4N3ZA

Crystal structure of rabex-5delta and rabaptin-5c21 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
290
structure length
238
Chain Sequence
EFIEFLKTHKTGQEIYKQTFLEGMHYKRDLIEEQSECAQDFYHNVEKIMDQIEKYIMTRLDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Rab5 GDP/GTP exchange factor
publication title Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 238
sequence length 290
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4n3zA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4n3zA02
2EFHA 4G01A 2EFEA 1TXUA 2EFCA 4N3ZA 2OT3A 2EFDA
chains in the Genus database with same CATH superfamily
4WA6B 3RFRC 3UBKA 4G0LA 1PD21 3SWLA 1MTCA 1B4PA 4HI7A 4EDZA 1E78A 1SB0A 1AQVA 1USBA 2HRAA 4Q5NA 3WD6A 3F63A 4BY9C 1VF3A 2R4VA 3F6DA 1BJ5A 5IJEA 5FWGA 3VI5A 2BXAA 2VCZA 1BYEA 2V6KA 1YY7A 3QAGA 2D2ZA 5D9WA 2XVVA 2WVYA 3UVHA 1FOUA 1GNWA 1E7FA 2DBWA 3FR6A 3GURA 4I9OA 1PA3A 5ECKB 5KEJA 1PX6A 1SVLA 2HNLA 1F2EA 4ZBDA 4AKXB 3ERGA 4Q5RA 5IFOA 19GSA 1Z9HA 2CVDA 3LG6A 2F8FA 3UAPA 1YJ6A 3BPJA 3DD3A 2H1LA 2WVXB 1PN9A 3MAKA 3TOTA 4GDXA 4J2VA 1KXPD 1BM0A 4OFMA 3N5OA 5F8BA 5DQFA 3IK7A 3NMUA 6GSYA 3KJYA 3B9MA 1BKEA 2BXGA 3VLNA 1E7CA 3V09A 5DAKB 3ICXA 1VF2A 5IJFA 1E7EA 5ECRB 2BXEA 3GA9L 4TQ1A 3CSIA 2R5GA 5FHIA 5D73A 1XWKA 1XW5A 4G04A 2CZ3A 2LQHA 2HQTA 4JK4A 1BG5A 1U3IA 1Q4JA 4NAXA 2GSQA 5A34B 2NTOA 4GF0A 3A75A 1GSQA 4G01A 5D7GA 4QMKA 3KIKA 5GIOA 12GSA 4LB9A 1F3AA 3LYKA 4OMVA 3SQJA 2OADA 6GSTA 1GSDA 4YQMA 3FNMA 5BPKA 17GSA 4WR5A 2O3EA 4MK3A 2C3TA 4K0GA 3FYGA 3ZMKA 1BAYA 4FJCB 1R5AA 2VD0A 1K0NA 1GNJA 3EE2A 4OFNA 1MUSA 1PGTA 5A1NA 3R2QA 4KAEA 2YV9A 5A5HA 4MDCA 3TOUA 2UZ8A 4IGJA 3D0ZA 3LU8A 3GSSA 2PERA 3LXTA 4F0BA 1GSUA 4GDKB 1AQXA 4HGKA 4Q5QA 4EMXA 2GSRA 1XWGA 2DBUA 5LCZA 1M9BA 3G9KD 1HK2A 2KBZA 1LNSA 4EXJA 1GTBA 3FWBC 1VZSA 4PQHA 3H3AA 1DUGA 20GSA 2ON7A 1BX9A 10GSA 4GDLB 11GSA 1HA2A 4BVXB 4LA0A 5BMUA 1NT2B 4K71A 13GSA 18GSA 2BXFA 1N2AA 3WHSA 3ISOA 3LFLA 3P90A 5JCUA 5ECHB 1MD3A 1J7EA 5IJ5A 5D9TA 6GSWA 2LXSA 2VDBA 1M99A 3IK9A 3CRUA 4KDYA 3VK9A 3RBTA 2EFCA 1UA5A 2VCWA 5J47A 2WB9A 3QAVA 1HQOA 3CX9A 4S1YA 3B9LA 4E99A 4O7HA 4ZBRA 4E68A 3NVMA 2DSAA 4ZCGA 5B7CA 3PPUA 2GUTA 4JEDA 4BVYB 1OE8A 2NQOA 1I1IP 2YV7A 2VO4A 1KBNA 2C4JA 4DEJA 1MIYA 3TDLA 3TGZA 4AKGA 5ID7A 1MIWA 2CA8A 2UV8G 4IQ1A 4KF9A 2VUEA 2XMOA 1KDXA 5DAKA 3VPTA 2GSTA 3UIVA 2WVZA 1ZL9A 2GDRA 1K3OA 4TOPA 3ZMLA 4YAVA 4WR4A 3UBLA 4C31B 4LMWA 5IIUA 2EFEA 2O5VA 2WRTA 4L8UA 5A34A 3CSJA 5GINA 3SIVB 3TU3B 2DBXA 1HNBA 4AKHA 3M3MA 1K0DA 5DALB 3LQ7A 2AHEA 4FXYP 2C3NA 4NAWB 4Q5FA 2XW1A 1JNBA 2DC5A 2C80A 4GLTA 5J40A 2VKZG 2QM6A 1TXUA 1ZGNA 5F07A 4PQIA 4GG2A 4LUHA 4PNGA 3L0HA 2E0YA 4IJIA 1IJGA 3GX0A 1U87A 2PBJA 4YQUA 2OACA 1E7BA 4PGTA 3ZFBA 3C8EA 3IE3A 4ZB9A 1GNIA 1EOHA 3GTUB 1E7GA 4ZBQA 2KWFA 1PL2A 2OT3A 4OTUA 2JUHA 5ECLB 2EFHA 2F3MA 3G7JA 1OKTA 2AGHB 2GSSA 4N0UD 1ML6A 4PURA 4EE0A 4IQAA 4ECCA 4KH7A 1K0AA 5ECOB 2NNWA 1TDIA 4F5UA 1F3BA 4MP4A 4BVXA 4ZBAA 2ROHA 1O9XA 4NHZA 1M9AA 1NHYA 3M1GA 4G0KA 5FUOA 1AO6A 1EV4A 1MIVA 3V03A 3Q74A 2Z8JA 3VPQA 3PLAA 2XVUA 4KX4A 3NIVA 5G5FA 2WW0A 2AJEA 5FT3A 5ELGA 2CZ2A 5G5EA 2BXDA 3GSTA 5ECIB 1PL1A 4N3ZA 1VF4A 3A73A 4GTUA 3QAWA 1B8XA 4N0VA 3LYPA 2HSMA 4BL7B 4PTSA 1VFIA 1B48A 5B5TA 1PX7A 1V40A 4MBEC 3H1NA 3CBUA 3P8WA 4GSSA 1S4BP 2VCXA 5AGYA 1OYJA 3MHHB 4MF7A 6GSVA 1EV9A 3IBHA 2BXNA 1YEWC 4PX1A 3WYWA 5DBYA 4KDUA 4L8EA 1Y1UA 1AXDA 4ZUXV 3JQZA 1GLQA 2IMKA 3GQUA 3GUSA 1MM8A 1MD4A 1TW9A 2IL3A 2CKXA 2BXIA 1K3LA 1K0BA 4D7XA 1TU7A 2PGTA 5EL8A 1GSSA 2Z8IA 3BBYA 2WW2A 3VQIA 1N5UA 1TF0A 3FWCC 4GSTA 4KGIA 2R3XA 3DGQA 5DJLA 4JBBA 4IS0A 4OR0A 3JRYA 2YCDA 4QQ7A 1GTAA 3M99C 5DCGA 4FK5B 5EVOA 4BKEA 2V36A 3UARA 3VI7A 2DYOA 2BXCA 1E7IA 4L9QA 3Q19A 2O36A 4G9HA 4IELA 2LJRA 2QHBA 5J4VA 3NVKA 1EOGA 4ZC6A 1HK1A 3HJMA 4G0IA 1GTIA 5A4VA 3CSHA 4ID0A 2I2ZA 1M0UA 3IR4A 3KJLA 1PMTA 3KTLA 3V08A 2R6KA 3O76A 3Q18A 1RK4A 4PI0C 3KMNA 5ECNB 2WVXA 4ZB8A 2XVWA 3GTUA 2BXOA 1C72A 4F5TA 3FR9A 4IBPA 3G7IA 2BXBA 2YDFA 2PVQA 4W4UB 5F06A 3M0FA 5ECQB 2GLRA 4F5SA 3QR6A 1A0FA 3CHXC 3ZFLA 1YVLA 5GIPA 4K0NA 4HGMB 4F03A 4NHWA 1JZRA 4IW2A 3LJRA 4N0FD 4Z69A 1XW6A 3VWXA 2X64A 1GUHA 6GSUA 4PO0A 4LB2A 4RI6A 3CWGA 3GH6A 2OA7A 5LD0A 7GSSA 5AIXA 4YAPA 2WW1A 1JLWA 5IQYA 4RI7A 1E7AA 4LUFA 2BXLA 3ECPA 3WHRA 3NVIA 1G6WA 2DYMA 5EY6A 4K2CA 2EFDA 2BXPA 3AY8A 1HK3A 3PR8A 4HJ2A 4PI2C 2BXQA 2WJUA 1GULA 1PKZA 4ACSA 3I69A 4YH2A 9GSSA 4MPFA 3KM6A 4FIPB 4MF6A 4DM0A 1GSYA 1IYIA 5GSSA 2HSNB 1YQ1A 4DHXB 4TQ0A 4ZBKA 2HRKB 5BMUB 4HZ2A 5DQSA 6GSXA 1H5WA 1J78A 4G03A 2VUFA 3W1SA 3VURA 2Z8KA 5DDLA 2PMTA 4KDXA 5ECPB 1HNAA 1GUKA 3KMOA 5ELAA 4ZBBA 4GDFA 3LU7A 1HK5A 2I30A 3HJOA 1FHEA 5JCWA 4G10A 1GLPA 3MHSB 4L9KA 3N9JA 4E8EA 5HOZA 4KSMA 4EC0A 5ID9A 5IIHA 6GSSA 1E6BA 2N5FA 5A4UA 2J9HA 2JL4A 4IKHA 5AISA 5D9VA 5ECSA 1SVMA 2AAWA 2E0XA 2A2SA 2VCQA 4IVFA 4M70B 1GUMA 5DJMA 1HK4A 2WW3A 3LXZA 4L5OA 5AIVA 4PXOA 4OT2A 3RGBC 1K3YA 2VD1A 3CRTA 4BVYA 4LMVA 4E8HA 5J4YA 1BG1A 1SVOA 4ISDA 2XW0A 1BF5A 1Y6EA 1YDKA 1GWCA 2DG5A 2IMIA 2AB6A 3O3TA 1GNEA 22GSA 2BXHA 5AN1A 3GQXA 3SIUB 3FRCA 4AI6A 1FW1A 3EINA 2BXMA 4JZQA 1LJRA 4OTTA 2WS2A 4MPGA 5IIXA 4AKIA 5D9XA 4O92A 1AQWA 2FHEA 1EEMA 3LSZA 4KE3A 1G7OA 1AW9A 2LOQA 1H9ZA 1GSEA 1LOTA 4MF5A 3M8NA 1GTUA 2LQIA 4USSA 5DALA 1MA9A 1VF1A 1KW2A 2ON5A 2OZBB 2VCVA 4ZB7A 14GSA 4ECJA 4ECIA 2CAQA 2WDUA 4GSNA 1V2AA 3WHQA 4MZWA 2C3QA 3HKRA 2BXKA 4W66A 2GTUA 1YKCA 5A4WA 5A5KA 1GSFA 2FNOA 3HMJG 4J2FA 8GSSA 1JLVA 1UORA 1TU8A 3W8SA 4FQUA 2HSNA 3H37A 4PHZC 4IW9A 4IW1A 4Z9OA 2HRKA 4EDYA 1HNCA 1OE7A 1IYHA 2BX8A 2WZSA 4YQVA 5J5NA 3ERFA 3I6AA 4G19A 4ZXGA 2CAIA 4I97A 3KXOA 1K0CA 5GHKA 1K0MA 4PUAA 1E7HA 4AGSA 4ECBA 1LBKA 1MUHA 5J41A 1U88A 4ZB6A 4PNFA 16GSA 2VCTA 3PGTA 4HOJA 2XVQA 3R3EA 2HSMB 2LXTA 1N25A 5GSTA 5J4UA 3MDKA 3U6VA 4L5LA 1PKWA 4CHSA 2XSIA 5A1NB 3F6FA 4GCIA 3FY7A 4HZ4A 5A5HB 2QMCA 3IC8A 1G6YA 5GZZB 5F05A 4OFTA 4BL7A 4F0CA 3LU6A 1K0OA 3FR3A 2K0NA 5ECMB 5HFKA 2A2RA 5F0GA 4F5VA 2C8UA
chains in the Genus database with same CATH topology
4WA6B 3UBKA 3SWLA 4G0LA 1PD21 1MTCA 1B4PA 4HI7A 4EDZA 1E78A 1AQVA 1USBA 2HRAA 4Q5NA 3WD6A 3F63A 4BY9C 1VF3A 2R4VA 3F6DA 1BJ5A 5IJEA 5FWGA 3VI5A 2BXAA 2VCZA 1BYEA 2V6KA 1YY7A 3QAGA 2D2ZA 5D9WA 2XVVA 3UVHA 1FOUA 1GNWA 1E7FA 2DBWA 3FR6A 3GURA 1PA3A 5ECKB 5KEJA 1PX6A 1SVLA 2HNLA 1F2EA 4ZBDA 4AKXB 3ERGA 4Q5RA 5IFOA 19GSA 1Z9HA 2CVDA 3LG6A 2F8FA 3UAPA 1YJ6A 3DD3A 2H1LA 1PN9A 3MAKA 3TOTA 4GDXA 4J2VA 1KXPD 1BM0A 4OFMA 3N5OA 5F8BA 5DQFA 3IK7A 3NMUA 6GSYA 3KJYA 3B9MA 1BKEA 2BXGA 3VLNA 1E7CA 3V09A 5DAKB 3ICXA 1VF2A 5IJFA 1E7EA 5ECRB 2BXEA 3GA9L 4TQ1A 3CSIA 2R5GA 5FHIA 5D73A 1XWKA 1XW5A 4G04A 2CZ3A 2HQTA 4JK4A 1BG5A 1U3IA 1Q4JA 4NAXA 2GSQA 5A34B 2NTOA 4GF0A 3A75A 1GSQA 4G01A 5D7GA 4QMKA 3KIKA 5GIOA 12GSA 4LB9A 1F3AA 3LYKA 4OMVA 3SQJA 2OADA 6GSTA 1GSDA 4YQMA 3FNMA 5BPKA 17GSA 4WR5A 4MK3A 2C3TA 4K0GA 3FYGA 3ZMKA 1BAYA 4FJCB 1R5AA 2VD0A 1K0NA 1GNJA 3EE2A 4OFNA 1PGTA 5A1NA 3R2QA 4KAEA 2YV9A 5A5HA 4MDCA 3TOUA 2UZ8A 4IGJA 3D0ZA 3LU8A 3GSSA 2PERA 3LXTA 4F0BA 1GSUA 4GDKB 1AQXA 4HGKA 4Q5QA 4EMXA 2GSRA 1XWGA 2DBUA 5LCZA 1M9BA 3G9KD 1HK2A 2KBZA 1LNSA 4EXJA 1GTBA 3FWBC 1VZSA 4PQHA 3H3AA 1DUGA 20GSA 2ON7A 1BX9A 10GSA 4GDLB 11GSA 1HA2A 4BVXB 4LA0A 5BMUA 1NT2B 4K71A 13GSA 18GSA 2BXFA 1N2AA 3WHSA 3ISOA 3LFLA 3P90A 5JCUA 5ECHB 1MD3A 1J7EA 5IJ5A 5D9TA 6GSWA 2VDBA 1M99A 3IK9A 3CRUA 4KDYA 3VK9A 3RBTA 2EFCA 1UA5A 2VCWA 5J47A 2WB9A 3QAVA 1HQOA 3CX9A 4S1YA 3B9LA 4E99A 4O7HA 4ZBRA 4E68A 3NVMA 2DSAA 4ZCGA 5B7CA 3PPUA 4JEDA 4BVYB 1OE8A 2NQOA 2YV7A 2VO4A 1KBNA 2C4JA 4DEJA 1MIYA 3TDLA 3TGZA 4AKGA 5ID7A 1MIWA 2CA8A 2UV8G 4IQ1A 4KF9A 2VUEA 2XMOA 5DAKA 3VPTA 2GSTA 3UIVA 1ZL9A 2GDRA 1K3OA 4TOPA 3ZMLA 4YAVA 4WR4A 3UBLA 4C31B 4LMWA 5IIUA 2EFEA 2O5VA 2WRTA 4L8UA 5A34A 3CSJA 5GINA 3SIVB 3TU3B 2DBXA 1HNBA 4AKHA 3M3MA 1K0DA 5DALB 3LQ7A 2AHEA 4Q5FA 2C3NA 4NAWB 2XW1A 1JNBA 2DC5A 2C80A 4GLTA 5J40A 2VKZG 2QM6A 1TXUA 1ZGNA 5F07A 4PQIA 4GG2A 4LUHA 4PNGA 3L0HA 2E0YA 4IJIA 1IJGA 3GX0A 1U87A 2PBJA 4YQUA 2OACA 1E7BA 4PGTA 3ZFBA 3C8EA 3IE3A 4ZB9A 1GNIA 1EOHA 3GTUB 1E7GA 4ZBQA 1PL2A 2OT3A 4OTUA 2JUHA 5ECLB 2EFHA 2F3MA 3G7JA 1OKTA 2GSSA 4N0UD 1ML6A 4PURA 4EE0A 4IQAA 4ECCA 4KH7A 1K0AA 5ECOB 2NNWA 1TDIA 4F5UA 1F3BA 4MP4A 4BVXA 4ZBAA 2ROHA 1O9XA 4NHZA 1M9AA 1NHYA 3M1GA 4G0KA 5FUOA 1AO6A 1EV4A 1MIVA 3V03A 3Q74A 2Z8JA 3VPQA 3PLAA 2XVUA 4KX4A 3NIVA 5G5FA 2AJEA 5FT3A 5ELGA 2CZ2A 5G5EA 2BXDA 3GSTA 5ECIB 1PL1A 4N3ZA 1VF4A 3A73A 4GTUA 3QAWA 1B8XA 4N0VA 3LYPA 2HSMA 4BL7B 4PTSA 1VFIA 1B48A 5B5TA 1PX7A 1V40A 4MBEC 3H1NA 3CBUA 3P8WA 4GSSA 5AGYA 2VCXA 1OYJA 3MHHB 4MF7A 6GSVA 1EV9A 3IBHA 2BXNA 4PX1A 3WYWA 5DBYA 4KDUA 4L8EA 1Y1UA 1AXDA 4ZUXV 3JQZA 1GLQA 2IMKA 3GQUA 3GUSA 1MD4A 1TW9A 2IL3A 2CKXA 2BXIA 1K3LA 1K0BA 1TU7A 2PGTA 5EL8A 1GSSA 2Z8IA 3BBYA 3VQIA 1N5UA 1TF0A 3FWCC 4GSTA 4KGIA 2R3XA 3DGQA 5DJLA 4JBBA 4IS0A 4OR0A 3JRYA 2YCDA 4QQ7A 1GTAA 3M99C 5DCGA 4FK5B 5EVOA 4BKEA 2V36A 3UARA 3VI7A 2DYOA 2BXCA 1E7IA 4L9QA 3Q19A 4G9HA 4IELA 2LJRA 2QHBA 5J4VA 3NVKA 1EOGA 4ZC6A 1HK1A 3HJMA 4G0IA 1GTIA 5A4VA 3CSHA 4ID0A 2I2ZA 1M0UA 3IR4A 3KJLA 1PMTA 3KTLA 3V08A 2R6KA 3O76A 3Q18A 1RK4A 3KMNA 5ECNB 4ZB8A 2XVWA 3GTUA 2BXOA 1C72A 4F5TA 3FR9A 4IBPA 3G7IA 2BXBA 2YDFA 2PVQA 4W4UB 5F06A 3M0FA 5ECQB 2GLRA 4F5SA 3QR6A 1A0FA 3ZFLA 1YVLA 5GIPA 4K0NA 4HGMB 4F03A 4NHWA 1JZRA 4IW2A 3LJRA 4N0FD 4Z69A 1XW6A 3VWXA 2X64A 1GUHA 6GSUA 4PO0A 4LB2A 4RI6A 3CWGA 3GH6A 2OA7A 5LD0A 7GSSA 5AIXA 4YAPA 1JLWA 5IQYA 4RI7A 1E7AA 4LUFA 2BXLA 3WHRA 3NVIA 1G6WA 2DYMA 5EY6A 4K2CA 2EFDA 2BXPA 3AY8A 1HK3A 3PR8A 4HJ2A 2BXQA 2WJUA 1GULA 1PKZA 4ACSA 3I69A 4YH2A 9GSSA 4MPFA 3KM6A 4FIPB 4MF6A 1GSYA 1IYIA 5GSSA 2HSNB 1YQ1A 4DHXB 4TQ0A 4ZBKA 2HRKB 5BMUB 4HZ2A 5DQSA 6GSXA 1H5WA 1J78A 4G03A 2VUFA 3W1SA 3VURA 2Z8KA 5DDLA 2PMTA 4KDXA 5ECPB 1HNAA 1GUKA 3KMOA 5ELAA 4ZBBA 4GDFA 3LU7A 1HK5A 2I30A 3HJOA 1FHEA 5JCWA 4G10A 1GLPA 3MHSB 4L9KA 3N9JA 4E8EA 5HOZA 4KSMA 4EC0A 5ID9A 5IIHA 6GSSA 1E6BA 2N5FA 5A4UA 2J9HA 2JL4A 4IKHA 5AISA 5D9VA 5ECSA 1SVMA 2AAWA 2E0XA 2A2SA 2VCQA 4IVFA 4M70B 1GUMA 5DJMA 1HK4A 3LXZA 5AIVA 4L5OA 4PXOA 4OT2A 4E8HA 1K3YA 2VD1A 3CRTA 4BVYA 4LMVA 5J4YA 1BG1A 1SVOA 4ISDA 2XW0A 1BF5A 1Y6EA 1YDKA 1GWCA 2DG5A 2IMIA 2AB6A 3O3TA 1GNEA 22GSA 2BXHA 5AN1A 3GQXA 3SIUB 3FRCA 4AI6A 1FW1A 3EINA 2BXMA 4JZQA 1LJRA 4OTTA 2WS2A 4MPGA 5IIXA 4AKIA 5D9XA 4O92A 1AQWA 2FHEA 1EEMA 3LSZA 4KE3A 1G7OA 1AW9A 2LOQA 1H9ZA 1GSEA 1LOTA 4MF5A 3M8NA 1GTUA 4USSA 5DALA 1MA9A 1VF1A 1KW2A 2ON5A 2OZBB 2VCVA 4ZB7A 14GSA 4ECJA 4ECIA 2CAQA 2WDUA 4GSNA 1V2AA 3WHQA 4MZWA 2C3QA 3HKRA 2BXKA 4W66A 2GTUA 1YKCA 5A4WA 5A5KA 1GSFA 2FNOA 3HMJG 4J2FA 8GSSA 1JLVA 1UORA 1TU8A 3W8SA 4FQUA 2HSNA 3H37A 4IW9A 4IW1A 4Z9OA 2HRKA 4EDYA 1HNCA 1OE7A 1IYHA 2BX8A 5J5NA 4YQVA 3ERFA 3I6AA 4G19A 4ZXGA 2CAIA 4I97A 3KXOA 1K0CA 5GHKA 1K0MA 4PUAA 1E7HA 4AGSA 4ECBA 1LBKA 5J41A 1U88A 4ZB6A 4PNFA 16GSA 2VCTA 3PGTA 4HOJA 2XVQA 3R3EA 2HSMB 1N25A 5GSTA 5J4UA 3MDKA 3U6VA 4L5LA 1PKWA 4CHSA 2XSIA 5A1NB 3F6FA 4GCIA 3FY7A 4HZ4A 5A5HB 2QMCA 3IC8A 1G6YA 5GZZB 5F05A 4OFTA 4BL7A 4F0CA 3LU6A 1K0OA 3FR3A 5ECMB 5HFKA 2A2RA 5F0GA 4F5VA 2C8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFH A;  4G01 A;  2EFE A;  1TXU A;  2EFC A;  4N3Z A;  2OT3 A;  2EFD A; 
#chains in the Genus database with same CATH topology
 4WA6 B;  3RFR C;  3UBK A;  4G0L A;  1PD2 1;  3SWL A;  1MTC A;  1B4P A;  4HI7 A;  4EDZ A;  1E78 A;  1SB0 A;  1AQV A;  1USB A;  2HRA A;  4Q5N A;  3WD6 A;  3F63 A;  4BY9 C;  1VF3 A;  2R4V A;  3F6D A;  1BJ5 A;  5IJE A;  5FWG A;  3VI5 A;  2BXA A;  2VCZ A;  1BYE A;  2V6K A;  1YY7 A;  3QAG A;  2D2Z A;  5D9W A;  2XVV A;  2WVY A;  3UVH A;  1FOU A;  1GNW A;  1E7F A;  2DBW A;  3FR6 A;  3GUR A;  4I9O A;  1PA3 A;  5ECK B;  5KEJ A;  1PX6 A;  1SVL A;  2HNL A;  1F2E A;  4ZBD A;  4AKX B;  3ERG A;  4Q5R A;  5IFO A;  19GS A;  1Z9H A;  2CVD A;  3LG6 A;  2F8F A;  3UAP A;  1YJ6 A;  3BPJ A;  3DD3 A;  2H1L A;  2WVX B;  1PN9 A;  3MAK A;  3TOT A;  4GDX A;  4J2V A;  1KXP D;  1BM0 A;  4OFM A;  3N5O A;  5F8B A;  5DQF A;  3IK7 A;  3NMU A;  6GSY A;  3KJY A;  3B9M A;  1BKE A;  2BXG A;  3VLN A;  1E7C A;  3V09 A;  5DAK B;  3ICX A;  1VF2 A;  5IJF A;  1E7E A;  5ECR B;  2BXE A;  3GA9 L;  4TQ1 A;  3CSI A;  2R5G A;  5FHI A;  5D73 A;  1XWK A;  1XW5 A;  4G04 A;  2CZ3 A;  2LQH A;  2HQT A;  4JK4 A;  1BG5 A;  1U3I A;  1Q4J A;  4NAX A;  2GSQ A;  5A34 B;  2NTO A;  4GF0 A;  3A75 A;  1GSQ A;  4G01 A;  5D7G A;  4QMK A;  3KIK A;  5GIO A;  12GS A;  4LB9 A;  1F3A A;  3LYK A;  4OMV A;  3SQJ A;  2OAD A;  6GST A;  1GSD A;  4YQM A;  3FNM A;  5BPK A;  17GS A;  4WR5 A;  2O3E A;  4MK3 A;  2C3T A;  4K0G A;  3FYG A;  3ZMK A;  1BAY A;  4FJC B;  1R5A A;  2VD0 A;  1K0N A;  1GNJ A;  3EE2 A;  4OFN A;  1MUS A;  1PGT A;  5A1N A;  3R2Q A;  4KAE A;  2YV9 A;  5A5H A;  4MDC A;  3TOU A;  2UZ8 A;  4IGJ A;  3D0Z A;  3LU8 A;  3GSS A;  2PER A;  3LXT A;  4F0B A;  1GSU A;  4GDK B;  1AQX A;  4HGK A;  4Q5Q A;  4EMX A;  2GSR A;  1XWG A;  2DBU A;  5LCZ A;  1M9B A;  3G9K D;  1HK2 A;  2KBZ A;  1LNS A;  4EXJ A;  1GTB A;  3FWB C;  1VZS A;  4PQH A;  3H3A A;  1DUG A;  20GS A;  2ON7 A;  1BX9 A;  10GS A;  4GDL B;  11GS A;  1HA2 A;  4BVX B;  4LA0 A;  5BMU A;  1NT2 B;  4K71 A;  13GS A;  18GS A;  2BXF A;  1N2A A;  3WHS A;  3ISO A;  3LFL A;  3P90 A;  5JCU A;  5ECH B;  1MD3 A;  1J7E A;  5IJ5 A;  5D9T A;  6GSW A;  2LXS A;  2VDB A;  1M99 A;  3IK9 A;  3CRU A;  4KDY A;  3VK9 A;  3RBT A;  2EFC A;  1UA5 A;  2VCW A;  5J47 A;  2WB9 A;  3QAV A;  1HQO A;  3CX9 A;  4S1Y A;  3B9L A;  4E99 A;  4O7H A;  4ZBR A;  4E68 A;  3NVM A;  2DSA A;  4ZCG A;  5B7C A;  3PPU A;  2GUT A;  4JED A;  4BVY B;  1OE8 A;  2NQO A;  1I1I P;  2YV7 A;  2VO4 A;  1KBN A;  2C4J A;  4DEJ A;  1MIY A;  3TDL A;  3TGZ A;  4AKG A;  5ID7 A;  1MIW A;  2CA8 A;  2UV8 G;  4IQ1 A;  4KF9 A;  2VUE A;  2XMO A;  1KDX A;  5DAK A;  3VPT A;  2GST A;  3UIV A;  2WVZ A;  1ZL9 A;  2GDR A;  1K3O A;  4TOP A;  3ZML A;  4YAV A;  4WR4 A;  3UBL A;  4C31 B;  4LMW A;  5IIU A;  2EFE A;  2O5V A;  2WRT A;  4L8U A;  5A34 A;  3CSJ A;  5GIN A;  3SIV B;  3TU3 B;  2DBX A;  1HNB A;  4AKH A;  3M3M A;  1K0D A;  5DAL B;  3LQ7 A;  2AHE A;  4FXY P;  2C3N A;  4NAW B;  4Q5F A;  2XW1 A;  1JNB A;  2DC5 A;  2C80 A;  4GLT A;  5J40 A;  2VKZ G;  2QM6 A;  1TXU A;  1ZGN A;  5F07 A;  4PQI A;  4GG2 A;  4LUH A;  4PNG A;  3L0H A;  2E0Y A;  4IJI A;  1IJG A;  3GX0 A;  1U87 A;  2PBJ A;  4YQU A;  2OAC A;  1E7B A;  4PGT A;  3ZFB A;  3C8E A;  3IE3 A;  4ZB9 A;  1GNI A;  1EOH A;  3GTU B;  1E7G A;  4ZBQ A;  2KWF A;  1PL2 A;  2OT3 A;  4OTU A;  2JUH A;  5ECL B;  2EFH A;  2F3M A;  3G7J A;  1OKT A;  2AGH B;  2GSS A;  4N0U D;  1ML6 A;  4PUR A;  4EE0 A;  4IQA A;  4ECC A;  4KH7 A;  1K0A A;  5ECO B;  2NNW A;  1TDI A;  4F5U A;  1F3B A;  4MP4 A;  4BVX A;  4ZBA A;  2ROH A;  1O9X A;  4NHZ A;  1M9A A;  1NHY A;  3M1G A;  4G0K A;  5FUO A;  1AO6 A;  1EV4 A;  1MIV A;  3V03 A;  3Q74 A;  2Z8J A;  3VPQ A;  3PLA A;  2XVU A;  4KX4 A;  3NIV A;  5G5F A;  2WW0 A;  2AJE A;  5FT3 A;  5ELG A;  2CZ2 A;  5G5E A;  2BXD A;  3GST A;  5ECI B;  1PL1 A;  4N3Z A;  1VF4 A;  3A73 A;  4GTU A;  3QAW A;  1B8X A;  4N0V A;  3LYP A;  2HSM A;  4BL7 B;  4PTS A;  1VFI A;  1B48 A;  5B5T A;  1PX7 A;  1V40 A;  4MBE C;  3H1N A;  3CBU A;  3P8W A;  4GSS A;  1S4B P;  2VCX A;  5AGY A;  1OYJ A;  3MHH B;  4MF7 A;  6GSV A;  1EV9 A;  3IBH A;  2BXN A;  1YEW C;  4PX1 A;  3WYW A;  5DBY A;  4KDU A;  4L8E A;  1Y1U A;  1AXD A;  4ZUX V;  3JQZ A;  1GLQ A;  2IMK A;  3GQU A;  3GUS A;  1MM8 A;  1MD4 A;  1TW9 A;  2IL3 A;  2CKX A;  2BXI A;  1K3L A;  1K0B A;  4D7X A;  1TU7 A;  2PGT A;  5EL8 A;  1GSS A;  2Z8I A;  3BBY A;  2WW2 A;  3VQI A;  1N5U A;  1TF0 A;  3FWC C;  4GST A;  4KGI A;  2R3X A;  3DGQ A;  5DJL A;  4JBB A;  4IS0 A;  4OR0 A;  3JRY A;  2YCD A;  4QQ7 A;  1GTA A;  3M99 C;  5DCG A;  4FK5 B;  5EVO A;  4BKE A;  2V36 A;  3UAR A;  3VI7 A;  2DYO A;  2BXC A;  1E7I A;  4L9Q A;  3Q19 A;  2O36 A;  4G9H A;  4IEL A;  2LJR A;  2QHB A;  5J4V A;  3NVK A;  1EOG A;  4ZC6 A;  1HK1 A;  3HJM A;  4G0I A;  1GTI A;  5A4V A;  3CSH A;  4ID0 A;  2I2Z A;  1M0U A;  3IR4 A;  3KJL A;  1PMT A;  3KTL A;  3V08 A;  2R6K A;  3O76 A;  3Q18 A;  1RK4 A;  4PI0 C;  3KMN A;  5ECN B;  2WVX A;  4ZB8 A;  2XVW A;  3GTU A;  2BXO A;  1C72 A;  4F5T A;  3FR9 A;  4IBP A;  3G7I A;  2BXB A;  2YDF A;  2PVQ A;  4W4U B;  5F06 A;  3M0F A;  5ECQ B;  2GLR A;  4F5S A;  3QR6 A;  1A0F A;  3CHX C;  3ZFL A;  1YVL A;  5GIP A;  4K0N A;  4HGM B;  4F03 A;  4NHW A;  1JZR A;  4IW2 A;  3LJR A;  4N0F D;  4Z69 A;  1XW6 A;  3VWX A;  2X64 A;  1GUH A;  6GSU A;  4PO0 A;  4LB2 A;  4RI6 A;  3CWG A;  3GH6 A;  2OA7 A;  5LD0 A;  7GSS A;  5AIX A;  4YAP A;  2WW1 A;  1JLW A;  5IQY A;  4RI7 A;  1E7A A;  4LUF A;  2BXL A;  3ECP A;  3WHR A;  3NVI A;  1G6W A;  2DYM A;  5EY6 A;  4K2C A;  2EFD A;  2BXP A;  3AY8 A;  1HK3 A;  3PR8 A;  4HJ2 A;  4PI2 C;  2BXQ A;  2WJU A;  1GUL A;  1PKZ A;  4ACS A;  3I69 A;  4YH2 A;  9GSS A;  4MPF A;  3KM6 A;  4FIP B;  4MF6 A;  4DM0 A;  1GSY A;  1IYI A;  5GSS A;  2HSN B;  1YQ1 A;  4DHX B;  4TQ0 A;  4ZBK A;  2HRK B;  5BMU B;  4HZ2 A;  5DQS A;  6GSX A;  1H5W A;  1J78 A;  4G03 A;  2VUF A;  3W1S A;  3VUR A;  2Z8K A;  5DDL A;  2PMT A;  4KDX A;  5ECP B;  1HNA A;  1GUK A;  3KMO A;  5ELA A;  4ZBB A;  4GDF A;  3LU7 A;  1HK5 A;  2I30 A;  3HJO A;  1FHE A;  5JCW A;  4G10 A;  1GLP A;  3MHS B;  4L9K A;  3N9J A;  4E8E A;  5HOZ A;  4KSM A;  4EC0 A;  5ID9 A;  5IIH A;  6GSS A;  1E6B A;  2N5F A;  5A4U A;  2J9H A;  2JL4 A;  4IKH A;  5AIS A;  5D9V A;  5ECS A;  1SVM A;  2AAW A;  2E0X A;  2A2S A;  2VCQ A;  4IVF A;  4M70 B;  1GUM A;  5DJM A;  1HK4 A;  2WW3 A;  3LXZ A;  4L5O A;  5AIV A;  4PXO A;  4OT2 A;  3RGB C;  1K3Y A;  2VD1 A;  3CRT A;  4BVY A;  4LMV A;  4E8H A;  5J4Y A;  1BG1 A;  1SVO A;  4ISD A;  2XW0 A;  1BF5 A;  1Y6E A;  1YDK A;  1GWC A;  2DG5 A;  2IMI A;  2AB6 A;  3O3T A;  1GNE A;  22GS A;  2BXH A;  5AN1 A;  3GQX A;  3SIU B;  3FRC A;  4AI6 A;  1FW1 A;  3EIN A;  2BXM A;  4JZQ A;  1LJR A;  4OTT A;  2WS2 A;  4MPG A;  5IIX A;  4AKI A;  5D9X A;  4O92 A;  1AQW A;  2FHE A;  1EEM A;  3LSZ A;  4KE3 A;  1G7O A;  1AW9 A;  2LOQ A;  1H9Z A;  1GSE A;  1LOT A;  4MF5 A;  3M8N A;  1GTU A;  2LQI A;  4USS A;  5DAL A;  1MA9 A;  1VF1 A;  1KW2 A;  2ON5 A;  2OZB B;  2VCV A;  4ZB7 A;  14GS A;  4ECJ A;  4ECI A;  2CAQ A;  2WDU A;  4GSN A;  1V2A A;  3WHQ A;  4MZW A;  2C3Q A;  3HKR A;  2BXK A;  4W66 A;  2GTU A;  1YKC A;  5A4W A;  5A5K A;  1GSF A;  2FNO A;  3HMJ G;  4J2F A;  8GSS A;  1JLV A;  1UOR A;  1TU8 A;  3W8S A;  4FQU A;  2HSN A;  3H37 A;  4PHZ C;  4IW9 A;  4IW1 A;  4Z9O A;  2HRK A;  4EDY A;  1HNC A;  1OE7 A;  1IYH A;  2BX8 A;  2WZS A;  4YQV A;  5J5N A;  3ERF A;  3I6A A;  4G19 A;  4ZXG A;  2CAI A;  4I97 A;  3KXO A;  1K0C A;  5GHK A;  1K0M A;  4PUA A;  1E7H A;  4AGS A;  4ECB A;  1LBK A;  1MUH A;  5J41 A;  1U88 A;  4ZB6 A;  4PNF A;  16GS A;  2VCT A;  3PGT A;  4HOJ A;  2XVQ A;  3R3E A;  2HSM B;  2LXT A;  1N25 A;  5GST A;  5J4U A;  3MDK A;  3U6V A;  4L5L A;  1PKW A;  4CHS A;  2XSI A;  5A1N B;  3F6F A;  4GCI A;  3FY7 A;  4HZ4 A;  5A5H B;  2QMC A;  3IC8 A;  1G6Y A;  5GZZ B;  5F05 A;  4OFT A;  4BL7 A;  4F0C A;  3LU6 A;  1K0O A;  3FR3 A;  2K0N A;  5ECM B;  5HFK A;  2A2R A;  5F0G A;  4F5V A;  2C8U A; 
#chains in the Genus database with same CATH homology
 4WA6 B;  3UBK A;  3SWL A;  4G0L A;  1PD2 1;  1MTC A;  1B4P A;  4HI7 A;  4EDZ A;  1E78 A;  1AQV A;  1USB A;  2HRA A;  4Q5N A;  3WD6 A;  3F63 A;  4BY9 C;  1VF3 A;  2R4V A;  3F6D A;  1BJ5 A;  5IJE A;  5FWG A;  3VI5 A;  2BXA A;  2VCZ A;  1BYE A;  2V6K A;  1YY7 A;  3QAG A;  2D2Z A;  5D9W A;  2XVV A;  3UVH A;  1FOU A;  1GNW A;  1E7F A;  2DBW A;  3FR6 A;  3GUR A;  1PA3 A;  5ECK B;  5KEJ A;  1PX6 A;  1SVL A;  2HNL A;  1F2E A;  4ZBD A;  4AKX B;  3ERG A;  4Q5R A;  5IFO A;  19GS A;  1Z9H A;  2CVD A;  3LG6 A;  2F8F A;  3UAP A;  1YJ6 A;  3DD3 A;  2H1L A;  1PN9 A;  3MAK A;  3TOT A;  4GDX A;  4J2V A;  1KXP D;  1BM0 A;  4OFM A;  3N5O A;  5F8B A;  5DQF A;  3IK7 A;  3NMU A;  6GSY A;  3KJY A;  3B9M A;  1BKE A;  2BXG A;  3VLN A;  1E7C A;  3V09 A;  5DAK B;  3ICX A;  1VF2 A;  5IJF A;  1E7E A;  5ECR B;  2BXE A;  3GA9 L;  4TQ1 A;  3CSI A;  2R5G A;  5FHI A;  5D73 A;  1XWK A;  1XW5 A;  4G04 A;  2CZ3 A;  2HQT A;  4JK4 A;  1BG5 A;  1U3I A;  1Q4J A;  4NAX A;  2GSQ A;  5A34 B;  2NTO A;  4GF0 A;  3A75 A;  1GSQ A;  4G01 A;  5D7G A;  4QMK A;  3KIK A;  5GIO A;  12GS A;  4LB9 A;  1F3A A;  3LYK A;  4OMV A;  3SQJ A;  2OAD A;  6GST A;  1GSD A;  4YQM A;  3FNM A;  5BPK A;  17GS A;  4WR5 A;  4MK3 A;  2C3T A;  4K0G A;  3FYG A;  3ZMK A;  1BAY A;  4FJC B;  1R5A A;  2VD0 A;  1K0N A;  1GNJ A;  3EE2 A;  4OFN A;  1PGT A;  5A1N A;  3R2Q A;  4KAE A;  2YV9 A;  5A5H A;  4MDC A;  3TOU A;  2UZ8 A;  4IGJ A;  3D0Z A;  3LU8 A;  3GSS A;  2PER A;  3LXT A;  4F0B A;  1GSU A;  4GDK B;  1AQX A;  4HGK A;  4Q5Q A;  4EMX A;  2GSR A;  1XWG A;  2DBU A;  5LCZ A;  1M9B A;  3G9K D;  1HK2 A;  2KBZ A;  1LNS A;  4EXJ A;  1GTB A;  3FWB C;  1VZS A;  4PQH A;  3H3A A;  1DUG A;  20GS A;  2ON7 A;  1BX9 A;  10GS A;  4GDL B;  11GS A;  1HA2 A;  4BVX B;  4LA0 A;  5BMU A;  1NT2 B;  4K71 A;  13GS A;  18GS A;  2BXF A;  1N2A A;  3WHS A;  3ISO A;  3LFL A;  3P90 A;  5JCU A;  5ECH B;  1MD3 A;  1J7E A;  5IJ5 A;  5D9T A;  6GSW A;  2VDB A;  1M99 A;  3IK9 A;  3CRU A;  4KDY A;  3VK9 A;  3RBT A;  2EFC A;  1UA5 A;  2VCW A;  5J47 A;  2WB9 A;  3QAV A;  1HQO A;  3CX9 A;  4S1Y A;  3B9L A;  4E99 A;  4O7H A;  4ZBR A;  4E68 A;  3NVM A;  2DSA A;  4ZCG A;  5B7C A;  3PPU A;  4JED A;  4BVY B;  1OE8 A;  2NQO A;  2YV7 A;  2VO4 A;  1KBN A;  2C4J A;  4DEJ A;  1MIY A;  3TDL A;  3TGZ A;  4AKG A;  5ID7 A;  1MIW A;  2CA8 A;  2UV8 G;  4IQ1 A;  4KF9 A;  2VUE A;  2XMO A;  5DAK A;  3VPT A;  2GST A;  3UIV A;  1ZL9 A;  2GDR A;  1K3O A;  4TOP A;  3ZML A;  4YAV A;  4WR4 A;  3UBL A;  4C31 B;  4LMW A;  5IIU A;  2EFE A;  2O5V A;  2WRT A;  4L8U A;  5A34 A;  3CSJ A;  5GIN A;  3SIV B;  3TU3 B;  2DBX A;  1HNB A;  4AKH A;  3M3M A;  1K0D A;  5DAL B;  3LQ7 A;  2AHE A;  4Q5F A;  2C3N A;  4NAW B;  2XW1 A;  1JNB A;  2DC5 A;  2C80 A;  4GLT A;  5J40 A;  2VKZ G;  2QM6 A;  1TXU A;  1ZGN A;  5F07 A;  4PQI A;  4GG2 A;  4LUH A;  4PNG A;  3L0H A;  2E0Y A;  4IJI A;  1IJG A;  3GX0 A;  1U87 A;  2PBJ A;  4YQU A;  2OAC A;  1E7B A;  4PGT A;  3ZFB A;  3C8E A;  3IE3 A;  4ZB9 A;  1GNI A;  1EOH A;  3GTU B;  1E7G A;  4ZBQ A;  1PL2 A;  2OT3 A;  4OTU A;  2JUH A;  5ECL B;  2EFH A;  2F3M A;  3G7J A;  1OKT A;  2GSS A;  4N0U D;  1ML6 A;  4PUR A;  4EE0 A;  4IQA A;  4ECC A;  4KH7 A;  1K0A A;  5ECO B;  2NNW A;  1TDI A;  4F5U A;  1F3B A;  4MP4 A;  4BVX A;  4ZBA A;  2ROH A;  1O9X A;  4NHZ A;  1M9A A;  1NHY A;  3M1G A;  4G0K A;  5FUO A;  1AO6 A;  1EV4 A;  1MIV A;  3V03 A;  3Q74 A;  2Z8J A;  3VPQ A;  3PLA A;  2XVU A;  4KX4 A;  3NIV A;  5G5F A;  2AJE A;  5FT3 A;  5ELG A;  2CZ2 A;  5G5E A;  2BXD A;  3GST A;  5ECI B;  1PL1 A;  4N3Z A;  1VF4 A;  3A73 A;  4GTU A;  3QAW A;  1B8X A;  4N0V A;  3LYP A;  2HSM A;  4BL7 B;  4PTS A;  1VFI A;  1B48 A;  5B5T A;  1PX7 A;  1V40 A;  4MBE C;  3H1N A;  3CBU A;  3P8W A;  4GSS A;  5AGY A;  2VCX A;  1OYJ A;  3MHH B;  4MF7 A;  6GSV A;  1EV9 A;  3IBH A;  2BXN A;  4PX1 A;  3WYW A;  5DBY A;  4KDU A;  4L8E A;  1Y1U A;  1AXD A;  4ZUX V;  3JQZ A;  1GLQ A;  2IMK A;  3GQU A;  3GUS A;  1MD4 A;  1TW9 A;  2IL3 A;  2CKX A;  2BXI A;  1K3L A;  1K0B A;  1TU7 A;  2PGT A;  5EL8 A;  1GSS A;  2Z8I A;  3BBY A;  3VQI A;  1N5U A;  1TF0 A;  3FWC C;  4GST A;  4KGI A;  2R3X A;  3DGQ A;  5DJL A;  4JBB A;  4IS0 A;  4OR0 A;  3JRY A;  2YCD A;  4QQ7 A;  1GTA A;  3M99 C;  5DCG A;  4FK5 B;  5EVO A;  4BKE A;  2V36 A;  3UAR A;  3VI7 A;  2DYO A;  2BXC A;  1E7I A;  4L9Q A;  3Q19 A;  4G9H A;  4IEL A;  2LJR A;  2QHB A;  5J4V A;  3NVK A;  1EOG A;  4ZC6 A;  1HK1 A;  3HJM A;  4G0I A;  1GTI A;  5A4V A;  3CSH A;  4ID0 A;  2I2Z A;  1M0U A;  3IR4 A;  3KJL A;  1PMT A;  3KTL A;  3V08 A;  2R6K A;  3O76 A;  3Q18 A;  1RK4 A;  3KMN A;  5ECN B;  4ZB8 A;  2XVW A;  3GTU A;  2BXO A;  1C72 A;  4F5T A;  3FR9 A;  4IBP A;  3G7I A;  2BXB A;  2YDF A;  2PVQ A;  4W4U B;  5F06 A;  3M0F A;  5ECQ B;  2GLR A;  4F5S A;  3QR6 A;  1A0F A;  3ZFL A;  1YVL A;  5GIP A;  4K0N A;  4HGM B;  4F03 A;  4NHW A;  1JZR A;  4IW2 A;  3LJR A;  4N0F D;  4Z69 A;  1XW6 A;  3VWX A;  2X64 A;  1GUH A;  6GSU A;  4PO0 A;  4LB2 A;  4RI6 A;  3CWG A;  3GH6 A;  2OA7 A;  5LD0 A;  7GSS A;  5AIX A;  4YAP A;  1JLW A;  5IQY A;  4RI7 A;  1E7A A;  4LUF A;  2BXL A;  3WHR A;  3NVI A;  1G6W A;  2DYM A;  5EY6 A;  4K2C A;  2EFD A;  2BXP A;  3AY8 A;  1HK3 A;  3PR8 A;  4HJ2 A;  2BXQ A;  2WJU A;  1GUL A;  1PKZ A;  4ACS A;  3I69 A;  4YH2 A;  9GSS A;  4MPF A;  3KM6 A;  4FIP B;  4MF6 A;  1GSY A;  1IYI A;  5GSS A;  2HSN B;  1YQ1 A;  4DHX B;  4TQ0 A;  4ZBK A;  2HRK B;  5BMU B;  4HZ2 A;  5DQS A;  6GSX A;  1H5W A;  1J78 A;  4G03 A;  2VUF A;  3W1S A;  3VUR A;  2Z8K A;  5DDL A;  2PMT A;  4KDX A;  5ECP B;  1HNA A;  1GUK A;  3KMO A;  5ELA A;  4ZBB A;  4GDF A;  3LU7 A;  1HK5 A;  2I30 A;  3HJO A;  1FHE A;  5JCW A;  4G10 A;  1GLP A;  3MHS B;  4L9K A;  3N9J A;  4E8E A;  5HOZ A;  4KSM A;  4EC0 A;  5ID9 A;  5IIH A;  6GSS A;  1E6B A;  2N5F A;  5A4U A;  2J9H A;  2JL4 A;  4IKH A;  5AIS A;  5D9V A;  5ECS A;  1SVM A;  2AAW A;  2E0X A;  2A2S A;  2VCQ A;  4IVF A;  4M70 B;  1GUM A;  5DJM A;  1HK4 A;  3LXZ A;  5AIV A;  4L5O A;  4PXO A;  4OT2 A;  4E8H A;  1K3Y A;  2VD1 A;  3CRT A;  4BVY A;  4LMV A;  5J4Y A;  1BG1 A;  1SVO A;  4ISD A;  2XW0 A;  1BF5 A;  1Y6E A;  1YDK A;  1GWC A;  2DG5 A;  2IMI A;  2AB6 A;  3O3T A;  1GNE A;  22GS A;  2BXH A;  5AN1 A;  3GQX A;  3SIU B;  3FRC A;  4AI6 A;  1FW1 A;  3EIN A;  2BXM A;  4JZQ A;  1LJR A;  4OTT A;  2WS2 A;  4MPG A;  5IIX A;  4AKI A;  5D9X A;  4O92 A;  1AQW A;  2FHE A;  1EEM A;  3LSZ A;  4KE3 A;  1G7O A;  1AW9 A;  2LOQ A;  1H9Z A;  1GSE A;  1LOT A;  4MF5 A;  3M8N A;  1GTU A;  4USS A;  5DAL A;  1MA9 A;  1VF1 A;  1KW2 A;  2ON5 A;  2OZB B;  2VCV A;  4ZB7 A;  14GS A;  4ECJ A;  4ECI A;  2CAQ A;  2WDU A;  4GSN A;  1V2A A;  3WHQ A;  4MZW A;  2C3Q A;  3HKR A;  2BXK A;  4W66 A;  2GTU A;  1YKC A;  5A4W A;  5A5K A;  1GSF A;  2FNO A;  3HMJ G;  4J2F A;  8GSS A;  1JLV A;  1UOR A;  1TU8 A;  3W8S A;  4FQU A;  2HSN A;  3H37 A;  4IW9 A;  4IW1 A;  4Z9O A;  2HRK A;  4EDY A;  1HNC A;  1OE7 A;  1IYH A;  2BX8 A;  5J5N A;  4YQV A;  3ERF A;  3I6A A;  4G19 A;  4ZXG A;  2CAI A;  4I97 A;  3KXO A;  1K0C A;  5GHK A;  1K0M A;  4PUA A;  1E7H A;  4AGS A;  4ECB A;  1LBK A;  5J41 A;  1U88 A;  4ZB6 A;  4PNF A;  16GS A;  2VCT A;  3PGT A;  4HOJ A;  2XVQ A;  3R3E A;  2HSM B;  1N25 A;  5GST A;  5J4U A;  3MDK A;  3U6V A;  4L5L A;  1PKW A;  4CHS A;  2XSI A;  5A1N B;  3F6F A;  4GCI A;  3FY7 A;  4HZ4 A;  5A5H B;  2QMC A;  3IC8 A;  1G6Y A;  5GZZ B;  5F05 A;  4OFT A;  4BL7 A;  4F0C A;  3LU6 A;  1K0O A;  3FR3 A;  5ECM B;  5HFK A;  2A2R A;  5F0G A;  4F5V A;  2C8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...