4N3ZA

Crystal structure of rabex-5delta and rabaptin-5c21 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
290
structure length
238
Chain Sequence
EFIEFLKTHKTGQEIYKQTFLEGMHYKRDLIEEQSECAQDFYHNVEKIMDQIEKYIMTRLDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 74
structure length 238
sequence length 290
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4n3zA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4n3zA02
2EFDA 1TXUA 4G01A 4N3ZA 2OT3A 2EFHA 2EFEA 2EFCA
chains in the Genus database with same CATH superfamily
3ZFLA 2DSAA 2N5FA 1EV4A 4WR4A 3TDLA 3G7JA 1YKCA 1GNIA 5A4WA 5GINA 1GTIA 5J4YA 1JLVA 2HRKA 1GLQA 3R3EA 2DG5A 4ZBQA 4ZXGA 3RFRC 4AI6A 3B9MA 1HK1A 3PPUA 2NQOA 4IW9A 4GDKB 4ZB7A 3A73A 1XW6A 3QR6A 2LOQA 5HOZA 4KDUA 5AN1A 5ELAA 5LD0A 2NTOA 2HSMA 3CRUA 3VURA 11GSA 4IBPA 1E7FA 3HJMA 3LG6A 4KDYA 5FUOA 2WW0A 3V09A 3GUSA 3UBLA 4LUHA 5DBYA 3DD3A 3KTLA 1K0MA 4G01A 1YVLA 2VCZA 4HZ2A 4EDYA 3LU7A 2I2ZA 4NAWB 4I97A 2BXHA 3LXZA 2BXAA 4EE0A 2BXEA 5ECKB 2BXQA 1K3LA 3H3AA 1JZRA 1E7AA 4L5LA 1KXPD 3FWBC 5A1NB 2CVDA 2YV7A 4ZBDA 3ICXA 3QAVA 1U87A 3PGTA 1VF4A 4Z69A 1GSQA 1G6YA 4LUFA 2YV9A 7GSSA 5EVOA 4K0GA 2OT3A 1HNCA 1AW9A 4AKIA 2BXKA 4WR5A 1G6WA 3R2QA 4ID0A 2LQIA 5JCUA 1LOTA 1MUHA 3A75A 4GDLB 3SQJA 1HK3A 4EC0A 1E7BA 2AJEA 1OE8A 5IIHA 5J4VA 1Z9HA 2GSTA 4BY9C 1C72A 4GF0A 6GSXA 4J2VA 1HK2A 3WYWA 4N0VA 3GSTA 1ZGNA 3AY8A 3UAPA 4NHWA 2O5VA 2WW1A 4E68A 1YEWC 2IMIA 3GX0A 1K3OA 2LJRA 2CAQA 5D7GA 4C31B 17GSA 2LQHA 4PNFA 4S1YA 4USSA 1XWKA 4YQUA 4RI7A 4G0LA 2CZ2A 1FHEA 5G5EA 1VF1A 5F0GA 3H37A 1TU8A 2J9HA 3KXOA 1HNBA 3DGQA 3VWXA 4YAPA 1K0BA 3O76A 2HSMB 3P8WA 2VUEA 5IJ5A 4KAEA 2GSRA 1GTUA 1MD4A 2WRTA 4PI0C 3CBUA 2DC5A 3ERFA 4F0BA 4FK5B 4MZWA 3HJOA 4LMWA 1PN9A 2DBXA 19GSA 1IJGA 2CKXA 4Z9OA 4F5SA 1V40A 3P90A 3ERGA 3CWGA 3VQIA 5AIXA 1B8XA 1MUSA 1AQWA 1PX7A 2H1LA 4L9KA 1Y1UA 1K0CA 4K0NA 1U88A 3L0HA 5ECRB 2BXGA 4G0KA 9GSSA 3I69A 1E7HA 2C8UA 4O92A 5DALA 2VD1A 4AGSA 4OFNA 4PQHA 2HRAA 1MTCA 4LMVA 1HA2A 2WW2A 1E7EA 1BYEA 2FNOA 4YQVA 3CSHA 3VPQA 1MA9A 1VF3A 2XVQA 2EFHA 3EINA 5JCWA 1EV9A 2C3NA 5GIPA 2F3MA 4JZQA 4TQ1A 5GSTA 1B48A 4L5OA 4AKHA 4PX1A 4K71A 4KE3A 4ECJA 4DM0A 1KBNA 2WW3A 1K0AA 5AIVA 2PVQA 5FT3A 4ISDA 1BG5A 1Y6EA 3FR3A 5ECIB 4MF7A 5D9XA 4YQMA 1S4BP 3KJLA 2VCXA 1HK5A 3Q74A 4GLTA 4RI6A 13GSA 5AGYA 2Z8JA 4KH7A 4JK4A 1DUGA 1GSYA 2R5GA 4NHZA 6GSVA 2O36A 3KJYA 3KIKA 10GSA 2I30A 2C4JA 3LYKA 4PQIA 3SWLA 5IJFA 2BXFA 4LA0A 1MM8A 1PD21 2PMTA 1K0NA 3Q19A 5GSSA 4G03A 1HK4A 5DAKA 4PHZC 1MIWA 4KDXA 3M99C 1RK4A 2HNLA 2GDRA 3VLNA 2XVUA 1E7GA 5F07A 4LB2A 4PXOA 1J78A 3NIVA 5IIUA 3TOTA 2QMCA 3VK9A 3VI5A 2ON5A 5ECOB 4ZC6A 4LB9A 2AB6A 3ISOA 1O9XA 2R6KA 2OZBB 1GULA 3PLAA 2XVVA 2A2SA 6GSTA 22GSA 5J47A 5FWGA 1K3YA 1LNSA 4FXYP 1EOHA 4E8HA 2Z8IA 4MBEC 2CAIA 3IE3A 4KF9A 3GTUA 3KM6A 1FOUA 5EL8A 4GDFA 3UIVA 1A0FA 1U3IA 4EDZA 4PO0A 3F63A 4WA6B 3QAWA 3F6DA 4G19A 4N0UD 4GTUA 5HFKA 2EFCA 4KSMA 5BPKA 1YY7A 4OT2A 3GA9L 3IBHA 4ZB9A 1KW2A 2O3EA 1MIVA 2BXPA 1PX6A 2WVXA 1NT2B 6GSWA 1IYIA 5ECMB 3IK9A 3LU6A 1UORA 1GNEA 5DDLA 4F03A 1M99A 14GSA 4MF6A 2WB9A 4CHSA 1BM0A 1OKTA 3FY7A 2QM6A 2HSNA 6GSYA 3MHSB 5F05A 4GSTA 2HRKB 2DYOA 2BXNA 1PKWA 5ID7A 2UZ8A 3LFLA 3KMNA 5A34A 2BXOA 4HGMB 2VD0A 4OTTA 3SIVB 1VFIA 3Q18A 4IW2A 1UA5A 4Q5FA 5IIXA 2Z8KA 4PTSA 1YDKA 4HZ4A 3BPJA 3WHQA 1F2EA 3MHHB 1VZSA 2GSSA 3MDKA 4ZBRA 3BBYA 4ZB6A 1BJ5A 4YAVA 1MIYA 3G9KD 5J5NA 5GIOA 3UBKA 2GUTA 1MD3A 1H9ZA 2LXSA 2VCWA 4BVXA 4W4UB 2OA7A 1AXDA 1TW9A 4OMVA 4DEJA 2WVYA 4ZCGA 2XW1A 1SVLA 5ECSA 3N9JA 4MDCA 1GSUA 3CHXC 1GLPA 2WVZA 4IS0A 2BX8A 3CRTA 1E6BA 4Q5QA 3O3TA 4AKGA 1GNWA 1JLWA 2EFDA 4HI7A 2BXCA 2JUHA 4F5UA 2WDUA 5D9TA 1OYJA 4G10A 3GTUB 2DYMA 4EMXA 2BXLA 2LXTA 1I1IP 1M9AA 3GSSA 4ZBAA 2A2RA 3V03A 3W1SA 1BX9A 3FNMA 4HGKA 4PURA 3B9LA 1PMTA 3LXTA 3GQXA 4JBBA 2C80A 5A1NA 3C8EA 4N0FD 3N5OA 5D9WA 3ZMLA 1GSFA 2VCVA 1XWGA 2QHBA 3VI7A 2WVXB 4MPFA 2C3TA 4YH2A 5G5FA 3W8SA 4BL7A 8GSSA 4OTUA 3M8NA 1AO6A 2V36A 4L9QA 3NVIA 2HSNB 1M9BA 3IK7A 1N2AA 2WS2A 5ECLB 2VKZG 5DQFA 2CA8A 3ZFBA 1GSSA 1NHYA 3U6VA 1HNAA 4IJIA 1Q4JA 2E0YA 5DCGA 1GNJA 4ZB8A 4L8EA 3EE2A 5LCZA 1TU7A 2K0NA 1PL1A 2CZ3A 3FR9A 4IQ1A 1EOGA 4J2FA 4ECCA 4G04A 2NNWA 3LJRA 2UV8G 5J41A 2R3XA 2KWFA 4IQAA 3GQUA 1ML6A 2AAWA 1HQOA 1YJ6A 4MP4A 5J4UA 3NVKA 5A4UA 4ACSA 4BVXB 5FHIA 1M0UA 1VF2A 1E7CA 4O7HA 2DBUA 2WJUA 5ID9A 1PL2A 2C3QA 3M1GA 3TOUA 3MAKA 18GSA 1GUHA 4Q5NA 1TF0A 2YDFA 4I9OA 4F5VA 5KEJA 1E7IA 4ZBBA 1GWCA 2VCTA 2FHEA 1BF5A 5B5TA 5F8BA 4GDXA 4Q5RA 1GSDA 1GUKA 2VCQA 1JNBA 5DALB 5DQSA 3LU8A 4L8UA 1KDXA 4AKXB 4DHXB 4HOJA 4TQ0A 4BVYA 2WZSA 5EY6A 3SIUB 16GSA 5BMUA 2ROHA 2PERA 2EFEA 4PI2C 3LYPA 1LBKA 5DJMA 3WD6A 1AQXA 6GSSA 1K0OA 4MPGA 1XW5A 1TDIA 1OE7A 2XW0A 2D2ZA 3IC8A 1E78A 4G0IA 4BL7B 2BXDA 3JRYA 5ECQB 1J7EA 3WHRA 5A5KA 1EEMA 2GSQA 5F06A 3HMJG 3JQZA 1PGTA 2OACA 2BXIA 2XMOA 4PGTA 3H1NA 5IQYA 4GSSA 1USBA 4KX4A 2GLRA 4TOPA 2PGTA 5AISA 1H5WA 1TXUA 2BXBA 5IJEA 3FR6A 3M0FA 5ECHB 1B4PA 3CX9A 5A5HA 4GSNA 4IELA 3UVHA 2VUFA 1SVMA 1SVOA 3D0ZA 4W66A 4IW1A 1FW1A 1V2AA 5DAKB 2IMKA 6GSUA 3F6FA 3ECPA 1PKZA 3GURA 5GZZB 4PNGA 4E99A 5GHKA 4GG2A 1GUMA 4QQ7A 5A4VA 5ECNB 4IGJA 3FWCC 3RGBC 1ZL9A 4QMKA 1BAYA 4KGIA 5D9VA 2XVWA 4HJ2A 1YQ1A 20GSA 2JL4A 3LSZA 5ECPB 4GCIA 3RBTA 1LJRA 4FJCB 1GTAA 4G9HA 2YCDA 4PUAA 3NMUA 3CSIA 1GTBA 4M70B 1F3BA 4IVFA 2V6KA 3FYGA 4F0CA 1BKEA 3I6AA 2HQTA 2DBWA 3QAGA 3ZMKA 1SB0A 4BKEA 4D7XA 1N5UA 4ZBKA 2F8FA 2IL3A 3VPTA 1BG1A 3TGZA 5DJLA 5B7CA 3TU3B 3M3MA 4EXJA 1IYHA 4E8EA 2ON7A 4BVYB 4NAXA 4ECIA 3NVMA 2E0XA 4FQUA 4ECBA 2AHEA 2X64A 3LQ7A 5BMUB 5IFOA 2OADA 1AQVA 4N3ZA 4ZUXV 12GSA 4F5TA 5D73A 3FRCA 4IKHA 5ELGA 3IR4A 2VO4A 3CSJA 1GSEA 2R4VA 1F3AA 3HKRA 3UARA 2XSIA 3V08A 4FIPB 2VDBA 4MF5A 3GH6A 2BXMA 2PBJA 1PA3A 2GTUA 3KMOA 3WHSA 5J40A 5A34B 1R5AA 3G7IA 4OFMA 3PR8A 4JEDA 1G7OA 4OFTA 4OR0A 1N25A 2AGHB 1K0DA 4MK3A 2KBZA 5A5HB 4K2CA
chains in the Genus database with same CATH topology
3ZFLA 2DSAA 2N5FA 1EV4A 4WR4A 3TDLA 3G7JA 1YKCA 1GNIA 5A4WA 5GINA 1GTIA 5J4YA 1JLVA 2HRKA 1GLQA 3R3EA 2DG5A 4ZBQA 4ZXGA 4AI6A 3B9MA 1HK1A 3PPUA 2NQOA 4IW9A 4GDKB 4ZB7A 3A73A 1XW6A 3QR6A 2LOQA 5HOZA 4KDUA 5AN1A 5ELAA 5LD0A 2NTOA 2HSMA 3CRUA 3VURA 11GSA 4IBPA 1E7FA 3HJMA 3LG6A 4KDYA 5FUOA 3V09A 3GUSA 3UBLA 4LUHA 5DBYA 3DD3A 3KTLA 1K0MA 4G01A 1YVLA 2VCZA 4HZ2A 4EDYA 3LU7A 2I2ZA 4NAWB 4I97A 2BXHA 3LXZA 2BXAA 4EE0A 2BXEA 5ECKB 2BXQA 1K3LA 3H3AA 1JZRA 1E7AA 4L5LA 1KXPD 3FWBC 5A1NB 2CVDA 2YV7A 4ZBDA 3ICXA 3QAVA 1U87A 3PGTA 1VF4A 4Z69A 1GSQA 1G6YA 4LUFA 2YV9A 7GSSA 5EVOA 4K0GA 2OT3A 1HNCA 1AW9A 4AKIA 2BXKA 4WR5A 1G6WA 3R2QA 4ID0A 5JCUA 1LOTA 3A75A 4GDLB 3SQJA 1HK3A 4EC0A 1E7BA 2AJEA 1OE8A 5IIHA 5J4VA 1Z9HA 2GSTA 4BY9C 1C72A 4GF0A 6GSXA 4J2VA 1HK2A 3WYWA 4N0VA 3GSTA 1ZGNA 3AY8A 3UAPA 4NHWA 2O5VA 4E68A 2IMIA 3GX0A 1K3OA 2LJRA 2CAQA 5D7GA 4C31B 17GSA 4PNFA 4USSA 4S1YA 4YQUA 1XWKA 4RI7A 4G0LA 2CZ2A 1FHEA 5G5EA 1VF1A 5F0GA 3H37A 1TU8A 2J9HA 3KXOA 1HNBA 3DGQA 3VWXA 4YAPA 1K0BA 3O76A 2HSMB 3P8WA 2VUEA 5IJ5A 4KAEA 2GSRA 1GTUA 1MD4A 2WRTA 3CBUA 2DC5A 3ERFA 4F0BA 4FK5B 4MZWA 3HJOA 4LMWA 1PN9A 2DBXA 19GSA 1IJGA 2CKXA 4Z9OA 4F5SA 1V40A 3P90A 3ERGA 3CWGA 3VQIA 5AIXA 1B8XA 1AQWA 1PX7A 2H1LA 4L9KA 1Y1UA 1K0CA 4K0NA 1U88A 3L0HA 5ECRB 2BXGA 4G0KA 9GSSA 3I69A 1E7HA 2C8UA 4O92A 5DALA 2VD1A 4AGSA 4OFNA 4PQHA 2HRAA 1MTCA 4LMVA 1HA2A 1E7EA 1BYEA 2FNOA 4YQVA 3CSHA 3VPQA 1MA9A 1VF3A 2XVQA 2EFHA 3EINA 5JCWA 1EV9A 2C3NA 5GIPA 2F3MA 4JZQA 4TQ1A 5GSTA 1B48A 4L5OA 4AKHA 4PX1A 4K71A 4KE3A 4ECJA 1KBNA 1K0AA 5AIVA 2PVQA 5FT3A 4ISDA 1BG5A 1Y6EA 3FR3A 5ECIB 4MF7A 5D9XA 4YQMA 3KJLA 2VCXA 1HK5A 3Q74A 4GLTA 4RI6A 13GSA 5AGYA 2Z8JA 4KH7A 4JK4A 1DUGA 1GSYA 2R5GA 4NHZA 6GSVA 3KJYA 3KIKA 10GSA 2I30A 2C4JA 3LYKA 4PQIA 3SWLA 5IJFA 2BXFA 4LA0A 1PD21 2PMTA 1K0NA 3Q19A 5GSSA 4G03A 1HK4A 5DAKA 1MIWA 4KDXA 3M99C 1RK4A 2HNLA 2GDRA 3VLNA 2XVUA 1E7GA 5F07A 4LB2A 4PXOA 1J78A 3NIVA 5IIUA 3TOTA 2QMCA 3VK9A 3VI5A 2ON5A 5ECOB 4ZC6A 4LB9A 2AB6A 3ISOA 1O9XA 2R6KA 2OZBB 1GULA 3PLAA 2XVVA 2A2SA 6GSTA 22GSA 5J47A 5FWGA 1K3YA 1LNSA 1EOHA 4E8HA 2Z8IA 4MBEC 2CAIA 3IE3A 4KF9A 3GTUA 3KM6A 1FOUA 5EL8A 4GDFA 3UIVA 1A0FA 1U3IA 4EDZA 4PO0A 3F63A 4WA6B 3QAWA 3F6DA 4G19A 4N0UD 4GTUA 5HFKA 2EFCA 4KSMA 5BPKA 1YY7A 4OT2A 3GA9L 3IBHA 4ZB9A 1KW2A 1MIVA 2BXPA 1PX6A 1NT2B 6GSWA 1IYIA 5ECMB 3IK9A 3LU6A 1UORA 1GNEA 5DDLA 4F03A 1M99A 14GSA 4MF6A 2WB9A 4CHSA 1BM0A 1OKTA 3FY7A 2QM6A 2HSNA 6GSYA 3MHSB 5F05A 4GSTA 2HRKB 2DYOA 2BXNA 1PKWA 5ID7A 2UZ8A 3LFLA 3KMNA 5A34A 2BXOA 4HGMB 2VD0A 4OTTA 3SIVB 1VFIA 3Q18A 4IW2A 1UA5A 4Q5FA 5IIXA 2Z8KA 4PTSA 1YDKA 4HZ4A 1F2EA 3WHQA 3MHHB 1VZSA 2GSSA 3MDKA 4ZBRA 3BBYA 4ZB6A 1BJ5A 4YAVA 1MIYA 3G9KD 5J5NA 5GIOA 3UBKA 1MD3A 1H9ZA 2VCWA 4BVXA 4W4UB 2OA7A 1AXDA 1TW9A 4OMVA 4DEJA 4ZCGA 2XW1A 1SVLA 5ECSA 3N9JA 4MDCA 1GSUA 1GLPA 4IS0A 2BX8A 3CRTA 1E6BA 4Q5QA 3O3TA 4AKGA 1GNWA 1JLWA 2EFDA 4HI7A 2BXCA 2JUHA 4F5UA 2WDUA 5D9TA 1OYJA 4G10A 3GTUB 2DYMA 4EMXA 2BXLA 1M9AA 3GSSA 4ZBAA 2A2RA 3V03A 3W1SA 1BX9A 3FNMA 4HGKA 4PURA 3B9LA 1PMTA 3LXTA 3GQXA 4JBBA 2C80A 5A1NA 3C8EA 4N0FD 3N5OA 5D9WA 3ZMLA 1GSFA 2VCVA 1XWGA 2QHBA 3VI7A 4MPFA 2C3TA 4YH2A 5G5FA 3W8SA 4BL7A 8GSSA 4OTUA 3M8NA 1AO6A 2V36A 4L9QA 3NVIA 2HSNB 1M9BA 3IK7A 1N2AA 2WS2A 5ECLB 2VKZG 5DQFA 2CA8A 3ZFBA 1GSSA 1NHYA 3U6VA 1HNAA 4IJIA 1Q4JA 2E0YA 5DCGA 1GNJA 4ZB8A 4L8EA 3EE2A 5LCZA 1TU7A 1PL1A 2CZ3A 3FR9A 4IQ1A 1EOGA 4J2FA 4ECCA 4G04A 2NNWA 3LJRA 2UV8G 5J41A 2R3XA 4IQAA 3GQUA 1ML6A 2AAWA 1HQOA 1YJ6A 4MP4A 5J4UA 3NVKA 5A4UA 4ACSA 4BVXB 5FHIA 1M0UA 1VF2A 1E7CA 4O7HA 2DBUA 2WJUA 5ID9A 1PL2A 2C3QA 3M1GA 3TOUA 3MAKA 18GSA 1GUHA 4Q5NA 1TF0A 2YDFA 4F5VA 5KEJA 1E7IA 4ZBBA 1GWCA 2VCTA 2FHEA 1BF5A 5B5TA 5F8BA 4GDXA 4Q5RA 1GSDA 1GUKA 2VCQA 1JNBA 5DALB 5DQSA 3LU8A 4L8UA 4AKXB 4DHXB 4HOJA 4TQ0A 4BVYA 5EY6A 3SIUB 16GSA 5BMUA 2ROHA 2PERA 2EFEA 3LYPA 1LBKA 5DJMA 3WD6A 1AQXA 6GSSA 1K0OA 4MPGA 1XW5A 1TDIA 1OE7A 2XW0A 2D2ZA 3IC8A 1E78A 4G0IA 4BL7B 2BXDA 3JRYA 5ECQB 1J7EA 3WHRA 5A5KA 1EEMA 2GSQA 5F06A 3HMJG 3JQZA 1PGTA 2OACA 2BXIA 2XMOA 4PGTA 3H1NA 5IQYA 4GSSA 1USBA 4KX4A 2GLRA 4TOPA 2PGTA 5AISA 1H5WA 1TXUA 2BXBA 5IJEA 3FR6A 3M0FA 5ECHB 1B4PA 3CX9A 5A5HA 4GSNA 4IELA 3UVHA 2VUFA 1SVMA 1SVOA 3D0ZA 4W66A 4IW1A 1FW1A 1V2AA 5DAKB 2IMKA 6GSUA 3F6FA 1PKZA 3GURA 5GZZB 4PNGA 4E99A 5GHKA 4GG2A 1GUMA 4QQ7A 5A4VA 5ECNB 4IGJA 3FWCC 1ZL9A 4QMKA 1BAYA 4KGIA 5D9VA 2XVWA 4HJ2A 1YQ1A 20GSA 2JL4A 3LSZA 5ECPB 4GCIA 3RBTA 1LJRA 4FJCB 1GTAA 4G9HA 2YCDA 4PUAA 3NMUA 3CSIA 1GTBA 4M70B 1F3BA 4IVFA 2V6KA 3FYGA 4F0CA 1BKEA 3I6AA 2HQTA 2DBWA 3QAGA 3ZMKA 4BKEA 2F8FA 2IL3A 1N5UA 4ZBKA 3VPTA 1BG1A 3TGZA 5DJLA 5B7CA 3TU3B 3M3MA 4EXJA 1IYHA 4E8EA 2ON7A 4BVYB 4NAXA 4ECIA 3NVMA 2E0XA 4FQUA 4ECBA 2AHEA 2X64A 3LQ7A 5BMUB 5IFOA 2OADA 1AQVA 4N3ZA 4ZUXV 12GSA 4F5TA 5D73A 3FRCA 4IKHA 5ELGA 3IR4A 2VO4A 3CSJA 1GSEA 2R4VA 1F3AA 3HKRA 3UARA 2XSIA 3V08A 4FIPB 2VDBA 4MF5A 3GH6A 2BXMA 2PBJA 1PA3A 2GTUA 3KMOA 3WHSA 5J40A 5A34B 1R5AA 3G7IA 4OFMA 3PR8A 4JEDA 1G7OA 4OFTA 4OR0A 1N25A 1K0DA 4MK3A 2KBZA 5A5HB 4K2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFD A;  1TXU A;  4G01 A;  4N3Z A;  2OT3 A;  2EFH A;  2EFE A;  2EFC A; 
#chains in the Genus database with same CATH topology
 3ZFL A;  2DSA A;  2N5F A;  1EV4 A;  4WR4 A;  3TDL A;  3G7J A;  1YKC A;  1GNI A;  5A4W A;  5GIN A;  1GTI A;  5J4Y A;  1JLV A;  2HRK A;  1GLQ A;  3R3E A;  2DG5 A;  4ZBQ A;  4ZXG A;  3RFR C;  4AI6 A;  3B9M A;  1HK1 A;  3PPU A;  2NQO A;  4IW9 A;  4GDK B;  4ZB7 A;  3A73 A;  1XW6 A;  3QR6 A;  2LOQ A;  5HOZ A;  4KDU A;  5AN1 A;  5ELA A;  5LD0 A;  2NTO A;  2HSM A;  3CRU A;  3VUR A;  11GS A;  4IBP A;  1E7F A;  3HJM A;  3LG6 A;  4KDY A;  5FUO A;  2WW0 A;  3V09 A;  3GUS A;  3UBL A;  4LUH A;  5DBY A;  3DD3 A;  3KTL A;  1K0M A;  4G01 A;  1YVL A;  2VCZ A;  4HZ2 A;  4EDY A;  3LU7 A;  2I2Z A;  4NAW B;  4I97 A;  2BXH A;  3LXZ A;  2BXA A;  4EE0 A;  2BXE A;  5ECK B;  2BXQ A;  1K3L A;  3H3A A;  1JZR A;  1E7A A;  4L5L A;  1KXP D;  3FWB C;  5A1N B;  2CVD A;  2YV7 A;  4ZBD A;  3ICX A;  3QAV A;  1U87 A;  3PGT A;  1VF4 A;  4Z69 A;  1GSQ A;  1G6Y A;  4LUF A;  2YV9 A;  7GSS A;  5EVO A;  4K0G A;  2OT3 A;  1HNC A;  1AW9 A;  4AKI A;  2BXK A;  4WR5 A;  1G6W A;  3R2Q A;  4ID0 A;  2LQI A;  5JCU A;  1LOT A;  1MUH A;  3A75 A;  4GDL B;  3SQJ A;  1HK3 A;  4EC0 A;  1E7B A;  2AJE A;  1OE8 A;  5IIH A;  5J4V A;  1Z9H A;  2GST A;  4BY9 C;  1C72 A;  4GF0 A;  6GSX A;  4J2V A;  1HK2 A;  3WYW A;  4N0V A;  3GST A;  1ZGN A;  3AY8 A;  3UAP A;  4NHW A;  2O5V A;  2WW1 A;  4E68 A;  1YEW C;  2IMI A;  3GX0 A;  1K3O A;  2LJR A;  2CAQ A;  5D7G A;  4C31 B;  17GS A;  2LQH A;  4PNF A;  4S1Y A;  4USS A;  1XWK A;  4YQU A;  4RI7 A;  4G0L A;  2CZ2 A;  1FHE A;  5G5E A;  1VF1 A;  5F0G A;  3H37 A;  1TU8 A;  2J9H A;  3KXO A;  1HNB A;  3DGQ A;  3VWX A;  4YAP A;  1K0B A;  3O76 A;  2HSM B;  3P8W A;  2VUE A;  5IJ5 A;  4KAE A;  2GSR A;  1GTU A;  1MD4 A;  2WRT A;  4PI0 C;  3CBU A;  2DC5 A;  3ERF A;  4F0B A;  4FK5 B;  4MZW A;  3HJO A;  4LMW A;  1PN9 A;  2DBX A;  19GS A;  1IJG A;  2CKX A;  4Z9O A;  4F5S A;  1V40 A;  3P90 A;  3ERG A;  3CWG A;  3VQI A;  5AIX A;  1B8X A;  1MUS A;  1AQW A;  1PX7 A;  2H1L A;  4L9K A;  1Y1U A;  1K0C A;  4K0N A;  1U88 A;  3L0H A;  5ECR B;  2BXG A;  4G0K A;  9GSS A;  3I69 A;  1E7H A;  2C8U A;  4O92 A;  5DAL A;  2VD1 A;  4AGS A;  4OFN A;  4PQH A;  2HRA A;  1MTC A;  4LMV A;  1HA2 A;  2WW2 A;  1E7E A;  1BYE A;  2FNO A;  4YQV A;  3CSH A;  3VPQ A;  1MA9 A;  1VF3 A;  2XVQ A;  2EFH A;  3EIN A;  5JCW A;  1EV9 A;  2C3N A;  5GIP A;  2F3M A;  4JZQ A;  4TQ1 A;  5GST A;  1B48 A;  4L5O A;  4AKH A;  4PX1 A;  4K71 A;  4KE3 A;  4ECJ A;  4DM0 A;  1KBN A;  2WW3 A;  1K0A A;  5AIV A;  2PVQ A;  5FT3 A;  4ISD A;  1BG5 A;  1Y6E A;  3FR3 A;  5ECI B;  4MF7 A;  5D9X A;  4YQM A;  1S4B P;  3KJL A;  2VCX A;  1HK5 A;  3Q74 A;  4GLT A;  4RI6 A;  13GS A;  5AGY A;  2Z8J A;  4KH7 A;  4JK4 A;  1DUG A;  1GSY A;  2R5G A;  4NHZ A;  6GSV A;  2O36 A;  3KJY A;  3KIK A;  10GS A;  2I30 A;  2C4J A;  3LYK A;  4PQI A;  3SWL A;  5IJF A;  2BXF A;  4LA0 A;  1MM8 A;  1PD2 1;  2PMT A;  1K0N A;  3Q19 A;  5GSS A;  4G03 A;  1HK4 A;  5DAK A;  4PHZ C;  1MIW A;  4KDX A;  3M99 C;  1RK4 A;  2HNL A;  2GDR A;  3VLN A;  2XVU A;  1E7G A;  5F07 A;  4LB2 A;  4PXO A;  1J78 A;  3NIV A;  5IIU A;  3TOT A;  2QMC A;  3VK9 A;  3VI5 A;  2ON5 A;  5ECO B;  4ZC6 A;  4LB9 A;  2AB6 A;  3ISO A;  1O9X A;  2R6K A;  2OZB B;  1GUL A;  3PLA A;  2XVV A;  2A2S A;  6GST A;  22GS A;  5J47 A;  5FWG A;  1K3Y A;  1LNS A;  4FXY P;  1EOH A;  4E8H A;  2Z8I A;  4MBE C;  2CAI A;  3IE3 A;  4KF9 A;  3GTU A;  3KM6 A;  1FOU A;  5EL8 A;  4GDF A;  3UIV A;  1A0F A;  1U3I A;  4EDZ A;  4PO0 A;  3F63 A;  4WA6 B;  3QAW A;  3F6D A;  4G19 A;  4N0U D;  4GTU A;  5HFK A;  2EFC A;  4KSM A;  5BPK A;  1YY7 A;  4OT2 A;  3GA9 L;  3IBH A;  4ZB9 A;  1KW2 A;  2O3E A;  1MIV A;  2BXP A;  1PX6 A;  2WVX A;  1NT2 B;  6GSW A;  1IYI A;  5ECM B;  3IK9 A;  3LU6 A;  1UOR A;  1GNE A;  5DDL A;  4F03 A;  1M99 A;  14GS A;  4MF6 A;  2WB9 A;  4CHS A;  1BM0 A;  1OKT A;  3FY7 A;  2QM6 A;  2HSN A;  6GSY A;  3MHS B;  5F05 A;  4GST A;  2HRK B;  2DYO A;  2BXN A;  1PKW A;  5ID7 A;  2UZ8 A;  3LFL A;  3KMN A;  5A34 A;  2BXO A;  4HGM B;  2VD0 A;  4OTT A;  3SIV B;  1VFI A;  3Q18 A;  4IW2 A;  1UA5 A;  4Q5F A;  5IIX A;  2Z8K A;  4PTS A;  1YDK A;  4HZ4 A;  3BPJ A;  3WHQ A;  1F2E A;  3MHH B;  1VZS A;  2GSS A;  3MDK A;  4ZBR A;  3BBY A;  4ZB6 A;  1BJ5 A;  4YAV A;  1MIY A;  3G9K D;  5J5N A;  5GIO A;  3UBK A;  2GUT A;  1MD3 A;  1H9Z A;  2LXS A;  2VCW A;  4BVX A;  4W4U B;  2OA7 A;  1AXD A;  1TW9 A;  4OMV A;  4DEJ A;  2WVY A;  4ZCG A;  2XW1 A;  1SVL A;  5ECS A;  3N9J A;  4MDC A;  1GSU A;  3CHX C;  1GLP A;  2WVZ A;  4IS0 A;  2BX8 A;  3CRT A;  1E6B A;  4Q5Q A;  3O3T A;  4AKG A;  1GNW A;  1JLW A;  2EFD A;  4HI7 A;  2BXC A;  2JUH A;  4F5U A;  2WDU A;  5D9T A;  1OYJ A;  4G10 A;  3GTU B;  2DYM A;  4EMX A;  2BXL A;  2LXT A;  1I1I P;  1M9A A;  3GSS A;  4ZBA A;  2A2R A;  3V03 A;  3W1S A;  1BX9 A;  3FNM A;  4HGK A;  4PUR A;  3B9L A;  1PMT A;  3LXT A;  3GQX A;  4JBB A;  2C80 A;  5A1N A;  3C8E A;  4N0F D;  3N5O A;  5D9W A;  3ZML A;  1GSF A;  2VCV A;  1XWG A;  2QHB A;  3VI7 A;  2WVX B;  4MPF A;  2C3T A;  4YH2 A;  5G5F A;  3W8S A;  4BL7 A;  8GSS A;  4OTU A;  3M8N A;  1AO6 A;  2V36 A;  4L9Q A;  3NVI A;  2HSN B;  1M9B A;  3IK7 A;  1N2A A;  2WS2 A;  5ECL B;  2VKZ G;  5DQF A;  2CA8 A;  3ZFB A;  1GSS A;  1NHY A;  3U6V A;  1HNA A;  4IJI A;  1Q4J A;  2E0Y A;  5DCG A;  1GNJ A;  4ZB8 A;  4L8E A;  3EE2 A;  5LCZ A;  1TU7 A;  2K0N A;  1PL1 A;  2CZ3 A;  3FR9 A;  4IQ1 A;  1EOG A;  4J2F A;  4ECC A;  4G04 A;  2NNW A;  3LJR A;  2UV8 G;  5J41 A;  2R3X A;  2KWF A;  4IQA A;  3GQU A;  1ML6 A;  2AAW A;  1HQO A;  1YJ6 A;  4MP4 A;  5J4U A;  3NVK A;  5A4U A;  4ACS A;  4BVX B;  5FHI A;  1M0U A;  1VF2 A;  1E7C A;  4O7H A;  2DBU A;  2WJU A;  5ID9 A;  1PL2 A;  2C3Q A;  3M1G A;  3TOU A;  3MAK A;  18GS A;  1GUH A;  4Q5N A;  1TF0 A;  2YDF A;  4I9O A;  4F5V A;  5KEJ A;  1E7I A;  4ZBB A;  1GWC A;  2VCT A;  2FHE A;  1BF5 A;  5B5T A;  5F8B A;  4GDX A;  4Q5R A;  1GSD A;  1GUK A;  2VCQ A;  1JNB A;  5DAL B;  5DQS A;  3LU8 A;  4L8U A;  1KDX A;  4AKX B;  4DHX B;  4HOJ A;  4TQ0 A;  4BVY A;  2WZS A;  5EY6 A;  3SIU B;  16GS A;  5BMU A;  2ROH A;  2PER A;  2EFE A;  4PI2 C;  3LYP A;  1LBK A;  5DJM A;  3WD6 A;  1AQX A;  6GSS A;  1K0O A;  4MPG A;  1XW5 A;  1TDI A;  1OE7 A;  2XW0 A;  2D2Z A;  3IC8 A;  1E78 A;  4G0I A;  4BL7 B;  2BXD A;  3JRY A;  5ECQ B;  1J7E A;  3WHR A;  5A5K A;  1EEM A;  2GSQ A;  5F06 A;  3HMJ G;  3JQZ A;  1PGT A;  2OAC A;  2BXI A;  2XMO A;  4PGT A;  3H1N A;  5IQY A;  4GSS A;  1USB A;  4KX4 A;  2GLR A;  4TOP A;  2PGT A;  5AIS A;  1H5W A;  1TXU A;  2BXB A;  5IJE A;  3FR6 A;  3M0F A;  5ECH B;  1B4P A;  3CX9 A;  5A5H A;  4GSN A;  4IEL A;  3UVH A;  2VUF A;  1SVM A;  1SVO A;  3D0Z A;  4W66 A;  4IW1 A;  1FW1 A;  1V2A A;  5DAK B;  2IMK A;  6GSU A;  3F6F A;  3ECP A;  1PKZ A;  3GUR A;  5GZZ B;  4PNG A;  4E99 A;  5GHK A;  4GG2 A;  1GUM A;  4QQ7 A;  5A4V A;  5ECN B;  4IGJ A;  3FWC C;  3RGB C;  1ZL9 A;  4QMK A;  1BAY A;  4KGI A;  5D9V A;  2XVW A;  4HJ2 A;  1YQ1 A;  20GS A;  2JL4 A;  3LSZ A;  5ECP B;  4GCI A;  3RBT A;  1LJR A;  4FJC B;  1GTA A;  4G9H A;  2YCD A;  4PUA A;  3NMU A;  3CSI A;  1GTB A;  4M70 B;  1F3B A;  4IVF A;  2V6K A;  3FYG A;  4F0C A;  1BKE A;  3I6A A;  2HQT A;  2DBW A;  3QAG A;  3ZMK A;  1SB0 A;  4BKE A;  4D7X A;  1N5U A;  4ZBK A;  2F8F A;  2IL3 A;  3VPT A;  1BG1 A;  3TGZ A;  5DJL A;  5B7C A;  3TU3 B;  3M3M A;  4EXJ A;  1IYH A;  4E8E A;  2ON7 A;  4BVY B;  4NAX A;  4ECI A;  3NVM A;  2E0X A;  4FQU A;  4ECB A;  2AHE A;  2X64 A;  3LQ7 A;  5BMU B;  5IFO A;  2OAD A;  1AQV A;  4N3Z A;  4ZUX V;  12GS A;  4F5T A;  5D73 A;  3FRC A;  4IKH A;  5ELG A;  3IR4 A;  2VO4 A;  3CSJ A;  1GSE A;  2R4V A;  1F3A A;  3HKR A;  3UAR A;  2XSI A;  3V08 A;  4FIP B;  2VDB A;  4MF5 A;  3GH6 A;  2BXM A;  2PBJ A;  1PA3 A;  2GTU A;  3KMO A;  3WHS A;  5J40 A;  5A34 B;  1R5A A;  3G7I A;  4OFM A;  3PR8 A;  4JED A;  1G7O A;  4OFT A;  4OR0 A;  1N25 A;  2AGH B;  1K0D A;  4MK3 A;  2KBZ A;  5A5H B;  4K2C A; 
#chains in the Genus database with same CATH homology
 3ZFL A;  2DSA A;  2N5F A;  1EV4 A;  4WR4 A;  3TDL A;  3G7J A;  1YKC A;  1GNI A;  5A4W A;  5GIN A;  1GTI A;  5J4Y A;  1JLV A;  2HRK A;  1GLQ A;  3R3E A;  2DG5 A;  4ZBQ A;  4ZXG A;  4AI6 A;  3B9M A;  1HK1 A;  3PPU A;  2NQO A;  4IW9 A;  4GDK B;  4ZB7 A;  3A73 A;  1XW6 A;  3QR6 A;  2LOQ A;  5HOZ A;  4KDU A;  5AN1 A;  5ELA A;  5LD0 A;  2NTO A;  2HSM A;  3CRU A;  3VUR A;  11GS A;  4IBP A;  1E7F A;  3HJM A;  3LG6 A;  4KDY A;  5FUO A;  3V09 A;  3GUS A;  3UBL A;  4LUH A;  5DBY A;  3DD3 A;  3KTL A;  1K0M A;  4G01 A;  1YVL A;  2VCZ A;  4HZ2 A;  4EDY A;  3LU7 A;  2I2Z A;  4NAW B;  4I97 A;  2BXH A;  3LXZ A;  2BXA A;  4EE0 A;  2BXE A;  5ECK B;  2BXQ A;  1K3L A;  3H3A A;  1JZR A;  1E7A A;  4L5L A;  1KXP D;  3FWB C;  5A1N B;  2CVD A;  2YV7 A;  4ZBD A;  3ICX A;  3QAV A;  1U87 A;  3PGT A;  1VF4 A;  4Z69 A;  1GSQ A;  1G6Y A;  4LUF A;  2YV9 A;  7GSS A;  5EVO A;  4K0G A;  2OT3 A;  1HNC A;  1AW9 A;  4AKI A;  2BXK A;  4WR5 A;  1G6W A;  3R2Q A;  4ID0 A;  5JCU A;  1LOT A;  3A75 A;  4GDL B;  3SQJ A;  1HK3 A;  4EC0 A;  1E7B A;  2AJE A;  1OE8 A;  5IIH A;  5J4V A;  1Z9H A;  2GST A;  4BY9 C;  1C72 A;  4GF0 A;  6GSX A;  4J2V A;  1HK2 A;  3WYW A;  4N0V A;  3GST A;  1ZGN A;  3AY8 A;  3UAP A;  4NHW A;  2O5V A;  4E68 A;  2IMI A;  3GX0 A;  1K3O A;  2LJR A;  2CAQ A;  5D7G A;  4C31 B;  17GS A;  4PNF A;  4USS A;  4S1Y A;  4YQU A;  1XWK A;  4RI7 A;  4G0L A;  2CZ2 A;  1FHE A;  5G5E A;  1VF1 A;  5F0G A;  3H37 A;  1TU8 A;  2J9H A;  3KXO A;  1HNB A;  3DGQ A;  3VWX A;  4YAP A;  1K0B A;  3O76 A;  2HSM B;  3P8W A;  2VUE A;  5IJ5 A;  4KAE A;  2GSR A;  1GTU A;  1MD4 A;  2WRT A;  3CBU A;  2DC5 A;  3ERF A;  4F0B A;  4FK5 B;  4MZW A;  3HJO A;  4LMW A;  1PN9 A;  2DBX A;  19GS A;  1IJG A;  2CKX A;  4Z9O A;  4F5S A;  1V40 A;  3P90 A;  3ERG A;  3CWG A;  3VQI A;  5AIX A;  1B8X A;  1AQW A;  1PX7 A;  2H1L A;  4L9K A;  1Y1U A;  1K0C A;  4K0N A;  1U88 A;  3L0H A;  5ECR B;  2BXG A;  4G0K A;  9GSS A;  3I69 A;  1E7H A;  2C8U A;  4O92 A;  5DAL A;  2VD1 A;  4AGS A;  4OFN A;  4PQH A;  2HRA A;  1MTC A;  4LMV A;  1HA2 A;  1E7E A;  1BYE A;  2FNO A;  4YQV A;  3CSH A;  3VPQ A;  1MA9 A;  1VF3 A;  2XVQ A;  2EFH A;  3EIN A;  5JCW A;  1EV9 A;  2C3N A;  5GIP A;  2F3M A;  4JZQ A;  4TQ1 A;  5GST A;  1B48 A;  4L5O A;  4AKH A;  4PX1 A;  4K71 A;  4KE3 A;  4ECJ A;  1KBN A;  1K0A A;  5AIV A;  2PVQ A;  5FT3 A;  4ISD A;  1BG5 A;  1Y6E A;  3FR3 A;  5ECI B;  4MF7 A;  5D9X A;  4YQM A;  3KJL A;  2VCX A;  1HK5 A;  3Q74 A;  4GLT A;  4RI6 A;  13GS A;  5AGY A;  2Z8J A;  4KH7 A;  4JK4 A;  1DUG A;  1GSY A;  2R5G A;  4NHZ A;  6GSV A;  3KJY A;  3KIK A;  10GS A;  2I30 A;  2C4J A;  3LYK A;  4PQI A;  3SWL A;  5IJF A;  2BXF A;  4LA0 A;  1PD2 1;  2PMT A;  1K0N A;  3Q19 A;  5GSS A;  4G03 A;  1HK4 A;  5DAK A;  1MIW A;  4KDX A;  3M99 C;  1RK4 A;  2HNL A;  2GDR A;  3VLN A;  2XVU A;  1E7G A;  5F07 A;  4LB2 A;  4PXO A;  1J78 A;  3NIV A;  5IIU A;  3TOT A;  2QMC A;  3VK9 A;  3VI5 A;  2ON5 A;  5ECO B;  4ZC6 A;  4LB9 A;  2AB6 A;  3ISO A;  1O9X A;  2R6K A;  2OZB B;  1GUL A;  3PLA A;  2XVV A;  2A2S A;  6GST A;  22GS A;  5J47 A;  5FWG A;  1K3Y A;  1LNS A;  1EOH A;  4E8H A;  2Z8I A;  4MBE C;  2CAI A;  3IE3 A;  4KF9 A;  3GTU A;  3KM6 A;  1FOU A;  5EL8 A;  4GDF A;  3UIV A;  1A0F A;  1U3I A;  4EDZ A;  4PO0 A;  3F63 A;  4WA6 B;  3QAW A;  3F6D A;  4G19 A;  4N0U D;  4GTU A;  5HFK A;  2EFC A;  4KSM A;  5BPK A;  1YY7 A;  4OT2 A;  3GA9 L;  3IBH A;  4ZB9 A;  1KW2 A;  1MIV A;  2BXP A;  1PX6 A;  1NT2 B;  6GSW A;  1IYI A;  5ECM B;  3IK9 A;  3LU6 A;  1UOR A;  1GNE A;  5DDL A;  4F03 A;  1M99 A;  14GS A;  4MF6 A;  2WB9 A;  4CHS A;  1BM0 A;  1OKT A;  3FY7 A;  2QM6 A;  2HSN A;  6GSY A;  3MHS B;  5F05 A;  4GST A;  2HRK B;  2DYO A;  2BXN A;  1PKW A;  5ID7 A;  2UZ8 A;  3LFL A;  3KMN A;  5A34 A;  2BXO A;  4HGM B;  2VD0 A;  4OTT A;  3SIV B;  1VFI A;  3Q18 A;  4IW2 A;  1UA5 A;  4Q5F A;  5IIX A;  2Z8K A;  4PTS A;  1YDK A;  4HZ4 A;  1F2E A;  3WHQ A;  3MHH B;  1VZS A;  2GSS A;  3MDK A;  4ZBR A;  3BBY A;  4ZB6 A;  1BJ5 A;  4YAV A;  1MIY A;  3G9K D;  5J5N A;  5GIO A;  3UBK A;  1MD3 A;  1H9Z A;  2VCW A;  4BVX A;  4W4U B;  2OA7 A;  1AXD A;  1TW9 A;  4OMV A;  4DEJ A;  4ZCG A;  2XW1 A;  1SVL A;  5ECS A;  3N9J A;  4MDC A;  1GSU A;  1GLP A;  4IS0 A;  2BX8 A;  3CRT A;  1E6B A;  4Q5Q A;  3O3T A;  4AKG A;  1GNW A;  1JLW A;  2EFD A;  4HI7 A;  2BXC A;  2JUH A;  4F5U A;  2WDU A;  5D9T A;  1OYJ A;  4G10 A;  3GTU B;  2DYM A;  4EMX A;  2BXL A;  1M9A A;  3GSS A;  4ZBA A;  2A2R A;  3V03 A;  3W1S A;  1BX9 A;  3FNM A;  4HGK A;  4PUR A;  3B9L A;  1PMT A;  3LXT A;  3GQX A;  4JBB A;  2C80 A;  5A1N A;  3C8E A;  4N0F D;  3N5O A;  5D9W A;  3ZML A;  1GSF A;  2VCV A;  1XWG A;  2QHB A;  3VI7 A;  4MPF A;  2C3T A;  4YH2 A;  5G5F A;  3W8S A;  4BL7 A;  8GSS A;  4OTU A;  3M8N A;  1AO6 A;  2V36 A;  4L9Q A;  3NVI A;  2HSN B;  1M9B A;  3IK7 A;  1N2A A;  2WS2 A;  5ECL B;  2VKZ G;  5DQF A;  2CA8 A;  3ZFB A;  1GSS A;  1NHY A;  3U6V A;  1HNA A;  4IJI A;  1Q4J A;  2E0Y A;  5DCG A;  1GNJ A;  4ZB8 A;  4L8E A;  3EE2 A;  5LCZ A;  1TU7 A;  1PL1 A;  2CZ3 A;  3FR9 A;  4IQ1 A;  1EOG A;  4J2F A;  4ECC A;  4G04 A;  2NNW A;  3LJR A;  2UV8 G;  5J41 A;  2R3X A;  4IQA A;  3GQU A;  1ML6 A;  2AAW A;  1HQO A;  1YJ6 A;  4MP4 A;  5J4U A;  3NVK A;  5A4U A;  4ACS A;  4BVX B;  5FHI A;  1M0U A;  1VF2 A;  1E7C A;  4O7H A;  2DBU A;  2WJU A;  5ID9 A;  1PL2 A;  2C3Q A;  3M1G A;  3TOU A;  3MAK A;  18GS A;  1GUH A;  4Q5N A;  1TF0 A;  2YDF A;  4F5V A;  5KEJ A;  1E7I A;  4ZBB A;  1GWC A;  2VCT A;  2FHE A;  1BF5 A;  5B5T A;  5F8B A;  4GDX A;  4Q5R A;  1GSD A;  1GUK A;  2VCQ A;  1JNB A;  5DAL B;  5DQS A;  3LU8 A;  4L8U A;  4AKX B;  4DHX B;  4HOJ A;  4TQ0 A;  4BVY A;  5EY6 A;  3SIU B;  16GS A;  5BMU A;  2ROH A;  2PER A;  2EFE A;  3LYP A;  1LBK A;  5DJM A;  3WD6 A;  1AQX A;  6GSS A;  1K0O A;  4MPG A;  1XW5 A;  1TDI A;  1OE7 A;  2XW0 A;  2D2Z A;  3IC8 A;  1E78 A;  4G0I A;  4BL7 B;  2BXD A;  3JRY A;  5ECQ B;  1J7E A;  3WHR A;  5A5K A;  1EEM A;  2GSQ A;  5F06 A;  3HMJ G;  3JQZ A;  1PGT A;  2OAC A;  2BXI A;  2XMO A;  4PGT A;  3H1N A;  5IQY A;  4GSS A;  1USB A;  4KX4 A;  2GLR A;  4TOP A;  2PGT A;  5AIS A;  1H5W A;  1TXU A;  2BXB A;  5IJE A;  3FR6 A;  3M0F A;  5ECH B;  1B4P A;  3CX9 A;  5A5H A;  4GSN A;  4IEL A;  3UVH A;  2VUF A;  1SVM A;  1SVO A;  3D0Z A;  4W66 A;  4IW1 A;  1FW1 A;  1V2A A;  5DAK B;  2IMK A;  6GSU A;  3F6F A;  1PKZ A;  3GUR A;  5GZZ B;  4PNG A;  4E99 A;  5GHK A;  4GG2 A;  1GUM A;  4QQ7 A;  5A4V A;  5ECN B;  4IGJ A;  3FWC C;  1ZL9 A;  4QMK A;  1BAY A;  4KGI A;  5D9V A;  2XVW A;  4HJ2 A;  1YQ1 A;  20GS A;  2JL4 A;  3LSZ A;  5ECP B;  4GCI A;  3RBT A;  1LJR A;  4FJC B;  1GTA A;  4G9H A;  2YCD A;  4PUA A;  3NMU A;  3CSI A;  1GTB A;  4M70 B;  1F3B A;  4IVF A;  2V6K A;  3FYG A;  4F0C A;  1BKE A;  3I6A A;  2HQT A;  2DBW A;  3QAG A;  3ZMK A;  4BKE A;  2F8F A;  2IL3 A;  1N5U A;  4ZBK A;  3VPT A;  1BG1 A;  3TGZ A;  5DJL A;  5B7C A;  3TU3 B;  3M3M A;  4EXJ A;  1IYH A;  4E8E A;  2ON7 A;  4BVY B;  4NAX A;  4ECI A;  3NVM A;  2E0X A;  4FQU A;  4ECB A;  2AHE A;  2X64 A;  3LQ7 A;  5BMU B;  5IFO A;  2OAD A;  1AQV A;  4N3Z A;  4ZUX V;  12GS A;  4F5T A;  5D73 A;  3FRC A;  4IKH A;  5ELG A;  3IR4 A;  2VO4 A;  3CSJ A;  1GSE A;  2R4V A;  1F3A A;  3HKR A;  3UAR A;  2XSI A;  3V08 A;  4FIP B;  2VDB A;  4MF5 A;  3GH6 A;  2BXM A;  2PBJ A;  1PA3 A;  2GTU A;  3KMO A;  3WHS A;  5J40 A;  5A34 B;  1R5A A;  3G7I A;  4OFM A;  3PR8 A;  4JED A;  1G7O A;  4OFT A;  4OR0 A;  1N25 A;  1K0D A;  4MK3 A;  2KBZ A;  5A5H B;  4K2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...