;  2IYD B;  4L23 A;  4ICV A;  3UGB B;  4B0E A;  4DXA B;  4R3D A;  2BWF A;  2PMV A;  3TEZ A;  2PIA A;  2WNM A;  3LYY A;  3ZLZ A;  2BPS A;  1UD7 A;  3UQA A;  2XW1 A;  2JYE A;  1KTK A;  5BYS A;  5DBY A;  1FOU A;  1RRB A;  2C7H A;  2VUE A;  4N58 A;  5LXI B;  1PFD A;  2JRI B;  3W1S C;  2REX A;  2DEN B;  1VZ7 A;  3LDZ E;  4ZOH C;  3ZO5 B;  1WXA A;  3VTU A;  2H88 B;  3H7P A;  3L54 A;  2IY1 B;  5DPT A;  3QAR A;  1WGY A;  4B6W A;  5C2T B;  3BVZ A;  2CU3 A;  4LB2 A;  4FAD A;  3NVK A;  4F7Z A;  1ZP0 B;  1PYW D;  2E3T A;  2C60 A;  1K50 A;  5CHW A;  1GC7 A;  1I4R A;  2KAJ A;  5D3I B;  1UWX A;  4I6P A;  1E7V A;  3QIJ A;  2NBV B;  4HRS A;  2BB5 A;  3RZF A;  1FXT B;  4EEW A;  5CTR C;  4AP4 C;  2EEL A;  1VZ8 A;  2L8J A;  2K0P A;  4K7S A;  4OZA A;  3FIL A;  1FO4 A;  1V9J A;  3EHV A;  1YJ1 A;  2PE6 B;  3TMP B;  1SE4 A;  2JVC A;  3WA0 A;  4CYE A;  4RMA A;  1YMH E;  4MH0 E;  3LU8 A;  3VQI A;  1F0Z A;  3T8M A;  1TS4 A;  4GDK B;  2KMA A;  2DBX A;  3FAH A;  2NQO A;  2JZ3 B;  2KWC A;  3U52 E;  3CF6 E;  4ZHP A;  1GJZ A;  5BO4 B;  4BOZ B;  1JCK B;  1VRA B;  1P7F A;  4GG2 A;  5IJF A;  2XBB C;  1E7C A;  3KIK A;  2L52 A;  4G50 A;  2KQ4 X;  2E0Y A;  1J7E A;  1R4M I;  1EU4 A;  2JQR B;  4W9D A;  3CIR B;  3AU5 A;  1K52 A;  5ID7 A;  4NNJ B;  3NS1 A;  5IFO A;  1QKZ A;  3U7Z A;  2G4D B;  1T6B X;  2BXH A;  3AEA B;  5H92 C;  1WWT A;  3BIN A;  2ZCC A;  2PVG C;  1IGD A;  2WS3 B;  1Q5W B;  2W54 A;  3BYY B;  1ET9 A;  4P7I A;  3H8H A;  3H6N A;  2NCN A;  2V3S A;  5KHQ A;  1L5P A;  4ANW A;  3ZNH B;  2D10 A;  2FUH B;  1WGG A;  3VXW A;  4NJ6 A;  1HK1 A;  2KJ6 A;  2LVP A;  3RD2 A;  2W9N A;  2BXP A;  4OVV A;  2KMC A;  4K2C A;  1WYW B;  2D3G A;  2N9K A;  4TV3 A;  3KVF B;  4XE0 A;  3PRP B;  4HGM B;  3O13 A;  4C56 C;  1BT0 A;  4C80 A;  2C7N B;  2Z8K A;  2IDY A;  3AB5 A;  1EUV B;  2CKH B;  2K8H A;  3VH3 B;  4KGT A;  1WRI A;  4RGN A;  1P98 A;  2EKI A;  1V97 A;  1WMH B;  1HQR D;  2AL3 A;  2LWP A;  2YEP F;  2LD9 A;  3EC8 A;  1KLV A;  1WZ0 A;  1YN4 A;  2M19 A;  4PO0 A;  3VAW A;  3ICX A;  2Z0E B;  1L6U A;  4IWO A;  2IJ0 A;  3L10 B;  1AYF A;  3NY5 A;  1FXA A;  4TKN A;  4L9Q A;  1C4C A;  4GDK A;  2Z8L A;  4G01 A;  1XLN A;  2EMT A;  1E7B A;  5D2M B;  5JXV A;  2MW5 A;  2KC2 A;  4NJC A;  1J0G A;  4IM3 A;  2N1W A;  3J9C A;  4OT2 A;  3AE5 B;  2G4S A;  4ITK A;  1UBI A;  4B0M A;  3UIV A;  3I9V 1;  3O65 B;  2KX3 A;  2KZR A;  2EKE C;  4PS7 A;  2CKX A;  3ZUN A;  3LU7 A;  1E5W A;  2MEK A;  4FHK A;  2GBN A;  3OLM D;  3AEB B;  1SGH A;  1WM2 A;  4MBE C;  4LUF A;  4CHK A;  1XXG A;  3R2I A;  3HIZ A;  1E78 A;  4OR0 A;  3JRY A;  4RGM A;  4ZRP A;  2DZJ A;  1Q0W B;  1KW2 A;  3CST A;  1JRO A;  4N0F D;  2BB6 A;  1E0Z A;  1JW9 D;  3ZYY X;  2AL6 A;  1PGA A;  1QLB B;  5E6N A;  1VD2 A;  1E7U A;  2JY6 A;  4O1N A;  1H8C A;  1FFV A;  1J8C A;  3AEE B;  1WMH A;  2IGG A;  3OJ3 A;  1WJ6 A;  1OEY A;  4NZL B;  1E7I A;  4MGY E;  4GSW A;  1OQR A;  4K1R B;  1OTR B;  3N9Y C;  3CMM B;  1I35 A;  2DZI A;  3E56 A;  2C7M B;  1ZE3 D;  4Z69 A;  2GRI A;  2JRH A;  3WAP A;  1NDD A;  3ZVV A;  3AXC A;  1CQV A;  2E0X A;  1J7A A;  4YT0 B;  3R3M A;  4TMA B;  3H37 A;  5DCN A;  4LA0 A;  1TKY A;  4C31 B;  1J19 A;  2GI9 A;  4HRO A;  1TGZ B;  3U2S C;  2BT6 A;  2BS4 B;  4HCP B;  1TTN A;  4F5S A;  5GXG B;  2L7R A;  3MJ5 A;  5JHA A;  2I38 A;  4ZUX V;  3B9M A;  1V1O A;  2BXN A;  2AQ1 B;  3DWG C;  2Y3A A;  4LK0 M;  5HKH A;  1UWM A;  3QC8 B;  2Y5C A;  1ZXI A;  4ARI A;  5C3J B;  4RNA A;  2KJR A;  1TS5 A;  4RF0 A;  5D7G A;  1L0Y B;  1L4Z B;  1AN8 A;  1EO6 A;  2OED A;  2C9W B;  1WIA A;  2PVO D;  2WXQ A;  2QIE B;  5T8I A;  1TJE A;  3AE1 B;  2RD0 A;  1ISN A;  1CJE A;  1PUT A;  3DVN U;  4MGK E;  4F5T A;  1AW7 A;  4K7W A;  3S2A A;  4ZDV A;  3NVM A;  4KX6 B;  1AAR A;  1E8W A;  2Z0D B;  3K9P B;  3MP9 A;  2D5G A;  2ON8 A;  3P63 A;  1HXY D;  2CU1 A;  3AU4 A;  3M95 A;  1YD8 U;  2LRW A;  4KGS A;  2K8C A;  2MBE A;  1I42 A;  4RF1 A;  3QA8 A;  1MHH E;  1P3Q U;  5IA7 A;  2PTL A;  1FNV A;  3SD5 A;  2FCS A;  3AE2 B;  1H9Z A;  3VUW A;  3NVZ A;  2K5P A;  1E8Z A;  3ZTC A;  1JWM D;  1I4X A;  3PS6 A;  2C5L C;  1D3Z A;  4F5V A;  2J0J A;  3WAM A;  1UOR A;  3DVN V;  4NJ7 A;  3RYT A;  3FNM A;  3BII D;  3KYC D;  4KGR A;  2I30 A;  4W4U B;  4EZJ A;  1V6E A;  3FWC C;  2WX1 A;  3DVG X;  1KFY B;  3DWM A;  3JW0 X;  1E90 A;  1E6E B;  2ASQ A;  5FR3 A;  2KFJ A;  1VCB A;  3C8Y A;  4GDL B;  2DYM A;  2BW2 A;  2L00 B;  5EE3 A;  4FBJ B;  4KV2 A;  4DQO C;  3IAM 1;  3FC4 A;  4YTP B;  3DVG Y;  3IFW B;  2ICI A;  4Q2J A;  2WDQ B;  2JYT A;  2N9E B;  2OOB B;  5BMG A;  4K7U A;  2K6Q A;  3UQB A;  1V8C A;  1TZ1 A;  1C79 A;  3TIX A;  1OQQ A;  1ZDV A;  2KTR B;  4YSZ B;  1RWS A;  3E9S A;  4KDL B;  4LB9 A;  3EA6 A;  1WXM A;  1C4A A;  4EUT A;  2V4I B;  2R61 A;  2XNA C;  3I3T B;  3OJ4 B;  3BVG A;  4XX5 A;  1NBF C;  1WXQ A;  3SIV B;  3IAS 1;  3ZJU A;  1V1P B;  1P9D U;  2DZM A;  4JQW C;  1JAL A;  2FCM A;  3JYU A;  3AEC B;  3W5U B;  2HDE A;  2JZZ A;  4WUR A;  4LJO B;  2KQS A;  3RT3 B;  2JF5 A;  3L4P A;  2JXX A;  1WX7 A;  3P2B A;  3EFU A;  1RLF A;  1WRD B;  3N32 A;  4WAF A;  1Y56 A;  2RDG A;  3NRZ A;  2J52 A;  3AED B;  5EE9 A;  2QHB A;  2X38 A;  3V3X A;  4GLS C;  2Z8J A;  1Z2M A;  4N59 A;  2E6X A;  4EMX A;  4DWF A;  1H5W A;  2BYV E;  1HK4 A;  2NPT B;  2NTS A;  2BKR B;  3BWU D;  3ZNI D;  1BM0 A;  4MM3 B;  3H9D A;  4ZCG A;  2FUG 1;  2GOW A;  4GDL A;  1WGD A;  3ZTD A;  4GOC A;  5LXH A;  2RGF A;  4G0N B;  3VRA B;  3ZNZ B;  3RFZ B;  3Q8F A;  1JNB A;  2JWZ A;  3M63 B;  2LAS A;  3MHZ A;  1SBB B;  2KFK B;  2JT4 B;  2O2V B;  2BS2 B;  3SQJ A;  1SE2 A;  1E7P B;  3IBE A;  1WX8 A;  3GQU A;  2GBK A;  2NBU A;  2BTE A;  2RMM A;  1ZDX A;  2KTR A;  2BS3 B;  3KWL A;  4L9K A;  1MIW A;  3APF A;  1FCL A;  1FNU A;  5BYR A;  3SFE B;  3AEG B;  2LEK A;  1KM7 A;  4C7Y A;  4AS1 A;  2LXA A;  1NYR A;  2EFE A;  3GQX A;  2ZZP B;  3VTW A;  5HFY A;  2RR9 A;  1V1P A;  2CJN A;  4II2 B;  3ZRF A;  2LUM A;  2J0K A;  2W55 A;  2N7D A;  4IM0 A;  3UI3 A;  1ESF A;  4NPN A;  4OTU A;  3JQZ A;  1SIJ A;  4EZK A;  3CWI A;  4IWP A;  5IJ5 A;  1P0R A;  1S1Q B;  1V86 A;  1V2Y A;  2SAK A;  2BXA A;  1WF9 A;  2H89 B;  4NQK E;  4ARC A;  1VZS A;  4W9F A;  5GIP A;  4HLE A;  3A1Q B;  3T9L A;  2BXQ A;  2M4N A;  1XCQ L;  1LM8 B;  2OJR A;  3AE4 B;  4JWU C;  2BXD A;  2RDH A;  3NZS A;  2NPT A;  1GNU A;  4BY9 C;  1N62 A;  1XF5 L;  4LDT D;  1NT2 B;  4K71 A;  4K81 A;  4AQ7 A;  4EE2 A;  2XVW A;  4MM3 A;  2M56 B;  1YJJ A;  3TDL A;  2I2Y A;  2K8B A;  1D5M C;  1FXI A;  2LFI A;  2MBO A;  3PZ7 A;  1CMX B;  4GB9 A;  3W1S A;  3IVF A;  1WR6 E;  4HK2 A;  4KVG B;  3MHS D;  2KFK A;  1BKE A;  2MBB B;  2LHE A;  2O2V A;  4GXB A;  4FN2 A;  3B9J A;  2WXK A;  4PT5 A;  5BMI A;  5DQF A;  4N6E B;  5BPK A;  4BKG A;  4S1Y A;  3RPF C;  1A5R A;  2KC1 A;  2LVO A;  1U4A A;  3QWZ B;  2KQ7 A;  2LGI A;  1QF6 A;  4HCN B;  4M0W B;  4F8C B;  1WY8 A;  2WWZ A;  2XVV A;  4FK5 B;  4BKE A;  4HGK A;  3A75 A;  4HKZ E;  1PDX A;  2L83 A;  1FCC C;  4GGQ A;  2N4F A;  1SSN A;  1HEZ E;  3A4R A;  2PKO A;  1T3Q A;  5AEK B;  3Q3J A;  4BKS D;  3DQV A;  4DXF A;  5JZE B;  4L1B A;  1KLG D;  3KH0 A;  4FA6 A;  3V6C B;  2KAN A;  4LLG M;  3QJZ A;  5DPS A;  3PRZ A;  1QQR A;  2K3U A;  1C76 A;  4MDK E;  1SEB D;  4OHJ A;  2KX0 A;  2Y5B B;  4DHX B;  2JPH A;  2M17 A;  3VVW B;  5JH5 C;  3KW5 B;  4REZ A;  2WXJ A;  3EUB 2;  3ABV B;  3A1Q A;  1N5X A;  4MAC A;  1HE8 A;  4F1S A;  2IBI B;  2XW0 A;  4ASW C;  5TSS A;  4JLC A;  1EWY C;  1YN5 A;  1V80 A;  1WR1 A;  3DOW A;  1YNT E;  1L4D B;  3L13 A;  4ZHO A;  2VRR B;  3APC A;  2KDF B;  3P4S B;  1E7A A;  5HOZ A;  4FHJ A;  5L83 A;  1SXT A;  4YSY B;  2QIL A;  3I57 A;  3UIP B;  3NVY A;  3M62 B;  1XD3 B;  5IIX A;  2MBH A;  1OEY J;  3ZKJ C;  4L8U A;  4ANV A;  4LDT B;  4GIV A;  2IY0 B;  3VFK A;  1L0V B;  4UDU C;  5IJE A;  2IO0 B;  2XVU A;  2JZP A;  4GU2 A;  3MTN B;  2WXL A;  2J0M A;  2O6V D;  5DPR A;  1UGJ A;  4MT5 A;  4M0W A;  3PTF C;  2CS4 A;  3PLA A;  2BX8 A;  2RPQ A;  3NUH B;  3MHS B;  1KRH A;  2IPK D;  2KOX A;  4XDC A;  1C78 A;  2QHO A;  3RCZ A;  3RUL A;  3WAL A;  1V5T A;  3Q69 A;  1IBX B;  2PJH A;  3B2F A;  3IG3 A;  3MHH B;  2L05 A;  1CZP A;  4KIK B;  3B2G A;  3GS2 A;  4AJY B;  1VDV A;  1WX9 A;  2RSU A;  3PSE B;  4FUL A;  4TQ1 A;  1FM0 D;  3GA9 L;  1GNI A;  2HJ8 A;  2FCN A;  2PEA A;  1NEN B;  2GB1 A;  1MG8 A;  3BK1 A;  3TBL D;  4TSS A;  2NTT A;  3P4P B;  2JSV X;  2KAC A;  2Q5W D;  4NAW B;  3ZJT A;  2KDE B;  2L0T A;  3M99 C;  4WQO B;  4KDI C;  1IPG A;  2IO3 B;  1HK2 A;  1FFU A;  5J2R A;  2MP2 B;  3KJL A;  1N60 A;  2KTF A;  1KJT A;  4RFB A;  2WLB A;  2PW9 A;  3N30 A;  1RYJ A;  5EE0 A;  4NY0 A;  2WYQ A;  4WJP A;  3DBH I;  2WXR A;  4G03 A;  2LRU A;  1C4P A;  4WWO A;  4FJZ A;  1E10 A;  4JWS C;  3LB8 C;  4PS3 A;  3SHQ A;  4W9E A;  2KWD A;  3H3A A;  4A3O A;  5KHO A;  3NS8 A;  3V08 A;  3R8B A;  2WXO A;  3PZD A;  1GPX A;  3MC0 B;  1ET6 A;  2WQY B;  5IIU A;  2BXE A;  1FRD A;  1WE7 A;  1DOY A;  2LUE A;  3AV8 A;  1B9R A;  3V6E B;  3WAO A;  2ONQ A;  1WJU A;  1IBX A;  1X1M A;  1YQ4 B;  3SU8 X;  4D2K A;  2AQ3 B;  5AZG A;  4OZC A;  3VUX A;  4AUQ C;  1ZXH A;  4KIK A;  4WWM A;  4XWW A;  1QOG A;  3GOE A;  4HPM B;  2WXH A;  4WQM A;  3HUI A;  2QMT A;  1R4N I;  1LNS A;  1D5Z C;  2O6V B;  3UF8 A;  1VR9 A;  1JML A;  2ZPN A;  1E8X A;  2L3Z A;  2WU2 B;  1Y8R C;  2M0A A;  5LLI A;  3T3N A;  4WJQ A;  4HKQ A;  4PYZ A;  1BJ5 A;  4YTM B;  1E9M A;  5B5T A;  2GBR A;  3VR9 B;  4NAW A;  5MPO A;  1TS2 A;  4BKS A;  2V0G A;  1C3T A;  1IP9 A;  2KWV B;  1V5O A;  3SIU B;  1N61 A;  2WDV B;  2MP2 A;  1TS3 A;  4KZ0 A;  1HK3 A;  2JXT A;  2ZNV B;  1VLB A;  4LTU A;  3LJ3 A;  1XLQ A;  4J2V A;  4M70 B;  3JSV B;  2FID A;  1RM6 C;  1JWB D;  2EFC A;  1JRP A;  1IYF A;  5E6P A;  4GMV A;  5L95 C;  2LGY A;  2ZCB A;  4DHJ D;  2MCN B;  3AH7 A;  2V4L A;  4MH8 A;  5EDS A;  3QX1 A;  3PGE A;  2MH7 A;  2ZPY A;  1XT9 B;  2JU6 X;  4XC2 A;  5FUO A;  3HVZ A;  1E8Y A;  3DBL I;  1H4R A;  2W3S A;  3VTV A;  3ZQ4 A;  2QM6 A;  1F2R I;  1C77 A;  1JRU A;  2J53 A;  3PRE A;  3WAN A;  1WI0 A;  3VH4 B;  5CHV C;  3TUO A;  1WM3 A;  3ZIM A;  3W9C B;  3CSF A;  4HJG E;  1CK1 A;  3U8Z A;  3ZW3 A;  1JWS D;  1Q10 A;  2AWT A;  1FD6 A;  2IO1 B;  4N0U D;  3URY A;  4A3P A;  2LMC A;  3L17 A;  4EOY A;  2K9X A;  2WXF A;  4A8X C;  1WGH A;  3WCQ A;  3A9J B;  2LHD A;  5AUK A;  1DYQ A;  2YEP B;  1DOX A;  4DK5 A;  2O6V A;  5GIN A;  1ROE A;  2AJE A;  4E74 A;  1KF6 B;  3WIM A;  2M8S A;  2MX2 A;  4BFR A;  2MSE D;  1ACC A;  5I4D A;  4KKI A;  1UEL A;  2DBU A;  4G3X B;  4ZRI A;  1JQ4 A;  3U30 A;  5CHF A;  4W9C A;  3R2T A;  3AE6 B;  2WXG A;  2ZW1 A;  3NVI A;  2CHZ A;  2ZJD A;  1UZX B;  5FKA C;  1KH0 A;  1QZE A;  3B1L X;  2KLC A;  1MIV A;  4N3Z A;  3JSV A;  4USA A;  2XK5 B;  1JWA D;  1I4Q A;  2K6D B;  4EKU A;  1UNS A;  3X23 A;  2KN4 A;  3W2D A;  1SE3 A;  4J6I A;  1IJG A;  3L08 A;  4EZL A;  3L0W B;  3VDZ A;  2KBZ A;  2NR2 A;  1YQB A;  3GZN I;  5FK9 C;  4AWJ A;  1LXD A;  4YXD B;  1XLO A;  4IOI E;  1C1Y B;  2HD5 B;  1RFA A;  1F2R C;  1K8R B;  3DBS A;  3U7D A;  1ZPS A;  1YIW A;  2V3N A;  2J42 A;  5D3D A;  3VHT C;  3PPA A;  5AUI A;  2KK8 A;  3ZNG C;  2WDR B;  3NHE B;  1V81 A;  3RZW C;  2EFD A;  2NVU I;  2K39 A;  2J4X A;  4W9G A;  4DHJ B;  2PLP A;  4IUM B;  5HI1 A;  3AN1 A;  2DYB A;  1Z5S B;  1XCT L;  3A9J A;  4M8M A;  3T3O A;  4KZC A;  3M3J A;  4ZBR A;  4JIO U;  1SF0 A;  3AI5 A;  2PPH A;  2B76 B;  2BF8 B;  1G6J A;  4I6N B;  2MQJ A;  1L0X B;  1GC6 A;  2KWU B;  4WWN A;  3AE9 B;  4A6Q A;  4WWP A;  2G9H D;  1SE9 A;  2ZW0 A;  2BXI A;  2WXI A;  2UYZ B;  4ZYS A;  1WJN A;  4FJC B;  4I6L B;  2KHW B;  2Y5P A;  2N7E A;  3KWV A;  3V62 A;  1JWU D;  2IO2 B;  1QOB A;  1EF5 A;  4WJN A;  4YL8 A;  1HK5 A;  2DX5 B;  5ID9 A;  2KMM A;  3Q8B A;  1M4V A;  4ZC6 A;  1AWD A;  3MFG A;  2OT3 A;  2J7Q B;  2N9X A;  3HVD A;  2XK5 A;  4US9 A;  4ZRK A;  3WHQ A;  4C7Z A;  1N5U A;  5GHK A;  4JPS A;  4HDQ A;  3P42 A;  2MJ3 A;  3ML9 A;  2BXC A;  1HA5 A;  4ZRQ A;  5AZH A;  3PHX B;  2AQ2 B;  4ICU A;  2QJL A;  2GBM A;  3PVL A;  1GUA B;  4P6V F;  2DHZ A;  2BXL A;  2KDB A;  2WU5 B;  4BVU C;  4G04 A;  4TQ0 A;  3TCA A;  5G5H A;  4RM8 A;  4H2A A;  2LOQ A;  1YX5 B;  3G9K D;  4TUU A;  3PZ8 A;  4LCD E;  4ANU A;  2MBQ A;  2ZVO A;  4IW0 A;  1T5X D;  2DYO A;  2M1M A;  2HE7 A;  1VZ6 A;  1AO6 A;  2BXM A;  1WXS A;  2IZV B;  4J3O D;  3QQ8 B;  3FWB C;  1YN3 A;  2OHF A;  3AE8 B;  1MVK A;  2FNJ B;  1M94 A;  2K25 A;  1LFD A;  2XSI A;  5C23 A;  5FR6 A;  3ZJV A;  3AEF B;  5LNK 1;  4WAA A;  4MEM A;  2HTM E;  2HTH A;  2VUF A;  4NQL B;  4WH4 A;  3NZ3 A;  3NVV A;  3D32 A;  4FIP B;  3HM6 X;  1NEK B;  1XEE A;  1KXP D;  3ETR A;  1C9F A;  5CX3 A;  4II3 B;  2AEH A;  2KXJ A;  5G5G A;  1FEH A;  3OWE B;  4KKJ A;  3A73 A;  1KLU D;  4DDI D;  3Q8C A;  2TSS A;  3DDC B;  1ENF A;  1K53 A;  2VZK D;  1HZ5 A;  3IT4 B;  5D94 A;  4L2Y A;  4OW0 A;  4WA6 B;  1WE6 A;  5E6O A;  3NOB A;  3TJP A;  3OAW A;  2PE9 A;  5BYQ A;  3Q3F A;  2D07 B;  2WXM A;  3UIO B;  4JGH B;  1P7E A;  5GMV A;  1E7H A;  1ZGU B;  1N5W A;  1UH6 A;  2LJ5 A;  5C1Z A;  2LGD A;  2FBW B;  1UBQ A;  1TBE A;  4HVB A;  1V49 A;  2N1V A;  5G55 A;  4MSQ B;  2BYE A;  4JK4 A;  1A70 A;  3TL5 A;  1WSP A;  5AZF A;  3DPD A;  2JWU A;  3TEW A;  1DOI A;  2KDM A;  2MWS B;  4JE3 B;  2WXP A;  4DHZ B;  4FLH A;  3H1U A;  2I1K A;  5IAA C;  3R7R A;  3BYT B;  2A5U A;  3V60 A;  1TYG B;  4IG7 B;  2NMQ A;  2CHW A;  2MJE A;  4MJS B;  2DBY A;  5HHD G;  4BBN F;  2XN9 C;  4EFO A;  2MLB A;  1TXU A;  1L6V A;  3PRM B;  3HRD D;  1P1A A;  2IGD A;  2B3A A;  3KLS X;  1PGB A;  2MJD A;  3B9L A;  2KN5 A;  2WDT B;  2KKC A;  3QK0 A;  4W9J A;  1TZO A;  1UUP A;  1EWC A;  2DLB A;  5D6J B;  5DPW A;  1MA9 A;  3ENE A;  1NI2 A;  2I2Z A;  1L7Y A;  4BKT A;  2BKF A;  2G1E A;  2OZB B;  1T0Y A;  1I4G A;  2CHX A;  1LQB A;  3QAQ A;  3KQ4 A;  4IKG A;  4RH6 A;  2GMI C;  2FCQ A;  2K1F A;  4HDO A;  2BBC A;  3H7S A;  3WHR A;  3A4S C;  3A33 B;  3NMU A;  5J17 A;  1QOF A;  4ZBQ A;  3ZDT A;  3R66 C;  2W82 A;  3U4E G;  2VZK B;  3VRB B;  2LI5 A;  1SB3 C;  1F77 A;  1YQ3 B;  2EMS A;  1FRR A;  3A9K B;  2N0S B;  4ZYN A;  3TEX A;  2BYF A;  4P16 A;  3PO0 A;  5GIO A;  4IWQ A;  2KNB A;  3MJW A;  3JVZ X;  3BY4 B;  4YSX B;  2CJO A;  3ZGZ A;  2A4Z A;  3PHW B;  1GOZ A;  4GN1 A;  1UGM A;  3AUL A;  1XLP A;  3IHP C;  4DXG A;  1E7E A;  1QT9 A;  4IW1 A;  4E99 A;  3V05 A;  1RAX A;  1WFY A;  4W9L A;  3GB1 A;  4OVZ A;  2BGF A;  3V61 A;  2LVQ A;  2VDB A;  3UIN B;  3SEB A;  2KD0 A;  1FMA D;  2NS5 A;  3KUC B;  1I4P A;  3HK0 A;  2XEW A;  2Z59 B;  2YDF A;  4MJS A;  2INN E;  5IIH A;  2Z8I A;  2R2O A;  3QCA A;  2DG5 A;  2UWQ A;  4F5U A;  4ZRJ A;  4W9K A;  4PYU A;  3Q8E A;  3VUY A;  4N9F 4;  4AJW A;  3KUZ A;  5HG2 A;  4JX1 C;  1J7C A;  2QMC A;  3B0A A;  4A90 A;  1EM7 A;  3BZD B;  2D2Q A;  1F9J A;  4AOF A;  2CR5 A;  1FIQ A;  1MI0 A;  1ZKH A;  4A9A A;  1J7B A;  4Z9O A;  4NAM A;  2LJI A;  1TF0 A;  2G3Q B;  4A55 A;  4XWT A;  2NNW A;  3LU6 A;  2DZK A;  2INP E;  2DBW A;  2M0X A;  2BXO A;  2L76 A;  4MSM B;  2DAJ A;  3P4R B;  1HZ6 A;  2IGH A;  3V09 A;  1D6E C;  4LUH A;  3BK2 A;  3KYD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...