1MA9A

Crystal structure of the complex of human vitamin d binding protein and rabbit muscle actin
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
458
structure length
442
Chain Sequence
LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPEATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin D-binding protein
publication title Actin-DBP: the perfect structural fit?
pubmed doi rcsb
molecule tags Transport protein/contractile protein
total genus 155
structure length 442
sequence length 458
ec nomenclature
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00273 Serum_albumin Serum albumin family
A PF09164 VitD-bind_III Vitamin D binding protein, domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1ma9A02
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1ma9A03
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1ma9A01
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1ma9A04
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1ma9A05
3LU6A 2YDFA 4HGKA 5IJ5A 1AO6A 1KXPD 4S1YA 2BXMA 1KW2A 2BXOA 1BM0A 3SQJA 4L8UA 2BXIA 2XW0A 3CX9A 5FUOA 5IJEA 4ZBQA 4EMXA 1UORA 4LB9A 1HK1A 2BXNA 2VUFA 4LB2A 4N0FD 1E7GA 4G04A 1E7FA 2BXEA 2I30A 2XVUA 1BJ5A 3LU8A 1LOTA 1GNJA 1HK5A 4F5UA 4K2CA 4LUHA 2XSIA 4HGMB 2XVQA 1HA2A 3V03A 4F5SA 2BXPA 2XVVA 5ID9A 5HOZA 4LA0A 1J78A 2BXGA 5IIXA 5IFOA 4J2VA 4JK4A 1HK4A 5DBYA 2XW1A 2VUEA 4F5TA 4IW1A 4L9KA 5IIUA 2BXDA 1H9ZA 5DQFA 3LU7A 4ZBRA 1E7CA 1E7EA 1E78A 3JRYA 1E7BA 1O9XA 1J7EA 2BX8A 2I2ZA 5ID7A 5IIHA 1MA9A 2BXQA 1HK2A 1HK3A 4OT2A 2VDBA 4L9QA 4IW2A 2BXCA 4K71A 1E7IA 4OR0A 1BKEA 3A73A 4E99A 3V09A 4Z69A 4LUFA 2BXFA 2XVWA 1E7AA 2BXKA 1E7HA 3UIVA 1GNIA 5IJFA 1N5UA 3B9MA 3B9LA 2BXHA 2BXLA 4G03A 3TDLA 1TF0A 3JQZA 4F5VA 3V08A 2BXBA 2BXAA 5GHKA 4BKEA 4PO0A 4N0UD
chains in the Genus database with same CATH superfamily
3SIUB 3LU6A 2YDFA 1SB0A 4HGKA 5IJ5A 1AO6A 1KXPD 3H3AA 4S1YA 2BXMA 2DBUA 4BY9C 4I9OA 2ROHA 1KW2A 3NMUA 2BXOA 1BM0A 3KIKA 3SQJA 2LXSA 4L8UA 4GDLB 3BPJA 1VFIA 3MHSB 4DHXB 3M99C 2BXIA 2XW0A 3CX9A 5FUOA 5IJEA 3KJLA 4ZBQA 1UORA 4EMXA 1LNSA 5B5TA 5BPKA 4LB9A 4W4UB 2GUTA 1H5WA 1HK1A 3GQUA 5GIOA 1IJGA 2DYOA 2BXNA 2VUFA 4LB2A 2KBZA 4N0FD 4TQ1A 1E7GA 4G04A 1E7FA 2EFEA 2BXEA 2I30A 2XVUA 3FNMA 3MHHB 1BJ5A 3LU8A 2XMOA 3FWCC 3WHSA 1LOTA 3NVKA 1GNJA 1HK5A 4F5UA 4TQ0A 2K0NA 2EFHA 4GDXA 4K2CA 4LUHA 2EFDA 3ECPA 2XSIA 2AJEA 2OZBB 2CKXA 4HGMB 2EFCA 2XVQA 1HA2A 2NNWA 3V03A 4C31B 4F5SA 2BXPA 3A75A 2XVVA 3SIVB 1MM8A 5ID9A 5GIPA 2Z8IA 5HOZA 3FWBC 4LA0A 1MIWA 1J78A 2BXGA 2DYMA 2LQHA 5IIXA 1NT2B 2LXTA 1MUHA 4Z9OA 5IFOA 2QMCA 2KWFA 4J2VA 4OTTA 4JK4A 1HK4A 2QHBA 1KDXA 2V36A 5DBYA 2XW1A 4M70B 2VUEA 4D7XA 4OTUA 4F5TA 4IW1A 4L9KA 5IIUA 2BXDA 1H9ZA 5DQFA 3LU7A 3GA9L 4ZBRA 1MIYA 2Z8JA 3WHRA 1E7CA 4GDKB 4ZBKA 1MIVA 1E7EA 1E78A 3ICXA 3GQXA 4FK5B 3W1SA 3JRYA 1E7BA 4FIPB 4N3ZA 1O9XA 2DBXA 1J7EA 2BX8A 2I2ZA 2LQIA 1VZSA 5ID7A 5IIHA 1MA9A 2BXQA 1HK2A 1JNBA 1HK3A 4GG2A 4OT2A 3NVIA 2VDBA 4L9QA 4IW2A 4WA6B 2BXCA 4K71A 2E0XA 3VQIA 1E7IA 2DG5A 4OR0A 1BKEA 4FJCB 1TXUA 2E0YA 2JUHA 3A73A 2OT3A 3V09A 4E99A 4Z69A 3WHQA 5GINA 4LUFA 2DBWA 2BXFA 4ZUXV 2XVWA 1E7AA 2BXKA 1E7HA 1MUSA 4MBEC 3UIVA 1GNIA 5IJFA 4ZC6A 1N5UA 3B9MA 3B9LA 3PLAA 2AGHB 2BXHA 2BXLA 3H37A 1FOUA 2NQOA 4G03A 3TDLA 5D7GA 1TF0A 2Z8KA 2LOQA 3JQZA 4ZCGA 4F5VA 3V08A 4DM0A 2BXBA 2BXAA 5GHKA 3G9KD 4G01A 4BKEA 4PO0A 4NAWB 3NVMA 4N0UD 2QM6A
chains in the Genus database with same CATH topology
3SIUB 3LU6A 2YDFA 4HGKA 5IJ5A 1AO6A 1KXPD 3H3AA 4S1YA 2BXMA 2DBUA 4BY9C 2ROHA 1KW2A 3NMUA 2BXOA 1BM0A 3KIKA 3SQJA 4L8UA 4GDLB 4DHXB 1VFIA 3MHSB 3M99C 2BXIA 2XW0A 3CX9A 5FUOA 5IJEA 3KJLA 4ZBQA 1UORA 4EMXA 1LNSA 5B5TA 5BPKA 4LB9A 4W4UB 1H5WA 1HK1A 3GQUA 5GIOA 1IJGA 2DYOA 2BXNA 2VUFA 4LB2A 2KBZA 4N0FD 4TQ1A 1E7GA 4G04A 1E7FA 2EFEA 2BXEA 2I30A 2XVUA 3FNMA 3MHHB 1BJ5A 3LU8A 2XMOA 3FWCC 3WHSA 1LOTA 3NVKA 1GNJA 1HK5A 4F5UA 4TQ0A 2EFHA 4GDXA 4K2CA 4LUHA 2EFDA 2XSIA 2AJEA 2OZBB 2CKXA 4HGMB 2EFCA 2XVQA 1HA2A 2NNWA 3V03A 4C31B 4F5SA 2BXPA 3A75A 2XVVA 3SIVB 5ID9A 5GIPA 2Z8IA 5HOZA 3FWBC 4LA0A 1MIWA 1J78A 2BXGA 2DYMA 5IIXA 1NT2B 4Z9OA 5IFOA 2QMCA 4J2VA 4OTTA 4JK4A 1HK4A 2QHBA 2V36A 5DBYA 2XW1A 4M70B 2VUEA 4OTUA 4F5TA 4IW1A 4L9KA 5IIUA 2BXDA 1H9ZA 5DQFA 3LU7A 3GA9L 4ZBRA 1MIYA 2Z8JA 3WHRA 1E7CA 4GDKB 4ZBKA 1MIVA 1E7EA 1E78A 3ICXA 3GQXA 4FK5B 3W1SA 3JRYA 1E7BA 4FIPB 4N3ZA 1O9XA 2DBXA 1J7EA 2BX8A 2I2ZA 5ID7A 1VZSA 5IIHA 1MA9A 2BXQA 1HK2A 1JNBA 1HK3A 4GG2A 4OT2A 3NVIA 2VDBA 4L9QA 4IW2A 4WA6B 2BXCA 4K71A 2E0XA 3VQIA 1E7IA 2DG5A 4OR0A 1BKEA 4FJCB 1TXUA 2E0YA 2JUHA 3A73A 2OT3A 3V09A 4E99A 4Z69A 3WHQA 5GINA 4LUFA 2DBWA 2BXFA 4ZUXV 2XVWA 1E7AA 2BXKA 1E7HA 4MBEC 3UIVA 1GNIA 5IJFA 4ZC6A 1N5UA 3B9MA 3B9LA 3PLAA 3H37A 2BXHA 2BXLA 1FOUA 2NQOA 4G03A 3TDLA 5D7GA 1TF0A 2Z8KA 2LOQA 3JQZA 4ZCGA 4F5VA 3V08A 2BXBA 2BXAA 5GHKA 3G9KD 4G01A 4BKEA 4PO0A 4NAWB 3NVMA 4N0UD 2QM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LU6 A;  2YDF A;  4HGK A;  5IJ5 A;  1AO6 A;  1KXP D;  4S1Y A;  2BXM A;  1KW2 A;  2BXO A;  1BM0 A;  3SQJ A;  4L8U A;  2BXI A;  2XW0 A;  3CX9 A;  5FUO A;  5IJE A;  4ZBQ A;  4EMX A;  1UOR A;  4LB9 A;  1HK1 A;  2BXN A;  2VUF A;  4LB2 A;  4N0F D;  1E7G A;  4G04 A;  1E7F A;  2BXE A;  2I30 A;  2XVU A;  1BJ5 A;  3LU8 A;  1LOT A;  1GNJ A;  1HK5 A;  4F5U A;  4K2C A;  4LUH A;  2XSI A;  4HGM B;  2XVQ A;  1HA2 A;  3V03 A;  4F5S A;  2BXP A;  2XVV A;  5ID9 A;  5HOZ A;  4LA0 A;  1J78 A;  2BXG A;  5IIX A;  5IFO A;  4J2V A;  4JK4 A;  1HK4 A;  5DBY A;  2XW1 A;  2VUE A;  4F5T A;  4IW1 A;  4L9K A;  5IIU A;  2BXD A;  1H9Z A;  5DQF A;  3LU7 A;  4ZBR A;  1E7C A;  1E7E A;  1E78 A;  3JRY A;  1E7B A;  1O9X A;  1J7E A;  2BX8 A;  2I2Z A;  5ID7 A;  5IIH A;  1MA9 A;  2BXQ A;  1HK2 A;  1HK3 A;  4OT2 A;  2VDB A;  4L9Q A;  4IW2 A;  2BXC A;  4K71 A;  1E7I A;  4OR0 A;  1BKE A;  3A73 A;  4E99 A;  3V09 A;  4Z69 A;  4LUF A;  2BXF A;  2XVW A;  1E7A A;  2BXK A;  1E7H A;  3UIV A;  1GNI A;  5IJF A;  1N5U A;  3B9M A;  3B9L A;  2BXH A;  2BXL A;  4G03 A;  3TDL A;  1TF0 A;  3JQZ A;  4F5V A;  3V08 A;  2BXB A;  2BXA A;  5GHK A;  4BKE A;  4PO0 A;  4N0U D; 
#chains in the Genus database with same CATH topology
 3SIU B;  3LU6 A;  2YDF A;  1SB0 A;  4HGK A;  5IJ5 A;  1AO6 A;  1KXP D;  3H3A A;  4S1Y A;  2BXM A;  2DBU A;  4BY9 C;  4I9O A;  2ROH A;  1KW2 A;  3NMU A;  2BXO A;  1BM0 A;  3KIK A;  3SQJ A;  2LXS A;  4L8U A;  4GDL B;  3BPJ A;  1VFI A;  3MHS B;  4DHX B;  3M99 C;  2BXI A;  2XW0 A;  3CX9 A;  5FUO A;  5IJE A;  3KJL A;  4ZBQ A;  1UOR A;  4EMX A;  1LNS A;  5B5T A;  5BPK A;  4LB9 A;  4W4U B;  2GUT A;  1H5W A;  1HK1 A;  3GQU A;  5GIO A;  1IJG A;  2DYO A;  2BXN A;  2VUF A;  4LB2 A;  2KBZ A;  4N0F D;  4TQ1 A;  1E7G A;  4G04 A;  1E7F A;  2EFE A;  2BXE A;  2I30 A;  2XVU A;  3FNM A;  3MHH B;  1BJ5 A;  3LU8 A;  2XMO A;  3FWC C;  3WHS A;  1LOT A;  3NVK A;  1GNJ A;  1HK5 A;  4F5U A;  4TQ0 A;  2K0N A;  2EFH A;  4GDX A;  4K2C A;  4LUH A;  2EFD A;  3ECP A;  2XSI A;  2AJE A;  2OZB B;  2CKX A;  4HGM B;  2EFC A;  2XVQ A;  1HA2 A;  2NNW A;  3V03 A;  4C31 B;  4F5S A;  2BXP A;  3A75 A;  2XVV A;  3SIV B;  1MM8 A;  5ID9 A;  5GIP A;  2Z8I A;  5HOZ A;  3FWB C;  4LA0 A;  1MIW A;  1J78 A;  2BXG A;  2DYM A;  2LQH A;  5IIX A;  1NT2 B;  2LXT A;  1MUH A;  4Z9O A;  5IFO A;  2QMC A;  2KWF A;  4J2V A;  4OTT A;  4JK4 A;  1HK4 A;  2QHB A;  1KDX A;  2V36 A;  5DBY A;  2XW1 A;  4M70 B;  2VUE A;  4D7X A;  4OTU A;  4F5T A;  4IW1 A;  4L9K A;  5IIU A;  2BXD A;  1H9Z A;  5DQF A;  3LU7 A;  3GA9 L;  4ZBR A;  1MIY A;  2Z8J A;  3WHR A;  1E7C A;  4GDK B;  4ZBK A;  1MIV A;  1E7E A;  1E78 A;  3ICX A;  3GQX A;  4FK5 B;  3W1S A;  3JRY A;  1E7B A;  4FIP B;  4N3Z A;  1O9X A;  2DBX A;  1J7E A;  2BX8 A;  2I2Z A;  2LQI A;  1VZS A;  5ID7 A;  5IIH A;  1MA9 A;  2BXQ A;  1HK2 A;  1JNB A;  1HK3 A;  4GG2 A;  4OT2 A;  3NVI A;  2VDB A;  4L9Q A;  4IW2 A;  4WA6 B;  2BXC A;  4K71 A;  2E0X A;  3VQI A;  1E7I A;  2DG5 A;  4OR0 A;  1BKE A;  4FJC B;  1TXU A;  2E0Y A;  2JUH A;  3A73 A;  2OT3 A;  3V09 A;  4E99 A;  4Z69 A;  3WHQ A;  5GIN A;  4LUF A;  2DBW A;  2BXF A;  4ZUX V;  2XVW A;  1E7A A;  2BXK A;  1E7H A;  1MUS A;  4MBE C;  3UIV A;  1GNI A;  5IJF A;  4ZC6 A;  1N5U A;  3B9M A;  3B9L A;  3PLA A;  2AGH B;  2BXH A;  2BXL A;  3H37 A;  1FOU A;  2NQO A;  4G03 A;  3TDL A;  5D7G A;  1TF0 A;  2Z8K A;  2LOQ A;  3JQZ A;  4ZCG A;  4F5V A;  3V08 A;  4DM0 A;  2BXB A;  2BXA A;  5GHK A;  3G9K D;  4G01 A;  4BKE A;  4PO0 A;  4NAW B;  3NVM A;  4N0U D;  2QM6 A; 
#chains in the Genus database with same CATH homology
 3SIU B;  3LU6 A;  2YDF A;  4HGK A;  5IJ5 A;  1AO6 A;  1KXP D;  3H3A A;  4S1Y A;  2BXM A;  2DBU A;  4BY9 C;  2ROH A;  1KW2 A;  3NMU A;  2BXO A;  1BM0 A;  3KIK A;  3SQJ A;  4L8U A;  4GDL B;  4DHX B;  1VFI A;  3MHS B;  3M99 C;  2BXI A;  2XW0 A;  3CX9 A;  5FUO A;  5IJE A;  3KJL A;  4ZBQ A;  1UOR A;  4EMX A;  1LNS A;  5B5T A;  5BPK A;  4LB9 A;  4W4U B;  1H5W A;  1HK1 A;  3GQU A;  5GIO A;  1IJG A;  2DYO A;  2BXN A;  2VUF A;  4LB2 A;  2KBZ A;  4N0F D;  4TQ1 A;  1E7G A;  4G04 A;  1E7F A;  2EFE A;  2BXE A;  2I30 A;  2XVU A;  3FNM A;  3MHH B;  1BJ5 A;  3LU8 A;  2XMO A;  3FWC C;  3WHS A;  1LOT A;  3NVK A;  1GNJ A;  1HK5 A;  4F5U A;  4TQ0 A;  2EFH A;  4GDX A;  4K2C A;  4LUH A;  2EFD A;  2XSI A;  2AJE A;  2OZB B;  2CKX A;  4HGM B;  2EFC A;  2XVQ A;  1HA2 A;  2NNW A;  3V03 A;  4C31 B;  4F5S A;  2BXP A;  3A75 A;  2XVV A;  3SIV B;  5ID9 A;  5GIP A;  2Z8I A;  5HOZ A;  3FWB C;  4LA0 A;  1MIW A;  1J78 A;  2BXG A;  2DYM A;  5IIX A;  1NT2 B;  4Z9O A;  5IFO A;  2QMC A;  4J2V A;  4OTT A;  4JK4 A;  1HK4 A;  2QHB A;  2V36 A;  5DBY A;  2XW1 A;  4M70 B;  2VUE A;  4OTU A;  4F5T A;  4IW1 A;  4L9K A;  5IIU A;  2BXD A;  1H9Z A;  5DQF A;  3LU7 A;  3GA9 L;  4ZBR A;  1MIY A;  2Z8J A;  3WHR A;  1E7C A;  4GDK B;  4ZBK A;  1MIV A;  1E7E A;  1E78 A;  3ICX A;  3GQX A;  4FK5 B;  3W1S A;  3JRY A;  1E7B A;  4FIP B;  4N3Z A;  1O9X A;  2DBX A;  1J7E A;  2BX8 A;  2I2Z A;  5ID7 A;  1VZS A;  5IIH A;  1MA9 A;  2BXQ A;  1HK2 A;  1JNB A;  1HK3 A;  4GG2 A;  4OT2 A;  3NVI A;  2VDB A;  4L9Q A;  4IW2 A;  4WA6 B;  2BXC A;  4K71 A;  2E0X A;  3VQI A;  1E7I A;  2DG5 A;  4OR0 A;  1BKE A;  4FJC B;  1TXU A;  2E0Y A;  2JUH A;  3A73 A;  2OT3 A;  3V09 A;  4E99 A;  4Z69 A;  3WHQ A;  5GIN A;  4LUF A;  2DBW A;  2BXF A;  4ZUX V;  2XVW A;  1E7A A;  2BXK A;  1E7H A;  4MBE C;  3UIV A;  1GNI A;  5IJF A;  4ZC6 A;  1N5U A;  3B9M A;  3B9L A;  3PLA A;  3H37 A;  2BXH A;  2BXL A;  1FOU A;  2NQO A;  4G03 A;  3TDL A;  5D7G A;  1TF0 A;  2Z8K A;  2LOQ A;  3JQZ A;  4ZCG A;  4F5V A;  3V08 A;  2BXB A;  2BXA A;  5GHK A;  3G9K D;  4G01 A;  4BKE A;  4PO0 A;  4NAW B;  3NVM A;  4N0U D;  2QM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...