1H5WA

2.1a bacteriophage phi-29 connector
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
268
structure length
249
Chain Sequence
RQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNYRDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFLGIKNSNDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords UPPER COLLAR PROTEIN
publication title Detailed Architecture of a DNA Translocating Machine: The High-Resolution Structure of the Bacteriophage Phi29 Connector Particle.
pubmed doi rcsb
source organism Bacteriophage phi-29
total genus 69
structure length 249
sequence length 268
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05352 Phage_connector Phage Connector (GP10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.30 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1h5wA01
2.40.500.10 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) 1h5wA02
3.30.1350.20 Alpha Beta 2-Layer Sandwich Crambin Bacteriophage PHI-29 conector. Domain 3 1h5wA03
1H5WA 1FOUA 1IJGA 1JNBA
chains in the Genus database with same CATH superfamily
1E7HA 5BPKA 1GNJA 3OT7A 1AR5A 2Z8KA 4NAWB 2BXAA 1GN4A 1NBLA 2V9BA 2BXDA 1GN2A 4X9QA 3NIRA 2VUEA 5FUOA 5GIPA 3GQXA 1BT8A 3NVKA 1B06A 2PLHA 4Z9OA 1IJGA 3H37A 4JZGA 3NVIA 5IJ5A 2YDFA 1LUVA 2BXNA 4ZBRA 1I08A 2CE4A 1CCMA 3SIUB 3V08A 4GDLB 4OR0A 1KDXA 2QKAA 4D7XA 2VDBA 1UORA 1E7EA 4F5VA 1XDCA 1HA2A 1LUWA 2BXLA 3ICXA 4F6EA 4C7UA 2EFEA 4YIOA 1MUHA 4L9KA 2GUTA 3BFRA 2AW9A 1E7FA 1LOTA 2DBXA 1ZUQA 2BXOA 2K0NA 4N0UD 4Z69A 3JQZA 4OTUA 3GQUA 3ECPA 1N0NA 3PLAA 2XVWA 1LNSA 1AVMA 4J2VA 1PL4A 1AO6A 4E4EA 2DBWA 3B9MA 1MUSA 4F5UA 5GINA 1GNIA 1P7GA 1GN3A 3WHSA 2EYCA 1O9XA 2XVVA 1J7EA 1ZTEA 4LUFA 3FWCC 4I9OA 3DC5A 1JMNA 2AJEA 1JA8A 2EFHA 2BXGA 5IFOA 1IXBA 2ADPA 2NQOA 3VQIA 1JXWA 4WA6B 2RCVA 4FK5B 3AK3A 2ADQB 1JXUA 3KIKA 1SB0A 4W4UB 1AP6A 2EYDA 4TQ1A 2EYBA 3U7TA 1XREA 5GIOA 3QVNA 4JYYA 2I2ZA 1CNRA 3SIVB 1HK1A 2JUHA 3CEIA 3SQJA 4TQ0A 1JXTA 2BXEA 2E0XA 4K71A 2DYOA 3KKYA 4BR6A 1BS3A 1EN4A 3K9SA 3BPJA 3C3SA 1EN5A 5IIUA 5DQFA 3FNMA 1AR4A 4E99A 1VARA 3NMUA 3LU7A 1HK2A 2LOQA 4BY9C 1OKHA 3DC6A 1EJGA 1KW2A 1MA9A 2DYMA 3MHSB 1AB1A 3A75A 1MM8A 1HK4A 2VUFA 2P4KA 2LXSA 2ROHA 4LB2A 1PM9A 2XSIA 2BXIA 3G9KD 2EYAA 2QHBA 4GUNA 3LU6A 1SZXA 2BXHA 4HGMB 4EMXA 4IW1A 4ZC6A 4OT2A 4PO0A 2FD7A 2KWFA 4LA0A 4HGKA 3MDSA 3AK2A 1VFIA 1MA1A 2AGHB 1E7CA 1JR9A 4FC1A 2I30A 2DG5A 2QM6A 1D5NA 1TXUA 1FOUA 1N5UA 3JRYA 1CCNA 1IDSA 1IX9A 1E7BA 1ED0A 2XW1A 2BX8A 4ZBKA 5IIHA 5IJEA 1KKCA 2CDYA 3V09A 3CX9A 1QNMA 3TDLA 1J78A 2LQIA 3C8PA 2BXQA 4FIPB 4K2CA 1ZLZA 3A73A 2OT3A 3B9LA 1ZSPA 2FD9A 2E0YA 1E7AA 5GHKA 1AP5A 3FWBC 2XVUA 4G03A 3GA9L 4L8UA 4YIPA 3KJLA 5HOZA 3WHQA 4DM0A 4DHXB 1HK5A 1Y67A 1VEWA 3UIVA 1BKEA 1BSMA 4JK4A 4N0FD 5AG2A 2KBZA 1MIWA 2BXMA 3M99C 1H9ZA 1MSDA 1BM0A 4G01A 3MHHB 1KXPD 3AK1A 1XILA 2QMCA 1MIVA 2BXPA 4GDXA 4JZ2A 1CBNA 4GDKB 1WB7A 3KDRA 1JMPA 4BKEA 2EFDA 3RN4A 4FFKA 2BXFA 2XW0A 4ZUXV 2BXCA 3LU8A 1I0HA 4S1YA 1JXXA 4MBEC 1EM1A 2CKXA 2Z8IA 4LB9A 1TF0A 1EN6A 5ID7A 1BJ5A 1CRNA 2DBUA 1YVAA 2EFCA 3SZSA 2BXKA 4C31B 3UE7B 3TJTA 2QKCA 4G04A 1XUQA 4ZCGA 1MIYA 4LUHA 1WB8A 3W1SA 2NNWA 1ORLA 2BXBA 5ID9A 1N0JA 4L9QA 1E7IA 4M70B 1JXYA 3NVMA 3V03A 4GG2A 2Z8JA 1GN6A 1H5WA 2OZBB 4IW2A 4ZBQA 1E78A 2LQHA 5IIXA 1NT2B 4F5TA 5D7GA 1VZSA 3H3AA 5DBYA 2LXTA 1BHPA 1HK3A 2XVQA 5IJFA 2GDSA 4OTTA 3EVKA 1WUWA 4F5SA 3LSUA 3WHRA 1E7GA 3C3TA 5A9GA 2V36A 1CXRA 1JNBA 4FJCB 4N3ZA 5B5TA 1YV8A 1MNGA 2XMOA 1MMMA
chains in the Genus database with same CATH topology
2XSIA 1E7HA 2BXIA 5BPKA 3G9KD 4F5UA 5GINA 1GNJA 2QHBA 1GNIA 2QMCA 1MIVA 3LU6A 2BXHA 4HGMB 2BXPA 4GDXA 3WHSA 4EMXA 2Z8KA 1O9XA 4IW1A 4GDKB 4NAWB 2BXAA 4ZC6A 2XVVA 4OT2A 1J7EA 4BKEA 2EFDA 2BXDA 2BXFA 2XW0A 4PO0A 2VUEA 4LUFA 4ZUXV 2BXCA 3FWCC 3LU8A 4LA0A 4HGKA 5FUOA 5GIPA 3GQXA 4S1YA 3NVKA 2AJEA 4MBEC 2EFHA 1VFIA 2CKXA 2Z8IA 2BXGA 4LB9A 5IFOA 1TF0A 2NQOA 1E7CA 3VQIA 5ID7A 1BJ5A 4WA6B 4Z9OA 1IJGA 2DG5A 2DBUA 2I30A 2QM6A 4FK5B 3H37A 2EFCA 2BXKA 3KIKA 4C31B 1TXUA 3NVIA 1FOUA 1N5UA 3JRYA 4W4UB 5IJ5A 1E7BA 2YDFA 4G04A 4TQ1A 2XW1A 2BX8A 2BXNA 4ZBRA 4ZCGA 4ZBKA 5GIOA 5IIHA 5IJEA 1MIYA 4LUHA 3SIUB 3V09A 3V08A 2I2ZA 3CX9A 4GDLB 4OR0A 3W1SA 3TDLA 2NNWA 2BXBA 1J78A 2VDBA 3SIVB 1HK1A 2BXQA 2JUHA 1UORA 4FIPB 4K2CA 1E7EA 3SQJA 5ID9A 4TQ0A 4L9QA 4F5VA 2BXEA 3A73A 2E0XA 1HA2A 4K71A 2OT3A 3B9LA 2BXLA 2DYOA 2E0YA 1E7AA 1E7IA 3ICXA 4M70B 5GHKA 3FWBC 2EFEA 3NVMA 2XVUA 4G03A 3V03A 4L9KA 4GG2A 5IIUA 2Z8JA 3GA9L 4L8UA 5DQFA 3FNMA 1H5WA 4E99A 2OZBB 1E7FA 4IW2A 4ZBQA 1E78A 3KJLA 1LOTA 2DBXA 2BXOA 5IIXA 5HOZA 3WHQA 3NMUA 1NT2B 4F5TA 4N0UD 5D7GA 1VZSA 3H3AA 5DBYA 3LU7A 4Z69A 4DHXB 1HK2A 1HK5A 2LOQA 1BKEA 3UIVA 1HK3A 3JQZA 4BY9C 4OTUA 3GQUA 4JK4A 4N0FD 2XVQA 5IJFA 2KBZA 4OTTA 4F5SA 1KW2A 1MA9A 2DYMA 3MHSB 3PLAA 3WHRA 1MIWA 1E7GA 2XVWA 2BXMA 3A75A 3M99C 1H9ZA 1HK4A 1LNSA 2V36A 2VUFA 1BM0A 1JNBA 4FJCB 4J2VA 4N3ZA 5B5TA 1AO6A 2DBWA 2ROHA 3B9MA 4LB2A 4G01A 2XMOA 3MHHB 1KXPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5W A;  1FOU A;  1IJG A;  1JNB A; 
#chains in the Genus database with same CATH topology
 1E7H A;  5BPK A;  1GNJ A;  3OT7 A;  1AR5 A;  2Z8K A;  4NAW B;  2BXA A;  1GN4 A;  1NBL A;  2V9B A;  2BXD A;  1GN2 A;  4X9Q A;  3NIR A;  2VUE A;  5FUO A;  5GIP A;  3GQX A;  1BT8 A;  3NVK A;  1B06 A;  2PLH A;  4Z9O A;  1IJG A;  3H37 A;  4JZG A;  3NVI A;  5IJ5 A;  2YDF A;  1LUV A;  2BXN A;  4ZBR A;  1I08 A;  2CE4 A;  1CCM A;  3SIU B;  3V08 A;  4GDL B;  4OR0 A;  1KDX A;  2QKA A;  4D7X A;  2VDB A;  1UOR A;  1E7E A;  4F5V A;  1XDC A;  1HA2 A;  1LUW A;  2BXL A;  3ICX A;  4F6E A;  4C7U A;  2EFE A;  4YIO A;  1MUH A;  4L9K A;  2GUT A;  3BFR A;  2AW9 A;  1E7F A;  1LOT A;  2DBX A;  1ZUQ A;  2BXO A;  2K0N A;  4N0U D;  4Z69 A;  3JQZ A;  4OTU A;  3GQU A;  3ECP A;  1N0N A;  3PLA A;  2XVW A;  1LNS A;  1AVM A;  4J2V A;  1PL4 A;  1AO6 A;  4E4E A;  2DBW A;  3B9M A;  1MUS A;  4F5U A;  5GIN A;  1GNI A;  1P7G A;  1GN3 A;  3WHS A;  2EYC A;  1O9X A;  2XVV A;  1J7E A;  1ZTE A;  4LUF A;  3FWC C;  4I9O A;  3DC5 A;  1JMN A;  2AJE A;  1JA8 A;  2EFH A;  2BXG A;  5IFO A;  1IXB A;  2ADP A;  2NQO A;  3VQI A;  1JXW A;  4WA6 B;  2RCV A;  4FK5 B;  3AK3 A;  2ADQ B;  1JXU A;  3KIK A;  1SB0 A;  4W4U B;  1AP6 A;  2EYD A;  4TQ1 A;  2EYB A;  3U7T A;  1XRE A;  5GIO A;  3QVN A;  4JYY A;  2I2Z A;  1CNR A;  3SIV B;  1HK1 A;  2JUH A;  3CEI A;  3SQJ A;  4TQ0 A;  1JXT A;  2BXE A;  2E0X A;  4K71 A;  2DYO A;  3KKY A;  4BR6 A;  1BS3 A;  1EN4 A;  3K9S A;  3BPJ A;  3C3S A;  1EN5 A;  5IIU A;  5DQF A;  3FNM A;  1AR4 A;  4E99 A;  1VAR A;  3NMU A;  3LU7 A;  1HK2 A;  2LOQ A;  4BY9 C;  1OKH A;  3DC6 A;  1EJG A;  1KW2 A;  1MA9 A;  2DYM A;  3MHS B;  1AB1 A;  3A75 A;  1MM8 A;  1HK4 A;  2VUF A;  2P4K A;  2LXS A;  2ROH A;  4LB2 A;  1PM9 A;  2XSI A;  2BXI A;  3G9K D;  2EYA A;  2QHB A;  4GUN A;  3LU6 A;  1SZX A;  2BXH A;  4HGM B;  4EMX A;  4IW1 A;  4ZC6 A;  4OT2 A;  4PO0 A;  2FD7 A;  2KWF A;  4LA0 A;  4HGK A;  3MDS A;  3AK2 A;  1VFI A;  1MA1 A;  2AGH B;  1E7C A;  1JR9 A;  4FC1 A;  2I30 A;  2DG5 A;  2QM6 A;  1D5N A;  1TXU A;  1FOU A;  1N5U A;  3JRY A;  1CCN A;  1IDS A;  1IX9 A;  1E7B A;  1ED0 A;  2XW1 A;  2BX8 A;  4ZBK A;  5IIH A;  5IJE A;  1KKC A;  2CDY A;  3V09 A;  3CX9 A;  1QNM A;  3TDL A;  1J78 A;  2LQI A;  3C8P A;  2BXQ A;  4FIP B;  4K2C A;  1ZLZ A;  3A73 A;  2OT3 A;  3B9L A;  1ZSP A;  2FD9 A;  2E0Y A;  1E7A A;  5GHK A;  1AP5 A;  3FWB C;  2XVU A;  4G03 A;  3GA9 L;  4L8U A;  4YIP A;  3KJL A;  5HOZ A;  3WHQ A;  4DM0 A;  4DHX B;  1HK5 A;  1Y67 A;  1VEW A;  3UIV A;  1BKE A;  1BSM A;  4JK4 A;  4N0F D;  5AG2 A;  2KBZ A;  1MIW A;  2BXM A;  3M99 C;  1H9Z A;  1MSD A;  1BM0 A;  4G01 A;  3MHH B;  1KXP D;  3AK1 A;  1XIL A;  2QMC A;  1MIV A;  2BXP A;  4GDX A;  4JZ2 A;  1CBN A;  4GDK B;  1WB7 A;  3KDR A;  1JMP A;  4BKE A;  2EFD A;  3RN4 A;  4FFK A;  2BXF A;  2XW0 A;  4ZUX V;  2BXC A;  3LU8 A;  1I0H A;  4S1Y A;  1JXX A;  4MBE C;  1EM1 A;  2CKX A;  2Z8I A;  4LB9 A;  1TF0 A;  1EN6 A;  5ID7 A;  1BJ5 A;  1CRN A;  2DBU A;  1YVA A;  2EFC A;  3SZS A;  2BXK A;  4C31 B;  3UE7 B;  3TJT A;  2QKC A;  4G04 A;  1XUQ A;  4ZCG A;  1MIY A;  4LUH A;  1WB8 A;  3W1S A;  2NNW A;  1ORL A;  2BXB A;  5ID9 A;  1N0J A;  4L9Q A;  1E7I A;  4M70 B;  1JXY A;  3NVM A;  3V03 A;  4GG2 A;  2Z8J A;  1GN6 A;  1H5W A;  2OZB B;  4IW2 A;  4ZBQ A;  1E78 A;  2LQH A;  5IIX A;  1NT2 B;  4F5T A;  5D7G A;  1VZS A;  3H3A A;  5DBY A;  2LXT A;  1BHP A;  1HK3 A;  2XVQ A;  5IJF A;  2GDS A;  4OTT A;  3EVK A;  1WUW A;  4F5S A;  3LSU A;  3WHR A;  1E7G A;  3C3T A;  5A9G A;  2V36 A;  1CXR A;  1JNB A;  4FJC B;  4N3Z A;  5B5T A;  1YV8 A;  1MNG A;  2XMO A;  1MMM A; 
#chains in the Genus database with same CATH homology
 2XSI A;  1E7H A;  2BXI A;  5BPK A;  3G9K D;  4F5U A;  5GIN A;  1GNJ A;  2QHB A;  1GNI A;  2QMC A;  1MIV A;  3LU6 A;  2BXH A;  4HGM B;  2BXP A;  4GDX A;  3WHS A;  4EMX A;  2Z8K A;  1O9X A;  4IW1 A;  4GDK B;  4NAW B;  2BXA A;  4ZC6 A;  2XVV A;  4OT2 A;  1J7E A;  4BKE A;  2EFD A;  2BXD A;  2BXF A;  2XW0 A;  4PO0 A;  2VUE A;  4LUF A;  4ZUX V;  2BXC A;  3FWC C;  3LU8 A;  4LA0 A;  4HGK A;  5FUO A;  5GIP A;  3GQX A;  4S1Y A;  3NVK A;  2AJE A;  4MBE C;  2EFH A;  1VFI A;  2CKX A;  2Z8I A;  2BXG A;  4LB9 A;  5IFO A;  1TF0 A;  2NQO A;  1E7C A;  3VQI A;  5ID7 A;  1BJ5 A;  4WA6 B;  4Z9O A;  1IJG A;  2DG5 A;  2DBU A;  2I30 A;  2QM6 A;  4FK5 B;  3H37 A;  2EFC A;  2BXK A;  3KIK A;  4C31 B;  1TXU A;  3NVI A;  1FOU A;  1N5U A;  3JRY A;  4W4U B;  5IJ5 A;  1E7B A;  2YDF A;  4G04 A;  4TQ1 A;  2XW1 A;  2BX8 A;  2BXN A;  4ZBR A;  4ZCG A;  4ZBK A;  5GIO A;  5IIH A;  5IJE A;  1MIY A;  4LUH A;  3SIU B;  3V09 A;  3V08 A;  2I2Z A;  3CX9 A;  4GDL B;  4OR0 A;  3W1S A;  3TDL A;  2NNW A;  2BXB A;  1J78 A;  2VDB A;  3SIV B;  1HK1 A;  2BXQ A;  2JUH A;  1UOR A;  4FIP B;  4K2C A;  1E7E A;  3SQJ A;  5ID9 A;  4TQ0 A;  4L9Q A;  4F5V A;  2BXE A;  3A73 A;  2E0X A;  1HA2 A;  4K71 A;  2OT3 A;  3B9L A;  2BXL A;  2DYO A;  2E0Y A;  1E7A A;  1E7I A;  3ICX A;  4M70 B;  5GHK A;  3FWB C;  2EFE A;  3NVM A;  2XVU A;  4G03 A;  3V03 A;  4L9K A;  4GG2 A;  5IIU A;  2Z8J A;  3GA9 L;  4L8U A;  5DQF A;  3FNM A;  1H5W A;  4E99 A;  2OZB B;  1E7F A;  4IW2 A;  4ZBQ A;  1E78 A;  3KJL A;  1LOT A;  2DBX A;  2BXO A;  5IIX A;  5HOZ A;  3WHQ A;  3NMU A;  1NT2 B;  4F5T A;  4N0U D;  5D7G A;  1VZS A;  3H3A A;  5DBY A;  3LU7 A;  4Z69 A;  4DHX B;  1HK2 A;  1HK5 A;  2LOQ A;  1BKE A;  3UIV A;  1HK3 A;  3JQZ A;  4BY9 C;  4OTU A;  3GQU A;  4JK4 A;  4N0F D;  2XVQ A;  5IJF A;  2KBZ A;  4OTT A;  4F5S A;  1KW2 A;  1MA9 A;  2DYM A;  3MHS B;  3PLA A;  3WHR A;  1MIW A;  1E7G A;  2XVW A;  2BXM A;  3A75 A;  3M99 C;  1H9Z A;  1HK4 A;  1LNS A;  2V36 A;  2VUF A;  1BM0 A;  1JNB A;  4FJC B;  4J2V A;  4N3Z A;  5B5T A;  1AO6 A;  2DBW A;  2ROH A;  3B9M A;  4LB2 A;  4G01 A;  2XMO A;  3MHH B;  1KXP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...