2DYMA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-46) complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
285
structure length
254
Chain Sequence
AHMNDIKQLLWNGELNVLVSIDPSFEIAVLRIRVPRETYLVNYMPLIWNKIKSYFWFEHNKTPIPWNYPVGVLFDCLAGFTTSFENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTTFRISQPTISMTGVNPTLKDIEGDILDVKDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein turnover/protein turnover
molecule keywords Autophagy protein 5
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 72
structure length 254
sequence length 285
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dymA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dymA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dymA01
2KD0A 4GDKA 4G11A 5J2RA 2LGYA 2N9EB 1H8CA 2UWQA 4E71A 3V6EB 2HD5B 4G3XB 4BKGA 2KVRA 1Q5WB 3RZFA 3X0WA 4MJSB 3VH4B 5JZEB 1RAXA 1SE9A 1WGRA 2K8BA 2DYMA 3EHVA 2MBHA 2CHXA 2CS4A 2PPHA 1RFAA 4XX5A 2CKHB 2RD0A 4ZRJA 3L08A 4MM3A 2MP2A 1L2NA 3D32A 4W9FA 1J19A 1SIFA 2NR2A 4NQKE 2K1FA 2PE9A 2IYDB 3VUYA 1OEYA 2EMTA 4HCPB 4W9EA 3L13A 4PS3A 1UGMA 2L3ZA 3ZIMA 3X23A 4HK2A 3HHMA 2MCNB 1E90A 2IY0B 3JSVB 4JQWC 5J18A 1P0RA 3A9KA 3IVFA 1IPGA 4IM0A 3PS6A 1UD7A 3JVZX 5G2NA 3N30A 1SGHA 1E5WA 4KDIC 4W9KA 4GGQA 4WJPA 1WFYA 1WZ3A 3BY4B 2FCNA 1E8ZA 3PHWB 2M4NA 1GJZA 3KYDD 2IO3B 1F9JA 4MSMB 3VXWA 4BKSD 3TL5A 2UYZB 1A5RA 2D3GA 1WXSA 2IBIB 3DQVA 5LXIB 4CHKA 4IM3A 3WA0A 4WJOA 1J0GA 2C9WB 2O6VA 2B3AA 2D10A 3ENEA 5CHFA 2FCSA 4BKTA 3EC8A 2DZJA 5DPTA 3GOEA 1WYWB 5CX3A 2EMSA 3H9DA 3M63B 1UH6A 4A3PA 2JRHA 2JZ3B 2MWSB 1LXDA 3M62B 3NZSA 1WX9A 4KVGB 3DBSA 4AJWA 4DHJD 3MTNB 1YX6B 2DHZA 4GU2A 5E6NA 4FA6A 4ANVA 3TBLD 3PPAA 1WF9A 3QIJA 4DBGA 3QHTA 1WGGA 3R3MA 4AUQC 2LVQA 3QWZB 4W9CA 2FCQA 2JRIB 2N1WA 3PRZA 2NCNA 3K9OB 4GN1A 4W9JA 1WM2A 4IWOA 1WGDA 4DHJB 2KWCA 3M3JA 3SU8X 2KC1A 1YD8U 3TJPA 3VDZA 3H7SA 1WX7A 1S3SG 2D11A 1WJ4A 5HKHA 1OTRB 2NPTA 2PE6B 2G45B 1AARA 4DXAB 2QHOA 4RM9A 4A3OA 4IUMB 4FADA 1I42A 3APFA 2LASA 4OVVA 3A33B 1J8CA 2GBJA 4GDLB 1KJTA 2L00B 2YVCA 3DVGY 3NOBA 4FLHA 2FNJB 2J0MA 1YIWA 1YX5B 2KLCA 4GB9A 2LXAA 1KM7A 2XK5B 2KQSA 2MBQA 4IG7B 2PJHA 2BWES 2DZMA 2MA9B 4DWFA 4E74A 3WALA 2LXCA 2RPQA 3A4SC 3BINA 4G0NB 5TR5A 3V62A 3PRMB 4AP4C 2KHWB 2EKEC 5KHOA 2GBRA 1XQQA 2Z0EB 2RGFA 3TIXA 4EZKA 5DPWA 4MDKE 4LCDE 2FUHB 4MH0E 4NQLB 4NPNA 5JHAA 2KJRA 3ONSA 1OGWA 5DPSA 3OJ3A 3EECA 5EDSA 2KOXA 4EOYA 1WE6A 4ZDVA 2V3SA 1YQBA 3A1QA 3WAMA 2W9NA 4M8MA 1I35A 2LJ5A 1UBIA 3PVLA 2NS5A 3R66C 3ZTCA 3VFKA 3WANA 2L8JA 2M17A 2K25A 2KTFA 2O2VA 1WXVA 3ZDMC 2ZZPB 2KJHB 1V5OA 1GC7A 2L0FA 1TBEA 2D2QA 4ASWC 5LXHA 4ZRKA 3V60A 4E3CA 2BGFA 2WX0A 3VHTC 2CHZA 2FAZA 3PREA 5LLIA 1V81A 2K6DB 3L17A 1WGYA 3WAOA 2KDIA 4DDGD 5AZGA 1R4NI 1V9JA 2BYEA 1WM3A 3A9JB 3L16A 2ZVNA 3L10B 4BFRA 2M0XA 3T8MA 1P3QU 2JVCA 2WX1A 4K7WA 3U30A 1P98A 3N3KB 4HDQA 4MGZE 4NAWB 2ZEQA 1P9DU 2KDEB 4ZYNA 1EF1A 2XBBC 3OLMD 3V61A 1D3ZA 2FIFA 1WMHB 3DBRI 2HTHA 3PZDA 4PS8A 4KZ0A 3DPDA 3RT3B 4DHZE 3KUZA 2MLBA 4F1SA 4TQ1A 3OAWA 2KDFB 3N32A 2K6QA 2NBUA 2N1VA 5AZFA 1RLFA 2LRWA 4GDLA 2N9PC 1WGHA 3OJ4B 2BWFA 5DPRA 4MELA 3QCAA 4IC7B 2CR5A 1PQSA 2XK5A 2V1YA 3QA8A 1UZXB 3NZUA 2NBWB 3L0WB 4K1RB 2WWZA 2KMCA 3IFWB 3DVNV 4EKUA 2M1MA 4ZRIA 1P1AA 3H7PB 4I6NB 1Z5SB 2KMAA 3HM3A 1T0YA 2Z0DB 2ZCBA 3KUCB 2HE7A 4FJVB 4FJYA 1WE7A 3O65B 3PT2B 3VUXA 3ZNGC 2PEAA 4BBNF 4ANWA 3QC8B 3UF8A 1GG3A 1WR6E 2C7NB 2KANA 5C1ZA 3DBLI 3KVFB 4YL8A 2C7HA 3ZLZA 2LD9A 1LM8B 4W9HA 1BT0A 5C23A 4HLEA 1EO6A 2A5UA 3SD5A 1WRDB 2NBVB 2BF8B 4LJOB 5CHWA 1VCBA 3AXCA 5KHQA 2KWUB 2ZVOA 4URKA 1EF5A 2BYFA 3KUDB 4TUUA 1FXTB 1UELA 2KQ7A 2V4LA 1WZ0A 3ZRCA 3IBEA 2Z59B 4MJSA 4BOZB 2K8HA 4GDKB 3IG3A 4KSLC 5JHBA 4DHZB 1KLVA 4GSWA 2KJ6A 1RRBA 2LUEA 3A9JA 4HDOA 2OOBB 4JIOU 3MHSD 4XZ4A 1WY8A 2C60A 2MSED 1GNUA 2ZNVB 4HCNB 2C7MB 2MP2B 4N9F4 5CTRC 3RYTA 4GOCA 4NAWA 2KO3A 4HJKA 2I1KA 4B95A 1GUAB 4B6WA 2N4FA 2NVUI 3VTUA 1Q1OA 1WMHA 3W1YA 3ML9A 2BPSA 3UQBA 3JSVA 1U4AA 4MGIE 3UIPB 1E8WA 2ZCCA 4HPMB 3SHQA 4JGHB 3B08A 2J0JA 3AU4A 1WIAA 4NNJB 3A9KB 2AWTA 2JUOA 3K9PB 3HM6X 2DYBA 2LWPA 2CHWA 4WQOB 4FJZA 2L05A 3ZUNA 1WXMA 3I3TB 2WDTB 1E7VA 3HK0A 2JF5A 3TMPB 4FULA 4M0WB 2O6VD 5IA7A 4EUTA 2ASQA 3B1LX 1L7YA 4ICVA 2KWVB 2LRUA 4W9LA 2KK8A 2L7RA 1IP9A 3ECIA 1C1YB 4HWIB 3PTFC 3H7PA 3CSFA 5GMVA 3VUWA 5JH5C 2AEHA 2R2OA 2L0TA 2OJRA 2BYVE 3R7QA 4BKSA 3B0AA 2BKFA 2K8CA 2KC2A 2VRRB 4BVUC 3ML8A 4PYZA 1G6JA 2IO1B 3EFUA 3KYCD 4IWPA 4MEMA 4TV3A 4W9DA 2KKCA 2IO2B 3P2BA 3VH3B 3C0RB 3HIZA 3WIMA 3UQAA 2JPHA 4JL9A 4MSQB 1M94A 3T9LA 1V86A 2JY6A 2LI5A 3DDCB 3ZNZB 2ZJDA 3PHXB 4DK5A 3ALBA 4MGYE 4HPLB 1XD3B 3V6CB 1UBQA 3RUIB 1WJUA 2K39A 4EZLA 2KFKB 1V49A 3LDZE 4A20A 4MGKE 1ISNA 3IHPC 2GOWA 2DX5B 4CO7A 2MQJA 4RM8A 4FHJA 2GBKA 4WJNA 4HVBA 2LZ6A 2R2QA 2ZPNA 4K81A 3W1SC 1V5TA 4IWQA 3ZDTA 3QK0A 2KLGA 2NPTB 3PGEA 4K7UA 4J6IA 3UIOB 5E6PA 4LDTD 3NY5A 4TKNA 2D07B 3DCGA 1LFDA 3QAQA 4WWPA 2CU1A 2KDBA 2MBEA 5E6OA 4W9GA 3KH0A 1CMXB 1R4MI 3UGBB 2DYOA 2MBOA 4WWOA 4JLCA 4TQ0A 2ZNVC 1TTNA 4F7ZA 1E7UA 2JWZA 4LDTB 2DZKA 5D6JB 5IAAC 2FCMA 2XEWA 4WAAA 3WAPA 2N9XA 4GXBA 3RD2A 4F8CB 3NHEB 2GBMA 2KX0A 5AZHA 3VQIA 1EUVB 4WJQA 1MG8A 3AULA 5CHVC 1Q0WB 5D94A 4BOSC 4GMVA 3ZNID 2DAJA 4GIVA 2KTRB 2J0KA 4NY0A 2LGDA 3A4RA 3DVNU 1OQYA 2KNBA 3MJWA 4KV2A 4FBJB 2G4SA 5L95C 4WWNA 2KFJA 4I6PA 5J17A 3AU5A 3A1QB 4NJ7A 3DBHI 4X57B 2IZVB 1XT9B 1X1MA 1ZW7A 5DCNA 4AOFA 1WJNA 2KX3A 2O2VB 1NI2A 3VTVA 1WJ6A 4BBNC 3ZKJC 1V2YA 1ZGUB 2YLMA 3QJZA 3U8ZA 4II2B 4PYUA 3R7RA 5D7GA 2AYOB 2G3QB 2A4ZA 1Z2MA 2LVPA 2M8SA 3CMMB 3PV1A 3QARA 3PRPB 3JW0X 3ZW3A 3CF6E 2WYQA 3DVGX 3UINB 2KFKA 3Q3FA 3QX1A 2DAFA 3KW5B 3H6NA 3L54A 2C5LC 2BKRB 4XC2A 1H4RA 3JYUA 5G55A 1VD2A 3VTWA 4II3B 1NDDA 1WXAA 3DOWA 1IYFA 2GMIC 3ZO5B 3PLVA 1WX8A 2KZRA 4IW0A 4NJ6A 3ZTDA 1QZEA 1WI0A 2HJ8A 1TGZB 4LJPB 3QQ8B 3VVWB 3M95A 1NBFC 2REXA 2KXJA 3Q3JA 2L76A 3NS8A 4KSKC 5D2MB 3RCZA 1YJ1A 5L83A 1WH3A 2AL6A 4P7IA 4KZCA 4ANXA 2FIDA 3LJ3A 1Y8RC 2MBBB 4OVUA 3TCAA 2RSUA 1ZKHA 1E8XA 1V80A 3ZNHB 4M8NA 4G50A 3GZNI 4B9KA 2ZPYA 3APDA 4HXDA 4DDID 2N7DA 3RULA 4KDLB 2DZIA 2KN5A 5FR6A 4KIKA 4FHKA 3ZRFA 4AWJA 1KOTA 2AL3A 1HE8A 2JZZA 1WR1A 1OEYJ 2RR9A 1S1QB 3U7DA 4FN2A 3PSEB 4EZJA 5AEKB 2JXXA 3VAWA 2O6VB 3SDLC 5BO4B 4ANUA 3PLUA 2MX2A 4AJYB 2J7QB 2N7EA 4EEWA 2KTRA 1TZ1A 2I1JA 4I6LB 4RMAA 2G4DB 4CYEA 1JRUA 1V6EA 3RZWC 1C3TA 1K8RB 3AI5A 4W9IA 3ZVVA 4KIKB 2LVOA 2MRPA 4PS7A 4EFOA 1LQBA 4ICUA 4IM2A 2DENB 2LGXA 3H1UA 3W1SA 4K7SA 2GBNA 2JT4B 3CSTA 3APCA 3S2AA 1E8YA 2Y5BB 1GC6A 2IO0B 2MW5A 2IY1B
chains in the Genus database with same CATH superfamily
2N0SB 4G11A 3P1MA 4E71A 3MFGA 4BKGA 2KVRA 1Q5WB 3X0WA 4MJSB 2DYMA 3EHVA 2PPHA 2CKHB 2RD0A 4MM3A 4W9FA 1TKGA 1PGBA 3BVGA 4NJCA 4RFBA 2K1FA 2XNAC 4HCPB 1VZSA 2R61A 1UGMA 1SE3A 4WURA 4US9A 2XW1A 1IPGA 4IM0A 1FMAD 3W9CB 3PS6A 3V05A 1UD7A 1HK2A 2B76B 3N30A 4M01A 4GGQA 2D5GA 3AB5A 2FCNA 1E8ZA 2FUG1 2M4NA 3KYDD 1LOTA 2UYZB 3TL5A 3Q3OC 2IBIB 5LXIB 2M19A 3FWCC 3FAHA 2BXQA 4WJOA 2J53A 1FPYA 1QOFA 4BKTA 3GOEA 1FXAA 3B2GA 1XLOA 5CX3A 2XVQA 4M02A 4S1YA 3H9DA 3M63B 1UH6A 3VRBB 4KVGB 4OTUA 4AJWA 3N1ZC 3MTNB 1YX6B 2DHZA 5E6NA 4FA6A 3EUB2 2AJEA 3QHTA 1QOGA 3QWZB 2FCQA 2JRIB 2N1WA 2NCNA 3K9OB 2RDHA 4IWOA 3AE9B 2ZW0A 4A90A 1YD8U 3DBHB 3TJPA 2D11A 1PGXA 5HKHA 2NPTA 1F1HA 4DXAB 2QHOA 4J2VA 2BB6A 4IUMB 3A33B 1I7HA 3NOBA 2J0MA 1YX5B 2CJOA 1ROEA 2XK5B 2KQSA 4HRSA 3GE8C 2DZMA 4E74A 2RPQA 3A4SC 2MH7A 4Z9OA 2WXGA 2GBRA 1SJED 3R2TA 4MH0E 4EMXA 4NQLB 1FD6A 1T0QC 3WHSA 3ONSA 1OGWA 5EDSA 2KOXA 2V3SA 1YQBA 3A1QA 1XCQL 2W9NA 2LJ5A 3MC8A 1UBIA 2NS5A 3ZTCA 1OQQA 1WXVA 3ZDMC 2KJHB 3GZNB 2L0FA 1TBEA 2D2QA 3FC4A 4FIPB 3C8YA 5LLIA 3Q8CA 4OHJA 1WGYA 1VZ7A 3ZJVA 1QKZA 3Q3MC 1WRIA 1V9JA 5AZGA 2BYEA 3A9JB 2SEBD 4BFRA 1NYQA 4ZBRA 4MBEC 1P3QU 1P98A 1MG4A 4MGZE 4NAWB 2N9LA 1P9DU 2ZEQA 3DBRI 2WU5B 2HTHA 4PS8A 4S17A 3DPDA 4Q2JA 3RT3B 2W54A 3KUZA 4F1SA 5C2TB 2BXAA 2LRWA 5HHDG 4KGTA 1WGHA 3OJ4B 2BWFA 2INCC 4ITKA 4B0MA 1P7EA 1FFVA 1UZXB 3AE3B 1PGAA 4K1RB 1YNTE 4ARCA 4EKUA 2INPE 2M1MA 1ZPSA 4P16A 1P1AA 3H7PB 4KIKB 1Z5SB 5G5GA 2ZCBA 4TMAB 3O65B 3PT2B 4D2KA 3NVYA 2I38A 5FUOA 1GG3A 4DHXB 1WR6E 5TSSA 2E0YA 1ZE3D 5C1ZA 5JXVA 3ICXA 3NVZA 1LM8B 2E0XA 2QILA 3SD5A 1QQRA 1KXPD 2KAJA 2MJEA 3HVZA 2K22A 4URKA 5E6JA 3KUDB 2W82A 1FXTB 3ZRCA 1L5PA 1NENB 3TEXA 2EELA 2WP9B 4GSWA 4P1CC 2KJ6A 1SEBD 4ZCGA 2LUEA 2IGGA 3SIUB 3Q8AA 3SQJA 2OOBB 4JIOU 1WY8A 2C60A 2MSED 4G03A 3B9MA 3N1XC 2KMMA 3RYTA 2KO3A 1GUAB 1P7FA 4B6WA 3W1YA 1Q1OA 1XEEA 3UQBA 3JSVA 4N58A 1QF6A 4MGIE 4NAMA 3AU4A 3K9PB 1E7CA 1STEA 2OEDA 4M70B 1D5XC 4HGKA 3I3TB 2MJDA 4IW1A 4W9LA 3LYYA 2LRUA 3Q69A 5D3DA 4HWIB 5MPOA 1T6BX 3PTFC 1I4GA 3OWEB 3CSFA 4BKSA 2KC2A 1SXTA 3ML8A 4ZRPA 5AUKA 3EFUA 3KYCD 4W9DA 2JPHA 3I57A 4JL9A 4MSQB 3AM9A 3T9LA 3PZ8A 2KBZA 2JY6A 2LI5A 2TSSA 2ZJDA 3IXSA 1PDXA 3I9V1 1K50A 2BXKA 1UBQA 4HJGE 1CZPA 2KVZA 1V49A 4RM8A 2DLBA 1TIFA 1HK4A 1NI3A 1V5TA 4IWQA 3QK0A 3URYA 2NPTB 3RNFC 1SIJA 1LFDA 3AE5B 4G04A 2M56B 2CU1A 1HXYD 1L0XB 2D3AA 4W9GA 3TUOA 2MBOA 3ZQ4A 4TQ0A 1TTNA 3SIVB 1NEKB 4F7ZA 1E7UA 2XN9C 2DZKA 4J3OD 2LJIA 2XEWA 3WAPA 4K71A 1FFUA 2BXGA 4F8CB 4BY9C 2GBMA 2KX0A 4WJQA 5CHVC 1MM8A 2BS4B 4BOSC 2DAJA 2KTRB 4LB9A 2WXIA 4KV2A 4WWNA 4I6PA 4N3ZA 1RM6C 3A1QB 3DBHI 3BZDB 3Q2AC 4PT5A 1X1MA 2BVCA 3E56A 4BZAA 4N6EB 1ZDXA 4RH6A 4PYUA 1UF0A 1D4BA 1I4QA 3CMMB 3PV1A 3QARA 3ZW3A 2LGSA 2KFKA 3QX1A 3DBLB 3UIVA 3L54A 2J4XA 2BKRB 5HI1A 1H4RA 1EM7A 5IJEA 1VD2A 2JZPA 4II3B 2VH1A 1NDDA 1WGKA 3PLVA 2SAKA 5B5TA 1WX8A 4IW0A 2HJ8A 4LJPB 1XO3A 3ZYYX 1GB1A 1FNUA 2KXJA 2L76A 5D2MB 5BPKA 1WH3A 4GG2A 3JQZA 4ANXA 1Y8RC 1WWTA 3EFCA 2Y3AA 1ZP0B 2RSUA 1E8XA 3GA9L 2PKOA 3GZNI 2ZPYA 4KDLB 4JWSC 4C7YA 2AL3A 2JZZA 3BK1A 1OEYJ 3PSEB 3AEAB 3CX9A 4OR0A 1FNWA 2GRIA 2J7QB 1TZ1A 2I1JA 2Z8LA 2QC8A 2V3PA 1JRUA 1I4RA 1K8RB 2LVOA 1TKEA 4PS7A 2WDQB 1EU4A 5H92C 4IM2A 1JQ4A 3H1UA 4ZUXV 2GBNA 3NS1A 2WXKA 2HD5B 1TS2A 2HTME 2BXIA 3N20C 3A75A 3VH4B 2K8BA 1LGRA 1NVID 1RFAA 4XX5A 2MP2A 3TEYA 1HK1A 1SIFA 2NTSA 2NR2A 4KKJA 2PIAA 4YTMB 4LNIA 3VUYA 1OEYA 1L6UA 1C79A 2DBYA 4PS3A 1JWMD 3HUIA 1JW9D 3X23A 1GNIA 3JSVB 4C56C 2EFEA 1EWCA 5G2NA 1SGHA 2WXNA 3AE4B 1V97A 4K3CA 2BXBA 1WFYA 1V8CA 4LB2A 3PHWB 1GJZA 1TT5B 1F9JA 4BKSD 2D3GA 1WXSA 1E7GA 4CHKA 4IM3A 5LNK1 4HROA 2WXRA 3MHHB 1E6EB 2B3AA 5DBYA 3ENEA 1KTKA 1FM0D 3EC8A 1D5ZC 5DPTA 1O9XA 4C4VA 2BBCA 2EMSA 3H8HA 1QOAA 2JZ3B 1LXDA 3M62B 3NZSA 4P6VF 4ANVA 3QIJA 2L32A 1WGGA 4AUQC 2LVQA 1OFFA 3PRZA 3AE8B 1WGDA 2KWCA 4RF0A 2KC1A 4A6QA 1S3SG 4KKIA 2LXTA 3U52E 1RWSA 4A55A 3APFA 1J8CA 2KN4A 4GDLB 1KJTA 2L00B 2YVCA 3DVGY 1N5WA 2V0GA 1J78A 4F5UA 2LXAA 1BKEA 5FR3A 4USAA 2LXCA 1K52A 3V62A 4AP4C 3PRMB 2K9XA 1HA2A 5KHOA 3R2IA 2RDBC 4L2YA 4YTNB 4EZKA 4MDKE 4LCDE 2FUHB 5JHAA 1AO6A 3NVIA 2BXCA 5GIOA 5DPSA 3EECA 2QMTA 1WE6A 1KLUD 1D5MC 3ZGZA 4M8MA 4LNNA 3BVZA 2PVOD 5BMHA 4LNKA 2KTFA 4KGRA 3AMZA 4L1BA 2ZZPB 4ASWC 5LXHA 3V60A 2W55A 1RYJA 2NTTA 2KDIA 2WU2B 1E7FA 4DDGD 3B9LA 3L16A 2ZVNA 2BW2A 4IKGA 2JVCA 4LNOA 2Y5CA 1T5XD 4ZYNA 3B2FA 2W3SA 1VLBA 4DXFA 2FIFA 3PZDA 4B0EA 2WGSA 4DHZE 2MLBA 4KX6B 3N32A 2K6QA 1PFDA 2N1VA 5AZFA 5T8IA 2JYTA 2N9PC 1E7AA 1MVKA 5DPRA 3BPJA 1MUSA 3QCAA 4IC7B 3J9CA 2FBWB 3NZUA 2XMOA 2KMCA 3RFZB 2INNE 2QEJC 3HRDD 4I6NB 3RZFA 1E7PB 2Z0DB 2HE7A 4BBNF 4ANWA 3QC8B 3PZ7A 1EU3A 1M4VA 2BQQA 2K0PA 3DBLI 2LD9A 4W9HA 1EO6A 1GB4A 1WRDB 4H2AA 5CHWA 2I30A 4HGMB 2KWUB 3W2DA 1SJHD 3N9YC 1EF5A 4TUUA 1N61A 2KQ7A 2Z59B 1UUPA 4BOZB 3IG3A 2PTLA 2ZW1A 4DHZB 1KLVA 3P4PB 2BXPA 3MC9A 4ZBKA 1C77A 2MP2B 4GOCA 3VTUA 1WMHA 3OG5A 2BXNA 2XW0A 3UIPB 4HPMB 4JGHB 3B08A 2AWTA 2E3TA 3DWMA 2CHWA 4WQOB 5IIHA 4FJZA 2H89B 1E7VA 2JF5A 5IA7A 3B1LX 4K3BA 5GHKA 4XGAB 2KK8A 1IP9A 3ECIA 3KLSX 2IGDA 1C1YB 1KH0A 3GS2A 5GMVA 3VUWA 2L0TA 2OJRA 3R7QA 3RPFC 2VRRB 1BUIC 4PYZA 2LGIA 1G6JA 3P2BA 5ID9A 3VH3B 3UQAA 4C4VB 4LUHA 1DGJA 1M94A 2AGHB 3ZNZB 3DDCB 4DK5A 4MGYE 4HPLB 2Z8JA 1XD3B 3V6CB 3N1YC 2K39A 1T0SC 4OVZA 2ON8A 3RNAC 2DX5B 1ZUD2 2MQJA 1V1OA 1J7AA 2GBKA 3O13A 4F5VA 1N62A 2ZPNA 3W1SC 3PLAA 1TS3A 1E10A 1JNBA 5IO9A 3UIOB 5E6PA 4LDTD 2D07B 1ZDVA 5HFYA 5E6OA 3KH0A 1R4NB 4W4UB 4WH4A 4OZCA 4LDTB 5IAAC 1BJ5A 2N9XA 1T0RC 4GXBA 1B9RA 3MP9A 3NHEB 3VRAB 3TDLA 3B9JA 1Q0WB 4M0WA 5D94A 5G5HA 3ZNID 4GIVA 4NY0A 3A4RA 1OQYA 1Q10A 2KNBA 4FBJB 4NJ7A 1C9FA 4X57B 3W5UB 1ZW7A 1WYGA 2GI9A 1WJNA 4WIPA 2KX3A 4XDCA 3ZKJC 3RI7C 1ZGUB 1CQVA 3U8ZA 4II2B 1KLGD 4C7ZA 1QT9A 2G3QB 4LUFA 2M8SA 3JW0X 4L9QA 2WYQA 3DVGX 4MM3B 3UINB 2DAFA 1FNVA 1VJKA 3KW5B 1MI0A 2VUFA 2C5LC 4XC2A 3JYUA 2V4IB 4OZBA 1WXAA 2CKXA 1FRDA 2ONQA 4XDDA 4ZOHC 1NBFC 2QM6A 3M99C 1N60A 4XYCA 3Q3JA 1KDXA 3NS8A 1YJ1A 5BYSA 4MT5A 2AL6A 4P7IA 4KZCA 3LJ3A 3SR6A 2MBBB 2KT7A 4MACA 3APDA 4HXDA 4DDID 2N7DA 4C31B 2DZIA 2KN5A 3ZRFA 1ET6A 4YXDB 1HE8A 4N59A 2QMCA 1JWAD 2RR9A 1BMLC 3U7DA 3VAWA 3SDLC 5BO4B 2N7EA 4EEWA 1HTOA 4I6LB 3NVMA 2LUMA 3RZWC 1UNSA 3AI5A 3NVKA 1KRHA 2L1AA 1J7BA 2WDRB 3BIID 2DENB 3W1SA 3FKYA 3KIKA 2Y5BB 2CJNA 3AE6B 4AQ7A 2IO0B 2VUEA 2MW5A 2KD0A 1I4PA 1H8CA 5J2RA 2LGYA 2N9EB 1SF0A 5ID7A 3IT4B 1C76A 1RFKA 1VFIA 1SE9A 1WGRA 3P4QB 5IN7A 1L0VB 2LHEA 2CS4A 2QJLA 3RNEC 3L08A 1SE4A 1J19A 3GP7A 4FXCA 3Q3NC 2PE9A 1TJEA 2EMTA 4RGNA 3P63A 3L13A 4ZC6A 3ZIMA 3HHMA 2MCNB 1E90A 2IY0B 1FXIA 5BYQA 5J18A 1XLPA 3Q8EA 2DG5A 4E99A 4BAXA 4KDIC 2EFCA 1WZ3A 2NNWA 2IO3B 1H9ZA 3DQVA 2QCZA 3WA0A 1E7IA 1ZOYB 1KF6B 1J0GA 1ET9A 2O6VA 5CHFA 2FCSA 2KYWA 2DZJA 1F52A 1AN8A 1D6EC 3AEDB 1KFYB 4A3PA 2JRHA 1AYFA 2YDFA 3L4PA 3DBSA 3P4SB 2D3BA 1SB3C 4GU2A 3PPAA 4YSYB 1WF9A 4DBGA 3R3MA 4W9CA 1GPXA 2EKIA 4LTUA 1J7EA 2LOQA 3T3OA 2WXPA 2I2YA 4W9JA 1UORA 2JWUA 3M3JA 3EA6A 1FEHA 1WX7A 4TSSA 1TY2A 3DHHC 1WJ4A 1OTRB 1MIVA 1VZ8A 2G45B 1AARA 1LO5D 2WXQA 4RM9A 4P1BC 4G01A 4A3OA 2V3NA 4OVVA 1HQRD 1A70A 2GBJA 4FLHA 4WQMA 3KJLA 1DOIA 1YIWA 4GB9A 1KM7A 2MBQA 3RN9C 3CWIA 4DWFA 1OQRA 4NZLB 3BINA 4G0NB 3ZJTA 2K3UA 2G1EA 2KHWB 2VDBA 2WXJA 2V9HA 2Z0EB 2RGFA 2KWDA 3TIXA 4REZA 4OTTA 1MJDA 4LK0M 4NPNA 2KJRA 1SE2A 3KWVA 4BKEA 1I35A 4YT0B 3PVLA 3R66C 2LFIA 2XVUA 2K25A 2GUTA 2O2VA 3NZ3A 3BWUD 1GC7A 4ZRKA 2BS2B 2WHIA 2BGFA 3VHTC 2FAZA 2K6DB 3L17A 2D3CA 1R4NI 1WM3A 1WXQA 4I9OA 1PYWD 3T8MA 4K7WA 1JROA 3N3KB 4HDQA 3V61A 2KDEB 3G9KD 3OLMD 2ACZB 4IDIA 1SB0A 1FOUA 4KZ0A 3AEBB 4TQ1A 4A9AA 2NBUA 5EE9A 5I4DA 3DHGC 1T3QA 4MELA 1PQSA 2XK5A 3QA8A 2NBWB 2X8XX 4YTPB 2K5PA 4C80A 3L0WB 2WWZA 3GE3C 3IAS1 2J52A 1Y56A 3IFWB 1E7EA 2OZBB 3HM3A 3KUCB 4FJVB 3VUXA 3ZNGC 1DYQA 2PEAA 5HOZA 3UI3A 2ROHA 2GB1A 1UWXA 2WXMA 2C7NB 2KANA 2OHFA 2C7HA 3DHIC 5C23A 1BT0A 4HLEA 2A5UA 3FILA 1E0ZA 1VCBA 2BX8A 3AXCA 5IKCM 2BYFA 2JQRB 1UELA 2V4LA 1WZ0A 3IBEA 4IOIE 2Q5WD 1EWYC 3V09A 2AX5A 4DM0A 3P4RB 1HZ6A 3A9JA 1L4DB 2Z8KA 3MHSD 3RNCC 4HCNB 2C7MB 2LXSA 5CTRC 4NAWA 4HJKA 3LB8C 1KW2A 2I1KA 4OW0A 4LA0A 2NVUI 3ML9A 2BPSA 5HG2A 2WXFA 1IGCA 2ZCCA 3SHQA 2J0JA 2PW9A 2KACA 3HM6X 2DYBA 2LWPA 3Q6BA 2L05A 1WXMA 4F5SA 2E6XA 3ABVB 2WDTB 1K51A 2O6VD 4EUTA 2ASQA 1TS5A 2L7RA 2PLPA 3H7PA 2BYVE 3B0AA 4HKQA 3NVVA 4IWPA 4MEMA 4WAFA 1TZOA 1TKYA 4TV3A 2IO2B 2MEKA 3WIMA 3FWBC 4JE3B 4R3DA 1V86A 3ALBA 3RUIB 2KFKB 3H3AA 3LDZE 1ISNA 2BTEA 1QILA 1YQ3B 2GOWA 3LU6A 2I2ZA 4FHJA 4HVBA 2R2QA 4K81A 1SBBB 1N5XA 2WXLA 4XWWA 3AN1A 2KLGA 3PGEA 4K7UA 1XXGA 2CU3A 4PO0A 1ZXIA 2YEPB 3DCGA 5IIXA 3QAQA 2WXOA 1I4HA 2MBEA 4ARIA 2DYOA 4JLCA 2ZNVC 1IBXA 3U2SC 5D6JB 1CJEA 3RD2A 1SSNA 1E9MA 1LNSA 5AZHA 3VQIA 1L6VA 3AULA 4UDUC 1XCTL 2N9KA 4YSZB 4GMVA 2H88B 2LGDA 1JWSD 3DVNU 3E9SA 3MJWA 5L95C 2LQIA 3AE7B 5J17A 3AU5A 2IZVB 1XT9B 2KQ4X 2JXTA 4AOFA 2O2VB 4EE2A 3AEFB 1NI2A 4BBNC 1WJ6A 1V2YA 5C3JB 2YLMA 1R7SA 2XSIA 5D7GA 2AYOB 1HA5A 2A4ZA 1Z2MA 3PRPB 2DBXA 1YN3A 3CF6E 2EFDA 3T3NA 2KDMA 5IJFA 3Q8BA 3H6NA 3VTWA 2JU6X 3DOWA 1IYFA 3NG0A 4WWMA 1YQ4B 3NRZA 4NJ6A 2WLBA 1QZEA 1WI0A 1K53A 3QQ8B 1JWUD 3VVWB 2KWFA 3M95A 3NMUA 4RGOS 1QLBB 3RCZA 2PMVA 1VZ6A 2FIDA 4OVUA 3TCAA 3P42A 1V1PA 1ZKHA 1IUEA 3ZNHB 4M8NA 4G50A 4WA6B 1AW7A 3VR9B 1YOVB 4L8UA 4FHKA 1I4XA 4EZJA 5AEKB 2JXXA 5GINA 4ANUA 3PLUA 2MX2A 3LU8A 1FCCC 2KTRA 2DNFA 2HDEA 4RMAA 3BK2A 2G4DB 2DWQA 3ZVVA 3TEZA 2BT6A 3S2AA 3U4EG 2G9HD 3FILB 3V3XA 1E8YA 2FE8A 1WSPA 2IY1B 4GDKA 1C4CA 3C19A 2UWQA 1VRAB 3V6EB 4G3XB 4HKZE 1AWDA 5JZEB 1E7HA 3V03A 1RAXA 2N7JA 3TEWA 2MBHA 1N5UA 2CHXA 1FRRA 4ZRJA 1C4PA 4CQNA 1DOYA 2BXMA 3WHQA 1L2NA 3D32A 4NQKE 2IYDB 2XVVA 2Z8IA 4W9EA 5IOIA 1JWBD 2WNMA 3IAM1 2L3ZA 4HK2A 1YN4A 4JQWC 1P0RA 1ACCA 3A9KA 3IVFA 1YJIA 2JSVX 3MC0B 3JVZX 1NYRA 1E5WA 4W9KA 4WJPA 3BY4B 3I63C 4MH8A 2L52A 2BYTA 2WS3B 4JX1C 4XE0A 2LHDA 4MSMB 4ZHPA 3VXWA 1A5RA 5H8YE 4RGTA 3ZXRA 1N6ZA 1TY0A 1ZXHA 2C9WB 4JPSA 1R4MB 2D10A 1HZ5A 1WYWB 4S0RA 2IGHA 4LNFA 2MWSB 4ZHOA 1WX9A 4ZYSA 2AQ2B 4DHJD 1NT2B 3FNMA 3TBLD 5EE0A 2IDYA 3GQXA 3BVMA 3AE1B 4GN1A 4YSXB 1WM2A 2HJ1A 2LMCA 4DHJB 5EE1A 1TYGB 3SU8X 3KQ4A 4FK5B 3VDZA 3SEBA 3H7SA 2PE6B 2VZKD 4FADA 1I42A 2QDFA 2LASA 1TXUA 3KWLA 2YEPF 2FNJB 1XLQA 2KLCA 4IG7B 2VZKB 2PJHA 2BWES 2MA9B 3WALA 3AEEB 1IBXB 3AV8A 3CIRB 5TR5A 1MHHE 2EKEC 1XQQA 2GLSA 5DPWA 1C78A 5DQFA 3OJ3A 4EOYA 2ICIA 1IJGA 4ZDVA 2JX5A 1FIQA 1MIWA 2K0NA 3WAMA 2DBWA 2BXHA 3VFKA 3WANA 4FJCB 2L8JA 2M17A 2W3RA 1JCKB 5BYRA 1MHXA 3ZXVA 1V5OA 3EGRA 1QOBA 3RNGC 1MPEA 4E3CA 4HEA1 2WX0A 2CHZA 3PREA 3H37A 1V81A 3WAOA 2MJ3A 3DWGC 5BMGA 2EFHA 3AH7A 3L10B 2M0XA 5D3IB 2WX1A 3U30A 2RPVA 2IPKD 1D3ZA 1EF1A 2XBBC 1WMHB 1JALA 1UWMA 2QSDA 2LEKA 3OAWA 2KDFB 5BMIA 1BXTA 3SFDB 3U7ZA 1RLFA 4GDLA 5GIPA 1YMHE 1J7CA 4C00A 3WCQA 2WDVB 3I5JC 2CR5A 2INDC 2V1YA 3ZJUA 1V1PB 2J42A 1MUHA 5AUIA 1FO4A 4GDXA 2MHJA 3DVNV 4ZRIA 3Q14C 4CO7A 2KMAA 4FJYA 1T0YA 4AJYB 1WE7A 1YJJA 1JMLA 3UF8A 2JUHA 3AEGB 1MIYA 3NUHB 3KVFB 4YL8A 1GOZA 2IJ0A 3GQUA 3ZLZA 1F2RC 3PO0A 2QHBA 2NBVB 2BF8B 4DQOC 4LJOB 1DOXA 1HTQA 5KHQA 2DBUA 2ZVOA 4RGMA 4M00A 4D7XA 4MJSA 2K8HA 4GDKB 4KSLC 5JHBA 3VR8B 1RRBA 3TSSA 4HDOA 4DXGA 4XZ4A 1GNUA 2BXEA 2ZNVB 2BB5A 1VR9A 4N9F4 1B1ZA 4B95A 1L0YB 2N4FA 2RDGA 4XWTA 1U4AA 1UGJA 3W5VB 1E8WA 1F2RI 1HK5A 4N0FD 1WIAA 4NNJB 3A9KB 2JUOA 3A73A 2NQOA 4N0UD 3JRYA 3ZUNA 5EE3A 1N63A 1XLNA 4KGSA 3V08A 3HK0A 1MFWA 3TMPB 4FULA 4M0WB 2AQ3B 2BXLA 1L7YA 4ICVA 2KWVB 1F77A 5IP4D 1ESFA 5JH5C 2AEHA 1CK1A 2R2OA 2BKFA 2K8CA 4BVUC 2VH2A 2IO1B 2KKCA 3C0RB 3HIZA 3ECPA 3Q8FA 4RF1A 3BYTB 3PHXB 2L83A 2OJWA 4US8A 4PK1A 1H5WA 1XF5L 1WJUA 3R8BA 4EZLA 4F5TA 4A20A 2RMMA 1JRPA 4MGKE 1PUTA 3IHPC 3ETRA 4WJNA 2LZ6A 1YN5A 2Y5PA 1BM0A 4QAYA 3ZDTA 3WHRA 4J6IA 3NY5A 4TKNA 2XVWA 3IT6B 4WWPA 2KDBA 4HPPA 2JYEA 4ZBQA 1CMXB 1R4MI 3UGBB 1E7BA 1GAQB 2JWZA 2FCMA 4WAAA 3HVDA 2BXOA 1GNJA 4JWUC 4GLSC 1EUVB 1MG8A 3DBRB 3MHZA 4L9KA 3RMKC 2J0KA 4IW2A 2G4SA 5FK9C 5IJ5A 2KFJA 3LU7A 2BXDA 2WQYB 3AE2B 3MJ5A 2PVGC 5DCNA 4A8XC 3VTVA 2NMQA 2AQ1B 4RNAA 3LXFA 3QJZA 3R7RA 1L4ZB 1IGDA 4AS1A 1E78A 2LVPA 3Q3FA 4K2CA 5G55A 3AECB 1HK3A 2WXHA 3NJTA 2V36A 3MHSB 2GMIC 3ZO5B 5IIUA 4OT2A 2KZRA 3ZTDA 1VDVA 3BYYB 1TGZB 2REXA 2X38A 4KSKC 1FCLA 5L83A 1TS4A 4YWGG 2UU7A 4L23A 4ACFA 2OT3A 1V80A 1C4AA 4B9KA 1ENFA 5IFOA 4Z69A 3RULA 5FR6A 4KIKA 4AWJA 1KOTA 4O1NA 2M0AA 5GXGB 1WR1A 1S1QB 4FN2A 2LQHA 2O6VB 1HEZE 4LLGM 4ZRQA 4JK4A 5FKAC 3GB1A 1MA9A 4OZAA 1TF0A 4CYEA 1V6EA 1C3TA 4W9IA 2MRPA 4EFOA 2QIEB 3SFEB 1F0ZA 1LQBA 4ICUA 2LGXA 2BS3B 2JT4B 3CSTA 4K7SA 3APCA 4RCOA 2BXFA 3NVWA 1GC6A 3RNBC 4WWOA
chains in the Genus database with same CATH topology
4G11A 2N0SB 4E71A 3P1MA 3MFGA 4BKGA 2KVRA 1Q5WB 3X0WA 4MJSB 2DYMA 3EHVA 2PPHA 2CKHB 2RD0A 4MM3A 4W9FA 1TKGA 1PGBA 3BVGA 4NJCA 4RFBA 2K1FA 2XNAC 4HCPB 1VZSA 2R61A 1UGMA 1SE3A 4WURA 4US9A 2XW1A 1IPGA 4IM0A 1FMAD 3W9CB 3PS6A 3V05A 1UD7A 1HK2A 2B76B 3N30A 4GGQA 2D5GA 3AB5A 2FCNA 1E8ZA 2M4NA 2FUG1 3KYDD 1LOTA 2UYZB 3TL5A 2IBIB 5LXIB 2M19A 3FWCC 3FAHA 2BXQA 4WJOA 2J53A 4BKTA 1QOFA 3GOEA 1FXAA 3B2GA 1XLOA 5CX3A 2XVQA 4S1YA 3H9DA 3M63B 1UH6A 3VRBB 4KVGB 4OTUA 4AJWA 3MTNB 1YX6B 2DHZA 5E6NA 4FA6A 3EUB2 2AJEA 3QHTA 3QWZB 1QOGA 2FCQA 2JRIB 2N1WA 2NCNA 3K9OB 2RDHA 4IWOA 3AE9B 2ZW0A 4A90A 1YD8U 3TJPA 2D11A 1PGXA 5HKHA 2NPTA 4DXAB 2QHOA 4J2VA 2BB6A 4IUMB 3A33B 3NOBA 1I7HA 2J0MA 1YX5B 2CJOA 2XK5B 1ROEA 2KQSA 4HRSA 2DZMA 4E74A 2RPQA 3A4SC 2MH7A 4Z9OA 2WXGA 2GBRA 1SJED 3R2TA 4MH0E 4EMXA 4NQLB 1FD6A 3WHSA 3ONSA 1OGWA 5EDSA 2KOXA 2V3SA 1YQBA 3A1QA 1XCQL 2W9NA 2LJ5A 1UBIA 2NS5A 3ZTCA 1OQQA 1WXVA 3ZDMC 2KJHB 2L0FA 1TBEA 2D2QA 3FC4A 4FIPB 5LLIA 3C8YA 3Q8CA 4OHJA 1WGYA 1VZ7A 3ZJVA 1QKZA 5AZGA 1V9JA 1WRIA 2BYEA 3A9JB 2SEBD 4BFRA 1NYQA 4ZBRA 1P3QU 4MBEC 1P98A 4MGZE 4NAWB 2ZEQA 1P9DU 2N9LA 3DBRI 4PS8A 2HTHA 2WU5B 3RT3B 3DPDA 4Q2JA 2W54A 3KUZA 4F1SA 5C2TB 2BXAA 2LRWA 5HHDG 4KGTA 1WGHA 3OJ4B 2BWFA 4ITKA 4B0MA 1P7EA 1FFVA 1UZXB 3AE3B 4K1RB 1PGAA 1YNTE 4ARCA 4EKUA 2M1MA 2INPE 1ZPSA 4P16A 1P1AA 3H7PB 4KIKB 1Z5SB 5G5GA 2ZCBA 4TMAB 3O65B 3PT2B 4D2KA 3NVYA 2I38A 5FUOA 1GG3A 4DHXB 1WR6E 5TSSA 2E0YA 5C1ZA 1ZE3D 5JXVA 3ICXA 3NVZA 1LM8B 2E0XA 3SD5A 2QILA 1QQRA 1KXPD 2KAJA 2MJEA 3HVZA 4URKA 2K22A 5E6JA 3KUDB 2W82A 1FXTB 3ZRCA 1L5PA 1NENB 3TEXA 2EELA 2WP9B 4GSWA 2KJ6A 2LUEA 4ZCGA 1SEBD 2IGGA 3SIUB 3Q8AA 3SQJA 2OOBB 4JIOU 1WY8A 2C60A 2MSED 4G03A 3B9MA 2KMMA 3RYTA 2KO3A 1GUAB 4B6WA 1P7FA 3W1YA 1Q1OA 1XEEA 3UQBA 3JSVA 4N58A 1QF6A 4MGIE 4NAMA 3AU4A 3K9PB 1E7CA 1STEA 2OEDA 4M70B 1D5XC 4HGKA 3I3TB 2MJDA 4IW1A 4W9LA 3LYYA 2LRUA 3Q69A 5D3DA 4HWIB 5MPOA 3PTFC 1T6BX 1I4GA 3OWEB 3CSFA 4BKSA 2KC2A 1SXTA 3ML8A 4ZRPA 5AUKA 3EFUA 3KYCD 4W9DA 2JPHA 3I57A 4JL9A 4MSQB 3AM9A 3T9LA 3PZ8A 2KBZA 2JY6A 2LI5A 2TSSA 2ZJDA 3IXSA 1PDXA 3I9V1 1K50A 2BXKA 1UBQA 4HJGE 1CZPA 1V49A 4RM8A 2DLBA 1HK4A 1NI3A 1V5TA 4IWQA 3QK0A 3URYA 2NPTB 1SIJA 1LFDA 3AE5B 4G04A 2M56B 2CU1A 1HXYD 1L0XB 4W9GA 3TUOA 2MBOA 3ZQ4A 4TQ0A 1TTNA 3SIVB 1NEKB 4F7ZA 1E7UA 2XN9C 2DZKA 4J3OD 2LJIA 2XEWA 3WAPA 4K71A 1FFUA 2BXGA 4F8CB 4BY9C 2GBMA 2KX0A 4WJQA 5CHVC 2BS4B 4BOSC 2DAJA 2KTRB 4LB9A 2WXIA 4KV2A 4WWNA 4I6PA 4N3ZA 1RM6C 3A1QB 3DBHI 3BZDB 4PT5A 1X1MA 3E56A 4N6EB 1ZDXA 4RH6A 4PYUA 1D4BA 1I4QA 3CMMB 3PV1A 3QARA 3ZW3A 2KFKA 3QX1A 3UIVA 3L54A 2J4XA 2BKRB 5HI1A 1H4RA 1EM7A 5IJEA 1VD2A 2JZPA 4II3B 1NDDA 1WGKA 3PLVA 2SAKA 5B5TA 1WX8A 4IW0A 2HJ8A 4LJPB 1XO3A 3ZYYX 1GB1A 1FNUA 2KXJA 2L76A 5D2MB 5BPKA 1WH3A 4GG2A 3JQZA 4ANXA 1Y8RC 1WWTA 2Y3AA 1ZP0B 2RSUA 1E8XA 3GA9L 2PKOA 3GZNI 2ZPYA 4KDLB 4JWSC 4C7YA 2AL3A 2JZZA 3BK1A 1OEYJ 3PSEB 3AEAB 3CX9A 4OR0A 1FNWA 2GRIA 2J7QB 1TZ1A 2I1JA 2Z8LA 2V3PA 1JRUA 1I4RA 1K8RB 2LVOA 4PS7A 1TKEA 2WDQB 1EU4A 5H92C 4IM2A 1JQ4A 3H1UA 4ZUXV 2GBNA 3NS1A 2WXKA 2HD5B 1TS2A 2HTME 2BXIA 3A75A 3VH4B 2K8BA 1RFAA 4XX5A 1NVID 2MP2A 3TEYA 1HK1A 1SIFA 2NTSA 2NR2A 4KKJA 2PIAA 4YTMB 3VUYA 1OEYA 1L6UA 1C79A 4PS3A 2DBYA 1JWMD 3HUIA 1JW9D 3X23A 1GNIA 3JSVB 4C56C 2EFEA 1EWCA 5G2NA 1SGHA 2WXNA 3AE4B 1V97A 2BXBA 1WFYA 1V8CA 4LB2A 3PHWB 1GJZA 1F9JA 4BKSD 2D3GA 1WXSA 1E7GA 4CHKA 4IM3A 5LNK1 4HROA 2WXRA 3MHHB 1E6EB 2B3AA 5DBYA 3ENEA 1KTKA 1FM0D 3EC8A 1D5ZC 5DPTA 1O9XA 2EMSA 2BBCA 3H8HA 2JZ3B 1QOAA 1LXDA 3M62B 3NZSA 4P6VF 4ANVA 3QIJA 2L32A 1WGGA 4AUQC 2LVQA 1OFFA 3PRZA 3AE8B 1WGDA 2KWCA 4RF0A 2KC1A 4A6QA 1S3SG 4KKIA 3U52E 1RWSA 4A55A 3APFA 1J8CA 2KN4A 4GDLB 1KJTA 2L00B 2YVCA 3DVGY 1N5WA 2V0GA 1J78A 4F5UA 2LXAA 1BKEA 5FR3A 4USAA 2LXCA 4AP4C 3V62A 1K52A 3PRMB 2K9XA 1HA2A 5KHOA 3R2IA 4L2YA 4YTNB 4EZKA 4MDKE 4LCDE 2FUHB 5JHAA 1AO6A 3NVIA 2BXCA 5GIOA 5DPSA 3EECA 2QMTA 1WE6A 1KLUD 1D5MC 3ZGZA 4M8MA 3BVZA 2PVOD 5BMHA 2KTFA 4KGRA 3AMZA 4L1BA 2ZZPB 4ASWC 5LXHA 3V60A 2W55A 1RYJA 2NTTA 2KDIA 2WU2B 1E7FA 4DDGD 3B9LA 3L16A 2ZVNA 2BW2A 4IKGA 2JVCA 2Y5CA 1T5XD 4ZYNA 3B2FA 2W3SA 1VLBA 4DXFA 2FIFA 3PZDA 4B0EA 4DHZE 2MLBA 4KX6B 3N32A 2K6QA 1PFDA 2N1VA 5AZFA 5T8IA 2JYTA 2N9PC 1E7AA 1MVKA 5DPRA 3QCAA 4IC7B 3J9CA 2FBWB 3NZUA 2XMOA 2KMCA 3RFZB 2INNE 2QEJC 3HRDD 4I6NB 3RZFA 2Z0DB 1E7PB 2HE7A 4BBNF 4ANWA 3QC8B 3PZ7A 1EU3A 1M4VA 2K0PA 3DBLI 2LD9A 4W9HA 1EO6A 1GB4A 1WRDB 4H2AA 5CHWA 2I30A 4HGMB 2KWUB 3W2DA 1SJHD 3N9YC 1EF5A 4TUUA 1N61A 2KQ7A 2Z59B 4BOZB 1UUPA 3IG3A 2PTLA 2ZW1A 4DHZB 1KLVA 3P4PB 2BXPA 4ZBKA 1C77A 2MP2B 4GOCA 3VTUA 1WMHA 2BXNA 2XW0A 3UIPB 4HPMB 4JGHB 3B08A 2AWTA 2E3TA 3DWMA 2CHWA 4WQOB 5IIHA 4FJZA 2H89B 1E7VA 2JF5A 5IA7A 3B1LX 5GHKA 2KK8A 1IP9A 3ECIA 3KLSX 2IGDA 1C1YB 1KH0A 3GS2A 5GMVA 3VUWA 2L0TA 2OJRA 3R7QA 3RPFC 2VRRB 1BUIC 4PYZA 1G6JA 2LGIA 3P2BA 5ID9A 3VH3B 3UQAA 4LUHA 1DGJA 1M94A 3ZNZB 3DDCB 4DK5A 4MGYE 4HPLB 2Z8JA 1XD3B 3V6CB 2K39A 4OVZA 2ON8A 2DX5B 1ZUD2 2MQJA 1V1OA 1J7AA 2GBKA 3O13A 4F5VA 2ZPNA 3W1SC 1N62A 3PLAA 1TS3A 1E10A 1JNBA 3UIOB 5E6PA 4LDTD 2D07B 1ZDVA 5HFYA 5E6OA 3KH0A 4W4UB 4WH4A 4OZCA 4LDTB 5IAAC 1BJ5A 2N9XA 4GXBA 1B9RA 3MP9A 3NHEB 3VRAB 3TDLA 3B9JA 1Q0WB 5D94A 4M0WA 3ZNID 5G5HA 4GIVA 4NY0A 3A4RA 1OQYA 1Q10A 2KNBA 4FBJB 4NJ7A 1C9FA 4X57B 3W5UB 1ZW7A 1WYGA 2GI9A 1WJNA 4WIPA 2KX3A 4XDCA 3ZKJC 1ZGUB 1CQVA 3U8ZA 4II2B 1KLGD 4C7ZA 1QT9A 2G3QB 4LUFA 2M8SA 3JW0X 4L9QA 2WYQA 3DVGX 4MM3B 3UINB 2DAFA 1FNVA 1VJKA 3KW5B 1MI0A 2VUFA 2C5LC 4XC2A 3JYUA 2V4IB 4OZBA 1WXAA 2CKXA 1FRDA 2ONQA 4XDDA 4ZOHC 1NBFC 2QM6A 3M99C 1N60A 3Q3JA 3NS8A 1YJ1A 5BYSA 4MT5A 2AL6A 4P7IA 4KZCA 3LJ3A 3SR6A 2MBBB 4MACA 3APDA 4HXDA 4DDID 2N7DA 4C31B 2DZIA 2KN5A 3ZRFA 1ET6A 4YXDB 1HE8A 4N59A 2QMCA 1JWAD 2RR9A 3U7DA 1BMLC 3VAWA 3SDLC 5BO4B 2N7EA 4EEWA 4I6LB 3NVMA 2LUMA 3RZWC 1UNSA 3AI5A 3NVKA 1KRHA 2L1AA 1J7BA 2WDRB 3BIID 2DENB 3W1SA 3KIKA 2Y5BB 2CJNA 3AE6B 4AQ7A 2IO0B 2VUEA 2MW5A 2KD0A 1H8CA 1I4PA 5J2RA 2LGYA 2N9EB 1SF0A 5ID7A 3IT4B 1C76A 1RFKA 1VFIA 1SE9A 1WGRA 3P4QB 1L0VB 2LHEA 2CS4A 2QJLA 3L08A 1SE4A 1J19A 3GP7A 4FXCA 2PE9A 1TJEA 2EMTA 4RGNA 3P63A 3L13A 4ZC6A 3ZIMA 3HHMA 2MCNB 1E90A 2IY0B 1FXIA 5J18A 5BYQA 1XLPA 3Q8EA 2DG5A 4E99A 4KDIC 2EFCA 1WZ3A 2NNWA 2IO3B 1H9ZA 3DQVA 3WA0A 1E7IA 1ZOYB 1J0GA 1KF6B 1ET9A 2O6VA 5CHFA 2FCSA 2DZJA 1AN8A 1D6EC 3AEDB 1KFYB 4A3PA 2JRHA 1AYFA 2YDFA 3L4PA 3DBSA 3P4SB 1SB3C 4GU2A 3PPAA 4YSYB 1WF9A 4DBGA 3R3MA 4W9CA 1GPXA 2EKIA 4LTUA 1J7EA 2LOQA 3T3OA 2WXPA 2I2YA 4W9JA 1UORA 2JWUA 3M3JA 3EA6A 1FEHA 1WX7A 4TSSA 1TY2A 1WJ4A 1OTRB 1MIVA 1VZ8A 2G45B 1AARA 1LO5D 2WXQA 4RM9A 4A3OA 4G01A 2V3NA 4OVVA 1HQRD 1A70A 2GBJA 4FLHA 4WQMA 3KJLA 1YIWA 1DOIA 4GB9A 1KM7A 2MBQA 3CWIA 4DWFA 1OQRA 4NZLB 3BINA 4G0NB 3ZJTA 2K3UA 2KHWB 2G1EA 2VDBA 2WXJA 2Z0EB 2RGFA 2KWDA 3TIXA 4REZA 4OTTA 4LK0M 4NPNA 2KJRA 1SE2A 3KWVA 4BKEA 1I35A 4YT0B 3PVLA 3R66C 2LFIA 2XVUA 2K25A 2O2VA 3NZ3A 3BWUD 1GC7A 4ZRKA 2BS2B 2BGFA 3VHTC 2FAZA 2K6DB 3L17A 1R4NI 1WM3A 1WXQA 1PYWD 3T8MA 4K7WA 1JROA 3N3KB 4HDQA 3V61A 2KDEB 3G9KD 3OLMD 2ACZB 4IDIA 1FOUA 4KZ0A 3AEBB 4TQ1A 4A9AA 2NBUA 5EE9A 5I4DA 1T3QA 4MELA 1PQSA 2XK5A 3QA8A 2NBWB 4YTPB 2K5PA 4C80A 3L0WB 2WWZA 3IAS1 2J52A 1Y56A 3IFWB 1E7EA 2OZBB 3HM3A 3KUCB 4FJVB 3VUXA 3ZNGC 1DYQA 2PEAA 5HOZA 3UI3A 2ROHA 2GB1A 1UWXA 2WXMA 2C7NB 2KANA 2OHFA 2C7HA 5C23A 1BT0A 4HLEA 2A5UA 3FILA 1E0ZA 1VCBA 2BX8A 3AXCA 2BYFA 2JQRB 1UELA 2V4LA 1WZ0A 3IBEA 4IOIE 2Q5WD 1EWYC 3V09A 2AX5A 3P4RB 1HZ6A 3A9JA 1L4DB 2Z8KA 3MHSD 4HCNB 2C7MB 5CTRC 4NAWA 4HJKA 3LB8C 1KW2A 2I1KA 4OW0A 4LA0A 2NVUI 3ML9A 2BPSA 5HG2A 2WXFA 1IGCA 2ZCCA 3SHQA 2J0JA 2PW9A 2KACA 3HM6X 2DYBA 2LWPA 2L05A 1WXMA 4F5SA 2E6XA 3ABVB 2WDTB 1K51A 2O6VD 4EUTA 2ASQA 1TS5A 2L7RA 2PLPA 3H7PA 2BYVE 3B0AA 4HKQA 3NVVA 4IWPA 4MEMA 4WAFA 1TZOA 4TV3A 1TKYA 2IO2B 2MEKA 3WIMA 3FWBC 4JE3B 4R3DA 1V86A 3ALBA 3RUIB 2KFKB 3H3AA 3LDZE 1ISNA 2BTEA 1QILA 2GOWA 1YQ3B 3LU6A 2I2ZA 4FHJA 4HVBA 2R2QA 4K81A 1SBBB 1N5XA 2WXLA 4XWWA 3AN1A 2KLGA 3PGEA 4K7UA 1XXGA 2CU3A 4PO0A 1ZXIA 2YEPB 3DCGA 5IIXA 3QAQA 2WXOA 1I4HA 2MBEA 4ARIA 2DYOA 4JLCA 2ZNVC 1IBXA 3U2SC 5D6JB 1CJEA 3RD2A 1SSNA 1E9MA 1LNSA 5AZHA 3VQIA 1L6VA 3AULA 4UDUC 1XCTL 2N9KA 4YSZB 4GMVA 2H88B 2LGDA 3DVNU 1JWSD 3E9SA 3MJWA 5L95C 3AE7B 5J17A 3AU5A 2IZVB 1XT9B 2KQ4X 2JXTA 4AOFA 2O2VB 4EE2A 3AEFB 1NI2A 4BBNC 1WJ6A 1V2YA 5C3JB 2YLMA 1R7SA 2XSIA 5D7GA 2AYOB 1HA5A 2A4ZA 1Z2MA 3PRPB 2DBXA 3CF6E 1YN3A 2EFDA 3T3NA 2KDMA 5IJFA 3Q8BA 3H6NA 3VTWA 2JU6X 3DOWA 1IYFA 4WWMA 4NJ6A 1YQ4B 3NRZA 2WLBA 1QZEA 1WI0A 1K53A 3QQ8B 1JWUD 3VVWB 3M95A 3NMUA 4RGOS 1QLBB 3RCZA 2PMVA 1VZ6A 2FIDA 4OVUA 3TCAA 3P42A 1V1PA 1ZKHA 1IUEA 3ZNHB 4M8NA 4G50A 1AW7A 4WA6B 3VR9B 4L8UA 4FHKA 1I4XA 4EZJA 5AEKB 2JXXA 5GINA 4ANUA 3PLUA 2MX2A 3LU8A 1FCCC 2KTRA 2HDEA 4RMAA 3BK2A 2G4DB 2DWQA 3ZVVA 3TEZA 2BT6A 3S2AA 3U4EG 2G9HD 3FILB 3V3XA 1E8YA 2FE8A 1WSPA 2IY1B 4GDKA 1C4CA 2UWQA 1VRAB 3V6EB 4G3XB 4HKZE 1AWDA 5JZEB 1E7HA 3V03A 1RAXA 2N7JA 3TEWA 2MBHA 1N5UA 2CHXA 1FRRA 4ZRJA 1C4PA 4CQNA 1DOYA 2BXMA 3WHQA 1L2NA 3D32A 4NQKE 2IYDB 2XVVA 2Z8IA 4W9EA 1JWBD 2WNMA 3IAM1 2L3ZA 4HK2A 1YN4A 4JQWC 1P0RA 1ACCA 3A9KA 3IVFA 1YJIA 2JSVX 3MC0B 3JVZX 1NYRA 1E5WA 4W9KA 4WJPA 3BY4B 4MH8A 2L52A 2BYTA 2WS3B 4JX1C 4XE0A 4MSMB 2LHDA 4ZHPA 3VXWA 1A5RA 5H8YE 4RGTA 1TY0A 2C9WB 1ZXHA 4JPSA 2D10A 1HZ5A 1WYWB 2IGHA 2MWSB 4ZHOA 1WX9A 4ZYSA 2AQ2B 4DHJD 1NT2B 3FNMA 3TBLD 5EE0A 2IDYA 3GQXA 3BVMA 4GN1A 3AE1B 4YSXB 1WM2A 4DHJB 2LMCA 5EE1A 1TYGB 3SU8X 3KQ4A 4FK5B 3VDZA 3SEBA 3H7SA 2PE6B 2VZKD 4FADA 1I42A 2LASA 1TXUA 3KWLA 2YEPF 2FNJB 2KLCA 1XLQA 4IG7B 2VZKB 2PJHA 2BWES 2MA9B 3WALA 3AEEB 1IBXB 5TR5A 3AV8A 3CIRB 1MHHE 2EKEC 1XQQA 5DPWA 1C78A 5DQFA 3OJ3A 4EOYA 2ICIA 1IJGA 4ZDVA 2JX5A 1FIQA 1MIWA 3WAMA 2DBWA 2BXHA 3VFKA 3WANA 4FJCB 2L8JA 2M17A 2W3RA 1JCKB 5BYRA 1MHXA 1V5OA 3EGRA 1QOBA 1MPEA 4E3CA 4HEA1 2WX0A 2CHZA 3PREA 3H37A 1V81A 3WAOA 2MJ3A 3DWGC 5BMGA 2EFHA 3AH7A 3L10B 2M0XA 5D3IB 2WX1A 3U30A 1D3ZA 2IPKD 2RPVA 1EF1A 2XBBC 1WMHB 1JALA 1UWMA 2QSDA 2LEKA 3OAWA 2KDFB 5BMIA 1BXTA 3SFDB 3U7ZA 1RLFA 4GDLA 5GIPA 1YMHE 1J7CA 3WCQA 2WDVB 2CR5A 2V1YA 3ZJUA 1V1PB 2J42A 5AUIA 1FO4A 4GDXA 3DVNV 4ZRIA 4CO7A 2KMAA 4FJYA 1T0YA 4AJYB 1WE7A 1YJJA 1JMLA 3UF8A 2JUHA 3AEGB 1MIYA 3NUHB 3KVFB 4YL8A 1GOZA 2IJ0A 3GQUA 3ZLZA 1F2RC 3PO0A 2QHBA 2NBVB 2BF8B 4DQOC 4LJOB 1DOXA 5KHQA 2DBUA 2ZVOA 4RGMA 4MJSA 2K8HA 4GDKB 4KSLC 5JHBA 3VR8B 1RRBA 3TSSA 4HDOA 4DXGA 4XZ4A 1GNUA 2BXEA 2ZNVB 2BB5A 1VR9A 4N9F4 1B1ZA 4B95A 1L0YB 2N4FA 2RDGA 4XWTA 1U4AA 1UGJA 3W5VB 1E8WA 1F2RI 1HK5A 4N0FD 1WIAA 4NNJB 3A9KB 2JUOA 3A73A 2NQOA 4N0UD 3JRYA 3ZUNA 5EE3A 1N63A 1XLNA 4KGSA 3V08A 3HK0A 3TMPB 4FULA 4M0WB 2AQ3B 2BXLA 1L7YA 4ICVA 2KWVB 1F77A 1ESFA 5JH5C 2AEHA 2R2OA 1CK1A 2BKFA 2K8CA 4BVUC 2IO1B 2KKCA 3C0RB 3HIZA 3Q8FA 4RF1A 3BYTB 3PHXB 2L83A 4US8A 1H5WA 1XF5L 1WJUA 3R8BA 4EZLA 4F5TA 4A20A 2RMMA 4MGKE 1JRPA 1PUTA 3IHPC 3ETRA 4WJNA 2LZ6A 1YN5A 2Y5PA 1BM0A 3ZDTA 3WHRA 4J6IA 3NY5A 4TKNA 2XVWA 3IT6B 4WWPA 2KDBA 2JYEA 4ZBQA 1CMXB 1R4MI 3UGBB 1E7BA 1GAQB 2JWZA 2FCMA 4WAAA 3HVDA 2BXOA 1GNJA 4JWUC 4GLSC 1EUVB 1MG8A 3MHZA 4L9KA 2J0KA 4IW2A 2G4SA 5FK9C 5IJ5A 2KFJA 3LU7A 2BXDA 2WQYB 3AE2B 3MJ5A 2PVGC 5DCNA 4A8XC 3VTVA 2NMQA 2AQ1B 4RNAA 3LXFA 3QJZA 3R7RA 1L4ZB 1IGDA 4AS1A 1E78A 2LVPA 3Q3FA 4K2CA 5G55A 3AECB 1HK3A 2WXHA 2V36A 3MHSB 2GMIC 3ZO5B 5IIUA 4OT2A 2KZRA 3ZTDA 1VDVA 3BYYB 1TGZB 2REXA 4KSKC 2X38A 1FCLA 5L83A 1TS4A 4YWGG 4L23A 2OT3A 1V80A 1C4AA 4B9KA 1ENFA 3RULA 5IFOA 4Z69A 5FR6A 4KIKA 4AWJA 1KOTA 4O1NA 2M0AA 5GXGB 1WR1A 1S1QB 4FN2A 2O6VB 1HEZE 4LLGM 4ZRQA 4JK4A 5FKAC 3GB1A 1MA9A 4OZAA 1TF0A 4CYEA 1V6EA 1C3TA 4W9IA 2MRPA 4EFOA 2QIEB 3SFEB 1F0ZA 1LQBA 4ICUA 2LGXA 4K7SA 2JT4B 3CSTA 2BS3B 3APCA 4RCOA 2BXFA 3NVWA 1GC6A 4WWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KD0 A;  4GDK A;  4G11 A;  5J2R A;  2LGY A;  2N9E B;  1H8C A;  2UWQ A;  4E71 A;  3V6E B;  2HD5 B;  4G3X B;  4BKG A;  2KVR A;  1Q5W B;  3RZF A;  3X0W A;  4MJS B;  3VH4 B;  5JZE B;  1RAX A;  1SE9 A;  1WGR A;  2K8B A;  2DYM A;  3EHV A;  2MBH A;  2CHX A;  2CS4 A;  2PPH A;  1RFA A;  4XX5 A;  2CKH B;  2RD0 A;  4ZRJ A;  3L08 A;  4MM3 A;  2MP2 A;  1L2N A;  3D32 A;  4W9F A;  1J19 A;  1SIF A;  2NR2 A;  4NQK E;  2K1F A;  2PE9 A;  2IYD B;  3VUY A;  1OEY A;  2EMT A;  4HCP B;  4W9E A;  3L13 A;  4PS3 A;  1UGM A;  2L3Z A;  3ZIM A;  3X23 A;  4HK2 A;  3HHM A;  2MCN B;  1E90 A;  2IY0 B;  3JSV B;  4JQW C;  5J18 A;  1P0R A;  3A9K A;  3IVF A;  1IPG A;  4IM0 A;  3PS6 A;  1UD7 A;  3JVZ X;  5G2N A;  3N30 A;  1SGH A;  1E5W A;  4KDI C;  4W9K A;  4GGQ A;  4WJP A;  1WFY A;  1WZ3 A;  3BY4 B;  2FCN A;  1E8Z A;  3PHW B;  2M4N A;  1GJZ A;  3KYD D;  2IO3 B;  1F9J A;  4MSM B;  3VXW A;  4BKS D;  3TL5 A;  2UYZ B;  1A5R A;  2D3G A;  1WXS A;  2IBI B;  3DQV A;  5LXI B;  4CHK A;  4IM3 A;  3WA0 A;  4WJO A;  1J0G A;  2C9W B;  2O6V A;  2B3A A;  2D10 A;  3ENE A;  5CHF A;  2FCS A;  4BKT A;  3EC8 A;  2DZJ A;  5DPT A;  3GOE A;  1WYW B;  5CX3 A;  2EMS A;  3H9D A;  3M63 B;  1UH6 A;  4A3P A;  2JRH A;  2JZ3 B;  2MWS B;  1LXD A;  3M62 B;  3NZS A;  1WX9 A;  4KVG B;  3DBS A;  4AJW A;  4DHJ D;  3MTN B;  1YX6 B;  2DHZ A;  4GU2 A;  5E6N A;  4FA6 A;  4ANV A;  3TBL D;  3PPA A;  1WF9 A;  3QIJ A;  4DBG A;  3QHT A;  1WGG A;  3R3M A;  4AUQ C;  2LVQ A;  3QWZ B;  4W9C A;  2FCQ A;  2JRI B;  2N1W A;  3PRZ A;  2NCN A;  3K9O B;  4GN1 A;  4W9J A;  1WM2 A;  4IWO A;  1WGD A;  4DHJ B;  2KWC A;  3M3J A;  3SU8 X;  2KC1 A;  1YD8 U;  3TJP A;  3VDZ A;  3H7S A;  1WX7 A;  1S3S G;  2D11 A;  1WJ4 A;  5HKH A;  1OTR B;  2NPT A;  2PE6 B;  2G45 B;  1AAR A;  4DXA B;  2QHO A;  4RM9 A;  4A3O A;  4IUM B;  4FAD A;  1I42 A;  3APF A;  2LAS A;  4OVV A;  3A33 B;  1J8C A;  2GBJ A;  4GDL B;  1KJT A;  2L00 B;  2YVC A;  3DVG Y;  3NOB A;  4FLH A;  2FNJ B;  2J0M A;  1YIW A;  1YX5 B;  2KLC A;  4GB9 A;  2LXA A;  1KM7 A;  2XK5 B;  2KQS A;  2MBQ A;  4IG7 B;  2PJH A;  2BWE S;  2DZM A;  2MA9 B;  4DWF A;  4E74 A;  3WAL A;  2LXC A;  2RPQ A;  3A4S C;  3BIN A;  4G0N B;  5TR5 A;  3V62 A;  3PRM B;  4AP4 C;  2KHW B;  2EKE C;  5KHO A;  2GBR A;  1XQQ A;  2Z0E B;  2RGF A;  3TIX A;  4EZK A;  5DPW A;  4MDK E;  4LCD E;  2FUH B;  4MH0 E;  4NQL B;  4NPN A;  5JHA A;  2KJR A;  3ONS A;  1OGW A;  5DPS A;  3OJ3 A;  3EEC A;  5EDS A;  2KOX A;  4EOY A;  1WE6 A;  4ZDV A;  2V3S A;  1YQB A;  3A1Q A;  3WAM A;  2W9N A;  4M8M A;  1I35 A;  2LJ5 A;  1UBI A;  3PVL A;  2NS5 A;  3R66 C;  3ZTC A;  3VFK A;  3WAN A;  2L8J A;  2M17 A;  2K25 A;  2KTF A;  2O2V A;  1WXV A;  3ZDM C;  2ZZP B;  2KJH B;  1V5O A;  1GC7 A;  2L0F A;  1TBE A;  2D2Q A;  4ASW C;  5LXH A;  4ZRK A;  3V60 A;  4E3C A;  2BGF A;  2WX0 A;  3VHT C;  2CHZ A;  2FAZ A;  3PRE A;  5LLI A;  1V81 A;  2K6D B;  3L17 A;  1WGY A;  3WAO A;  2KDI A;  4DDG D;  5AZG A;  1R4N I;  1V9J A;  2BYE A;  1WM3 A;  3A9J B;  3L16 A;  2ZVN A;  3L10 B;  4BFR A;  2M0X A;  3T8M A;  1P3Q U;  2JVC A;  2WX1 A;  4K7W A;  3U30 A;  1P98 A;  3N3K B;  4HDQ A;  4MGZ E;  4NAW B;  2ZEQ A;  1P9D U;  2KDE B;  4ZYN A;  1EF1 A;  2XBB C;  3OLM D;  3V61 A;  1D3Z A;  2FIF A;  1WMH B;  3DBR I;  2HTH A;  3PZD A;  4PS8 A;  4KZ0 A;  3DPD A;  3RT3 B;  4DHZ E;  3KUZ A;  2MLB A;  4F1S A;  4TQ1 A;  3OAW A;  2KDF B;  3N32 A;  2K6Q A;  2NBU A;  2N1V A;  5AZF A;  1RLF A;  2LRW A;  4GDL A;  2N9P C;  1WGH A;  3OJ4 B;  2BWF A;  5DPR A;  4MEL A;  3QCA A;  4IC7 B;  2CR5 A;  1PQS A;  2XK5 A;  2V1Y A;  3QA8 A;  1UZX B;  3NZU A;  2NBW B;  3L0W B;  4K1R B;  2WWZ A;  2KMC A;  3IFW B;  3DVN V;  4EKU A;  2M1M A;  4ZRI A;  1P1A A;  3H7P B;  4I6N B;  1Z5S B;  2KMA A;  3HM3 A;  1T0Y A;  2Z0D B;  2ZCB A;  3KUC B;  2HE7 A;  4FJV B;  4FJY A;  1WE7 A;  3O65 B;  3PT2 B;  3VUX A;  3ZNG C;  2PEA A;  4BBN F;  4ANW A;  3QC8 B;  3UF8 A;  1GG3 A;  1WR6 E;  2C7N B;  2KAN A;  5C1Z A;  3DBL I;  3KVF B;  4YL8 A;  2C7H A;  3ZLZ A;  2LD9 A;  1LM8 B;  4W9H A;  1BT0 A;  5C23 A;  4HLE A;  1EO6 A;  2A5U A;  3SD5 A;  1WRD B;  2NBV B;  2BF8 B;  4LJO B;  5CHW A;  1VCB A;  3AXC A;  5KHQ A;  2KWU B;  2ZVO A;  4URK A;  1EF5 A;  2BYF A;  3KUD B;  4TUU A;  1FXT B;  1UEL A;  2KQ7 A;  2V4L A;  1WZ0 A;  3ZRC A;  3IBE A;  2Z59 B;  4MJS A;  4BOZ B;  2K8H A;  4GDK B;  3IG3 A;  4KSL C;  5JHB A;  4DHZ B;  1KLV A;  4GSW A;  2KJ6 A;  1RRB A;  2LUE A;  3A9J A;  4HDO A;  2OOB B;  4JIO U;  3MHS D;  4XZ4 A;  1WY8 A;  2C60 A;  2MSE D;  1GNU A;  2ZNV B;  4HCN B;  2C7M B;  2MP2 B;  4N9F 4;  5CTR C;  3RYT A;  4GOC A;  4NAW A;  2KO3 A;  4HJK A;  2I1K A;  4B95 A;  1GUA B;  4B6W A;  2N4F A;  2NVU I;  3VTU A;  1Q1O A;  1WMH A;  3W1Y A;  3ML9 A;  2BPS A;  3UQB A;  3JSV A;  1U4A A;  4MGI E;  3UIP B;  1E8W A;  2ZCC A;  4HPM B;  3SHQ A;  4JGH B;  3B08 A;  2J0J A;  3AU4 A;  1WIA A;  4NNJ B;  3A9K B;  2AWT A;  2JUO A;  3K9P B;  3HM6 X;  2DYB A;  2LWP A;  2CHW A;  4WQO B;  4FJZ A;  2L05 A;  3ZUN A;  1WXM A;  3I3T B;  2WDT B;  1E7V A;  3HK0 A;  2JF5 A;  3TMP B;  4FUL A;  4M0W B;  2O6V D;  5IA7 A;  4EUT A;  2ASQ A;  3B1L X;  1L7Y A;  4ICV A;  2KWV B;  2LRU A;  4W9L A;  2KK8 A;  2L7R A;  1IP9 A;  3ECI A;  1C1Y B;  4HWI B;  3PTF C;  3H7P A;  3CSF A;  5GMV A;  3VUW A;  5JH5 C;  2AEH A;  2R2O A;  2L0T A;  2OJR A;  2BYV E;  3R7Q A;  4BKS A;  3B0A A;  2BKF A;  2K8C A;  2KC2 A;  2VRR B;  4BVU C;  3ML8 A;  4PYZ A;  1G6J A;  2IO1 B;  3EFU A;  3KYC D;  4IWP A;  4MEM A;  4TV3 A;  4W9D A;  2KKC A;  2IO2 B;  3P2B A;  3VH3 B;  3C0R B;  3HIZ A;  3WIM A;  3UQA A;  2JPH A;  4JL9 A;  4MSQ B;  1M94 A;  3T9L A;  1V86 A;  2JY6 A;  2LI5 A;  3DDC B;  3ZNZ B;  2ZJD A;  3PHX B;  4DK5 A;  3ALB A;  4MGY E;  4HPL B;  1XD3 B;  3V6C B;  1UBQ A;  3RUI B;  1WJU A;  2K39 A;  4EZL A;  2KFK B;  1V49 A;  3LDZ E;  4A20 A;  4MGK E;  1ISN A;  3IHP C;  2GOW A;  2DX5 B;  4CO7 A;  2MQJ A;  4RM8 A;  4FHJ A;  2GBK A;  4WJN A;  4HVB A;  2LZ6 A;  2R2Q A;  2ZPN A;  4K81 A;  3W1S C;  1V5T A;  4IWQ A;  3ZDT A;  3QK0 A;  2KLG A;  2NPT B;  3PGE A;  4K7U A;  4J6I A;  3UIO B;  5E6P A;  4LDT D;  3NY5 A;  4TKN A;  2D07 B;  3DCG A;  1LFD A;  3QAQ A;  4WWP A;  2CU1 A;  2KDB A;  2MBE A;  5E6O A;  4W9G A;  3KH0 A;  1CMX B;  1R4M I;  3UGB B;  2DYO A;  2MBO A;  4WWO A;  4JLC A;  4TQ0 A;  2ZNV C;  1TTN A;  4F7Z A;  1E7U A;  2JWZ A;  4LDT B;  2DZK A;  5D6J B;  5IAA C;  2FCM A;  2XEW A;  4WAA A;  3WAP A;  2N9X A;  4GXB A;  3RD2 A;  4F8C B;  3NHE B;  2GBM A;  2KX0 A;  5AZH A;  3VQI A;  1EUV B;  4WJQ A;  1MG8 A;  3AUL A;  5CHV C;  1Q0W B;  5D94 A;  4BOS C;  4GMV A;  3ZNI D;  2DAJ A;  4GIV A;  2KTR B;  2J0K A;  4NY0 A;  2LGD A;  3A4R A;  3DVN U;  1OQY A;  2KNB A;  3MJW A;  4KV2 A;  4FBJ B;  2G4S A;  5L95 C;  4WWN A;  2KFJ A;  4I6P A;  5J17 A;  3AU5 A;  3A1Q B;  4NJ7 A;  3DBH I;  4X57 B;  2IZV B;  1XT9 B;  1X1M A;  1ZW7 A;  5DCN A;  4AOF A;  1WJN A;  2KX3 A;  2O2V B;  1NI2 A;  3VTV A;  1WJ6 A;  4BBN C;  3ZKJ C;  1V2Y A;  1ZGU B;  2YLM A;  3QJZ A;  3U8Z A;  4II2 B;  4PYU A;  3R7R A;  5D7G A;  2AYO B;  2G3Q B;  2A4Z A;  1Z2M A;  2LVP A;  2M8S A;  3CMM B;  3PV1 A;  3QAR A;  3PRP B;  3JW0 X;  3ZW3 A;  3CF6 E;  2WYQ A;  3DVG X;  3UIN B;  2KFK A;  3Q3F A;  3QX1 A;  2DAF A;  3KW5 B;  3H6N A;  3L54 A;  2C5L C;  2BKR B;  4XC2 A;  1H4R A;  3JYU A;  5G55 A;  1VD2 A;  3VTW A;  4II3 B;  1NDD A;  1WXA A;  3DOW A;  1IYF A;  2GMI C;  3ZO5 B;  3PLV A;  1WX8 A;  2KZR A;  4IW0 A;  4NJ6 A;  3ZTD A;  1QZE A;  1WI0 A;  2HJ8 A;  1TGZ B;  4LJP B;  3QQ8 B;  3VVW B;  3M95 A;  1NBF C;  2REX A;  2KXJ A;  3Q3J A;  2L76 A;  3NS8 A;  4KSK C;  5D2M B;  3RCZ A;  1YJ1 A;  5L83 A;  1WH3 A;  2AL6 A;  4P7I A;  4KZC A;  4ANX A;  2FID A;  3LJ3 A;  1Y8R C;  2MBB B;  4OVU A;  3TCA A;  2RSU A;  1ZKH A;  1E8X A;  1V80 A;  3ZNH B;  4M8N A;  4G50 A;  3GZN I;  4B9K A;  2ZPY A;  3APD A;  4HXD A;  4DDI D;  2N7D A;  3RUL A;  4KDL B;  2DZI A;  2KN5 A;  5FR6 A;  4KIK A;  4FHK A;  3ZRF A;  4AWJ A;  1KOT A;  2AL3 A;  1HE8 A;  2JZZ A;  1WR1 A;  1OEY J;  2RR9 A;  1S1Q B;  3U7D A;  4FN2 A;  3PSE B;  4EZJ A;  5AEK B;  2JXX A;  3VAW A;  2O6V B;  3SDL C;  5BO4 B;  4ANU A;  3PLU A;  2MX2 A;  4AJY B;  2J7Q B;  2N7E A;  4EEW A;  2KTR A;  1TZ1 A;  2I1J A;  4I6L B;  4RMA A;  2G4D B;  4CYE A;  1JRU A;  1V6E A;  3RZW C;  1C3T A;  1K8R B;  3AI5 A;  4W9I A;  3ZVV A;  4KIK B;  2LVO A;  2MRP A;  4PS7 A;  4EFO A;  1LQB A;  4ICU A;  4IM2 A;  2DEN B;  2LGX A;  3H1U A;  3W1S A;  4K7S A;  2GBN A;  2JT4 B;  3CST A;  3APC A;  3S2A A;  1E8Y A;  2Y5B B;  1GC6 A;  2IO0 B;  2MW5 A;  2IY1 B; 
#chains in the Genus database with same CATH topology
 2N0S B;  4G11 A;  3P1M A;  4E71 A;  3MFG A;  4BKG A;  2KVR A;  1Q5W B;  3X0W A;  4MJS B;  2DYM A;  3EHV A;  2PPH A;  2CKH B;  2RD0 A;  4MM3 A;  4W9F A;  1TKG A;  1PGB A;  3BVG A;  4NJC A;  4RFB A;  2K1F A;  2XNA C;  4HCP B;  1VZS A;  2R61 A;  1UGM A;  1SE3 A;  4WUR A;  4US9 A;  2XW1 A;  1IPG A;  4IM0 A;  1FMA D;  3W9C B;  3PS6 A;  3V05 A;  1UD7 A;  1HK2 A;  2B76 B;  3N30 A;  4M01 A;  4GGQ A;  2D5G A;  3AB5 A;  2FCN A;  1E8Z A;  2FUG 1;  2M4N A;  3KYD D;  1LOT A;  2UYZ B;  3TL5 A;  3Q3O C;  2IBI B;  5LXI B;  2M19 A;  3FWC C;  3FAH A;  2BXQ A;  4WJO A;  2J53 A;  1FPY A;  1QOF A;  4BKT A;  3GOE A;  1FXA A;  3B2G A;  1XLO A;  5CX3 A;  2XVQ A;  4M02 A;  4S1Y A;  3H9D A;  3M63 B;  1UH6 A;  3VRB B;  4KVG B;  4OTU A;  4AJW A;  3N1Z C;  3MTN B;  1YX6 B;  2DHZ A;  5E6N A;  4FA6 A;  3EUB 2;  2AJE A;  3QHT A;  1QOG A;  3QWZ B;  2FCQ A;  2JRI B;  2N1W A;  2NCN A;  3K9O B;  2RDH A;  4IWO A;  3AE9 B;  2ZW0 A;  4A90 A;  1YD8 U;  3DBH B;  3TJP A;  2D11 A;  1PGX A;  5HKH A;  2NPT A;  1F1H A;  4DXA B;  2QHO A;  4J2V A;  2BB6 A;  4IUM B;  3A33 B;  1I7H A;  3NOB A;  2J0M A;  1YX5 B;  2CJO A;  1ROE A;  2XK5 B;  2KQS A;  4HRS A;  3GE8 C;  2DZM A;  4E74 A;  2RPQ A;  3A4S C;  2MH7 A;  4Z9O A;  2WXG A;  2GBR A;  1SJE D;  3R2T A;  4MH0 E;  4EMX A;  4NQL B;  1FD6 A;  1T0Q C;  3WHS A;  3ONS A;  1OGW A;  5EDS A;  2KOX A;  2V3S A;  1YQB A;  3A1Q A;  1XCQ L;  2W9N A;  2LJ5 A;  3MC8 A;  1UBI A;  2NS5 A;  3ZTC A;  1OQQ A;  1WXV A;  3ZDM C;  2KJH B;  3GZN B;  2L0F A;  1TBE A;  2D2Q A;  3FC4 A;  4FIP B;  3C8Y A;  5LLI A;  3Q8C A;  4OHJ A;  1WGY A;  1VZ7 A;  3ZJV A;  1QKZ A;  3Q3M C;  1WRI A;  1V9J A;  5AZG A;  2BYE A;  3A9J B;  2SEB D;  4BFR A;  1NYQ A;  4ZBR A;  4MBE C;  1P3Q U;  1P98 A;  1MG4 A;  4MGZ E;  4NAW B;  2N9L A;  1P9D U;  2ZEQ A;  3DBR I;  2WU5 B;  2HTH A;  4PS8 A;  4S17 A;  3DPD A;  4Q2J A;  3RT3 B;  2W54 A;  3KUZ A;  4F1S A;  5C2T B;  2BXA A;  2LRW A;  5HHD G;  4KGT A;  1WGH A;  3OJ4 B;  2BWF A;  2INC C;  4ITK A;  4B0M A;  1P7E A;  1FFV A;  1UZX B;  3AE3 B;  1PGA A;  4K1R B;  1YNT E;  4ARC A;  4EKU A;  2INP E;  2M1M A;  1ZPS A;  4P16 A;  1P1A A;  3H7P B;  4KIK B;  1Z5S B;  5G5G A;  2ZCB A;  4TMA B;  3O65 B;  3PT2 B;  4D2K A;  3NVY A;  2I38 A;  5FUO A;  1GG3 A;  4DHX B;  1WR6 E;  5TSS A;  2E0Y A;  1ZE3 D;  5C1Z A;  5JXV A;  3ICX A;  3NVZ A;  1LM8 B;  2E0X A;  2QIL A;  3SD5 A;  1QQR A;  1KXP D;  2KAJ A;  2MJE A;  3HVZ A;  2K22 A;  4URK A;  5E6J A;  3KUD B;  2W82 A;  1FXT B;  3ZRC A;  1L5P A;  1NEN B;  3TEX A;  2EEL A;  2WP9 B;  4GSW A;  4P1C C;  2KJ6 A;  1SEB D;  4ZCG A;  2LUE A;  2IGG A;  3SIU B;  3Q8A A;  3SQJ A;  2OOB B;  4JIO U;  1WY8 A;  2C60 A;  2MSE D;  4G03 A;  3B9M A;  3N1X C;  2KMM A;  3RYT A;  2KO3 A;  1GUA B;  1P7F A;  4B6W A;  3W1Y A;  1Q1O A;  1XEE A;  3UQB A;  3JSV A;  4N58 A;  1QF6 A;  4MGI E;  4NAM A;  3AU4 A;  3K9P B;  1E7C A;  1STE A;  2OED A;  4M70 B;  1D5X C;  4HGK A;  3I3T B;  2MJD A;  4IW1 A;  4W9L A;  3LYY A;  2LRU A;  3Q69 A;  5D3D A;  4HWI B;  5MPO A;  1T6B X;  3PTF C;  1I4G A;  3OWE B;  3CSF A;  4BKS A;  2KC2 A;  1SXT A;  3ML8 A;  4ZRP A;  5AUK A;  3EFU A;  3KYC D;  4W9D A;  2JPH A;  3I57 A;  4JL9 A;  4MSQ B;  3AM9 A;  3T9L A;  3PZ8 A;  2KBZ A;  2JY6 A;  2LI5 A;  2TSS A;  2ZJD A;  3IXS A;  1PDX A;  3I9V 1;  1K50 A;  2BXK A;  1UBQ A;  4HJG E;  1CZP A;  2KVZ A;  1V49 A;  4RM8 A;  2DLB A;  1TIF A;  1HK4 A;  1NI3 A;  1V5T A;  4IWQ A;  3QK0 A;  3URY A;  2NPT B;  3RNF C;  1SIJ A;  1LFD A;  3AE5 B;  4G04 A;  2M56 B;  2CU1 A;  1HXY D;  1L0X B;  2D3A A;  4W9G A;  3TUO A;  2MBO A;  3ZQ4 A;  4TQ0 A;  1TTN A;  3SIV B;  1NEK B;  4F7Z A;  1E7U A;  2XN9 C;  2DZK A;  4J3O D;  2LJI A;  2XEW A;  3WAP A;  4K71 A;  1FFU A;  2BXG A;  4F8C B;  4BY9 C;  2GBM A;  2KX0 A;  4WJQ A;  5CHV C;  1MM8 A;  2BS4 B;  4BOS C;  2DAJ A;  2KTR B;  4LB9 A;  2WXI A;  4KV2 A;  4WWN A;  4I6P A;  4N3Z A;  1RM6 C;  3A1Q B;  3DBH I;  3BZD B;  3Q2A C;  4PT5 A;  1X1M A;  2BVC A;  3E56 A;  4BZA A;  4N6E B;  1ZDX A;  4RH6 A;  4PYU A;  1UF0 A;  1D4B A;  1I4Q A;  3CMM B;  3PV1 A;  3QAR A;  3ZW3 A;  2LGS A;  2KFK A;  3QX1 A;  3DBL B;  3UIV A;  3L54 A;  2J4X A;  2BKR B;  5HI1 A;  1H4R A;  1EM7 A;  5IJE A;  1VD2 A;  2JZP A;  4II3 B;  2VH1 A;  1NDD A;  1WGK A;  3PLV A;  2SAK A;  5B5T A;  1WX8 A;  4IW0 A;  2HJ8 A;  4LJP B;  1XO3 A;  3ZYY X;  1GB1 A;  1FNU A;  2KXJ A;  2L76 A;  5D2M B;  5BPK A;  1WH3 A;  4GG2 A;  3JQZ A;  4ANX A;  1Y8R C;  1WWT A;  3EFC A;  2Y3A A;  1ZP0 B;  2RSU A;  1E8X A;  3GA9 L;  2PKO A;  3GZN I;  2ZPY A;  4KDL B;  4JWS C;  4C7Y A;  2AL3 A;  2JZZ A;  3BK1 A;  1OEY J;  3PSE B;  3AEA B;  3CX9 A;  4OR0 A;  1FNW A;  2GRI A;  2J7Q B;  1TZ1 A;  2I1J A;  2Z8L A;  2QC8 A;  2V3P A;  1JRU A;  1I4R A;  1K8R B;  2LVO A;  1TKE A;  4PS7 A;  2WDQ B;  1EU4 A;  5H92 C;  4IM2 A;  1JQ4 A;  3H1U A;  4ZUX V;  2GBN A;  3NS1 A;  2WXK A;  2HD5 B;  1TS2 A;  2HTM E;  2BXI A;  3N20 C;  3A75 A;  3VH4 B;  2K8B A;  1LGR A;  1NVI D;  1RFA A;  4XX5 A;  2MP2 A;  3TEY A;  1HK1 A;  1SIF A;  2NTS A;  2NR2 A;  4KKJ A;  2PIA A;  4YTM B;  4LNI A;  3VUY A;  1OEY A;  1L6U A;  1C79 A;  2DBY A;  4PS3 A;  1JWM D;  3HUI A;  1JW9 D;  3X23 A;  1GNI A;  3JSV B;  4C56 C;  2EFE A;  1EWC A;  5G2N A;  1SGH A;  2WXN A;  3AE4 B;  1V97 A;  4K3C A;  2BXB A;  1WFY A;  1V8C A;  4LB2 A;  3PHW B;  1GJZ A;  1TT5 B;  1F9J A;  4BKS D;  2D3G A;  1WXS A;  1E7G A;  4CHK A;  4IM3 A;  5LNK 1;  4HRO A;  2WXR A;  3MHH B;  1E6E B;  2B3A A;  5DBY A;  3ENE A;  1KTK A;  1FM0 D;  3EC8 A;  1D5Z C;  5DPT A;  1O9X A;  4C4V A;  2BBC A;  2EMS A;  3H8H A;  1QOA A;  2JZ3 B;  1LXD A;  3M62 B;  3NZS A;  4P6V F;  4ANV A;  3QIJ A;  2L32 A;  1WGG A;  4AUQ C;  2LVQ A;  1OFF A;  3PRZ A;  3AE8 B;  1WGD A;  2KWC A;  4RF0 A;  2KC1 A;  4A6Q A;  1S3S G;  4KKI A;  2LXT A;  3U52 E;  1RWS A;  4A55 A;  3APF A;  1J8C A;  2KN4 A;  4GDL B;  1KJT A;  2L00 B;  2YVC A;  3DVG Y;  1N5W A;  2V0G A;  1J78 A;  4F5U A;  2LXA A;  1BKE A;  5FR3 A;  4USA A;  2LXC A;  1K52 A;  3V62 A;  4AP4 C;  3PRM B;  2K9X A;  1HA2 A;  5KHO A;  3R2I A;  2RDB C;  4L2Y A;  4YTN B;  4EZK A;  4MDK E;  4LCD E;  2FUH B;  5JHA A;  1AO6 A;  3NVI A;  2BXC A;  5GIO A;  5DPS A;  3EEC A;  2QMT A;  1WE6 A;  1KLU D;  1D5M C;  3ZGZ A;  4M8M A;  4LNN A;  3BVZ A;  2PVO D;  5BMH A;  4LNK A;  2KTF A;  4KGR A;  3AMZ A;  4L1B A;  2ZZP B;  4ASW C;  5LXH A;  3V60 A;  2W55 A;  1RYJ A;  2NTT A;  2KDI A;  2WU2 B;  1E7F A;  4DDG D;  3B9L A;  3L16 A;  2ZVN A;  2BW2 A;  4IKG A;  2JVC A;  4LNO A;  2Y5C A;  1T5X D;  4ZYN A;  3B2F A;  2W3S A;  1VLB A;  4DXF A;  2FIF A;  3PZD A;  4B0E A;  2WGS A;  4DHZ E;  2MLB A;  4KX6 B;  3N32 A;  2K6Q A;  1PFD A;  2N1V A;  5AZF A;  5T8I A;  2JYT A;  2N9P C;  1E7A A;  1MVK A;  5DPR A;  3BPJ A;  1MUS A;  3QCA A;  4IC7 B;  3J9C A;  2FBW B;  3NZU A;  2XMO A;  2KMC A;  3RFZ B;  2INN E;  2QEJ C;  3HRD D;  4I6N B;  3RZF A;  1E7P B;  2Z0D B;  2HE7 A;  4BBN F;  4ANW A;  3QC8 B;  3PZ7 A;  1EU3 A;  1M4V A;  2BQQ A;  2K0P A;  3DBL I;  2LD9 A;  4W9H A;  1EO6 A;  1GB4 A;  1WRD B;  4H2A A;  5CHW A;  2I30 A;  4HGM B;  2KWU B;  3W2D A;  1SJH D;  3N9Y C;  1EF5 A;  4TUU A;  1N61 A;  2KQ7 A;  2Z59 B;  1UUP A;  4BOZ B;  3IG3 A;  2PTL A;  2ZW1 A;  4DHZ B;  1KLV A;  3P4P B;  2BXP A;  3MC9 A;  4ZBK A;  1C77 A;  2MP2 B;  4GOC A;  3VTU A;  1WMH A;  3OG5 A;  2BXN A;  2XW0 A;  3UIP B;  4HPM B;  4JGH B;  3B08 A;  2AWT A;  2E3T A;  3DWM A;  2CHW A;  4WQO B;  5IIH A;  4FJZ A;  2H89 B;  1E7V A;  2JF5 A;  5IA7 A;  3B1L X;  4K3B A;  5GHK A;  4XGA B;  2KK8 A;  1IP9 A;  3ECI A;  3KLS X;  2IGD A;  1C1Y B;  1KH0 A;  3GS2 A;  5GMV A;  3VUW A;  2L0T A;  2OJR A;  3R7Q A;  3RPF C;  2VRR B;  1BUI C;  4PYZ A;  2LGI A;  1G6J A;  3P2B A;  5ID9 A;  3VH3 B;  3UQA A;  4C4V B;  4LUH A;  1DGJ A;  1M94 A;  2AGH B;  3ZNZ B;  3DDC B;  4DK5 A;  4MGY E;  4HPL B;  2Z8J A;  1XD3 B;  3V6C B;  3N1Y C;  2K39 A;  1T0S C;  4OVZ A;  2ON8 A;  3RNA C;  2DX5 B;  1ZUD 2;  2MQJ A;  1V1O A;  1J7A A;  2GBK A;  3O13 A;  4F5V A;  1N62 A;  2ZPN A;  3W1S C;  3PLA A;  1TS3 A;  1E10 A;  1JNB A;  5IO9 A;  3UIO B;  5E6P A;  4LDT D;  2D07 B;  1ZDV A;  5HFY A;  5E6O A;  3KH0 A;  1R4N B;  4W4U B;  4WH4 A;  4OZC A;  4LDT B;  5IAA C;  1BJ5 A;  2N9X A;  1T0R C;  4GXB A;  1B9R A;  3MP9 A;  3NHE B;  3VRA B;  3TDL A;  3B9J A;  1Q0W B;  4M0W A;  5D94 A;  5G5H A;  3ZNI D;  4GIV A;  4NY0 A;  3A4R A;  1OQY A;  1Q10 A;  2KNB A;  4FBJ B;  4NJ7 A;  1C9F A;  4X57 B;  3W5U B;  1ZW7 A;  1WYG A;  2GI9 A;  1WJN A;  4WIP A;  2KX3 A;  4XDC A;  3ZKJ C;  3RI7 C;  1ZGU B;  1CQV A;  3U8Z A;  4II2 B;  1KLG D;  4C7Z A;  1QT9 A;  2G3Q B;  4LUF A;  2M8S A;  3JW0 X;  4L9Q A;  2WYQ A;  3DVG X;  4MM3 B;  3UIN B;  2DAF A;  1FNV A;  1VJK A;  3KW5 B;  1MI0 A;  2VUF A;  2C5L C;  4XC2 A;  3JYU A;  2V4I B;  4OZB A;  1WXA A;  2CKX A;  1FRD A;  2ONQ A;  4XDD A;  4ZOH C;  1NBF C;  2QM6 A;  3M99 C;  1N60 A;  4XYC A;  3Q3J A;  1KDX A;  3NS8 A;  1YJ1 A;  5BYS A;  4MT5 A;  2AL6 A;  4P7I A;  4KZC A;  3LJ3 A;  3SR6 A;  2MBB B;  2KT7 A;  4MAC A;  3APD A;  4HXD A;  4DDI D;  2N7D A;  4C31 B;  2DZI A;  2KN5 A;  3ZRF A;  1ET6 A;  4YXD B;  1HE8 A;  4N59 A;  2QMC A;  1JWA D;  2RR9 A;  1BML C;  3U7D A;  3VAW A;  3SDL C;  5BO4 B;  2N7E A;  4EEW A;  1HTO A;  4I6L B;  3NVM A;  2LUM A;  3RZW C;  1UNS A;  3AI5 A;  3NVK A;  1KRH A;  2L1A A;  1J7B A;  2WDR B;  3BII D;  2DEN B;  3W1S A;  3FKY A;  3KIK A;  2Y5B B;  2CJN A;  3AE6 B;  4AQ7 A;  2IO0 B;  2VUE A;  2MW5 A;  2KD0 A;  1I4P A;  1H8C A;  5J2R A;  2LGY A;  2N9E B;  1SF0 A;  5ID7 A;  3IT4 B;  1C76 A;  1RFK A;  1VFI A;  1SE9 A;  1WGR A;  3P4Q B;  5IN7 A;  1L0V B;  2LHE A;  2CS4 A;  2QJL A;  3RNE C;  3L08 A;  1SE4 A;  1J19 A;  3GP7 A;  4FXC A;  3Q3N C;  2PE9 A;  1TJE A;  2EMT A;  4RGN A;  3P63 A;  3L13 A;  4ZC6 A;  3ZIM A;  3HHM A;  2MCN B;  1E90 A;  2IY0 B;  1FXI A;  5BYQ A;  5J18 A;  1XLP A;  3Q8E A;  2DG5 A;  4E99 A;  4BAX A;  4KDI C;  2EFC A;  1WZ3 A;  2NNW A;  2IO3 B;  1H9Z A;  3DQV A;  2QCZ A;  3WA0 A;  1E7I A;  1ZOY B;  1KF6 B;  1J0G A;  1ET9 A;  2O6V A;  5CHF A;  2FCS A;  2KYW A;  2DZJ A;  1F52 A;  1AN8 A;  1D6E C;  3AED B;  1KFY B;  4A3P A;  2JRH A;  1AYF A;  2YDF A;  3L4P A;  3DBS A;  3P4S B;  2D3B A;  1SB3 C;  4GU2 A;  3PPA A;  4YSY B;  1WF9 A;  4DBG A;  3R3M A;  4W9C A;  1GPX A;  2EKI A;  4LTU A;  1J7E A;  2LOQ A;  3T3O A;  2WXP A;  2I2Y A;  4W9J A;  1UOR A;  2JWU A;  3M3J A;  3EA6 A;  1FEH A;  1WX7 A;  4TSS A;  1TY2 A;  3DHH C;  1WJ4 A;  1OTR B;  1MIV A;  1VZ8 A;  2G45 B;  1AAR A;  1LO5 D;  2WXQ A;  4RM9 A;  4P1B C;  4G01 A;  4A3O A;  2V3N A;  4OVV A;  1HQR D;  1A70 A;  2GBJ A;  4FLH A;  4WQM A;  3KJL A;  1DOI A;  1YIW A;  4GB9 A;  1KM7 A;  2MBQ A;  3RN9 C;  3CWI A;  4DWF A;  1OQR A;  4NZL B;  3BIN A;  4G0N B;  3ZJT A;  2K3U A;  2G1E A;  2KHW B;  2VDB A;  2WXJ A;  2V9H A;  2Z0E B;  2RGF A;  2KWD A;  3TIX A;  4REZ A;  4OTT A;  1MJD A;  4LK0 M;  4NPN A;  2KJR A;  1SE2 A;  3KWV A;  4BKE A;  1I35 A;  4YT0 B;  3PVL A;  3R66 C;  2LFI A;  2XVU A;  2K25 A;  2GUT A;  2O2V A;  3NZ3 A;  3BWU D;  1GC7 A;  4ZRK A;  2BS2 B;  2WHI A;  2BGF A;  3VHT C;  2FAZ A;  2K6D B;  3L17 A;  2D3C A;  1R4N I;  1WM3 A;  1WXQ A;  4I9O A;  1PYW D;  3T8M A;  4K7W A;  1JRO A;  3N3K B;  4HDQ A;  3V61 A;  2KDE B;  3G9K D;  3OLM D;  2ACZ B;  4IDI A;  1SB0 A;  1FOU A;  4KZ0 A;  3AEB B;  4TQ1 A;  4A9A A;  2NBU A;  5EE9 A;  5I4D A;  3DHG C;  1T3Q A;  4MEL A;  1PQS A;  2XK5 A;  3QA8 A;  2NBW B;  2X8X X;  4YTP B;  2K5P A;  4C80 A;  3L0W B;  2WWZ A;  3GE3 C;  3IAS 1;  2J52 A;  1Y56 A;  3IFW B;  1E7E A;  2OZB B;  3HM3 A;  3KUC B;  4FJV B;  3VUX A;  3ZNG C;  1DYQ A;  2PEA A;  5HOZ A;  3UI3 A;  2ROH A;  2GB1 A;  1UWX A;  2WXM A;  2C7N B;  2KAN A;  2OHF A;  2C7H A;  3DHI C;  5C23 A;  1BT0 A;  4HLE A;  2A5U A;  3FIL A;  1E0Z A;  1VCB A;  2BX8 A;  3AXC A;  5IKC M;  2BYF A;  2JQR B;  1UEL A;  2V4L A;  1WZ0 A;  3IBE A;  4IOI E;  2Q5W D;  1EWY C;  3V09 A;  2AX5 A;  4DM0 A;  3P4R B;  1HZ6 A;  3A9J A;  1L4D B;  2Z8K A;  3MHS D;  3RNC C;  4HCN B;  2C7M B;  2LXS A;  5CTR C;  4NAW A;  4HJK A;  3LB8 C;  1KW2 A;  2I1K A;  4OW0 A;  4LA0 A;  2NVU I;  3ML9 A;  2BPS A;  5HG2 A;  2WXF A;  1IGC A;  2ZCC A;  3SHQ A;  2J0J A;  2PW9 A;  2KAC A;  3HM6 X;  2DYB A;  2LWP A;  3Q6B A;  2L05 A;  1WXM A;  4F5S A;  2E6X A;  3ABV B;  2WDT B;  1K51 A;  2O6V D;  4EUT A;  2ASQ A;  1TS5 A;  2L7R A;  2PLP A;  3H7P A;  2BYV E;  3B0A A;  4HKQ A;  3NVV A;  4IWP A;  4MEM A;  4WAF A;  1TZO A;  1TKY A;  4TV3 A;  2IO2 B;  2MEK A;  3WIM A;  3FWB C;  4JE3 B;  4R3D A;  1V86 A;  3ALB A;  3RUI B;  2KFK B;  3H3A A;  3LDZ E;  1ISN A;  2BTE A;  1QIL A;  1YQ3 B;  2GOW A;  3LU6 A;  2I2Z A;  4FHJ A;  4HVB A;  2R2Q A;  4K81 A;  1SBB B;  1N5X A;  2WXL A;  4XWW A;  3AN1 A;  2KLG A;  3PGE A;  4K7U A;  1XXG A;  2CU3 A;  4PO0 A;  1ZXI A;  2YEP B;  3DCG A;  5IIX A;  3QAQ A;  2WXO A;  1I4H A;  2MBE A;  4ARI A;  2DYO A;  4JLC A;  2ZNV C;  1IBX A;  3U2S C;  5D6J B;  1CJE A;  3RD2 A;  1SSN A;  1E9M A;  1LNS A;  5AZH A;  3VQI A;  1L6V A;  3AUL A;  4UDU C;  1XCT L;  2N9K A;  4YSZ B;  4GMV A;  2H88 B;  2LGD A;  1JWS D;  3DVN U;  3E9S A;  3MJW A;  5L95 C;  2LQI A;  3AE7 B;  5J17 A;  3AU5 A;  2IZV B;  1XT9 B;  2KQ4 X;  2JXT A;  4AOF A;  2O2V B;  4EE2 A;  3AEF B;  1NI2 A;  4BBN C;  1WJ6 A;  1V2Y A;  5C3J B;  2YLM A;  1R7S A;  2XSI A;  5D7G A;  2AYO B;  1HA5 A;  2A4Z A;  1Z2M A;  3PRP B;  2DBX A;  1YN3 A;  3CF6 E;  2EFD A;  3T3N A;  2KDM A;  5IJF A;  3Q8B A;  3H6N A;  3VTW A;  2JU6 X;  3DOW A;  1IYF A;  3NG0 A;  4WWM A;  1YQ4 B;  3NRZ A;  4NJ6 A;  2WLB A;  1QZE A;  1WI0 A;  1K53 A;  3QQ8 B;  1JWU D;  3VVW B;  2KWF A;  3M95 A;  3NMU A;  4RGO S;  1QLB B;  3RCZ A;  2PMV A;  1VZ6 A;  2FID A;  4OVU A;  3TCA A;  3P42 A;  1V1P A;  1ZKH A;  1IUE A;  3ZNH B;  4M8N A;  4G50 A;  4WA6 B;  1AW7 A;  3VR9 B;  1YOV B;  4L8U A;  4FHK A;  1I4X A;  4EZJ A;  5AEK B;  2JXX A;  5GIN A;  4ANU A;  3PLU A;  2MX2 A;  3LU8 A;  1FCC C;  2KTR A;  2DNF A;  2HDE A;  4RMA A;  3BK2 A;  2G4D B;  2DWQ A;  3ZVV A;  3TEZ A;  2BT6 A;  3S2A A;  3U4E G;  2G9H D;  3FIL B;  3V3X A;  1E8Y A;  2FE8 A;  1WSP A;  2IY1 B;  4GDK A;  1C4C A;  3C19 A;  2UWQ A;  1VRA B;  3V6E B;  4G3X B;  4HKZ E;  1AWD A;  5JZE B;  1E7H A;  3V03 A;  1RAX A;  2N7J A;  3TEW A;  2MBH A;  1N5U A;  2CHX A;  1FRR A;  4ZRJ A;  1C4P A;  4CQN A;  1DOY A;  2BXM A;  3WHQ A;  1L2N A;  3D32 A;  4NQK E;  2IYD B;  2XVV A;  2Z8I A;  4W9E A;  5IOI A;  1JWB D;  2WNM A;  3IAM 1;  2L3Z A;  4HK2 A;  1YN4 A;  4JQW C;  1P0R A;  1ACC A;  3A9K A;  3IVF A;  1YJI A;  2JSV X;  3MC0 B;  3JVZ X;  1NYR A;  1E5W A;  4W9K A;  4WJP A;  3BY4 B;  3I63 C;  4MH8 A;  2L52 A;  2BYT A;  2WS3 B;  4JX1 C;  4XE0 A;  2LHD A;  4MSM B;  4ZHP A;  3VXW A;  1A5R A;  5H8Y E;  4RGT A;  3ZXR A;  1N6Z A;  1TY0 A;  1ZXH A;  2C9W B;  4JPS A;  1R4M B;  2D10 A;  1HZ5 A;  1WYW B;  4S0R A;  2IGH A;  4LNF A;  2MWS B;  4ZHO A;  1WX9 A;  4ZYS A;  2AQ2 B;  4DHJ D;  1NT2 B;  3FNM A;  3TBL D;  5EE0 A;  2IDY A;  3GQX A;  3BVM A;  3AE1 B;  4GN1 A;  4YSX B;  1WM2 A;  2HJ1 A;  2LMC A;  4DHJ B;  5EE1 A;  1TYG B;  3SU8 X;  3KQ4 A;  4FK5 B;  3VDZ A;  3SEB A;  3H7S A;  2PE6 B;  2VZK D;  4FAD A;  1I42 A;  2QDF A;  2LAS A;  1TXU A;  3KWL A;  2YEP F;  2FNJ B;  1XLQ A;  2KLC A;  4IG7 B;  2VZK B;  2PJH A;  2BWE S;  2MA9 B;  3WAL A;  3AEE B;  1IBX B;  3AV8 A;  3CIR B;  5TR5 A;  1MHH E;  2EKE C;  1XQQ A;  2GLS A;  5DPW A;  1C78 A;  5DQF A;  3OJ3 A;  4EOY A;  2ICI A;  1IJG A;  4ZDV A;  2JX5 A;  1FIQ A;  1MIW A;  2K0N A;  3WAM A;  2DBW A;  2BXH A;  3VFK A;  3WAN A;  4FJC B;  2L8J A;  2M17 A;  2W3R A;  1JCK B;  5BYR A;  1MHX A;  3ZXV A;  1V5O A;  3EGR A;  1QOB A;  3RNG C;  1MPE A;  4E3C A;  4HEA 1;  2WX0 A;  2CHZ A;  3PRE A;  3H37 A;  1V81 A;  3WAO A;  2MJ3 A;  3DWG C;  5BMG A;  2EFH A;  3AH7 A;  3L10 B;  2M0X A;  5D3I B;  2WX1 A;  3U30 A;  2RPV A;  2IPK D;  1D3Z A;  1EF1 A;  2XBB C;  1WMH B;  1JAL A;  1UWM A;  2QSD A;  2LEK A;  3OAW A;  2KDF B;  5BMI A;  1BXT A;  3SFD B;  3U7Z A;  1RLF A;  4GDL A;  5GIP A;  1YMH E;  1J7C A;  4C00 A;  3WCQ A;  2WDV B;  3I5J C;  2CR5 A;  2IND C;  2V1Y A;  3ZJU A;  1V1P B;  2J42 A;  1MUH A;  5AUI A;  1FO4 A;  4GDX A;  2MHJ A;  3DVN V;  4ZRI A;  3Q14 C;  4CO7 A;  2KMA A;  4FJY A;  1T0Y A;  4AJY B;  1WE7 A;  1YJJ A;  1JML A;  3UF8 A;  2JUH A;  3AEG B;  1MIY A;  3NUH B;  3KVF B;  4YL8 A;  1GOZ A;  2IJ0 A;  3GQU A;  3ZLZ A;  1F2R C;  3PO0 A;  2QHB A;  2NBV B;  2BF8 B;  4DQO C;  4LJO B;  1DOX A;  1HTQ A;  5KHQ A;  2DBU A;  2ZVO A;  4RGM A;  4M00 A;  4D7X A;  4MJS A;  2K8H A;  4GDK B;  4KSL C;  5JHB A;  3VR8 B;  1RRB A;  3TSS A;  4HDO A;  4DXG A;  4XZ4 A;  1GNU A;  2BXE A;  2ZNV B;  2BB5 A;  1VR9 A;  4N9F 4;  1B1Z A;  4B95 A;  1L0Y B;  2N4F A;  2RDG A;  4XWT A;  1U4A A;  1UGJ A;  3W5V B;  1E8W A;  1F2R I;  1HK5 A;  4N0F D;  1WIA A;  4NNJ B;  3A9K B;  2JUO A;  3A73 A;  2NQO A;  4N0U D;  3JRY A;  3ZUN A;  5EE3 A;  1N63 A;  1XLN A;  4KGS A;  3V08 A;  3HK0 A;  1MFW A;  3TMP B;  4FUL A;  4M0W B;  2AQ3 B;  2BXL A;  1L7Y A;  4ICV A;  2KWV B;  1F77 A;  5IP4 D;  1ESF A;  5JH5 C;  2AEH A;  1CK1 A;  2R2O A;  2BKF A;  2K8C A;  4BVU C;  2VH2 A;  2IO1 B;  2KKC A;  3C0R B;  3HIZ A;  3ECP A;  3Q8F A;  4RF1 A;  3BYT B;  3PHX B;  2L83 A;  2OJW A;  4US8 A;  4PK1 A;  1H5W A;  1XF5 L;  1WJU A;  3R8B A;  4EZL A;  4F5T A;  4A20 A;  2RMM A;  1JRP A;  4MGK E;  1PUT A;  3IHP C;  3ETR A;  4WJN A;  2LZ6 A;  1YN5 A;  2Y5P A;  1BM0 A;  4QAY A;  3ZDT A;  3WHR A;  4J6I A;  3NY5 A;  4TKN A;  2XVW A;  3IT6 B;  4WWP A;  2KDB A;  4HPP A;  2JYE A;  4ZBQ A;  1CMX B;  1R4M I;  3UGB B;  1E7B A;  1GAQ B;  2JWZ A;  2FCM A;  4WAA A;  3HVD A;  2BXO A;  1GNJ A;  4JWU C;  4GLS C;  1EUV B;  1MG8 A;  3DBR B;  3MHZ A;  4L9K A;  3RMK C;  2J0K A;  4IW2 A;  2G4S A;  5FK9 C;  5IJ5 A;  2KFJ A;  3LU7 A;  2BXD A;  2WQY B;  3AE2 B;  3MJ5 A;  2PVG C;  5DCN A;  4A8X C;  3VTV A;  2NMQ A;  2AQ1 B;  4RNA A;  3LXF A;  3QJZ A;  3R7R A;  1L4Z B;  1IGD A;  4AS1 A;  1E78 A;  2LVP A;  3Q3F A;  4K2C A;  5G55 A;  3AEC B;  1HK3 A;  2WXH A;  3NJT A;  2V36 A;  3MHS B;  2GMI C;  3ZO5 B;  5IIU A;  4OT2 A;  2KZR A;  3ZTD A;  1VDV A;  3BYY B;  1TGZ B;  2REX A;  2X38 A;  4KSK C;  1FCL A;  5L83 A;  1TS4 A;  4YWG G;  2UU7 A;  4L23 A;  4ACF A;  2OT3 A;  1V80 A;  1C4A A;  4B9K A;  1ENF A;  5IFO A;  4Z69 A;  3RUL A;  5FR6 A;  4KIK A;  4AWJ A;  1KOT A;  4O1N A;  2M0A A;  5GXG B;  1WR1 A;  1S1Q B;  4FN2 A;  2LQH A;  2O6V B;  1HEZ E;  4LLG M;  4ZRQ A;  4JK4 A;  5FKA C;  3GB1 A;  1MA9 A;  4OZA A;  1TF0 A;  4CYE A;  1V6E A;  1C3T A;  4W9I A;  2MRP A;  4EFO A;  2QIE B;  3SFE B;  1F0Z A;  1LQB A;  4ICU A;  2LGX A;  2BS3 B;  2JT4 B;  3CST A;  4K7S A;  3APC A;  4RCO A;  2BXF A;  3NVW A;  1GC6 A;  3RNB C;  4WWO A; 
#chains in the Genus database with same CATH homology
 4G11 A;  2N0S B;  4E71 A;  3P1M A;  3MFG A;  4BKG A;  2KVR A;  1Q5W B;  3X0W A;  4MJS B;  2DYM A;  3EHV A;  2PPH A;  2CKH B;  2RD0 A;  4MM3 A;  4W9F A;  1TKG A;  1PGB A;  3BVG A;  4NJC A;  4RFB A;  2K1F A;  2XNA C;  4HCP B;  1VZS A;  2R61 A;  1UGM A;  1SE3 A;  4WUR A;  4US9 A;  2XW1 A;  1IPG A;  4IM0 A;  1FMA D;  3W9C B;  3PS6 A;  3V05 A;  1UD7 A;  1HK2 A;  2B76 B;  3N30 A;  4GGQ A;  2D5G A;  3AB5 A;  2FCN A;  1E8Z A;  2M4N A;  2FUG 1;  3KYD D;  1LOT A;  2UYZ B;  3TL5 A;  2IBI B;  5LXI B;  2M19 A;  3FWC C;  3FAH A;  2BXQ A;  4WJO A;  2J53 A;  4BKT A;  1QOF A;  3GOE A;  1FXA A;  3B2G A;  1XLO A;  5CX3 A;  2XVQ A;  4S1Y A;  3H9D A;  3M63 B;  1UH6 A;  3VRB B;  4KVG B;  4OTU A;  4AJW A;  3MTN B;  1YX6 B;  2DHZ A;  5E6N A;  4FA6 A;  3EUB 2;  2AJE A;  3QHT A;  3QWZ B;  1QOG A;  2FCQ A;  2JRI B;  2N1W A;  2NCN A;  3K9O B;  2RDH A;  4IWO A;  3AE9 B;  2ZW0 A;  4A90 A;  1YD8 U;  3TJP A;  2D11 A;  1PGX A;  5HKH A;  2NPT A;  4DXA B;  2QHO A;  4J2V A;  2BB6 A;  4IUM B;  3A33 B;  3NOB A;  1I7H A;  2J0M A;  1YX5 B;  2CJO A;  2XK5 B;  1ROE A;  2KQS A;  4HRS A;  2DZM A;  4E74 A;  2RPQ A;  3A4S C;  2MH7 A;  4Z9O A;  2WXG A;  2GBR A;  1SJE D;  3R2T A;  4MH0 E;  4EMX A;  4NQL B;  1FD6 A;  3WHS A;  3ONS A;  1OGW A;  5EDS A;  2KOX A;  2V3S A;  1YQB A;  3A1Q A;  1XCQ L;  2W9N A;  2LJ5 A;  1UBI A;  2NS5 A;  3ZTC A;  1OQQ A;  1WXV A;  3ZDM C;  2KJH B;  2L0F A;  1TBE A;  2D2Q A;  3FC4 A;  4FIP B;  5LLI A;  3C8Y A;  3Q8C A;  4OHJ A;  1WGY A;  1VZ7 A;  3ZJV A;  1QKZ A;  5AZG A;  1V9J A;  1WRI A;  2BYE A;  3A9J B;  2SEB D;  4BFR A;  1NYQ A;  4ZBR A;  1P3Q U;  4MBE C;  1P98 A;  4MGZ E;  4NAW B;  2ZEQ A;  1P9D U;  2N9L A;  3DBR I;  4PS8 A;  2HTH A;  2WU5 B;  3RT3 B;  3DPD A;  4Q2J A;  2W54 A;  3KUZ A;  4F1S A;  5C2T B;  2BXA A;  2LRW A;  5HHD G;  4KGT A;  1WGH A;  3OJ4 B;  2BWF A;  4ITK A;  4B0M A;  1P7E A;  1FFV A;  1UZX B;  3AE3 B;  4K1R B;  1PGA A;  1YNT E;  4ARC A;  4EKU A;  2M1M A;  2INP E;  1ZPS A;  4P16 A;  1P1A A;  3H7P B;  4KIK B;  1Z5S B;  5G5G A;  2ZCB A;  4TMA B;  3O65 B;  3PT2 B;  4D2K A;  3NVY A;  2I38 A;  5FUO A;  1GG3 A;  4DHX B;  1WR6 E;  5TSS A;  2E0Y A;  5C1Z A;  1ZE3 D;  5JXV A;  3ICX A;  3NVZ A;  1LM8 B;  2E0X A;  3SD5 A;  2QIL A;  1QQR A;  1KXP D;  2KAJ A;  2MJE A;  3HVZ A;  4URK A;  2K22 A;  5E6J A;  3KUD B;  2W82 A;  1FXT B;  3ZRC A;  1L5P A;  1NEN B;  3TEX A;  2EEL A;  2WP9 B;  4GSW A;  2KJ6 A;  2LUE A;  4ZCG A;  1SEB D;  2IGG A;  3SIU B;  3Q8A A;  3SQJ A;  2OOB B;  4JIO U;  1WY8 A;  2C60 A;  2MSE D;  4G03 A;  3B9M A;  2KMM A;  3RYT A;  2KO3 A;  1GUA B;  4B6W A;  1P7F A;  3W1Y A;  1Q1O A;  1XEE A;  3UQB A;  3JSV A;  4N58 A;  1QF6 A;  4MGI E;  4NAM A;  3AU4 A;  3K9P B;  1E7C A;  1STE A;  2OED A;  4M70 B;  1D5X C;  4HGK A;  3I3T B;  2MJD A;  4IW1 A;  4W9L A;  3LYY A;  2LRU A;  3Q69 A;  5D3D A;  4HWI B;  5MPO A;  3PTF C;  1T6B X;  1I4G A;  3OWE B;  3CSF A;  4BKS A;  2KC2 A;  1SXT A;  3ML8 A;  4ZRP A;  5AUK A;  3EFU A;  3KYC D;  4W9D A;  2JPH A;  3I57 A;  4JL9 A;  4MSQ B;  3AM9 A;  3T9L A;  3PZ8 A;  2KBZ A;  2JY6 A;  2LI5 A;  2TSS A;  2ZJD A;  3IXS A;  1PDX A;  3I9V 1;  1K50 A;  2BXK A;  1UBQ A;  4HJG E;  1CZP A;  1V49 A;  4RM8 A;  2DLB A;  1HK4 A;  1NI3 A;  1V5T A;  4IWQ A;  3QK0 A;  3URY A;  2NPT B;  1SIJ A;  1LFD A;  3AE5 B;  4G04 A;  2M56 B;  2CU1 A;  1HXY D;  1L0X B;  4W9G A;  3TUO A;  2MBO A;  3ZQ4 A;  4TQ0 A;  1TTN A;  3SIV B;  1NEK B;  4F7Z A;  1E7U A;  2XN9 C;  2DZK A;  4J3O D;  2LJI A;  2XEW A;  3WAP A;  4K71 A;  1FFU A;  2BXG A;  4F8C B;  4BY9 C;  2GBM A;  2KX0 A;  4WJQ A;  5CHV C;  2BS4 B;  4BOS C;  2DAJ A;  2KTR B;  4LB9 A;  2WXI A;  4KV2 A;  4WWN A;  4I6P A;  4N3Z A;  1RM6 C;  3A1Q B;  3DBH I;  3BZD B;  4PT5 A;  1X1M A;  3E56 A;  4N6E B;  1ZDX A;  4RH6 A;  4PYU A;  1D4B A;  1I4Q A;  3CMM B;  3PV1 A;  3QAR A;  3ZW3 A;  2KFK A;  3QX1 A;  3UIV A;  3L54 A;  2J4X A;  2BKR B;  5HI1 A;  1H4R A;  1EM7 A;  5IJE A;  1VD2 A;  2JZP A;  4II3 B;  1NDD A;  1WGK A;  3PLV A;  2SAK A;  5B5T A;  1WX8 A;  4IW0 A;  2HJ8 A;  4LJP B;  1XO3 A;  3ZYY X;  1GB1 A;  1FNU A;  2KXJ A;  2L76 A;  5D2M B;  5BPK A;  1WH3 A;  4GG2 A;  3JQZ A;  4ANX A;  1Y8R C;  1WWT A;  2Y3A A;  1ZP0 B;  2RSU A;  1E8X A;  3GA9 L;  2PKO A;  3GZN I;  2ZPY A;  4KDL B;  4JWS C;  4C7Y A;  2AL3 A;  2JZZ A;  3BK1 A;  1OEY J;  3PSE B;  3AEA B;  3CX9 A;  4OR0 A;  1FNW A;  2GRI A;  2J7Q B;  1TZ1 A;  2I1J A;  2Z8L A;  2V3P A;  1JRU A;  1I4R A;  1K8R B;  2LVO A;  4PS7 A;  1TKE A;  2WDQ B;  1EU4 A;  5H92 C;  4IM2 A;  1JQ4 A;  3H1U A;  4ZUX V;  2GBN A;  3NS1 A;  2WXK A;  2HD5 B;  1TS2 A;  2HTM E;  2BXI A;  3A75 A;  3VH4 B;  2K8B A;  1RFA A;  4XX5 A;  1NVI D;  2MP2 A;  3TEY A;  1HK1 A;  1SIF A;  2NTS A;  2NR2 A;  4KKJ A;  2PIA A;  4YTM B;  3VUY A;  1OEY A;  1L6U A;  1C79 A;  4PS3 A;  2DBY A;  1JWM D;  3HUI A;  1JW9 D;  3X23 A;  1GNI A;  3JSV B;  4C56 C;  2EFE A;  1EWC A;  5G2N A;  1SGH A;  2WXN A;  3AE4 B;  1V97 A;  2BXB A;  1WFY A;  1V8C A;  4LB2 A;  3PHW B;  1GJZ A;  1F9J A;  4BKS D;  2D3G A;  1WXS A;  1E7G A;  4CHK A;  4IM3 A;  5LNK 1;  4HRO A;  2WXR A;  3MHH B;  1E6E B;  2B3A A;  5DBY A;  3ENE A;  1KTK A;  1FM0 D;  3EC8 A;  1D5Z C;  5DPT A;  1O9X A;  2EMS A;  2BBC A;  3H8H A;  2JZ3 B;  1QOA A;  1LXD A;  3M62 B;  3NZS A;  4P6V F;  4ANV A;  3QIJ A;  2L32 A;  1WGG A;  4AUQ C;  2LVQ A;  1OFF A;  3PRZ A;  3AE8 B;  1WGD A;  2KWC A;  4RF0 A;  2KC1 A;  4A6Q A;  1S3S G;  4KKI A;  3U52 E;  1RWS A;  4A55 A;  3APF A;  1J8C A;  2KN4 A;  4GDL B;  1KJT A;  2L00 B;  2YVC A;  3DVG Y;  1N5W A;  2V0G A;  1J78 A;  4F5U A;  2LXA A;  1BKE A;  5FR3 A;  4USA A;  2LXC A;  4AP4 C;  3V62 A;  1K52 A;  3PRM B;  2K9X A;  1HA2 A;  5KHO A;  3R2I A;  4L2Y A;  4YTN B;  4EZK A;  4MDK E;  4LCD E;  2FUH B;  5JHA A;  1AO6 A;  3NVI A;  2BXC A;  5GIO A;  5DPS A;  3EEC A;  2QMT A;  1WE6 A;  1KLU D;  1D5M C;  3ZGZ A;  4M8M A;  3BVZ A;  2PVO D;  5BMH A;  2KTF A;  4KGR A;  3AMZ A;  4L1B A;  2ZZP B;  4ASW C;  5LXH A;  3V60 A;  2W55 A;  1RYJ A;  2NTT A;  2KDI A;  2WU2 B;  1E7F A;  4DDG D;  3B9L A;  3L16 A;  2ZVN A;  2BW2 A;  4IKG A;  2JVC A;  2Y5C A;  1T5X D;  4ZYN A;  3B2F A;  2W3S A;  1VLB A;  4DXF A;  2FIF A;  3PZD A;  4B0E A;  4DHZ E;  2MLB A;  4KX6 B;  3N32 A;  2K6Q A;  1PFD A;  2N1V A;  5AZF A;  5T8I A;  2JYT A;  2N9P C;  1E7A A;  1MVK A;  5DPR A;  3QCA A;  4IC7 B;  3J9C A;  2FBW B;  3NZU A;  2XMO A;  2KMC A;  3RFZ B;  2INN E;  2QEJ C;  3HRD D;  4I6N B;  3RZF A;  2Z0D B;  1E7P B;  2HE7 A;  4BBN F;  4ANW A;  3QC8 B;  3PZ7 A;  1EU3 A;  1M4V A;  2K0P A;  3DBL I;  2LD9 A;  4W9H A;  1EO6 A;  1GB4 A;  1WRD B;  4H2A A;  5CHW A;  2I30 A;  4HGM B;  2KWU B;  3W2D A;  1SJH D;  3N9Y C;  1EF5 A;  4TUU A;  1N61 A;  2KQ7 A;  2Z59 B;  4BOZ B;  1UUP A;  3IG3 A;  2PTL A;  2ZW1 A;  4DHZ B;  1KLV A;  3P4P B;  2BXP A;  4ZBK A;  1C77 A;  2MP2 B;  4GOC A;  3VTU A;  1WMH A;  2BXN A;  2XW0 A;  3UIP B;  4HPM B;  4JGH B;  3B08 A;  2AWT A;  2E3T A;  3DWM A;  2CHW A;  4WQO B;  5IIH A;  4FJZ A;  2H89 B;  1E7V A;  2JF5 A;  5IA7 A;  3B1L X;  5GHK A;  2KK8 A;  1IP9 A;  3ECI A;  3KLS X;  2IGD A;  1C1Y B;  1KH0 A;  3GS2 A;  5GMV A;  3VUW A;  2L0T A;  2OJR A;  3R7Q A;  3RPF C;  2VRR B;  1BUI C;  4PYZ A;  1G6J A;  2LGI A;  3P2B A;  5ID9 A;  3VH3 B;  3UQA A;  4LUH A;  1DGJ A;  1M94 A;  3ZNZ B;  3DDC B;  4DK5 A;  4MGY E;  4HPL B;  2Z8J A;  1XD3 B;  3V6C B;  2K39 A;  4OVZ A;  2ON8 A;  2DX5 B;  1ZUD 2;  2MQJ A;  1V1O A;  1J7A A;  2GBK A;  3O13 A;  4F5V A;  2ZPN A;  3W1S C;  1N62 A;  3PLA A;  1TS3 A;  1E10 A;  1JNB A;  3UIO B;  5E6P A;  4LDT D;  2D07 B;  1ZDV A;  5HFY A;  5E6O A;  3KH0 A;  4W4U B;  4WH4 A;  4OZC A;  4LDT B;  5IAA C;  1BJ5 A;  2N9X A;  4GXB A;  1B9R A;  3MP9 A;  3NHE B;  3VRA B;  3TDL A;  3B9J A;  1Q0W B;  5D94 A;  4M0W A;  3ZNI D;  5G5H A;  4GIV A;  4NY0 A;  3A4R A;  1OQY A;  1Q10 A;  2KNB A;  4FBJ B;  4NJ7 A;  1C9F A;  4X57 B;  3W5U B;  1ZW7 A;  1WYG A;  2GI9 A;  1WJN A;  4WIP A;  2KX3 A;  4XDC A;  3ZKJ C;  1ZGU B;  1CQV A;  3U8Z A;  4II2 B;  1KLG D;  4C7Z A;  1QT9 A;  2G3Q B;  4LUF A;  2M8S A;  3JW0 X;  4L9Q A;  2WYQ A;  3DVG X;  4MM3 B;  3UIN B;  2DAF A;  1FNV A;  1VJK A;  3KW5 B;  1MI0 A;  2VUF A;  2C5L C;  4XC2 A;  3JYU A;  2V4I B;  4OZB A;  1WXA A;  2CKX A;  1FRD A;  2ONQ A;  4XDD A;  4ZOH C;  1NBF C;  2QM6 A;  3M99 C;  1N60 A;  3Q3J A;  3NS8 A;  1YJ1 A;  5BYS A;  4MT5 A;  2AL6 A;  4P7I A;  4KZC A;  3LJ3 A;  3SR6 A;  2MBB B;  4MAC A;  3APD A;  4HXD A;  4DDI D;  2N7D A;  4C31 B;  2DZI A;  2KN5 A;  3ZRF A;  1ET6 A;  4YXD B;  1HE8 A;  4N59 A;  2QMC A;  1JWA D;  2RR9 A;  3U7D A;  1BML C;  3VAW A;  3SDL C;  5BO4 B;  2N7E A;  4EEW A;  4I6L B;  3NVM A;  2LUM A;  3RZW C;  1UNS A;  3AI5 A;  3NVK A;  1KRH A;  2L1A A;  1J7B A;  2WDR B;  3BII D;  2DEN B;  3W1S A;  3KIK A;  2Y5B B;  2CJN A;  3AE6 B;  4AQ7 A;  2IO0 B;  2VUE A;  2MW5 A;  2KD0 A;  1H8C A;  1I4P A;  5J2R A;  2LGY A;  2N9E B;  1SF0 A;  5ID7 A;  3IT4 B;  1C76 A;  1RFK A;  1VFI A;  1SE9 A;  1WGR A;  3P4Q B;  1L0V B;  2LHE A;  2CS4 A;  2QJL A;  3L08 A;  1SE4 A;  1J19 A;  3GP7 A;  4FXC A;  2PE9 A;  1TJE A;  2EMT A;  4RGN A;  3P63 A;  3L13 A;  4ZC6 A;  3ZIM A;  3HHM A;  2MCN B;  1E90 A;  2IY0 B;  1FXI A;  5J18 A;  5BYQ A;  1XLP A;  3Q8E A;  2DG5 A;  4E99 A;  4KDI C;  2EFC A;  1WZ3 A;  2NNW A;  2IO3 B;  1H9Z A;  3DQV A;  3WA0 A;  1E7I A;  1ZOY B;  1J0G A;  1KF6 B;  1ET9 A;  2O6V A;  5CHF A;  2FCS A;  2DZJ A;  1AN8 A;  1D6E C;  3AED B;  1KFY B;  4A3P A;  2JRH A;  1AYF A;  2YDF A;  3L4P A;  3DBS A;  3P4S B;  1SB3 C;  4GU2 A;  3PPA A;  4YSY B;  1WF9 A;  4DBG A;  3R3M A;  4W9C A;  1GPX A;  2EKI A;  4LTU A;  1J7E A;  2LOQ A;  3T3O A;  2WXP A;  2I2Y A;  4W9J A;  1UOR A;  2JWU A;  3M3J A;  3EA6 A;  1FEH A;  1WX7 A;  4TSS A;  1TY2 A;  1WJ4 A;  1OTR B;  1MIV A;  1VZ8 A;  2G45 B;  1AAR A;  1LO5 D;  2WXQ A;  4RM9 A;  4A3O A;  4G01 A;  2V3N A;  4OVV A;  1HQR D;  1A70 A;  2GBJ A;  4FLH A;  4WQM A;  3KJL A;  1YIW A;  1DOI A;  4GB9 A;  1KM7 A;  2MBQ A;  3CWI A;  4DWF A;  1OQR A;  4NZL B;  3BIN A;  4G0N B;  3ZJT A;  2K3U A;  2KHW B;  2G1E A;  2VDB A;  2WXJ A;  2Z0E B;  2RGF A;  2KWD A;  3TIX A;  4REZ A;  4OTT A;  4LK0 M;  4NPN A;  2KJR A;  1SE2 A;  3KWV A;  4BKE A;  1I35 A;  4YT0 B;  3PVL A;  3R66 C;  2LFI A;  2XVU A;  2K25 A;  2O2V A;  3NZ3 A;  3BWU D;  1GC7 A;  4ZRK A;  2BS2 B;  2BGF A;  3VHT C;  2FAZ A;  2K6D B;  3L17 A;  1R4N I;  1WM3 A;  1WXQ A;  1PYW D;  3T8M A;  4K7W A;  1JRO A;  3N3K B;  4HDQ A;  3V61 A;  2KDE B;  3G9K D;  3OLM D;  2ACZ B;  4IDI A;  1FOU A;  4KZ0 A;  3AEB B;  4TQ1 A;  4A9A A;  2NBU A;  5EE9 A;  5I4D A;  1T3Q A;  4MEL A;  1PQS A;  2XK5 A;  3QA8 A;  2NBW B;  4YTP B;  2K5P A;  4C80 A;  3L0W B;  2WWZ A;  3IAS 1;  2J52 A;  1Y56 A;  3IFW B;  1E7E A;  2OZB B;  3HM3 A;  3KUC B;  4FJV B;  3VUX A;  3ZNG C;  1DYQ A;  2PEA A;  5HOZ A;  3UI3 A;  2ROH A;  2GB1 A;  1UWX A;  2WXM A;  2C7N B;  2KAN A;  2OHF A;  2C7H A;  5C23 A;  1BT0 A;  4HLE A;  2A5U A;  3FIL A;  1E0Z A;  1VCB A;  2BX8 A;  3AXC A;  2BYF A;  2JQR B;  1UEL A;  2V4L A;  1WZ0 A;  3IBE A;  4IOI E;  2Q5W D;  1EWY C;  3V09 A;  2AX5 A;  3P4R B;  1HZ6 A;  3A9J A;  1L4D B;  2Z8K A;  3MHS D;  4HCN B;  2C7M B;  5CTR C;  4NAW A;  4HJK A;  3LB8 C;  1KW2 A;  2I1K A;  4OW0 A;  4LA0 A;  2NVU I;  3ML9 A;  2BPS A;  5HG2 A;  2WXF A;  1IGC A;  2ZCC A;  3SHQ A;  2J0J A;  2PW9 A;  2KAC A;  3HM6 X;  2DYB A;  2LWP A;  2L05 A;  1WXM A;  4F5S A;  2E6X A;  3ABV B;  2WDT B;  1K51 A;  2O6V D;  4EUT A;  2ASQ A;  1TS5 A;  2L7R A;  2PLP A;  3H7P A;  2BYV E;  3B0A A;  4HKQ A;  3NVV A;  4IWP A;  4MEM A;  4WAF A;  1TZO A;  4TV3 A;  1TKY A;  2IO2 B;  2MEK A;  3WIM A;  3FWB C;  4JE3 B;  4R3D A;  1V86 A;  3ALB A;  3RUI B;  2KFK B;  3H3A A;  3LDZ E;  1ISN A;  2BTE A;  1QIL A;  2GOW A;  1YQ3 B;  3LU6 A;  2I2Z A;  4FHJ A;  4HVB A;  2R2Q A;  4K81 A;  1SBB B;  1N5X A;  2WXL A;  4XWW A;  3AN1 A;  2KLG A;  3PGE A;  4K7U A;  1XXG A;  2CU3 A;  4PO0 A;  1ZXI A;  2YEP B;  3DCG A;  5IIX A;  3QAQ A;  2WXO A;  1I4H A;  2MBE A;  4ARI A;  2DYO A;  4JLC A;  2ZNV C;  1IBX A;  3U2S C;  5D6J B;  1CJE A;  3RD2 A;  1SSN A;  1E9M A;  1LNS A;  5AZH A;  3VQI A;  1L6V A;  3AUL A;  4UDU C;  1XCT L;  2N9K A;  4YSZ B;  4GMV A;  2H88 B;  2LGD A;  3DVN U;  1JWS D;  3E9S A;  3MJW A;  5L95 C;  3AE7 B;  5J17 A;  3AU5 A;  2IZV B;  1XT9 B;  2KQ4 X;  2JXT A;  4AOF A;  2O2V B;  4EE2 A;  3AEF B;  1NI2 A;  4BBN C;  1WJ6 A;  1V2Y A;  5C3J B;  2YLM A;  1R7S A;  2XSI A;  5D7G A;  2AYO B;  1HA5 A;  2A4Z A;  1Z2M A;  3PRP B;  2DBX A;  3CF6 E;  1YN3 A;  2EFD A;  3T3N A;  2KDM A;  5IJF A;  3Q8B A;  3H6N A;  3VTW A;  2JU6 X;  3DOW A;  1IYF A;  4WWM A;  4NJ6 A;  1YQ4 B;  3NRZ A;  2WLB A;  1QZE A;  1WI0 A;  1K53 A;  3QQ8 B;  1JWU D;  3VVW B;  3M95 A;  3NMU A;  4RGO S;  1QLB B;  3RCZ A;  2PMV A;  1VZ6 A;  2FID A;  4OVU A;  3TCA A;  3P42 A;  1V1P A;  1ZKH A;  1IUE A;  3ZNH B;  4M8N A;  4G50 A;  1AW7 A;  4WA6 B;  3VR9 B;  4L8U A;  4FHK A;  1I4X A;  4EZJ A;  5AEK B;  2JXX A;  5GIN A;  4ANU A;  3PLU A;  2MX2 A;  3LU8 A;  1FCC C;  2KTR A;  2HDE A;  4RMA A;  3BK2 A;  2G4D B;  2DWQ A;  3ZVV A;  3TEZ A;  2BT6 A;  3S2A A;  3U4E G;  2G9H D;  3FIL B;  3V3X A;  1E8Y A;  2FE8 A;  1WSP A;  2IY1 B;  4GDK A;  1C4C A;  2UWQ A;  1VRA B;  3V6E B;  4G3X B;  4HKZ E;  1AWD A;  5JZE B;  1E7H A;  3V03 A;  1RAX A;  2N7J A;  3TEW A;  2MBH A;  1N5U A;  2CHX A;  1FRR A;  4ZRJ A;  1C4P A;  4CQN A;  1DOY A;  2BXM A;  3WHQ A;  1L2N A;  3D32 A;  4NQK E;  2IYD B;  2XVV A;  2Z8I A;  4W9E A;  1JWB D;  2WNM A;  3IAM 1;  2L3Z A;  4HK2 A;  1YN4 A;  4JQW C;  1P0R A;  1ACC A;  3A9K A;  3IVF A;  1YJI A;  2JSV X;  3MC0 B;  3JVZ X;  1NYR A;  1E5W A;  4W9K A;  4WJP A;  3BY4 B;  4MH8 A;  2L52 A;  2BYT A;  2WS3 B;  4JX1 C;  4XE0 A;  4MSM B;  2LHD A;  4ZHP A;  3VXW A;  1A5R A;  5H8Y E;  4RGT A;  1TY0 A;  2C9W B;  1ZXH A;  4JPS A;  2D10 A;  1HZ5 A;  1WYW B;  2IGH A;  2MWS B;  4ZHO A;  1WX9 A;  4ZYS A;  2AQ2 B;  4DHJ D;  1NT2 B;  3FNM A;  3TBL D;  5EE0 A;  2IDY A;  3GQX A;  3BVM A;  4GN1 A;  3AE1 B;  4YSX B;  1WM2 A;  4DHJ B;  2LMC A;  5EE1 A;  1TYG B;  3SU8 X;  3KQ4 A;  4FK5 B;  3VDZ A;  3SEB A;  3H7S A;  2PE6 B;  2VZK D;  4FAD A;  1I42 A;  2LAS A;  1TXU A;  3KWL A;  2YEP F;  2FNJ B;  2KLC A;  1XLQ A;  4IG7 B;  2VZK B;  2PJH A;  2BWE S;  2MA9 B;  3WAL A;  3AEE B;  1IBX B;  5TR5 A;  3AV8 A;  3CIR B;  1MHH E;  2EKE C;  1XQQ A;  5DPW A;  1C78 A;  5DQF A;  3OJ3 A;  4EOY A;  2ICI A;  1IJG A;  4ZDV A;  2JX5 A;  1FIQ A;  1MIW A;  3WAM A;  2DBW A;  2BXH A;  3VFK A;  3WAN A;  4FJC B;  2L8J A;  2M17 A;  2W3R A;  1JCK B;  5BYR A;  1MHX A;  1V5O A;  3EGR A;  1QOB A;  1MPE A;  4E3C A;  4HEA 1;  2WX0 A;  2CHZ A;  3PRE A;  3H37 A;  1V81 A;  3WAO A;  2MJ3 A;  3DWG C;  5BMG A;  2EFH A;  3AH7 A;  3L10 B;  2M0X A;  5D3I B;  2WX1 A;  3U30 A;  1D3Z A;  2IPK D;  2RPV A;  1EF1 A;  2XBB C;  1WMH B;  1JAL A;  1UWM A;  2QSD A;  2LEK A;  3OAW A;  2KDF B;  5BMI A;  1BXT A;  3SFD B;  3U7Z A;  1RLF A;  4GDL A;  5GIP A;  1YMH E;  1J7C A;  3WCQ A;  2WDV B;  2CR5 A;  2V1Y A;  3ZJU A;  1V1P B;  2J42 A;  5AUI A;  1FO4 A;  4GDX A;  3DVN V;  4ZRI A;  4CO7 A;  2KMA A;  4FJY A;  1T0Y A;  4AJY B;  1WE7 A;  1YJJ A;  1JML A;  3UF8 A;  2JUH A;  3AEG B;  1MIY A;  3NUH B;  3KVF B;  4YL8 A;  1GOZ A;  2IJ0 A;  3GQU A;  3ZLZ A;  1F2R C;  3PO0 A;  2QHB A;  2NBV B;  2BF8 B;  4DQO C;  4LJO B;  1DOX A;  5KHQ A;  2DBU A;  2ZVO A;  4RGM A;  4MJS A;  2K8H A;  4GDK B;  4KSL C;  5JHB A;  3VR8 B;  1RRB A;  3TSS A;  4HDO A;  4DXG A;  4XZ4 A;  1GNU A;  2BXE A;  2ZNV B;  2BB5 A;  1VR9 A;  4N9F 4;  1B1Z A;  4B95 A;  1L0Y B;  2N4F A;  2RDG A;  4XWT A;  1U4A A;  1UGJ A;  3W5V B;  1E8W A;  1F2R I;  1HK5 A;  4N0F D;  1WIA A;  4NNJ B;  3A9K B;  2JUO A;  3A73 A;  2NQO A;  4N0U D;  3JRY A;  3ZUN A;  5EE3 A;  1N63 A;  1XLN A;  4KGS A;  3V08 A;  3HK0 A;  3TMP B;  4FUL A;  4M0W B;  2AQ3 B;  2BXL A;  1L7Y A;  4ICV A;  2KWV B;  1F77 A;  1ESF A;  5JH5 C;  2AEH A;  2R2O A;  1CK1 A;  2BKF A;  2K8C A;  4BVU C;  2IO1 B;  2KKC A;  3C0R B;  3HIZ A;  3Q8F A;  4RF1 A;  3BYT B;  3PHX B;  2L83 A;  4US8 A;  1H5W A;  1XF5 L;  1WJU A;  3R8B A;  4EZL A;  4F5T A;  4A20 A;  2RMM A;  4MGK E;  1JRP A;  1PUT A;  3IHP C;  3ETR A;  4WJN A;  2LZ6 A;  1YN5 A;  2Y5P A;  1BM0 A;  3ZDT A;  3WHR A;  4J6I A;  3NY5 A;  4TKN A;  2XVW A;  3IT6 B;  4WWP A;  2KDB A;  2JYE A;  4ZBQ A;  1CMX B;  1R4M I;  3UGB B;  1E7B A;  1GAQ B;  2JWZ A;  2FCM A;  4WAA A;  3HVD A;  2BXO A;  1GNJ A;  4JWU C;  4GLS C;  1EUV B;  1MG8 A;  3MHZ A;  4L9K A;  2J0K A;  4IW2 A;  2G4S A;  5FK9 C;  5IJ5 A;  2KFJ A;  3LU7 A;  2BXD A;  2WQY B;  3AE2 B;  3MJ5 A;  2PVG C;  5DCN A;  4A8X C;  3VTV A;  2NMQ A;  2AQ1 B;  4RNA A;  3LXF A;  3QJZ A;  3R7R A;  1L4Z B;  1IGD A;  4AS1 A;  1E78 A;  2LVP A;  3Q3F A;  4K2C A;  5G55 A;  3AEC B;  1HK3 A;  2WXH A;  2V36 A;  3MHS B;  2GMI C;  3ZO5 B;  5IIU A;  4OT2 A;  2KZR A;  3ZTD A;  1VDV A;  3BYY B;  1TGZ B;  2REX A;  4KSK C;  2X38 A;  1FCL A;  5L83 A;  1TS4 A;  4YWG G;  4L23 A;  2OT3 A;  1V80 A;  1C4A A;  4B9K A;  1ENF A;  3RUL A;  5IFO A;  4Z69 A;  5FR6 A;  4KIK A;  4AWJ A;  1KOT A;  4O1N A;  2M0A A;  5GXG B;  1WR1 A;  1S1Q B;  4FN2 A;  2O6V B;  1HEZ E;  4LLG M;  4ZRQ A;  4JK4 A;  5FKA C;  3GB1 A;  1MA9 A;  4OZA A;  1TF0 A;  4CYE A;  1V6E A;  1C3T A;  4W9I A;  2MRP A;  4EFO A;  2QIE B;  3SFE B;  1F0Z A;  1LQB A;  4ICU A;  2LGX A;  4K7S A;  2JT4 B;  3CST A;  2BS3 B;  3APC A;  4RCO A;  2BXF A;  3NVW A;  1GC6 A;  4WWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...