2DYMA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-46) complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
285
structure length
254
Chain Sequence
AHMNDIKQLLWNGELNVLVSIDPSFEIAVLRIRVPRETYLVNYMPLIWNKIKSYFWFEHNKTPIPWNYPVGVLFDCLAGFTTSFENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTTFRISQPTISMTGVNPTLKDIEGDILDVKDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover/protein turnover
molecule keywords Autophagy protein 5
total genus 72
structure length 254
sequence length 285
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dymA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dymA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dymA01
3W1SA 1WZ3A 3PREA 2LWPA 3NZUA 3A1QB 3PTFC 1RFAA 2YVCA 4NPNA 4JQWC 2KKCA 2KNBA 4W9FA 2L0FA 5DPWA 3VUXA 4CHKA 3KH0A 2JVCA 3PRZA 4PS3A 3NY5A 1EO6A 1HE8A 2LGDA 3QC8B 2Z59B 5AEKB 3S2AA 3TIXA 2PEAA 4HXDA 3B1LX 1P9DU 1V80A 3MHSD 1R4NI 3VTWA 2CU1A 1L2NA 1WX7A 3QA8A 1SGHA 5LXHA 4AUQC 4W9KA 1WI0A 2GMIC 3RUIB 2IZVB 1WZ0A 3KW5B 1WF9A 2K39A 2KANA 4NJ7A 3R7RA 2EMSA 3H9DA 2PJHA 4IC7B 3ECIA 3U7DA 5LXIB 4ZRKA 5CHFA 4F8CB 3UQAA 3MJWA 3VDZA 3GZNI 4FBJB 3X0WA 2KHWB 2WX0A 3RYTA 2JF5A 4GN1A 4B95A 3MTNB 2AEHA 2NPTA 2KMAA 2W9NA 5J17A 1WXSA 4RM9A 5L95C 4WJNA 2K6QA 4I6PA 4ZDVA 3DCGA 4ANVA 1RRBA 3DDCB 3OJ4B 1I35A 1GC7A 3RULA 2MBQA 1WE7A 2C5LC 2C9WB 2HD5B 2LJ5A 2NBUA 3PV1A 4MJSA 4NAWA 4WQOB 4X57B 2BWES 2JZ3B 2REXA 3ALBA 3AU4A 2KJHB 3QARA 3ZTCA 4ANWA 3EHVA 5J18A 1GUAB 5JHBA 1UD7A 1WFYA 2GBRA 2KC2A 4N9F4 2N9XA 1E90A 3DVNU 1C3TA 4MJSB 1WXAA 3PZDA 4W9HA 4IW0A 3VAWA 2LRUA 2JPHA 2ZPYA 5AZFA 4DBGA 2DYBA 2ZCCA 2JZZA 3PS6A 2KMCA 3DPDA 1F9JA 5CHWA 1WY8A 2XBBC 2O6VA 5JHAA 4DWFA 3ZUNA 1Q0WB 1P98A 3ZLZA 5JH5C 1KLVA 2MW5A 2JUOA 1WGDA 3TCAA 1MG8A 4K7WA 5KHOA 4BVUC 4URKA 2KN5A 3H7PB 2KX3A 2O6VB 4B6WA 2HE7A 2K8HA 1YQBA 1E8YA 4WJOA 2CR5A 4ANXA 2LXCA 2HTHA 5DPTA 1IP9A 2V1YA 4GDKB 1WM3A 1J19A 4BOZB 2WDTB 2DAFA 3I3TB 3VTVA 1WJNA 4K81A 4TKNA 4W9EA 2EMTA 2G3QB 3EECA 4II2B 3ZKJC 1V5TA 1GJZA 1ISNA 1PQSA 1WJ4A 1V86A 2ZJDA 5E6PA 4MGKE 1EF5A 2L0TA 4KVGB 3ZTDA 4KSLC 4BBNF 4GDLB 4IWPA 2AL3A 3QQ8B 2KTRA 2KDFB 4W9DA 2GBMA 2C7MB 1EUVB 2K25A 2UYZB 1YIWA 2L3ZA 1UBQA 3DOWA 4JGHB 4W9GA 2KFKB 4EKUA 2WX1A 2IO3B 4CO7A 4XZ4A 2R2QA 2KLCA 4BKSD 4DXAB 2KDBA 3U8ZA 4P7IA 2MBHA 3WAPA 4NNJB 2DZIA 3DVGX 1WMHA 5EDSA 3ZDTA 1GC6A 1V6EA 3A4RA 2CHWA 1XT9B 3C0RB 2JWZA 4FLHA 2DYOA 1OEYA 2OOBB 3K9OB 1Q5WB 2L7RA 2KWUB 3M3JA 1E7UA 4ZRIA 4AP4C 2NVUI 1NBFC 4BBNC 2O2VB 4GDKA 3A9JB 2MBEA 4HJKA 4DDGD 1UBIA 4LDTD 2FUHB 1UELA 1KOTA 4JL9A 4LCDE 2N9PC 3VQIA 1Z2MA 1ZKHA 2K1FA 1KM7A 4IWOA 2JY6A 1JRUA 3RCZA 3V62A 3WIMA 3L13A 5HKHA 4HCPB 4GU2A 3ZIMA 3H7SA 4HDOA 1S3SG 1WMHB 1LM8B 3VUYA 4EFOA 2HJ8A 2WYQA 4KDLB 2G4DB 2V3SA 1FXTB 4KV2A 4MDKE 2GBNA 2LVOA 4OVUA 2KTFA 3V6EB 4ZRJA 1E7VA 2IO2B 2BYEA 2RD0A 3LJ3A 4PS8A 1T0YA 2GBJA 1WX8A 2MSED 4B9KA 4M0WB 2XK5A 1UZXB 2LI5A 3V61A 4WAAA 3A33B 3KUCB 2N7DA 3UIOB 2PE9A 2N9EB 5C1ZA 3ML9A 2MA9B 5L83A 1U4AA 2D10A 2AWTA 4MM3A 3TBLD 3CSFA 2N4FA 3VHTC 2FCSA 3ZDMC 4BOSC 3ZVVA 2L8JA 1RLFA 4F7ZA 2UWQA 2KLGA 3L0WB 3D32A 3KUDB 4M8MA 2LZ6A 2RSUA 4JIOU 2IO1B 2JRIB 4GMVA 5IA7A 3V6CB 1H8CA 2D2QA 1IPGA 2MQJA 3BY4B 4DK5A 2C7NB 4EUTA 1NDDA 1I42A 3OAWA 3QK0A 2D11A 2KJRA 4JLCA 3ZNGC 1WH3A 2KQSA 2M4NA 4IM0A 3N3KB 2YLMA 3VTUA 4TV3A 4A3PA 4RMAA 1D3ZA 2KQ7A 2DENB 2IO0B 2KZRA 3M95A 4WJQA 5D94A 4E3CA 2LUEA 4DHZE 3KYCD 3B0AA 2ZPNA 3L08A 4ANUA 2N7EA 4EZKA 2A4ZA 2J0JA 2J7QB 4DHZB 1J8CA 1GNUA 3IG3A 2LD9A 4FADA 3RZFA 2BKRB 3WALA 4HWIB 4WWNA 2G45B 2DAJA 2Z0EB 2K8CA 3VFKA 3CF6E 5TR5A 4GOCA 2WWZA 3ONSA 3WANA 4FA6A 2KXJA 1VD2A 4EZLA 4PS7A 4NQLB 3APCA 1R4MI 3W1YA 3NZSA 4HK2A 1WR6E 2XEWA 4AJWA 2ZVNA 5J2RA 4BKGA 2KX0A 2ZEQA 1WJUA 3VUWA 2J0KA 4MGYE 3VXWA 1RAXA 1XD3B 3KYDD 2M8SA 3A4SC 3KUZA 5DCNA 1P3QU 2BF8B 4IG7B 3ZRFA 3JYUA 3PSEB 2KFJA 1OGWA 5CHVC 5DPRA 2O2VA 4MELA 3PT2B 3UINB 2KOXA 3W1SC 3LDZE 1P0RA 4PYZA 4AJYB 3DBLI 2B3AA 1TZ1A 4RM8A 1L7YA 3OLMD 2K6DB 2GOWA 3R66C 4FJYA 5G2NA 4K7SA 2IY1B 4WWPA 3ZW3A 2LVQA 4FJVB 4K1RB 2R2OA 4J6IA 2GBKA 1V2YA 3IVFA 1NI2A 1E8ZA 3UF8A 3UQBA 3R7QA 2M1MA 3HHMA 3PHWB 3AU5A 2MLBA 3H6NA 3SD5A 1M94A 2VRRB 3ZRCA 3APFA 2MCNB 4NQKE 2NCNA 2PPHA 4A20A 2RR9A 2DZKA 2FCNA 3ENEA 4TUUA 2BWFA 4MGIE 3CMMB 2NBWB 1WM2A 3PGEA 3IFWB 1Y8RC 3RD2A 3Q3JA 3A9KB 2V4LA 1K8RB 2LXAA 3QJZA 4MSQB 2KO3A 1WXVA 2FAZA 4HLEA 1WR1A 3A9KA 4ICVA 2LGXA 4IUMB 5AZHA 2JXXA 3ZNID 3AXCA 2JRHA 2BKFA 2FCQA 4G3XB 3NHEB 4IM3A 3M63B 3ML8A 1LFDA 3Q3FA 2CS4A 2CHXA 4MGZE 2FIFA 2O6VD 5D2MB 4E74A 4PYUA 2AYOB 3H1UA 1OTRB 4M8NA 2N1WA 1YX6B 3WA0A 4EZJA 1YX5B 2M17A 2MRPA 4FULA 2PE6B 1YJ1A 4LDTB 2DYMA 2AL6A 4GIVA 1WGHA 1OEYJ 5E6OA 3SU8X 1E8XA 3QAQA 2ZVOA 4AWJA 3UGBB 4ICUA 1SIFA 1TTNA 2KWCA 3M62B 2MX2A 3L17A 3WAOA 2MWSB 4FHKA 2L05A 4F1SA 4G50A 1UH6A 3PRMB 5CX3A 5JZEB 1WIAA 3BINA 4KIKA 1VCBA 3WAMA 4DHJD 3B08A 2D3GA 1WGYA 3QCAA 2LVPA 2DZJA 1V9JA 4DDID 4DHJB 5G55A 1J0GA 1Q1OA 1P1AA 4FJZA 4ASWC 3UIPB 4II3B 5D7GA 3TJPA 4GGQA 2MP2A 3VH3B 2QHOA 3V60A 1WXMA 3JVZX 3L54A 2NR2A 2NBVB 3JSVA 4FHJA 1YD8U 3AULA 1V81A 4WJPA 2ASQA 2NS5A 4I6NB 4KSKC 3QHTA 2KK8A 2KFKA 1TBEA 1H4RA 2D07B 3X23A 3L10B 3SHQA 3EFUA 3ZNZB 1TGZB 2KTRB 3IBEA 2LASA 3PLUA 3JSVB 3OJ3A 1V5OA 2G4SA 1LQBA 2C60A 4WWOA 3VVWB 1XQQA 3NS8A 3HM3A 1UGMA 4CYEA 4ZYNA 1WJ6A 1S1QB 2K8BA 3DBSA 2ZCBA 5FR6A 3PHXB 4GSWA 1ZGUB 2BPSA 2OJRA 4EEWA 4BKTA 4HCNB 4K7UA 2IY0B 4NY0A 3EC8A 3RZWC 3A9JA 3DQVA 3ZNHB 2LRWA 5E6NA 1WE6A 3HK0A 5C23A 5IAAC 2FIDA 2ZNVC 2KDIA 2Y5BB 2L76A 4AOFA 1ZW7A 2L00B 5DPSA 4A3OA 2EKEC 3ZO5B 3H7PA 4MSMB 2Z0DB 3KVFB 4OVVA 3L16A 4G0NB 3T8MA 1LXDA 1E5WA 3TMPB 1IYFA 4XC2A 2C7HA 3K9PB 4GXBA 1E8WA 1WGGA 3A1QA 3DBRI 3N32A 3SDLC 5KHQA 2KDEB 3DBHI 2KWVB 4I6LB 1C1YB 1BT0A 2KVRA 3PLVA 4GDLA 2N1VA 3N30A 1AARA 2CHZA 2MP2B 3VH4B 4IWQA 3U30A 2DX5B 2DHZA 2DZMA 3PVLA 4MH0E 2XK5B 5BO4B 1SE9A 2JT4B 4W9JA 2BGFA 4KIKB 4W9LA 2MBOA 4EOYA 3HIZA 3P2BA 2IBIB 4NJ6A 5CTRC 1KJTA 1X1MA 4HPLB 3T9LA 2CKHB 3DVGY 1Z5SB 4KZCA 4W9CA 3CSTA 4KDIC 2MBBB 2BYFA 1A5RA 2NPTB 4IM2A 5GMVA 4FN2A 3QIJA 3R3MA 5LLIA 1EF1A 2ZZPB 2BYVE 1G6JA 4XX5A 3DVNV 4LJOB 1WX9A 3PRPB 1QZEA 5D6JB 1GG3A 4HVBA 3TL5A 4BKSA 2KJ6A 4GB9A 2J0MA 4HDQA 2I1KA 3IHPC 4G11A 1WYWB 3QWZB 1V49A 2I1JA 2A5UA 2M0XA 1WGRA 4MEMA 3RT3B 4TQ0A 1OQYA 4BFRA 2IYDB 3AI5A 4W9IA 2RGFA 3JW0X 1WRDB 2RPQA 3QX1A 4HPMB 4YL8A 3APDA 3PPAA 4NAWB 2FNJB 2KD0A 3HM6X 3NOBA 5AZGA 2LGYA 1CMXB 2ZNVB 4LJPB 4TQ1A 2FCMA 3GOEA 4E71A 2KC1A 3O65B 4KZ0A
chains in the Genus database with same CATH superfamily
3CWIA 3W1SA 1E7PB 1QKZA 4NAMA 3A1QB 4M70B 1RFAA 2LGIA 1F52A 1HE8A 5AEKB 3AEAB 1HK3A 3TIXA 3ZJVA 1MFWA 1P9DU 1V80A 3WCQA 1FNUA 2QEJC 3QA8A 1D4BA 4AUQC 1GNJA 3RUIB 1WZ0A 3I5JC 2K39A 4MT5A 1V1OA 3AEBB 3R7RA 2EMSA 2LOQA 3GP7A 3ECIA 3U7DA 1IGCA 4WURA 4ZRKA 4F8CB 3UQAA 1E7CA 2EFHA 3M99C 3X0WA 3H37A 1TS4A 2WX0A 3AM9A 2JF5A 4GN1A 1CK1A 1WXSA 1SE4A 2K6QA 2KACA 4ANVA 3DDCB 2VZKD 3RULA 3JQZA 4DQOC 5FKAC 5J18A 3AU4A 2KBZA 3AEGB 1GUAB 2SAKA 1VR9A 1UD7A 2GBRA 1XXGA 1CJEA 1MIWA 2N9XA 1E90A 4YWGG 1C3TA 2KMMA 1ET6A 1UGJA 2ZPYA 2DYBA 2ZCCA 2JZZA 3Q8CA 1WY8A 2K3UA 3OWEB 1J7EA 4DHXB 1SJED 2J42A 2GRIA 1FOUA 2BXPA 1C4PA 5KHOA 3WHQA 4BVUC 4F5TA 2HE7A 1R4MB 1YQBA 2K8HA 1E8YA 4WJOA 2LXCA 1YJIA 3ZJTA 1WM3A 1J19A 2VUEA 3B9LA 1WJNA 1UWMA 4K81A 1ISNA 4N59A 3KQ4A 3GQUA 1MHXA 2LXSA 1NYQA 3HVZA 4KSLC 4BBNF 4ZBRA 1KLGD 2C7MB 2UYZB 1Q10A 1UBQA 3DOWA 3DBHB 2R2QA 2KLCA 4LB9A 2KDBA 1ZOYB 2MBHA 4LNNA 4NNJB 3BK1A 3TEYA 2JX5A 4J3OD 1TXUA 3C0RB 2BS2B 2CHWA 2JWZA 1HK2A 4ZHPA 1Y56A 1Q5WB 2L7RA 5BMHA 1FRRA 4AP4C 4F5UA 1YN4A 5FR3A 3A9JB 4HJKA 1E9MA 1JWUD 5BYSA 2JY6A 1MIYA 4GU2A 3ZIMA 4C56C 4HDOA 1LM8B 3VUYA 2HJ8A 3IT6B 4KV2A 3KLSX 2GBNA 4OVUA 2IDYA 4K3BA 2IO2B 3LJ3A 1YMHE 2JUHA 3BVZA 1HK5A 2MSED 1UZXB 3LXFA 4WAAA 3A33B 3ECPA 5L83A 2WDQB 4OTUA 3AE7B 4M00A 2VDBA 3TBLD 2N4FA 2FCSA 3ZDMC 3ZVVA 2L8JA 1F0ZA 1RLFA 4H2AA 3D32A 3P4RB 1JWSD 4GMVA 2BS3B 1H8CA 2TSSA 3MC8A 2Z8JA 1IPGA 1F1HA 2WXOA 3BY4B 1I42A 4JLCA 1WXQA 3ZNGC 2KQSA 2M4NA 3MP9A 3N3KB 3AB5A 2ZW1A 2AQ1B 2KQ7A 3B9MA 1L4DB 2DENB 2KZRA 4KKJA 4MM3B 4WJQA 5D94A 1CQVA 4OZBA 2LUEA 1I4PA 3U7ZA 3LU8A 3B0AA 1VZSA 5BPKA 2J7QB 1GNUA 2H89B 4FADA 3RZFA 4ZRPA 3FWBC 3VR9B 2K8CA 1R7SA 3CF6E 2WWZA 1VD2A 2KXJA 4RFBA 4OR0A 1FNWA 5BYQA 2OEDA 4HK2A 4TMAB 4B0EA 4C4VA 2MJ3A 1JQ4A 1KDXA 2KX0A 1WJUA 4AS1A 2J0KA 3VXWA 1JCKB 1XD3B 2QSDA 3KYDD 1YQ3B 5DCNA 2JQRB 3PSEB 3UINB 2M56B 3PT2B 3W1SC 4HGKA 2GB1A 3LDZE 1P0RA 1JROA 4RM8A 2WXQA 1MA9A 4IW1A 4FJYA 5G2NA 4GG2A 2IY1B 4KX6B 2J52A 3UQBA 1P7FA 1NEKB 2MLBA 3SD5A 1M94A 1K52A 1D5MC 3APFA 2W3SA 2WHIA 2PPHA 4NQKE 1DOYA 4ZRQA 4WIPA 2RR9A 2FCNA 1DOXA 1FNVA 3NVYA 3PGEA 1Y8RC 3RD2A 2INNE 1K8RB 4MSQB 1ZDVA 4HLEA 3VRBB 4WQMA 2X8XX 3JRYA 3T3NA 1H9ZA 1FIQA 1NYRA 2FIFA 4WH4A 1I4QA 5D2MB 2LUMA 1VRAB 2AYOB 2V36A 3H1UA 1SB0A 2ZW0A 2N1WA 1YX5B 4O1NA 2MRPA 3LB8C 5H8YE 4LDTB 3TEZA 3IAS1 1SIFA 1TTNA 4OVZA 2MX2A 2BW2A 2DG5A 4FHKA 2K5PA 2QJLA 5EE0A 1TKEA 1JW9D 1O9XA 5IJ5A 2LVPA 1V9JA 1MIVA 5G55A 4MH8A 1N5XA 2MP2A 2FE8A 3VH3B 3V60A 1WXMA 2NBVB 3JSVA 1YD8U 1R4NB 2QCZA 4I6NB 3NJTA 2D07B 3ZGZA 3AE8B 3IXSA 3EFUA 1EWCA 2KTRB 2LASA 3AN1A 2AX5A 4HROA 3FC4A 1XEEA 3BPJA 4ZYNA 3ZQ4A 1S1QB 4XWTA 3DBSA 4GSWA 4EEWA 4HCNB 3NUHB 1V1PB 1VJKA 3A9JA 2DBXA 1WE6A 3HK0A 5C23A 2WXFA 2LGSA 2Y5BB 1F2RI 4L1BA 3ZXVA 3ZYYX 5B5TA 2Z0DB 3MHZA 3V3XA 1E5WA 3K9PB 3DBRB 1E7EA 4JWSC 1KW2A 3N32A 3SDLC 2KDEB 3DBHI 1GB4A 2QC8A 2K22A 4G03A 4N3ZA 3PLVA 3N30A 4EE2A 2DX5B 2DZMA 1I4RA 2XK5B 4YTPB 4W9LA 1AN8A 5AUIA 5CTRC 2CKHB 1Z5SB 5H92C 2BYFA 4KKIA 3AEDB 2K9XA 2BXLA 3AE9B 1G6JA 3DVNV 1XF5L 1DGJA 4LJOB 1QZEA 5D6JB 2M19A 5DQFA 4ARCA 3TL5A 2XVQA 4BKSA 1HZ6A 4GB9A 4N0FD 3FKYA 2LMCA 1WYWB 3QWZB 2I38A 2B76B 4GLSC 2BXAA 1ROEA 1VLBA 3R2IA 3VR8B 4D7XA 2RGFA 2RPQA 4HPMB 2JSVX 1QOGA 3APDA 1BKEA 2E3TA 2D3AA 3NOBA 2ZNVB 4TQ1A 2FCMA 4A9AA 4KZ0A 1WZ3A 3PREA 2LWPA 5IP4D 4NPNA 4W9FA 2KNBA 4J2VA 3N9YC 1PFDA 4JE3B 4IKGA 3KH0A 4PS3A 2BVCA 3QC8B 2Z59B 4LNFA 2PEAA 5IN7A 4HXDA 3VTWA 1D6EC 2CU1A 1WX7A 2XNAC 4W9KA 1T0RC 2KDMA 2IZVB 1WF9A 4KGTA 4LK0M 1V1PA 2KANA 4NJ7A 3H9DA 2PJHA 1FXIA 2I2YA 4ACFA 5CHFA 3R8BA 2V3NA 1QOBA 4RGMA 3NVWA 1IBXA 1XLOA 2G1EA 4B95A 4F5VA 2KMAA 3V08A 5J17A 4C00A 2WGSA 2MEKA 4WJNA 4ZDVA 1E7FA 3NRZA 1GC7A 2LJ5A 2C5LC 3N20C 2BWES 3QARA 2BXDA 5JHBA 1TYGB 3I57A 2JYTA 2KC2A 4N9F4 4ZOHC 1WXAA 3PZDA 1C76A 1XLPA 4PO0A 2WXPA 2Z8LA 4QAYA 2LHEA 2BXFA 1Q0WB 3V05A 1WGDA 4W4UB 2O6VB 3DHGC 2XSIA 4DXGA 4ZUXV 2CR5A 4ANXA 2Z8IA 1FFVA 2V1YA 1XLQA 4GDKB 4BOZB 2DAFA 3VTVA 1BM0A 4TKNA 4W9EA 3EECA 2PMVA 1QOFA 1V5TA 3ZKJC 1V86A 2ZJDA 2L0TA 4US8A 2PVOD 4GDLB 2KTRA 4KGSA 1NENB 2GBMA 2INPE 2IGGA 2RPVA 3HRDD 2WX1A 3NVVA 4DXAB 3HVDA 3WAPA 5HFYA 1LO5D 1T6BX 2ROHA 3A4RA 4YSYB 5HG2A 1OEYA 1E7UA 2QM6A 4ZBKA 3PZ8A 4P16A 2D3CA 4BBNC 1SB3C 2MBEA 4DDGD 4LDTD 1KOTA 1Z2MA 1ZKHA 3BVMA 2Y3AA 1KM7A 1EU4A 4IWOA 1MI0A 1JRUA 1XCQL 3V62A 2WXRA 3WIMA 2PTLA 1ENFA 3P4SB 1SXTA 4EFOA 4UDUC 4A6QA 2G4DB 1FXTB 2LVOA 3A75A 2L52A 3UIVA 2WXKA 3V6EB 1E7VA 1SJHD 1HK4A 2EKIA 4PS8A 2N9LA 4M0WB 2N7DA 4K3CA 3UIOB 1P7EA 5EE9A 4K71A 4FIPB 1FPYA 4MM3A 2JU6X 4OTTA 4BOSC 2MHJA 3L0WB 4RCOA 3KUDB 1TY2A 4M8MA 3BYYB 2LZ6A 2QIEB 4JIOU 2NTTA 1XLNA 2IO1B 4C80A 3V6CB 3MC9A 3NG0A 2MQJA 1K51A 2BXBA 4DK5A 2C7NB 2D11A 4RF0A 2OZBB 1WH3A 3ETRA 4BAXA 1K53A 1YN3A 3VTUA 4A3PA 1TIFA 1D3ZA 4D2KA 1AO6A 2BYTA 3M95A 2R61A 1C9FA 4DHZE 3L08A 2A4ZA 2J0JA 3AEFB 4HKQA 2LQHA 3GS2A 1J8CA 3EA6A 3G9KD 2LD9A 2NTSA 3WALA 1SSNA 2G45B 1ET9A 1MPEA 5TR5A 2GLSA 3ZXRA 2EFEA 4L9QA 3W1YA 3NZSA 3GQXA 2XEWA 3P4QB 3MHHB 2L1AA 1WWTA 4YXDB 1TY0A 1E7BA 2M8SA 2K0NA 3ZRFA 4IG7B 4US9A 1CZPA 3JYUA 4WA6B 1HA5A 1JWMD 2KFJA 2LJIA 3W2DA 4MELA 2KOXA 4AJYB 1AW7A 1K50A 2B3AA 3TEXA 1L7YA 5BMIA 1E7IA 3FAHA 1M4VA 2GOWA 1E7HA 3Q8BA 3TDLA 2IGDA 1SIJA 2R2OA 1NI2A 5GHKA 3UF8A 2M1MA 1IJGA 2VRRB 3ZRCA 1ZUD2 2MCNB 1QILA 1H5WA 5G5GA 1E0ZA 2INDC 2NBWB 4MBEC 1WM2A 5IOIA 5I4DA 2XVVA 3A9KB 4E99A 3P4PB 4GDXA 3B2FA 1WR1A 3PLAA 2LGXA 4IUMB 2JXXA 3KWVA 1OQQA 2V4IB 3SR6A 3TSSA 1VFIA 4N6EB 4Z9OA 4ARIA 1LFDA 3Q3FA 3N1YC 2CHXA 2O6VD 4P1CC 2DNFA 1DYQA 4EZJA 3WA0A 4S0RA 5GIOA 4FULA 2PE6B 2AGHB 2DYMA 2JXTA 4GIVA 1TF0A 3SIVB 2KVZA 1OEYJ 2ZVOA 4MACA 4RH6A 3NVMA 3WAOA 2L05A 5JXVA 1WSPA 1B1ZA 3B08A 1WGYA 3QCAA 4DDID 4DHJB 1J0GA 3GE3C 3TJPA 3L54A 2NR2A 3UI3A 4WJPA 2ASQA 3C8YA 4P6VF 3BZDB 3QHTA 1MUHA 2DBYA 3AE6B 3SHQA 3ZNZB 4LUFA 1TGZB 3PLUA 2G4SA 1LQBA 4WWOA 5IIHA 1XQQA 3HM3A 1E7GA 4CYEA 3E56A 2BXIA 3AE4B 2BPSA 2OJRA 4K7UA 3DQVA 2LRWA 2J4XA 2ZNVC 2KDIA 4AOFA 1ZW7A 3ZO5B 5AUKA 3B9JA 3T8MA 3TMPB 1IYFA 2D5GA 2WNMA 4LTUA 1YNTE 3A1QA 4Z69A 3DBRI 4I6LB 1BT0A 2WU2B 2G9HD 2KVRA 3VH4B 1AARA 2MP2B 2DHZA 3PVLA 4PK1A 4MH0E 2EELA 1RFKA 2MBOA 1ZXIA 4FN2A 2VUFA 3R3MA 5HI1A 2X38A 1EF1A 2ZZPB 2DBUA 2BT6A 4HVBA 2V3PA 3NVIA 1NI3A 1FM0D 4G11A 1V49A 2I1JA 3RT3B 1OQYA 4BFRA 4Q2JA 4JPSA 4NAWB 2KD0A 1CMXB 2CJOA 2XVUA 2HDEA 1KF6B 4E71A 3GOEA 4EMXA 4RGOS 4HPPA 1MJDA 4BKEA 1SBBB 3Q3MC 5DPWA 3VUXA 4N0UD 2JVCA 1WRIA 1MHHE 3S2AA 3B1LX 1R4NI 1L2NA 1SGHA 4YTNB 2KAJA 1WI0A 1KH0A 1FMAD 3KW5B 1LOTA 2MJDA 2W55A 5MPOA 2V9HA 4M01A 2K0PA 2WXLA 3MJWA 3VDZA 4FBJB 4C4VB 3BK2A 2DBWA 4WAFA 1FCCC 1QOAA 2AEHA 2NPTA 3N1ZC 2RDHA 1N62A 1IUEA 2W9NA 3MC0B 1L0YB 3AE1B 2FBWB 3DCGA 3AE2B 1I35A 1ZDXA 1WE7A 2C9WB 4MJSA 3PV1A 3CIRB 3A73A 3NVKA 1L6UA 2JZ3B 2REXA 4ANWA 2W3RA 3ZTCA 1L6VA 4LLGM 3BIID 1WFYA 5C3JB 3DVNU 4MJSB 3VAWA 4DBGA 4LB2A 3PS6A 2KMCA 2BS4B 3DPDA 2O6VA 3SFEB 5JHAA 4DWFA 3ZUNA 5GIPA 1KLVA 2JUOA 2KWFA 2BXQA 4K7WA 1PDXA 1ZXHA 2KX3A 3Q8FA 2HTHA 2WXJA 1IP9A 4HJGE 1VDVA 4OW0A 3MJ5A 3KIKA 3H3AA 3NMUA 3SIUB 1JALA 4KVGB 2L83A 3QQ8B 4W9DA 2KDFB 2K25A 4JGHB 1YIWA 2L3ZA 1UNSA 4W9GA 2KFKB 4EKUA 2IO3B 2KT7A 4BKSD 2BXHA 4P7IA 2BXNA 3MHSB 3AV8A 2RDGA 4XDCA 3ZDTA 1V6EA 1XT9B 3GZNB 2OOBB 4A8XC 4XDDA 4ZRIA 2CKXA 1J7BA 2NVUI 5ID7A 1NBFC 3BYTB 4GDKA 3TUOA 2FUHB 1UELA 4JL9A 4LCDE 2N9PC 3VQIA 3W5VB 3W5UB 3L13A 4YT0B 1E10A 5HKHA 4HCPB 1IGDA 3L4PA 1S3SG 4RF1A 4IW2A 2WYQA 4KDLB 1UORA 2V3SA 3N1XC 2J53A 3NZ3A 1TT5B 2JWUA 4ZRJA 2UU7A 1T0YA 2GBJA 2PLPA 4B9KA 4N58A 4L9KA 2LI5A 4OHJA 3V61A 1WGKA 5C1ZA 1C78A 1U4AA 2D10A 2AWTA 1QQRA 3AE5B 3VHTC 4XWWA 1ESFA 1JWAD 4F7ZA 4JX1C 2RSUA 3V09A 2JRIB 5IA7A 2BXEA 3GA9L 1IBXB 3NS1A 1GNIA 2XVWA 1J7AA 1NDDA 3OAWA 3QK0A 1PGBA 2KJRA 1HA2A 1C79A 2XN9C 2QMCA 4ZC6A 3LU6A 2IO0B 1D5ZC 1JMLA 4R3DA 2ZPNA 3H8HA 2VH2A 4I9OA 3IG3A 2BKRB 2QILA 1BJ5A 5EE3A 4WWNA 2Z0EB 1HK1A 4C7ZA 1HZ5A 3FILA 4EZLA 4ZHOA 1YQ4B 2GI9A 4PS7A 1R4MI 4ITKA 4RGTA 1WR6E 4ZCGA 3SQJA 1KRHA 1MM8A 2ZVNA 5J2RA 1I4HA 2ZEQA 2SEBD 3VUWA 4MGYE 1KXPD 3A4SC 3KUZA 2HJ1A 1P3QU 2BF8B 3DBLB 3DHIC 4FK5B 1N60A 5CHVC 2Q5WD 3Q3NC 1HXYD 2O2VA 1FD6A 5IIUA 4PYZA 3DBLI 1YN5A 1KTKA 1TZ1A 3OLMD 1N5WA 1PGXA 3R66C 4K7SA 3RMKC 4WWPA 3ZW3A 4FJVB 4C7YA 4K1RB 2Y5CA 1YJJA 3IVFA 2WP9B 5EE1A 3R7QA 1UUPA 3PHWB 2WXIA 4NZLB 3IT4B 2PW9A 2NCNA 4G01A 2N0SB 3FILB 4A20A 2DZKA 2BWFA 3AE3B 3IFWB 1HQRD 2V4LA 3QJZA 2KO3A 2BXOA 3A9KA 5AZHA 3AXCA 2JRHA 1SF0A 2BKFA 2I30A 2CS4A 2XMOA 1T5XD 4MGZE 3CX9A 1BXTA 4E74A 4PYUA 1OTRB 4L8UA 4M8NA 1YX6B 1YJ1A 1L0XB 5BYRA 4AWJA 4ICUA 1LGRA 2KWCA 2VH1A 1FRDA 1J7CA 3L17A 2MWSB 4F1SA 4G50A 1UH6A 3PRMB 1QT9A 5CX3A 3SFDB 2WLBA 3BINA 1JNBA 3ZJUA 2E0YA 1VCBA 4B0MA 4DHJD 3BWUD 4FJCB 5DBYA 3Q3OC 1Q1OA 1P1AA 3Q6BA 5D7GA 4GGQA 1AYFA 2QHOA 4FHJA 1BMLC 3AULA 1T0SC 3VRAB 3Q14C 3E9SA 1KLUD 2KK8A 3GE8C 1TKGA 1H4RA 1MG4A 3X23A 3L10B 3JSVB 2DWQA 2C60A 3NS8A 5D3DA 2ZCBA 2YEPB 1ZGUB 1PUTA 4BKTA 2BQQA 4S17A 3RZWC 1C77A 3ZNHB 5E6NA 2NQOA 5IAAC 2XW1A 2FIDA 2RMMA 2L76A 2L00B 4M02A 4CQNA 4A3OA 2EKEC 3H7PA 3KVFB 4OVVA 3L16A 2QDFA 2XW0A 4P1BC 4XC2A 3J9CA 4GXBA 1SE3A 1GAQB 1E8WA 1XO3A 5KHQA 2KWVB 1L4ZB 2INCC 2CHZA 3U30A 1D5XC 2V0GA 3WHSA 2AJEA 2JT4B 4M0WA 1TS3A 2BGFA 4KIKB 1T0QC 2KWDA 3P2BA 2IBIB 2BX8A 1X1MA 3T9LA 2PVGC 1RM6C 4KZCA 2N7JA 4KDIC 5IIXA 4IM2A 3Q2AC 3QIJA 4PT5A 1DOIA 3Q8AA 2I2ZA 3C19A 1ZP0B 1T3QA 4XX5A 2E0XA 4KGRA 2WXNA 2D3BA 2J0MA 2I1KA 3IHPC 1RYJA 3U4EG 2IYDB 4W9IA 3JW0X 3QX1A 4YL8A 3PPAA 3HM6X 5AZGA 2LGYA 4LJPB 3O65B 4ANUA 1I4GA 3RN9C 2PIAA 3NZUA 3PTFC 2YVCA 1TS2A 2PKOA 2KKCA 4JQWC 2L0FA 2L32A 3ABVB 4CHKA 1FO4A 3PRZA 1HEZE 3NY5A 1EO6A 2LGDA 4F5SA 3MHSD 3EFCA 5LXHA 2GMIC 5BMGA 4OT2A 5HHDG 3AECB 3P42A 4IC7B 2DLBA 5LXIB 2AQ3B 3GZNI 3GB1A 4XE0A 2KHWB 1PYWD 3RYTA 1E6EB 3MTNB 4LUHA 1KFYB 4RM9A 5L95C 4I6PA 1RRBA 2FUG1 3OJ4B 3NVZA 1FCLA 2EFDA 2MBQA 2HD5B 2NBUA 4NAWA 4WQOB 4X57B 3ALBA 2KJHB 3EHVA 1L5PA 1E78A 1N6ZA 2CJNA 4W9HA 4IW0A 1EM7A 2LRUA 2JPHA 4USAA 5AZFA 5FK9C 2BBCA 1UWXA 1F9JA 5CHWA 2KYWA 2XBBC 1P98A 3ZLZA 5D3IB 5JH5C 2MW5A 4FXCA 4IDIA 4YSXB 1TJEA 5IJEA 3TCAA 1MG8A 1TKYA 4URKA 4NJCA 2KN5A 3H7PB 4B6WA 2Y5PA 5DPTA 5GINA 2CU3A 2WDTB 3I3TB 2N9KA 2EMTA 2G3QB 4II2B 4ZYSA 1GJZA 1PQSA 1WJ4A 3T3OA 2H88B 5E6PA 2BXMA 2AQ2B 4G04A 4MGKE 1EF5A 3ZTDA 3RNCC 4IWPA 3RNBC 1PGAA 2AL3A 2W82A 2WXGA 1EUVB 2LHDA 1C4AA 1GPXA 4CO7A 4XZ4A 4L2YA 4WWMA 3AMZA 2BTEA 3U8ZA 1TS5A 1V8CA 3RI7C 3AEEB 1ZE3D 2DZIA 2YEPF 2VZKB 3DVGX 1WMHA 5EDSA 1L0VB 5GXGB 1GC6A 4FLHA 1B9RA 2DYOA 3K9OB 4HKZE 3DWMA 3M3JA 1FFUA 2KWUB 4IOIE 2O2VB 1STEA 1UBIA 3IAM1 1SE2A 2K1FA 2RDBC 1UF0A 3RCZA 5IKCM 3H7SA 3OG5A 2EFCA 1WMHB 2OHFA 2KN4A 2BB6A 2HTME 4MDKE 2KTFA 2LXTA 2BYEA 2RD0A 1RWSA 1WX8A 2MJEA 2XK5A 5T8IA 3KUCB 1YOVB 2PE9A 2N9EB 2BXKA 3ML9A 2MA9B 4LNOA 1LNSA 3URYA 3KJLA 1ACCA 4BZAA 1FEHA 1NVID 3CSFA 4RNAA 2UWQA 2KLGA 2OT3A 4DM0A 1TZOA 1F2RC 2D2QA 4A90A 3V03A 4JK4A 3WHRA 4EUTA 5IJFA 2M0AA 4XYCA 3TEWA 4IM0A 2JZPA 4BY9C 2BXCA 2YLMA 4TV3A 4RMAA 5IFOA 1C4CA 4E3CA 5FUOA 4L23A 3KYCD 2N7EA 2WS3B 4EZKA 3Q69A 4DHZB 1QF6A 5C2TB 1NT2B 2W54A 4HWIB 1FXAA 2DAJA 3VFKA 4GOCA 3SEBA 3ONSA 2NMQA 3WANA 4FA6A 1SEBD 1VZ6A 1GOZA 2WXHA 4NQLB 3APCA 1N5UA 2WQYB 3RFZB 4AJWA 3RNEC 4BKGA 1RAXA 4LNKA 2IPKD 1OGWA 4A55A 2JYEA 5DPRA 2YDFA 2ACZB 2K6DB 2LVQA 2QHBA 4J6IA 3O13A 2GBKA 1V2YA 1E8ZA 3HHMA 5TSSA 3AU5A 3H6NA 3P1MA 3I9V1 3ENEA 4TUUA 4RGNA 2LEKA 4OZAA 3I63C 4MGIE 3CMMB 4OZCA 5E6JA 3Q3JA 2GUTA 2LXAA 2ICIA 1HTQA 1WXVA 2FAZA 1JRPA 4ICVA 3ZNID 1JWBD 2FCQA 4G3XB 1BUIC 3NHEB 4IM3A 1WYGA 3M63B 3ML8A 3PO0A 3RNFC 2OJWA 4ZBQA 3B2GA 2BXGA 3DHHC 1EWYC 3P63A 2M17A 2ONQA 2AL6A 1WGHA 5E6OA 3SU8X 1E8XA 3QAQA 3UGBB 3M62B 4LA0A 3RNAC 1OFFA 5JZEB 1WIAA 4KIKA 5G5HA 3WAMA 2IJ0A 2D3GA 2WDVB 1V97A 2DZJA 3HUIA 4FJZA 4ASWC 3UIPB 4II3B 3JVZX 2MH7A 1V81A 3R2TA 2NS5A 4KSKC 2WU5B 1MVKA 2KFKA 1TBEA 3DWGC 1F77A 2LQIA 3IBEA 3U52E 2LFIA 3OJ3A 1V5OA 3VVWB 3BVGA 4YTMB 1UGMA 3EUB2 3ICXA 1WJ6A 4HEA1 2K8BA 5FR6A 3PHXB 3PZ7A 4S1YA 1VZ8A 2IY0B 4NY0A 3EC8A 1HTOA 1OQRA 1I7HA 5DPSA 2IGHA 3MFGA 4MSMB 1N63A 4G0NB 1LXDA 1VZ7A 2KQ4X 2C7HA 1WGGA 1ZPSA 2NNWA 1GB1A 4DXFA 3EGRA 1QLBB 2QMTA 3LYYA 2BB5A 1C1YB 4GDLA 2N1VA 1E7AA 4IWQA 3LU7A 3RPFC 2E6XA 1I4XA 4TSSA 4HGMB 4JWUC 4C31B 1N61A 5BO4B 1SE9A 4W9JA 4XGAB 1AWDA 3Q8EA 4EOYA 5HOZA 2ON8A 3HIZA 4YSZB 3U2SC 4NJ6A 1KJTA 4HPLB 3DVGY 4W9CA 3CSTA 3FNMA 2WDRB 2MBBB 1A5RA 2NPTB 5GMVA 4K2CA 3FWCC 5LLIA 2Z8KA 2BYVE 1WX9A 1MUSA 4AQ7A 5ID9A 3PRPB 2WXMA 1A70A 3AH7A 1GG3A 3RNGC 2KJ6A 4HDQA 3KWLA 2A5UA 2M0XA 1WGRA 4MEMA 4REZA 4TQ0A 5IO9A 3AI5A 1WRDB 1EU3A 5LNK1 1XCTL 2FNJB 1J78A 4LNIA 4HRSA 2KC1A 3W9CB
chains in the Genus database with same CATH topology
3CWIA 3W1SA 1E7PB 1QKZA 4NAMA 3A1QB 4M70B 1RFAA 2LGIA 1HE8A 5AEKB 3AEAB 1HK3A 3TIXA 3ZJVA 1P9DU 1V80A 3WCQA 1FNUA 3QA8A 2QEJC 1D4BA 4AUQC 1GNJA 3RUIB 1WZ0A 4MT5A 2K39A 1V1OA 3AEBB 3R7RA 2EMSA 2LOQA 3GP7A 3ECIA 3U7DA 1IGCA 4WURA 4ZRKA 4F8CB 3UQAA 1E7CA 2EFHA 3M99C 3X0WA 3H37A 1TS4A 2WX0A 3AM9A 2JF5A 4GN1A 1CK1A 1WXSA 1SE4A 2K6QA 2KACA 4ANVA 3DDCB 2VZKD 3RULA 3JQZA 4DQOC 5FKAC 5J18A 3AU4A 2KBZA 3AEGB 1GUAB 2SAKA 1VR9A 1UD7A 2GBRA 1XXGA 1CJEA 1MIWA 2N9XA 1E90A 4YWGG 1C3TA 2KMMA 1ET6A 1UGJA 2ZPYA 2DYBA 2ZCCA 2JZZA 3Q8CA 1WY8A 2K3UA 3OWEB 1J7EA 4DHXB 1SJED 2J42A 2GRIA 1FOUA 2BXPA 1C4PA 5KHOA 3WHQA 4BVUC 4F5TA 2HE7A 2K8HA 1YQBA 1E8YA 4WJOA 2LXCA 1YJIA 3ZJTA 1WM3A 1J19A 2VUEA 3B9LA 1WJNA 4K81A 1UWMA 1ISNA 4N59A 3KQ4A 3GQUA 1MHXA 1NYQA 3HVZA 4KSLC 4BBNF 4ZBRA 1KLGD 2C7MB 2UYZB 1Q10A 1UBQA 3DOWA 2R2QA 2KLCA 4LB9A 2KDBA 1ZOYB 2MBHA 4NNJB 3BK1A 3TEYA 2JX5A 4J3OD 1TXUA 3C0RB 2CHWA 2BS2B 2JWZA 1HK2A 4ZHPA 1Y56A 1Q5WB 2L7RA 5BMHA 1FRRA 4AP4C 4F5UA 1YN4A 5FR3A 3A9JB 4HJKA 1E9MA 1JWUD 5BYSA 2JY6A 1MIYA 4GU2A 3ZIMA 4C56C 4HDOA 1LM8B 3VUYA 2HJ8A 3IT6B 4KV2A 3KLSX 2GBNA 4OVUA 2IDYA 2IO2B 3LJ3A 1YMHE 2JUHA 3BVZA 1HK5A 2MSED 1UZXB 3LXFA 4WAAA 3A33B 5L83A 2WDQB 4OTUA 3AE7B 2VDBA 3TBLD 2N4FA 2FCSA 3ZDMC 3ZVVA 2L8JA 1F0ZA 1RLFA 4H2AA 3D32A 3P4RB 1JWSD 4GMVA 1H8CA 2BS3B 2TSSA 2Z8JA 1IPGA 3BY4B 2WXOA 1I42A 4JLCA 3ZNGC 1WXQA 2KQSA 2M4NA 3MP9A 3N3KB 3AB5A 2ZW1A 2AQ1B 2KQ7A 3B9MA 1L4DB 2DENB 2KZRA 5D94A 4KKJA 4WJQA 4MM3B 1CQVA 4OZBA 2LUEA 1I4PA 3U7ZA 3LU8A 3B0AA 1VZSA 5BPKA 2J7QB 1GNUA 2H89B 4FADA 3RZFA 4ZRPA 3FWBC 3VR9B 2K8CA 1R7SA 3CF6E 2WWZA 1VD2A 2KXJA 4RFBA 4OR0A 1FNWA 5BYQA 2OEDA 4HK2A 4TMAB 4B0EA 2MJ3A 1JQ4A 2KX0A 1WJUA 4AS1A 2J0KA 3VXWA 1XD3B 1JCKB 2QSDA 3KYDD 1YQ3B 5DCNA 2JQRB 3PSEB 3UINB 2M56B 3PT2B 3W1SC 4HGKA 2GB1A 3LDZE 1P0RA 1JROA 4RM8A 2WXQA 1MA9A 4IW1A 4FJYA 5G2NA 4GG2A 2IY1B 4KX6B 2J52A 3UQBA 2MLBA 3SD5A 1NEKB 1P7FA 1M94A 1K52A 1D5MC 3APFA 2W3SA 4NQKE 2PPHA 1DOYA 4ZRQA 4WIPA 2RR9A 2FCNA 1DOXA 1FNVA 3NVYA 3PGEA 1Y8RC 3RD2A 2INNE 1K8RB 4MSQB 1ZDVA 4HLEA 3VRBB 4WQMA 3JRYA 3T3NA 1H9ZA 1FIQA 2FIFA 1NYRA 4WH4A 1I4QA 5D2MB 2LUMA 1VRAB 2AYOB 2V36A 3H1UA 2ZW0A 2N1WA 1YX5B 4O1NA 2MRPA 3LB8C 5H8YE 4LDTB 3TEZA 3IAS1 1SIFA 1TTNA 4OVZA 2MX2A 2BW2A 2DG5A 4FHKA 2K5PA 2QJLA 5EE0A 1TKEA 1JW9D 1O9XA 5IJ5A 2LVPA 1V9JA 1MIVA 5G55A 4MH8A 1N5XA 2MP2A 3VH3B 2FE8A 3V60A 1WXMA 2NBVB 3JSVA 1YD8U 4I6NB 2D07B 3ZGZA 3AE8B 3IXSA 3EFUA 1EWCA 2KTRB 2LASA 3AN1A 2AX5A 4HROA 3FC4A 1XEEA 4ZYNA 3ZQ4A 1S1QB 4XWTA 3DBSA 4GSWA 4EEWA 4HCNB 3NUHB 1V1PB 3A9JA 1VJKA 2DBXA 1WE6A 3HK0A 5C23A 2WXFA 2Y5BB 1F2RI 4L1BA 3ZYYX 5B5TA 2Z0DB 3MHZA 3V3XA 1E5WA 3K9PB 1E7EA 4JWSC 1KW2A 3N32A 3SDLC 2KDEB 3DBHI 1GB4A 2K22A 4G03A 4N3ZA 3PLVA 3N30A 4EE2A 2DX5B 2DZMA 1I4RA 2XK5B 4YTPB 4W9LA 1AN8A 5AUIA 5CTRC 2CKHB 1Z5SB 5H92C 2BYFA 4KKIA 3AEDB 2K9XA 2BXLA 3AE9B 1G6JA 3DVNV 1XF5L 1DGJA 4LJOB 1QZEA 5D6JB 2M19A 5DQFA 4ARCA 3TL5A 2XVQA 4BKSA 1HZ6A 4GB9A 4N0FD 2LMCA 1WYWB 3QWZB 2I38A 2B76B 4GLSC 2BXAA 1ROEA 1VLBA 3R2IA 3VR8B 2RGFA 2RPQA 4HPMB 2JSVX 1QOGA 3APDA 1BKEA 2E3TA 3NOBA 2ZNVB 4TQ1A 2FCMA 4A9AA 4KZ0A 1WZ3A 3PREA 2LWPA 4NPNA 4W9FA 2KNBA 4J2VA 3N9YC 1PFDA 4JE3B 4IKGA 3KH0A 4PS3A 3QC8B 2Z59B 2PEAA 4HXDA 3VTWA 1D6EC 2CU1A 1WX7A 4W9KA 2XNAC 2KDMA 2IZVB 1WF9A 4KGTA 4LK0M 1V1PA 2KANA 4NJ7A 3H9DA 2PJHA 1FXIA 2I2YA 5CHFA 3R8BA 2V3NA 1QOBA 4RGMA 3NVWA 1IBXA 1XLOA 2G1EA 4B95A 4F5VA 2KMAA 3V08A 5J17A 2MEKA 4WJNA 4ZDVA 1E7FA 3NRZA 1GC7A 2LJ5A 2C5LC 2BWES 3QARA 2BXDA 5JHBA 1TYGB 3I57A 2JYTA 2KC2A 4N9F4 4ZOHC 1WXAA 3PZDA 1C76A 1XLPA 4PO0A 2WXPA 2Z8LA 2LHEA 2BXFA 1Q0WB 3V05A 1WGDA 4W4UB 2O6VB 2XSIA 4DXGA 4ZUXV 2CR5A 4ANXA 2Z8IA 1FFVA 2V1YA 1XLQA 4GDKB 4BOZB 2DAFA 3VTVA 1BM0A 4TKNA 4W9EA 3EECA 2PMVA 3ZKJC 1V5TA 1QOFA 1V86A 2ZJDA 2L0TA 4US8A 2PVOD 4GDLB 2KTRA 4KGSA 1NENB 2GBMA 2INPE 2IGGA 2RPVA 3HRDD 2WX1A 3NVVA 4DXAB 3HVDA 3WAPA 5HFYA 1LO5D 1T6BX 2ROHA 3A4RA 4YSYB 5HG2A 1OEYA 1E7UA 2QM6A 4ZBKA 3PZ8A 4BBNC 4P16A 1SB3C 2MBEA 4DDGD 4LDTD 1KOTA 1Z2MA 1ZKHA 3BVMA 2Y3AA 1KM7A 1EU4A 4IWOA 1MI0A 1JRUA 1XCQL 3V62A 2WXRA 3WIMA 2PTLA 1ENFA 3P4SB 1SXTA 4EFOA 4UDUC 4A6QA 2G4DB 1FXTB 2LVOA 3A75A 2L52A 3UIVA 3V6EB 2WXKA 1E7VA 1SJHD 1HK4A 2EKIA 4PS8A 2N9LA 4M0WB 2N7DA 3UIOB 1P7EA 5EE9A 4K71A 4FIPB 4MM3A 2JU6X 4OTTA 4BOSC 3L0WB 4RCOA 3KUDB 4M8MA 1TY2A 3BYYB 2LZ6A 2QIEB 4JIOU 2NTTA 2IO1B 1XLNA 4C80A 3V6CB 2MQJA 1K51A 2BXBA 4DK5A 2C7NB 2D11A 4RF0A 2OZBB 1WH3A 3ETRA 1K53A 1YN3A 3VTUA 4A3PA 1D3ZA 4D2KA 1AO6A 2BYTA 3M95A 2R61A 1C9FA 4DHZE 3L08A 2A4ZA 2J0JA 3AEFB 4HKQA 3GS2A 1J8CA 3EA6A 3G9KD 2LD9A 2NTSA 3WALA 1SSNA 2G45B 1ET9A 1MPEA 5TR5A 2EFEA 4L9QA 3W1YA 3NZSA 3GQXA 2XEWA 3P4QB 3MHHB 2L1AA 1WWTA 4YXDB 1TY0A 1E7BA 2M8SA 3ZRFA 4IG7B 4US9A 1CZPA 4WA6B 3JYUA 1JWMD 2KFJA 1HA5A 2LJIA 3W2DA 4MELA 2KOXA 4AJYB 1AW7A 1K50A 2B3AA 3TEXA 1L7YA 5BMIA 1E7IA 3FAHA 1M4VA 2GOWA 1E7HA 3Q8BA 3TDLA 2IGDA 1SIJA 2R2OA 1NI2A 5GHKA 3UF8A 2M1MA 1IJGA 2VRRB 3ZRCA 2MCNB 1ZUD2 1QILA 1H5WA 5G5GA 1E0ZA 2NBWB 4MBEC 1WM2A 5I4DA 2XVVA 3A9KB 4E99A 3P4PB 4GDXA 3B2FA 1WR1A 3PLAA 2LGXA 4IUMB 2JXXA 3KWVA 1OQQA 2V4IB 3SR6A 3TSSA 1VFIA 4N6EB 4Z9OA 4ARIA 1LFDA 3Q3FA 2CHXA 2O6VD 4EZJA 1DYQA 3WA0A 5GIOA 4FULA 2PE6B 2DYMA 4GIVA 2JXTA 1TF0A 3SIVB 1OEYJ 2ZVOA 4MACA 4RH6A 3NVMA 3WAOA 2L05A 5JXVA 1WSPA 3B08A 1B1ZA 1WGYA 3QCAA 4DDID 4DHJB 1J0GA 3TJPA 3L54A 2NR2A 3UI3A 4WJPA 2ASQA 3C8YA 4P6VF 3BZDB 3QHTA 2DBYA 3AE6B 3SHQA 3ZNZB 4LUFA 1TGZB 3PLUA 2G4SA 1LQBA 4WWOA 5IIHA 1XQQA 3HM3A 1E7GA 4CYEA 3E56A 2BXIA 3AE4B 2BPSA 2OJRA 4K7UA 3DQVA 2LRWA 2J4XA 2ZNVC 2KDIA 4AOFA 1ZW7A 3ZO5B 5AUKA 3B9JA 3T8MA 3TMPB 1IYFA 2D5GA 2WNMA 4LTUA 1YNTE 3A1QA 4Z69A 3DBRI 4I6LB 1BT0A 2WU2B 2G9HD 2KVRA 3VH4B 1AARA 2MP2B 2DHZA 3PVLA 4MH0E 2EELA 1RFKA 2MBOA 1ZXIA 4FN2A 2VUFA 3R3MA 5HI1A 2X38A 1EF1A 2ZZPB 2DBUA 2BT6A 4HVBA 2V3PA 3NVIA 1NI3A 4G11A 1FM0D 1V49A 2I1JA 3RT3B 1OQYA 4BFRA 4Q2JA 4JPSA 4NAWB 2KD0A 1CMXB 2CJOA 2XVUA 2HDEA 1KF6B 4E71A 3GOEA 4EMXA 4RGOS 4BKEA 1SBBB 5DPWA 3VUXA 4N0UD 2JVCA 1WRIA 1MHHE 3S2AA 3B1LX 1R4NI 1L2NA 1SGHA 4YTNB 2KAJA 1WI0A 1KH0A 1FMAD 3KW5B 1LOTA 2MJDA 2W55A 5MPOA 2K0PA 2WXLA 3MJWA 3VDZA 4FBJB 3BK2A 2DBWA 4WAFA 1FCCC 2AEHA 1QOAA 2NPTA 3MC0B 2RDHA 1N62A 2W9NA 1IUEA 1L0YB 3AE1B 3DCGA 2FBWB 3AE2B 1I35A 1ZDXA 1WE7A 2C9WB 4MJSA 3PV1A 3CIRB 3A73A 3NVKA 2REXA 2JZ3B 4ANWA 1L6UA 3ZTCA 2W3RA 1L6VA 4LLGM 3BIID 1WFYA 5C3JB 3DVNU 4MJSB 3VAWA 4DBGA 4LB2A 3PS6A 2KMCA 3DPDA 2BS4B 2O6VA 3SFEB 5JHAA 4DWFA 3ZUNA 5GIPA 1KLVA 2JUOA 2BXQA 4K7WA 1PDXA 2KX3A 1ZXHA 3Q8FA 2HTHA 1IP9A 2WXJA 4HJGE 1VDVA 4OW0A 3MJ5A 3KIKA 3H3AA 3NMUA 3SIUB 1JALA 4KVGB 2L83A 3QQ8B 4W9DA 2KDFB 2K25A 4JGHB 1YIWA 2L3ZA 4W9GA 1UNSA 2KFKB 4EKUA 2IO3B 4BKSD 2BXHA 4P7IA 2BXNA 3MHSB 3AV8A 2RDGA 4XDCA 3ZDTA 1V6EA 1XT9B 2OOBB 4A8XC 4XDDA 4ZRIA 2CKXA 1J7BA 2NVUI 5ID7A 1NBFC 3BYTB 4GDKA 3TUOA 2FUHB 1UELA 4JL9A 4LCDE 2N9PC 3VQIA 3W5VB 3W5UB 3L13A 4YT0B 1E10A 5HKHA 4HCPB 1IGDA 3L4PA 1S3SG 4RF1A 4IW2A 2WYQA 4KDLB 1UORA 2V3SA 2J53A 3NZ3A 2JWUA 4ZRJA 1T0YA 2GBJA 2PLPA 4B9KA 4N58A 4L9KA 2LI5A 4OHJA 3V61A 1WGKA 5C1ZA 1C78A 1U4AA 2D10A 2AWTA 1QQRA 3AE5B 3VHTC 4XWWA 1ESFA 1JWAD 4F7ZA 4JX1C 2RSUA 3V09A 2JRIB 5IA7A 2BXEA 3GA9L 1IBXB 3NS1A 1GNIA 2XVWA 1J7AA 1NDDA 3OAWA 3QK0A 1PGBA 2KJRA 1HA2A 1C79A 2XN9C 2QMCA 4ZC6A 3LU6A 2IO0B 1D5ZC 1JMLA 4R3DA 2ZPNA 3H8HA 3IG3A 2BKRB 2QILA 1BJ5A 5EE3A 4WWNA 2Z0EB 1HK1A 4C7ZA 1HZ5A 3FILA 4EZLA 4ZHOA 1YQ4B 2GI9A 4PS7A 1R4MI 4ITKA 4RGTA 1WR6E 4ZCGA 3SQJA 1KRHA 2ZVNA 5J2RA 1I4HA 2ZEQA 2SEBD 3VUWA 4MGYE 1KXPD 3A4SC 3KUZA 1P3QU 2BF8B 4FK5B 5CHVC 1N60A 2Q5WD 1HXYD 2O2VA 1FD6A 5IIUA 4PYZA 3DBLI 1YN5A 1TZ1A 1KTKA 3OLMD 1N5WA 1PGXA 3R66C 4K7SA 4WWPA 3ZW3A 4FJVB 4C7YA 4K1RB 2Y5CA 1YJJA 3IVFA 2WP9B 5EE1A 3R7QA 1UUPA 3PHWB 2WXIA 4NZLB 3IT4B 2PW9A 2NCNA 4G01A 2N0SB 3FILB 4A20A 2DZKA 2BWFA 3AE3B 3IFWB 1HQRD 2V4LA 3QJZA 2KO3A 2BXOA 3A9KA 5AZHA 3AXCA 2JRHA 1SF0A 2BKFA 2I30A 2CS4A 2XMOA 1T5XD 4MGZE 3CX9A 1BXTA 4E74A 4PYUA 1OTRB 4L8UA 4M8NA 1YX6B 1YJ1A 1L0XB 5BYRA 4AWJA 4ICUA 2KWCA 1FRDA 1J7CA 3L17A 2MWSB 4F1SA 4G50A 1UH6A 3PRMB 5CX3A 1QT9A 3SFDB 2WLBA 3BINA 1JNBA 3ZJUA 2E0YA 1VCBA 4B0MA 4DHJD 3BWUD 4FJCB 5DBYA 1Q1OA 1P1AA 5D7GA 4GGQA 1AYFA 2QHOA 4FHJA 1BMLC 3AULA 3VRAB 3E9SA 1KLUD 2KK8A 1TKGA 1H4RA 3X23A 3L10B 3JSVB 2DWQA 2C60A 3NS8A 5D3DA 2ZCBA 2YEPB 1ZGUB 1PUTA 4BKTA 3RZWC 1C77A 3ZNHB 5E6NA 2NQOA 5IAAC 2XW1A 2FIDA 2RMMA 2L76A 2L00B 4CQNA 4A3OA 2EKEC 3H7PA 3KVFB 4OVVA 3L16A 2XW0A 4XC2A 3J9CA 4GXBA 1SE3A 1GAQB 1E8WA 1XO3A 5KHQA 2KWVB 1L4ZB 2CHZA 3U30A 1D5XC 2V0GA 3WHSA 2AJEA 2JT4B 4M0WA 1TS3A 2BGFA 4KIKB 2KWDA 3P2BA 2IBIB 2BX8A 1X1MA 3T9LA 2PVGC 4KZCA 1RM6C 4KDIC 2N7JA 5IIXA 4IM2A 3QIJA 4PT5A 1DOIA 3Q8AA 2I2ZA 1ZP0B 1T3QA 4XX5A 2E0XA 4KGRA 2WXNA 2J0MA 2I1KA 3IHPC 1RYJA 3U4EG 2IYDB 4W9IA 3JW0X 3QX1A 4YL8A 3PPAA 3HM6X 5AZGA 2LGYA 4LJPB 3O65B 4ANUA 1I4GA 2PIAA 3NZUA 3PTFC 2YVCA 1TS2A 4JQWC 2KKCA 2PKOA 2L0FA 2L32A 4CHKA 3ABVB 1FO4A 3PRZA 1HEZE 3NY5A 1EO6A 2LGDA 4F5SA 3MHSD 5LXHA 2GMIC 5BMGA 4OT2A 5HHDG 3AECB 3P42A 4IC7B 5LXIB 2DLBA 2AQ3B 3GZNI 3GB1A 4XE0A 2KHWB 1PYWD 3RYTA 1E6EB 3MTNB 4LUHA 1KFYB 4RM9A 5L95C 4I6PA 1RRBA 3OJ4B 2FUG1 3NVZA 1FCLA 2EFDA 2MBQA 2HD5B 2NBUA 4NAWA 4WQOB 4X57B 3ALBA 2KJHB 3EHVA 1L5PA 1E78A 2CJNA 4W9HA 4IW0A 1EM7A 2LRUA 2JPHA 4USAA 5AZFA 5FK9C 2BBCA 1UWXA 1F9JA 5CHWA 2XBBC 1P98A 3ZLZA 5JH5C 5D3IB 2MW5A 4FXCA 4IDIA 4YSXB 1TJEA 5IJEA 3TCAA 1MG8A 1TKYA 4URKA 4NJCA 2KN5A 3H7PB 4B6WA 2Y5PA 5DPTA 5GINA 2CU3A 2WDTB 3I3TB 2N9KA 2EMTA 2G3QB 4II2B 1GJZA 4ZYSA 1PQSA 1WJ4A 3T3OA 2H88B 5E6PA 2AQ2B 2BXMA 4G04A 4MGKE 1EF5A 3ZTDA 4IWPA 1PGAA 2AL3A 2W82A 2WXGA 1EUVB 2LHDA 1C4AA 1GPXA 4CO7A 4XZ4A 4L2YA 4WWMA 3AMZA 2BTEA 3U8ZA 1TS5A 1V8CA 3AEEB 1ZE3D 2DZIA 2YEPF 3DVGX 2VZKB 1WMHA 5EDSA 1L0VB 5GXGB 1GC6A 4FLHA 1B9RA 2DYOA 3K9OB 4HKZE 3DWMA 3M3JA 2KWUB 1FFUA 4IOIE 2O2VB 1UBIA 1STEA 3IAM1 2K1FA 1SE2A 3RCZA 3H7SA 2EFCA 1WMHB 2OHFA 2KN4A 2BB6A 2HTME 4MDKE 2KTFA 2BYEA 2RD0A 1RWSA 1WX8A 2MJEA 2XK5A 5T8IA 3KUCB 2PE9A 2N9EB 2BXKA 3ML9A 2MA9B 1LNSA 3URYA 3KJLA 1ACCA 1FEHA 1NVID 3CSFA 4RNAA 2UWQA 2KLGA 2OT3A 1TZOA 1F2RC 2D2QA 4A90A 3V03A 4JK4A 3WHRA 4EUTA 5IJFA 2M0AA 3TEWA 4IM0A 2JZPA 4BY9C 2BXCA 2YLMA 4TV3A 4RMAA 5IFOA 1C4CA 4E3CA 5FUOA 4L23A 3KYCD 2N7EA 2WS3B 4EZKA 3Q69A 4DHZB 1QF6A 5C2TB 1NT2B 2W54A 4HWIB 1FXAA 2DAJA 3VFKA 4GOCA 3SEBA 3ONSA 3WANA 4FA6A 2NMQA 1SEBD 1VZ6A 1GOZA 4NQLB 2WXHA 3APCA 1N5UA 2WQYB 3RFZB 4AJWA 4BKGA 1RAXA 2IPKD 1OGWA 4A55A 5DPRA 2JYEA 2YDFA 2ACZB 2K6DB 2LVQA 2QHBA 4J6IA 3O13A 2GBKA 1V2YA 1E8ZA 3HHMA 5TSSA 3AU5A 3H6NA 3P1MA 3I9V1 3ENEA 4TUUA 4RGNA 2LEKA 4OZAA 4MGIE 3CMMB 4OZCA 5E6JA 3Q3JA 2LXAA 2ICIA 1WXVA 2FAZA 1JRPA 4ICVA 3ZNID 1JWBD 2FCQA 4G3XB 1BUIC 3NHEB 4IM3A 3M63B 3ML8A 1WYGA 3PO0A 4ZBQA 3B2GA 2BXGA 1EWYC 3P63A 2M17A 2ONQA 2AL6A 1WGHA 5E6OA 3SU8X 1E8XA 3QAQA 3UGBB 3M62B 4LA0A 1OFFA 5JZEB 1WIAA 4KIKA 5G5HA 3WAMA 2IJ0A 2D3GA 2WDVB 1V97A 2DZJA 3HUIA 4FJZA 4ASWC 3UIPB 4II3B 3JVZX 2MH7A 1V81A 3R2TA 2NS5A 4KSKC 2WU5B 1MVKA 2KFKA 1TBEA 3DWGC 1F77A 3IBEA 3U52E 2LFIA 3OJ3A 1V5OA 3VVWB 3BVGA 4YTMB 1UGMA 3EUB2 3ICXA 1WJ6A 4HEA1 2K8BA 5FR6A 3PHXB 3PZ7A 4S1YA 1VZ8A 2IY0B 4NY0A 3EC8A 1OQRA 1I7HA 5DPSA 2IGHA 3MFGA 4MSMB 1N63A 4G0NB 1LXDA 1VZ7A 2KQ4X 2C7HA 1WGGA 1ZPSA 2NNWA 1GB1A 4DXFA 3EGRA 1QLBB 2QMTA 3LYYA 2BB5A 1C1YB 4GDLA 2N1VA 1E7AA 4IWQA 3LU7A 3RPFC 2E6XA 1I4XA 4TSSA 4HGMB 4JWUC 4C31B 1N61A 5BO4B 1SE9A 4W9JA 1AWDA 3Q8EA 4EOYA 5HOZA 3HIZA 2ON8A 4YSZB 3U2SC 4NJ6A 1KJTA 4HPLB 3DVGY 4W9CA 3CSTA 3FNMA 2WDRB 2MBBB 1A5RA 2NPTB 5GMVA 4K2CA 3FWCC 5LLIA 2Z8KA 2BYVE 1WX9A 4AQ7A 5ID9A 3PRPB 2WXMA 1A70A 3AH7A 1GG3A 2KJ6A 4HDQA 3KWLA 2A5UA 2M0XA 1WGRA 4MEMA 4REZA 4TQ0A 3AI5A 1WRDB 1EU3A 5LNK1 1XCTL 2FNJB 1J78A 4HRSA 2KC1A 3W9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1S A;  1WZ3 A;  3PRE A;  2LWP A;  3NZU A;  3A1Q B;  3PTF C;  1RFA A;  2YVC A;  4NPN A;  4JQW C;  2KKC A;  2KNB A;  4W9F A;  2L0F A;  5DPW A;  3VUX A;  4CHK A;  3KH0 A;  2JVC A;  3PRZ A;  4PS3 A;  3NY5 A;  1EO6 A;  1HE8 A;  2LGD A;  3QC8 B;  2Z59 B;  5AEK B;  3S2A A;  3TIX A;  2PEA A;  4HXD A;  3B1L X;  1P9D U;  1V80 A;  3MHS D;  1R4N I;  3VTW A;  2CU1 A;  1L2N A;  1WX7 A;  3QA8 A;  1SGH A;  5LXH A;  4AUQ C;  4W9K A;  1WI0 A;  2GMI C;  3RUI B;  2IZV B;  1WZ0 A;  3KW5 B;  1WF9 A;  2K39 A;  2KAN A;  4NJ7 A;  3R7R A;  2EMS A;  3H9D A;  2PJH A;  4IC7 B;  3ECI A;  3U7D A;  5LXI B;  4ZRK A;  5CHF A;  4F8C B;  3UQA A;  3MJW A;  3VDZ A;  3GZN I;  4FBJ B;  3X0W A;  2KHW B;  2WX0 A;  3RYT A;  2JF5 A;  4GN1 A;  4B95 A;  3MTN B;  2AEH A;  2NPT A;  2KMA A;  2W9N A;  5J17 A;  1WXS A;  4RM9 A;  5L95 C;  4WJN A;  2K6Q A;  4I6P A;  4ZDV A;  3DCG A;  4ANV A;  1RRB A;  3DDC B;  3OJ4 B;  1I35 A;  1GC7 A;  3RUL A;  2MBQ A;  1WE7 A;  2C5L C;  2C9W B;  2HD5 B;  2LJ5 A;  2NBU A;  3PV1 A;  4MJS A;  4NAW A;  4WQO B;  4X57 B;  2BWE S;  2JZ3 B;  2REX A;  3ALB A;  3AU4 A;  2KJH B;  3QAR A;  3ZTC A;  4ANW A;  3EHV A;  5J18 A;  1GUA B;  5JHB A;  1UD7 A;  1WFY A;  2GBR A;  2KC2 A;  4N9F 4;  2N9X A;  1E90 A;  3DVN U;  1C3T A;  4MJS B;  1WXA A;  3PZD A;  4W9H A;  4IW0 A;  3VAW A;  2LRU A;  2JPH A;  2ZPY A;  5AZF A;  4DBG A;  2DYB A;  2ZCC A;  2JZZ A;  3PS6 A;  2KMC A;  3DPD A;  1F9J A;  5CHW A;  1WY8 A;  2XBB C;  2O6V A;  5JHA A;  4DWF A;  3ZUN A;  1Q0W B;  1P98 A;  3ZLZ A;  5JH5 C;  1KLV A;  2MW5 A;  2JUO A;  1WGD A;  3TCA A;  1MG8 A;  4K7W A;  5KHO A;  4BVU C;  4URK A;  2KN5 A;  3H7P B;  2KX3 A;  2O6V B;  4B6W A;  2HE7 A;  2K8H A;  1YQB A;  1E8Y A;  4WJO A;  2CR5 A;  4ANX A;  2LXC A;  2HTH A;  5DPT A;  1IP9 A;  2V1Y A;  4GDK B;  1WM3 A;  1J19 A;  4BOZ B;  2WDT B;  2DAF A;  3I3T B;  3VTV A;  1WJN A;  4K81 A;  4TKN A;  4W9E A;  2EMT A;  2G3Q B;  3EEC A;  4II2 B;  3ZKJ C;  1V5T A;  1GJZ A;  1ISN A;  1PQS A;  1WJ4 A;  1V86 A;  2ZJD A;  5E6P A;  4MGK E;  1EF5 A;  2L0T A;  4KVG B;  3ZTD A;  4KSL C;  4BBN F;  4GDL B;  4IWP A;  2AL3 A;  3QQ8 B;  2KTR A;  2KDF B;  4W9D A;  2GBM A;  2C7M B;  1EUV B;  2K25 A;  2UYZ B;  1YIW A;  2L3Z A;  1UBQ A;  3DOW A;  4JGH B;  4W9G A;  2KFK B;  4EKU A;  2WX1 A;  2IO3 B;  4CO7 A;  4XZ4 A;  2R2Q A;  2KLC A;  4BKS D;  4DXA B;  2KDB A;  3U8Z A;  4P7I A;  2MBH A;  3WAP A;  4NNJ B;  2DZI A;  3DVG X;  1WMH A;  5EDS A;  3ZDT A;  1GC6 A;  1V6E A;  3A4R A;  2CHW A;  1XT9 B;  3C0R B;  2JWZ A;  4FLH A;  2DYO A;  1OEY A;  2OOB B;  3K9O B;  1Q5W B;  2L7R A;  2KWU B;  3M3J A;  1E7U A;  4ZRI A;  4AP4 C;  2NVU I;  1NBF C;  4BBN C;  2O2V B;  4GDK A;  3A9J B;  2MBE A;  4HJK A;  4DDG D;  1UBI A;  4LDT D;  2FUH B;  1UEL A;  1KOT A;  4JL9 A;  4LCD E;  2N9P C;  3VQI A;  1Z2M A;  1ZKH A;  2K1F A;  1KM7 A;  4IWO A;  2JY6 A;  1JRU A;  3RCZ A;  3V62 A;  3WIM A;  3L13 A;  5HKH A;  4HCP B;  4GU2 A;  3ZIM A;  3H7S A;  4HDO A;  1S3S G;  1WMH B;  1LM8 B;  3VUY A;  4EFO A;  2HJ8 A;  2WYQ A;  4KDL B;  2G4D B;  2V3S A;  1FXT B;  4KV2 A;  4MDK E;  2GBN A;  2LVO A;  4OVU A;  2KTF A;  3V6E B;  4ZRJ A;  1E7V A;  2IO2 B;  2BYE A;  2RD0 A;  3LJ3 A;  4PS8 A;  1T0Y A;  2GBJ A;  1WX8 A;  2MSE D;  4B9K A;  4M0W B;  2XK5 A;  1UZX B;  2LI5 A;  3V61 A;  4WAA A;  3A33 B;  3KUC B;  2N7D A;  3UIO B;  2PE9 A;  2N9E B;  5C1Z A;  3ML9 A;  2MA9 B;  5L83 A;  1U4A A;  2D10 A;  2AWT A;  4MM3 A;  3TBL D;  3CSF A;  2N4F A;  3VHT C;  2FCS A;  3ZDM C;  4BOS C;  3ZVV A;  2L8J A;  1RLF A;  4F7Z A;  2UWQ A;  2KLG A;  3L0W B;  3D32 A;  3KUD B;  4M8M A;  2LZ6 A;  2RSU A;  4JIO U;  2IO1 B;  2JRI B;  4GMV A;  5IA7 A;  3V6C B;  1H8C A;  2D2Q A;  1IPG A;  2MQJ A;  3BY4 B;  4DK5 A;  2C7N B;  4EUT A;  1NDD A;  1I42 A;  3OAW A;  3QK0 A;  2D11 A;  2KJR A;  4JLC A;  3ZNG C;  1WH3 A;  2KQS A;  2M4N A;  4IM0 A;  3N3K B;  2YLM A;  3VTU A;  4TV3 A;  4A3P A;  4RMA A;  1D3Z A;  2KQ7 A;  2DEN B;  2IO0 B;  2KZR A;  3M95 A;  4WJQ A;  5D94 A;  4E3C A;  2LUE A;  4DHZ E;  3KYC D;  3B0A A;  2ZPN A;  3L08 A;  4ANU A;  2N7E A;  4EZK A;  2A4Z A;  2J0J A;  2J7Q B;  4DHZ B;  1J8C A;  1GNU A;  3IG3 A;  2LD9 A;  4FAD A;  3RZF A;  2BKR B;  3WAL A;  4HWI B;  4WWN A;  2G45 B;  2DAJ A;  2Z0E B;  2K8C A;  3VFK A;  3CF6 E;  5TR5 A;  4GOC A;  2WWZ A;  3ONS A;  3WAN A;  4FA6 A;  2KXJ A;  1VD2 A;  4EZL A;  4PS7 A;  4NQL B;  3APC A;  1R4M I;  3W1Y A;  3NZS A;  4HK2 A;  1WR6 E;  2XEW A;  4AJW A;  2ZVN A;  5J2R A;  4BKG A;  2KX0 A;  2ZEQ A;  1WJU A;  3VUW A;  2J0K A;  4MGY E;  3VXW A;  1RAX A;  1XD3 B;  3KYD D;  2M8S A;  3A4S C;  3KUZ A;  5DCN A;  1P3Q U;  2BF8 B;  4IG7 B;  3ZRF A;  3JYU A;  3PSE B;  2KFJ A;  1OGW A;  5CHV C;  5DPR A;  2O2V A;  4MEL A;  3PT2 B;  3UIN B;  2KOX A;  3W1S C;  3LDZ E;  1P0R A;  4PYZ A;  4AJY B;  3DBL I;  2B3A A;  1TZ1 A;  4RM8 A;  1L7Y A;  3OLM D;  2K6D B;  2GOW A;  3R66 C;  4FJY A;  5G2N A;  4K7S A;  2IY1 B;  4WWP A;  3ZW3 A;  2LVQ A;  4FJV B;  4K1R B;  2R2O A;  4J6I A;  2GBK A;  1V2Y A;  3IVF A;  1NI2 A;  1E8Z A;  3UF8 A;  3UQB A;  3R7Q A;  2M1M A;  3HHM A;  3PHW B;  3AU5 A;  2MLB A;  3H6N A;  3SD5 A;  1M94 A;  2VRR B;  3ZRC A;  3APF A;  2MCN B;  4NQK E;  2NCN A;  2PPH A;  4A20 A;  2RR9 A;  2DZK A;  2FCN A;  3ENE A;  4TUU A;  2BWF A;  4MGI E;  3CMM B;  2NBW B;  1WM2 A;  3PGE A;  3IFW B;  1Y8R C;  3RD2 A;  3Q3J A;  3A9K B;  2V4L A;  1K8R B;  2LXA A;  3QJZ A;  4MSQ B;  2KO3 A;  1WXV A;  2FAZ A;  4HLE A;  1WR1 A;  3A9K A;  4ICV A;  2LGX A;  4IUM B;  5AZH A;  2JXX A;  3ZNI D;  3AXC A;  2JRH A;  2BKF A;  2FCQ A;  4G3X B;  3NHE B;  4IM3 A;  3M63 B;  3ML8 A;  1LFD A;  3Q3F A;  2CS4 A;  2CHX A;  4MGZ E;  2FIF A;  2O6V D;  5D2M B;  4E74 A;  4PYU A;  2AYO B;  3H1U A;  1OTR B;  4M8N A;  2N1W A;  1YX6 B;  3WA0 A;  4EZJ A;  1YX5 B;  2M17 A;  2MRP A;  4FUL A;  2PE6 B;  1YJ1 A;  4LDT B;  2DYM A;  2AL6 A;  4GIV A;  1WGH A;  1OEY J;  5E6O A;  3SU8 X;  1E8X A;  3QAQ A;  2ZVO A;  4AWJ A;  3UGB B;  4ICU A;  1SIF A;  1TTN A;  2KWC A;  3M62 B;  2MX2 A;  3L17 A;  3WAO A;  2MWS B;  4FHK A;  2L05 A;  4F1S A;  4G50 A;  1UH6 A;  3PRM B;  5CX3 A;  5JZE B;  1WIA A;  3BIN A;  4KIK A;  1VCB A;  3WAM A;  4DHJ D;  3B08 A;  2D3G A;  1WGY A;  3QCA A;  2LVP A;  2DZJ A;  1V9J A;  4DDI D;  4DHJ B;  5G55 A;  1J0G A;  1Q1O A;  1P1A A;  4FJZ A;  4ASW C;  3UIP B;  4II3 B;  5D7G A;  3TJP A;  4GGQ A;  2MP2 A;  3VH3 B;  2QHO A;  3V60 A;  1WXM A;  3JVZ X;  3L54 A;  2NR2 A;  2NBV B;  3JSV A;  4FHJ A;  1YD8 U;  3AUL A;  1V81 A;  4WJP A;  2ASQ A;  2NS5 A;  4I6N B;  4KSK C;  3QHT A;  2KK8 A;  2KFK A;  1TBE A;  1H4R A;  2D07 B;  3X23 A;  3L10 B;  3SHQ A;  3EFU A;  3ZNZ B;  1TGZ B;  2KTR B;  3IBE A;  2LAS A;  3PLU A;  3JSV B;  3OJ3 A;  1V5O A;  2G4S A;  1LQB A;  2C60 A;  4WWO A;  3VVW B;  1XQQ A;  3NS8 A;  3HM3 A;  1UGM A;  4CYE A;  4ZYN A;  1WJ6 A;  1S1Q B;  2K8B A;  3DBS A;  2ZCB A;  5FR6 A;  3PHX B;  4GSW A;  1ZGU B;  2BPS A;  2OJR A;  4EEW A;  4BKT A;  4HCN B;  4K7U A;  2IY0 B;  4NY0 A;  3EC8 A;  3RZW C;  3A9J A;  3DQV A;  3ZNH B;  2LRW A;  5E6N A;  1WE6 A;  3HK0 A;  5C23 A;  5IAA C;  2FID A;  2ZNV C;  2KDI A;  2Y5B B;  2L76 A;  4AOF A;  1ZW7 A;  2L00 B;  5DPS A;  4A3O A;  2EKE C;  3ZO5 B;  3H7P A;  4MSM B;  2Z0D B;  3KVF B;  4OVV A;  3L16 A;  4G0N B;  3T8M A;  1LXD A;  1E5W A;  3TMP B;  1IYF A;  4XC2 A;  2C7H A;  3K9P B;  4GXB A;  1E8W A;  1WGG A;  3A1Q A;  3DBR I;  3N32 A;  3SDL C;  5KHQ A;  2KDE B;  3DBH I;  2KWV B;  4I6L B;  1C1Y B;  1BT0 A;  2KVR A;  3PLV A;  4GDL A;  2N1V A;  3N30 A;  1AAR A;  2CHZ A;  2MP2 B;  3VH4 B;  4IWQ A;  3U30 A;  2DX5 B;  2DHZ A;  2DZM A;  3PVL A;  4MH0 E;  2XK5 B;  5BO4 B;  1SE9 A;  2JT4 B;  4W9J A;  2BGF A;  4KIK B;  4W9L A;  2MBO A;  4EOY A;  3HIZ A;  3P2B A;  2IBI B;  4NJ6 A;  5CTR C;  1KJT A;  1X1M A;  4HPL B;  3T9L A;  2CKH B;  3DVG Y;  1Z5S B;  4KZC A;  4W9C A;  3CST A;  4KDI C;  2MBB B;  2BYF A;  1A5R A;  2NPT B;  4IM2 A;  5GMV A;  4FN2 A;  3QIJ A;  3R3M A;  5LLI A;  1EF1 A;  2ZZP B;  2BYV E;  1G6J A;  4XX5 A;  3DVN V;  4LJO B;  1WX9 A;  3PRP B;  1QZE A;  5D6J B;  1GG3 A;  4HVB A;  3TL5 A;  4BKS A;  2KJ6 A;  4GB9 A;  2J0M A;  4HDQ A;  2I1K A;  3IHP C;  4G11 A;  1WYW B;  3QWZ B;  1V49 A;  2I1J A;  2A5U A;  2M0X A;  1WGR A;  4MEM A;  3RT3 B;  4TQ0 A;  1OQY A;  4BFR A;  2IYD B;  3AI5 A;  4W9I A;  2RGF A;  3JW0 X;  1WRD B;  2RPQ A;  3QX1 A;  4HPM B;  4YL8 A;  3APD A;  3PPA A;  4NAW B;  2FNJ B;  2KD0 A;  3HM6 X;  3NOB A;  5AZG A;  2LGY A;  1CMX B;  2ZNV B;  4LJP B;  4TQ1 A;  2FCM A;  3GOE A;  4E71 A;  2KC1 A;  3O65 B;  4KZ0 A; 
#chains in the Genus database with same CATH topology
 3CWI A;  3W1S A;  1E7P B;  1QKZ A;  4NAM A;  3A1Q B;  4M70 B;  1RFA A;  2LGI A;  1F52 A;  1HE8 A;  5AEK B;  3AEA B;  1HK3 A;  3TIX A;  3ZJV A;  1MFW A;  1P9D U;  1V80 A;  3WCQ A;  1FNU A;  2QEJ C;  3QA8 A;  1D4B A;  4AUQ C;  1GNJ A;  3RUI B;  1WZ0 A;  3I5J C;  2K39 A;  4MT5 A;  1V1O A;  3AEB B;  3R7R A;  2EMS A;  2LOQ A;  3GP7 A;  3ECI A;  3U7D A;  1IGC A;  4WUR A;  4ZRK A;  4F8C B;  3UQA A;  1E7C A;  2EFH A;  3M99 C;  3X0W A;  3H37 A;  1TS4 A;  2WX0 A;  3AM9 A;  2JF5 A;  4GN1 A;  1CK1 A;  1WXS A;  1SE4 A;  2K6Q A;  2KAC A;  4ANV A;  3DDC B;  2VZK D;  3RUL A;  3JQZ A;  4DQO C;  5FKA C;  5J18 A;  3AU4 A;  2KBZ A;  3AEG B;  1GUA B;  2SAK A;  1VR9 A;  1UD7 A;  2GBR A;  1XXG A;  1CJE A;  1MIW A;  2N9X A;  1E90 A;  4YWG G;  1C3T A;  2KMM A;  1ET6 A;  1UGJ A;  2ZPY A;  2DYB A;  2ZCC A;  2JZZ A;  3Q8C A;  1WY8 A;  2K3U A;  3OWE B;  1J7E A;  4DHX B;  1SJE D;  2J42 A;  2GRI A;  1FOU A;  2BXP A;  1C4P A;  5KHO A;  3WHQ A;  4BVU C;  4F5T A;  2HE7 A;  1R4M B;  1YQB A;  2K8H A;  1E8Y A;  4WJO A;  2LXC A;  1YJI A;  3ZJT A;  1WM3 A;  1J19 A;  2VUE A;  3B9L A;  1WJN A;  1UWM A;  4K81 A;  1ISN A;  4N59 A;  3KQ4 A;  3GQU A;  1MHX A;  2LXS A;  1NYQ A;  3HVZ A;  4KSL C;  4BBN F;  4ZBR A;  1KLG D;  2C7M B;  2UYZ B;  1Q10 A;  1UBQ A;  3DOW A;  3DBH B;  2R2Q A;  2KLC A;  4LB9 A;  2KDB A;  1ZOY B;  2MBH A;  4LNN A;  4NNJ B;  3BK1 A;  3TEY A;  2JX5 A;  4J3O D;  1TXU A;  3C0R B;  2BS2 B;  2CHW A;  2JWZ A;  1HK2 A;  4ZHP A;  1Y56 A;  1Q5W B;  2L7R A;  5BMH A;  1FRR A;  4AP4 C;  4F5U A;  1YN4 A;  5FR3 A;  3A9J B;  4HJK A;  1E9M A;  1JWU D;  5BYS A;  2JY6 A;  1MIY A;  4GU2 A;  3ZIM A;  4C56 C;  4HDO A;  1LM8 B;  3VUY A;  2HJ8 A;  3IT6 B;  4KV2 A;  3KLS X;  2GBN A;  4OVU A;  2IDY A;  4K3B A;  2IO2 B;  3LJ3 A;  1YMH E;  2JUH A;  3BVZ A;  1HK5 A;  2MSE D;  1UZX B;  3LXF A;  4WAA A;  3A33 B;  3ECP A;  5L83 A;  2WDQ B;  4OTU A;  3AE7 B;  4M00 A;  2VDB A;  3TBL D;  2N4F A;  2FCS A;  3ZDM C;  3ZVV A;  2L8J A;  1F0Z A;  1RLF A;  4H2A A;  3D32 A;  3P4R B;  1JWS D;  4GMV A;  2BS3 B;  1H8C A;  2TSS A;  3MC8 A;  2Z8J A;  1IPG A;  1F1H A;  2WXO A;  3BY4 B;  1I42 A;  4JLC A;  1WXQ A;  3ZNG C;  2KQS A;  2M4N A;  3MP9 A;  3N3K B;  3AB5 A;  2ZW1 A;  2AQ1 B;  2KQ7 A;  3B9M A;  1L4D B;  2DEN B;  2KZR A;  4KKJ A;  4MM3 B;  4WJQ A;  5D94 A;  1CQV A;  4OZB A;  2LUE A;  1I4P A;  3U7Z A;  3LU8 A;  3B0A A;  1VZS A;  5BPK A;  2J7Q B;  1GNU A;  2H89 B;  4FAD A;  3RZF A;  4ZRP A;  3FWB C;  3VR9 B;  2K8C A;  1R7S A;  3CF6 E;  2WWZ A;  1VD2 A;  2KXJ A;  4RFB A;  4OR0 A;  1FNW A;  5BYQ A;  2OED A;  4HK2 A;  4TMA B;  4B0E A;  4C4V A;  2MJ3 A;  1JQ4 A;  1KDX A;  2KX0 A;  1WJU A;  4AS1 A;  2J0K A;  3VXW A;  1JCK B;  1XD3 B;  2QSD A;  3KYD D;  1YQ3 B;  5DCN A;  2JQR B;  3PSE B;  3UIN B;  2M56 B;  3PT2 B;  3W1S C;  4HGK A;  2GB1 A;  3LDZ E;  1P0R A;  1JRO A;  4RM8 A;  2WXQ A;  1MA9 A;  4IW1 A;  4FJY A;  5G2N A;  4GG2 A;  2IY1 B;  4KX6 B;  2J52 A;  3UQB A;  1P7F A;  1NEK B;  2MLB A;  3SD5 A;  1M94 A;  1K52 A;  1D5M C;  3APF A;  2W3S A;  2WHI A;  2PPH A;  4NQK E;  1DOY A;  4ZRQ A;  4WIP A;  2RR9 A;  2FCN A;  1DOX A;  1FNV A;  3NVY A;  3PGE A;  1Y8R C;  3RD2 A;  2INN E;  1K8R B;  4MSQ B;  1ZDV A;  4HLE A;  3VRB B;  4WQM A;  2X8X X;  3JRY A;  3T3N A;  1H9Z A;  1FIQ A;  1NYR A;  2FIF A;  4WH4 A;  1I4Q A;  5D2M B;  2LUM A;  1VRA B;  2AYO B;  2V36 A;  3H1U A;  1SB0 A;  2ZW0 A;  2N1W A;  1YX5 B;  4O1N A;  2MRP A;  3LB8 C;  5H8Y E;  4LDT B;  3TEZ A;  3IAS 1;  1SIF A;  1TTN A;  4OVZ A;  2MX2 A;  2BW2 A;  2DG5 A;  4FHK A;  2K5P A;  2QJL A;  5EE0 A;  1TKE A;  1JW9 D;  1O9X A;  5IJ5 A;  2LVP A;  1V9J A;  1MIV A;  5G55 A;  4MH8 A;  1N5X A;  2MP2 A;  2FE8 A;  3VH3 B;  3V60 A;  1WXM A;  2NBV B;  3JSV A;  1YD8 U;  1R4N B;  2QCZ A;  4I6N B;  3NJT A;  2D07 B;  3ZGZ A;  3AE8 B;  3IXS A;  3EFU A;  1EWC A;  2KTR B;  2LAS A;  3AN1 A;  2AX5 A;  4HRO A;  3FC4 A;  1XEE A;  3BPJ A;  4ZYN A;  3ZQ4 A;  1S1Q B;  4XWT A;  3DBS A;  4GSW A;  4EEW A;  4HCN B;  3NUH B;  1V1P B;  1VJK A;  3A9J A;  2DBX A;  1WE6 A;  3HK0 A;  5C23 A;  2WXF A;  2LGS A;  2Y5B B;  1F2R I;  4L1B A;  3ZXV A;  3ZYY X;  5B5T A;  2Z0D B;  3MHZ A;  3V3X A;  1E5W A;  3K9P B;  3DBR B;  1E7E A;  4JWS C;  1KW2 A;  3N32 A;  3SDL C;  2KDE B;  3DBH I;  1GB4 A;  2QC8 A;  2K22 A;  4G03 A;  4N3Z A;  3PLV A;  3N30 A;  4EE2 A;  2DX5 B;  2DZM A;  1I4R A;  2XK5 B;  4YTP B;  4W9L A;  1AN8 A;  5AUI A;  5CTR C;  2CKH B;  1Z5S B;  5H92 C;  2BYF A;  4KKI A;  3AED B;  2K9X A;  2BXL A;  3AE9 B;  1G6J A;  3DVN V;  1XF5 L;  1DGJ A;  4LJO B;  1QZE A;  5D6J B;  2M19 A;  5DQF A;  4ARC A;  3TL5 A;  2XVQ A;  4BKS A;  1HZ6 A;  4GB9 A;  4N0F D;  3FKY A;  2LMC A;  1WYW B;  3QWZ B;  2I38 A;  2B76 B;  4GLS C;  2BXA A;  1ROE A;  1VLB A;  3R2I A;  3VR8 B;  4D7X A;  2RGF A;  2RPQ A;  4HPM B;  2JSV X;  1QOG A;  3APD A;  1BKE A;  2E3T A;  2D3A A;  3NOB A;  2ZNV B;  4TQ1 A;  2FCM A;  4A9A A;  4KZ0 A;  1WZ3 A;  3PRE A;  2LWP A;  5IP4 D;  4NPN A;  4W9F A;  2KNB A;  4J2V A;  3N9Y C;  1PFD A;  4JE3 B;  4IKG A;  3KH0 A;  4PS3 A;  2BVC A;  3QC8 B;  2Z59 B;  4LNF A;  2PEA A;  5IN7 A;  4HXD A;  3VTW A;  1D6E C;  2CU1 A;  1WX7 A;  2XNA C;  4W9K A;  1T0R C;  2KDM A;  2IZV B;  1WF9 A;  4KGT A;  4LK0 M;  1V1P A;  2KAN A;  4NJ7 A;  3H9D A;  2PJH A;  1FXI A;  2I2Y A;  4ACF A;  5CHF A;  3R8B A;  2V3N A;  1QOB A;  4RGM A;  3NVW A;  1IBX A;  1XLO A;  2G1E A;  4B95 A;  4F5V A;  2KMA A;  3V08 A;  5J17 A;  4C00 A;  2WGS A;  2MEK A;  4WJN A;  4ZDV A;  1E7F A;  3NRZ A;  1GC7 A;  2LJ5 A;  2C5L C;  3N20 C;  2BWE S;  3QAR A;  2BXD A;  5JHB A;  1TYG B;  3I57 A;  2JYT A;  2KC2 A;  4N9F 4;  4ZOH C;  1WXA A;  3PZD A;  1C76 A;  1XLP A;  4PO0 A;  2WXP A;  2Z8L A;  4QAY A;  2LHE A;  2BXF A;  1Q0W B;  3V05 A;  1WGD A;  4W4U B;  2O6V B;  3DHG C;  2XSI A;  4DXG A;  4ZUX V;  2CR5 A;  4ANX A;  2Z8I A;  1FFV A;  2V1Y A;  1XLQ A;  4GDK B;  4BOZ B;  2DAF A;  3VTV A;  1BM0 A;  4TKN A;  4W9E A;  3EEC A;  2PMV A;  1QOF A;  1V5T A;  3ZKJ C;  1V86 A;  2ZJD A;  2L0T A;  4US8 A;  2PVO D;  4GDL B;  2KTR A;  4KGS A;  1NEN B;  2GBM A;  2INP E;  2IGG A;  2RPV A;  3HRD D;  2WX1 A;  3NVV A;  4DXA B;  3HVD A;  3WAP A;  5HFY A;  1LO5 D;  1T6B X;  2ROH A;  3A4R A;  4YSY B;  5HG2 A;  1OEY A;  1E7U A;  2QM6 A;  4ZBK A;  3PZ8 A;  4P16 A;  2D3C A;  4BBN C;  1SB3 C;  2MBE A;  4DDG D;  4LDT D;  1KOT A;  1Z2M A;  1ZKH A;  3BVM A;  2Y3A A;  1KM7 A;  1EU4 A;  4IWO A;  1MI0 A;  1JRU A;  1XCQ L;  3V62 A;  2WXR A;  3WIM A;  2PTL A;  1ENF A;  3P4S B;  1SXT A;  4EFO A;  4UDU C;  4A6Q A;  2G4D B;  1FXT B;  2LVO A;  3A75 A;  2L52 A;  3UIV A;  2WXK A;  3V6E B;  1E7V A;  1SJH D;  1HK4 A;  2EKI A;  4PS8 A;  2N9L A;  4M0W B;  2N7D A;  4K3C A;  3UIO B;  1P7E A;  5EE9 A;  4K71 A;  4FIP B;  1FPY A;  4MM3 A;  2JU6 X;  4OTT A;  4BOS C;  2MHJ A;  3L0W B;  4RCO A;  3KUD B;  1TY2 A;  4M8M A;  3BYY B;  2LZ6 A;  2QIE B;  4JIO U;  2NTT A;  1XLN A;  2IO1 B;  4C80 A;  3V6C B;  3MC9 A;  3NG0 A;  2MQJ A;  1K51 A;  2BXB A;  4DK5 A;  2C7N B;  2D11 A;  4RF0 A;  2OZB B;  1WH3 A;  3ETR A;  4BAX A;  1K53 A;  1YN3 A;  3VTU A;  4A3P A;  1TIF A;  1D3Z A;  4D2K A;  1AO6 A;  2BYT A;  3M95 A;  2R61 A;  1C9F A;  4DHZ E;  3L08 A;  2A4Z A;  2J0J A;  3AEF B;  4HKQ A;  2LQH A;  3GS2 A;  1J8C A;  3EA6 A;  3G9K D;  2LD9 A;  2NTS A;  3WAL A;  1SSN A;  2G45 B;  1ET9 A;  1MPE A;  5TR5 A;  2GLS A;  3ZXR A;  2EFE A;  4L9Q A;  3W1Y A;  3NZS A;  3GQX A;  2XEW A;  3P4Q B;  3MHH B;  2L1A A;  1WWT A;  4YXD B;  1TY0 A;  1E7B A;  2M8S A;  2K0N A;  3ZRF A;  4IG7 B;  4US9 A;  1CZP A;  3JYU A;  4WA6 B;  1HA5 A;  1JWM D;  2KFJ A;  2LJI A;  3W2D A;  4MEL A;  2KOX A;  4AJY B;  1AW7 A;  1K50 A;  2B3A A;  3TEX A;  1L7Y A;  5BMI A;  1E7I A;  3FAH A;  1M4V A;  2GOW A;  1E7H A;  3Q8B A;  3TDL A;  2IGD A;  1SIJ A;  2R2O A;  1NI2 A;  5GHK A;  3UF8 A;  2M1M A;  1IJG A;  2VRR B;  3ZRC A;  1ZUD 2;  2MCN B;  1QIL A;  1H5W A;  5G5G A;  1E0Z A;  2IND C;  2NBW B;  4MBE C;  1WM2 A;  5IOI A;  5I4D A;  2XVV A;  3A9K B;  4E99 A;  3P4P B;  4GDX A;  3B2F A;  1WR1 A;  3PLA A;  2LGX A;  4IUM B;  2JXX A;  3KWV A;  1OQQ A;  2V4I B;  3SR6 A;  3TSS A;  1VFI A;  4N6E B;  4Z9O A;  4ARI A;  1LFD A;  3Q3F A;  3N1Y C;  2CHX A;  2O6V D;  4P1C C;  2DNF A;  1DYQ A;  4EZJ A;  3WA0 A;  4S0R A;  5GIO A;  4FUL A;  2PE6 B;  2AGH B;  2DYM A;  2JXT A;  4GIV A;  1TF0 A;  3SIV B;  2KVZ A;  1OEY J;  2ZVO A;  4MAC A;  4RH6 A;  3NVM A;  3WAO A;  2L05 A;  5JXV A;  1WSP A;  1B1Z A;  3B08 A;  1WGY A;  3QCA A;  4DDI D;  4DHJ B;  1J0G A;  3GE3 C;  3TJP A;  3L54 A;  2NR2 A;  3UI3 A;  4WJP A;  2ASQ A;  3C8Y A;  4P6V F;  3BZD B;  3QHT A;  1MUH A;  2DBY A;  3AE6 B;  3SHQ A;  3ZNZ B;  4LUF A;  1TGZ B;  3PLU A;  2G4S A;  1LQB A;  4WWO A;  5IIH A;  1XQQ A;  3HM3 A;  1E7G A;  4CYE A;  3E56 A;  2BXI A;  3AE4 B;  2BPS A;  2OJR A;  4K7U A;  3DQV A;  2LRW A;  2J4X A;  2ZNV C;  2KDI A;  4AOF A;  1ZW7 A;  3ZO5 B;  5AUK A;  3B9J A;  3T8M A;  3TMP B;  1IYF A;  2D5G A;  2WNM A;  4LTU A;  1YNT E;  3A1Q A;  4Z69 A;  3DBR I;  4I6L B;  1BT0 A;  2WU2 B;  2G9H D;  2KVR A;  3VH4 B;  1AAR A;  2MP2 B;  2DHZ A;  3PVL A;  4PK1 A;  4MH0 E;  2EEL A;  1RFK A;  2MBO A;  1ZXI A;  4FN2 A;  2VUF A;  3R3M A;  5HI1 A;  2X38 A;  1EF1 A;  2ZZP B;  2DBU A;  2BT6 A;  4HVB A;  2V3P A;  3NVI A;  1NI3 A;  1FM0 D;  4G11 A;  1V49 A;  2I1J A;  3RT3 B;  1OQY A;  4BFR A;  4Q2J A;  4JPS A;  4NAW B;  2KD0 A;  1CMX B;  2CJO A;  2XVU A;  2HDE A;  1KF6 B;  4E71 A;  3GOE A;  4EMX A;  4RGO S;  4HPP A;  1MJD A;  4BKE A;  1SBB B;  3Q3M C;  5DPW A;  3VUX A;  4N0U D;  2JVC A;  1WRI A;  1MHH E;  3S2A A;  3B1L X;  1R4N I;  1L2N A;  1SGH A;  4YTN B;  2KAJ A;  1WI0 A;  1KH0 A;  1FMA D;  3KW5 B;  1LOT A;  2MJD A;  2W55 A;  5MPO A;  2V9H A;  4M01 A;  2K0P A;  2WXL A;  3MJW A;  3VDZ A;  4FBJ B;  4C4V B;  3BK2 A;  2DBW A;  4WAF A;  1FCC C;  1QOA A;  2AEH A;  2NPT A;  3N1Z C;  2RDH A;  1N62 A;  1IUE A;  2W9N A;  3MC0 B;  1L0Y B;  3AE1 B;  2FBW B;  3DCG A;  3AE2 B;  1I35 A;  1ZDX A;  1WE7 A;  2C9W B;  4MJS A;  3PV1 A;  3CIR B;  3A73 A;  3NVK A;  1L6U A;  2JZ3 B;  2REX A;  4ANW A;  2W3R A;  3ZTC A;  1L6V A;  4LLG M;  3BII D;  1WFY A;  5C3J B;  3DVN U;  4MJS B;  3VAW A;  4DBG A;  4LB2 A;  3PS6 A;  2KMC A;  2BS4 B;  3DPD A;  2O6V A;  3SFE B;  5JHA A;  4DWF A;  3ZUN A;  5GIP A;  1KLV A;  2JUO A;  2KWF A;  2BXQ A;  4K7W A;  1PDX A;  1ZXH A;  2KX3 A;  3Q8F A;  2HTH A;  2WXJ A;  1IP9 A;  4HJG E;  1VDV A;  4OW0 A;  3MJ5 A;  3KIK A;  3H3A A;  3NMU A;  3SIU B;  1JAL A;  4KVG B;  2L83 A;  3QQ8 B;  4W9D A;  2KDF B;  2K25 A;  4JGH B;  1YIW A;  2L3Z A;  1UNS A;  4W9G A;  2KFK B;  4EKU A;  2IO3 B;  2KT7 A;  4BKS D;  2BXH A;  4P7I A;  2BXN A;  3MHS B;  3AV8 A;  2RDG A;  4XDC A;  3ZDT A;  1V6E A;  1XT9 B;  3GZN B;  2OOB B;  4A8X C;  4XDD A;  4ZRI A;  2CKX A;  1J7B A;  2NVU I;  5ID7 A;  1NBF C;  3BYT B;  4GDK A;  3TUO A;  2FUH B;  1UEL A;  4JL9 A;  4LCD E;  2N9P C;  3VQI A;  3W5V B;  3W5U B;  3L13 A;  4YT0 B;  1E10 A;  5HKH A;  4HCP B;  1IGD A;  3L4P A;  1S3S G;  4RF1 A;  4IW2 A;  2WYQ A;  4KDL B;  1UOR A;  2V3S A;  3N1X C;  2J53 A;  3NZ3 A;  1TT5 B;  2JWU A;  4ZRJ A;  2UU7 A;  1T0Y A;  2GBJ A;  2PLP A;  4B9K A;  4N58 A;  4L9K A;  2LI5 A;  4OHJ A;  3V61 A;  1WGK A;  5C1Z A;  1C78 A;  1U4A A;  2D10 A;  2AWT A;  1QQR A;  3AE5 B;  3VHT C;  4XWW A;  1ESF A;  1JWA D;  4F7Z A;  4JX1 C;  2RSU A;  3V09 A;  2JRI B;  5IA7 A;  2BXE A;  3GA9 L;  1IBX B;  3NS1 A;  1GNI A;  2XVW A;  1J7A A;  1NDD A;  3OAW A;  3QK0 A;  1PGB A;  2KJR A;  1HA2 A;  1C79 A;  2XN9 C;  2QMC A;  4ZC6 A;  3LU6 A;  2IO0 B;  1D5Z C;  1JML A;  4R3D A;  2ZPN A;  3H8H A;  2VH2 A;  4I9O A;  3IG3 A;  2BKR B;  2QIL A;  1BJ5 A;  5EE3 A;  4WWN A;  2Z0E B;  1HK1 A;  4C7Z A;  1HZ5 A;  3FIL A;  4EZL A;  4ZHO A;  1YQ4 B;  2GI9 A;  4PS7 A;  1R4M I;  4ITK A;  4RGT A;  1WR6 E;  4ZCG A;  3SQJ A;  1KRH A;  1MM8 A;  2ZVN A;  5J2R A;  1I4H A;  2ZEQ A;  2SEB D;  3VUW A;  4MGY E;  1KXP D;  3A4S C;  3KUZ A;  2HJ1 A;  1P3Q U;  2BF8 B;  3DBL B;  3DHI C;  4FK5 B;  1N60 A;  5CHV C;  2Q5W D;  3Q3N C;  1HXY D;  2O2V A;  1FD6 A;  5IIU A;  4PYZ A;  3DBL I;  1YN5 A;  1KTK A;  1TZ1 A;  3OLM D;  1N5W A;  1PGX A;  3R66 C;  4K7S A;  3RMK C;  4WWP A;  3ZW3 A;  4FJV B;  4C7Y A;  4K1R B;  2Y5C A;  1YJJ A;  3IVF A;  2WP9 B;  5EE1 A;  3R7Q A;  1UUP A;  3PHW B;  2WXI A;  4NZL B;  3IT4 B;  2PW9 A;  2NCN A;  4G01 A;  2N0S B;  3FIL B;  4A20 A;  2DZK A;  2BWF A;  3AE3 B;  3IFW B;  1HQR D;  2V4L A;  3QJZ A;  2KO3 A;  2BXO A;  3A9K A;  5AZH A;  3AXC A;  2JRH A;  1SF0 A;  2BKF A;  2I30 A;  2CS4 A;  2XMO A;  1T5X D;  4MGZ E;  3CX9 A;  1BXT A;  4E74 A;  4PYU A;  1OTR B;  4L8U A;  4M8N A;  1YX6 B;  1YJ1 A;  1L0X B;  5BYR A;  4AWJ A;  4ICU A;  1LGR A;  2KWC A;  2VH1 A;  1FRD A;  1J7C A;  3L17 A;  2MWS B;  4F1S A;  4G50 A;  1UH6 A;  3PRM B;  1QT9 A;  5CX3 A;  3SFD B;  2WLB A;  3BIN A;  1JNB A;  3ZJU A;  2E0Y A;  1VCB A;  4B0M A;  4DHJ D;  3BWU D;  4FJC B;  5DBY A;  3Q3O C;  1Q1O A;  1P1A A;  3Q6B A;  5D7G A;  4GGQ A;  1AYF A;  2QHO A;  4FHJ A;  1BML C;  3AUL A;  1T0S C;  3VRA B;  3Q14 C;  3E9S A;  1KLU D;  2KK8 A;  3GE8 C;  1TKG A;  1H4R A;  1MG4 A;  3X23 A;  3L10 B;  3JSV B;  2DWQ A;  2C60 A;  3NS8 A;  5D3D A;  2ZCB A;  2YEP B;  1ZGU B;  1PUT A;  4BKT A;  2BQQ A;  4S17 A;  3RZW C;  1C77 A;  3ZNH B;  5E6N A;  2NQO A;  5IAA C;  2XW1 A;  2FID A;  2RMM A;  2L76 A;  2L00 B;  4M02 A;  4CQN A;  4A3O A;  2EKE C;  3H7P A;  3KVF B;  4OVV A;  3L16 A;  2QDF A;  2XW0 A;  4P1B C;  4XC2 A;  3J9C A;  4GXB A;  1SE3 A;  1GAQ B;  1E8W A;  1XO3 A;  5KHQ A;  2KWV B;  1L4Z B;  2INC C;  2CHZ A;  3U30 A;  1D5X C;  2V0G A;  3WHS A;  2AJE A;  2JT4 B;  4M0W A;  1TS3 A;  2BGF A;  4KIK B;  1T0Q C;  2KWD A;  3P2B A;  2IBI B;  2BX8 A;  1X1M A;  3T9L A;  2PVG C;  1RM6 C;  4KZC A;  2N7J A;  4KDI C;  5IIX A;  4IM2 A;  3Q2A C;  3QIJ A;  4PT5 A;  1DOI A;  3Q8A A;  2I2Z A;  3C19 A;  1ZP0 B;  1T3Q A;  4XX5 A;  2E0X A;  4KGR A;  2WXN A;  2D3B A;  2J0M A;  2I1K A;  3IHP C;  1RYJ A;  3U4E G;  2IYD B;  4W9I A;  3JW0 X;  3QX1 A;  4YL8 A;  3PPA A;  3HM6 X;  5AZG A;  2LGY A;  4LJP B;  3O65 B;  4ANU A;  1I4G A;  3RN9 C;  2PIA A;  3NZU A;  3PTF C;  2YVC A;  1TS2 A;  2PKO A;  2KKC A;  4JQW C;  2L0F A;  2L32 A;  3ABV B;  4CHK A;  1FO4 A;  3PRZ A;  1HEZ E;  3NY5 A;  1EO6 A;  2LGD A;  4F5S A;  3MHS D;  3EFC A;  5LXH A;  2GMI C;  5BMG A;  4OT2 A;  5HHD G;  3AEC B;  3P42 A;  4IC7 B;  2DLB A;  5LXI B;  2AQ3 B;  3GZN I;  3GB1 A;  4XE0 A;  2KHW B;  1PYW D;  3RYT A;  1E6E B;  3MTN B;  4LUH A;  1KFY B;  4RM9 A;  5L95 C;  4I6P A;  1RRB A;  2FUG 1;  3OJ4 B;  3NVZ A;  1FCL A;  2EFD A;  2MBQ A;  2HD5 B;  2NBU A;  4NAW A;  4WQO B;  4X57 B;  3ALB A;  2KJH B;  3EHV A;  1L5P A;  1E78 A;  1N6Z A;  2CJN A;  4W9H A;  4IW0 A;  1EM7 A;  2LRU A;  2JPH A;  4USA A;  5AZF A;  5FK9 C;  2BBC A;  1UWX A;  1F9J A;  5CHW A;  2KYW A;  2XBB C;  1P98 A;  3ZLZ A;  5D3I B;  5JH5 C;  2MW5 A;  4FXC A;  4IDI A;  4YSX B;  1TJE A;  5IJE A;  3TCA A;  1MG8 A;  1TKY A;  4URK A;  4NJC A;  2KN5 A;  3H7P B;  4B6W A;  2Y5P A;  5DPT A;  5GIN A;  2CU3 A;  2WDT B;  3I3T B;  2N9K A;  2EMT A;  2G3Q B;  4II2 B;  4ZYS A;  1GJZ A;  1PQS A;  1WJ4 A;  3T3O A;  2H88 B;  5E6P A;  2BXM A;  2AQ2 B;  4G04 A;  4MGK E;  1EF5 A;  3ZTD A;  3RNC C;  4IWP A;  3RNB C;  1PGA A;  2AL3 A;  2W82 A;  2WXG A;  1EUV B;  2LHD A;  1C4A A;  1GPX A;  4CO7 A;  4XZ4 A;  4L2Y A;  4WWM A;  3AMZ A;  2BTE A;  3U8Z A;  1TS5 A;  1V8C A;  3RI7 C;  3AEE B;  1ZE3 D;  2DZI A;  2YEP F;  2VZK B;  3DVG X;  1WMH A;  5EDS A;  1L0V B;  5GXG B;  1GC6 A;  4FLH A;  1B9R A;  2DYO A;  3K9O B;  4HKZ E;  3DWM A;  3M3J A;  1FFU A;  2KWU B;  4IOI E;  2O2V B;  1STE A;  1UBI A;  3IAM 1;  1SE2 A;  2K1F A;  2RDB C;  1UF0 A;  3RCZ A;  5IKC M;  3H7S A;  3OG5 A;  2EFC A;  1WMH B;  2OHF A;  2KN4 A;  2BB6 A;  2HTM E;  4MDK E;  2KTF A;  2LXT A;  2BYE A;  2RD0 A;  1RWS A;  1WX8 A;  2MJE A;  2XK5 A;  5T8I A;  3KUC B;  1YOV B;  2PE9 A;  2N9E B;  2BXK A;  3ML9 A;  2MA9 B;  4LNO A;  1LNS A;  3URY A;  3KJL A;  1ACC A;  4BZA A;  1FEH A;  1NVI D;  3CSF A;  4RNA A;  2UWQ A;  2KLG A;  2OT3 A;  4DM0 A;  1TZO A;  1F2R C;  2D2Q A;  4A90 A;  3V03 A;  4JK4 A;  3WHR A;  4EUT A;  5IJF A;  2M0A A;  4XYC A;  3TEW A;  4IM0 A;  2JZP A;  4BY9 C;  2BXC A;  2YLM A;  4TV3 A;  4RMA A;  5IFO A;  1C4C A;  4E3C A;  5FUO A;  4L23 A;  3KYC D;  2N7E A;  2WS3 B;  4EZK A;  3Q69 A;  4DHZ B;  1QF6 A;  5C2T B;  1NT2 B;  2W54 A;  4HWI B;  1FXA A;  2DAJ A;  3VFK A;  4GOC A;  3SEB A;  3ONS A;  2NMQ A;  3WAN A;  4FA6 A;  1SEB D;  1VZ6 A;  1GOZ A;  2WXH A;  4NQL B;  3APC A;  1N5U A;  2WQY B;  3RFZ B;  4AJW A;  3RNE C;  4BKG A;  1RAX A;  4LNK A;  2IPK D;  1OGW A;  4A55 A;  2JYE A;  5DPR A;  2YDF A;  2ACZ B;  2K6D B;  2LVQ A;  2QHB A;  4J6I A;  3O13 A;  2GBK A;  1V2Y A;  1E8Z A;  3HHM A;  5TSS A;  3AU5 A;  3H6N A;  3P1M A;  3I9V 1;  3ENE A;  4TUU A;  4RGN A;  2LEK A;  4OZA A;  3I63 C;  4MGI E;  3CMM B;  4OZC A;  5E6J A;  3Q3J A;  2GUT A;  2LXA A;  2ICI A;  1HTQ A;  1WXV A;  2FAZ A;  1JRP A;  4ICV A;  3ZNI D;  1JWB D;  2FCQ A;  4G3X B;  1BUI C;  3NHE B;  4IM3 A;  1WYG A;  3M63 B;  3ML8 A;  3PO0 A;  3RNF C;  2OJW A;  4ZBQ A;  3B2G A;  2BXG A;  3DHH C;  1EWY C;  3P63 A;  2M17 A;  2ONQ A;  2AL6 A;  1WGH A;  5E6O A;  3SU8 X;  1E8X A;  3QAQ A;  3UGB B;  3M62 B;  4LA0 A;  3RNA C;  1OFF A;  5JZE B;  1WIA A;  4KIK A;  5G5H A;  3WAM A;  2IJ0 A;  2D3G A;  2WDV B;  1V97 A;  2DZJ A;  3HUI A;  4FJZ A;  4ASW C;  3UIP B;  4II3 B;  3JVZ X;  2MH7 A;  1V81 A;  3R2T A;  2NS5 A;  4KSK C;  2WU5 B;  1MVK A;  2KFK A;  1TBE A;  3DWG C;  1F77 A;  2LQI A;  3IBE A;  3U52 E;  2LFI A;  3OJ3 A;  1V5O A;  3VVW B;  3BVG A;  4YTM B;  1UGM A;  3EUB 2;  3ICX A;  1WJ6 A;  4HEA 1;  2K8B A;  5FR6 A;  3PHX B;  3PZ7 A;  4S1Y A;  1VZ8 A;  2IY0 B;  4NY0 A;  3EC8 A;  1HTO A;  1OQR A;  1I7H A;  5DPS A;  2IGH A;  3MFG A;  4MSM B;  1N63 A;  4G0N B;  1LXD A;  1VZ7 A;  2KQ4 X;  2C7H A;  1WGG A;  1ZPS A;  2NNW A;  1GB1 A;  4DXF A;  3EGR A;  1QLB B;  2QMT A;  3LYY A;  2BB5 A;  1C1Y B;  4GDL A;  2N1V A;  1E7A A;  4IWQ A;  3LU7 A;  3RPF C;  2E6X A;  1I4X A;  4TSS A;  4HGM B;  4JWU C;  4C31 B;  1N61 A;  5BO4 B;  1SE9 A;  4W9J A;  4XGA B;  1AWD A;  3Q8E A;  4EOY A;  5HOZ A;  2ON8 A;  3HIZ A;  4YSZ B;  3U2S C;  4NJ6 A;  1KJT A;  4HPL B;  3DVG Y;  4W9C A;  3CST A;  3FNM A;  2WDR B;  2MBB B;  1A5R A;  2NPT B;  5GMV A;  4K2C A;  3FWC C;  5LLI A;  2Z8K A;  2BYV E;  1WX9 A;  1MUS A;  4AQ7 A;  5ID9 A;  3PRP B;  2WXM A;  1A70 A;  3AH7 A;  1GG3 A;  3RNG C;  2KJ6 A;  4HDQ A;  3KWL A;  2A5U A;  2M0X A;  1WGR A;  4MEM A;  4REZ A;  4TQ0 A;  5IO9 A;  3AI5 A;  1WRD B;  1EU3 A;  5LNK 1;  1XCT L;  2FNJ B;  1J78 A;  4LNI A;  4HRS A;  2KC1 A;  3W9C B; 
#chains in the Genus database with same CATH homology
 3CWI A;  3W1S A;  1E7P B;  1QKZ A;  4NAM A;  3A1Q B;  4M70 B;  1RFA A;  2LGI A;  1HE8 A;  5AEK B;  3AEA B;  1HK3 A;  3TIX A;  3ZJV A;  1P9D U;  1V80 A;  3WCQ A;  1FNU A;  3QA8 A;  2QEJ C;  1D4B A;  4AUQ C;  1GNJ A;  3RUI B;  1WZ0 A;  4MT5 A;  2K39 A;  1V1O A;  3AEB B;  3R7R A;  2EMS A;  2LOQ A;  3GP7 A;  3ECI A;  3U7D A;  1IGC A;  4WUR A;  4ZRK A;  4F8C B;  3UQA A;  1E7C A;  2EFH A;  3M99 C;  3X0W A;  3H37 A;  1TS4 A;  2WX0 A;  3AM9 A;  2JF5 A;  4GN1 A;  1CK1 A;  1WXS A;  1SE4 A;  2K6Q A;  2KAC A;  4ANV A;  3DDC B;  2VZK D;  3RUL A;  3JQZ A;  4DQO C;  5FKA C;  5J18 A;  3AU4 A;  2KBZ A;  3AEG B;  1GUA B;  2SAK A;  1VR9 A;  1UD7 A;  2GBR A;  1XXG A;  1CJE A;  1MIW A;  2N9X A;  1E90 A;  4YWG G;  1C3T A;  2KMM A;  1ET6 A;  1UGJ A;  2ZPY A;  2DYB A;  2ZCC A;  2JZZ A;  3Q8C A;  1WY8 A;  2K3U A;  3OWE B;  1J7E A;  4DHX B;  1SJE D;  2J42 A;  2GRI A;  1FOU A;  2BXP A;  1C4P A;  5KHO A;  3WHQ A;  4BVU C;  4F5T A;  2HE7 A;  2K8H A;  1YQB A;  1E8Y A;  4WJO A;  2LXC A;  1YJI A;  3ZJT A;  1WM3 A;  1J19 A;  2VUE A;  3B9L A;  1WJN A;  4K81 A;  1UWM A;  1ISN A;  4N59 A;  3KQ4 A;  3GQU A;  1MHX A;  1NYQ A;  3HVZ A;  4KSL C;  4BBN F;  4ZBR A;  1KLG D;  2C7M B;  2UYZ B;  1Q10 A;  1UBQ A;  3DOW A;  2R2Q A;  2KLC A;  4LB9 A;  2KDB A;  1ZOY B;  2MBH A;  4NNJ B;  3BK1 A;  3TEY A;  2JX5 A;  4J3O D;  1TXU A;  3C0R B;  2CHW A;  2BS2 B;  2JWZ A;  1HK2 A;  4ZHP A;  1Y56 A;  1Q5W B;  2L7R A;  5BMH A;  1FRR A;  4AP4 C;  4F5U A;  1YN4 A;  5FR3 A;  3A9J B;  4HJK A;  1E9M A;  1JWU D;  5BYS A;  2JY6 A;  1MIY A;  4GU2 A;  3ZIM A;  4C56 C;  4HDO A;  1LM8 B;  3VUY A;  2HJ8 A;  3IT6 B;  4KV2 A;  3KLS X;  2GBN A;  4OVU A;  2IDY A;  2IO2 B;  3LJ3 A;  1YMH E;  2JUH A;  3BVZ A;  1HK5 A;  2MSE D;  1UZX B;  3LXF A;  4WAA A;  3A33 B;  5L83 A;  2WDQ B;  4OTU A;  3AE7 B;  2VDB A;  3TBL D;  2N4F A;  2FCS A;  3ZDM C;  3ZVV A;  2L8J A;  1F0Z A;  1RLF A;  4H2A A;  3D32 A;  3P4R B;  1JWS D;  4GMV A;  1H8C A;  2BS3 B;  2TSS A;  2Z8J A;  1IPG A;  3BY4 B;  2WXO A;  1I42 A;  4JLC A;  3ZNG C;  1WXQ A;  2KQS A;  2M4N A;  3MP9 A;  3N3K B;  3AB5 A;  2ZW1 A;  2AQ1 B;  2KQ7 A;  3B9M A;  1L4D B;  2DEN B;  2KZR A;  5D94 A;  4KKJ A;  4WJQ A;  4MM3 B;  1CQV A;  4OZB A;  2LUE A;  1I4P A;  3U7Z A;  3LU8 A;  3B0A A;  1VZS A;  5BPK A;  2J7Q B;  1GNU A;  2H89 B;  4FAD A;  3RZF A;  4ZRP A;  3FWB C;  3VR9 B;  2K8C A;  1R7S A;  3CF6 E;  2WWZ A;  1VD2 A;  2KXJ A;  4RFB A;  4OR0 A;  1FNW A;  5BYQ A;  2OED A;  4HK2 A;  4TMA B;  4B0E A;  2MJ3 A;  1JQ4 A;  2KX0 A;  1WJU A;  4AS1 A;  2J0K A;  3VXW A;  1XD3 B;  1JCK B;  2QSD A;  3KYD D;  1YQ3 B;  5DCN A;  2JQR B;  3PSE B;  3UIN B;  2M56 B;  3PT2 B;  3W1S C;  4HGK A;  2GB1 A;  3LDZ E;  1P0R A;  1JRO A;  4RM8 A;  2WXQ A;  1MA9 A;  4IW1 A;  4FJY A;  5G2N A;  4GG2 A;  2IY1 B;  4KX6 B;  2J52 A;  3UQB A;  2MLB A;  3SD5 A;  1NEK B;  1P7F A;  1M94 A;  1K52 A;  1D5M C;  3APF A;  2W3S A;  4NQK E;  2PPH A;  1DOY A;  4ZRQ A;  4WIP A;  2RR9 A;  2FCN A;  1DOX A;  1FNV A;  3NVY A;  3PGE A;  1Y8R C;  3RD2 A;  2INN E;  1K8R B;  4MSQ B;  1ZDV A;  4HLE A;  3VRB B;  4WQM A;  3JRY A;  3T3N A;  1H9Z A;  1FIQ A;  2FIF A;  1NYR A;  4WH4 A;  1I4Q A;  5D2M B;  2LUM A;  1VRA B;  2AYO B;  2V36 A;  3H1U A;  2ZW0 A;  2N1W A;  1YX5 B;  4O1N A;  2MRP A;  3LB8 C;  5H8Y E;  4LDT B;  3TEZ A;  3IAS 1;  1SIF A;  1TTN A;  4OVZ A;  2MX2 A;  2BW2 A;  2DG5 A;  4FHK A;  2K5P A;  2QJL A;  5EE0 A;  1TKE A;  1JW9 D;  1O9X A;  5IJ5 A;  2LVP A;  1V9J A;  1MIV A;  5G55 A;  4MH8 A;  1N5X A;  2MP2 A;  3VH3 B;  2FE8 A;  3V60 A;  1WXM A;  2NBV B;  3JSV A;  1YD8 U;  4I6N B;  2D07 B;  3ZGZ A;  3AE8 B;  3IXS A;  3EFU A;  1EWC A;  2KTR B;  2LAS A;  3AN1 A;  2AX5 A;  4HRO A;  3FC4 A;  1XEE A;  4ZYN A;  3ZQ4 A;  1S1Q B;  4XWT A;  3DBS A;  4GSW A;  4EEW A;  4HCN B;  3NUH B;  1V1P B;  3A9J A;  1VJK A;  2DBX A;  1WE6 A;  3HK0 A;  5C23 A;  2WXF A;  2Y5B B;  1F2R I;  4L1B A;  3ZYY X;  5B5T A;  2Z0D B;  3MHZ A;  3V3X A;  1E5W A;  3K9P B;  1E7E A;  4JWS C;  1KW2 A;  3N32 A;  3SDL C;  2KDE B;  3DBH I;  1GB4 A;  2K22 A;  4G03 A;  4N3Z A;  3PLV A;  3N30 A;  4EE2 A;  2DX5 B;  2DZM A;  1I4R A;  2XK5 B;  4YTP B;  4W9L A;  1AN8 A;  5AUI A;  5CTR C;  2CKH B;  1Z5S B;  5H92 C;  2BYF A;  4KKI A;  3AED B;  2K9X A;  2BXL A;  3AE9 B;  1G6J A;  3DVN V;  1XF5 L;  1DGJ A;  4LJO B;  1QZE A;  5D6J B;  2M19 A;  5DQF A;  4ARC A;  3TL5 A;  2XVQ A;  4BKS A;  1HZ6 A;  4GB9 A;  4N0F D;  2LMC A;  1WYW B;  3QWZ B;  2I38 A;  2B76 B;  4GLS C;  2BXA A;  1ROE A;  1VLB A;  3R2I A;  3VR8 B;  2RGF A;  2RPQ A;  4HPM B;  2JSV X;  1QOG A;  3APD A;  1BKE A;  2E3T A;  3NOB A;  2ZNV B;  4TQ1 A;  2FCM A;  4A9A A;  4KZ0 A;  1WZ3 A;  3PRE A;  2LWP A;  4NPN A;  4W9F A;  2KNB A;  4J2V A;  3N9Y C;  1PFD A;  4JE3 B;  4IKG A;  3KH0 A;  4PS3 A;  3QC8 B;  2Z59 B;  2PEA A;  4HXD A;  3VTW A;  1D6E C;  2CU1 A;  1WX7 A;  4W9K A;  2XNA C;  2KDM A;  2IZV B;  1WF9 A;  4KGT A;  4LK0 M;  1V1P A;  2KAN A;  4NJ7 A;  3H9D A;  2PJH A;  1FXI A;  2I2Y A;  5CHF A;  3R8B A;  2V3N A;  1QOB A;  4RGM A;  3NVW A;  1IBX A;  1XLO A;  2G1E A;  4B95 A;  4F5V A;  2KMA A;  3V08 A;  5J17 A;  2MEK A;  4WJN A;  4ZDV A;  1E7F A;  3NRZ A;  1GC7 A;  2LJ5 A;  2C5L C;  2BWE S;  3QAR A;  2BXD A;  5JHB A;  1TYG B;  3I57 A;  2JYT A;  2KC2 A;  4N9F 4;  4ZOH C;  1WXA A;  3PZD A;  1C76 A;  1XLP A;  4PO0 A;  2WXP A;  2Z8L A;  2LHE A;  2BXF A;  1Q0W B;  3V05 A;  1WGD A;  4W4U B;  2O6V B;  2XSI A;  4DXG A;  4ZUX V;  2CR5 A;  4ANX A;  2Z8I A;  1FFV A;  2V1Y A;  1XLQ A;  4GDK B;  4BOZ B;  2DAF A;  3VTV A;  1BM0 A;  4TKN A;  4W9E A;  3EEC A;  2PMV A;  3ZKJ C;  1V5T A;  1QOF A;  1V86 A;  2ZJD A;  2L0T A;  4US8 A;  2PVO D;  4GDL B;  2KTR A;  4KGS A;  1NEN B;  2GBM A;  2INP E;  2IGG A;  2RPV A;  3HRD D;  2WX1 A;  3NVV A;  4DXA B;  3HVD A;  3WAP A;  5HFY A;  1LO5 D;  1T6B X;  2ROH A;  3A4R A;  4YSY B;  5HG2 A;  1OEY A;  1E7U A;  2QM6 A;  4ZBK A;  3PZ8 A;  4BBN C;  4P16 A;  1SB3 C;  2MBE A;  4DDG D;  4LDT D;  1KOT A;  1Z2M A;  1ZKH A;  3BVM A;  2Y3A A;  1KM7 A;  1EU4 A;  4IWO A;  1MI0 A;  1JRU A;  1XCQ L;  3V62 A;  2WXR A;  3WIM A;  2PTL A;  1ENF A;  3P4S B;  1SXT A;  4EFO A;  4UDU C;  4A6Q A;  2G4D B;  1FXT B;  2LVO A;  3A75 A;  2L52 A;  3UIV A;  3V6E B;  2WXK A;  1E7V A;  1SJH D;  1HK4 A;  2EKI A;  4PS8 A;  2N9L A;  4M0W B;  2N7D A;  3UIO B;  1P7E A;  5EE9 A;  4K71 A;  4FIP B;  4MM3 A;  2JU6 X;  4OTT A;  4BOS C;  3L0W B;  4RCO A;  3KUD B;  4M8M A;  1TY2 A;  3BYY B;  2LZ6 A;  2QIE B;  4JIO U;  2NTT A;  2IO1 B;  1XLN A;  4C80 A;  3V6C B;  2MQJ A;  1K51 A;  2BXB A;  4DK5 A;  2C7N B;  2D11 A;  4RF0 A;  2OZB B;  1WH3 A;  3ETR A;  1K53 A;  1YN3 A;  3VTU A;  4A3P A;  1D3Z A;  4D2K A;  1AO6 A;  2BYT A;  3M95 A;  2R61 A;  1C9F A;  4DHZ E;  3L08 A;  2A4Z A;  2J0J A;  3AEF B;  4HKQ A;  3GS2 A;  1J8C A;  3EA6 A;  3G9K D;  2LD9 A;  2NTS A;  3WAL A;  1SSN A;  2G45 B;  1ET9 A;  1MPE A;  5TR5 A;  2EFE A;  4L9Q A;  3W1Y A;  3NZS A;  3GQX A;  2XEW A;  3P4Q B;  3MHH B;  2L1A A;  1WWT A;  4YXD B;  1TY0 A;  1E7B A;  2M8S A;  3ZRF A;  4IG7 B;  4US9 A;  1CZP A;  4WA6 B;  3JYU A;  1JWM D;  2KFJ A;  1HA5 A;  2LJI A;  3W2D A;  4MEL A;  2KOX A;  4AJY B;  1AW7 A;  1K50 A;  2B3A A;  3TEX A;  1L7Y A;  5BMI A;  1E7I A;  3FAH A;  1M4V A;  2GOW A;  1E7H A;  3Q8B A;  3TDL A;  2IGD A;  1SIJ A;  2R2O A;  1NI2 A;  5GHK A;  3UF8 A;  2M1M A;  1IJG A;  2VRR B;  3ZRC A;  2MCN B;  1ZUD 2;  1QIL A;  1H5W A;  5G5G A;  1E0Z A;  2NBW B;  4MBE C;  1WM2 A;  5I4D A;  2XVV A;  3A9K B;  4E99 A;  3P4P B;  4GDX A;  3B2F A;  1WR1 A;  3PLA A;  2LGX A;  4IUM B;  2JXX A;  3KWV A;  1OQQ A;  2V4I B;  3SR6 A;  3TSS A;  1VFI A;  4N6E B;  4Z9O A;  4ARI A;  1LFD A;  3Q3F A;  2CHX A;  2O6V D;  4EZJ A;  1DYQ A;  3WA0 A;  5GIO A;  4FUL A;  2PE6 B;  2DYM A;  4GIV A;  2JXT A;  1TF0 A;  3SIV B;  1OEY J;  2ZVO A;  4MAC A;  4RH6 A;  3NVM A;  3WAO A;  2L05 A;  5JXV A;  1WSP A;  3B08 A;  1B1Z A;  1WGY A;  3QCA A;  4DDI D;  4DHJ B;  1J0G A;  3TJP A;  3L54 A;  2NR2 A;  3UI3 A;  4WJP A;  2ASQ A;  3C8Y A;  4P6V F;  3BZD B;  3QHT A;  2DBY A;  3AE6 B;  3SHQ A;  3ZNZ B;  4LUF A;  1TGZ B;  3PLU A;  2G4S A;  1LQB A;  4WWO A;  5IIH A;  1XQQ A;  3HM3 A;  1E7G A;  4CYE A;  3E56 A;  2BXI A;  3AE4 B;  2BPS A;  2OJR A;  4K7U A;  3DQV A;  2LRW A;  2J4X A;  2ZNV C;  2KDI A;  4AOF A;  1ZW7 A;  3ZO5 B;  5AUK A;  3B9J A;  3T8M A;  3TMP B;  1IYF A;  2D5G A;  2WNM A;  4LTU A;  1YNT E;  3A1Q A;  4Z69 A;  3DBR I;  4I6L B;  1BT0 A;  2WU2 B;  2G9H D;  2KVR A;  3VH4 B;  1AAR A;  2MP2 B;  2DHZ A;  3PVL A;  4MH0 E;  2EEL A;  1RFK A;  2MBO A;  1ZXI A;  4FN2 A;  2VUF A;  3R3M A;  5HI1 A;  2X38 A;  1EF1 A;  2ZZP B;  2DBU A;  2BT6 A;  4HVB A;  2V3P A;  3NVI A;  1NI3 A;  4G11 A;  1FM0 D;  1V49 A;  2I1J A;  3RT3 B;  1OQY A;  4BFR A;  4Q2J A;  4JPS A;  4NAW B;  2KD0 A;  1CMX B;  2CJO A;  2XVU A;  2HDE A;  1KF6 B;  4E71 A;  3GOE A;  4EMX A;  4RGO S;  4BKE A;  1SBB B;  5DPW A;  3VUX A;  4N0U D;  2JVC A;  1WRI A;  1MHH E;  3S2A A;  3B1L X;  1R4N I;  1L2N A;  1SGH A;  4YTN B;  2KAJ A;  1WI0 A;  1KH0 A;  1FMA D;  3KW5 B;  1LOT A;  2MJD A;  2W55 A;  5MPO A;  2K0P A;  2WXL A;  3MJW A;  3VDZ A;  4FBJ B;  3BK2 A;  2DBW A;  4WAF A;  1FCC C;  2AEH A;  1QOA A;  2NPT A;  3MC0 B;  2RDH A;  1N62 A;  2W9N A;  1IUE A;  1L0Y B;  3AE1 B;  3DCG A;  2FBW B;  3AE2 B;  1I35 A;  1ZDX A;  1WE7 A;  2C9W B;  4MJS A;  3PV1 A;  3CIR B;  3A73 A;  3NVK A;  2REX A;  2JZ3 B;  4ANW A;  1L6U A;  3ZTC A;  2W3R A;  1L6V A;  4LLG M;  3BII D;  1WFY A;  5C3J B;  3DVN U;  4MJS B;  3VAW A;  4DBG A;  4LB2 A;  3PS6 A;  2KMC A;  3DPD A;  2BS4 B;  2O6V A;  3SFE B;  5JHA A;  4DWF A;  3ZUN A;  5GIP A;  1KLV A;  2JUO A;  2BXQ A;  4K7W A;  1PDX A;  2KX3 A;  1ZXH A;  3Q8F A;  2HTH A;  1IP9 A;  2WXJ A;  4HJG E;  1VDV A;  4OW0 A;  3MJ5 A;  3KIK A;  3H3A A;  3NMU A;  3SIU B;  1JAL A;  4KVG B;  2L83 A;  3QQ8 B;  4W9D A;  2KDF B;  2K25 A;  4JGH B;  1YIW A;  2L3Z A;  4W9G A;  1UNS A;  2KFK B;  4EKU A;  2IO3 B;  4BKS D;  2BXH A;  4P7I A;  2BXN A;  3MHS B;  3AV8 A;  2RDG A;  4XDC A;  3ZDT A;  1V6E A;  1XT9 B;  2OOB B;  4A8X C;  4XDD A;  4ZRI A;  2CKX A;  1J7B A;  2NVU I;  5ID7 A;  1NBF C;  3BYT B;  4GDK A;  3TUO A;  2FUH B;  1UEL A;  4JL9 A;  4LCD E;  2N9P C;  3VQI A;  3W5V B;  3W5U B;  3L13 A;  4YT0 B;  1E10 A;  5HKH A;  4HCP B;  1IGD A;  3L4P A;  1S3S G;  4RF1 A;  4IW2 A;  2WYQ A;  4KDL B;  1UOR A;  2V3S A;  2J53 A;  3NZ3 A;  2JWU A;  4ZRJ A;  1T0Y A;  2GBJ A;  2PLP A;  4B9K A;  4N58 A;  4L9K A;  2LI5 A;  4OHJ A;  3V61 A;  1WGK A;  5C1Z A;  1C78 A;  1U4A A;  2D10 A;  2AWT A;  1QQR A;  3AE5 B;  3VHT C;  4XWW A;  1ESF A;  1JWA D;  4F7Z A;  4JX1 C;  2RSU A;  3V09 A;  2JRI B;  5IA7 A;  2BXE A;  3GA9 L;  1IBX B;  3NS1 A;  1GNI A;  2XVW A;  1J7A A;  1NDD A;  3OAW A;  3QK0 A;  1PGB A;  2KJR A;  1HA2 A;  1C79 A;  2XN9 C;  2QMC A;  4ZC6 A;  3LU6 A;  2IO0 B;  1D5Z C;  1JML A;  4R3D A;  2ZPN A;  3H8H A;  3IG3 A;  2BKR B;  2QIL A;  1BJ5 A;  5EE3 A;  4WWN A;  2Z0E B;  1HK1 A;  4C7Z A;  1HZ5 A;  3FIL A;  4EZL A;  4ZHO A;  1YQ4 B;  2GI9 A;  4PS7 A;  1R4M I;  4ITK A;  4RGT A;  1WR6 E;  4ZCG A;  3SQJ A;  1KRH A;  2ZVN A;  5J2R A;  1I4H A;  2ZEQ A;  2SEB D;  3VUW A;  4MGY E;  1KXP D;  3A4S C;  3KUZ A;  1P3Q U;  2BF8 B;  4FK5 B;  5CHV C;  1N60 A;  2Q5W D;  1HXY D;  2O2V A;  1FD6 A;  5IIU A;  4PYZ A;  3DBL I;  1YN5 A;  1TZ1 A;  1KTK A;  3OLM D;  1N5W A;  1PGX A;  3R66 C;  4K7S A;  4WWP A;  3ZW3 A;  4FJV B;  4C7Y A;  4K1R B;  2Y5C A;  1YJJ A;  3IVF A;  2WP9 B;  5EE1 A;  3R7Q A;  1UUP A;  3PHW B;  2WXI A;  4NZL B;  3IT4 B;  2PW9 A;  2NCN A;  4G01 A;  2N0S B;  3FIL B;  4A20 A;  2DZK A;  2BWF A;  3AE3 B;  3IFW B;  1HQR D;  2V4L A;  3QJZ A;  2KO3 A;  2BXO A;  3A9K A;  5AZH A;  3AXC A;  2JRH A;  1SF0 A;  2BKF A;  2I30 A;  2CS4 A;  2XMO A;  1T5X D;  4MGZ E;  3CX9 A;  1BXT A;  4E74 A;  4PYU A;  1OTR B;  4L8U A;  4M8N A;  1YX6 B;  1YJ1 A;  1L0X B;  5BYR A;  4AWJ A;  4ICU A;  2KWC A;  1FRD A;  1J7C A;  3L17 A;  2MWS B;  4F1S A;  4G50 A;  1UH6 A;  3PRM B;  5CX3 A;  1QT9 A;  3SFD B;  2WLB A;  3BIN A;  1JNB A;  3ZJU A;  2E0Y A;  1VCB A;  4B0M A;  4DHJ D;  3BWU D;  4FJC B;  5DBY A;  1Q1O A;  1P1A A;  5D7G A;  4GGQ A;  1AYF A;  2QHO A;  4FHJ A;  1BML C;  3AUL A;  3VRA B;  3E9S A;  1KLU D;  2KK8 A;  1TKG A;  1H4R A;  3X23 A;  3L10 B;  3JSV B;  2DWQ A;  2C60 A;  3NS8 A;  5D3D A;  2ZCB A;  2YEP B;  1ZGU B;  1PUT A;  4BKT A;  3RZW C;  1C77 A;  3ZNH B;  5E6N A;  2NQO A;  5IAA C;  2XW1 A;  2FID A;  2RMM A;  2L76 A;  2L00 B;  4CQN A;  4A3O A;  2EKE C;  3H7P A;  3KVF B;  4OVV A;  3L16 A;  2XW0 A;  4XC2 A;  3J9C A;  4GXB A;  1SE3 A;  1GAQ B;  1E8W A;  1XO3 A;  5KHQ A;  2KWV B;  1L4Z B;  2CHZ A;  3U30 A;  1D5X C;  2V0G A;  3WHS A;  2AJE A;  2JT4 B;  4M0W A;  1TS3 A;  2BGF A;  4KIK B;  2KWD A;  3P2B A;  2IBI B;  2BX8 A;  1X1M A;  3T9L A;  2PVG C;  4KZC A;  1RM6 C;  4KDI C;  2N7J A;  5IIX A;  4IM2 A;  3QIJ A;  4PT5 A;  1DOI A;  3Q8A A;  2I2Z A;  1ZP0 B;  1T3Q A;  4XX5 A;  2E0X A;  4KGR A;  2WXN A;  2J0M A;  2I1K A;  3IHP C;  1RYJ A;  3U4E G;  2IYD B;  4W9I A;  3JW0 X;  3QX1 A;  4YL8 A;  3PPA A;  3HM6 X;  5AZG A;  2LGY A;  4LJP B;  3O65 B;  4ANU A;  1I4G A;  2PIA A;  3NZU A;  3PTF C;  2YVC A;  1TS2 A;  4JQW C;  2KKC A;  2PKO A;  2L0F A;  2L32 A;  4CHK A;  3ABV B;  1FO4 A;  3PRZ A;  1HEZ E;  3NY5 A;  1EO6 A;  2LGD A;  4F5S A;  3MHS D;  5LXH A;  2GMI C;  5BMG A;  4OT2 A;  5HHD G;  3AEC B;  3P42 A;  4IC7 B;  5LXI B;  2DLB A;  2AQ3 B;  3GZN I;  3GB1 A;  4XE0 A;  2KHW B;  1PYW D;  3RYT A;  1E6E B;  3MTN B;  4LUH A;  1KFY B;  4RM9 A;  5L95 C;  4I6P A;  1RRB A;  3OJ4 B;  2FUG 1;  3NVZ A;  1FCL A;  2EFD A;  2MBQ A;  2HD5 B;  2NBU A;  4NAW A;  4WQO B;  4X57 B;  3ALB A;  2KJH B;  3EHV A;  1L5P A;  1E78 A;  2CJN A;  4W9H A;  4IW0 A;  1EM7 A;  2LRU A;  2JPH A;  4USA A;  5AZF A;  5FK9 C;  2BBC A;  1UWX A;  1F9J A;  5CHW A;  2XBB C;  1P98 A;  3ZLZ A;  5JH5 C;  5D3I B;  2MW5 A;  4FXC A;  4IDI A;  4YSX B;  1TJE A;  5IJE A;  3TCA A;  1MG8 A;  1TKY A;  4URK A;  4NJC A;  2KN5 A;  3H7P B;  4B6W A;  2Y5P A;  5DPT A;  5GIN A;  2CU3 A;  2WDT B;  3I3T B;  2N9K A;  2EMT A;  2G3Q B;  4II2 B;  1GJZ A;  4ZYS A;  1PQS A;  1WJ4 A;  3T3O A;  2H88 B;  5E6P A;  2AQ2 B;  2BXM A;  4G04 A;  4MGK E;  1EF5 A;  3ZTD A;  4IWP A;  1PGA A;  2AL3 A;  2W82 A;  2WXG A;  1EUV B;  2LHD A;  1C4A A;  1GPX A;  4CO7 A;  4XZ4 A;  4L2Y A;  4WWM A;  3AMZ A;  2BTE A;  3U8Z A;  1TS5 A;  1V8C A;  3AEE B;  1ZE3 D;  2DZI A;  2YEP F;  3DVG X;  2VZK B;  1WMH A;  5EDS A;  1L0V B;  5GXG B;  1GC6 A;  4FLH A;  1B9R A;  2DYO A;  3K9O B;  4HKZ E;  3DWM A;  3M3J A;  2KWU B;  1FFU A;  4IOI E;  2O2V B;  1UBI A;  1STE A;  3IAM 1;  2K1F A;  1SE2 A;  3RCZ A;  3H7S A;  2EFC A;  1WMH B;  2OHF A;  2KN4 A;  2BB6 A;  2HTM E;  4MDK E;  2KTF A;  2BYE A;  2RD0 A;  1RWS A;  1WX8 A;  2MJE A;  2XK5 A;  5T8I A;  3KUC B;  2PE9 A;  2N9E B;  2BXK A;  3ML9 A;  2MA9 B;  1LNS A;  3URY A;  3KJL A;  1ACC A;  1FEH A;  1NVI D;  3CSF A;  4RNA A;  2UWQ A;  2KLG A;  2OT3 A;  1TZO A;  1F2R C;  2D2Q A;  4A90 A;  3V03 A;  4JK4 A;  3WHR A;  4EUT A;  5IJF A;  2M0A A;  3TEW A;  4IM0 A;  2JZP A;  4BY9 C;  2BXC A;  2YLM A;  4TV3 A;  4RMA A;  5IFO A;  1C4C A;  4E3C A;  5FUO A;  4L23 A;  3KYC D;  2N7E A;  2WS3 B;  4EZK A;  3Q69 A;  4DHZ B;  1QF6 A;  5C2T B;  1NT2 B;  2W54 A;  4HWI B;  1FXA A;  2DAJ A;  3VFK A;  4GOC A;  3SEB A;  3ONS A;  3WAN A;  4FA6 A;  2NMQ A;  1SEB D;  1VZ6 A;  1GOZ A;  4NQL B;  2WXH A;  3APC A;  1N5U A;  2WQY B;  3RFZ B;  4AJW A;  4BKG A;  1RAX A;  2IPK D;  1OGW A;  4A55 A;  5DPR A;  2JYE A;  2YDF A;  2ACZ B;  2K6D B;  2LVQ A;  2QHB A;  4J6I A;  3O13 A;  2GBK A;  1V2Y A;  1E8Z A;  3HHM A;  5TSS A;  3AU5 A;  3H6N A;  3P1M A;  3I9V 1;  3ENE A;  4TUU A;  4RGN A;  2LEK A;  4OZA A;  4MGI E;  3CMM B;  4OZC A;  5E6J A;  3Q3J A;  2LXA A;  2ICI A;  1WXV A;  2FAZ A;  1JRP A;  4ICV A;  3ZNI D;  1JWB D;  2FCQ A;  4G3X B;  1BUI C;  3NHE B;  4IM3 A;  3M63 B;  3ML8 A;  1WYG A;  3PO0 A;  4ZBQ A;  3B2G A;  2BXG A;  1EWY C;  3P63 A;  2M17 A;  2ONQ A;  2AL6 A;  1WGH A;  5E6O A;  3SU8 X;  1E8X A;  3QAQ A;  3UGB B;  3M62 B;  4LA0 A;  1OFF A;  5JZE B;  1WIA A;  4KIK A;  5G5H A;  3WAM A;  2IJ0 A;  2D3G A;  2WDV B;  1V97 A;  2DZJ A;  3HUI A;  4FJZ A;  4ASW C;  3UIP B;  4II3 B;  3JVZ X;  2MH7 A;  1V81 A;  3R2T A;  2NS5 A;  4KSK C;  2WU5 B;  1MVK A;  2KFK A;  1TBE A;  3DWG C;  1F77 A;  3IBE A;  3U52 E;  2LFI A;  3OJ3 A;  1V5O A;  3VVW B;  3BVG A;  4YTM B;  1UGM A;  3EUB 2;  3ICX A;  1WJ6 A;  4HEA 1;  2K8B A;  5FR6 A;  3PHX B;  3PZ7 A;  4S1Y A;  1VZ8 A;  2IY0 B;  4NY0 A;  3EC8 A;  1OQR A;  1I7H A;  5DPS A;  2IGH A;  3MFG A;  4MSM B;  1N63 A;  4G0N B;  1LXD A;  1VZ7 A;  2KQ4 X;  2C7H A;  1WGG A;  1ZPS A;  2NNW A;  1GB1 A;  4DXF A;  3EGR A;  1QLB B;  2QMT A;  3LYY A;  2BB5 A;  1C1Y B;  4GDL A;  2N1V A;  1E7A A;  4IWQ A;  3LU7 A;  3RPF C;  2E6X A;  1I4X A;  4TSS A;  4HGM B;  4JWU C;  4C31 B;  1N61 A;  5BO4 B;  1SE9 A;  4W9J A;  1AWD A;  3Q8E A;  4EOY A;  5HOZ A;  3HIZ A;  2ON8 A;  4YSZ B;  3U2S C;  4NJ6 A;  1KJT A;  4HPL B;  3DVG Y;  4W9C A;  3CST A;  3FNM A;  2WDR B;  2MBB B;  1A5R A;  2NPT B;  5GMV A;  4K2C A;  3FWC C;  5LLI A;  2Z8K A;  2BYV E;  1WX9 A;  4AQ7 A;  5ID9 A;  3PRP B;  2WXM A;  1A70 A;  3AH7 A;  1GG3 A;  2KJ6 A;  4HDQ A;  3KWL A;  2A5U A;  2M0X A;  1WGR A;  4MEM A;  4REZ A;  4TQ0 A;  3AI5 A;  1WRD B;  1EU3 A;  5LNK 1;  1XCT L;  2FNJ B;  1J78 A;  4HRS A;  2KC1 A;  3W9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...