1H5WA

2.1a bacteriophage phi-29 connector
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
268
structure length
249
Chain Sequence
RQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNYRDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFLGIKNSNDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPPER COLLAR PROTEIN
publication title Detailed Architecture of a DNA Translocating Machine: The High-Resolution Structure of the Bacteriophage Phi29 Connector Particle.
pubmed doi rcsb
source organism Bacteriophage phi-29
molecule tags Virus
total genus 69
structure length 249
sequence length 268
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05352 Phage_connector Phage Connector (GP10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.30 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1h5wA01
2.40.500.10 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) 1h5wA02
3.30.1350.20 Alpha Beta 2-Layer Sandwich Crambin Bacteriophage PHI-29 conector. Domain 3 1h5wA03
1JNBA 1IJGA 1FOUA 1H5WA
chains in the Genus database with same CATH superfamily
1VEWA 4GDXA 2OZBB 1E7EA 2BXPA 1AB1A 3KIKA 3B9MA 2DYOA 1LUVA 3WHQA 2Z8JA 3PLAA 3GQXA 3SIUB 3SZSA 5ID9A 3JRYA 2E0XA 2NQOA 2EFCA 2EYBA 4GG2A 3NVMA 2BXBA 1GNIA 4YIPA 4FC1A 3AK3A 1N5UA 2FD9A 1MIVA 3GA9L 4G04A 2GDSA 1JXYA 3B9LA 5IJ5A 1JA8A 4J2VA 4L9QA 3LU7A 2EYDA 4F5VA 4LB2A 2KBZA 1GNJA 2BXOA 3V09A 1E7IA 3A75A 4LUFA 1IXBA 3UE7B 3KKYA 2YDFA 2BXHA 4TQ0A 1GN6A 5DQFA 1MUSA 1VARA 2NNWA 3BFRA 2V36A 5AG2A 3NIRA 3A73A 4IW2A 4C7UA 1XDCA 1BT8A 1HK3A 3ECPA 4GUNA 2QMCA 2GUTA 4PO0A 1XILA 1MIWA 4TQ1A 1SZXA 2I2ZA 4W4UB 4ZBQA 4HGKA 1AVMA 3AK1A 1JNBA 1SB0A 1GN3A 4D7XA 1JXXA 3VQIA 1AP6A 3NVIA 1WB7A 1MIYA 1IX9A 4OTTA 1I08A 3EVKA 4OR0A 2XVQA 1HA2A 2Z8KA 4N0UD 1GN4A 5HOZA 2LXSA 4Z9OA 1EM1A 1JXWA 2EYAA 4OTUA 1CCNA 3K9SA 1ZTEA 2AW9A 5IIUA 1VFIA 1YVAA 5IJEA 1UORA 2BX8A 2XVWA 4WA6B 2ADQB 2DBXA 4Z69A 2CKXA 2XSIA 4L8UA 1CCMA 4C31B 2BXDA 4F5TA 1WUWA 2EFHA 2BXCA 4E99A 5IIXA 3MDSA 3V08A 5GINA 1ZSPA 1MMMA 3ICXA 4S1YA 4F5SA 1H9ZA 5BPKA 1EN5A 4E4EA 3V03A 1KKCA 1XUQA 1HK4A 2XW0A 4ZUXV 2ROHA 1IJGA 1O9XA 4ZC6A 4JZGA 1MSDA 2BXIA 2LXTA 2QHBA 2XW1A 2DBUA 1AR5A 1B06A 2BXNA 2LQIA 2CE4A 1JXTA 3M99C 4DM0A 4HGMB 4N0FD 4DHXB 5B5TA 3TDLA 2DBWA 3FWCC 2BXQA 3UIVA 3DC6A 1PM9A 3LU8A 3SIVB 5GIOA 1J78A 2DG5A 1E7GA 1EJGA 1MM8A 5IJFA 2BXAA 3MHSB 4F5UA 1JXUA 1H5WA 4FIPB 3WHSA 5ID7A 3RN4A 3SQJA 2K0NA 1I0HA 3H3AA 1KDXA 2LQHA 3BPJA 1BM0A 1MA9A 1AO6A 1CXRA 2EFEA 3WHRA 5A9GA 5GHKA 1LNSA 1MNGA 3C8PA 4G03A 1Y67A 1IDSA 4N3ZA 3U7TA 1KW2A 1LUWA 4YIOA 4OT2A 3FWBC 1CBNA 2P4KA 1AP5A 1N0JA 2I30A 4I9OA 2VUFA 4BKEA 2QKCA 2BXKA 3QVNA 5DBYA 1HK5A 1CNRA 5IFOA 4BY9C 3NMUA 2PLHA 4K2CA 3NVKA 2XVVA 3W1SA 3G9KD 1BJ5A 1BKEA 4JYYA 5IIHA 4F6EA 2QM6A 2EFDA 1E7CA 3LU6A 4L9KA 2KWFA 4IW1A 1MUHA 2VDBA 1AR4A 1E7AA 2BXLA 3DC5A 1GN2A 4LUHA 2JUHA 3CEIA 5GIPA 4NAWB 1TXUA 1OKHA 1HK2A 3JQZA 4FK5B 3LSUA 1ZLZA 1J7EA 4LB9A 4M70B 3AK2A 1JMPA 1MA1A 3GQUA 4FFKA 2QKAA 3FNMA 2BXEA 1BS3A 4FJCB 2AGHB 1BHPA 4JZ2A 1HK1A 1ZUQA 2XVUA 2XMOA 4GDKB 2ADPA 4ZBRA 3C3TA 2FD7A 1E78A 1D5NA 1EN4A 4X9QA 1ORLA 1E7BA 1P7GA 1JR9A 2BXMA 1JMNA 1NBLA 2BXGA 2CDYA 1QNMA 1TF0A 4G01A 3KDRA 3CX9A 1LOTA 1FOUA 4JK4A 1BSMA 5D7GA 2Z8IA 3C3SA 3TJTA 1NT2B 2E0YA 2BXFA 4LA0A 2AJEA 1YV8A 4BR6A 2EYCA 4ZCGA 2OT3A 1E7HA 4ZBKA 1PL4A 1E7FA 2RCVA 5FUOA 1WB8A 4EMXA 1CRNA 1N0NA 3MHHB 1ED0A 2LOQA 4K71A 1VZSA 2V9BA 2DYMA 4GDLB 4MBEC 2VUEA 3OT7A 1EN6A 3H37A 1KXPD 3KJLA 1XREA
chains in the Genus database with same CATH topology
3VQIA 3NVIA 1E7GA 1J7EA 1MIYA 4LB9A 5IJFA 4GDXA 4OTTA 4M70B 2BXAA 4OR0A 2XVQA 1HA2A 2Z8KA 3MHSB 1H5WA 4N0UD 4FIPB 4F5UA 1E7EA 5HOZA 2BXPA 3GQUA 3WHSA 3KIKA 2OZBB 3B9MA 4Z9OA 5ID7A 2DYOA 4OTUA 3WHQA 2Z8JA 3FNMA 2BXEA 3GQXA 3SQJA 3PLAA 3SIUB 5ID9A 3JRYA 4FJCB 5IIUA 3H3AA 1VFIA 2E0XA 2NQOA 5IJEA 2EFCA 1HK1A 1BM0A 1UORA 4GG2A 1MA9A 2XVUA 3NVMA 1AO6A 2XMOA 2BXBA 4GDKB 1GNIA 2BX8A 2XVWA 4WA6B 2DBXA 2EFEA 4ZBRA 3WHRA 5GHKA 1LNSA 4Z69A 2CKXA 2XSIA 4L8UA 1N5UA 1MIVA 4C31B 2BXDA 3GA9L 4G03A 4F5TA 4N3ZA 4G04A 1KW2A 2EFHA 1E78A 4OT2A 3FWBC 2BXCA 3B9LA 5IJ5A 4J2VA 4L9QA 1E7BA 3LU7A 4E99A 4F5VA 2I30A 2BXMA 4LB2A 2KBZA 2BXGA 5IIXA 2VUFA 4BKEA 2BXKA 3V08A 5GINA 1TF0A 4G01A 5DBYA 3ICXA 1GNJA 1HK5A 2BXOA 3CX9A 1LOTA 3V09A 5IFOA 1FOUA 4JK4A 4S1YA 4BY9C 1E7IA 5D7GA 3NMUA 2Z8IA 1H9ZA 4F5SA 3A75A 4LUFA 5BPKA 1NT2B 2E0YA 3V03A 4K2CA 2BXFA 3NVKA 1HK4A 2XW0A 4LA0A 4ZUXV 2ROHA 2YDFA 1IJGA 1O9XA 2BXHA 2XVVA 2AJEA 3W1SA 3G9KD 4TQ0A 1BJ5A 5DQFA 4ZC6A 1BKEA 2NNWA 4ZCGA 2BXIA 2V36A 5IIHA 2QHBA 2XW1A 2DBUA 3A73A 2OT3A 4IW2A 1E7HA 4ZBKA 2BXNA 2QM6A 1HK3A 1E7FA 2EFDA 1E7CA 5FUOA 3LU6A 4L9KA 4EMXA 2QMCA 3MHHB 3M99C 2LOQA 4IW1A 4K71A 2VDBA 4HGMB 4N0FD 4PO0A 1VZSA 1E7AA 4DHXB 5B5TA 2DYMA 1MIWA 3TDLA 4GDLB 4TQ1A 2DBWA 2BXLA 3FWCC 2BXQA 2VUEA 4MBEC 4LUHA 3UIVA 2I2ZA 2JUHA 4W4UB 5GIPA 3H37A 4NAWB 4ZBQA 1TXUA 1KXPD 3KJLA 3LU8A 4HGKA 3SIVB 1HK2A 1JNBA 5GIOA 1J78A 3JQZA 2DG5A 4FK5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNB A;  1IJG A;  1FOU A;  1H5W A; 
#chains in the Genus database with same CATH topology
 1VEW A;  4GDX A;  2OZB B;  1E7E A;  2BXP A;  1AB1 A;  3KIK A;  3B9M A;  2DYO A;  1LUV A;  3WHQ A;  2Z8J A;  3PLA A;  3GQX A;  3SIU B;  3SZS A;  5ID9 A;  3JRY A;  2E0X A;  2NQO A;  2EFC A;  2EYB A;  4GG2 A;  3NVM A;  2BXB A;  1GNI A;  4YIP A;  4FC1 A;  3AK3 A;  1N5U A;  2FD9 A;  1MIV A;  3GA9 L;  4G04 A;  2GDS A;  1JXY A;  3B9L A;  5IJ5 A;  1JA8 A;  4J2V A;  4L9Q A;  3LU7 A;  2EYD A;  4F5V A;  4LB2 A;  2KBZ A;  1GNJ A;  2BXO A;  3V09 A;  1E7I A;  3A75 A;  4LUF A;  1IXB A;  3UE7 B;  3KKY A;  2YDF A;  2BXH A;  4TQ0 A;  1GN6 A;  5DQF A;  1MUS A;  1VAR A;  2NNW A;  3BFR A;  2V36 A;  5AG2 A;  3NIR A;  3A73 A;  4IW2 A;  4C7U A;  1XDC A;  1BT8 A;  1HK3 A;  3ECP A;  4GUN A;  2QMC A;  2GUT A;  4PO0 A;  1XIL A;  1MIW A;  4TQ1 A;  1SZX A;  2I2Z A;  4W4U B;  4ZBQ A;  4HGK A;  1AVM A;  3AK1 A;  1JNB A;  1SB0 A;  1GN3 A;  4D7X A;  1JXX A;  3VQI A;  1AP6 A;  3NVI A;  1WB7 A;  1MIY A;  1IX9 A;  4OTT A;  1I08 A;  3EVK A;  4OR0 A;  2XVQ A;  1HA2 A;  2Z8K A;  4N0U D;  1GN4 A;  5HOZ A;  2LXS A;  4Z9O A;  1EM1 A;  1JXW A;  2EYA A;  4OTU A;  1CCN A;  3K9S A;  1ZTE A;  2AW9 A;  5IIU A;  1VFI A;  1YVA A;  5IJE A;  1UOR A;  2BX8 A;  2XVW A;  4WA6 B;  2ADQ B;  2DBX A;  4Z69 A;  2CKX A;  2XSI A;  4L8U A;  1CCM A;  4C31 B;  2BXD A;  4F5T A;  1WUW A;  2EFH A;  2BXC A;  4E99 A;  5IIX A;  3MDS A;  3V08 A;  5GIN A;  1ZSP A;  1MMM A;  3ICX A;  4S1Y A;  4F5S A;  1H9Z A;  5BPK A;  1EN5 A;  4E4E A;  3V03 A;  1KKC A;  1XUQ A;  1HK4 A;  2XW0 A;  4ZUX V;  2ROH A;  1IJG A;  1O9X A;  4ZC6 A;  4JZG A;  1MSD A;  2BXI A;  2LXT A;  2QHB A;  2XW1 A;  2DBU A;  1AR5 A;  1B06 A;  2BXN A;  2LQI A;  2CE4 A;  1JXT A;  3M99 C;  4DM0 A;  4HGM B;  4N0F D;  4DHX B;  5B5T A;  3TDL A;  2DBW A;  3FWC C;  2BXQ A;  3UIV A;  3DC6 A;  1PM9 A;  3LU8 A;  3SIV B;  5GIO A;  1J78 A;  2DG5 A;  1E7G A;  1EJG A;  1MM8 A;  5IJF A;  2BXA A;  3MHS B;  4F5U A;  1JXU A;  1H5W A;  4FIP B;  3WHS A;  5ID7 A;  3RN4 A;  3SQJ A;  2K0N A;  1I0H A;  3H3A A;  1KDX A;  2LQH A;  3BPJ A;  1BM0 A;  1MA9 A;  1AO6 A;  1CXR A;  2EFE A;  3WHR A;  5A9G A;  5GHK A;  1LNS A;  1MNG A;  3C8P A;  4G03 A;  1Y67 A;  1IDS A;  4N3Z A;  3U7T A;  1KW2 A;  1LUW A;  4YIO A;  4OT2 A;  3FWB C;  1CBN A;  2P4K A;  1AP5 A;  1N0J A;  2I30 A;  4I9O A;  2VUF A;  4BKE A;  2QKC A;  2BXK A;  3QVN A;  5DBY A;  1HK5 A;  1CNR A;  5IFO A;  4BY9 C;  3NMU A;  2PLH A;  4K2C A;  3NVK A;  2XVV A;  3W1S A;  3G9K D;  1BJ5 A;  1BKE A;  4JYY A;  5IIH A;  4F6E A;  2QM6 A;  2EFD A;  1E7C A;  3LU6 A;  4L9K A;  2KWF A;  4IW1 A;  1MUH A;  2VDB A;  1AR4 A;  1E7A A;  2BXL A;  3DC5 A;  1GN2 A;  4LUH A;  2JUH A;  3CEI A;  5GIP A;  4NAW B;  1TXU A;  1OKH A;  1HK2 A;  3JQZ A;  4FK5 B;  3LSU A;  1ZLZ A;  1J7E A;  4LB9 A;  4M70 B;  3AK2 A;  1JMP A;  1MA1 A;  3GQU A;  4FFK A;  2QKA A;  3FNM A;  2BXE A;  1BS3 A;  4FJC B;  2AGH B;  1BHP A;  4JZ2 A;  1HK1 A;  1ZUQ A;  2XVU A;  2XMO A;  4GDK B;  2ADP A;  4ZBR A;  3C3T A;  2FD7 A;  1E78 A;  1D5N A;  1EN4 A;  4X9Q A;  1ORL A;  1E7B A;  1P7G A;  1JR9 A;  2BXM A;  1JMN A;  1NBL A;  2BXG A;  2CDY A;  1QNM A;  1TF0 A;  4G01 A;  3KDR A;  3CX9 A;  1LOT A;  1FOU A;  4JK4 A;  1BSM A;  5D7G A;  2Z8I A;  3C3S A;  3TJT A;  1NT2 B;  2E0Y A;  2BXF A;  4LA0 A;  2AJE A;  1YV8 A;  4BR6 A;  2EYC A;  4ZCG A;  2OT3 A;  1E7H A;  4ZBK A;  1PL4 A;  1E7F A;  2RCV A;  5FUO A;  1WB8 A;  4EMX A;  1CRN A;  1N0N A;  3MHH B;  1ED0 A;  2LOQ A;  4K71 A;  1VZS A;  2V9B A;  2DYM A;  4GDL B;  4MBE C;  2VUE A;  3OT7 A;  1EN6 A;  3H37 A;  1KXP D;  3KJL A;  1XRE A; 
#chains in the Genus database with same CATH homology
 3VQI A;  3NVI A;  1E7G A;  1J7E A;  1MIY A;  4LB9 A;  5IJF A;  4GDX A;  4OTT A;  4M70 B;  2BXA A;  4OR0 A;  2XVQ A;  1HA2 A;  2Z8K A;  3MHS B;  1H5W A;  4N0U D;  4FIP B;  4F5U A;  1E7E A;  5HOZ A;  2BXP A;  3GQU A;  3WHS A;  3KIK A;  2OZB B;  3B9M A;  4Z9O A;  5ID7 A;  2DYO A;  4OTU A;  3WHQ A;  2Z8J A;  3FNM A;  2BXE A;  3GQX A;  3SQJ A;  3PLA A;  3SIU B;  5ID9 A;  3JRY A;  4FJC B;  5IIU A;  3H3A A;  1VFI A;  2E0X A;  2NQO A;  5IJE A;  2EFC A;  1HK1 A;  1BM0 A;  1UOR A;  4GG2 A;  1MA9 A;  2XVU A;  3NVM A;  1AO6 A;  2XMO A;  2BXB A;  4GDK B;  1GNI A;  2BX8 A;  2XVW A;  4WA6 B;  2DBX A;  2EFE A;  4ZBR A;  3WHR A;  5GHK A;  1LNS A;  4Z69 A;  2CKX A;  2XSI A;  4L8U A;  1N5U A;  1MIV A;  4C31 B;  2BXD A;  3GA9 L;  4G03 A;  4F5T A;  4N3Z A;  4G04 A;  1KW2 A;  2EFH A;  1E78 A;  4OT2 A;  3FWB C;  2BXC A;  3B9L A;  5IJ5 A;  4J2V A;  4L9Q A;  1E7B A;  3LU7 A;  4E99 A;  4F5V A;  2I30 A;  2BXM A;  4LB2 A;  2KBZ A;  2BXG A;  5IIX A;  2VUF A;  4BKE A;  2BXK A;  3V08 A;  5GIN A;  1TF0 A;  4G01 A;  5DBY A;  3ICX A;  1GNJ A;  1HK5 A;  2BXO A;  3CX9 A;  1LOT A;  3V09 A;  5IFO A;  1FOU A;  4JK4 A;  4S1Y A;  4BY9 C;  1E7I A;  5D7G A;  3NMU A;  2Z8I A;  1H9Z A;  4F5S A;  3A75 A;  4LUF A;  5BPK A;  1NT2 B;  2E0Y A;  3V03 A;  4K2C A;  2BXF A;  3NVK A;  1HK4 A;  2XW0 A;  4LA0 A;  4ZUX V;  2ROH A;  2YDF A;  1IJG A;  1O9X A;  2BXH A;  2XVV A;  2AJE A;  3W1S A;  3G9K D;  4TQ0 A;  1BJ5 A;  5DQF A;  4ZC6 A;  1BKE A;  2NNW A;  4ZCG A;  2BXI A;  2V36 A;  5IIH A;  2QHB A;  2XW1 A;  2DBU A;  3A73 A;  2OT3 A;  4IW2 A;  1E7H A;  4ZBK A;  2BXN A;  2QM6 A;  1HK3 A;  1E7F A;  2EFD A;  1E7C A;  5FUO A;  3LU6 A;  4L9K A;  4EMX A;  2QMC A;  3MHH B;  3M99 C;  2LOQ A;  4IW1 A;  4K71 A;  2VDB A;  4HGM B;  4N0F D;  4PO0 A;  1VZS A;  1E7A A;  4DHX B;  5B5T A;  2DYM A;  1MIW A;  3TDL A;  4GDL B;  4TQ1 A;  2DBW A;  2BXL A;  3FWC C;  2BXQ A;  2VUE A;  4MBE C;  4LUH A;  3UIV A;  2I2Z A;  2JUH A;  4W4U B;  5GIP A;  3H37 A;  4NAW B;  4ZBQ A;  1TXU A;  1KXP D;  3KJL A;  3LU8 A;  4HGK A;  3SIV B;  1HK2 A;  1JNB A;  5GIO A;  1J78 A;  3JQZ A;  2DG5 A;  4FK5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...