4N3ZA

Crystal structure of rabex-5delta and rabaptin-5c21 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
290
structure length
238
Chain Sequence
EFIEFLKTHKTGQEIYKQTFLEGMHYKRDLIEEQSECAQDFYHNVEKIMDQIEKYIMTRLDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 74
structure length 238
sequence length 290
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4n3zA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4n3zA02
2EFEA 2EFHA 4G01A 2EFDA 2OT3A 2EFCA 4N3ZA 1TXUA
chains in the Genus database with same CATH superfamily
13GSA 2EFHA 4F5SA 2KWFA 4L5LA 1FW1A 2WB9A 2KBZA 5J5NA 3R3EA 5ECLB 3VLNA 1BYEA 4ACSA 4PNFA 4LUHA 2PBJA 3CSJA 4CHSA 2BXCA 4PHZC 1G6WA 4K2CA 3SIVB 2BXFA 3V08A 4IELA 2C3TA 1E7HA 4ZBRA 1U88A 4AKXB 4J2FA 1V2AA 1U3IA 4RI7A 2GLRA 4GCIA 3VQIA 5GHKA 3U6VA 6GSYA 3LU8A 3ECPA 1E7CA 1BM0A 3NVKA 2HRKB 1TU7A 4IW1A 4N3ZA 5J47A 5ID7A 1K0NA 3FNMA 2D2ZA 1OKTA 2WW2A 4WR4A 2DBWA 6GSSA 3VI5A 3LJRA 4PI0C 4EE0A 3SWLA 1XWGA 1LNSA 2NQOA 1GNIA 2DYMA 4HGKA 3ERFA 3D0ZA 5EVOA 3TOUA 4BY9C 5BMUA 22GSA 5LCZA 4F03A 4IS0A 2BX8A 5B7CA 1GLPA 5EY6A 6GSWA 1K0CA 4O92A 2HNLA 2XW0A 2UZ8A 4KE3A 2R5GA 4AKIA 5IIXA 2N5FA 1KBNA 2YCDA 3Q18A 5DALA 1U87A 1N2AA 3H1NA 1GSDA 3LXZA 3NIVA 3AY8A 4MF5A 1EOHA 2WVZA 4GDFA 2C8UA 16GSA 1B4PA 1K3OA 5ECPB 3QAVA 4WA6B 4G04A 4O7HA 4N0VA 4Q5NA 5DDLA 4OT2A 4QMKA 1KXPD 4F5VA 4ZB8A 2PVQA 3GA9L 1FHEA 4GDLB 3TGZA 4I9OA 5JCWA 1SVMA 4KAEA 4YH2A 3M0FA 2AB6A 3ISOA 5A5HA 4EC0A 5G5FA 4BL7B 3I69A 4G0IA 5FHIA 2F8FA 4L9KA 3WHSA 3PLAA 1VF1A 5J4VA 1BX9A 2LQIA 1K0AA 2GTUA 3MHSB 4AKGA 1GNJA 4ECCA 1K0DA 4BVXA 5DAKA 3G9KD 1GSEA 4ZBBA 4PTSA 3KXOA 4HZ2A 1BAYA 1R5AA 2BXIA 1BKEA 2IMKA 4G10A 4AKHA 1PGTA 5HOZA 3FY7A 2JL4A 2O3EA 5ECQB 1MTCA 3GUSA 2XMOA 5IIHA 10GSA 1TDIA 2WVXB 2JUHA 2EFDA 2HSMA 2J9HA 3FR6A 8GSSA 1KDXA 5D9XA 3DD3A 2Z8JA 4S1YA 1YDKA 4GTUA 3ICXA 4G01A 4F5UA 4KGIA 2NNWA 1ZL9A 1TW9A 2WDUA 4LMWA 5IIUA 1VF4A 3L0HA 1HA2A 2BXPA 2K0NA 2OT3A 3QAWA 2GSTA 4PI2C 5ECIB 5F06A 6GSUA 1AQXA 3DGQA 1HNAA 4GF0A 5B5TA 3GTUB 5IJEA 2VUFA 4MK3A 4F0CA 1NHYA 4EDYA 4W4UB 4TOPA 3TU3B 7GSSA 1E7FA 4LA0A 4ID0A 3KTLA 3IK7A 1B8XA 4PXOA 4FIPB 3UARA 1GSYA 1HQOA 3MAKA 2XW1A 3JRYA 4F5TA 3FRCA 5AGYA 2IMIA 4PX1A 1EOGA 5GSSA 1XWKA 4Q5FA 4OR0A 2HSNB 2LJRA 1M0UA 2BXHA 5J4UA 1GTAA 3GSTA 4G19A 2AJEA 5A34B 2EFEA 3H3AA 3V09A 3H37A 2HRAA 14GSA 3QR6A 2YDFA 2WW0A 2HSNA 1VF3A 3LU7A 3NMUA 1HK2A 3B9MA 1IYIA 1PD21 1A0FA 1XW6A 2FNOA 4GG2A 2C3NA 4DHXB 3IK9A 1DUGA 5D9TA 2GUTA 5A4VA 6GSXA 3P90A 1FOUA 2PERA 1EEMA 3GURA 3LQ7A 4KH7A 3B9LA 4PO0A 4BKEA 3Q74A 1Y6EA 3VK9A 4OMVA 3UVHA 5IQYA 4MPGA 3VI7A 2VCZA 1AO6A 2VDBA 4GDKB 4FQUA 2HRKA 4E8HA 4IKHA 3CSIA 3FYGA 5GZZB 2E0YA 5GSTA 5EL8A 4PUAA 3PPUA 3LYPA 4ZBKA 1MUHA 3G7IA 5ECKB 3LXTA 1Q4JA 3WHQA 4FXYP 4IVFA 4JZQA 6GSVA 1J78A 3LG6A 12GSA 2ROHA 1PA3A 4HJ2A 4WR5A 4GSNA 5DQSA 2BXOA 3M8NA 2R3XA 5FT3A 2XVQA 2BXQA 2O5VA 4IBPA 4MDCA 2AGHB 1BF5A 3GQUA 2XVVA 2BXLA 1SVOA 1PL2A 4LMVA 5LD0A 1ML6A 3PGTA 3VURA 1LOTA 1M9BA 3LYKA 4YAVA 2CKXA 2Z8KA 4LB9A 3QAGA 4GSTA 5J40A 1Z9HA 5F8BA 4ZXGA 5IFOA 3FWBC 3MHHB 1H5WA 4HOJA 4E99A 1JZRA 4MP4A 5A1NB 1JNBA 4F0BA 2BXMA 4ZCGA 1BG5A 1LBKA 1PKWA 4PQHA 1EV9A 4YQVA 1YJ6A 5GINA 1MIYA 5ECMB 3UAPA 4QQ7A 2VUEA 4LUFA 5F0GA 4G9HA 5A1NA 4ZB7A 3IE3A 4TQ0A 1HK1A 4GDXA 2GDRA 5D9VA 2QMCA 3GQXA 2PMTA 18GSA 4ZBAA 3LSZA 5GIPA 1XW5A 4JBBA 4BL7A 3BBYA 4NAXA 2QM6A 4E68A 5ECSA 2C80A 1PX6A 1PN9A 1MA9A 2OACA 5DBYA 2E0XA 5DJLA 3UBKA 1OE7A 2VD1A 5KEJA 4K71A 3LU6A 2CA8A 2HQTA 1GSUA 3KJYA 4HZ4A 4KSMA 2R4VA 3F6FA 1J7EA 3KJLA 1PX7A 1HK4A 1JLWA 1TXUA 2ON7A 2BXGA 3IC8A 4ZB9A 4DM0A 4AI6A 2WVXA 3O3TA 3V03A 1K0BA 4IQAA 2VCQA 4ZBQA 3KIKA 4ZUXV 3ERGA 1F2EA 4MPFA 1YKCA 3A75A 4NAWB 1V40A 5ECNB 4KF9A 2BXNA 1G6YA 5G5EA 1ZGNA 3GSSA 5ECRB 5ELGA 1E7GA 4BVYB 4K0NA 2YV7A 2CZ3A 4EMXA 3GTUA 5FWGA 4HGMB 2WJUA 1EV4A 4Q5RA 4GSSA 3HMJG 1SB0A 2WW1A 4G03A 11GSA 1PKZA 2LOQA 4KX4A 4Q5QA 9GSSA 4HI7A 3O76A 5AN1A 3ZMKA 2VCWA 1E7BA 2WW3A 5A5KA 19GSA 3RFRC 4E8EA 1IJGA 1IYHA 1HNCA 2R6KA 1N5UA 3KM6A 2VKZG 4K0GA 4IW2A 5BPKA 1GSFA 2PGTA 3VPTA 2WRTA 2BXBA 1VZSA 4C31B 2NTOA 1HK3A 3NVIA 2DC5A 3IR4A 1E6BA 4ISDA 5D73A 5A34A 4NHZA 2CZ2A 1AQWA 5GIOA 2LQHA 2IL3A 3FWCC 1RK4A 2WVYA 3HJMA 4PURA 5AIVA 3RGBC 3ZFBA 1GSQA 2FHEA 2DBXA 4TQ1A 3IBHA 3FR9A 3CBUA 5JCUA 2DBUA 1MIVA 1YVLA 4I97A 2A2SA 3WD6A 3VPQA 4USSA 1GTUA 2LXSA 2XSIA 2YV9A 3LFLA 4W66A 3MDKA 1HK5A 1GUKA 5HFKA 3CRTA 1YY7A 2CAIA 5A4UA 2QHBA 1GTIA 1Y1UA 1UORA 1YEWC 5J41A 3CSHA 2BXDA 4D7XA 4Z9OA 4AGSA 5BMUB 3EE2A 1MM8A 2A2RA 3N5OA 3UBLA 2GSQA 4NHWA 1MD3A 3BPJA 2DYOA 2WS2A 2WZSA 4IJIA 4DEJA 2DSAA 4YQMA 4ECJA 1GUMA 2VO4A 3EINA 2C3QA 5ECOB 5IJ5A 4ECBA 3FR3A 1G7OA 1GUHA 1F3AA 2GSSA 5DALB 2UV8G 3C8EA 5F07A 5D9WA 1AW9A 3ZFLA 1K3YA 2I30A 2O36A 3PR8A 1BJ5A 4GLTA 1GTBA 5J4YA 4JK4A 4OTTA 4MF6A 3HKRA 2OA7A 4L8EA 1OYJA 1NT2B 1E7IA 1N25A 3GX0A 5DCGA 4Z69A 1OE8A 1PL1A 3Q19A 3A73A 1AXDA 2BXAA 3NVMA 1S4BP 3WYWA 4FK5B 5AISA 1F3BA 1E7EA 4ECIA 1K0OA 1E7AA 1VFIA 2VCXA 4EDZA 5AIXA 1TU8A 3RBTA 1B48A 1JLVA 3JQZA 3CRUA 5A5HB 2BXKA 1I1IP 3SIUB 4IGJA 3G7JA 1MD4A 4OTUA 5ELAA 5IJFA 17GSA 2V36A 5D7GA 4MZWA 5F05A 1E78A 3TDLA 1C72A 2GSRA 4IW9A 6GSTA 1GLQA 4BVXB 2I2ZA 5DAKB 3N9JA 4KDXA 2OADA 5FUOA 4PQIA 3R2QA 4ZC6A 4MBEC 4OFMA 3CHXC 1GNEA 4KDYA 20GSA 1HNBA 2V6KA 3HJOA 4MF7A 2DG5A 3CWGA 4RI6A 2OZBB 2H1LA 2CVDA 1M9AA 5DQFA 3ZMLA 2F3MA 1AQVA 2HSMB 3P8WA 1YQ1A 1VF2A 1TF0A 2BXEA 4EXJA 1GSSA 1O9XA 2VCVA 4YAPA 2LXTA 2C4JA 3TOTA 4IQ1A 2ON5A 5A4WA 1LJRA 2VD0A 3SQJA 4JEDA 3I6AA 2EFCA 3CX9A 2VCTA 3F6DA 3KMNA 1BG1A 1GULA 3M3MA 4ZB6A 1H9ZA 4L5OA 1KW2A 1K0MA 1SVLA 1GWCA 4J2VA 1PMTA 2X64A 4G0LA 5ECHB 4FJCB 3VWXA 2AAWA 1MUSA 3M1GA 4KDUA 1USBA 1UA5A 4N0UD 4N0FD 2XVWA 4BVYA 1MIWA 4M70B 1M99A 1K3LA 4OFNA 1GNWA 4G0KA 3M99C 4LB2A 3WHRA 3W1SA 2XVUA 4L9QA 2AHEA 3F63A 3W8SA 3GH6A 2CAQA 4PNGA 4OFTA 3UIVA 3KMOA 5ID9A 2Z8IA 4L8UA 4ZBDA 5DJMA 4YQUA 4PGTA
chains in the Genus database with same CATH topology
13GSA 2EFHA 4F5SA 4L5LA 1FW1A 2WB9A 2KBZA 5J5NA 3R3EA 5ECLB 3VLNA 1BYEA 4ACSA 4PNFA 4LUHA 2PBJA 3CSJA 4CHSA 2BXCA 1G6WA 4K2CA 3SIVB 2BXFA 3V08A 4IELA 2C3TA 1E7HA 4ZBRA 1U88A 4AKXB 4J2FA 1V2AA 1U3IA 4RI7A 2GLRA 4GCIA 3VQIA 5GHKA 3U6VA 6GSYA 3LU8A 1E7CA 1BM0A 3NVKA 2HRKB 1TU7A 4IW1A 4N3ZA 5J47A 5ID7A 1K0NA 3FNMA 2D2ZA 1OKTA 4WR4A 2DBWA 6GSSA 3VI5A 3LJRA 4EE0A 3SWLA 1XWGA 1LNSA 2NQOA 1GNIA 2DYMA 4HGKA 3ERFA 3D0ZA 5EVOA 3TOUA 4BY9C 5BMUA 22GSA 5LCZA 4F03A 4IS0A 2BX8A 5B7CA 1GLPA 5EY6A 6GSWA 1K0CA 4O92A 2HNLA 2XW0A 2UZ8A 4KE3A 2R5GA 4AKIA 5IIXA 2N5FA 1KBNA 2YCDA 3Q18A 5DALA 1U87A 1N2AA 3H1NA 1GSDA 3LXZA 3NIVA 3AY8A 4MF5A 1EOHA 4GDFA 2C8UA 16GSA 1B4PA 1K3OA 5ECPB 3QAVA 4WA6B 4G04A 4O7HA 4N0VA 4Q5NA 5DDLA 4OT2A 4QMKA 1KXPD 4F5VA 4ZB8A 2PVQA 3GA9L 1FHEA 4GDLB 3TGZA 5JCWA 1SVMA 4KAEA 4YH2A 3M0FA 2AB6A 3ISOA 5A5HA 4EC0A 5G5FA 4BL7B 3I69A 4G0IA 5FHIA 2F8FA 4L9KA 3WHSA 3PLAA 1VF1A 5J4VA 1BX9A 1K0AA 2GTUA 3MHSB 4AKGA 1GNJA 4ECCA 1K0DA 4BVXA 5DAKA 3G9KD 1GSEA 4ZBBA 4PTSA 3KXOA 4HZ2A 1BAYA 1R5AA 2BXIA 1BKEA 2IMKA 4G10A 4AKHA 1PGTA 5HOZA 3FY7A 2JL4A 5ECQB 1MTCA 3GUSA 2XMOA 5IIHA 10GSA 1TDIA 2JUHA 2EFDA 2HSMA 2J9HA 3FR6A 8GSSA 5D9XA 3DD3A 2Z8JA 4S1YA 1YDKA 4GTUA 3ICXA 4G01A 4F5UA 4KGIA 2NNWA 1ZL9A 1TW9A 2WDUA 4LMWA 5IIUA 1VF4A 3L0HA 1HA2A 2BXPA 2OT3A 3QAWA 5ECIB 2GSTA 5F06A 6GSUA 1AQXA 3DGQA 1HNAA 4GF0A 5B5TA 3GTUB 5IJEA 2VUFA 4MK3A 4F0CA 1NHYA 4EDYA 4W4UB 4TOPA 3TU3B 7GSSA 1E7FA 4LA0A 4ID0A 3KTLA 3IK7A 1B8XA 4PXOA 4FIPB 3UARA 1GSYA 1HQOA 3MAKA 2XW1A 3JRYA 4F5TA 3FRCA 5AGYA 2IMIA 4PX1A 1EOGA 5GSSA 1XWKA 4Q5FA 4OR0A 2HSNB 2LJRA 1M0UA 2BXHA 5J4UA 1GTAA 3GSTA 4G19A 2AJEA 5A34B 2EFEA 3H3AA 3V09A 3H37A 2HRAA 14GSA 3QR6A 2YDFA 2HSNA 1VF3A 3LU7A 3NMUA 1HK2A 3B9MA 1IYIA 1PD21 1A0FA 1XW6A 2FNOA 4GG2A 2C3NA 4DHXB 3IK9A 1DUGA 5D9TA 5A4VA 6GSXA 3P90A 1FOUA 2PERA 1EEMA 3GURA 3LQ7A 4KH7A 3B9LA 4PO0A 4BKEA 3Q74A 1Y6EA 3VK9A 4OMVA 3UVHA 5IQYA 4MPGA 3VI7A 2VCZA 1AO6A 2VDBA 4GDKB 4FQUA 2HRKA 4E8HA 4IKHA 3CSIA 3FYGA 5GZZB 2E0YA 5GSTA 5EL8A 4PUAA 3PPUA 3LYPA 4ZBKA 3G7IA 5ECKB 3LXTA 1Q4JA 3WHQA 4IVFA 4JZQA 6GSVA 1J78A 3LG6A 12GSA 2ROHA 1PA3A 4HJ2A 4WR5A 4GSNA 5DQSA 2BXOA 3M8NA 2R3XA 5FT3A 2XVQA 2BXQA 2O5VA 4IBPA 4MDCA 1BF5A 3GQUA 2XVVA 2BXLA 1SVOA 1PL2A 4LMVA 5LD0A 1ML6A 3PGTA 3VURA 1LOTA 1M9BA 3LYKA 4YAVA 2CKXA 2Z8KA 4LB9A 3QAGA 4GSTA 5J40A 1Z9HA 5F8BA 4ZXGA 5IFOA 3FWBC 3MHHB 1H5WA 4HOJA 4E99A 1JZRA 4MP4A 5A1NB 1JNBA 4F0BA 2BXMA 4ZCGA 1BG5A 1LBKA 1PKWA 4PQHA 1EV9A 4YQVA 1YJ6A 5GINA 1MIYA 5ECMB 3UAPA 4QQ7A 2VUEA 4LUFA 5F0GA 4G9HA 5A1NA 4ZB7A 3IE3A 4TQ0A 1HK1A 4GDXA 2GDRA 5D9VA 2QMCA 3GQXA 2PMTA 18GSA 4ZBAA 3LSZA 5GIPA 1XW5A 4JBBA 4BL7A 3BBYA 4NAXA 2QM6A 4E68A 5ECSA 2C80A 1PX6A 1PN9A 1MA9A 2OACA 5DBYA 2E0XA 5DJLA 3UBKA 1OE7A 2VD1A 5KEJA 4K71A 3LU6A 2CA8A 2HQTA 1GSUA 3KJYA 4HZ4A 4KSMA 2R4VA 3F6FA 1J7EA 3KJLA 1PX7A 1HK4A 1JLWA 1TXUA 2ON7A 2BXGA 3IC8A 4ZB9A 4AI6A 3O3TA 3V03A 1K0BA 4IQAA 2VCQA 4ZBQA 3KIKA 4ZUXV 3ERGA 1F2EA 4MPFA 1YKCA 3A75A 4NAWB 1V40A 5ECNB 4KF9A 2BXNA 1G6YA 5G5EA 1ZGNA 3GSSA 5ECRB 5ELGA 1E7GA 4BVYB 4K0NA 2YV7A 2CZ3A 4EMXA 3GTUA 5FWGA 4HGMB 2WJUA 1EV4A 4Q5RA 4GSSA 3HMJG 4G03A 11GSA 1PKZA 2LOQA 4KX4A 4Q5QA 9GSSA 4HI7A 3O76A 5AN1A 3ZMKA 2VCWA 1E7BA 5A5KA 19GSA 4E8EA 1IJGA 1IYHA 1HNCA 2R6KA 1N5UA 3KM6A 2VKZG 4K0GA 4IW2A 5BPKA 1GSFA 2PGTA 3VPTA 2WRTA 2BXBA 1VZSA 4C31B 2NTOA 1HK3A 3NVIA 2DC5A 3IR4A 1E6BA 4ISDA 5D73A 5A34A 4NHZA 2CZ2A 1AQWA 5GIOA 2IL3A 3FWCC 1RK4A 3HJMA 4PURA 5AIVA 3ZFBA 1GSQA 2FHEA 2DBXA 4TQ1A 3IBHA 3FR9A 3CBUA 5JCUA 2DBUA 1MIVA 1YVLA 4I97A 2A2SA 3WD6A 3VPQA 4USSA 1GTUA 2XSIA 3LFLA 2YV9A 4W66A 3MDKA 1HK5A 1GUKA 5HFKA 3CRTA 1YY7A 2CAIA 5A4UA 2QHBA 1GTIA 1Y1UA 1UORA 5J41A 3CSHA 2BXDA 4Z9OA 4AGSA 5BMUB 3EE2A 3N5OA 2A2RA 3UBLA 2GSQA 4NHWA 1MD3A 2DYOA 2WS2A 4IJIA 4DEJA 2DSAA 4YQMA 4ECJA 1GUMA 2VO4A 3EINA 2C3QA 5ECOB 5IJ5A 4ECBA 3FR3A 1G7OA 1GUHA 1F3AA 2GSSA 5DALB 2UV8G 3C8EA 5F07A 5D9WA 1AW9A 3ZFLA 1K3YA 2I30A 3PR8A 1BJ5A 4GLTA 1GTBA 5J4YA 4JK4A 4OTTA 4MF6A 3HKRA 2OA7A 4L8EA 1OYJA 1NT2B 1E7IA 1N25A 3GX0A 5DCGA 4Z69A 1OE8A 1PL1A 3Q19A 3A73A 1AXDA 2BXAA 3NVMA 3WYWA 4FK5B 5AISA 1F3BA 1E7EA 4ECIA 1K0OA 1E7AA 1VFIA 2VCXA 4EDZA 5AIXA 1TU8A 3RBTA 1B48A 1JLVA 3JQZA 3CRUA 5A5HB 2BXKA 3SIUB 4IGJA 3G7JA 1MD4A 4OTUA 5ELAA 5IJFA 17GSA 2V36A 5D7GA 4MZWA 5F05A 1E78A 3TDLA 1C72A 2GSRA 4IW9A 6GSTA 1GLQA 4BVXB 2I2ZA 5DAKB 3N9JA 4KDXA 2OADA 5FUOA 4PQIA 3R2QA 4ZC6A 4MBEC 4OFMA 1GNEA 4KDYA 20GSA 1HNBA 2V6KA 3HJOA 4MF7A 2DG5A 3CWGA 4RI6A 2OZBB 2H1LA 2CVDA 1M9AA 5DQFA 3ZMLA 2F3MA 1AQVA 2HSMB 3P8WA 1YQ1A 1VF2A 1TF0A 2BXEA 4EXJA 1GSSA 1O9XA 2VCVA 4YAPA 2C4JA 3TOTA 4IQ1A 2ON5A 5A4WA 1LJRA 2VD0A 3SQJA 4JEDA 3I6AA 2EFCA 3CX9A 2VCTA 3F6DA 3KMNA 1BG1A 1GULA 3M3MA 4ZB6A 1H9ZA 4L5OA 1KW2A 1K0MA 1SVLA 1GWCA 4J2VA 1PMTA 2X64A 4G0LA 5ECHB 4FJCB 3VWXA 2AAWA 3M1GA 4KDUA 1USBA 1UA5A 4N0UD 4N0FD 2XVWA 4BVYA 1MIWA 1M99A 4M70B 1K3LA 4OFNA 1GNWA 4G0KA 3M99C 4LB2A 3WHRA 3W1SA 2XVUA 4L9QA 2AHEA 3F63A 3W8SA 3GH6A 2CAQA 4PNGA 4OFTA 3UIVA 3KMOA 5ID9A 2Z8IA 4L8UA 4ZBDA 5DJMA 4YQUA 4PGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFE A;  2EFH A;  4G01 A;  2EFD A;  2OT3 A;  2EFC A;  4N3Z A;  1TXU A; 
#chains in the Genus database with same CATH topology
 13GS A;  2EFH A;  4F5S A;  2KWF A;  4L5L A;  1FW1 A;  2WB9 A;  2KBZ A;  5J5N A;  3R3E A;  5ECL B;  3VLN A;  1BYE A;  4ACS A;  4PNF A;  4LUH A;  2PBJ A;  3CSJ A;  4CHS A;  2BXC A;  4PHZ C;  1G6W A;  4K2C A;  3SIV B;  2BXF A;  3V08 A;  4IEL A;  2C3T A;  1E7H A;  4ZBR A;  1U88 A;  4AKX B;  4J2F A;  1V2A A;  1U3I A;  4RI7 A;  2GLR A;  4GCI A;  3VQI A;  5GHK A;  3U6V A;  6GSY A;  3LU8 A;  3ECP A;  1E7C A;  1BM0 A;  3NVK A;  2HRK B;  1TU7 A;  4IW1 A;  4N3Z A;  5J47 A;  5ID7 A;  1K0N A;  3FNM A;  2D2Z A;  1OKT A;  2WW2 A;  4WR4 A;  2DBW A;  6GSS A;  3VI5 A;  3LJR A;  4PI0 C;  4EE0 A;  3SWL A;  1XWG A;  1LNS A;  2NQO A;  1GNI A;  2DYM A;  4HGK A;  3ERF A;  3D0Z A;  5EVO A;  3TOU A;  4BY9 C;  5BMU A;  22GS A;  5LCZ A;  4F03 A;  4IS0 A;  2BX8 A;  5B7C A;  1GLP A;  5EY6 A;  6GSW A;  1K0C A;  4O92 A;  2HNL A;  2XW0 A;  2UZ8 A;  4KE3 A;  2R5G A;  4AKI A;  5IIX A;  2N5F A;  1KBN A;  2YCD A;  3Q18 A;  5DAL A;  1U87 A;  1N2A A;  3H1N A;  1GSD A;  3LXZ A;  3NIV A;  3AY8 A;  4MF5 A;  1EOH A;  2WVZ A;  4GDF A;  2C8U A;  16GS A;  1B4P A;  1K3O A;  5ECP B;  3QAV A;  4WA6 B;  4G04 A;  4O7H A;  4N0V A;  4Q5N A;  5DDL A;  4OT2 A;  4QMK A;  1KXP D;  4F5V A;  4ZB8 A;  2PVQ A;  3GA9 L;  1FHE A;  4GDL B;  3TGZ A;  4I9O A;  5JCW A;  1SVM A;  4KAE A;  4YH2 A;  3M0F A;  2AB6 A;  3ISO A;  5A5H A;  4EC0 A;  5G5F A;  4BL7 B;  3I69 A;  4G0I A;  5FHI A;  2F8F A;  4L9K A;  3WHS A;  3PLA A;  1VF1 A;  5J4V A;  1BX9 A;  2LQI A;  1K0A A;  2GTU A;  3MHS B;  4AKG A;  1GNJ A;  4ECC A;  1K0D A;  4BVX A;  5DAK A;  3G9K D;  1GSE A;  4ZBB A;  4PTS A;  3KXO A;  4HZ2 A;  1BAY A;  1R5A A;  2BXI A;  1BKE A;  2IMK A;  4G10 A;  4AKH A;  1PGT A;  5HOZ A;  3FY7 A;  2JL4 A;  2O3E A;  5ECQ B;  1MTC A;  3GUS A;  2XMO A;  5IIH A;  10GS A;  1TDI A;  2WVX B;  2JUH A;  2EFD A;  2HSM A;  2J9H A;  3FR6 A;  8GSS A;  1KDX A;  5D9X A;  3DD3 A;  2Z8J A;  4S1Y A;  1YDK A;  4GTU A;  3ICX A;  4G01 A;  4F5U A;  4KGI A;  2NNW A;  1ZL9 A;  1TW9 A;  2WDU A;  4LMW A;  5IIU A;  1VF4 A;  3L0H A;  1HA2 A;  2BXP A;  2K0N A;  2OT3 A;  3QAW A;  2GST A;  4PI2 C;  5ECI B;  5F06 A;  6GSU A;  1AQX A;  3DGQ A;  1HNA A;  4GF0 A;  5B5T A;  3GTU B;  5IJE A;  2VUF A;  4MK3 A;  4F0C A;  1NHY A;  4EDY A;  4W4U B;  4TOP A;  3TU3 B;  7GSS A;  1E7F A;  4LA0 A;  4ID0 A;  3KTL A;  3IK7 A;  1B8X A;  4PXO A;  4FIP B;  3UAR A;  1GSY A;  1HQO A;  3MAK A;  2XW1 A;  3JRY A;  4F5T A;  3FRC A;  5AGY A;  2IMI A;  4PX1 A;  1EOG A;  5GSS A;  1XWK A;  4Q5F A;  4OR0 A;  2HSN B;  2LJR A;  1M0U A;  2BXH A;  5J4U A;  1GTA A;  3GST A;  4G19 A;  2AJE A;  5A34 B;  2EFE A;  3H3A A;  3V09 A;  3H37 A;  2HRA A;  14GS A;  3QR6 A;  2YDF A;  2WW0 A;  2HSN A;  1VF3 A;  3LU7 A;  3NMU A;  1HK2 A;  3B9M A;  1IYI A;  1PD2 1;  1A0F A;  1XW6 A;  2FNO A;  4GG2 A;  2C3N A;  4DHX B;  3IK9 A;  1DUG A;  5D9T A;  2GUT A;  5A4V A;  6GSX A;  3P90 A;  1FOU A;  2PER A;  1EEM A;  3GUR A;  3LQ7 A;  4KH7 A;  3B9L A;  4PO0 A;  4BKE A;  3Q74 A;  1Y6E A;  3VK9 A;  4OMV A;  3UVH A;  5IQY A;  4MPG A;  3VI7 A;  2VCZ A;  1AO6 A;  2VDB A;  4GDK B;  4FQU A;  2HRK A;  4E8H A;  4IKH A;  3CSI A;  3FYG A;  5GZZ B;  2E0Y A;  5GST A;  5EL8 A;  4PUA A;  3PPU A;  3LYP A;  4ZBK A;  1MUH A;  3G7I A;  5ECK B;  3LXT A;  1Q4J A;  3WHQ A;  4FXY P;  4IVF A;  4JZQ A;  6GSV A;  1J78 A;  3LG6 A;  12GS A;  2ROH A;  1PA3 A;  4HJ2 A;  4WR5 A;  4GSN A;  5DQS A;  2BXO A;  3M8N A;  2R3X A;  5FT3 A;  2XVQ A;  2BXQ A;  2O5V A;  4IBP A;  4MDC A;  2AGH B;  1BF5 A;  3GQU A;  2XVV A;  2BXL A;  1SVO A;  1PL2 A;  4LMV A;  5LD0 A;  1ML6 A;  3PGT A;  3VUR A;  1LOT A;  1M9B A;  3LYK A;  4YAV A;  2CKX A;  2Z8K A;  4LB9 A;  3QAG A;  4GST A;  5J40 A;  1Z9H A;  5F8B A;  4ZXG A;  5IFO A;  3FWB C;  3MHH B;  1H5W A;  4HOJ A;  4E99 A;  1JZR A;  4MP4 A;  5A1N B;  1JNB A;  4F0B A;  2BXM A;  4ZCG A;  1BG5 A;  1LBK A;  1PKW A;  4PQH A;  1EV9 A;  4YQV A;  1YJ6 A;  5GIN A;  1MIY A;  5ECM B;  3UAP A;  4QQ7 A;  2VUE A;  4LUF A;  5F0G A;  4G9H A;  5A1N A;  4ZB7 A;  3IE3 A;  4TQ0 A;  1HK1 A;  4GDX A;  2GDR A;  5D9V A;  2QMC A;  3GQX A;  2PMT A;  18GS A;  4ZBA A;  3LSZ A;  5GIP A;  1XW5 A;  4JBB A;  4BL7 A;  3BBY A;  4NAX A;  2QM6 A;  4E68 A;  5ECS A;  2C80 A;  1PX6 A;  1PN9 A;  1MA9 A;  2OAC A;  5DBY A;  2E0X A;  5DJL A;  3UBK A;  1OE7 A;  2VD1 A;  5KEJ A;  4K71 A;  3LU6 A;  2CA8 A;  2HQT A;  1GSU A;  3KJY A;  4HZ4 A;  4KSM A;  2R4V A;  3F6F A;  1J7E A;  3KJL A;  1PX7 A;  1HK4 A;  1JLW A;  1TXU A;  2ON7 A;  2BXG A;  3IC8 A;  4ZB9 A;  4DM0 A;  4AI6 A;  2WVX A;  3O3T A;  3V03 A;  1K0B A;  4IQA A;  2VCQ A;  4ZBQ A;  3KIK A;  4ZUX V;  3ERG A;  1F2E A;  4MPF A;  1YKC A;  3A75 A;  4NAW B;  1V40 A;  5ECN B;  4KF9 A;  2BXN A;  1G6Y A;  5G5E A;  1ZGN A;  3GSS A;  5ECR B;  5ELG A;  1E7G A;  4BVY B;  4K0N A;  2YV7 A;  2CZ3 A;  4EMX A;  3GTU A;  5FWG A;  4HGM B;  2WJU A;  1EV4 A;  4Q5R A;  4GSS A;  3HMJ G;  1SB0 A;  2WW1 A;  4G03 A;  11GS A;  1PKZ A;  2LOQ A;  4KX4 A;  4Q5Q A;  9GSS A;  4HI7 A;  3O76 A;  5AN1 A;  3ZMK A;  2VCW A;  1E7B A;  2WW3 A;  5A5K A;  19GS A;  3RFR C;  4E8E A;  1IJG A;  1IYH A;  1HNC A;  2R6K A;  1N5U A;  3KM6 A;  2VKZ G;  4K0G A;  4IW2 A;  5BPK A;  1GSF A;  2PGT A;  3VPT A;  2WRT A;  2BXB A;  1VZS A;  4C31 B;  2NTO A;  1HK3 A;  3NVI A;  2DC5 A;  3IR4 A;  1E6B A;  4ISD A;  5D73 A;  5A34 A;  4NHZ A;  2CZ2 A;  1AQW A;  5GIO A;  2LQH A;  2IL3 A;  3FWC C;  1RK4 A;  2WVY A;  3HJM A;  4PUR A;  5AIV A;  3RGB C;  3ZFB A;  1GSQ A;  2FHE A;  2DBX A;  4TQ1 A;  3IBH A;  3FR9 A;  3CBU A;  5JCU A;  2DBU A;  1MIV A;  1YVL A;  4I97 A;  2A2S A;  3WD6 A;  3VPQ A;  4USS A;  1GTU A;  2LXS A;  2XSI A;  2YV9 A;  3LFL A;  4W66 A;  3MDK A;  1HK5 A;  1GUK A;  5HFK A;  3CRT A;  1YY7 A;  2CAI A;  5A4U A;  2QHB A;  1GTI A;  1Y1U A;  1UOR A;  1YEW C;  5J41 A;  3CSH A;  2BXD A;  4D7X A;  4Z9O A;  4AGS A;  5BMU B;  3EE2 A;  1MM8 A;  2A2R A;  3N5O A;  3UBL A;  2GSQ A;  4NHW A;  1MD3 A;  3BPJ A;  2DYO A;  2WS2 A;  2WZS A;  4IJI A;  4DEJ A;  2DSA A;  4YQM A;  4ECJ A;  1GUM A;  2VO4 A;  3EIN A;  2C3Q A;  5ECO B;  5IJ5 A;  4ECB A;  3FR3 A;  1G7O A;  1GUH A;  1F3A A;  2GSS A;  5DAL B;  2UV8 G;  3C8E A;  5F07 A;  5D9W A;  1AW9 A;  3ZFL A;  1K3Y A;  2I30 A;  2O36 A;  3PR8 A;  1BJ5 A;  4GLT A;  1GTB A;  5J4Y A;  4JK4 A;  4OTT A;  4MF6 A;  3HKR A;  2OA7 A;  4L8E A;  1OYJ A;  1NT2 B;  1E7I A;  1N25 A;  3GX0 A;  5DCG A;  4Z69 A;  1OE8 A;  1PL1 A;  3Q19 A;  3A73 A;  1AXD A;  2BXA A;  3NVM A;  1S4B P;  3WYW A;  4FK5 B;  5AIS A;  1F3B A;  1E7E A;  4ECI A;  1K0O A;  1E7A A;  1VFI A;  2VCX A;  4EDZ A;  5AIX A;  1TU8 A;  3RBT A;  1B48 A;  1JLV A;  3JQZ A;  3CRU A;  5A5H B;  2BXK A;  1I1I P;  3SIU B;  4IGJ A;  3G7J A;  1MD4 A;  4OTU A;  5ELA A;  5IJF A;  17GS A;  2V36 A;  5D7G A;  4MZW A;  5F05 A;  1E78 A;  3TDL A;  1C72 A;  2GSR A;  4IW9 A;  6GST A;  1GLQ A;  4BVX B;  2I2Z A;  5DAK B;  3N9J A;  4KDX A;  2OAD A;  5FUO A;  4PQI A;  3R2Q A;  4ZC6 A;  4MBE C;  4OFM A;  3CHX C;  1GNE A;  4KDY A;  20GS A;  1HNB A;  2V6K A;  3HJO A;  4MF7 A;  2DG5 A;  3CWG A;  4RI6 A;  2OZB B;  2H1L A;  2CVD A;  1M9A A;  5DQF A;  3ZML A;  2F3M A;  1AQV A;  2HSM B;  3P8W A;  1YQ1 A;  1VF2 A;  1TF0 A;  2BXE A;  4EXJ A;  1GSS A;  1O9X A;  2VCV A;  4YAP A;  2LXT A;  2C4J A;  3TOT A;  4IQ1 A;  2ON5 A;  5A4W A;  1LJR A;  2VD0 A;  3SQJ A;  4JED A;  3I6A A;  2EFC A;  3CX9 A;  2VCT A;  3F6D A;  3KMN A;  1BG1 A;  1GUL A;  3M3M A;  4ZB6 A;  1H9Z A;  4L5O A;  1KW2 A;  1K0M A;  1SVL A;  1GWC A;  4J2V A;  1PMT A;  2X64 A;  4G0L A;  5ECH B;  4FJC B;  3VWX A;  2AAW A;  1MUS A;  3M1G A;  4KDU A;  1USB A;  1UA5 A;  4N0U D;  4N0F D;  2XVW A;  4BVY A;  1MIW A;  4M70 B;  1M99 A;  1K3L A;  4OFN A;  1GNW A;  4G0K A;  3M99 C;  4LB2 A;  3WHR A;  3W1S A;  2XVU A;  4L9Q A;  2AHE A;  3F63 A;  3W8S A;  3GH6 A;  2CAQ A;  4PNG A;  4OFT A;  3UIV A;  3KMO A;  5ID9 A;  2Z8I A;  4L8U A;  4ZBD A;  5DJM A;  4YQU A;  4PGT A; 
#chains in the Genus database with same CATH homology
 13GS A;  2EFH A;  4F5S A;  4L5L A;  1FW1 A;  2WB9 A;  2KBZ A;  5J5N A;  3R3E A;  5ECL B;  3VLN A;  1BYE A;  4ACS A;  4PNF A;  4LUH A;  2PBJ A;  3CSJ A;  4CHS A;  2BXC A;  1G6W A;  4K2C A;  3SIV B;  2BXF A;  3V08 A;  4IEL A;  2C3T A;  1E7H A;  4ZBR A;  1U88 A;  4AKX B;  4J2F A;  1V2A A;  1U3I A;  4RI7 A;  2GLR A;  4GCI A;  3VQI A;  5GHK A;  3U6V A;  6GSY A;  3LU8 A;  1E7C A;  1BM0 A;  3NVK A;  2HRK B;  1TU7 A;  4IW1 A;  4N3Z A;  5J47 A;  5ID7 A;  1K0N A;  3FNM A;  2D2Z A;  1OKT A;  4WR4 A;  2DBW A;  6GSS A;  3VI5 A;  3LJR A;  4EE0 A;  3SWL A;  1XWG A;  1LNS A;  2NQO A;  1GNI A;  2DYM A;  4HGK A;  3ERF A;  3D0Z A;  5EVO A;  3TOU A;  4BY9 C;  5BMU A;  22GS A;  5LCZ A;  4F03 A;  4IS0 A;  2BX8 A;  5B7C A;  1GLP A;  5EY6 A;  6GSW A;  1K0C A;  4O92 A;  2HNL A;  2XW0 A;  2UZ8 A;  4KE3 A;  2R5G A;  4AKI A;  5IIX A;  2N5F A;  1KBN A;  2YCD A;  3Q18 A;  5DAL A;  1U87 A;  1N2A A;  3H1N A;  1GSD A;  3LXZ A;  3NIV A;  3AY8 A;  4MF5 A;  1EOH A;  4GDF A;  2C8U A;  16GS A;  1B4P A;  1K3O A;  5ECP B;  3QAV A;  4WA6 B;  4G04 A;  4O7H A;  4N0V A;  4Q5N A;  5DDL A;  4OT2 A;  4QMK A;  1KXP D;  4F5V A;  4ZB8 A;  2PVQ A;  3GA9 L;  1FHE A;  4GDL B;  3TGZ A;  5JCW A;  1SVM A;  4KAE A;  4YH2 A;  3M0F A;  2AB6 A;  3ISO A;  5A5H A;  4EC0 A;  5G5F A;  4BL7 B;  3I69 A;  4G0I A;  5FHI A;  2F8F A;  4L9K A;  3WHS A;  3PLA A;  1VF1 A;  5J4V A;  1BX9 A;  1K0A A;  2GTU A;  3MHS B;  4AKG A;  1GNJ A;  4ECC A;  1K0D A;  4BVX A;  5DAK A;  3G9K D;  1GSE A;  4ZBB A;  4PTS A;  3KXO A;  4HZ2 A;  1BAY A;  1R5A A;  2BXI A;  1BKE A;  2IMK A;  4G10 A;  4AKH A;  1PGT A;  5HOZ A;  3FY7 A;  2JL4 A;  5ECQ B;  1MTC A;  3GUS A;  2XMO A;  5IIH A;  10GS A;  1TDI A;  2JUH A;  2EFD A;  2HSM A;  2J9H A;  3FR6 A;  8GSS A;  5D9X A;  3DD3 A;  2Z8J A;  4S1Y A;  1YDK A;  4GTU A;  3ICX A;  4G01 A;  4F5U A;  4KGI A;  2NNW A;  1ZL9 A;  1TW9 A;  2WDU A;  4LMW A;  5IIU A;  1VF4 A;  3L0H A;  1HA2 A;  2BXP A;  2OT3 A;  3QAW A;  5ECI B;  2GST A;  5F06 A;  6GSU A;  1AQX A;  3DGQ A;  1HNA A;  4GF0 A;  5B5T A;  3GTU B;  5IJE A;  2VUF A;  4MK3 A;  4F0C A;  1NHY A;  4EDY A;  4W4U B;  4TOP A;  3TU3 B;  7GSS A;  1E7F A;  4LA0 A;  4ID0 A;  3KTL A;  3IK7 A;  1B8X A;  4PXO A;  4FIP B;  3UAR A;  1GSY A;  1HQO A;  3MAK A;  2XW1 A;  3JRY A;  4F5T A;  3FRC A;  5AGY A;  2IMI A;  4PX1 A;  1EOG A;  5GSS A;  1XWK A;  4Q5F A;  4OR0 A;  2HSN B;  2LJR A;  1M0U A;  2BXH A;  5J4U A;  1GTA A;  3GST A;  4G19 A;  2AJE A;  5A34 B;  2EFE A;  3H3A A;  3V09 A;  3H37 A;  2HRA A;  14GS A;  3QR6 A;  2YDF A;  2HSN A;  1VF3 A;  3LU7 A;  3NMU A;  1HK2 A;  3B9M A;  1IYI A;  1PD2 1;  1A0F A;  1XW6 A;  2FNO A;  4GG2 A;  2C3N A;  4DHX B;  3IK9 A;  1DUG A;  5D9T A;  5A4V A;  6GSX A;  3P90 A;  1FOU A;  2PER A;  1EEM A;  3GUR A;  3LQ7 A;  4KH7 A;  3B9L A;  4PO0 A;  4BKE A;  3Q74 A;  1Y6E A;  3VK9 A;  4OMV A;  3UVH A;  5IQY A;  4MPG A;  3VI7 A;  2VCZ A;  1AO6 A;  2VDB A;  4GDK B;  4FQU A;  2HRK A;  4E8H A;  4IKH A;  3CSI A;  3FYG A;  5GZZ B;  2E0Y A;  5GST A;  5EL8 A;  4PUA A;  3PPU A;  3LYP A;  4ZBK A;  3G7I A;  5ECK B;  3LXT A;  1Q4J A;  3WHQ A;  4IVF A;  4JZQ A;  6GSV A;  1J78 A;  3LG6 A;  12GS A;  2ROH A;  1PA3 A;  4HJ2 A;  4WR5 A;  4GSN A;  5DQS A;  2BXO A;  3M8N A;  2R3X A;  5FT3 A;  2XVQ A;  2BXQ A;  2O5V A;  4IBP A;  4MDC A;  1BF5 A;  3GQU A;  2XVV A;  2BXL A;  1SVO A;  1PL2 A;  4LMV A;  5LD0 A;  1ML6 A;  3PGT A;  3VUR A;  1LOT A;  1M9B A;  3LYK A;  4YAV A;  2CKX A;  2Z8K A;  4LB9 A;  3QAG A;  4GST A;  5J40 A;  1Z9H A;  5F8B A;  4ZXG A;  5IFO A;  3FWB C;  3MHH B;  1H5W A;  4HOJ A;  4E99 A;  1JZR A;  4MP4 A;  5A1N B;  1JNB A;  4F0B A;  2BXM A;  4ZCG A;  1BG5 A;  1LBK A;  1PKW A;  4PQH A;  1EV9 A;  4YQV A;  1YJ6 A;  5GIN A;  1MIY A;  5ECM B;  3UAP A;  4QQ7 A;  2VUE A;  4LUF A;  5F0G A;  4G9H A;  5A1N A;  4ZB7 A;  3IE3 A;  4TQ0 A;  1HK1 A;  4GDX A;  2GDR A;  5D9V A;  2QMC A;  3GQX A;  2PMT A;  18GS A;  4ZBA A;  3LSZ A;  5GIP A;  1XW5 A;  4JBB A;  4BL7 A;  3BBY A;  4NAX A;  2QM6 A;  4E68 A;  5ECS A;  2C80 A;  1PX6 A;  1PN9 A;  1MA9 A;  2OAC A;  5DBY A;  2E0X A;  5DJL A;  3UBK A;  1OE7 A;  2VD1 A;  5KEJ A;  4K71 A;  3LU6 A;  2CA8 A;  2HQT A;  1GSU A;  3KJY A;  4HZ4 A;  4KSM A;  2R4V A;  3F6F A;  1J7E A;  3KJL A;  1PX7 A;  1HK4 A;  1JLW A;  1TXU A;  2ON7 A;  2BXG A;  3IC8 A;  4ZB9 A;  4AI6 A;  3O3T A;  3V03 A;  1K0B A;  4IQA A;  2VCQ A;  4ZBQ A;  3KIK A;  4ZUX V;  3ERG A;  1F2E A;  4MPF A;  1YKC A;  3A75 A;  4NAW B;  1V40 A;  5ECN B;  4KF9 A;  2BXN A;  1G6Y A;  5G5E A;  1ZGN A;  3GSS A;  5ECR B;  5ELG A;  1E7G A;  4BVY B;  4K0N A;  2YV7 A;  2CZ3 A;  4EMX A;  3GTU A;  5FWG A;  4HGM B;  2WJU A;  1EV4 A;  4Q5R A;  4GSS A;  3HMJ G;  4G03 A;  11GS A;  1PKZ A;  2LOQ A;  4KX4 A;  4Q5Q A;  9GSS A;  4HI7 A;  3O76 A;  5AN1 A;  3ZMK A;  2VCW A;  1E7B A;  5A5K A;  19GS A;  4E8E A;  1IJG A;  1IYH A;  1HNC A;  2R6K A;  1N5U A;  3KM6 A;  2VKZ G;  4K0G A;  4IW2 A;  5BPK A;  1GSF A;  2PGT A;  3VPT A;  2WRT A;  2BXB A;  1VZS A;  4C31 B;  2NTO A;  1HK3 A;  3NVI A;  2DC5 A;  3IR4 A;  1E6B A;  4ISD A;  5D73 A;  5A34 A;  4NHZ A;  2CZ2 A;  1AQW A;  5GIO A;  2IL3 A;  3FWC C;  1RK4 A;  3HJM A;  4PUR A;  5AIV A;  3ZFB A;  1GSQ A;  2FHE A;  2DBX A;  4TQ1 A;  3IBH A;  3FR9 A;  3CBU A;  5JCU A;  2DBU A;  1MIV A;  1YVL A;  4I97 A;  2A2S A;  3WD6 A;  3VPQ A;  4USS A;  1GTU A;  2XSI A;  3LFL A;  2YV9 A;  4W66 A;  3MDK A;  1HK5 A;  1GUK A;  5HFK A;  3CRT A;  1YY7 A;  2CAI A;  5A4U A;  2QHB A;  1GTI A;  1Y1U A;  1UOR A;  5J41 A;  3CSH A;  2BXD A;  4Z9O A;  4AGS A;  5BMU B;  3EE2 A;  3N5O A;  2A2R A;  3UBL A;  2GSQ A;  4NHW A;  1MD3 A;  2DYO A;  2WS2 A;  4IJI A;  4DEJ A;  2DSA A;  4YQM A;  4ECJ A;  1GUM A;  2VO4 A;  3EIN A;  2C3Q A;  5ECO B;  5IJ5 A;  4ECB A;  3FR3 A;  1G7O A;  1GUH A;  1F3A A;  2GSS A;  5DAL B;  2UV8 G;  3C8E A;  5F07 A;  5D9W A;  1AW9 A;  3ZFL A;  1K3Y A;  2I30 A;  3PR8 A;  1BJ5 A;  4GLT A;  1GTB A;  5J4Y A;  4JK4 A;  4OTT A;  4MF6 A;  3HKR A;  2OA7 A;  4L8E A;  1OYJ A;  1NT2 B;  1E7I A;  1N25 A;  3GX0 A;  5DCG A;  4Z69 A;  1OE8 A;  1PL1 A;  3Q19 A;  3A73 A;  1AXD A;  2BXA A;  3NVM A;  3WYW A;  4FK5 B;  5AIS A;  1F3B A;  1E7E A;  4ECI A;  1K0O A;  1E7A A;  1VFI A;  2VCX A;  4EDZ A;  5AIX A;  1TU8 A;  3RBT A;  1B48 A;  1JLV A;  3JQZ A;  3CRU A;  5A5H B;  2BXK A;  3SIU B;  4IGJ A;  3G7J A;  1MD4 A;  4OTU A;  5ELA A;  5IJF A;  17GS A;  2V36 A;  5D7G A;  4MZW A;  5F05 A;  1E78 A;  3TDL A;  1C72 A;  2GSR A;  4IW9 A;  6GST A;  1GLQ A;  4BVX B;  2I2Z A;  5DAK B;  3N9J A;  4KDX A;  2OAD A;  5FUO A;  4PQI A;  3R2Q A;  4ZC6 A;  4MBE C;  4OFM A;  1GNE A;  4KDY A;  20GS A;  1HNB A;  2V6K A;  3HJO A;  4MF7 A;  2DG5 A;  3CWG A;  4RI6 A;  2OZB B;  2H1L A;  2CVD A;  1M9A A;  5DQF A;  3ZML A;  2F3M A;  1AQV A;  2HSM B;  3P8W A;  1YQ1 A;  1VF2 A;  1TF0 A;  2BXE A;  4EXJ A;  1GSS A;  1O9X A;  2VCV A;  4YAP A;  2C4J A;  3TOT A;  4IQ1 A;  2ON5 A;  5A4W A;  1LJR A;  2VD0 A;  3SQJ A;  4JED A;  3I6A A;  2EFC A;  3CX9 A;  2VCT A;  3F6D A;  3KMN A;  1BG1 A;  1GUL A;  3M3M A;  4ZB6 A;  1H9Z A;  4L5O A;  1KW2 A;  1K0M A;  1SVL A;  1GWC A;  4J2V A;  1PMT A;  2X64 A;  4G0L A;  5ECH B;  4FJC B;  3VWX A;  2AAW A;  3M1G A;  4KDU A;  1USB A;  1UA5 A;  4N0U D;  4N0F D;  2XVW A;  4BVY A;  1MIW A;  1M99 A;  4M70 B;  1K3L A;  4OFN A;  1GNW A;  4G0K A;  3M99 C;  4LB2 A;  3WHR A;  3W1S A;  2XVU A;  4L9Q A;  2AHE A;  3F63 A;  3W8S A;  3GH6 A;  2CAQ A;  4PNG A;  4OFT A;  3UIV A;  3KMO A;  5ID9 A;  2Z8I A;  4L8U A;  4ZBD A;  5DJM A;  4YQU A;  4PGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...