2DYMA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-46) complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
285
structure length
254
Chain Sequence
AHMNDIKQLLWNGELNVLVSIDPSFEIAVLRIRVPRETYLVNYMPLIWNKIKSYFWFEHNKTPIPWNYPVGVLFDCLAGFTTSFENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTTFRISQPTISMTGVNPTLKDIEGDILDVKDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover/protein turnover
molecule keywords Autophagy protein 5
total genus 72
structure length 254
sequence length 285
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dymA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dymA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dymA01
2DZKA 4HJKA 2L3ZA 1GG3A 2K6QA 1C3TA 2MW5A 4HWIB 2C7HA 2JZ3B 3ZIMA 2GOWA 2BF8B 1NI2A 4IWPA 2KQ7A 2LGDA 3DPDA 3X0WA 2L05A 2AWTA 3PSEB 3V62A 2MRPA 1GJZA 2J0KA 2JRIB 4FJZA 4GXBA 2KZRA 2V3SA 4GDKA 1J0GA 1P9DU 1G6JA 4WQOB 3M63B 2MCNB 4ANXA 2C5LC 4GIVA 2ZVOA 3QARA 2GBKA 2HTHA 2XK5A 4GN1A 4MELA 4BOSC 1V2YA 1WF9A 2N9PC 3QCAA 1WYWB 2KMCA 4JGHB 3QK0A 2CHZA 1RAXA 5E6OA 5EDSA 4HLEA 3Q3FA 3CSFA 5D7GA 1RRBA 2KWVB 4IWQA 3N32A 3H7PB 2GBNA 2DAFA 3WAMA 4W9KA 3NHEB 1D3ZA 4HPMB 1LQBA 5AEKB 2MBHA 3SHQA 4MGZE 4LJOB 1RFAA 2MX2A 3DBLI 4FJVB 5DPRA 3TMPB 1V86A 4AJWA 1Z5SB 2FCQA 4IWOA 5J2RA 2J0JA 2KJ6A 3K9PB 4BVUC 3ENEA 3IVFA 2V4LA 3APCA 2D3GA 4WWNA 2KANA 3KVFB 1WH3A 3EECA 3DQVA 2FNJB 2LWPA 3RULA 4FULA 3U8ZA 1V81A 2XBBC 1XT9B 3VVWB 5LXIB 3PHWB 2FCMA 1E90A 3C0RB 2D11A 2O6VA 3CSTA 3L54A 2MBEA 2R2QA 1KM7A 5C1ZA 3RUIB 2JVCA 4XC2A 2LRWA 1WE7A 3PS6A 3QC8B 1OEYJ 2PJHA 2BYEA 4KVGB 3R7RA 2BYFA 2NBVB 4ZRKA 3ZUNA 2KDIA 3HIZA 3UINB 1L7YA 2KWUB 2XK5B 3UIPB 4AP4C 1AARA 3TCAA 2FCNA 4X57B 3VAWA 1V80A 1KOTA 2RR9A 4B95A 4JQWC 4K1RB 3ZNID 2GBMA 3A33B 5LLIA 4AUQC 4B6WA 1J8CA 2DX5B 1V49A 3H7PA 4WJQA 1KLVA 1V5TA 2KDEB 3VXWA 2CHWA 3NZUA 4P7IA 5CX3A 3HM6X 1PQSA 3W1SC 4OVUA 3NZSA 2FAZA 2FIFA 3DVGX 1GUAB 2WDTB 2G45B 4MM3A 4GMVA 2OJRA 2ZZPB 4W9LA 1LFDA 1P3QU 1WRDB 5KHOA 1E8YA 3SU8X 1HE8A 3OAWA 1WXAA 4DWFA 2FUHB 2M8SA 2O2VB 2B3AA 4ZDVA 1WJUA 1E8ZA 4JIOU 3QA8A 3WALA 3AULA 2LUEA 1Q1OA 1UGMA 2L76A 4HVBA 5DPSA 1UELA 1YJ1A 4DDID 3OJ4B 1KJTA 1WM3A 2EKEC 3RZWC 2DZMA 2MQJA 2BKRB 3UIOB 3ZNHB 4ICUA 4W9FA 3MJWA 2N1WA 2CKHB 2J0MA 5C23A 3ALBA 3A1QB 2IO3B 4CYEA 4XZ4A 5IA7A 4M8MA 4NY0A 1UZXB 3ZKJC 3QX1A 2N4FA 4HCPB 1LM8B 3R66C 2LGYA 4JLCA 2PEAA 4IW0A 3ML8A 1M94A 2EMSA 2Z59B 5IAAC 5BO4B 2KQSA 4G3XB 2KXJA 4IG7B 2Z0EB 2KMAA 2ZNVB 3BINA 3IG3A 4ZYNA 2KDFB 1IYFA 4F1SA 1E8XA 3CMMB 4K7WA 2I1KA 3PTFC 1TTNA 2V1YA 5D94A 3Q3JA 3APDA 3CF6E 1GC6A 4FLHA 2MP2A 4LCDE 2L7RA 1UD7A 1OEYA 2NPTA 5JH5C 3DOWA 3ZVVA 3B1LX 3B08A 1YD8U 2YVCA 2KFKA 4M0WB 3LDZE 1XD3B 1H4RA 2AYOB 2MSED 2DZIA 2WX0A 4K7UA 3KUCB 1U4AA 5AZFA 1Z2MA 1T0YA 2UYZB 3L17A 3QIJA 4NNJB 1WE6A 1Q5WB 4G50A 3I3TB 4HK2A 5DPTA 3HM3A 1E7UA 2LVPA 1EF5A 1YQBA 5L83A 4RM9A 3L16A 3M95A 2JPHA 3IBEA 2PE6B 4CO7A 3SD5A 2WX1A 1WJNA 2G4DB 1UH6A 2A4ZA 3U7DA 2NR2A 2NVUI 1UBIA 3P2BA 1OTRB 3A9JB 1P98A 4KDIC 4GDLA 3VFKA 2LRUA 3SDLC 1WMHB 4TQ1A 3L0WB 4FJYA 4HDQA 5DPWA 2IO0B 2ZPNA 1QZEA 4WJNA 4IM2A 4NJ6A 4LJPB 2L0FA 4TKNA 3LJ3A 4II2B 4EOYA 4HDOA 2I1JA 4JL9A 3KUDB 4BKSA 3QQ8B 2N9XA 2IY0B 2Y5BB 4PS8A 4MJSB 3N3KB 3RZFA 2D2QA 3RYTA 3V61A 3WAOA 1WM2A 4IUMB 1J19A 2K8BA 4MSMB 3RD2A 4LDTD 1WX9A 3B0AA 3H7SA 4BFRA 2K8CA 3W1SA 2KJRA 3O65B 3NOBA 3OJ3A 4NAWB 1I35A 3JSVA 1WX7A 3KUZA 3M62B 2LVQA 3BY4B 5CHVC 2A5UA 3MHSD 4AOFA 4GU2A 4URKA 4G11A 2RSUA 2JWZA 2KTRA 2MBOA 4A20A 2IO2B 1BT0A 4KSKC 4E74A 4DBGA 4TQ0A 3KH0A 2MA9B 4WWOA 1ISNA 3QHTA 4KIKA 1TZ1A 1WFYA 1YX6B 2JXXA 2KC1A 1GNUA 3A4SC 4DK5A 1I42A 3GZNI 3UQBA 1OGWA 1P1AA 4ZRIA 3V6CB 1OQYA 1WMHA 1WXSA 3ZRFA 3NY5A 1XQQA 2M17A 1Y8RC 4RM8A 1RLFA 3PLVA 2BKFA 2KLGA 4W9EA 2JRHA 3DBHI 2PE9A 5GMVA 2YLMA 3MTNB 1WY8A 4PYZA 4EUTA 1WR1A 5FR6A 2O6VD 1V9JA 2ZNVC 4MSQB 4E3CA 4KDLB 2EMTA 4GSWA 4DHZB 5AZGA 2N9EB 4IM3A 4K81A 2C7MB 3N30A 2J7QB 5D6JB 5E6PA 3ML9A 3PZDA 3HHMA 4HPLB 3EFUA 4MGYE 3A4RA 4WJOA 3W1YA 1WJ4A 3ZTDA 4DHZE 2M4NA 1GC7A 2KLCA 4A3OA 4AJYB 5JHBA 3ECIA 2IO1B 3TJPA 1ZGUB 2DHZA 3PRZA 2NBUA 4EZLA 4WWPA 4DXAB 4GGQA 2CHXA 2NBWB 3PRPB 2ASQA 3ZNGC 1SIFA 2WWZA 3A9KB 2KKCA 1WXVA 3PGEA 3T8MA 4HCNB 2FCSA 2R2OA 4KIKB 1WZ3A 4FBJB 3UQAA 2ZEQA 3TL5A 1H8CA 2NCNA 2C60A 3AU5A 2Z0DB 3NS8A 3WIMA 4BKGA 2IBIB 2K6DB 3H1UA 1A5RA 1IP9A 4HXDA 1ZKHA 4G0NB 4W9IA 5CHFA 1L2NA 4PS3A 1WI0A 4FADA 3QAQA 5G55A 3IHPC 2WYQA 4KZ0A 3VUYA 1EUVB 1R4NI 2BPSA 2IYDB 2C9WB 3GOEA 2QHOA 2UWQA 4EFOA 3KYCD 3L10B 4I6PA 2MLBA 2LGXA 3RT3B 2LZ6A 5LXHA 2N1VA 2L8JA 1CMXB 3WAPA 3UGBB 2BYVE 3ZDMC 4A3PA 4F7ZA 1TBEA 1LXDA 1ZW7A 2MBQA 2KWCA 4WJPA 1EF1A 4BKTA 1SE9A 2JZZA 3H9DA 3PVLA 3A1QA 3KW5B 1P0RA 2AEHA 1YX5B 1V5OA 1TGZB 4EZKA 3IFWB 2DYBA 1WR6E 4PYUA 3VUWA 3DCGA 4MGKE 1IPGA 4DHJD 2FIDA 5CTRC 1YIWA 2KHWB 2CR5A 2M1MA 3ZO5B 3DVNV 4MH0E 2O2VA 3PPAA 3VTWA 1JRUA 3VQIA 5D2MB 2DYMA 4FA6A 2ZJDA 2MBBB 4XX5A 3ZLZA 1WGRA 2JT4B 2L0TA 4ANVA 4B9KA 4J6IA 3QWZB 2KDBA 1S3SG 3R7QA 3AI5A 2KTFA 4W9JA 3VH3B 4W9HA 2LXCA 1R4MI 4RMAA 1NDDA 2D10A 3V60A 1S1QB 2GBRA 2KFKB 1VD2A 3WANA 3DVNU 2BGFA 1WXMA 3ZTCA 2BWES 5DCNA 2IY1B 4NQKE 4WAAA 2KO3A 2K39A 2XEWA 2ZCCA 2W9NA 4MDKE 3TBLD 4BBNC 1WGHA 2KN5A 2K8HA 1NBFC 2RD0A 2HJ8A 3QJZA 3PREA 4YL8A 5KHQA 3VH4B 4IC7B 2DAJA 4ANWA 2AL6A 2VRRB 4PS7A 3U30A 5CHWA 5AZHA 1WX8A 1WGYA 2K25A 4II3B 2KOXA 3VHTC 2LD9A 4E71A 4NJ7A 2CU1A 4DDGD 2KX0A 2NS5A 3VTVA 4BOZB 3ZNZB 5L95C 2DYOA 2NPTB 3A9KA 3S2AA 4N9F4 3AU4A 3ZDTA 1E8WA 4FHKA 4CHKA 2N7DA 3DBRI 4AWJA 2RGFA 5JZEB 4DHJB 2D07B 4GDLB 1Q0WB 2M0XA 3OLMD 1WGDA 3VUXA 3UF8A 2L00B 4F8CB 5HKHA 2MP2B 3DVGY 3X23A 3APFA 2KK8A 4IM0A 4LDTB 3L13A 2PPHA 2RPQA 3L08A 4W9DA 1C1YB 1FXTB 1WJ6A 2HE7A 4NPNA 2N7EA 5J18A 3ZW3A 3JYUA 3V6EB 4W9GA 3PHXB 1E5WA 4NQLB 2ZPYA 4ICVA 5JHAA 2ZCBA 4KZCA 1X1MA 2REXA 3PV1A 1K8RB 2KVRA 2JF5A 3VDZA 3EC8A 4MGIE 2LI5A 4EZJA 5J17A 2JUOA 2G3QB 3T9LA 3JVZX 4ASWC 2AL3A 2DZJA 2DENB 4I6LB 1MG8A 1E7VA 4OVVA 3TIXA 4BKSD 1SGHA 2KTRB 1WIAA 2HD5B 4GOCA 3DBSA 5E6NA 2ZVNA 4EKUA 2GBJA 3A9JA 1UBQA 3ONSA 1V6EA 4K7SA 1EO6A 3PT2B 4BBNF 4GDKB 1WGGA 1VCBA 2KFJA 2LJ5A 3PRMB 3HK0A 3RCZA 2CS4A 2LASA 4TV3A 3WA0A 2G4SA 4MJSA 3M3JA 2O6VB 3VTUA 2BWFA 4ZRJA 4TUUA 2K1FA 2OOBB 3AXCA 3KYDD 4KV2A 3R3MA 3EHVA 5G2NA 3D32A 3JSVB 4FHJA 2KNBA 3DDCB 4M8NA 3ZRCA 4EEWA 2KD0A 2IZVB 4I6NB 4W9CA 4ANUA 2KC2A 2LVOA 2GMIC 2KJHB 3H6NA 5TR5A 3K9OB 4FN2A 1WZ0A 4NAWA 4KSLC 4MEMA 3JW0X 1F9JA 2JY6A 2MWSB 3PLUA 2C7NB 2KX3A 2LXAA 4GB9A
chains in the Genus database with same CATH superfamily
4WIPA 5BYRA 4OW0A 4LUFA 2L05A 5IP4D 1C79A 1MM8A 1JWBD 2PMVA 2JRIB 4GXBA 5LNK1 1J0GA 3FKYA 2W55A 2VUEA 1G6JA 3M63B 1F52A 4GN1A 1EM7A 1WF9A 2N9PC 2FBWB 2L32A 5GINA 2KMCA 3AE8B 2H88B 3CX9A 3CSFA 4IWQA 1IGCA 1I4XA 1D3ZA 3TEWA 3SHQA 2JQRB 2QEJC 5FKAC 2KQ4X 1ET9A 2FCQA 2JYEA 1MUSA 5J2RA 4BVUC 3MP9A 1HTOA 3APCA 2D3GA 3W5UB 1VJKA 2KANA 3EECA 2FNJB 2LWPA 1JW9D 1VLBA 3U8ZA 1XT9B 3VVWB 3ZYYX 2UU7A 2D11A 2R2QA 3NVMA 3SEBA 4P1BC 1K50A 1KM7A 5C1ZA 1HK5A 2LRWA 3N1XC 1KW2A 4RGTA 1OEYJ 1HXYD 2BYFA 2NBVB 2KDIA 2EFDA 1AARA 1DOIA 2FCNA 1TS4A 2RDBC 4PO0A 3NVZA 4JQWC 4YSXB 1J7CA 2EFHA 2DX5B 1V49A 4WJQA 2KYWA 2I2YA 4GDXA 3DHGC 3W1SC 4M02A 3V3XA 4M70B 1QILA 2JXTA 1UWMA 4GMVA 2OJRA 2XMOA 1LFDA 2PW9A 1WRDB 1E8YA 3AEFB 3NRZA 1F2RI 4ZDVA 1MA9A 1Q1OA 2W54A 2L76A 2QM6A 1E7CA 1ZDXA 1N5UA 4NAMA 1KJTA 4MBEC 2EKEC 3UIOB 3ZNHB 4ICUA 3AH7A 5C23A 3A1QB 2BT6A 4L2YA 4XZ4A 4M8MA 3N20C 4YWGG 3ZKJC 4E99A 4LTUA 3R66C 2PEAA 4IW0A 1M94A 2WXPA 1IYFA 2KDFB 3PTFC 1LGRA 4QAYA 3Q3JA 1E7FA 3CF6E 1HA2A 4HGMB 2NPTA 1NEKB 1YMHE 3SR6A 3DOWA 1R4NB 5GHKA 1JWMD 3B08A 1YD8U 2L52A 2KFKA 1TKGA 2YVCA 3FILB 3U4EG 3LDZE 1H4RA 2WX0A 1EWCA 4ACFA 2BXGA 3KLSX 3RPFC 4FXCA 4K3BA 1Q5WB 4NZLB 3HM3A 5H92C 2BXCA 4LA0A 4FIPB 1EF5A 5IN7A 4FJCB 3Q8CA 1TZOA 2DLBA 3A75A 4WAFA 3L16A 2JPHA 3IBEA 1UUPA 4CO7A 2A4ZA 2KAJA 3U7DA 1OTRB 4GDLA 1ENFA 2KMMA 3KWLA 4OHJA 4DXFA 4NJ6A 2L0FA 4TKNA 2D3AA 2I1JA 2JYTA 1VR9A 4YSYB 2IY0B 3WAOA 4LK0M 3RZFA 5HFYA 5DQFA 1P7EA 1WX9A 1VZ8A 3H7SA 4H2AA 3O65B 1MVKA 2LVQA 5CHVC 2V4IB 1V8CA 2JSVX 4I9OA 2JWZA 2KTRA 2MBOA 2WXRA 3Q8EA 4F5TA 1XCTL 5HOZA 5IIXA 2KC1A 1WFYA 4IOIE 4WWMA 1GNUA 1I42A 2XVWA 1Q10A 3BWUD 3UQBA 1P1AA 5HHDG 1AO6A 3NY5A 4DM0A 1FCCC 1Y8RC 4RM8A 3AMZA 3PLVA 4C7ZA 4WURA 2JRHA 3DBHI 5BPKA 2BXNA 4C56C 4PYZA 4KGTA 4B0MA 2K0NA 4MSQB 4E3CA 4J3OD 3AEAB 4DHZB 4IM3A 1T6BX 1J78A 3ML9A 4WJOA 1TF0A 3P42A 4DHZE 1GC7A 5GIPA 5JHBA 3TJPA 1ZGUB 2BQQA 3T8MA 2KKCA 3TEZA 1H8CA 2NCNA 2C60A 5B5TA 2IBIB 2K6DB 3AEGB 4HXDA 4G0NB 5CHFA 2YEPF 4DQOC 3IHPC 2WYQA 3MHHB 2BPSA 3GOEA 2QHOA 4XGAB 3IAS1 4I6PA 2MLBA 2BB6A 3RT3B 2RDGA 1CMXB 4A3PA 1F2RC 1ZE3D 2AQ2B 1TY0A 2L1AA 1LXDA 1ZW7A 1AW7A 1SBBB 2BB5A 4HRSA 1STEA 3H8HA 4BKTA 3A1QA 1V5OA 1YN5A 3IFWB 3FC4A 5EE1A 1JQ4A 4AQ7A 4LNFA 1IPGA 4DHJD 4ZUXV 1SE4A 3MC0B 2DWQA 4C4VA 2WXJA 5D2MB 1A70A 3B9LA 2DYMA 4A9AA 2DNFA 4FA6A 2MBBB 3ZLZA 4XWWA 5GIOA 2JT4B 4ANVA 4J6IA 2QMTA 4XDDA 2KTFA 3VR9B 4W9HA 4DHXB 1KF6B 2LJIA 1NDDA 2D10A 4M0WA 2GBRA 3DVNU 1GB1A 3BK2A 2NNWA 4NQKE 2BXMA 4WAAA 2BS3B 2W9NA 4MDKE 3TBLD 1WGHA 4C7YA 4JE3B 2RD0A 3VH4B 4ANWA 1BJ5A 1N60A 4PS7A 4C80A 4GLSC 2ZW0A 1EU4A 2KOXA 2LD9A 1H9ZA 4CQNA 4DDGD 3A9KA 2NPTB 4WH4A 4DHJB 2BBCA 3MJ5A 1I4PA 3OLMD 1WGDA 3VUXA 1GAQB 3APFA 2KK8A 3P1MA 2PPHA 1RM6C 2WGSA 3L08A 1C1YB 2HE7A 2PVOD 5IJEA 4RCOA 3ZW3A 1YJIA 1IUEA 4NQLB 2ZPYA 3TEYA 4ICVA 2ZCBA 1IBXB 3PV1A 2BXDA 1SJHD 3EC8A 2BW2A 2E0XA 1T3QA 2N9KA 3JVZX 2DENB 1E7VA 2LXSA 2WS3B 4OVVA 1SGHA 4ZBKA 2KTRB 2J42A 2IGDA 2ZVNA 3A9JA 4K7SA 1EO6A 3BPJA 1IJGA 5C3JB 2BXPA 3RCZA 4JX1C 2SAKA 1KH0A 4OTTA 2CS4A 3RNGC 3VTUA 1L0YB 2INNE 1ROEA 3D32A 2DBYA 2IZVB 5FR3A 5TR5A 1D5ZC 1FMAD 1NT2B 2ROHA 1IBXA 2X8XX 1PYWD 2JY6A 2MWSB 3BVZA 5JXVA 2KX3A 3O13A 2LXAA 5BMIA 2DZKA 2QCZA 3GZNB 2C7HA 3ZIMA 1NI2A 4IWPA 2LGDA 3X0WA 1FM0D 5AUKA 1CK1A 2PVGC 3TUOA 1GJZA 2J0KA 1E7HA 1N63A 1KDXA 2V3SA 4XWTA 4GDKA 4JWSC 1YQ3B 4WQOB 1CQVA 1UWXA 2FE8A 2C5LC 2ZVOA 3NMUA 1YN3A 2M0AA 3PO0A 1RAXA 5E6OA 3DWMA 4W9KA 3NHEB 3DBRB 4HPMB 1LQBA 3W2DA 4FJVB 4L9KA 1V86A 3TMPB 1F77A 1Z5SB 3ENEA 1NYQA 1WH3A 3DQVA 2FCMA 2J4XA 1ZPSA 3C0RB 3L4PA 1UORA 1WE7A 4DXGA 2BYEA 4YTPB 4ZRKA 3ZUNA 3HIZA 3UIPB 1UF0A 2XW1A 4WQMA 4X57B 1V80A 1KOTA 4B95A 1DOXA 1L4ZB 1V5TA 2AGHB 3OG5A 3WCQA 3DVGX 1L6VA 3HUIA 4MM3A 2BXQA 1BKEA 5IJ5A 4W9LA 4WA6B 3AECB 3SU8X 1WXAA 4DWFA 2M8SA 2B3AA 2INCC 3AULA 1UGMA 5IOIA 3LU6A 3RZWC 1AYFA 2DZMA 2CKHB 3ALBA 3AE9B 2IO3B 4L9QA 2PIAA 4CYEA 2WXNA 3LB8C 1TKEA 3RNFC 3IAM1 3ML8A 4ZYSA 2KXJA 4IG7B 3NVKA 2Z0EB 2ZNVB 1TKYA 4ZYNA 1P7FA 3CMMB 4K7WA 2I1KA 2Z8LA 2V1YA 5D94A 4FLHA 4IW1A 2MP2A 4LCDE 1UD7A 1OEYA 5H8YE 4B0EA 4HJGE 1JWSD 2X38A 1C76A 2BX8A 1XD3B 3TEXA 2AYOB 4K7UA 4P1CC 3KUCB 1T0YA 2XN9C 3L17A 3QIJA 4NNJB 3H3AA 1OQQA 1WE6A 3GB1A 2G9HD 2DBWA 5DPTA 3WHQA 1H5WA 1VZ7A 2DBXA 1ESFA 3M95A 4HROA 2PE6B 2WX1A 4RF1A 3A9JB 1P98A 3NG0A 3VFKA 3SDLC 1WMHB 5DPWA 1TS2A 2IO0B 4BY9C 4IM2A 2GI9A 1I4QA 4II2B 2LGSA 1KLUD 1D6EC 4JL9A 2CU3A 1BXTA 4MJSB 1MIVA 3V61A 1VFIA 2D2QA 3Q8AA 3RD2A 3JRYA 4MSMB 1JALA 1R7SA 1XLOA 2QDFA 1KXPD 2K8CA 2KJRA 3OJ3A 4UDUC 1I35A 3KUZA 1WX7A 3BY4B 3MHSD 4P6VF 4G11A 2RSUA 1F1HA 4A20A 3AEEB 4DBGA 3KH0A 4WWOA 1ISNA 4KIKA 3A4SC 1YX6B 2JXXA 2DG5A 3V6CB 1WMHA 2D3CA 1XQQA 1FXAA 1B1ZA 1TS3A 4W9EA 2BXOA 2PE9A 5GMVA 1WY8A 4W4UB 1WR1A 5FR6A 2WP9B 5FUOA 1V9JA 2ZNVC 1EWYC 1FXIA 3AE3B 2TSSA 2BTEA 1OQRA 3NZ3A 2IGGA 2J7QB 5E6PA 4JK4A 4HPLB 3EFUA 3W1YA 1WJ4A 3ZTDA 2KLCA 3ECIA 2IO1B 1SB0A 4OR0A 1QT9A 4WWPA 1FNWA 2J53A 3RNBC 1SIFA 1B9RA 1FO4A 1E10A 2FCSA 2R2OA 3TL5A 1OFFA 3NS8A 2IPKD 4BKGA 5ID7A 2IDYA 4ZHPA 1A5RA 1MHXA 4HGKA 3VUYA 1EUVB 1PGXA 1MIWA 1E7AA 1T5XD 1SJED 2MJ3A 3AN1A 4ZC6A 2BYVE 2WLBA 1FD6A 3VR8B 2LOQA 1E7GA 1XCQL 4J2VA 3PVLA 3HVZA 2AEHA 1YX5B 1K52A 2D3BA 4EZKA 1HZ5A 1ZUD2 2DBUA 2FIDA 2KHWB 2M1MA 3ZO5B 4LNOA 4OVZA 3RNCC 4F5VA 1JRUA 3VQIA 2ZJDA 3WHRA 3QWZB 2KDBA 4OZBA 3VH3B 2BXBA 1R4MI 3V60A 2BGFA 3ZTCA 2BWES 5DCNA 2IY1B 2KO3A 1E6EB 2K39A 1HK4A 2XEWA 2K8HA 1N62A 1NBFC 2HJ8A 3QJZA 3PREA 2AL6A 1AWDA 1SXTA 3PLAA 1WGYA 4E71A 1PDXA 4BOZB 3ZNZB 3S2AA 3U52E 4N9F4 3ZDTA 1E8WA 4CHKA 2N7DA 2KDMA 1GB4A 1K53A 3UF8A 2L00B 2CKXA 5HKHA 3DVGY 1JWUD 3X23A 4IM0A 2I2ZA 2BXIA 1MPEA 1FXTB 1BUIC 1WJ6A 1HQRD 2N7EA 4ZHOA 2LQHA 5J18A 3UI3A 4IDIA 3V6EB 4W9GA 4KZCA 1X1MA 2REXA 1E7PB 1K8RB 2KVRA 4MACA 1ZXHA 2LI5A 2BYTA 5J17A 2G3QB 4MT5A 4BKSD 1MG8A 4RNAA 3GE8C 2XVVA 4XYCA 2GBJA 1M4VA 4RH6A 3TSSA 4L8UA 2BXAA 3J9CA 4S17A 2VZKB 3HK0A 4R3DA 5IIUA 4TV3A 2EELA 2G4SA 1RFKA 2XNAC 4JPSA 4ZRJA 4TUUA 2K1FA 2AQ1B 2OOBB 3AXCA 3MHSB 3KYDD 1RWSA 3R3MA 2KN4A 4FK5B 3JSVB 4FHJA 4IKGA 4M8NA 4EEWA 3B9MA 4W9CA 2GMIC 3H6NA 3AE4B 3HVDA 4EMXA 3K9OB 1WZ0A 3Q3NC 3P63A 4KSLC 1DYQA 3MC9A 3JW0X 4HJKA 1C3TA 2MW5A 4HWIB 5AUIA 4N3ZA 2GOWA 2KQ7A 2WHIA 2AWTA 3PSEB 3V62A 2MRPA 1TS5A 4FJZA 2E6XA 2KZRA 3ABVB 3AE5B 2KACA 2VZKD 4GIVA 2K3UA 2KBZA 3QARA 4HEA1 2GBKA 2HTHA 4MELA 4O1NA 4BOSC 1V2YA 4ZRQA 3QCAA 2E0YA 1WYWB 3GS2A 4JGHB 2CHZA 2NQOA 1SEBD 3Q3FA 1DOYA 2WXMA 1RRBA 2KWVB 3N32A 1ET6A 2GBNA 4HKZE 4XE0A 3G9KD 1JNBA 3ZJTA 5AEKB 2MBHA 2WXIA 4LJOB 3DBLI 5DPRA 1PGBA 4BAXA 2RDHA 2W3RA 4JWUC 4IWOA 2Z8KA 3AE1B 1QOBA 2KJ6A 3EUB2 1MI0A 3KVFB 3RULA 2AJEA 1QOAA 1J7AA 1V81A 1BM0A 2LMCA 3PHWB 3E9SA 3RI7C 1HK2A 3Q6BA 2O6VA 3L54A 2MBEA 1HK3A 1I7HA 4XC2A 2CJOA 4US8A 1YNTE 2QMCA 3R7RA 2LQIA 1QKZA 4S0RA 1L7YA 2KWUB 3DHHC 3U7ZA 4AP4C 3TCAA 1V1PB 5EE9A 3VAWA 2RR9A 3ZNID 4AUQC 4C31B 3Q14C 3FAHA 4BKEA 1KLGD 2MJDA 4USAA 2WXOA 1PQSA 3M99C 1GUAB 2G45B 4N0FD 3CIRB 2ZZPB 3GQXA 1GPXA 1P3QU 1HE8A 3OAWA 1MFWA 2FUHB 2O2VB 4LNNA 4C4VB 1WJUA 1YJJA 1E8ZA 4JIOU 3QA8A 2PLPA 3WALA 2LUEA 2D5GA 1D4BA 1UELA 1YJ1A 4DDID 3OJ4B 5EE0A 2BKRB 4W9FA 2WDVB 2N1WA 3SIVB 3U2SC 4NY0A 4ZBQA 3QX1A 2KT7A 2QHBA 1WRIA 4HCPB 1V97A 2LHDA 2LGYA 5BO4B 2EMSA 3ECPA 2Z59B 4XDCA 4G3XB 1GNJA 3AB5A 3ETRA 4F1SA 1E8XA 4A6QA 1NVID 1TTNA 2RMMA 3KQ4A 4A8XC 3APDA 2MJEA 1KFYB 5JH5C 3SFEB 3B1LX 4M0WB 3LXFA 1U4AA 1Z2MA 4EE2A 1SIJA 4HK2A 2XSIA 4YXDB 2GLSA 1YQBA 2V9HA 1TY2A 4P16A 1NYRA 1N5XA 1YQ4B 1J7EA 2G4DB 3Q3OC 2NR2A 1UBIA 4KGSA 1YOVB 3GP7A 4TQ1A 3L0WB 4FJYA 3BIID 4HDQA 1C77A 1QLBB 2ZPNA 1QZEA 3DBLB 2LEKA 4LJPB 3W5VB 2LGIA 2W82A 2INDC 3NVVA 2EFEA 4HDOA 2Y3AA 4REZA 3KUDB 4BKSA 3AE2B 3QQ8B 2QJLA 1C4AA 3N3KB 3RYTA 1WM2A 1L4DB 2WXKA 3B0AA 4RGMA 1I4RA 2YDFA 2OEDA 4M01A 1JROA 3M62B 4AOFA 4G03A 4URKA 1J7BA 4RGNA 1BT0A 4KSKC 2IGHA 2BXEA 4TQ0A 4M00A 2MA9B 2ACZB 3H37A 3AE6B 2BXHA 5IO9A 3ZQ4A 3PZ7A 2JWUA 3ZGZA 3V08A 4ZRIA 3ZRFA 1WXSA 1XXGA 1FOUA 1FNVA 4L23A 4D7XA 1WSPA 2JZPA 2BKFA 1JWAD 2KLGA 1VDVA 1FPYA 5BYQA 3P4SB 2NTSA 2O6VD 2WXQA 4K81A 3PZDA 3HHMA 1TT5B 1NENB 4RGOS 3AE7B 4G01A 5GXGB 2DHZA 3NS1A 4EZLA 4GGQA 3PRPB 2WWZA 1C78A 3DHIC 4HCNB 2JU6X 3BK1A 1WZ3A 4FBJB 2ZEQA 3GQUA 3AU5A 2K22A 2K0PA 1WI0A 4FADA 3QAQA 4KZ0A 1R4NI 2C9WB 2UWQA 1KRHA 4EFOA 5MPOA 3BVGA 2LGXA 2LZ6A 3LU8A 3HRDD 3NVIA 3ZDMC 1XF5L 1TBEA 2KWCA 4WJPA 3V03A 1SE9A 3H9DA 1CZPA 1PGAA 1TGZB 2HDEA 1L0XB 1WR6E 3VUWA 4MGKE 1YIWA 2PTLA 1WWTA 2CR5A 1L0VB 4MH0E 2O2VA 2FUG1 3VRBB 3N1ZC 2QSDA 4MM3B 4XX5A 1FRDA 3Q8FA 1S3SG 1FFUA 4W9JA 1E9MA 3GA9L 4RMAA 3FNMA 2KFKB 3IT6B 1VD2A 3RMKC 3GE3C 2KN5A 4OZAA 1PUTA 3R2TA 5KHQA 2Z8JA 4N59A 2Y5CA 2VRRB 1PFDA 5CHWA 5AZHA 1HTQA 3VHTC 1EU3A 4II3B 4NJ7A 1C9FA 3LU7A 2V3PA 2CU1A 2KWDA 3EA6A 3P4PB 3VTVA 5L95C 2DYOA 3LYYA 1NI3A 3AU4A 3EFCA 3ZJUA 1UNSA 4OT2A 1FIQA 3DBRI 5JZEB 2D07B 4GDLB 1Q0WB 4MH8A 1T0RC 3Q3MC 2JX5A 2MP2B 3L13A 1SF0A 2G1EA 3I9V1 2BVCA 3PHXB 4Z9OA 1E5WA 2ZW1A 3MFGA 3RN9C 1AN8A 1I4HA 1ZXIA 2JF5A 3VDZA 1ACCA 2BS4B 4ZCGA 3W9CB 4EZJA 2JUOA 1Y56A 3IXSA 3T9LA 3BZDB 4I6LB 4ASWC 3TIXA 3RFZB 3URYA 1FFVA 2QILA 4EKUA 1FRRA 1UBQA 1MJDA 4LLGM 3PT2B 4GDKB 2KWFA 2KFJA 3PRMB 1MHHE 2LASA 4ZRPA 3WA0A 3M3JA 1VRAB 1FEHA 2O6VB 3WHSA 2BWFA 2N9LA 2XVQA 4KV2A 1K51A 5T8IA 2KNBA 3ZRCA 4OTUA 4LNIA 2KD0A 4I6NB 4ANUA 2KC2A 1C4PA 2KJHB 1LOTA 3AEBB 1MG4A 3DBHB 4NAWA 4MEMA 3V09A 2WQYB 2C7NB 2YEPB 4GB9A 2L3ZA 1GG3A 3AEDB 2K6QA 5IKCM 2INPE 2JZ3B 2BF8B 4LUHA 3DPDA 2ICIA 1I4GA 1N61A 3NUHB 1P9DU 3P4RB 3BYYB 2MCNB 4LNKA 2JUHA 2NMQA 4ANXA 3AM9A 3BVMA 2XK5A 2LUMA 2WDRB 1FCLA 3QK0A 1D5MC 2ONQA 5EDSA 4HLEA 5D7GA 1L6UA 1WXQA 4ITKA 3H7PB 2DAFA 2MH7A 2WXLA 3WAMA 1VZSA 4MGZE 4YT0B 1RFAA 1MIYA 3FWCC 2MX2A 5BMHA 4AJWA 4N0UD 4RFBA 2J0JA 4G04A 2L83A 3K9PB 3IVFA 2V4LA 4WWNA 2WU5B 3FILA 4FULA 2XBBC 3DWGC 1QOGA 2BXLA 5LXIB 5I4DA 1E90A 3CSTA 4PT5A 3RUIB 2JVCA 2B76B 3PS6A 2LXTA 3QC8B 2PJHA 4KVGB 1GNIA 5G5HA 3UINB 2XK5B 5G5GA 3E56A 1E7BA 4YTNB 4K1RB 1HZ6A 5BYSA 2GBMA 3A33B 4K3CA 5LLIA 4B6WA 1J8CA 3H7PA 1N6ZA 1KLVA 1KTKA 2KDEB 3VXWA 2CHWA 3NZUA 4P7IA 5CX3A 1N5WA 3HM6X 5IIHA 4OVUA 4ARIA 3NZSA 2FAZA 2LHEA 2FIFA 3AV8A 2WDTB 2V36A 2N0SB 2N7JA 2XVUA 5KHOA 1JCKB 4LB2A 3V05A 2E3TA 3MHZA 2CJNA 3Q69A 1QQRA 2IJ0A 5DPSA 4HVBA 2W3SA 2GB1A 5DBYA 1T0QC 1WM3A 2J52A 2MQJA 2AX5A 2ON8A 2Q5WD 3MJWA 4HPPA 2J0MA 1HK1A 1JRPA 1F0ZA 5IA7A 5HI1A 1YN4A 1UZXB 2N4FA 1LM8B 1XLNA 4JLCA 2XW0A 5IAAC 2KQSA 3RNEC 2KMAA 3BINA 3IG3A 3I57A 4Z69A 1MUHA 1GC6A 2L7RA 2HTME 1BMLC 3ZVVA 2K9XA 1LO5D 4F5SA 3B2GA 2Y5PA 2MSED 2DZIA 5AZFA 2UYZB 2EKIA 3T3OA 3TDLA 4G50A 3I3TB 2VH2A 1E7UA 2LVPA 5L83A 4RM9A 2HJ1A 1E0ZA 4PK1A 3SD5A 2KVZA 1WJNA 1UH6A 2QC8A 2NVUI 3P2BA 1CJEA 3B9JA 4KDIC 3NVWA 2LRUA 2PKOA 1ZDVA 1T0SC 2R61A 4WJNA 5D3DA 3LJ3A 3R2IA 4EOYA 2BXKA 4RF0A 3VRAB 3ICXA 2N9XA 2Y5BB 4PS8A 1DGJA 3B2FA 2WXGA 3KWVA 4IUMB 1J19A 1RYJA 2K8BA 1V1OA 4LDTD 4KX6B 4BFRA 4GG2A 3W1SA 3NOBA 4NAWB 3JSVA 4AS1A 3NVYA 2A5UA 4GU2A 3Q8BA 2BXFA 4E74A 1D5XC 4D2KA 3SFDB 3RNAC 3QHTA 1TZ1A 1WGKA 3UIVA 4DK5A 3GZNI 1OGWA 2V0GA 1OQYA 5BMGA 5ID9A 1VZ6A 2M17A 3NJTA 1RLFA 1XLPA 2GUTA 1LNSA 4YSZB 2WXHA 2YLMA 3MTNB 5IFOA 3CWIA 4EUTA 2WU2B 4KDLB 2V3NA 2EMTA 4GSWA 4ARCA 5AZGA 2N9EB 2C7MB 3KIKA 4ZOHC 3N30A 5D6JB 3KJLA 4MGYE 3A4RA 3N1YC 2M4NA 4A3OA 4AJYB 3PRZA 2NBUA 3T3NA 4DXAB 5D3IB 2CHXA 2NBWB 3C8YA 2ASQA 3ZNGC 5EE3A 3A9KB 1WXVA 3PGEA 3UQAA 2Z8IA 4KIKB 3SQJA 2Z0DB 3WIMA 2M19A 3H1UA 1IP9A 2H89B 1ZKHA 4W9IA 2WNMA 1L2NA 4F5UA 1QOFA 4PS3A 5G55A 3N9YC 4KGRA 3C19A 2IYDB 1E7IA 4A90A 3KYCD 4Q2JA 3L10B 2OZBB 5LXHA 2N1VA 2L8JA 1ZP0B 3SIUB 3WAPA 4US9A 3UGBB 4KKIA 4F7ZA 1R4MB 2MBQA 4KKJA 1EF1A 1TXUA 1GOZA 2JZZA 3KW5B 4HKQA 1P0RA 1E78A 1C4CA 2DYBA 2VDBA 2GRIA 4PYUA 3DCGA 2I30A 5CTRC 5HG2A 2WXFA 3ZXRA 3DVNV 3PPAA 3VTWA 2QIEB 4N6EB 4TMAB 1WGRA 2L0TA 2VUFA 4K71A 5E6JA 4B9KA 3R7QA 3AI5A 4LB9A 2LXCA 3I5JC 3JQZA 1V1PA 4ZBRA 1S1QB 3WANA 2WDQB 2MEKA 3Q2AC 1WXMA 1HEZE 3PZ8A 4C00A 2BS2B 2ZCCA 3P4QB 4BBNC 1TJEA 4YL8A 2RPVA 4IC7B 2DAJA 2LFIA 1L5PA 3U30A 1WX8A 2K25A 4K2CA 1ZOYB 4OZCA 2KX0A 2NS5A 2K5PA 2OT3A 4FHKA 1E7EA 4AWJA 2RGFA 3FWBC 2M0XA 4F8CB 4LDTB 5FK9C 2RPQA 1IGDA 4W9DA 4NPNA 2EFCA 2SEBD 3JYUA 2VH1A 1QF6A 4L1BA 3A73A 5JHAA 2OHFA 2MHJA 4YTMB 2I38A 4MGIE 5TSSA 1O9XA 4TSSA 4NJCA 2AL3A 2DZJA 2M56B 3MC8A 3BYTB 1WIAA 2HD5B 4GOCA 3DBSA 5E6NA 1HA5A 1SSNA 3I63C 1TYGB 1FNUA 3ZXVA 3ONSA 1SE3A 1V6EA 4BBNF 1TIFA 4S1YA 5IJFA 1WGGA 1VCBA 2LJ5A 5C2TB 2OJWA 4MJSA 1XEEA 4A55A 4IW2A 1WYGA 4N58A 4BZAA 3IT4B 3EHVA 5G2NA 3DDCB 3OWEB 2NTTA 2LVOA 3R8BA 1UGJA 2AQ3B 4FN2A 1JMLA 3ZJVA 1XO3A 1SE2A 3EGRA 1F9JA 1XLQA 3PLUA 2IO2B 1SB3C
chains in the Genus database with same CATH topology
4WIPA 5BYRA 4OW0A 4LUFA 2L05A 1C79A 1JWBD 2PMVA 2JRIB 4GXBA 5LNK1 1J0GA 2W55A 2VUEA 1G6JA 3M63B 4GN1A 1WF9A 2N9PC 1EM7A 2FBWB 2L32A 5GINA 2KMCA 3AE8B 2H88B 3CX9A 3CSFA 4IWQA 1IGCA 1I4XA 1D3ZA 3TEWA 3SHQA 2JQRB 2QEJC 5FKAC 2KQ4X 1ET9A 2FCQA 2JYEA 5J2RA 4BVUC 3MP9A 3APCA 2D3GA 3W5UB 2KANA 1VJKA 3EECA 2FNJB 2LWPA 1JW9D 1VLBA 3U8ZA 1XT9B 3VVWB 3ZYYX 2D11A 2R2QA 3NVMA 3SEBA 1KM7A 5C1ZA 1K50A 1HK5A 2LRWA 1KW2A 4RGTA 1OEYJ 1HXYD 2BYFA 2NBVB 2KDIA 2EFDA 1AARA 1DOIA 2FCNA 1TS4A 3NVZA 4PO0A 4JQWC 4YSXB 1J7CA 2EFHA 2DX5B 1V49A 4WJQA 2I2YA 4GDXA 3W1SC 3V3XA 4M70B 1QILA 2JXTA 1UWMA 4GMVA 2OJRA 2XMOA 1LFDA 2PW9A 1WRDB 1E8YA 3AEFB 3NRZA 4ZDVA 1F2RI 1MA9A 1Q1OA 2W54A 2L76A 2QM6A 1E7CA 1ZDXA 1N5UA 4NAMA 1KJTA 4MBEC 2EKEC 3UIOB 3ZNHB 4ICUA 3AH7A 5C23A 3A1QB 2BT6A 4L2YA 4XZ4A 4M8MA 4YWGG 3ZKJC 4E99A 4LTUA 3R66C 2PEAA 4IW0A 1M94A 2WXPA 1IYFA 2KDFB 3PTFC 3Q3JA 1E7FA 3CF6E 1HA2A 4HGMB 2NPTA 1NEKB 1YMHE 3SR6A 3DOWA 5GHKA 1JWMD 3B08A 1YD8U 2YVCA 2KFKA 1TKGA 2L52A 3FILB 3U4EG 3LDZE 1H4RA 2WX0A 1EWCA 2BXGA 3KLSX 3RPFC 4FXCA 1Q5WB 4NZLB 3HM3A 5H92C 2BXCA 4LA0A 4FIPB 1EF5A 4FJCB 3Q8CA 1TZOA 2DLBA 3A75A 4WAFA 3L16A 2JPHA 3IBEA 1UUPA 4CO7A 2A4ZA 2KAJA 3U7DA 1OTRB 4GDLA 1ENFA 2KMMA 3KWLA 4OHJA 4DXFA 4NJ6A 2L0FA 4TKNA 2I1JA 2JYTA 1VR9A 4YSYB 2IY0B 3WAOA 3RZFA 4LK0M 5HFYA 5DQFA 1WX9A 3H7SA 1P7EA 1VZ8A 4H2AA 3O65B 2LVQA 5CHVC 1MVKA 2V4IB 1V8CA 2JSVX 2JWZA 2KTRA 2MBOA 2WXRA 3Q8EA 4F5TA 1XCTL 5HOZA 5IIXA 2KC1A 1WFYA 4IOIE 4WWMA 1GNUA 1I42A 2XVWA 1Q10A 3BWUD 3UQBA 1P1AA 5HHDG 1AO6A 3NY5A 1Y8RC 1FCCC 4RM8A 3AMZA 3PLVA 4C7ZA 4WURA 2JRHA 3DBHI 5BPKA 2BXNA 4C56C 4PYZA 4KGTA 4B0MA 4MSQB 4E3CA 4J3OD 3AEAB 4DHZB 4IM3A 1T6BX 1J78A 3ML9A 4WJOA 1TF0A 3P42A 4DHZE 1GC7A 5GIPA 5JHBA 3TJPA 1ZGUB 3T8MA 2KKCA 3TEZA 1H8CA 2NCNA 2C60A 5B5TA 2IBIB 2K6DB 3AEGB 4HXDA 4G0NB 5CHFA 2YEPF 4DQOC 3IHPC 2WYQA 3MHHB 2BPSA 3GOEA 2QHOA 3IAS1 4I6PA 2MLBA 2BB6A 3RT3B 2RDGA 1CMXB 4A3PA 1F2RC 1ZE3D 2AQ2B 1TY0A 2L1AA 1LXDA 1ZW7A 1AW7A 1SBBB 2BB5A 4HRSA 1STEA 3H8HA 4BKTA 3A1QA 1V5OA 1YN5A 3IFWB 3FC4A 5EE1A 1JQ4A 4AQ7A 1IPGA 4DHJD 4ZUXV 1SE4A 3MC0B 2DWQA 2WXJA 5D2MB 1A70A 3B9LA 2DYMA 4FA6A 4A9AA 4XWWA 2MBBB 3ZLZA 5GIOA 2JT4B 4ANVA 4J6IA 2QMTA 4XDDA 2KTFA 3VR9B 4W9HA 4DHXB 1KF6B 2LJIA 1NDDA 2D10A 4M0WA 2GBRA 3DVNU 1GB1A 3BK2A 2NNWA 4NQKE 2BXMA 4WAAA 2BS3B 2W9NA 4MDKE 3TBLD 1WGHA 4C7YA 4JE3B 2RD0A 3VH4B 4ANWA 1BJ5A 1N60A 4PS7A 4C80A 4GLSC 2ZW0A 2KOXA 1EU4A 2LD9A 1H9ZA 4CQNA 4DDGD 3A9KA 2NPTB 4WH4A 4DHJB 2BBCA 3MJ5A 1I4PA 3OLMD 1WGDA 3VUXA 1GAQB 3APFA 2KK8A 3P1MA 2PPHA 1RM6C 3L08A 1C1YB 2HE7A 2PVOD 5IJEA 4RCOA 3ZW3A 1YJIA 1IUEA 4NQLB 2ZPYA 3TEYA 4ICVA 2ZCBA 1IBXB 3PV1A 2BXDA 1SJHD 3EC8A 2BW2A 2E0XA 1T3QA 2N9KA 3JVZX 2DENB 1E7VA 4OVVA 2WS3B 1SGHA 4ZBKA 2KTRB 2J42A 2IGDA 2ZVNA 3A9JA 4K7SA 1EO6A 1IJGA 5C3JB 2BXPA 3RCZA 4JX1C 2SAKA 1KH0A 4OTTA 2CS4A 3VTUA 1L0YB 2INNE 1ROEA 3D32A 2DBYA 2IZVB 5FR3A 5TR5A 1D5ZC 1FMAD 1NT2B 2ROHA 1IBXA 1PYWD 2JY6A 2MWSB 3BVZA 5JXVA 2KX3A 3O13A 2LXAA 5BMIA 2DZKA 2C7HA 3ZIMA 1NI2A 4IWPA 2LGDA 3X0WA 1FM0D 5AUKA 1CK1A 1GJZA 2PVGC 3TUOA 2J0KA 1E7HA 1N63A 2V3SA 4XWTA 4GDKA 4JWSC 1YQ3B 4WQOB 1CQVA 1UWXA 2FE8A 2C5LC 2ZVOA 3NMUA 1YN3A 2M0AA 3PO0A 1RAXA 5E6OA 3DWMA 4W9KA 3NHEB 4HPMB 3W2DA 1LQBA 4FJVB 4L9KA 1V86A 3TMPB 1F77A 1Z5SB 3ENEA 1NYQA 1WH3A 3DQVA 2FCMA 3C0RB 1ZPSA 2J4XA 3L4PA 1UORA 1WE7A 4DXGA 2BYEA 4YTPB 4ZRKA 3ZUNA 3HIZA 3UIPB 4WQMA 2XW1A 4X57B 1V80A 1KOTA 4B95A 1DOXA 1L4ZB 1V5TA 3WCQA 3DVGX 1L6VA 3HUIA 4MM3A 2BXQA 1BKEA 5IJ5A 4W9LA 4WA6B 3AECB 3SU8X 1WXAA 4DWFA 2M8SA 2B3AA 3AULA 1UGMA 3LU6A 3RZWC 1AYFA 2DZMA 2CKHB 3ALBA 3AE9B 2IO3B 4L9QA 4CYEA 2PIAA 2WXNA 3LB8C 1TKEA 3IAM1 3ML8A 4ZYSA 2KXJA 4IG7B 3NVKA 2Z0EB 2ZNVB 4ZYNA 1TKYA 1P7FA 3CMMB 4K7WA 2I1KA 2Z8LA 2V1YA 5D94A 4FLHA 4IW1A 2MP2A 4LCDE 1UD7A 1OEYA 5H8YE 4B0EA 4HJGE 1JWSD 2X38A 1C76A 2BX8A 1XD3B 3TEXA 2AYOB 4K7UA 3KUCB 1T0YA 3L17A 3QIJA 2XN9C 4NNJB 3H3AA 1OQQA 1WE6A 3GB1A 2G9HD 2DBWA 5DPTA 3WHQA 1H5WA 1VZ7A 2DBXA 1ESFA 3M95A 4HROA 2PE6B 2WX1A 4RF1A 3A9JB 1P98A 3VFKA 3SDLC 1WMHB 5DPWA 1TS2A 2IO0B 4BY9C 4IM2A 2GI9A 1I4QA 4II2B 1KLUD 1D6EC 4JL9A 2CU3A 1BXTA 4MJSB 1MIVA 3V61A 1VFIA 2D2QA 3Q8AA 3RD2A 3JRYA 4MSMB 1JALA 1R7SA 1XLOA 1KXPD 2K8CA 2KJRA 3OJ3A 4UDUC 1I35A 3KUZA 1WX7A 3BY4B 3MHSD 4P6VF 4G11A 2RSUA 4A20A 3AEEB 4DBGA 3KH0A 4WWOA 1ISNA 4KIKA 2JXXA 1YX6B 3A4SC 2DG5A 3V6CB 1WMHA 1XQQA 1FXAA 1B1ZA 1TS3A 4W9EA 2BXOA 2PE9A 5GMVA 1WY8A 4W4UB 1WR1A 5FR6A 2WP9B 5FUOA 1V9JA 2ZNVC 1EWYC 1FXIA 3AE3B 2TSSA 2BTEA 1OQRA 3NZ3A 2IGGA 2J7QB 5E6PA 4JK4A 4HPLB 3EFUA 3W1YA 1WJ4A 3ZTDA 2KLCA 3ECIA 2IO1B 4OR0A 1QT9A 4WWPA 1FNWA 2J53A 1B9RA 1SIFA 1FO4A 1E10A 2FCSA 2R2OA 3TL5A 1OFFA 3NS8A 4BKGA 2IPKD 5ID7A 2IDYA 4ZHPA 1A5RA 1MHXA 4HGKA 3VUYA 1EUVB 1PGXA 1MIWA 1T5XD 1E7AA 1SJED 2MJ3A 3AN1A 4ZC6A 2BYVE 2WLBA 1FD6A 3VR8B 2LOQA 1XCQL 1E7GA 4J2VA 3PVLA 3HVZA 2AEHA 1YX5B 1K52A 4EZKA 1HZ5A 1ZUD2 2DBUA 2FIDA 2KHWB 2M1MA 3ZO5B 4OVZA 4F5VA 1JRUA 3VQIA 2ZJDA 3WHRA 3QWZB 2KDBA 4OZBA 3VH3B 2BXBA 1R4MI 3V60A 2BGFA 3ZTCA 2BWES 5DCNA 2IY1B 2KO3A 1E6EB 2K39A 1HK4A 2XEWA 2K8HA 1N62A 1NBFC 2HJ8A 3QJZA 3PREA 2AL6A 1AWDA 1SXTA 3PLAA 1WGYA 4E71A 1PDXA 4BOZB 3ZNZB 3S2AA 3U52E 4N9F4 3ZDTA 1E8WA 4CHKA 2N7DA 2KDMA 1GB4A 1K53A 3UF8A 2L00B 2CKXA 5HKHA 3DVGY 3X23A 1JWUD 4IM0A 2I2ZA 2BXIA 1MPEA 1FXTB 1WJ6A 1BUIC 1HQRD 2N7EA 4ZHOA 5J18A 3UI3A 4IDIA 3V6EB 4W9GA 4KZCA 1X1MA 2REXA 1E7PB 1K8RB 2KVRA 4MACA 1ZXHA 2LI5A 2BYTA 5J17A 2G3QB 4BKSD 4MT5A 1MG8A 4RNAA 2XVVA 2GBJA 1M4VA 4RH6A 3TSSA 4L8UA 2BXAA 3J9CA 2VZKB 3HK0A 4R3DA 5IIUA 4TV3A 2EELA 2G4SA 1RFKA 2XNAC 4JPSA 4ZRJA 4TUUA 2K1FA 2AQ1B 2OOBB 3AXCA 3MHSB 3KYDD 1RWSA 3R3MA 2KN4A 4FK5B 3JSVB 4FHJA 4M8NA 4IKGA 4EEWA 3B9MA 4W9CA 2GMIC 3H6NA 3AE4B 3HVDA 4EMXA 3K9OB 1WZ0A 3P63A 4KSLC 1DYQA 3JW0X 4HJKA 1C3TA 2MW5A 4HWIB 5AUIA 4N3ZA 2GOWA 2KQ7A 2AWTA 3PSEB 3V62A 2MRPA 1TS5A 4FJZA 2E6XA 2KZRA 3ABVB 3AE5B 2KACA 2VZKD 4GIVA 2K3UA 2KBZA 3QARA 4HEA1 2GBKA 2HTHA 4MELA 4BOSC 4O1NA 1V2YA 4ZRQA 3QCAA 2E0YA 1WYWB 3GS2A 4JGHB 2CHZA 2NQOA 1SEBD 3Q3FA 1DOYA 2WXMA 1RRBA 2KWVB 3N32A 1ET6A 2GBNA 4HKZE 4XE0A 3G9KD 1JNBA 3ZJTA 5AEKB 2MBHA 2WXIA 4LJOB 3DBLI 5DPRA 1PGBA 2RDHA 2W3RA 4JWUC 4IWOA 2Z8KA 3AE1B 1QOBA 2KJ6A 3EUB2 1MI0A 3KVFB 3RULA 2AJEA 1QOAA 1V81A 1J7AA 1BM0A 2LMCA 3PHWB 3E9SA 1HK2A 2O6VA 3L54A 2MBEA 1HK3A 1I7HA 4XC2A 2CJOA 4US8A 1YNTE 2QMCA 3R7RA 1QKZA 1L7YA 2KWUB 3U7ZA 4AP4C 3TCAA 1V1PB 5EE9A 3VAWA 2RR9A 3ZNID 4AUQC 4C31B 3FAHA 4BKEA 1KLGD 2MJDA 4USAA 2WXOA 1PQSA 3M99C 1GUAB 2G45B 4N0FD 3CIRB 2ZZPB 3GQXA 1GPXA 1P3QU 1HE8A 3OAWA 2FUHB 2O2VB 1WJUA 1YJJA 1E8ZA 4JIOU 3QA8A 3WALA 2PLPA 2LUEA 2D5GA 1D4BA 1UELA 1YJ1A 4DDID 3OJ4B 5EE0A 2BKRB 4W9FA 2WDVB 2N1WA 3SIVB 3U2SC 4NY0A 4ZBQA 3QX1A 2QHBA 1WRIA 4HCPB 1V97A 2LHDA 2LGYA 5BO4B 2EMSA 2Z59B 4XDCA 4G3XB 1GNJA 3AB5A 3ETRA 4F1SA 1E8XA 4A6QA 1NVID 1TTNA 2RMMA 3KQ4A 4A8XC 3APDA 2MJEA 1KFYB 5JH5C 3SFEB 3B1LX 4M0WB 3LXFA 1U4AA 1Z2MA 4EE2A 1SIJA 4HK2A 2XSIA 4YXDB 1YQBA 1TY2A 4P16A 1NYRA 1N5XA 1YQ4B 1J7EA 2G4DB 2NR2A 1UBIA 4KGSA 3GP7A 4TQ1A 3L0WB 4FJYA 4HDQA 3BIID 1C77A 1QLBB 2ZPNA 1QZEA 2LEKA 4LJPB 3W5VB 2LGIA 2W82A 3NVVA 2EFEA 4HDOA 2Y3AA 4REZA 3KUDB 4BKSA 3AE2B 3QQ8B 2QJLA 1C4AA 3N3KB 3RYTA 1WM2A 1L4DB 2WXKA 3B0AA 4RGMA 1I4RA 2YDFA 2OEDA 1JROA 3M62B 4AOFA 4G03A 4URKA 1J7BA 4RGNA 1BT0A 4KSKC 2IGHA 2BXEA 4TQ0A 2MA9B 2ACZB 3H37A 3AE6B 2BXHA 3ZQ4A 3PZ7A 2JWUA 3ZGZA 3V08A 4ZRIA 3ZRFA 1WXSA 1XXGA 1FOUA 1FNVA 4L23A 1WSPA 2JZPA 2BKFA 1JWAD 2KLGA 1VDVA 5BYQA 3P4SB 2NTSA 2O6VD 2WXQA 4K81A 3PZDA 3HHMA 1NENB 4RGOS 3AE7B 4G01A 5GXGB 2DHZA 3NS1A 4EZLA 4GGQA 3PRPB 2WWZA 1C78A 4HCNB 2JU6X 3BK1A 1WZ3A 4FBJB 2ZEQA 3GQUA 3AU5A 2K22A 2K0PA 1WI0A 4FADA 3QAQA 4KZ0A 1R4NI 2C9WB 2UWQA 1KRHA 4EFOA 5MPOA 3BVGA 2LGXA 2LZ6A 3LU8A 3HRDD 3NVIA 3ZDMC 1XF5L 1TBEA 2KWCA 4WJPA 3V03A 1SE9A 3H9DA 1CZPA 1PGAA 1TGZB 2HDEA 1L0XB 1WR6E 3VUWA 4MGKE 1YIWA 2PTLA 1WWTA 2CR5A 4MH0E 1L0VB 2O2VA 2FUG1 3VRBB 2QSDA 4MM3B 4XX5A 1FRDA 3Q8FA 1S3SG 1FFUA 4W9JA 1E9MA 3GA9L 4RMAA 3FNMA 2KFKB 3IT6B 1VD2A 2KN5A 4OZAA 1PUTA 3R2TA 5KHQA 2Z8JA 4N59A 2Y5CA 2VRRB 1PFDA 5CHWA 5AZHA 3VHTC 4II3B 1EU3A 4NJ7A 1C9FA 3LU7A 2V3PA 2CU1A 2KWDA 3EA6A 3P4PB 3VTVA 5L95C 2DYOA 3LYYA 1NI3A 3AU4A 3ZJUA 1UNSA 4OT2A 1FIQA 3DBRI 5JZEB 2D07B 4GDLB 1Q0WB 4MH8A 2JX5A 2MP2B 3L13A 1SF0A 2G1EA 3I9V1 3PHXB 4Z9OA 1E5WA 2ZW1A 3MFGA 1AN8A 1I4HA 1ZXIA 2JF5A 3VDZA 1ACCA 2BS4B 4ZCGA 3W9CB 4EZJA 2JUOA 1Y56A 3T9LA 4ASWC 3BZDB 4I6LB 3IXSA 3TIXA 3RFZB 3URYA 1FFVA 2QILA 4EKUA 1FRRA 1UBQA 4LLGM 3PT2B 4GDKB 2KFJA 3PRMB 1MHHE 2LASA 4ZRPA 3WA0A 3M3JA 1VRAB 2O6VB 1FEHA 3WHSA 2BWFA 2N9LA 2XVQA 4KV2A 1K51A 5T8IA 2KNBA 3ZRCA 4OTUA 2KD0A 4I6NB 4ANUA 2KC2A 1C4PA 2KJHB 1LOTA 3AEBB 4NAWA 4MEMA 3V09A 2WQYB 2C7NB 4GB9A 2YEPB 2L3ZA 1GG3A 3AEDB 2K6QA 2INPE 2JZ3B 2BF8B 4LUHA 3DPDA 2ICIA 1I4GA 1N61A 3NUHB 1P9DU 3P4RB 3BYYB 2MCNB 4ANXA 2JUHA 2NMQA 3AM9A 3BVMA 2XK5A 2LUMA 2WDRB 1FCLA 3QK0A 1D5MC 2ONQA 5EDSA 4HLEA 5D7GA 1L6UA 1WXQA 4ITKA 3H7PB 2DAFA 2MH7A 2WXLA 3WAMA 1VZSA 4MGZE 4YT0B 1RFAA 1MIYA 3FWCC 2MX2A 5BMHA 4AJWA 4N0UD 4RFBA 2J0JA 4G04A 2L83A 3K9PB 3IVFA 2V4LA 4WWNA 2WU5B 4FULA 3FILA 2XBBC 3DWGC 1QOGA 2BXLA 5LXIB 5I4DA 1E90A 3CSTA 4PT5A 3RUIB 2JVCA 2B76B 3PS6A 3QC8B 2PJHA 4KVGB 1GNIA 5G5HA 3UINB 2XK5B 5G5GA 3E56A 1E7BA 4YTNB 4K1RB 1HZ6A 5BYSA 2GBMA 3A33B 5LLIA 4B6WA 1J8CA 3H7PA 1KLVA 1KTKA 2KDEB 3VXWA 2CHWA 3NZUA 4P7IA 5CX3A 1N5WA 3HM6X 5IIHA 4OVUA 4ARIA 3NZSA 2FAZA 2LHEA 2FIFA 3AV8A 2WDTB 2V36A 2N0SB 2N7JA 2XVUA 5KHOA 1JCKB 4LB2A 3V05A 2E3TA 3MHZA 2CJNA 4HVBA 1QQRA 5DPSA 2IJ0A 3Q69A 2W3SA 2GB1A 5DBYA 1WM3A 2MQJA 2J52A 2AX5A 2ON8A 3MJWA 2Q5WD 2J0MA 1HK1A 1JRPA 1F0ZA 5IA7A 5HI1A 1YN4A 1UZXB 2N4FA 1LM8B 1XLNA 4JLCA 2XW0A 5IAAC 2KQSA 2KMAA 3BINA 3IG3A 3I57A 4Z69A 1GC6A 2L7RA 2HTME 1BMLC 3ZVVA 2K9XA 1LO5D 4F5SA 3B2GA 2Y5PA 2MSED 2DZIA 5AZFA 2UYZB 2EKIA 3T3OA 3TDLA 4G50A 3I3TB 1E7UA 2LVPA 5L83A 4RM9A 1E0ZA 3SD5A 1WJNA 1UH6A 2NVUI 3P2BA 1CJEA 3B9JA 4KDIC 3NVWA 2LRUA 2PKOA 1ZDVA 2R61A 4WJNA 5D3DA 3LJ3A 3R2IA 4EOYA 2BXKA 4RF0A 3VRAB 3ICXA 2N9XA 2Y5BB 4PS8A 1DGJA 3B2FA 2WXGA 3KWVA 4IUMB 1J19A 2K8BA 1RYJA 1V1OA 4LDTD 4KX6B 4BFRA 4GG2A 3W1SA 3NOBA 4NAWB 3JSVA 4AS1A 3NVYA 2A5UA 4GU2A 3Q8BA 2BXFA 4E74A 1D5XC 4D2KA 3SFDB 3QHTA 1TZ1A 1WGKA 3UIVA 4DK5A 3GZNI 1OGWA 2V0GA 1OQYA 5BMGA 5ID9A 1VZ6A 2M17A 1RLFA 1XLPA 1LNSA 4YSZB 2YLMA 3MTNB 2WXHA 5IFOA 4EUTA 3CWIA 2WU2B 4KDLB 2V3NA 2EMTA 4GSWA 4ARCA 5AZGA 2N9EB 2C7MB 3KIKA 4ZOHC 3N30A 5D6JB 3KJLA 4MGYE 3A4RA 2M4NA 4A3OA 4AJYB 3PRZA 2NBUA 3T3NA 4DXAB 5D3IB 2CHXA 2NBWB 3C8YA 2ASQA 3ZNGC 5EE3A 3A9KB 1WXVA 3PGEA 3UQAA 2Z8IA 4KIKB 3SQJA 2Z0DB 3WIMA 2M19A 3H1UA 1IP9A 2H89B 1ZKHA 4W9IA 1L2NA 2WNMA 4F5UA 1QOFA 4PS3A 5G55A 3N9YC 4KGRA 2IYDB 1E7IA 4A90A 3KYCD 4Q2JA 3L10B 2OZBB 5LXHA 2N1VA 2L8JA 1ZP0B 3SIUB 3WAPA 3UGBB 4US9A 4KKIA 4F7ZA 2MBQA 4KKJA 1EF1A 1TXUA 2JZZA 1GOZA 3KW5B 4HKQA 1P0RA 1E78A 1C4CA 2DYBA 2VDBA 2GRIA 4PYUA 3DCGA 2I30A 5CTRC 5HG2A 2WXFA 3DVNV 3PPAA 3VTWA 2QIEB 4N6EB 4TMAB 1WGRA 2L0TA 2VUFA 4K71A 4B9KA 5E6JA 3R7QA 3AI5A 4LB9A 2LXCA 3JQZA 1V1PA 4ZBRA 1S1QB 3WANA 2WDQB 2MEKA 1WXMA 1HEZE 3PZ8A 2BS2B 2ZCCA 3P4QB 4BBNC 1TJEA 4YL8A 2RPVA 4IC7B 2DAJA 2LFIA 1L5PA 3U30A 1WX8A 2K25A 4K2CA 1ZOYB 4OZCA 2KX0A 2NS5A 2K5PA 2OT3A 4FHKA 1E7EA 4AWJA 2RGFA 3FWBC 2M0XA 4F8CB 4LDTB 5FK9C 2RPQA 1IGDA 4W9DA 4NPNA 2EFCA 2SEBD 3JYUA 1QF6A 4L1BA 3A73A 5JHAA 2OHFA 4YTMB 2I38A 4MGIE 5TSSA 1O9XA 4TSSA 4NJCA 2AL3A 2DZJA 2M56B 3BYTB 1WIAA 2HD5B 4GOCA 3DBSA 5E6NA 1HA5A 1SSNA 1TYGB 1FNUA 3ONSA 1SE3A 1V6EA 4BBNF 4S1YA 5IJFA 1WGGA 1VCBA 2LJ5A 5C2TB 4MJSA 1XEEA 4A55A 4IW2A 1WYGA 4N58A 3IT4B 3EHVA 5G2NA 3DDCB 3OWEB 2NTTA 2LVOA 3R8BA 1UGJA 2AQ3B 4FN2A 1JMLA 3ZJVA 1XO3A 1SE2A 3EGRA 1F9JA 1XLQA 3PLUA 2IO2B 1SB3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZK A;  4HJK A;  2L3Z A;  1GG3 A;  2K6Q A;  1C3T A;  2MW5 A;  4HWI B;  2C7H A;  2JZ3 B;  3ZIM A;  2GOW A;  2BF8 B;  1NI2 A;  4IWP A;  2KQ7 A;  2LGD A;  3DPD A;  3X0W A;  2L05 A;  2AWT A;  3PSE B;  3V62 A;  2MRP A;  1GJZ A;  2J0K A;  2JRI B;  4FJZ A;  4GXB A;  2KZR A;  2V3S A;  4GDK A;  1J0G A;  1P9D U;  1G6J A;  4WQO B;  3M63 B;  2MCN B;  4ANX A;  2C5L C;  4GIV A;  2ZVO A;  3QAR A;  2GBK A;  2HTH A;  2XK5 A;  4GN1 A;  4MEL A;  4BOS C;  1V2Y A;  1WF9 A;  2N9P C;  3QCA A;  1WYW B;  2KMC A;  4JGH B;  3QK0 A;  2CHZ A;  1RAX A;  5E6O A;  5EDS A;  4HLE A;  3Q3F A;  3CSF A;  5D7G A;  1RRB A;  2KWV B;  4IWQ A;  3N32 A;  3H7P B;  2GBN A;  2DAF A;  3WAM A;  4W9K A;  3NHE B;  1D3Z A;  4HPM B;  1LQB A;  5AEK B;  2MBH A;  3SHQ A;  4MGZ E;  4LJO B;  1RFA A;  2MX2 A;  3DBL I;  4FJV B;  5DPR A;  3TMP B;  1V86 A;  4AJW A;  1Z5S B;  2FCQ A;  4IWO A;  5J2R A;  2J0J A;  2KJ6 A;  3K9P B;  4BVU C;  3ENE A;  3IVF A;  2V4L A;  3APC A;  2D3G A;  4WWN A;  2KAN A;  3KVF B;  1WH3 A;  3EEC A;  3DQV A;  2FNJ B;  2LWP A;  3RUL A;  4FUL A;  3U8Z A;  1V81 A;  2XBB C;  1XT9 B;  3VVW B;  5LXI B;  3PHW B;  2FCM A;  1E90 A;  3C0R B;  2D11 A;  2O6V A;  3CST A;  3L54 A;  2MBE A;  2R2Q A;  1KM7 A;  5C1Z A;  3RUI B;  2JVC A;  4XC2 A;  2LRW A;  1WE7 A;  3PS6 A;  3QC8 B;  1OEY J;  2PJH A;  2BYE A;  4KVG B;  3R7R A;  2BYF A;  2NBV B;  4ZRK A;  3ZUN A;  2KDI A;  3HIZ A;  3UIN B;  1L7Y A;  2KWU B;  2XK5 B;  3UIP B;  4AP4 C;  1AAR A;  3TCA A;  2FCN A;  4X57 B;  3VAW A;  1V80 A;  1KOT A;  2RR9 A;  4B95 A;  4JQW C;  4K1R B;  3ZNI D;  2GBM A;  3A33 B;  5LLI A;  4AUQ C;  4B6W A;  1J8C A;  2DX5 B;  1V49 A;  3H7P A;  4WJQ A;  1KLV A;  1V5T A;  2KDE B;  3VXW A;  2CHW A;  3NZU A;  4P7I A;  5CX3 A;  3HM6 X;  1PQS A;  3W1S C;  4OVU A;  3NZS A;  2FAZ A;  2FIF A;  3DVG X;  1GUA B;  2WDT B;  2G45 B;  4MM3 A;  4GMV A;  2OJR A;  2ZZP B;  4W9L A;  1LFD A;  1P3Q U;  1WRD B;  5KHO A;  1E8Y A;  3SU8 X;  1HE8 A;  3OAW A;  1WXA A;  4DWF A;  2FUH B;  2M8S A;  2O2V B;  2B3A A;  4ZDV A;  1WJU A;  1E8Z A;  4JIO U;  3QA8 A;  3WAL A;  3AUL A;  2LUE A;  1Q1O A;  1UGM A;  2L76 A;  4HVB A;  5DPS A;  1UEL A;  1YJ1 A;  4DDI D;  3OJ4 B;  1KJT A;  1WM3 A;  2EKE C;  3RZW C;  2DZM A;  2MQJ A;  2BKR B;  3UIO B;  3ZNH B;  4ICU A;  4W9F A;  3MJW A;  2N1W A;  2CKH B;  2J0M A;  5C23 A;  3ALB A;  3A1Q B;  2IO3 B;  4CYE A;  4XZ4 A;  5IA7 A;  4M8M A;  4NY0 A;  1UZX B;  3ZKJ C;  3QX1 A;  2N4F A;  4HCP B;  1LM8 B;  3R66 C;  2LGY A;  4JLC A;  2PEA A;  4IW0 A;  3ML8 A;  1M94 A;  2EMS A;  2Z59 B;  5IAA C;  5BO4 B;  2KQS A;  4G3X B;  2KXJ A;  4IG7 B;  2Z0E B;  2KMA A;  2ZNV B;  3BIN A;  3IG3 A;  4ZYN A;  2KDF B;  1IYF A;  4F1S A;  1E8X A;  3CMM B;  4K7W A;  2I1K A;  3PTF C;  1TTN A;  2V1Y A;  5D94 A;  3Q3J A;  3APD A;  3CF6 E;  1GC6 A;  4FLH A;  2MP2 A;  4LCD E;  2L7R A;  1UD7 A;  1OEY A;  2NPT A;  5JH5 C;  3DOW A;  3ZVV A;  3B1L X;  3B08 A;  1YD8 U;  2YVC A;  2KFK A;  4M0W B;  3LDZ E;  1XD3 B;  1H4R A;  2AYO B;  2MSE D;  2DZI A;  2WX0 A;  4K7U A;  3KUC B;  1U4A A;  5AZF A;  1Z2M A;  1T0Y A;  2UYZ B;  3L17 A;  3QIJ A;  4NNJ B;  1WE6 A;  1Q5W B;  4G50 A;  3I3T B;  4HK2 A;  5DPT A;  3HM3 A;  1E7U A;  2LVP A;  1EF5 A;  1YQB A;  5L83 A;  4RM9 A;  3L16 A;  3M95 A;  2JPH A;  3IBE A;  2PE6 B;  4CO7 A;  3SD5 A;  2WX1 A;  1WJN A;  2G4D B;  1UH6 A;  2A4Z A;  3U7D A;  2NR2 A;  2NVU I;  1UBI A;  3P2B A;  1OTR B;  3A9J B;  1P98 A;  4KDI C;  4GDL A;  3VFK A;  2LRU A;  3SDL C;  1WMH B;  4TQ1 A;  3L0W B;  4FJY A;  4HDQ A;  5DPW A;  2IO0 B;  2ZPN A;  1QZE A;  4WJN A;  4IM2 A;  4NJ6 A;  4LJP B;  2L0F A;  4TKN A;  3LJ3 A;  4II2 B;  4EOY A;  4HDO A;  2I1J A;  4JL9 A;  3KUD B;  4BKS A;  3QQ8 B;  2N9X A;  2IY0 B;  2Y5B B;  4PS8 A;  4MJS B;  3N3K B;  3RZF A;  2D2Q A;  3RYT A;  3V61 A;  3WAO A;  1WM2 A;  4IUM B;  1J19 A;  2K8B A;  4MSM B;  3RD2 A;  4LDT D;  1WX9 A;  3B0A A;  3H7S A;  4BFR A;  2K8C A;  3W1S A;  2KJR A;  3O65 B;  3NOB A;  3OJ3 A;  4NAW B;  1I35 A;  3JSV A;  1WX7 A;  3KUZ A;  3M62 B;  2LVQ A;  3BY4 B;  5CHV C;  2A5U A;  3MHS D;  4AOF A;  4GU2 A;  4URK A;  4G11 A;  2RSU A;  2JWZ A;  2KTR A;  2MBO A;  4A20 A;  2IO2 B;  1BT0 A;  4KSK C;  4E74 A;  4DBG A;  4TQ0 A;  3KH0 A;  2MA9 B;  4WWO A;  1ISN A;  3QHT A;  4KIK A;  1TZ1 A;  1WFY A;  1YX6 B;  2JXX A;  2KC1 A;  1GNU A;  3A4S C;  4DK5 A;  1I42 A;  3GZN I;  3UQB A;  1OGW A;  1P1A A;  4ZRI A;  3V6C B;  1OQY A;  1WMH A;  1WXS A;  3ZRF A;  3NY5 A;  1XQQ A;  2M17 A;  1Y8R C;  4RM8 A;  1RLF A;  3PLV A;  2BKF A;  2KLG A;  4W9E A;  2JRH A;  3DBH I;  2PE9 A;  5GMV A;  2YLM A;  3MTN B;  1WY8 A;  4PYZ A;  4EUT A;  1WR1 A;  5FR6 A;  2O6V D;  1V9J A;  2ZNV C;  4MSQ B;  4E3C A;  4KDL B;  2EMT A;  4GSW A;  4DHZ B;  5AZG A;  2N9E B;  4IM3 A;  4K81 A;  2C7M B;  3N30 A;  2J7Q B;  5D6J B;  5E6P A;  3ML9 A;  3PZD A;  3HHM A;  4HPL B;  3EFU A;  4MGY E;  3A4R A;  4WJO A;  3W1Y A;  1WJ4 A;  3ZTD A;  4DHZ E;  2M4N A;  1GC7 A;  2KLC A;  4A3O A;  4AJY B;  5JHB A;  3ECI A;  2IO1 B;  3TJP A;  1ZGU B;  2DHZ A;  3PRZ A;  2NBU A;  4EZL A;  4WWP A;  4DXA B;  4GGQ A;  2CHX A;  2NBW B;  3PRP B;  2ASQ A;  3ZNG C;  1SIF A;  2WWZ A;  3A9K B;  2KKC A;  1WXV A;  3PGE A;  3T8M A;  4HCN B;  2FCS A;  2R2O A;  4KIK B;  1WZ3 A;  4FBJ B;  3UQA A;  2ZEQ A;  3TL5 A;  1H8C A;  2NCN A;  2C60 A;  3AU5 A;  2Z0D B;  3NS8 A;  3WIM A;  4BKG A;  2IBI B;  2K6D B;  3H1U A;  1A5R A;  1IP9 A;  4HXD A;  1ZKH A;  4G0N B;  4W9I A;  5CHF A;  1L2N A;  4PS3 A;  1WI0 A;  4FAD A;  3QAQ A;  5G55 A;  3IHP C;  2WYQ A;  4KZ0 A;  3VUY A;  1EUV B;  1R4N I;  2BPS A;  2IYD B;  2C9W B;  3GOE A;  2QHO A;  2UWQ A;  4EFO A;  3KYC D;  3L10 B;  4I6P A;  2MLB A;  2LGX A;  3RT3 B;  2LZ6 A;  5LXH A;  2N1V A;  2L8J A;  1CMX B;  3WAP A;  3UGB B;  2BYV E;  3ZDM C;  4A3P A;  4F7Z A;  1TBE A;  1LXD A;  1ZW7 A;  2MBQ A;  2KWC A;  4WJP A;  1EF1 A;  4BKT A;  1SE9 A;  2JZZ A;  3H9D A;  3PVL A;  3A1Q A;  3KW5 B;  1P0R A;  2AEH A;  1YX5 B;  1V5O A;  1TGZ B;  4EZK A;  3IFW B;  2DYB A;  1WR6 E;  4PYU A;  3VUW A;  3DCG A;  4MGK E;  1IPG A;  4DHJ D;  2FID A;  5CTR C;  1YIW A;  2KHW B;  2CR5 A;  2M1M A;  3ZO5 B;  3DVN V;  4MH0 E;  2O2V A;  3PPA A;  3VTW A;  1JRU A;  3VQI A;  5D2M B;  2DYM A;  4FA6 A;  2ZJD A;  2MBB B;  4XX5 A;  3ZLZ A;  1WGR A;  2JT4 B;  2L0T A;  4ANV A;  4B9K A;  4J6I A;  3QWZ B;  2KDB A;  1S3S G;  3R7Q A;  3AI5 A;  2KTF A;  4W9J A;  3VH3 B;  4W9H A;  2LXC A;  1R4M I;  4RMA A;  1NDD A;  2D10 A;  3V60 A;  1S1Q B;  2GBR A;  2KFK B;  1VD2 A;  3WAN A;  3DVN U;  2BGF A;  1WXM A;  3ZTC A;  2BWE S;  5DCN A;  2IY1 B;  4NQK E;  4WAA A;  2KO3 A;  2K39 A;  2XEW A;  2ZCC A;  2W9N A;  4MDK E;  3TBL D;  4BBN C;  1WGH A;  2KN5 A;  2K8H A;  1NBF C;  2RD0 A;  2HJ8 A;  3QJZ A;  3PRE A;  4YL8 A;  5KHQ A;  3VH4 B;  4IC7 B;  2DAJ A;  4ANW A;  2AL6 A;  2VRR B;  4PS7 A;  3U30 A;  5CHW A;  5AZH A;  1WX8 A;  1WGY A;  2K25 A;  4II3 B;  2KOX A;  3VHT C;  2LD9 A;  4E71 A;  4NJ7 A;  2CU1 A;  4DDG D;  2KX0 A;  2NS5 A;  3VTV A;  4BOZ B;  3ZNZ B;  5L95 C;  2DYO A;  2NPT B;  3A9K A;  3S2A A;  4N9F 4;  3AU4 A;  3ZDT A;  1E8W A;  4FHK A;  4CHK A;  2N7D A;  3DBR I;  4AWJ A;  2RGF A;  5JZE B;  4DHJ B;  2D07 B;  4GDL B;  1Q0W B;  2M0X A;  3OLM D;  1WGD A;  3VUX A;  3UF8 A;  2L00 B;  4F8C B;  5HKH A;  2MP2 B;  3DVG Y;  3X23 A;  3APF A;  2KK8 A;  4IM0 A;  4LDT B;  3L13 A;  2PPH A;  2RPQ A;  3L08 A;  4W9D A;  1C1Y B;  1FXT B;  1WJ6 A;  2HE7 A;  4NPN A;  2N7E A;  5J18 A;  3ZW3 A;  3JYU A;  3V6E B;  4W9G A;  3PHX B;  1E5W A;  4NQL B;  2ZPY A;  4ICV A;  5JHA A;  2ZCB A;  4KZC A;  1X1M A;  2REX A;  3PV1 A;  1K8R B;  2KVR A;  2JF5 A;  3VDZ A;  3EC8 A;  4MGI E;  2LI5 A;  4EZJ A;  5J17 A;  2JUO A;  2G3Q B;  3T9L A;  3JVZ X;  4ASW C;  2AL3 A;  2DZJ A;  2DEN B;  4I6L B;  1MG8 A;  1E7V A;  4OVV A;  3TIX A;  4BKS D;  1SGH A;  2KTR B;  1WIA A;  2HD5 B;  4GOC A;  3DBS A;  5E6N A;  2ZVN A;  4EKU A;  2GBJ A;  3A9J A;  1UBQ A;  3ONS A;  1V6E A;  4K7S A;  1EO6 A;  3PT2 B;  4BBN F;  4GDK B;  1WGG A;  1VCB A;  2KFJ A;  2LJ5 A;  3PRM B;  3HK0 A;  3RCZ A;  2CS4 A;  2LAS A;  4TV3 A;  3WA0 A;  2G4S A;  4MJS A;  3M3J A;  2O6V B;  3VTU A;  2BWF A;  4ZRJ A;  4TUU A;  2K1F A;  2OOB B;  3AXC A;  3KYD D;  4KV2 A;  3R3M A;  3EHV A;  5G2N A;  3D32 A;  3JSV B;  4FHJ A;  2KNB A;  3DDC B;  4M8N A;  3ZRC A;  4EEW A;  2KD0 A;  2IZV B;  4I6N B;  4W9C A;  4ANU A;  2KC2 A;  2LVO A;  2GMI C;  2KJH B;  3H6N A;  5TR5 A;  3K9O B;  4FN2 A;  1WZ0 A;  4NAW A;  4KSL C;  4MEM A;  3JW0 X;  1F9J A;  2JY6 A;  2MWS B;  3PLU A;  2C7N B;  2KX3 A;  2LXA A;  4GB9 A; 
#chains in the Genus database with same CATH topology
 4WIP A;  5BYR A;  4OW0 A;  4LUF A;  2L05 A;  5IP4 D;  1C79 A;  1MM8 A;  1JWB D;  2PMV A;  2JRI B;  4GXB A;  5LNK 1;  1J0G A;  3FKY A;  2W55 A;  2VUE A;  1G6J A;  3M63 B;  1F52 A;  4GN1 A;  1EM7 A;  1WF9 A;  2N9P C;  2FBW B;  2L32 A;  5GIN A;  2KMC A;  3AE8 B;  2H88 B;  3CX9 A;  3CSF A;  4IWQ A;  1IGC A;  1I4X A;  1D3Z A;  3TEW A;  3SHQ A;  2JQR B;  2QEJ C;  5FKA C;  2KQ4 X;  1ET9 A;  2FCQ A;  2JYE A;  1MUS A;  5J2R A;  4BVU C;  3MP9 A;  1HTO A;  3APC A;  2D3G A;  3W5U B;  1VJK A;  2KAN A;  3EEC A;  2FNJ B;  2LWP A;  1JW9 D;  1VLB A;  3U8Z A;  1XT9 B;  3VVW B;  3ZYY X;  2UU7 A;  2D11 A;  2R2Q A;  3NVM A;  3SEB A;  4P1B C;  1K50 A;  1KM7 A;  5C1Z A;  1HK5 A;  2LRW A;  3N1X C;  1KW2 A;  4RGT A;  1OEY J;  1HXY D;  2BYF A;  2NBV B;  2KDI A;  2EFD A;  1AAR A;  1DOI A;  2FCN A;  1TS4 A;  2RDB C;  4PO0 A;  3NVZ A;  4JQW C;  4YSX B;  1J7C A;  2EFH A;  2DX5 B;  1V49 A;  4WJQ A;  2KYW A;  2I2Y A;  4GDX A;  3DHG C;  3W1S C;  4M02 A;  3V3X A;  4M70 B;  1QIL A;  2JXT A;  1UWM A;  4GMV A;  2OJR A;  2XMO A;  1LFD A;  2PW9 A;  1WRD B;  1E8Y A;  3AEF B;  3NRZ A;  1F2R I;  4ZDV A;  1MA9 A;  1Q1O A;  2W54 A;  2L76 A;  2QM6 A;  1E7C A;  1ZDX A;  1N5U A;  4NAM A;  1KJT A;  4MBE C;  2EKE C;  3UIO B;  3ZNH B;  4ICU A;  3AH7 A;  5C23 A;  3A1Q B;  2BT6 A;  4L2Y A;  4XZ4 A;  4M8M A;  3N20 C;  4YWG G;  3ZKJ C;  4E99 A;  4LTU A;  3R66 C;  2PEA A;  4IW0 A;  1M94 A;  2WXP A;  1IYF A;  2KDF B;  3PTF C;  1LGR A;  4QAY A;  3Q3J A;  1E7F A;  3CF6 E;  1HA2 A;  4HGM B;  2NPT A;  1NEK B;  1YMH E;  3SR6 A;  3DOW A;  1R4N B;  5GHK A;  1JWM D;  3B08 A;  1YD8 U;  2L52 A;  2KFK A;  1TKG A;  2YVC A;  3FIL B;  3U4E G;  3LDZ E;  1H4R A;  2WX0 A;  1EWC A;  4ACF A;  2BXG A;  3KLS X;  3RPF C;  4FXC A;  4K3B A;  1Q5W B;  4NZL B;  3HM3 A;  5H92 C;  2BXC A;  4LA0 A;  4FIP B;  1EF5 A;  5IN7 A;  4FJC B;  3Q8C A;  1TZO A;  2DLB A;  3A75 A;  4WAF A;  3L16 A;  2JPH A;  3IBE A;  1UUP A;  4CO7 A;  2A4Z A;  2KAJ A;  3U7D A;  1OTR B;  4GDL A;  1ENF A;  2KMM A;  3KWL A;  4OHJ A;  4DXF A;  4NJ6 A;  2L0F A;  4TKN A;  2D3A A;  2I1J A;  2JYT A;  1VR9 A;  4YSY B;  2IY0 B;  3WAO A;  4LK0 M;  3RZF A;  5HFY A;  5DQF A;  1P7E A;  1WX9 A;  1VZ8 A;  3H7S A;  4H2A A;  3O65 B;  1MVK A;  2LVQ A;  5CHV C;  2V4I B;  1V8C A;  2JSV X;  4I9O A;  2JWZ A;  2KTR A;  2MBO A;  2WXR A;  3Q8E A;  4F5T A;  1XCT L;  5HOZ A;  5IIX A;  2KC1 A;  1WFY A;  4IOI E;  4WWM A;  1GNU A;  1I42 A;  2XVW A;  1Q10 A;  3BWU D;  3UQB A;  1P1A A;  5HHD G;  1AO6 A;  3NY5 A;  4DM0 A;  1FCC C;  1Y8R C;  4RM8 A;  3AMZ A;  3PLV A;  4C7Z A;  4WUR A;  2JRH A;  3DBH I;  5BPK A;  2BXN A;  4C56 C;  4PYZ A;  4KGT A;  4B0M A;  2K0N A;  4MSQ B;  4E3C A;  4J3O D;  3AEA B;  4DHZ B;  4IM3 A;  1T6B X;  1J78 A;  3ML9 A;  4WJO A;  1TF0 A;  3P42 A;  4DHZ E;  1GC7 A;  5GIP A;  5JHB A;  3TJP A;  1ZGU B;  2BQQ A;  3T8M A;  2KKC A;  3TEZ A;  1H8C A;  2NCN A;  2C60 A;  5B5T A;  2IBI B;  2K6D B;  3AEG B;  4HXD A;  4G0N B;  5CHF A;  2YEP F;  4DQO C;  3IHP C;  2WYQ A;  3MHH B;  2BPS A;  3GOE A;  2QHO A;  4XGA B;  3IAS 1;  4I6P A;  2MLB A;  2BB6 A;  3RT3 B;  2RDG A;  1CMX B;  4A3P A;  1F2R C;  1ZE3 D;  2AQ2 B;  1TY0 A;  2L1A A;  1LXD A;  1ZW7 A;  1AW7 A;  1SBB B;  2BB5 A;  4HRS A;  1STE A;  3H8H A;  4BKT A;  3A1Q A;  1V5O A;  1YN5 A;  3IFW B;  3FC4 A;  5EE1 A;  1JQ4 A;  4AQ7 A;  4LNF A;  1IPG A;  4DHJ D;  4ZUX V;  1SE4 A;  3MC0 B;  2DWQ A;  4C4V A;  2WXJ A;  5D2M B;  1A70 A;  3B9L A;  2DYM A;  4A9A A;  2DNF A;  4FA6 A;  2MBB B;  3ZLZ A;  4XWW A;  5GIO A;  2JT4 B;  4ANV A;  4J6I A;  2QMT A;  4XDD A;  2KTF A;  3VR9 B;  4W9H A;  4DHX B;  1KF6 B;  2LJI A;  1NDD A;  2D10 A;  4M0W A;  2GBR A;  3DVN U;  1GB1 A;  3BK2 A;  2NNW A;  4NQK E;  2BXM A;  4WAA A;  2BS3 B;  2W9N A;  4MDK E;  3TBL D;  1WGH A;  4C7Y A;  4JE3 B;  2RD0 A;  3VH4 B;  4ANW A;  1BJ5 A;  1N60 A;  4PS7 A;  4C80 A;  4GLS C;  2ZW0 A;  1EU4 A;  2KOX A;  2LD9 A;  1H9Z A;  4CQN A;  4DDG D;  3A9K A;  2NPT B;  4WH4 A;  4DHJ B;  2BBC A;  3MJ5 A;  1I4P A;  3OLM D;  1WGD A;  3VUX A;  1GAQ B;  3APF A;  2KK8 A;  3P1M A;  2PPH A;  1RM6 C;  2WGS A;  3L08 A;  1C1Y B;  2HE7 A;  2PVO D;  5IJE A;  4RCO A;  3ZW3 A;  1YJI A;  1IUE A;  4NQL B;  2ZPY A;  3TEY A;  4ICV A;  2ZCB A;  1IBX B;  3PV1 A;  2BXD A;  1SJH D;  3EC8 A;  2BW2 A;  2E0X A;  1T3Q A;  2N9K A;  3JVZ X;  2DEN B;  1E7V A;  2LXS A;  2WS3 B;  4OVV A;  1SGH A;  4ZBK A;  2KTR B;  2J42 A;  2IGD A;  2ZVN A;  3A9J A;  4K7S A;  1EO6 A;  3BPJ A;  1IJG A;  5C3J B;  2BXP A;  3RCZ A;  4JX1 C;  2SAK A;  1KH0 A;  4OTT A;  2CS4 A;  3RNG C;  3VTU A;  1L0Y B;  2INN E;  1ROE A;  3D32 A;  2DBY A;  2IZV B;  5FR3 A;  5TR5 A;  1D5Z C;  1FMA D;  1NT2 B;  2ROH A;  1IBX A;  2X8X X;  1PYW D;  2JY6 A;  2MWS B;  3BVZ A;  5JXV A;  2KX3 A;  3O13 A;  2LXA A;  5BMI A;  2DZK A;  2QCZ A;  3GZN B;  2C7H A;  3ZIM A;  1NI2 A;  4IWP A;  2LGD A;  3X0W A;  1FM0 D;  5AUK A;  1CK1 A;  2PVG C;  3TUO A;  1GJZ A;  2J0K A;  1E7H A;  1N63 A;  1KDX A;  2V3S A;  4XWT A;  4GDK A;  4JWS C;  1YQ3 B;  4WQO B;  1CQV A;  1UWX A;  2FE8 A;  2C5L C;  2ZVO A;  3NMU A;  1YN3 A;  2M0A A;  3PO0 A;  1RAX A;  5E6O A;  3DWM A;  4W9K A;  3NHE B;  3DBR B;  4HPM B;  1LQB A;  3W2D A;  4FJV B;  4L9K A;  1V86 A;  3TMP B;  1F77 A;  1Z5S B;  3ENE A;  1NYQ A;  1WH3 A;  3DQV A;  2FCM A;  2J4X A;  1ZPS A;  3C0R B;  3L4P A;  1UOR A;  1WE7 A;  4DXG A;  2BYE A;  4YTP B;  4ZRK A;  3ZUN A;  3HIZ A;  3UIP B;  1UF0 A;  2XW1 A;  4WQM A;  4X57 B;  1V80 A;  1KOT A;  4B95 A;  1DOX A;  1L4Z B;  1V5T A;  2AGH B;  3OG5 A;  3WCQ A;  3DVG X;  1L6V A;  3HUI A;  4MM3 A;  2BXQ A;  1BKE A;  5IJ5 A;  4W9L A;  4WA6 B;  3AEC B;  3SU8 X;  1WXA A;  4DWF A;  2M8S A;  2B3A A;  2INC C;  3AUL A;  1UGM A;  5IOI A;  3LU6 A;  3RZW C;  1AYF A;  2DZM A;  2CKH B;  3ALB A;  3AE9 B;  2IO3 B;  4L9Q A;  2PIA A;  4CYE A;  2WXN A;  3LB8 C;  1TKE A;  3RNF C;  3IAM 1;  3ML8 A;  4ZYS A;  2KXJ A;  4IG7 B;  3NVK A;  2Z0E B;  2ZNV B;  1TKY A;  4ZYN A;  1P7F A;  3CMM B;  4K7W A;  2I1K A;  2Z8L A;  2V1Y A;  5D94 A;  4FLH A;  4IW1 A;  2MP2 A;  4LCD E;  1UD7 A;  1OEY A;  5H8Y E;  4B0E A;  4HJG E;  1JWS D;  2X38 A;  1C76 A;  2BX8 A;  1XD3 B;  3TEX A;  2AYO B;  4K7U A;  4P1C C;  3KUC B;  1T0Y A;  2XN9 C;  3L17 A;  3QIJ A;  4NNJ B;  3H3A A;  1OQQ A;  1WE6 A;  3GB1 A;  2G9H D;  2DBW A;  5DPT A;  3WHQ A;  1H5W A;  1VZ7 A;  2DBX A;  1ESF A;  3M95 A;  4HRO A;  2PE6 B;  2WX1 A;  4RF1 A;  3A9J B;  1P98 A;  3NG0 A;  3VFK A;  3SDL C;  1WMH B;  5DPW A;  1TS2 A;  2IO0 B;  4BY9 C;  4IM2 A;  2GI9 A;  1I4Q A;  4II2 B;  2LGS A;  1KLU D;  1D6E C;  4JL9 A;  2CU3 A;  1BXT A;  4MJS B;  1MIV A;  3V61 A;  1VFI A;  2D2Q A;  3Q8A A;  3RD2 A;  3JRY A;  4MSM B;  1JAL A;  1R7S A;  1XLO A;  2QDF A;  1KXP D;  2K8C A;  2KJR A;  3OJ3 A;  4UDU C;  1I35 A;  3KUZ A;  1WX7 A;  3BY4 B;  3MHS D;  4P6V F;  4G11 A;  2RSU A;  1F1H A;  4A20 A;  3AEE B;  4DBG A;  3KH0 A;  4WWO A;  1ISN A;  4KIK A;  3A4S C;  1YX6 B;  2JXX A;  2DG5 A;  3V6C B;  1WMH A;  2D3C A;  1XQQ A;  1FXA A;  1B1Z A;  1TS3 A;  4W9E A;  2BXO A;  2PE9 A;  5GMV A;  1WY8 A;  4W4U B;  1WR1 A;  5FR6 A;  2WP9 B;  5FUO A;  1V9J A;  2ZNV C;  1EWY C;  1FXI A;  3AE3 B;  2TSS A;  2BTE A;  1OQR A;  3NZ3 A;  2IGG A;  2J7Q B;  5E6P A;  4JK4 A;  4HPL B;  3EFU A;  3W1Y A;  1WJ4 A;  3ZTD A;  2KLC A;  3ECI A;  2IO1 B;  1SB0 A;  4OR0 A;  1QT9 A;  4WWP A;  1FNW A;  2J53 A;  3RNB C;  1SIF A;  1B9R A;  1FO4 A;  1E10 A;  2FCS A;  2R2O A;  3TL5 A;  1OFF A;  3NS8 A;  2IPK D;  4BKG A;  5ID7 A;  2IDY A;  4ZHP A;  1A5R A;  1MHX A;  4HGK A;  3VUY A;  1EUV B;  1PGX A;  1MIW A;  1E7A A;  1T5X D;  1SJE D;  2MJ3 A;  3AN1 A;  4ZC6 A;  2BYV E;  2WLB A;  1FD6 A;  3VR8 B;  2LOQ A;  1E7G A;  1XCQ L;  4J2V A;  3PVL A;  3HVZ A;  2AEH A;  1YX5 B;  1K52 A;  2D3B A;  4EZK A;  1HZ5 A;  1ZUD 2;  2DBU A;  2FID A;  2KHW B;  2M1M A;  3ZO5 B;  4LNO A;  4OVZ A;  3RNC C;  4F5V A;  1JRU A;  3VQI A;  2ZJD A;  3WHR A;  3QWZ B;  2KDB A;  4OZB A;  3VH3 B;  2BXB A;  1R4M I;  3V60 A;  2BGF A;  3ZTC A;  2BWE S;  5DCN A;  2IY1 B;  2KO3 A;  1E6E B;  2K39 A;  1HK4 A;  2XEW A;  2K8H A;  1N62 A;  1NBF C;  2HJ8 A;  3QJZ A;  3PRE A;  2AL6 A;  1AWD A;  1SXT A;  3PLA A;  1WGY A;  4E71 A;  1PDX A;  4BOZ B;  3ZNZ B;  3S2A A;  3U52 E;  4N9F 4;  3ZDT A;  1E8W A;  4CHK A;  2N7D A;  2KDM A;  1GB4 A;  1K53 A;  3UF8 A;  2L00 B;  2CKX A;  5HKH A;  3DVG Y;  1JWU D;  3X23 A;  4IM0 A;  2I2Z A;  2BXI A;  1MPE A;  1FXT B;  1BUI C;  1WJ6 A;  1HQR D;  2N7E A;  4ZHO A;  2LQH A;  5J18 A;  3UI3 A;  4IDI A;  3V6E B;  4W9G A;  4KZC A;  1X1M A;  2REX A;  1E7P B;  1K8R B;  2KVR A;  4MAC A;  1ZXH A;  2LI5 A;  2BYT A;  5J17 A;  2G3Q B;  4MT5 A;  4BKS D;  1MG8 A;  4RNA A;  3GE8 C;  2XVV A;  4XYC A;  2GBJ A;  1M4V A;  4RH6 A;  3TSS A;  4L8U A;  2BXA A;  3J9C A;  4S17 A;  2VZK B;  3HK0 A;  4R3D A;  5IIU A;  4TV3 A;  2EEL A;  2G4S A;  1RFK A;  2XNA C;  4JPS A;  4ZRJ A;  4TUU A;  2K1F A;  2AQ1 B;  2OOB B;  3AXC A;  3MHS B;  3KYD D;  1RWS A;  3R3M A;  2KN4 A;  4FK5 B;  3JSV B;  4FHJ A;  4IKG A;  4M8N A;  4EEW A;  3B9M A;  4W9C A;  2GMI C;  3H6N A;  3AE4 B;  3HVD A;  4EMX A;  3K9O B;  1WZ0 A;  3Q3N C;  3P63 A;  4KSL C;  1DYQ A;  3MC9 A;  3JW0 X;  4HJK A;  1C3T A;  2MW5 A;  4HWI B;  5AUI A;  4N3Z A;  2GOW A;  2KQ7 A;  2WHI A;  2AWT A;  3PSE B;  3V62 A;  2MRP A;  1TS5 A;  4FJZ A;  2E6X A;  2KZR A;  3ABV B;  3AE5 B;  2KAC A;  2VZK D;  4GIV A;  2K3U A;  2KBZ A;  3QAR A;  4HEA 1;  2GBK A;  2HTH A;  4MEL A;  4O1N A;  4BOS C;  1V2Y A;  4ZRQ A;  3QCA A;  2E0Y A;  1WYW B;  3GS2 A;  4JGH B;  2CHZ A;  2NQO A;  1SEB D;  3Q3F A;  1DOY A;  2WXM A;  1RRB A;  2KWV B;  3N32 A;  1ET6 A;  2GBN A;  4HKZ E;  4XE0 A;  3G9K D;  1JNB A;  3ZJT A;  5AEK B;  2MBH A;  2WXI A;  4LJO B;  3DBL I;  5DPR A;  1PGB A;  4BAX A;  2RDH A;  2W3R A;  4JWU C;  4IWO A;  2Z8K A;  3AE1 B;  1QOB A;  2KJ6 A;  3EUB 2;  1MI0 A;  3KVF B;  3RUL A;  2AJE A;  1QOA A;  1J7A A;  1V81 A;  1BM0 A;  2LMC A;  3PHW B;  3E9S A;  3RI7 C;  1HK2 A;  3Q6B A;  2O6V A;  3L54 A;  2MBE A;  1HK3 A;  1I7H A;  4XC2 A;  2CJO A;  4US8 A;  1YNT E;  2QMC A;  3R7R A;  2LQI A;  1QKZ A;  4S0R A;  1L7Y A;  2KWU B;  3DHH C;  3U7Z A;  4AP4 C;  3TCA A;  1V1P B;  5EE9 A;  3VAW A;  2RR9 A;  3ZNI D;  4AUQ C;  4C31 B;  3Q14 C;  3FAH A;  4BKE A;  1KLG D;  2MJD A;  4USA A;  2WXO A;  1PQS A;  3M99 C;  1GUA B;  2G45 B;  4N0F D;  3CIR B;  2ZZP B;  3GQX A;  1GPX A;  1P3Q U;  1HE8 A;  3OAW A;  1MFW A;  2FUH B;  2O2V B;  4LNN A;  4C4V B;  1WJU A;  1YJJ A;  1E8Z A;  4JIO U;  3QA8 A;  2PLP A;  3WAL A;  2LUE A;  2D5G A;  1D4B A;  1UEL A;  1YJ1 A;  4DDI D;  3OJ4 B;  5EE0 A;  2BKR B;  4W9F A;  2WDV B;  2N1W A;  3SIV B;  3U2S C;  4NY0 A;  4ZBQ A;  3QX1 A;  2KT7 A;  2QHB A;  1WRI A;  4HCP B;  1V97 A;  2LHD A;  2LGY A;  5BO4 B;  2EMS A;  3ECP A;  2Z59 B;  4XDC A;  4G3X B;  1GNJ A;  3AB5 A;  3ETR A;  4F1S A;  1E8X A;  4A6Q A;  1NVI D;  1TTN A;  2RMM A;  3KQ4 A;  4A8X C;  3APD A;  2MJE A;  1KFY B;  5JH5 C;  3SFE B;  3B1L X;  4M0W B;  3LXF A;  1U4A A;  1Z2M A;  4EE2 A;  1SIJ A;  4HK2 A;  2XSI A;  4YXD B;  2GLS A;  1YQB A;  2V9H A;  1TY2 A;  4P16 A;  1NYR A;  1N5X A;  1YQ4 B;  1J7E A;  2G4D B;  3Q3O C;  2NR2 A;  1UBI A;  4KGS A;  1YOV B;  3GP7 A;  4TQ1 A;  3L0W B;  4FJY A;  3BII D;  4HDQ A;  1C77 A;  1QLB B;  2ZPN A;  1QZE A;  3DBL B;  2LEK A;  4LJP B;  3W5V B;  2LGI A;  2W82 A;  2IND C;  3NVV A;  2EFE A;  4HDO A;  2Y3A A;  4REZ A;  3KUD B;  4BKS A;  3AE2 B;  3QQ8 B;  2QJL A;  1C4A A;  3N3K B;  3RYT A;  1WM2 A;  1L4D B;  2WXK A;  3B0A A;  4RGM A;  1I4R A;  2YDF A;  2OED A;  4M01 A;  1JRO A;  3M62 B;  4AOF A;  4G03 A;  4URK A;  1J7B A;  4RGN A;  1BT0 A;  4KSK C;  2IGH A;  2BXE A;  4TQ0 A;  4M00 A;  2MA9 B;  2ACZ B;  3H37 A;  3AE6 B;  2BXH A;  5IO9 A;  3ZQ4 A;  3PZ7 A;  2JWU A;  3ZGZ A;  3V08 A;  4ZRI A;  3ZRF A;  1WXS A;  1XXG A;  1FOU A;  1FNV A;  4L23 A;  4D7X A;  1WSP A;  2JZP A;  2BKF A;  1JWA D;  2KLG A;  1VDV A;  1FPY A;  5BYQ A;  3P4S B;  2NTS A;  2O6V D;  2WXQ A;  4K81 A;  3PZD A;  3HHM A;  1TT5 B;  1NEN B;  4RGO S;  3AE7 B;  4G01 A;  5GXG B;  2DHZ A;  3NS1 A;  4EZL A;  4GGQ A;  3PRP B;  2WWZ A;  1C78 A;  3DHI C;  4HCN B;  2JU6 X;  3BK1 A;  1WZ3 A;  4FBJ B;  2ZEQ A;  3GQU A;  3AU5 A;  2K22 A;  2K0P A;  1WI0 A;  4FAD A;  3QAQ A;  4KZ0 A;  1R4N I;  2C9W B;  2UWQ A;  1KRH A;  4EFO A;  5MPO A;  3BVG A;  2LGX A;  2LZ6 A;  3LU8 A;  3HRD D;  3NVI A;  3ZDM C;  1XF5 L;  1TBE A;  2KWC A;  4WJP A;  3V03 A;  1SE9 A;  3H9D A;  1CZP A;  1PGA A;  1TGZ B;  2HDE A;  1L0X B;  1WR6 E;  3VUW A;  4MGK E;  1YIW A;  2PTL A;  1WWT A;  2CR5 A;  1L0V B;  4MH0 E;  2O2V A;  2FUG 1;  3VRB B;  3N1Z C;  2QSD A;  4MM3 B;  4XX5 A;  1FRD A;  3Q8F A;  1S3S G;  1FFU A;  4W9J A;  1E9M A;  3GA9 L;  4RMA A;  3FNM A;  2KFK B;  3IT6 B;  1VD2 A;  3RMK C;  3GE3 C;  2KN5 A;  4OZA A;  1PUT A;  3R2T A;  5KHQ A;  2Z8J A;  4N59 A;  2Y5C A;  2VRR B;  1PFD A;  5CHW A;  5AZH A;  1HTQ A;  3VHT C;  1EU3 A;  4II3 B;  4NJ7 A;  1C9F A;  3LU7 A;  2V3P A;  2CU1 A;  2KWD A;  3EA6 A;  3P4P B;  3VTV A;  5L95 C;  2DYO A;  3LYY A;  1NI3 A;  3AU4 A;  3EFC A;  3ZJU A;  1UNS A;  4OT2 A;  1FIQ A;  3DBR I;  5JZE B;  2D07 B;  4GDL B;  1Q0W B;  4MH8 A;  1T0R C;  3Q3M C;  2JX5 A;  2MP2 B;  3L13 A;  1SF0 A;  2G1E A;  3I9V 1;  2BVC A;  3PHX B;  4Z9O A;  1E5W A;  2ZW1 A;  3MFG A;  3RN9 C;  1AN8 A;  1I4H A;  1ZXI A;  2JF5 A;  3VDZ A;  1ACC A;  2BS4 B;  4ZCG A;  3W9C B;  4EZJ A;  2JUO A;  1Y56 A;  3IXS A;  3T9L A;  3BZD B;  4I6L B;  4ASW C;  3TIX A;  3RFZ B;  3URY A;  1FFV A;  2QIL A;  4EKU A;  1FRR A;  1UBQ A;  1MJD A;  4LLG M;  3PT2 B;  4GDK B;  2KWF A;  2KFJ A;  3PRM B;  1MHH E;  2LAS A;  4ZRP A;  3WA0 A;  3M3J A;  1VRA B;  1FEH A;  2O6V B;  3WHS A;  2BWF A;  2N9L A;  2XVQ A;  4KV2 A;  1K51 A;  5T8I A;  2KNB A;  3ZRC A;  4OTU A;  4LNI A;  2KD0 A;  4I6N B;  4ANU A;  2KC2 A;  1C4P A;  2KJH B;  1LOT A;  3AEB B;  1MG4 A;  3DBH B;  4NAW A;  4MEM A;  3V09 A;  2WQY B;  2C7N B;  2YEP B;  4GB9 A;  2L3Z A;  1GG3 A;  3AED B;  2K6Q A;  5IKC M;  2INP E;  2JZ3 B;  2BF8 B;  4LUH A;  3DPD A;  2ICI A;  1I4G A;  1N61 A;  3NUH B;  1P9D U;  3P4R B;  3BYY B;  2MCN B;  4LNK A;  2JUH A;  2NMQ A;  4ANX A;  3AM9 A;  3BVM A;  2XK5 A;  2LUM A;  2WDR B;  1FCL A;  3QK0 A;  1D5M C;  2ONQ A;  5EDS A;  4HLE A;  5D7G A;  1L6U A;  1WXQ A;  4ITK A;  3H7P B;  2DAF A;  2MH7 A;  2WXL A;  3WAM A;  1VZS A;  4MGZ E;  4YT0 B;  1RFA A;  1MIY A;  3FWC C;  2MX2 A;  5BMH A;  4AJW A;  4N0U D;  4RFB A;  2J0J A;  4G04 A;  2L83 A;  3K9P B;  3IVF A;  2V4L A;  4WWN A;  2WU5 B;  3FIL A;  4FUL A;  2XBB C;  3DWG C;  1QOG A;  2BXL A;  5LXI B;  5I4D A;  1E90 A;  3CST A;  4PT5 A;  3RUI B;  2JVC A;  2B76 B;  3PS6 A;  2LXT A;  3QC8 B;  2PJH A;  4KVG B;  1GNI A;  5G5H A;  3UIN B;  2XK5 B;  5G5G A;  3E56 A;  1E7B A;  4YTN B;  4K1R B;  1HZ6 A;  5BYS A;  2GBM A;  3A33 B;  4K3C A;  5LLI A;  4B6W A;  1J8C A;  3H7P A;  1N6Z A;  1KLV A;  1KTK A;  2KDE B;  3VXW A;  2CHW A;  3NZU A;  4P7I A;  5CX3 A;  1N5W A;  3HM6 X;  5IIH A;  4OVU A;  4ARI A;  3NZS A;  2FAZ A;  2LHE A;  2FIF A;  3AV8 A;  2WDT B;  2V36 A;  2N0S B;  2N7J A;  2XVU A;  5KHO A;  1JCK B;  4LB2 A;  3V05 A;  2E3T A;  3MHZ A;  2CJN A;  3Q69 A;  1QQR A;  2IJ0 A;  5DPS A;  4HVB A;  2W3S A;  2GB1 A;  5DBY A;  1T0Q C;  1WM3 A;  2J52 A;  2MQJ A;  2AX5 A;  2ON8 A;  2Q5W D;  3MJW A;  4HPP A;  2J0M A;  1HK1 A;  1JRP A;  1F0Z A;  5IA7 A;  5HI1 A;  1YN4 A;  1UZX B;  2N4F A;  1LM8 B;  1XLN A;  4JLC A;  2XW0 A;  5IAA C;  2KQS A;  3RNE C;  2KMA A;  3BIN A;  3IG3 A;  3I57 A;  4Z69 A;  1MUH A;  1GC6 A;  2L7R A;  2HTM E;  1BML C;  3ZVV A;  2K9X A;  1LO5 D;  4F5S A;  3B2G A;  2Y5P A;  2MSE D;  2DZI A;  5AZF A;  2UYZ B;  2EKI A;  3T3O A;  3TDL A;  4G50 A;  3I3T B;  2VH2 A;  1E7U A;  2LVP A;  5L83 A;  4RM9 A;  2HJ1 A;  1E0Z A;  4PK1 A;  3SD5 A;  2KVZ A;  1WJN A;  1UH6 A;  2QC8 A;  2NVU I;  3P2B A;  1CJE A;  3B9J A;  4KDI C;  3NVW A;  2LRU A;  2PKO A;  1ZDV A;  1T0S C;  2R61 A;  4WJN A;  5D3D A;  3LJ3 A;  3R2I A;  4EOY A;  2BXK A;  4RF0 A;  3VRA B;  3ICX A;  2N9X A;  2Y5B B;  4PS8 A;  1DGJ A;  3B2F A;  2WXG A;  3KWV A;  4IUM B;  1J19 A;  1RYJ A;  2K8B A;  1V1O A;  4LDT D;  4KX6 B;  4BFR A;  4GG2 A;  3W1S A;  3NOB A;  4NAW B;  3JSV A;  4AS1 A;  3NVY A;  2A5U A;  4GU2 A;  3Q8B A;  2BXF A;  4E74 A;  1D5X C;  4D2K A;  3SFD B;  3RNA C;  3QHT A;  1TZ1 A;  1WGK A;  3UIV A;  4DK5 A;  3GZN I;  1OGW A;  2V0G A;  1OQY A;  5BMG A;  5ID9 A;  1VZ6 A;  2M17 A;  3NJT A;  1RLF A;  1XLP A;  2GUT A;  1LNS A;  4YSZ B;  2WXH A;  2YLM A;  3MTN B;  5IFO A;  3CWI A;  4EUT A;  2WU2 B;  4KDL B;  2V3N A;  2EMT A;  4GSW A;  4ARC A;  5AZG A;  2N9E B;  2C7M B;  3KIK A;  4ZOH C;  3N30 A;  5D6J B;  3KJL A;  4MGY E;  3A4R A;  3N1Y C;  2M4N A;  4A3O A;  4AJY B;  3PRZ A;  2NBU A;  3T3N A;  4DXA B;  5D3I B;  2CHX A;  2NBW B;  3C8Y A;  2ASQ A;  3ZNG C;  5EE3 A;  3A9K B;  1WXV A;  3PGE A;  3UQA A;  2Z8I A;  4KIK B;  3SQJ A;  2Z0D B;  3WIM A;  2M19 A;  3H1U A;  1IP9 A;  2H89 B;  1ZKH A;  4W9I A;  2WNM A;  1L2N A;  4F5U A;  1QOF A;  4PS3 A;  5G55 A;  3N9Y C;  4KGR A;  3C19 A;  2IYD B;  1E7I A;  4A90 A;  3KYC D;  4Q2J A;  3L10 B;  2OZB B;  5LXH A;  2N1V A;  2L8J A;  1ZP0 B;  3SIU B;  3WAP A;  4US9 A;  3UGB B;  4KKI A;  4F7Z A;  1R4M B;  2MBQ A;  4KKJ A;  1EF1 A;  1TXU A;  1GOZ A;  2JZZ A;  3KW5 B;  4HKQ A;  1P0R A;  1E78 A;  1C4C A;  2DYB A;  2VDB A;  2GRI A;  4PYU A;  3DCG A;  2I30 A;  5CTR C;  5HG2 A;  2WXF A;  3ZXR A;  3DVN V;  3PPA A;  3VTW A;  2QIE B;  4N6E B;  4TMA B;  1WGR A;  2L0T A;  2VUF A;  4K71 A;  5E6J A;  4B9K A;  3R7Q A;  3AI5 A;  4LB9 A;  2LXC A;  3I5J C;  3JQZ A;  1V1P A;  4ZBR A;  1S1Q B;  3WAN A;  2WDQ B;  2MEK A;  3Q2A C;  1WXM A;  1HEZ E;  3PZ8 A;  4C00 A;  2BS2 B;  2ZCC A;  3P4Q B;  4BBN C;  1TJE A;  4YL8 A;  2RPV A;  4IC7 B;  2DAJ A;  2LFI A;  1L5P A;  3U30 A;  1WX8 A;  2K25 A;  4K2C A;  1ZOY B;  4OZC A;  2KX0 A;  2NS5 A;  2K5P A;  2OT3 A;  4FHK A;  1E7E A;  4AWJ A;  2RGF A;  3FWB C;  2M0X A;  4F8C B;  4LDT B;  5FK9 C;  2RPQ A;  1IGD A;  4W9D A;  4NPN A;  2EFC A;  2SEB D;  3JYU A;  2VH1 A;  1QF6 A;  4L1B A;  3A73 A;  5JHA A;  2OHF A;  2MHJ A;  4YTM B;  2I38 A;  4MGI E;  5TSS A;  1O9X A;  4TSS A;  4NJC A;  2AL3 A;  2DZJ A;  2M56 B;  3MC8 A;  3BYT B;  1WIA A;  2HD5 B;  4GOC A;  3DBS A;  5E6N A;  1HA5 A;  1SSN A;  3I63 C;  1TYG B;  1FNU A;  3ZXV A;  3ONS A;  1SE3 A;  1V6E A;  4BBN F;  1TIF A;  4S1Y A;  5IJF A;  1WGG A;  1VCB A;  2LJ5 A;  5C2T B;  2OJW A;  4MJS A;  1XEE A;  4A55 A;  4IW2 A;  1WYG A;  4N58 A;  4BZA A;  3IT4 B;  3EHV A;  5G2N A;  3DDC B;  3OWE B;  2NTT A;  2LVO A;  3R8B A;  1UGJ A;  2AQ3 B;  4FN2 A;  1JML A;  3ZJV A;  1XO3 A;  1SE2 A;  3EGR A;  1F9J A;  1XLQ A;  3PLU A;  2IO2 B;  1SB3 C; 
#chains in the Genus database with same CATH homology
 4WIP A;  5BYR A;  4OW0 A;  4LUF A;  2L05 A;  1C79 A;  1JWB D;  2PMV A;  2JRI B;  4GXB A;  5LNK 1;  1J0G A;  2W55 A;  2VUE A;  1G6J A;  3M63 B;  4GN1 A;  1WF9 A;  2N9P C;  1EM7 A;  2FBW B;  2L32 A;  5GIN A;  2KMC A;  3AE8 B;  2H88 B;  3CX9 A;  3CSF A;  4IWQ A;  1IGC A;  1I4X A;  1D3Z A;  3TEW A;  3SHQ A;  2JQR B;  2QEJ C;  5FKA C;  2KQ4 X;  1ET9 A;  2FCQ A;  2JYE A;  5J2R A;  4BVU C;  3MP9 A;  3APC A;  2D3G A;  3W5U B;  2KAN A;  1VJK A;  3EEC A;  2FNJ B;  2LWP A;  1JW9 D;  1VLB A;  3U8Z A;  1XT9 B;  3VVW B;  3ZYY X;  2D11 A;  2R2Q A;  3NVM A;  3SEB A;  1KM7 A;  5C1Z A;  1K50 A;  1HK5 A;  2LRW A;  1KW2 A;  4RGT A;  1OEY J;  1HXY D;  2BYF A;  2NBV B;  2KDI A;  2EFD A;  1AAR A;  1DOI A;  2FCN A;  1TS4 A;  3NVZ A;  4PO0 A;  4JQW C;  4YSX B;  1J7C A;  2EFH A;  2DX5 B;  1V49 A;  4WJQ A;  2I2Y A;  4GDX A;  3W1S C;  3V3X A;  4M70 B;  1QIL A;  2JXT A;  1UWM A;  4GMV A;  2OJR A;  2XMO A;  1LFD A;  2PW9 A;  1WRD B;  1E8Y A;  3AEF B;  3NRZ A;  4ZDV A;  1F2R I;  1MA9 A;  1Q1O A;  2W54 A;  2L76 A;  2QM6 A;  1E7C A;  1ZDX A;  1N5U A;  4NAM A;  1KJT A;  4MBE C;  2EKE C;  3UIO B;  3ZNH B;  4ICU A;  3AH7 A;  5C23 A;  3A1Q B;  2BT6 A;  4L2Y A;  4XZ4 A;  4M8M A;  4YWG G;  3ZKJ C;  4E99 A;  4LTU A;  3R66 C;  2PEA A;  4IW0 A;  1M94 A;  2WXP A;  1IYF A;  2KDF B;  3PTF C;  3Q3J A;  1E7F A;  3CF6 E;  1HA2 A;  4HGM B;  2NPT A;  1NEK B;  1YMH E;  3SR6 A;  3DOW A;  5GHK A;  1JWM D;  3B08 A;  1YD8 U;  2YVC A;  2KFK A;  1TKG A;  2L52 A;  3FIL B;  3U4E G;  3LDZ E;  1H4R A;  2WX0 A;  1EWC A;  2BXG A;  3KLS X;  3RPF C;  4FXC A;  1Q5W B;  4NZL B;  3HM3 A;  5H92 C;  2BXC A;  4LA0 A;  4FIP B;  1EF5 A;  4FJC B;  3Q8C A;  1TZO A;  2DLB A;  3A75 A;  4WAF A;  3L16 A;  2JPH A;  3IBE A;  1UUP A;  4CO7 A;  2A4Z A;  2KAJ A;  3U7D A;  1OTR B;  4GDL A;  1ENF A;  2KMM A;  3KWL A;  4OHJ A;  4DXF A;  4NJ6 A;  2L0F A;  4TKN A;  2I1J A;  2JYT A;  1VR9 A;  4YSY B;  2IY0 B;  3WAO A;  3RZF A;  4LK0 M;  5HFY A;  5DQF A;  1WX9 A;  3H7S A;  1P7E A;  1VZ8 A;  4H2A A;  3O65 B;  2LVQ A;  5CHV C;  1MVK A;  2V4I B;  1V8C A;  2JSV X;  2JWZ A;  2KTR A;  2MBO A;  2WXR A;  3Q8E A;  4F5T A;  1XCT L;  5HOZ A;  5IIX A;  2KC1 A;  1WFY A;  4IOI E;  4WWM A;  1GNU A;  1I42 A;  2XVW A;  1Q10 A;  3BWU D;  3UQB A;  1P1A A;  5HHD G;  1AO6 A;  3NY5 A;  1Y8R C;  1FCC C;  4RM8 A;  3AMZ A;  3PLV A;  4C7Z A;  4WUR A;  2JRH A;  3DBH I;  5BPK A;  2BXN A;  4C56 C;  4PYZ A;  4KGT A;  4B0M A;  4MSQ B;  4E3C A;  4J3O D;  3AEA B;  4DHZ B;  4IM3 A;  1T6B X;  1J78 A;  3ML9 A;  4WJO A;  1TF0 A;  3P42 A;  4DHZ E;  1GC7 A;  5GIP A;  5JHB A;  3TJP A;  1ZGU B;  3T8M A;  2KKC A;  3TEZ A;  1H8C A;  2NCN A;  2C60 A;  5B5T A;  2IBI B;  2K6D B;  3AEG B;  4HXD A;  4G0N B;  5CHF A;  2YEP F;  4DQO C;  3IHP C;  2WYQ A;  3MHH B;  2BPS A;  3GOE A;  2QHO A;  3IAS 1;  4I6P A;  2MLB A;  2BB6 A;  3RT3 B;  2RDG A;  1CMX B;  4A3P A;  1F2R C;  1ZE3 D;  2AQ2 B;  1TY0 A;  2L1A A;  1LXD A;  1ZW7 A;  1AW7 A;  1SBB B;  2BB5 A;  4HRS A;  1STE A;  3H8H A;  4BKT A;  3A1Q A;  1V5O A;  1YN5 A;  3IFW B;  3FC4 A;  5EE1 A;  1JQ4 A;  4AQ7 A;  1IPG A;  4DHJ D;  4ZUX V;  1SE4 A;  3MC0 B;  2DWQ A;  2WXJ A;  5D2M B;  1A70 A;  3B9L A;  2DYM A;  4FA6 A;  4A9A A;  4XWW A;  2MBB B;  3ZLZ A;  5GIO A;  2JT4 B;  4ANV A;  4J6I A;  2QMT A;  4XDD A;  2KTF A;  3VR9 B;  4W9H A;  4DHX B;  1KF6 B;  2LJI A;  1NDD A;  2D10 A;  4M0W A;  2GBR A;  3DVN U;  1GB1 A;  3BK2 A;  2NNW A;  4NQK E;  2BXM A;  4WAA A;  2BS3 B;  2W9N A;  4MDK E;  3TBL D;  1WGH A;  4C7Y A;  4JE3 B;  2RD0 A;  3VH4 B;  4ANW A;  1BJ5 A;  1N60 A;  4PS7 A;  4C80 A;  4GLS C;  2ZW0 A;  2KOX A;  1EU4 A;  2LD9 A;  1H9Z A;  4CQN A;  4DDG D;  3A9K A;  2NPT B;  4WH4 A;  4DHJ B;  2BBC A;  3MJ5 A;  1I4P A;  3OLM D;  1WGD A;  3VUX A;  1GAQ B;  3APF A;  2KK8 A;  3P1M A;  2PPH A;  1RM6 C;  3L08 A;  1C1Y B;  2HE7 A;  2PVO D;  5IJE A;  4RCO A;  3ZW3 A;  1YJI A;  1IUE A;  4NQL B;  2ZPY A;  3TEY A;  4ICV A;  2ZCB A;  1IBX B;  3PV1 A;  2BXD A;  1SJH D;  3EC8 A;  2BW2 A;  2E0X A;  1T3Q A;  2N9K A;  3JVZ X;  2DEN B;  1E7V A;  4OVV A;  2WS3 B;  1SGH A;  4ZBK A;  2KTR B;  2J42 A;  2IGD A;  2ZVN A;  3A9J A;  4K7S A;  1EO6 A;  1IJG A;  5C3J B;  2BXP A;  3RCZ A;  4JX1 C;  2SAK A;  1KH0 A;  4OTT A;  2CS4 A;  3VTU A;  1L0Y B;  2INN E;  1ROE A;  3D32 A;  2DBY A;  2IZV B;  5FR3 A;  5TR5 A;  1D5Z C;  1FMA D;  1NT2 B;  2ROH A;  1IBX A;  1PYW D;  2JY6 A;  2MWS B;  3BVZ A;  5JXV A;  2KX3 A;  3O13 A;  2LXA A;  5BMI A;  2DZK A;  2C7H A;  3ZIM A;  1NI2 A;  4IWP A;  2LGD A;  3X0W A;  1FM0 D;  5AUK A;  1CK1 A;  1GJZ A;  2PVG C;  3TUO A;  2J0K A;  1E7H A;  1N63 A;  2V3S A;  4XWT A;  4GDK A;  4JWS C;  1YQ3 B;  4WQO B;  1CQV A;  1UWX A;  2FE8 A;  2C5L C;  2ZVO A;  3NMU A;  1YN3 A;  2M0A A;  3PO0 A;  1RAX A;  5E6O A;  3DWM A;  4W9K A;  3NHE B;  4HPM B;  3W2D A;  1LQB A;  4FJV B;  4L9K A;  1V86 A;  3TMP B;  1F77 A;  1Z5S B;  3ENE A;  1NYQ A;  1WH3 A;  3DQV A;  2FCM A;  3C0R B;  1ZPS A;  2J4X A;  3L4P A;  1UOR A;  1WE7 A;  4DXG A;  2BYE A;  4YTP B;  4ZRK A;  3ZUN A;  3HIZ A;  3UIP B;  4WQM A;  2XW1 A;  4X57 B;  1V80 A;  1KOT A;  4B95 A;  1DOX A;  1L4Z B;  1V5T A;  3WCQ A;  3DVG X;  1L6V A;  3HUI A;  4MM3 A;  2BXQ A;  1BKE A;  5IJ5 A;  4W9L A;  4WA6 B;  3AEC B;  3SU8 X;  1WXA A;  4DWF A;  2M8S A;  2B3A A;  3AUL A;  1UGM A;  3LU6 A;  3RZW C;  1AYF A;  2DZM A;  2CKH B;  3ALB A;  3AE9 B;  2IO3 B;  4L9Q A;  4CYE A;  2PIA A;  2WXN A;  3LB8 C;  1TKE A;  3IAM 1;  3ML8 A;  4ZYS A;  2KXJ A;  4IG7 B;  3NVK A;  2Z0E B;  2ZNV B;  4ZYN A;  1TKY A;  1P7F A;  3CMM B;  4K7W A;  2I1K A;  2Z8L A;  2V1Y A;  5D94 A;  4FLH A;  4IW1 A;  2MP2 A;  4LCD E;  1UD7 A;  1OEY A;  5H8Y E;  4B0E A;  4HJG E;  1JWS D;  2X38 A;  1C76 A;  2BX8 A;  1XD3 B;  3TEX A;  2AYO B;  4K7U A;  3KUC B;  1T0Y A;  3L17 A;  3QIJ A;  2XN9 C;  4NNJ B;  3H3A A;  1OQQ A;  1WE6 A;  3GB1 A;  2G9H D;  2DBW A;  5DPT A;  3WHQ A;  1H5W A;  1VZ7 A;  2DBX A;  1ESF A;  3M95 A;  4HRO A;  2PE6 B;  2WX1 A;  4RF1 A;  3A9J B;  1P98 A;  3VFK A;  3SDL C;  1WMH B;  5DPW A;  1TS2 A;  2IO0 B;  4BY9 C;  4IM2 A;  2GI9 A;  1I4Q A;  4II2 B;  1KLU D;  1D6E C;  4JL9 A;  2CU3 A;  1BXT A;  4MJS B;  1MIV A;  3V61 A;  1VFI A;  2D2Q A;  3Q8A A;  3RD2 A;  3JRY A;  4MSM B;  1JAL A;  1R7S A;  1XLO A;  1KXP D;  2K8C A;  2KJR A;  3OJ3 A;  4UDU C;  1I35 A;  3KUZ A;  1WX7 A;  3BY4 B;  3MHS D;  4P6V F;  4G11 A;  2RSU A;  4A20 A;  3AEE B;  4DBG A;  3KH0 A;  4WWO A;  1ISN A;  4KIK A;  2JXX A;  1YX6 B;  3A4S C;  2DG5 A;  3V6C B;  1WMH A;  1XQQ A;  1FXA A;  1B1Z A;  1TS3 A;  4W9E A;  2BXO A;  2PE9 A;  5GMV A;  1WY8 A;  4W4U B;  1WR1 A;  5FR6 A;  2WP9 B;  5FUO A;  1V9J A;  2ZNV C;  1EWY C;  1FXI A;  3AE3 B;  2TSS A;  2BTE A;  1OQR A;  3NZ3 A;  2IGG A;  2J7Q B;  5E6P A;  4JK4 A;  4HPL B;  3EFU A;  3W1Y A;  1WJ4 A;  3ZTD A;  2KLC A;  3ECI A;  2IO1 B;  4OR0 A;  1QT9 A;  4WWP A;  1FNW A;  2J53 A;  1B9R A;  1SIF A;  1FO4 A;  1E10 A;  2FCS A;  2R2O A;  3TL5 A;  1OFF A;  3NS8 A;  4BKG A;  2IPK D;  5ID7 A;  2IDY A;  4ZHP A;  1A5R A;  1MHX A;  4HGK A;  3VUY A;  1EUV B;  1PGX A;  1MIW A;  1T5X D;  1E7A A;  1SJE D;  2MJ3 A;  3AN1 A;  4ZC6 A;  2BYV E;  2WLB A;  1FD6 A;  3VR8 B;  2LOQ A;  1XCQ L;  1E7G A;  4J2V A;  3PVL A;  3HVZ A;  2AEH A;  1YX5 B;  1K52 A;  4EZK A;  1HZ5 A;  1ZUD 2;  2DBU A;  2FID A;  2KHW B;  2M1M A;  3ZO5 B;  4OVZ A;  4F5V A;  1JRU A;  3VQI A;  2ZJD A;  3WHR A;  3QWZ B;  2KDB A;  4OZB A;  3VH3 B;  2BXB A;  1R4M I;  3V60 A;  2BGF A;  3ZTC A;  2BWE S;  5DCN A;  2IY1 B;  2KO3 A;  1E6E B;  2K39 A;  1HK4 A;  2XEW A;  2K8H A;  1N62 A;  1NBF C;  2HJ8 A;  3QJZ A;  3PRE A;  2AL6 A;  1AWD A;  1SXT A;  3PLA A;  1WGY A;  4E71 A;  1PDX A;  4BOZ B;  3ZNZ B;  3S2A A;  3U52 E;  4N9F 4;  3ZDT A;  1E8W A;  4CHK A;  2N7D A;  2KDM A;  1GB4 A;  1K53 A;  3UF8 A;  2L00 B;  2CKX A;  5HKH A;  3DVG Y;  3X23 A;  1JWU D;  4IM0 A;  2I2Z A;  2BXI A;  1MPE A;  1FXT B;  1WJ6 A;  1BUI C;  1HQR D;  2N7E A;  4ZHO A;  5J18 A;  3UI3 A;  4IDI A;  3V6E B;  4W9G A;  4KZC A;  1X1M A;  2REX A;  1E7P B;  1K8R B;  2KVR A;  4MAC A;  1ZXH A;  2LI5 A;  2BYT A;  5J17 A;  2G3Q B;  4BKS D;  4MT5 A;  1MG8 A;  4RNA A;  2XVV A;  2GBJ A;  1M4V A;  4RH6 A;  3TSS A;  4L8U A;  2BXA A;  3J9C A;  2VZK B;  3HK0 A;  4R3D A;  5IIU A;  4TV3 A;  2EEL A;  2G4S A;  1RFK A;  2XNA C;  4JPS A;  4ZRJ A;  4TUU A;  2K1F A;  2AQ1 B;  2OOB B;  3AXC A;  3MHS B;  3KYD D;  1RWS A;  3R3M A;  2KN4 A;  4FK5 B;  3JSV B;  4FHJ A;  4M8N A;  4IKG A;  4EEW A;  3B9M A;  4W9C A;  2GMI C;  3H6N A;  3AE4 B;  3HVD A;  4EMX A;  3K9O B;  1WZ0 A;  3P63 A;  4KSL C;  1DYQ A;  3JW0 X;  4HJK A;  1C3T A;  2MW5 A;  4HWI B;  5AUI A;  4N3Z A;  2GOW A;  2KQ7 A;  2AWT A;  3PSE B;  3V62 A;  2MRP A;  1TS5 A;  4FJZ A;  2E6X A;  2KZR A;  3ABV B;  3AE5 B;  2KAC A;  2VZK D;  4GIV A;  2K3U A;  2KBZ A;  3QAR A;  4HEA 1;  2GBK A;  2HTH A;  4MEL A;  4BOS C;  4O1N A;  1V2Y A;  4ZRQ A;  3QCA A;  2E0Y A;  1WYW B;  3GS2 A;  4JGH B;  2CHZ A;  2NQO A;  1SEB D;  3Q3F A;  1DOY A;  2WXM A;  1RRB A;  2KWV B;  3N32 A;  1ET6 A;  2GBN A;  4HKZ E;  4XE0 A;  3G9K D;  1JNB A;  3ZJT A;  5AEK B;  2MBH A;  2WXI A;  4LJO B;  3DBL I;  5DPR A;  1PGB A;  2RDH A;  2W3R A;  4JWU C;  4IWO A;  2Z8K A;  3AE1 B;  1QOB A;  2KJ6 A;  3EUB 2;  1MI0 A;  3KVF B;  3RUL A;  2AJE A;  1QOA A;  1V81 A;  1J7A A;  1BM0 A;  2LMC A;  3PHW B;  3E9S A;  1HK2 A;  2O6V A;  3L54 A;  2MBE A;  1HK3 A;  1I7H A;  4XC2 A;  2CJO A;  4US8 A;  1YNT E;  2QMC A;  3R7R A;  1QKZ A;  1L7Y A;  2KWU B;  3U7Z A;  4AP4 C;  3TCA A;  1V1P B;  5EE9 A;  3VAW A;  2RR9 A;  3ZNI D;  4AUQ C;  4C31 B;  3FAH A;  4BKE A;  1KLG D;  2MJD A;  4USA A;  2WXO A;  1PQS A;  3M99 C;  1GUA B;  2G45 B;  4N0F D;  3CIR B;  2ZZP B;  3GQX A;  1GPX A;  1P3Q U;  1HE8 A;  3OAW A;  2FUH B;  2O2V B;  1WJU A;  1YJJ A;  1E8Z A;  4JIO U;  3QA8 A;  3WAL A;  2PLP A;  2LUE A;  2D5G A;  1D4B A;  1UEL A;  1YJ1 A;  4DDI D;  3OJ4 B;  5EE0 A;  2BKR B;  4W9F A;  2WDV B;  2N1W A;  3SIV B;  3U2S C;  4NY0 A;  4ZBQ A;  3QX1 A;  2QHB A;  1WRI A;  4HCP B;  1V97 A;  2LHD A;  2LGY A;  5BO4 B;  2EMS A;  2Z59 B;  4XDC A;  4G3X B;  1GNJ A;  3AB5 A;  3ETR A;  4F1S A;  1E8X A;  4A6Q A;  1NVI D;  1TTN A;  2RMM A;  3KQ4 A;  4A8X C;  3APD A;  2MJE A;  1KFY B;  5JH5 C;  3SFE B;  3B1L X;  4M0W B;  3LXF A;  1U4A A;  1Z2M A;  4EE2 A;  1SIJ A;  4HK2 A;  2XSI A;  4YXD B;  1YQB A;  1TY2 A;  4P16 A;  1NYR A;  1N5X A;  1YQ4 B;  1J7E A;  2G4D B;  2NR2 A;  1UBI A;  4KGS A;  3GP7 A;  4TQ1 A;  3L0W B;  4FJY A;  4HDQ A;  3BII D;  1C77 A;  1QLB B;  2ZPN A;  1QZE A;  2LEK A;  4LJP B;  3W5V B;  2LGI A;  2W82 A;  3NVV A;  2EFE A;  4HDO A;  2Y3A A;  4REZ A;  3KUD B;  4BKS A;  3AE2 B;  3QQ8 B;  2QJL A;  1C4A A;  3N3K B;  3RYT A;  1WM2 A;  1L4D B;  2WXK A;  3B0A A;  4RGM A;  1I4R A;  2YDF A;  2OED A;  1JRO A;  3M62 B;  4AOF A;  4G03 A;  4URK A;  1J7B A;  4RGN A;  1BT0 A;  4KSK C;  2IGH A;  2BXE A;  4TQ0 A;  2MA9 B;  2ACZ B;  3H37 A;  3AE6 B;  2BXH A;  3ZQ4 A;  3PZ7 A;  2JWU A;  3ZGZ A;  3V08 A;  4ZRI A;  3ZRF A;  1WXS A;  1XXG A;  1FOU A;  1FNV A;  4L23 A;  1WSP A;  2JZP A;  2BKF A;  1JWA D;  2KLG A;  1VDV A;  5BYQ A;  3P4S B;  2NTS A;  2O6V D;  2WXQ A;  4K81 A;  3PZD A;  3HHM A;  1NEN B;  4RGO S;  3AE7 B;  4G01 A;  5GXG B;  2DHZ A;  3NS1 A;  4EZL A;  4GGQ A;  3PRP B;  2WWZ A;  1C78 A;  4HCN B;  2JU6 X;  3BK1 A;  1WZ3 A;  4FBJ B;  2ZEQ A;  3GQU A;  3AU5 A;  2K22 A;  2K0P A;  1WI0 A;  4FAD A;  3QAQ A;  4KZ0 A;  1R4N I;  2C9W B;  2UWQ A;  1KRH A;  4EFO A;  5MPO A;  3BVG A;  2LGX A;  2LZ6 A;  3LU8 A;  3HRD D;  3NVI A;  3ZDM C;  1XF5 L;  1TBE A;  2KWC A;  4WJP A;  3V03 A;  1SE9 A;  3H9D A;  1CZP A;  1PGA A;  1TGZ B;  2HDE A;  1L0X B;  1WR6 E;  3VUW A;  4MGK E;  1YIW A;  2PTL A;  1WWT A;  2CR5 A;  4MH0 E;  1L0V B;  2O2V A;  2FUG 1;  3VRB B;  2QSD A;  4MM3 B;  4XX5 A;  1FRD A;  3Q8F A;  1S3S G;  1FFU A;  4W9J A;  1E9M A;  3GA9 L;  4RMA A;  3FNM A;  2KFK B;  3IT6 B;  1VD2 A;  2KN5 A;  4OZA A;  1PUT A;  3R2T A;  5KHQ A;  2Z8J A;  4N59 A;  2Y5C A;  2VRR B;  1PFD A;  5CHW A;  5AZH A;  3VHT C;  4II3 B;  1EU3 A;  4NJ7 A;  1C9F A;  3LU7 A;  2V3P A;  2CU1 A;  2KWD A;  3EA6 A;  3P4P B;  3VTV A;  5L95 C;  2DYO A;  3LYY A;  1NI3 A;  3AU4 A;  3ZJU A;  1UNS A;  4OT2 A;  1FIQ A;  3DBR I;  5JZE B;  2D07 B;  4GDL B;  1Q0W B;  4MH8 A;  2JX5 A;  2MP2 B;  3L13 A;  1SF0 A;  2G1E A;  3I9V 1;  3PHX B;  4Z9O A;  1E5W A;  2ZW1 A;  3MFG A;  1AN8 A;  1I4H A;  1ZXI A;  2JF5 A;  3VDZ A;  1ACC A;  2BS4 B;  4ZCG A;  3W9C B;  4EZJ A;  2JUO A;  1Y56 A;  3T9L A;  4ASW C;  3BZD B;  4I6L B;  3IXS A;  3TIX A;  3RFZ B;  3URY A;  1FFV A;  2QIL A;  4EKU A;  1FRR A;  1UBQ A;  4LLG M;  3PT2 B;  4GDK B;  2KFJ A;  3PRM B;  1MHH E;  2LAS A;  4ZRP A;  3WA0 A;  3M3J A;  1VRA B;  2O6V B;  1FEH A;  3WHS A;  2BWF A;  2N9L A;  2XVQ A;  4KV2 A;  1K51 A;  5T8I A;  2KNB A;  3ZRC A;  4OTU A;  2KD0 A;  4I6N B;  4ANU A;  2KC2 A;  1C4P A;  2KJH B;  1LOT A;  3AEB B;  4NAW A;  4MEM A;  3V09 A;  2WQY B;  2C7N B;  4GB9 A;  2YEP B;  2L3Z A;  1GG3 A;  3AED B;  2K6Q A;  2INP E;  2JZ3 B;  2BF8 B;  4LUH A;  3DPD A;  2ICI A;  1I4G A;  1N61 A;  3NUH B;  1P9D U;  3P4R B;  3BYY B;  2MCN B;  4ANX A;  2JUH A;  2NMQ A;  3AM9 A;  3BVM A;  2XK5 A;  2LUM A;  2WDR B;  1FCL A;  3QK0 A;  1D5M C;  2ONQ A;  5EDS A;  4HLE A;  5D7G A;  1L6U A;  1WXQ A;  4ITK A;  3H7P B;  2DAF A;  2MH7 A;  2WXL A;  3WAM A;  1VZS A;  4MGZ E;  4YT0 B;  1RFA A;  1MIY A;  3FWC C;  2MX2 A;  5BMH A;  4AJW A;  4N0U D;  4RFB A;  2J0J A;  4G04 A;  2L83 A;  3K9P B;  3IVF A;  2V4L A;  4WWN A;  2WU5 B;  4FUL A;  3FIL A;  2XBB C;  3DWG C;  1QOG A;  2BXL A;  5LXI B;  5I4D A;  1E90 A;  3CST A;  4PT5 A;  3RUI B;  2JVC A;  2B76 B;  3PS6 A;  3QC8 B;  2PJH A;  4KVG B;  1GNI A;  5G5H A;  3UIN B;  2XK5 B;  5G5G A;  3E56 A;  1E7B A;  4YTN B;  4K1R B;  1HZ6 A;  5BYS A;  2GBM A;  3A33 B;  5LLI A;  4B6W A;  1J8C A;  3H7P A;  1KLV A;  1KTK A;  2KDE B;  3VXW A;  2CHW A;  3NZU A;  4P7I A;  5CX3 A;  1N5W A;  3HM6 X;  5IIH A;  4OVU A;  4ARI A;  3NZS A;  2FAZ A;  2LHE A;  2FIF A;  3AV8 A;  2WDT B;  2V36 A;  2N0S B;  2N7J A;  2XVU A;  5KHO A;  1JCK B;  4LB2 A;  3V05 A;  2E3T A;  3MHZ A;  2CJN A;  4HVB A;  1QQR A;  5DPS A;  2IJ0 A;  3Q69 A;  2W3S A;  2GB1 A;  5DBY A;  1WM3 A;  2MQJ A;  2J52 A;  2AX5 A;  2ON8 A;  3MJW A;  2Q5W D;  2J0M A;  1HK1 A;  1JRP A;  1F0Z A;  5IA7 A;  5HI1 A;  1YN4 A;  1UZX B;  2N4F A;  1LM8 B;  1XLN A;  4JLC A;  2XW0 A;  5IAA C;  2KQS A;  2KMA A;  3BIN A;  3IG3 A;  3I57 A;  4Z69 A;  1GC6 A;  2L7R A;  2HTM E;  1BML C;  3ZVV A;  2K9X A;  1LO5 D;  4F5S A;  3B2G A;  2Y5P A;  2MSE D;  2DZI A;  5AZF A;  2UYZ B;  2EKI A;  3T3O A;  3TDL A;  4G50 A;  3I3T B;  1E7U A;  2LVP A;  5L83 A;  4RM9 A;  1E0Z A;  3SD5 A;  1WJN A;  1UH6 A;  2NVU I;  3P2B A;  1CJE A;  3B9J A;  4KDI C;  3NVW A;  2LRU A;  2PKO A;  1ZDV A;  2R61 A;  4WJN A;  5D3D A;  3LJ3 A;  3R2I A;  4EOY A;  2BXK A;  4RF0 A;  3VRA B;  3ICX A;  2N9X A;  2Y5B B;  4PS8 A;  1DGJ A;  3B2F A;  2WXG A;  3KWV A;  4IUM B;  1J19 A;  2K8B A;  1RYJ A;  1V1O A;  4LDT D;  4KX6 B;  4BFR A;  4GG2 A;  3W1S A;  3NOB A;  4NAW B;  3JSV A;  4AS1 A;  3NVY A;  2A5U A;  4GU2 A;  3Q8B A;  2BXF A;  4E74 A;  1D5X C;  4D2K A;  3SFD B;  3QHT A;  1TZ1 A;  1WGK A;  3UIV A;  4DK5 A;  3GZN I;  1OGW A;  2V0G A;  1OQY A;  5BMG A;  5ID9 A;  1VZ6 A;  2M17 A;  1RLF A;  1XLP A;  1LNS A;  4YSZ B;  2YLM A;  3MTN B;  2WXH A;  5IFO A;  4EUT A;  3CWI A;  2WU2 B;  4KDL B;  2V3N A;  2EMT A;  4GSW A;  4ARC A;  5AZG A;  2N9E B;  2C7M B;  3KIK A;  4ZOH C;  3N30 A;  5D6J B;  3KJL A;  4MGY E;  3A4R A;  2M4N A;  4A3O A;  4AJY B;  3PRZ A;  2NBU A;  3T3N A;  4DXA B;  5D3I B;  2CHX A;  2NBW B;  3C8Y A;  2ASQ A;  3ZNG C;  5EE3 A;  3A9K B;  1WXV A;  3PGE A;  3UQA A;  2Z8I A;  4KIK B;  3SQJ A;  2Z0D B;  3WIM A;  2M19 A;  3H1U A;  1IP9 A;  2H89 B;  1ZKH A;  4W9I A;  1L2N A;  2WNM A;  4F5U A;  1QOF A;  4PS3 A;  5G55 A;  3N9Y C;  4KGR A;  2IYD B;  1E7I A;  4A90 A;  3KYC D;  4Q2J A;  3L10 B;  2OZB B;  5LXH A;  2N1V A;  2L8J A;  1ZP0 B;  3SIU B;  3WAP A;  3UGB B;  4US9 A;  4KKI A;  4F7Z A;  2MBQ A;  4KKJ A;  1EF1 A;  1TXU A;  2JZZ A;  1GOZ A;  3KW5 B;  4HKQ A;  1P0R A;  1E78 A;  1C4C A;  2DYB A;  2VDB A;  2GRI A;  4PYU A;  3DCG A;  2I30 A;  5CTR C;  5HG2 A;  2WXF A;  3DVN V;  3PPA A;  3VTW A;  2QIE B;  4N6E B;  4TMA B;  1WGR A;  2L0T A;  2VUF A;  4K71 A;  4B9K A;  5E6J A;  3R7Q A;  3AI5 A;  4LB9 A;  2LXC A;  3JQZ A;  1V1P A;  4ZBR A;  1S1Q B;  3WAN A;  2WDQ B;  2MEK A;  1WXM A;  1HEZ E;  3PZ8 A;  2BS2 B;  2ZCC A;  3P4Q B;  4BBN C;  1TJE A;  4YL8 A;  2RPV A;  4IC7 B;  2DAJ A;  2LFI A;  1L5P A;  3U30 A;  1WX8 A;  2K25 A;  4K2C A;  1ZOY B;  4OZC A;  2KX0 A;  2NS5 A;  2K5P A;  2OT3 A;  4FHK A;  1E7E A;  4AWJ A;  2RGF A;  3FWB C;  2M0X A;  4F8C B;  4LDT B;  5FK9 C;  2RPQ A;  1IGD A;  4W9D A;  4NPN A;  2EFC A;  2SEB D;  3JYU A;  1QF6 A;  4L1B A;  3A73 A;  5JHA A;  2OHF A;  4YTM B;  2I38 A;  4MGI E;  5TSS A;  1O9X A;  4TSS A;  4NJC A;  2AL3 A;  2DZJ A;  2M56 B;  3BYT B;  1WIA A;  2HD5 B;  4GOC A;  3DBS A;  5E6N A;  1HA5 A;  1SSN A;  1TYG B;  1FNU A;  3ONS A;  1SE3 A;  1V6E A;  4BBN F;  4S1Y A;  5IJF A;  1WGG A;  1VCB A;  2LJ5 A;  5C2T B;  4MJS A;  1XEE A;  4A55 A;  4IW2 A;  1WYG A;  4N58 A;  3IT4 B;  3EHV A;  5G2N A;  3DDC B;  3OWE B;  2NTT A;  2LVO A;  3R8B A;  1UGJ A;  2AQ3 B;  4FN2 A;  1JML A;  3ZJV A;  1XO3 A;  1SE2 A;  3EGR A;  1F9J A;  1XLQ A;  3PLU A;  2IO2 B;  1SB3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...