3VQIA

Crystal structure of kluyveromyces marxianus atg5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
252
Chain Sequence
MEELRERVWNGTINVEVVVSDAIVVPNTTLADKSCHIVMLRDAYLGFYLPTVVRKLADTIKVPYESDYRNWWFEYNGEGVPWEYPCGVLFDLLNKQMWELQLCHGDKYPRGILPLVDGHSQIKDYWRHQWKQACFILNGSAKRIMSLSIPDFENFWVSILSRNRSDFMAVRSKLFSMNKAKSLPVRVWTSNYAVLQPTVPVTLSVAELLDSIKLSSVKSVIIQGIDVSIEDNIFELYDIFASIDGFLYLVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Atg5
publication title Structural insights into atg10-mediated formation of the autophagy-essential atg12-atg5 conjugate
pubmed doi rcsb
source organism Kluyveromyces marxianus
total genus 76
structure length 252
sequence length 271
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3vqiA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vqiA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vqiA01
2KQ7A 3EFUA 3L0WB 1WF9A 2BYVE 2AYOB 3DPDA 4CHKA 4EZJA 2NCNA 5CTRC 5J18A 3B08A 3PHWB 4ANXA 3VUWA 2FIDA 3L17A 3ZTCA 4F1SA 2IYDB 2IO2B 2KANA 3ZUNA 1E8ZA 1C3TA 2M0XA 4FJYA 3KUZA 2O2VA 1E5WA 3APFA 4DBGA 4HDQA 1ZGUB 4KSKC 5J2RA 2DX5B 3IVFA 3V6EB 2DHZA 1R4MI 3X0WA 5L83A 2KJHB 1ZW7A 3AULA 2IO3B 5D6JB 2NPTA 3PRZA 4KV2A 4WWNA 4RM9A 2KDBA 2KLGA 2MP2A 1VCBA 3BY4B 2NBVB 5AZGA 3RZWC 4A3PA 5HKHA 4MJSB 1WGYA 1GUAB 4I6LB 2C60A 2A5UA 2KQSA 2M4NA 4G3XB 4I6NB 3UIPB 1WGDA 3NZSA 4II3B 3PT2B 4MELA 3SU8X 4LJPB 4W9GA 1SE9A 4FHJA 2MSED 2V4LA 4DK5A 3JSVB 1H4RA 4TKNA 2J0JA 1VD2A 4W9JA 2LXAA 4FJZA 2ZEQA 2O6VD 3U7DA 5CHWA 3DOWA 2CHXA 2J0MA 4EZLA 1Z2MA 1EF5A 4MGIE 4K1RB 3W1SC 3IHPC 1Q5WB 2J0KA 2K39A 2D10A 5C1ZA 2BYEA 3ZDMC 4AJYB 3T8MA 4KVGB 2PPHA 4FADA 3DBHI 4IUMB 4MEMA 4ZYNA 1GG3A 1Z5SB 5JHAA 2FCSA 3AU4A 1YJ1A 4JIOU 4ZDVA 5AEKB 2BKRB 2LJ5A 5JZEB 2XBBC 3V61A 1WY8A 3LJ3A 2ZVOA 4IWOA 1WFYA 2PE6B 2MBHA 2GBKA 4WJOA 3ECIA 2Z0DB 4NJ7A 2KWCA 4HLEA 3HM3A 3HM6X 1IYFA 3TJPA 3HIZA 2XK5A 3SD5A 2MBQA 2KNBA 4GDLA 3M63B 4DDGD 3RT3B 3PLVA 3H6NA 3U8ZA 3R66C 3QIJA 4BBNC 2KK8A 5JH5C 3A9JB 5IAAC 5EDSA 4W9DA 3DQVA 2KOXA 2PE9A 3ZRFA 3TMPB 1D3ZA 1V5TA 3IG3A 2NR2A 4W9LA 1ZKHA 4JGHB 4GU2A 2D07B 1WM3A 4GB9A 2ZNVB 1V80A 2JRHA 3VQIA 2QHOA 3PPAA 3ZTDA 4EFOA 2XEWA 3W1YA 3ZLZA 1I35A 2RGFA 3DBSA 2BKFA 3QJZA 5LXHA 3ZNID 1R4NI 5LLIA 4PS7A 4NJ6A 4GIVA 2MBOA 4M8MA 2NBUA 4KZCA 3KUCB 3PRMB 2RR9A 4GMVA 2O2VB 2LWPA 2UWQA 4HK2A 3ENEA 5AZHA 4CYEA 1GJZA 3KUDB 3KW5B 2BPSA 2Z0EB 4FHKA 1J0GA 3ZW3A 2G3QB 4K7WA 2DYMA 2JY6A 2CHWA 2GOWA 3CMMB 2AL3A 2K8HA 2CU1A 4IM3A 2NPTB 4JQWC 4E74A 4HWIB 3DVNV 2MP2B 2N7DA 2KFKA 2DZIA 3L13A 3UIOB 4CO7A 2RPQA 5DCNA 3VUYA 3R3MA 1WE6A 3QQ8B 2KWVB 2LASA 4W9KA 4ICUA 1JRUA 4DHZE 3WAPA 5E6PA 1GC7A 2KDEB 3OAWA 5C23A 1FXTB 3B1LX 2YVCA 3L08A 5E6OA 3ZDTA 1WYWB 2LGYA 3CSTA 4AUQC 4BKSA 3QARA 1WZ0A 4HCNB 2A4ZA 2ZPNA 3UF8A 1WH3A 1X1MA 3ZKJC 3UQBA 2BYFA 1UD7A 4LDTD 3N3KB 3ZIMA 4W9IA 4URKA 3KVFB 1V9JA 1L7YA 3N30A 1UZXB 2KJRA 4GXBA 2AWTA 3JYUA 2KMCA 2MA9B 1KLVA 1V6EA 1NI2A 4PYUA 3QK0A 3ZNHB 4MH0E 4MGYE 3A1QA 4ANUA 3DDCB 4RM8A 3MTNB 4KIKA 3JW0X 4XX5A 3PV1A 3Q3FA 2DAFA 2WX0A 2KC1A 2GBJA 4OVVA 4W9CA 4KZ0A 4PYZA 2BGFA 2JF5A 2JRIB 2XK5B 1S1QB 2MW5A 1SGHA 1P9DU 4NQKE 5DPRA 1GNUA 1WXVA 3H7PA 4KSLC 4GDLB 3NZUA 1J8CA 2K8CA 1TTNA 1V2YA 4AOFA 2LXCA 2R2QA 3WAMA 2KKCA 3DCGA 3GZNI 4GGQA 1E7UA 5D7GA 2KMAA 4K81A 4XZ4A 5IA7A 4FLHA 4FULA 4HCPB 3RZFA 2J7QB 2WYQA 1TGZB 2WWZA 4NAWA 3DVGX 4YL8A 3N32A 4TUUA 2UYZB 2NS5A 4J6IA 5KHQA 1Y8RC 3UINB 4B9KA 1WXMA 2HD5B 1WJNA 4BBNF 4GOCA 3WANA 1A5RA 4DWFA 5KHOA 2ZZPB 3KYCD 1YX5B 2LI5A 4GSWA 4W9EA 2N1VA 4WJQA 2JWZA 2AEHA 3NS8A 4KDLB 3ML9A 2BWFA 4DDID 3L54A 1OEYJ 1V86A 5D94A 5DPSA 3VH4B 3QX1A 5DPWA 4FJVB 2R2OA 1U4AA 2AL6A 5J17A 2M8SA 4NPNA 4HVBA 3W1SA 4IM2A 1K8RB 2DZMA 3ALBA 2BF8B 1KOTA 2K6DB 2HJ8A 4LCDE 5AZFA 3B0AA 4W9FA 1WR6E 2O6VA 2D11A 2C9WB 3QCAA 4XC2A 1NBFC 4WJPA 2YLMA 3DBLI 3L16A 3DBRI 4BFRA 4JL9A 2N9XA 4EUTA 4A20A 3MJWA 4OVUA 2GBRA 2K1FA 2V3SA 2ZVNA 4A3OA 4AWJA 1TBEA 1WGHA 1UBIA 2KZRA 4WWOA 4TV3A 3RD2A 3WA0A 3AI5A 3VHTC 1CMXB 2C5LC 2N9EB 3CF6E 1C1YB 2EMTA 2ZPYA 3PTFC 4IWPA 2MRPA 3TL5A 1QZEA 3RCZA 4BKTA 4ANWA 3PRPB 1E8XA 2L76A 2Z59B 3ZVVA 2IBIB 5CHFA 2KHWB 4BOZB 2M17A 4HPMB 4MDKE 4B95A 2V1YA 1WM2A 3QA8A 2KX0A 2HTHA 4M0WB 1KJTA 3VFKA 4EEWA 4DHJB 1UH6A 4TQ0A 3ZO5B 2I1KA 4IC7B 1L2NA 3A1QB 4MGZE 5DPTA 2RSUA 4GDKA 4KIKB 5CX3A 4MSQB 3OJ4B 1I42A 1RRBA 2FCNA 3PHXB 3NOBA 1EO6A 1RAXA 2IY1B 3QC8B 1P98A 1LXDA 1AARA 2KXJA 3H7PB 2MQJA 1F9JA 5D2MB 2N1WA 2FCQA 4F7ZA 2GBNA 3L10B 4WAAA 2IO0B 3PGEA 2RD0A 4W9HA 2DAJA 5GMVA 3VDZA 1V49A 2WDTB 4FBJB 3QWZB 4M8NA 3O65B 1WI0A 2BWES 2Y5BB 1XT9B 1T0YA 3AU5A 2KTRA 1V81A 2EKEC 4PS3A 2ZNVC 4NAWB 2FAZA 2JPHA 1WE7A 4GN1A 3D32A 4WJNA 4ZRIA 2NVUI 5LXIB 2K25A 3C0RB 3H1UA 4ICVA 2MLBA 4HJKA 4E3CA 3SDLC 4WQOB 3APDA 3OLMD 1HE8A 3P2BA 4LJOB 2MCNB 3TIXA 3CSFA 5L95C 1GC6A 2KTFA 1LFDA 3R7RA 3VH3B 3KH0A 1P0RA 1XQQA 3PSEB 3HHMA 1M94A 4EZKA 2JT4B 3KYDD 3ML8A 3SHQA 3DVNU 1WX8A 2KDFB 1WXAA 1WMHA 2DZJA 2LUEA 2D3GA 2DYBA 2N9PC 4FA6A 1E7VA 2KX3A 4I6PA 2O6VB 4RMAA 4ANVA 4BKGA 2FUHB 4EKUA 1UBQA 3WALA 3ZNGC 2KC2A 2KFJA 4G0NB 2W9NA 4K7SA 2REXA 4ZRKA 5G2NA 3S2AA 4DXAB 2DENB 4JLCA 3QHTA 2ZCCA 1YX6B 4FN2A 2L3ZA 3A9KA 1UELA 4HPLB 2G4SA 1WX7A 3MHSD 4NNJB 2JUOA 2GMIC 1WX9A 2KO3A 3RYTA 4EOYA 3DVGY 3PZDA 3OJ3A 3VUXA 1IPGA 2L8JA 2ZCBA 3VTVA 5G55A 3V60A 1TZ1A 2K6QA 4ASWC 1WJ4A 3WIMA 1WIAA 1WGGA 2N7EA 1WR1A 2N4FA 4AP4C 5BO4B 2M1MA 1BT0A 1RLFA 4PS8A 1WRDB 1WGRA 2MBBB 3VAWA 1E8WA 1OQYA 3RULA 3A33B 1V5OA 2KWUB 4IWQA 3A4SC 2LD9A 4IM0A 1S3SG 2B3AA 2L0TA 2EMSA 4NY0A 5E6NA 2IZVB 3NY5A 3VTUA 1LQBA 4GDKB 2OJRA 2WX1A 4MSMB 3V6CB 2JZZA 3VXWA 1YIWA 3PVLA 3ONSA 3PLUA 4P7IA 4IW0A 2FIFA 2KFKB 2G45B 3TBLD 1YD8U 2K8BA 2FCMA 1KM7A 4WWPA 3WAOA 2ASQA 3EHVA 3K9PB 3M95A 2LVQA 3UGBB 4MM3A 3HK0A 3X23A 1WZ3A 3UQAA 2LZ6A 2KLCA 2CKHB 4KDIC 3IFWB 2KTRB 4BOSC 2L05A 2C7NB 3APCA 4MJSA 1H8CA 4TQ1A 2KJ6A 2CS4A 4NQLB 2DZKA 1IP9A 2KVRA 4X57B 5TR5A 3U30A 3ZNZB 4BVUC 2I1JA 2JXXA 2L00B 2MWSB 3JSVA 3PS6A 2LVOA 2PEAA 2VRRB 3NHEB 1UGMA 3QAQA 2PJHA 1WXSA 1WJUA 1P3QU 2G4DB 1Q0WB 4HDOA 3TCAA 4MGKE 5JHBA 4DHZB 1EF1A 1PQSA 4B6WA 3BINA 2D2QA 2LRUA 4G50A 4F8CB 4E71A 3VVWB 3M3JA 2L0FA 2KD0A 1OGWA 1WMHB 3GOEA 5CHVC 4ZRJA 1RFAA 2LRWA 2KDIA 3T9LA 2LGDA 4G11A 1ISNA 3JVZX 3A4RA 3H7SA 1SIFA 1E8YA 4BKSD 1Q1OA 2ZJDA 2LVPA 3EC8A 2C7HA 2LGXA 2IO1B 3LDZE 3Q3JA 4K7UA 1E90A 3AXCA 3K9OB 3V62A 1G6JA 1EUVB 3PREA 2MX2A 3EECA 3H9DA 2JVCA 2JZ3B 2CR5A 2HE7A 2IY0B 3A9KB 2GBMA 1NDDA 2OOBB 3IBEA 4IG7B 4LDTB 3VTWA 3ZRCA 4AJWA 4DHJD 2DYOA 3R7QA 1P1AA 1MG8A 1WJ6A 3RUIB 1XD3B 3M62B 1OEYA 2MBEA 2L7RA 1J19A 4N9F4 3A9JA 1LM8B 1OTRB 2C7MB 4II2B 2CHZA 2FNJB 1YQBA 4HXDA 2NBWB 2KN5A 5FR6A 3I3TB
chains in the Genus database with same CATH superfamily
1WF9A 3I63C 2QIEB 5CTRC 3B08A 3NVWA 3ZTCA 4ITKA 4F1SA 2IO2B 3MC9A 3ZUNA 4H2AA 2M0XA 3A73A 4US9A 1KXPD 4N3ZA 4K71A 2AQ1B 3P4SB 2H89B 4ACFA 5J2RA 1V1PA 4S1YA 3RNEC 1R4MI 1ZW7A 3AULA 2IO3B 3PRZA 2KDBA 4Q2JA 4GG2A 1ENFA 4A3PA 2LHEA 1GUAB 4I6NB 1WGDA 4LJPB 1SE9A 1K52A 3SR6A 2J0JA 4W9JA 3DOWA 3KIKA 4EZLA 4MGIE 3W1SC 2BTEA 3RI7C 5C1ZA 2BYEA 1N6ZA 1I4PA 4AJYB 3T8MA 1IBXB 2X38A 2ON8A 2V0GA 1XXGA 2WQYB 2VUEA 2ZW1A 3GB1A 2BKRB 2LJ5A 2OHFA 2PE6B 4NJ7A 2LQHA 4HLEA 3AE9B 1JQ4A 2K5PA 1TY2A 4GDLA 1HA2A 1N5UA 4DDGD 1K50A 2LGSA 5BYQA 1UNSA 3GZNB 4W9DA 1IUEA 1D3ZA 3IG3A 4JGHB 2ZNVB 3PPAA 3ZTDA 4EFOA 2EELA 3W1YA 2WXOA 1R4NI 5LLIA 4PS7A 4GIVA 4M8MA 2NBUA 3PRMB 3R2TA 1QT9A 2QCZA 1V1PB 4MH8A 3OWEB 2CHWA 5DBYA 3L4PA 3NVKA 4JQWC 4RH6A 1SE2A 2N7DA 2DZIA 4CO7A 3Q3MC 3WHRA 3R3MA 3DBRB 4ICUA 1QOBA 5E6PA 3B1LX 3L08A 4HGMB 1QOAA 2LGYA 4KX6B 1WZ0A 2UU7A 5IO9A 3UF8A 5HFYA 2DBWA 3UQBA 2BYFA 4LDTD 4M0WA 2INCC 2QMCA 2KJRA 1I7HA 1NI2A 4PYUA 2CJOA 3V3XA 4RM8A 2EFEA 4YSXB 1MG4A 1KFYB 2WX0A 4W9CA 1L0XB 2BGFA 2ICIA 1SGHA 1P9DU 4NQKE 2D3BA 1TXUA 2SAKA 4GDLB 1J8CA 2LXCA 4NJCA 2VDBA 4GGQA 1SJED 1D5ZC 4XZ4A 1MIWA 5ID9A 3RZFA 2WXIA 4DQOC 2J7QB 2WYQA 2G1EA 3N1XC 2BS2B 1Y8RC 5H92C 2H88B 2HD5B 5BMHA 1WJNA 4BBNF 4GOCA 1A5RA 4DWFA 2JX5A 2E3TA 3RN9C 4C80A 4LNIA 2JWZA 2AEHA 2RDHA 2GI9A 4DDID 1OEYJ 1V86A 5DPSA 2R2OA 4RNAA 4IM2A 4M70B 2BF8B 2LOQA 5AZFA 3B0AA 1CZPA 2CU3A 2O6VA 3DHIC 4WJPA 3L16A 2LJIA 2N9XA 4A20A 3MJWA 3Q3NC 4XDDA 1L6UA 1TBEA 2KZRA 5IFOA 1ZP0B 3FKYA 2RPVA 1PFDA 2DWQA 2EMTA 3TL5A 3TEYA 1C76A 3NMUA 2IBIB 1D5MC 2YDFA 3QA8A 4M0WB 2EFDA 1KJTA 1YOVB 2IDYA 3ZJUA 2BXGA 3ZO5B 4ARIA 2WXKA 5DPTA 4BY9C 5CX3A 3AE7B 2VZKD 4F5TA 2FCNA 2Y3AA 1P98A 5D2MB 1HK5A 3ZJVA 1HTOA 2PIAA 2DAJA 1V49A 3P42A 4FBJB 3QWZB 1XLPA 2I2YA 2Y5BB 1T0YA 3R2IA 2KTRA 4OW0A 4PS3A 2IGDA 2FAZA 1F2RI 3NG0A 3N9YC 2V36A 2NVUI 2K25A 2E0YA 1E78A 3SDLC 4WQOB 2KQ4X 3P2BA 4LLGM 3TIXA 2MCNB 1GC6A 4C4VA 2BXHA 1M94A 2JT4B 4K3CA 2WXJA 1WX8A 1WXAA 1WMHA 4M01A 3BK2A 1EU4A 1IGCA 2DYBA 1B9RA 2KX3A 2O6VB 4EKUA 2KFJA 1E7PB 4G0NB 2W9NA 2IPKD 4ZRKA 3M99C 4LUHA 2L3ZA 1TS5A 4HPLB 2JYEA 4CQNA 1JROA 1WX7A 3NVIA 3MFGA 2KO3A 3RYTA 1LNSA 4EOYA 3DVGY 3VUXA 2ZCBA 3V60A 3KJLA 4C56C 1BT0A 4PS8A 1WRDB 1YN4A 1WGRA 2MHJA 1P7FA 3H37A 1E8WA 1HK4A 3RULA 3NVYA 1V5OA 2KWUB 3H8HA 2MEKA 3A4SC 3I9V1 1XLQA 2L0TA 4IW1A 2IZVB 3NY5A 1LQBA 3V6CB 4YTNB 1YQ4B 1YMHE 1L0YB 1N61A 2YEPF 2FIFA 2XVVA 2KFKB 3UI3A 1YD8U 3FWCC 3NZ3A 4HEA1 4A6QA 1WZ3A 1FM0D 2LZ6A 4WIPA 1GAQB 1HZ5A 3IFWB 4FK5B 1ZE3D 2KTRB 4MACA 2C7NB 3SIUB 4L1BA 2KJ6A 2CS4A 3KWLA 5G5GA 4C00A 5EE1A 1SB3C 1E7CA 3U30A 3FILA 2BXAA 3PS6A 1WXSA 2G4DB 1SE3A 4C4VB 1Q0WB 1L4ZB 1QF6A 3HVZA 4F8CB 4G50A 2L0FA 2KD0A 1FIQA 4G01A 1WMHB 3T9LA 1KW2A 2DBUA 3JVZX 1VJKA 3PLAA 1E8YA 3SFEB 4BKSD 3NUHB 2ZJDA 3RNCC 2K9XA 2C7HA 2LGXA 2IO1B 3Q3JA 2NNWA 1EUVB 2GBMA 3IAM1 1TKYA 4DHJD 3R7QA 4B0MA 1MG8A 4IDIA 2BXDA 2N0SB 2LQIA 1ZOYB 1HK3A 4N9F4 1EWCA 3Q14C 4FIPB 1LM8B 3AE1B 3AECB 5IJ5A 5EE0A 1YQBA 2KN5A 1JWAD 4CHKA 4EZJA 2NCNA 3G9KD 2L83A 2Z8KA 2B76B 3AEFB 2ACZB 2BXPA 2KANA 4FJYA 3APFA 1MUSA 2AJEA 4HDQA 1ZGUB 3B2GA 1JWSD 5GIOA 5IP4D 2PTLA 3FAHA 1JALA 2WS3B 5ID7A 4WWNA 4RM9A 2KLGA 3RZWC 3EUB2 4I6LB 2C60A 2KQSA 4G3XB 4II3B 4MELA 1N63A 3FILB 4FHJA 2MSED 4ZCGA 1I4HA 4L2YA 2V4LA 1H4RA 4OR0A 4FJZA 3U7DA 5GIPA 2CHXA 2BXLA 1EF5A 2WGSA 4D2KA 3IHPC 1FFUA 2WXMA 2D10A 3Q69A 2WXGA 3R8BA 5H8YE 3SQJA 4GDXA 4KVGB 1ZDXA 2N7JA 5AEKB 4ZDVA 2LHDA 2OZBB 1FNWA 3V61A 3LJ3A 3RNAC 4IWOA 3FWBC 1WFYA 3ECIA 1WRIA 2KWCA 3HM3A 3HM6X 1IYFA 3Q2AC 3HIZA 1H9ZA 1YJJA 5IJEA 4YWGG 3RFZB 1XLOA 3RT3B 3PLVA 3H6NA 3U8ZA 1JCKB 3P63A 2KK8A 1A70A 3WHSA 1UWXA 5IAAC 5EDSA 3KQ4A 2NTSA 1WM3A 1I35A 1KH0A 3QJZA 3ZNID 4NJ6A 2MBOA 1C4AA 1YN3A 1DYQA 5IJFA 4HK2A 3ENEA 1GJZA 4FHKA 1J0GA 5FKAC 3ZW3A 1N5WA 1L6VA 2LGIA 2CU1A 4IM3A 4LNKA 2NTTA 4LB9A 4WWMA 4E74A 3DVNV 3L13A 3UIOB 3N1ZC 2RPQA 2OEDA 1T0QC 1WE6A 2KWVB 3AMZA 4W9KA 3BVGA 4DHZE 3J9CA 1NT2B 3AE8B 2YVCA 2QM6A 3W5UB 3ZDTA 2V9HA 3QARA 4OZCA 2A4ZA 1ZDVA 2XW0A 1X1MA 1TKEA 4HGKA 3ZKJC 3ZIMA 2AQ2B 3JYUA 1KLVA 1V6EA 1VDVA 4MGYE 1EM7A 3DDCB 5IIUA 3AE2B 3PV1A 2DAFA 4UDUC 4PYZA 2JF5A 4ZHOA 5EE9A 5DPRA 3H7PA 2WXHA 3NZUA 4KSLC 1C4PA 2K8CA 2R2QA 3WAMA 2KKCA 3VRAB 4FULA 4HCPB 2JU6X 2QSDA 2BT6A 3N32A 3VR9B 4TUUA 1NEKB 2UYZB 1HK1A 1FMAD 4J6IA 4KKIA 5FK9C 4ZYSA 2D3CA 5KHOA 3KYCD 2LI5A 1J7BA 3ML9A 2BWFA 3L54A 3VH4B 3QX1A 1FPYA 4FJVB 5DPWA 2AL6A 4NPNA 3W1SA 2DZMA 3ALBA 2BXBA 1KOTA 2C9WB 4XC2A 1NBFC 1JMLA 2YLMA 3DBLI 4EUTA 2GBRA 1E9MA 4FJCB 3AI5A 2PVOD 3TEXA 1CMXB 1TJEA 2BBCA 2C5LC 1C1YB 2N9EB 3P1MA 3PTFC 2MRPA 3AE4B 1QZEA 1RFKA 4ANWA 3PRPB 1Q10A 1E8XA 2Z59B 3ZVVA 3V09A 1PDXA 2KHWB 1F1HA 4HPMB 3ZXVA 1D6EC 3ZGZA 3U4EG 1M4VA 3B9MA 2HTHA 1MI0A 2INDC 4USAA 2SEBD 1F52A 3FNMA 1Y56A 4MGZE 2RSUA 1ROEA 4MSQB 1JWBD 2EKIA 1I42A 2JYTA 3NVVA 3IT6B 3NOBA 1H5WA 1EO6A 1RAXA 1JRPA 3QC8B 4W4UB 3H7PB 1YNTE 2GLSA 3L10B 4WAAA 5GMVA 1K53A 4P1CC 4Z9OA 4PK1A 4LK0M 2K0PA 1WI0A 2BWES 1XT9B 3SIVB 5FR3A 3V03A 4P6VF 4RF1A 4GN1A 3GQUA 1UGJA 2TSSA 1HEZE 4N58A 4OZBA 5L95C 1MUHA 1ZUD2 3V08A 2LEKA 1LFDA 4LTUA 1JNBA 1AW7A 2BXNA 3ML8A 3SHQA 4M02A 1SE4A 4LNNA 2WU5B 4YSZB 1KDXA 4Z69A 2LUEA 4PT5A 4RMAA 2MJDA 4YSYB 4B0EA 5EE3A 4A9AA 1DOXA 1WYGA 5G2NA 1VZSA 2ZCCA 3TSSA 3A9KA 3UIVA 4NNJB 3MHSD 2KBZA 2OJWA 1WX9A 2JSVX 3LU6A 2L8JA 1IJGA 1TZ1A 4ASWC 1WJ4A 2Q5WD 4AP4C 5BO4B 4AQ7A 1TY0A 3U2SC 1KRHA 3VAWA 2KMMA 3A33B 4IWQA 2BXMA 3WCQA 1ET9A 5E6NA 4MSMB 3Q8FA 3AM9A 2JZZA 2KN4A 3CIRB 3PVLA 3SFDB 3BZDB 3ONSA 3PLUA 2BXFA 3TBLD 2FCMA 1J78A 4WWPA 1NYRA 1SBBB 2D3AA 3NJTA 3M95A 3UGBB 4MM3A 2XVUA 1WSPA 3PZ8A 3UQAA 4BOSC 2VH1A 4MJSA 4TSSA 1XCTL 4NQLB 1P7EA 2DZKA 2KVRA 1TS2A 2BS3B 2K22A 1LO5D 3ZNZB 2R61A 3JSVA 4RGNA 3QAQA 1LGRA 4WAFA 1SF0A 3RNFC 2GB1A 1N62A 4MGKE 5JHBA 4DHZB 1EF1A 2W55A 3BINA 2LRUA 4G04A 4E71A 1KF6B 3M3JA 3EA6A 2LRWA 2KDIA 1OQRA 3BYTB 3GQXA 3A4RA 3H7SA 1Q1OA 2DNFA 2LVPA 2INNE 3EC8A 1VZ8A 3LDZE 1MJDA 1TZOA 2JVCA 2JZ3B 3MJ5A 3A9KB 2IY0B 3IBEA 4IG7B 4LDTB 4AJWA 3ZRCA 4OTTA 3VTWA 2WXNA 1V8CA 3Q8AA 1L0VB 4O1NA 4J2VA 3AEEB 5HHDG 2MBEA 1QLBB 2MJ3A 2DG5A 1TKGA 2FNJB 2Z8LA 4HXDA 5E6JA 4F5UA 1N60A 2KQ7A 4LB2A 3DPDA 3W5VB 1ZXIA 5J18A 1NYQA 3VUWA 3L17A 4A90A 1T0SC 1FRDA 1DOYA 1SB0A 5HOZA 2O2VA 1E5WA 3AE5B 1AO6A 4KSKC 3NVMA 4K2CA 3V6EB 2DHZA 3X0WA 2KJHB 4MM3B 4KV2A 5C2TB 1VCBA 5AZGA 2NBVB 4MJSB 1WGYA 4AS1A 1R7SA 2M4NA 2LUMA 2KVZA 3NZSA 3PT2B 3ZJTA 4W9GA 4DK5A 3JSVB 2WLBA 4TKNA 4N0UD 2ZEQA 4HRSA 1ACCA 2J0MA 5BMGA 1BXTA 1EWYC 2QHBA 1RWSA 2BXKA 2J0KA 2K39A 5BPKA 3TUOA 3EFCA 4MEMA 4ZYNA 5JHAA 2FCSA 1YJ1A 2JUHA 3Q8EA 1FCLA 5JZEB 2XBBC 1WY8A 4WJOA 2J42A 2PLPA 2Z0DB 4OT2A 3SD5A 1F2RC 5BYRA 1JWMD 3NVZA 1XEEA 3R66C 3QIJA 4US8A 3Q8BA 3HRDD 2PE9A 1I4RA 2VZKB 4TMAB 3TMPB 1V5TA 4W9LA 1ZKHA 4GU2A 3RNBC 2JRHA 2WP9B 2XEWA 2JQRB 3DBSA 2L52A 3GP7A 2I2ZA 3AEGB 3BVZA 4KZCA 4HKQA 3DBHB 4GMVA 4WURA 4REZA 5GXGB 2O2VB 4XGAB 4CYEA 3KUDB 1PGAA 2Z0EB 4JWUC 4L9QA 4FXCA 2G3QB 4K7WA 2DYMA 5D3IB 5JXVA 1VLBA 2AL3A 2K8HA 2PMVA 2BYTA 3T3NA 2J4XA 2Z8IA 5DCNA 3VUYA 3QQ8B 1WWTA 3WHQA 3N1YC 1V97A 1JRUA 3WAPA 2M56B 2L1AA 1GNIA 3OAWA 3LB8C 1RYJA 5E6OA 1TF0A 2XNAC 1QQRA 3CSTA 4BKSA 5HI1A 2N9LA 2WDRB 1WH3A 3TEZA 2VH2A 2MJEA 5LNK1 4URKA 3N30A 1UZXB 3NS1A 4GXBA 1E7GA 2DLBA 2MA9B 1FO4A 3ZNHB 4MH0E 3AE6B 2KC1A 2MW5A 2BX8A 1PGXA 1V2YA 4KGSA 4AOFA 5C3JB 3GZNI 3ZXRA 1FXAA 1E7UA 5D7GA 2KMAA 4QAYA 5IA7A 4FLHA 1V1OA 1T5XD 1VFIA 4YXDB 3HUIA 1TGZB 2WWZA 4F5SA 4NAWA 3DVGX 1TS3A 2V3NA 4YL8A 2K0NA 3UINB 4B9KA 1WXMA 2J52A 4EMXA 4BZAA 2WDVB 2YEPB 4GSWA 4WJQA 4W9EA 4KGTA 4KDLB 2GUTA 4P1BC 5D94A 1UORA 2M8SA 4HVBA 1K8RB 1K51A 3AN1A 2HJ8A 4RF0A 2V3PA 1WR6E 3QCAA 5MPOA 2ONQA 1TIFA 3DBRI 4N59A 1J7CA 1HXYD 4OVUA 2ZVNA 4A3OA 1STEA 3P4QB 1AWDA 1WGHA 4C7ZA 4TV3A 2AGHB 3WA0A 1NI3A 3CF6E 4IWPA 1WGKA 2IGHA 3RCZA 4BKTA 1DGJA 2KACA 1FOUA 4BOZB 4B95A 2V1YA 1KLUD 1WM2A 2RDBC 4DHJB 3DWGC 1BJ5A 1UH6A 2QC8A 5IIHA 5G5HA 2EFHA 3NRZA 5AUIA 4IC7B 1CK1A 1L2NA 2INPE 1O9XA 1RRBA 5IKCM 4E99A 2IY1B 4XYCA 1LXDA 2KXJA 3IT4B 4F7ZA 1F9JA 2N1WA 4ZRQA 2GBNA 2NMQA 2IO0B 2RD0A 3A75A 4W9HA 2WDTB 3AU5A 3MHHB 2EKEC 2ZNVC 4NAWB 2RDGA 2JPHA 5FUOA 3P4PB 3D32A 4ZRIA 5LXIB 2BS4B 3H1UA 1MPEA 3OG5A 4C7YA 4ZHPA 3I5JC 3APDA 3OLMD 1HE8A 2M0AA 2KTFA 3R7RA 1FCCC 3KH0A 2HDEA 1XQQA 2BB5A 3KYDD 3B2FA 3DVNU 1CQVA 2DZJA 5TSSA 1PGBA 4C31B 4ANVA 2Z8JA 4JWSC 2FUHB 1UBQA 1F77A 3C8YA 2KWDA 2REXA 3S2AA 4DXAB 2DENB 3QHTA 1YX6B 4ZC6A 2Y5PA 1UELA 2G4SA 3IAS1 1ET6A 4RGOS 3URYA 2XVQA 3PZDA 4ZBQA 2W3RA 3OJ3A 4LUFA 2D5GA 2XN9C 3VTVA 2JXTA 3WIMA 1WR1A 4S0RA 2M1MA 2OT3A 1C78A 2W82A 2MBBB 3B9JA 2BXQA 4ZUXV 2BXIA 1YN5A 1S3SG 2EMSA 1KTKA 3VTUA 2WX1A 1YJIA 3I57A 1VZ6A 3VXWA 2HTME 4PO0A 2QDFA 3BK1A 3ZYYX 4P7IA 2WXRA 2G45B 1HK2A 1I4QA 5IOIA 1FXIA 5D3DA 2ASQA 3EHVA 2KLCA 2CKHB 4KDIC 1H8CA 2L05A 1UUPA 4X57B 5TR5A 4BVUC 2I1JA 4S17A 2L00B 2MWSB 2QEJC 2LVOA 2PEAA 3NHEB 1UGMA 2PJHA 3GE3C 3LXFA 1P3QU 4HDOA 4A8XC 1PQSA 3VVWB 4M00A 5CHVC 1RFAA 2BXCA 1PYWD 2XMOA 1NVID 2LGDA 4WH4A 2JZPA 1QOGA 2ZW0A 1G6JA 3K9OB 3Q8CA 2MX2A 3H9DA 4J3OD 1GOZA 2CR5A 2HE7A 2OOBB 2WU2B 4YTMB 2DYOA 1DOIA 2KAJA 3W9CB 3TEWA 3AEDB 1XD3B 1E7HA 1FRRA 5DQFA 1OEYA 4L23A 3BVMA 3A9JA 4K3BA 1I4GA 2HJ1A 1MIVA 3KWVA 1QILA 2NBWB 5AUKA 3EFUA 3L0WB 2BYVE 2AYOB 3DHGC 2N9KA 1FEHA 1TYGB 3PHWB 4ANXA 2GRIA 2FIDA 4WA6B 1SSNA 2IYDB 4N6EB 1E8ZA 1C3TA 2XW1A 3KUZA 3H3AA 2L32A 1TS4A 2BVCA 4DBGA 2DX5B 3IVFA 4ZBRA 3MC8A 1WXQA 1E7AA 3SEBA 4YTPB 3ZQ4A 5L83A 5D6JB 2NPTA 1MVKA 2MP2A 3BY4B 5HKHA 2AQ3B 2V4IB 2A5UA 1C4CA 3BIID 3UIPB 2J53A 3SU8X 4DM0A 3C19A 2BXEA 1T0RC 1YQ3B 1VD2A 2LXAA 2O6VD 4A55A 5CHWA 2NQOA 1MHXA 1SEBD 1E10A 1Z2MA 4JX1C 4K1RB 1F0ZA 1Q5WB 1L4DB 3LYYA 3ZDMC 4DXGA 2PPHA 4FADA 2LXTA 3DBHI 4IUMB 1GG3A 3ICXA 1Z5SB 2FUG1 4BAXA 3AU4A 4JIOU 2ZVOA 2MBHA 2GBKA 1R4MB 3VRBB 2MH7A 3TJPA 2XK5A 2MBQA 1D5XC 2KNBA 4KKJA 1XF5L 1FD6A 3M63B 2QJLA 4XWWA 1CJEA 4BBNC 1HZ6A 5JH5C 3A9JB 3DQVA 2KOXA 3ZRFA 1C9FA 2VUFA 4P16A 2NR2A 2WNMA 2D07B 1GB4A 4GB9A 1V80A 3VQIA 2QHOA 2KYWA 3ZLZA 2RGFA 4MBEC 2BKFA 5LXHA 3BYYB 3N20C 3GA9L 3KUCB 2RR9A 5I4DA 2BB6A 2LWPA 2UWQA 3AH7A 1SIJA 5AZHA 2AX5A 4ARCA 3KW5B 2BPSA 1T3QA 3FC4A 4EE2A 2JY6A 3CWIA 1AN8A 2QILA 4OVZA 2GOWA 3CMMB 2NPTB 4HWIB 4N0FD 2MP2B 2KFKA 4F5VA 2FE8A 4XWTA 2LMCA 3DBLB 3AB5A 2LASA 2KDMA 1GC7A 2WXFA 2KDEB 4RGTA 5C23A 1FXTB 4OHJA 4YT0B 4RGMA 4GLSC 2CKXA 1WYWB 3ECPA 1PUTA 3Q3OC 4AUQC 3IXSA 4HCNB 2ZPNA 4HPPA 3Q6BA 1E7IA 5BMIA 1E6EB 1R4NB 2DBXA 1UD7A 3N3KB 2CJNA 4W9IA 3MHSB 1V9JA 3KVFB 4XDCA 1L7YA 1E7EA 2AWTA 3E56A 1NENB 2KMCA 3RNGC 3QK0A 4ANUA 3A1QA 3MP9A 3MTNB 4KIKA 3JW0X 4XX5A 1BM0A 3Q3FA 3CX9A 4OVVA 2GBJA 3DWMA 4KZ0A 4L9KA 4D7XA 2JRIB 2XK5B 1S1QB 1E7BA 2M19A 1GNUA 3LU8A 1WXVA 1D4BA 1TTNA 1OFFA 1LOTA 3DCGA 2QMTA 3ETRA 4K81A 2K3UA 1EU3A 2XSIA 1XCQL 3PO0A 1AYFA 2E0XA 4ZRPA 2NS5A 1UF0A 5KHQA 2W3SA 4RFBA 3WANA 1HTQA 2ZZPB 1YX5B 2N1VA 5T8IA 3NS8A 1JWUD 4G03A 1U4AA 5J17A 2WXPA 2K6DB 4LCDE 4W9FA 1MFWA 3MC0B 2D11A 2X8XX 4OTUA 4BFRA 4JL9A 1ZPSA 1BMLC 1J7AA 2IGGA 4LA0A 2K1FA 2V3SA 2ROHA 4AWJA 4WWOA 1UBIA 3RD2A 4I9OA 3VHTC 2ZPYA 3PZ7A 1XO3A 2KT7A 2L76A 2Y5CA 3AEAB 1ZXHA 5CHFA 1SJHD 2M17A 4L8UA 1BUIC 4MDKE 3LU7A 5IN7A 2KX0A 4NAMA 1MHHE 3VFKA 4EEWA 2BQQA 3RPFC 4DHXB 4TQ0A 1C79A 2I1KA 2FBWB 2DBYA 1J7EA 3A1QB 4RCOA 5HG2A 4GDKA 3AE3B 2IJ0A 4KIKB 3OJ4B 3PHXB 4JK4A 3AV8A 2WXQA 1AARA 2MQJA 2FCQA 1KLGD 4ZOHC 2JWUA 3PGEA 2LFIA 3JQZA 3VDZA 1SXTA 3GE8C 4M8NA 1N5XA 1GB1A 2PVGC 3BWUD 3O65B 1V81A 3GS2A 1WE7A 1VRAB 4WJNA 1RM6C 4BKEA 3C0RB 3EGRA 4ICVA 2MLBA 4HJKA 4E3CA 2G9HD 2PKOA 4LJOB 1GPXA 3CSFA 1T6BX 4OZAA 3VH3B 3U7ZA 3O13A 1P0RA 3PSEB 3HHMA 4EZKA 1IGDA 2KDFB 2D3GA 1E7FA 2N9PC 4FA6A 1E7VA 4I6PA 4BKGA 3U52E 3WALA 3ZNGC 2KC2A 4HROA 4K7SA 2BXOA 4JLCA 2PW9A 4FN2A 1GNJA 1XLNA 2JUOA 4WQMA 1L5PA 2GMIC 1FNUA 1TT5B 1IPGA 1B1ZA 4JE3B 5G55A 2K6QA 1WIAA 1WGGA 2N7EA 2N4FA 4IKGA 4IOIE 1RLFA 1HA5A 1UWMA 4MT5A 3E9SA 1VZ7A 1OQYA 1I4XA 3VR8B 2EFCA 4JPSA 2LD9A 2LXSA 4IM0A 2B3AA 4NY0A 2WXLA 4GDKB 2OJRA 1C77A 4HKZE 1YIWA 3TDLA 4IW0A 1MA9A 2WHIA 5BYSA 2K8BA 1KM7A 2BW2A 3WAOA 4HJGE 3JRYA 3K9PB 1HQRD 2LVQA 1QKZA 3HK0A 4ZBKA 3X23A 1E0ZA 1MM8A 2W54A 4XE0A 4R3DA 1JW9D 3APCA 1FFVA 4TQ1A 1QOFA 2XVWA 4LNFA 5GINA 5IIXA 1IP9A 2I30A 3B9LA 2RMMA 3DHHC 1OQQA 2JXXA 3T3OA 2VRRB 3RMKC 3W2DA 3HVDA 2E6XA 3AEBB 1WJUA 3TCAA 4B6WA 2D2QA 3P4RB 3BPJA 1OGWA 3KLSX 3GOEA 4ZRJA 3V05A 1IBXA 5GHKA 4G11A 1ISNA 1SIFA 3MHZA 1VR9A 4K7UA 3V62A 1E90A 3AXCA 3PREA 3EECA 2I38A 2KWFA 1BKEA 1NDDA 1FNVA 3ABVB 1P1AA 1WJ6A 3RUIB 5B5TA 4IW2A 3M62B 4KGRA 1ESFA 2L7RA 1J19A 1OTRB 1MIYA 2C7MB 4II2B 2CHZA 2WDQB 4LNOA 4NZLB 5FR6A 3I3TB 4DXFA
chains in the Genus database with same CATH topology
1WF9A 5CTRC 2QIEB 3B08A 3NVWA 3ZTCA 4ITKA 4F1SA 2IO2B 3ZUNA 4H2AA 2M0XA 3A73A 4US9A 1KXPD 4N3ZA 4K71A 2AQ1B 3P4SB 2H89B 5J2RA 1V1PA 4S1YA 1R4MI 1ZW7A 3AULA 2IO3B 3PRZA 2KDBA 4Q2JA 4GG2A 4A3PA 1ENFA 2LHEA 1GUAB 4I6NB 1WGDA 4LJPB 1SE9A 1K52A 3SR6A 2J0JA 4W9JA 3DOWA 3KIKA 4EZLA 4MGIE 3W1SC 2BTEA 5C1ZA 2BYEA 4AJYB 1I4PA 3T8MA 1IBXB 2X38A 2ON8A 2V0GA 1XXGA 2WQYB 2VUEA 2ZW1A 3GB1A 2BKRB 2LJ5A 2OHFA 2PE6B 4NJ7A 4HLEA 3AE9B 1JQ4A 2K5PA 1TY2A 4GDLA 1HA2A 1N5UA 4DDGD 1K50A 5BYQA 1UNSA 4W9DA 1IUEA 1D3ZA 3IG3A 4JGHB 2ZNVB 3PPAA 3ZTDA 4EFOA 2EELA 3W1YA 2WXOA 1R4NI 5LLIA 4PS7A 4GIVA 4M8MA 2NBUA 3PRMB 3R2TA 1QT9A 1V1PB 4MH8A 3OWEB 2CHWA 5DBYA 3L4PA 3NVKA 4JQWC 4RH6A 1SE2A 2N7DA 2DZIA 4CO7A 3WHRA 3R3MA 4ICUA 1QOBA 5E6PA 3B1LX 3L08A 4HGMB 1QOAA 2LGYA 4KX6B 1WZ0A 3UF8A 5HFYA 2DBWA 3UQBA 2BYFA 4LDTD 4M0WA 2QMCA 2KJRA 1I7HA 1NI2A 4PYUA 2CJOA 3V3XA 4RM8A 2EFEA 4YSXB 1KFYB 2WX0A 4W9CA 2BGFA 1L0XB 4NQKE 1SGHA 1P9DU 2ICIA 1TXUA 2SAKA 4GDLB 1J8CA 2LXCA 4NJCA 2VDBA 4GGQA 1SJED 4XZ4A 1D5ZC 1MIWA 5ID9A 3RZFA 2WXIA 4DQOC 2J7QB 2WYQA 2G1EA 2BS2B 1Y8RC 5H92C 2H88B 2HD5B 5BMHA 1WJNA 4BBNF 4GOCA 1A5RA 4DWFA 2JX5A 2E3TA 4C80A 2JWZA 2AEHA 2RDHA 2GI9A 4DDID 1OEYJ 1V86A 5DPSA 2R2OA 4RNAA 4IM2A 4M70B 2BF8B 2LOQA 5AZFA 3B0AA 1CZPA 2CU3A 2O6VA 4WJPA 3L16A 2LJIA 2N9XA 4A20A 3MJWA 4XDDA 1L6UA 1TBEA 2KZRA 5IFOA 1ZP0B 3TL5A 2RPVA 2EMTA 1PFDA 2DWQA 3TEYA 1C76A 3NMUA 2IBIB 1D5MC 2YDFA 3QA8A 4M0WB 2EFDA 1KJTA 2IDYA 3ZJUA 2BXGA 3ZO5B 4ARIA 2WXKA 5DPTA 4BY9C 5CX3A 3AE7B 2VZKD 4F5TA 2FCNA 2Y3AA 1P98A 5D2MB 1HK5A 3ZJVA 2PIAA 2DAJA 1V49A 3P42A 4FBJB 3QWZB 1XLPA 2I2YA 2Y5BB 1T0YA 3R2IA 2KTRA 4OW0A 4PS3A 2IGDA 2FAZA 1F2RI 3N9YC 2V36A 2NVUI 2K25A 2E0YA 1E78A 3SDLC 4WQOB 2KQ4X 3P2BA 3TIXA 4LLGM 2MCNB 1GC6A 2BXHA 1M94A 2JT4B 2WXJA 1WX8A 1WXAA 1WMHA 3BK2A 1EU4A 1IGCA 2DYBA 1B9RA 2KX3A 2O6VB 4EKUA 2KFJA 1E7PB 4G0NB 2W9NA 2IPKD 4ZRKA 3M99C 4LUHA 2L3ZA 1TS5A 4HPLB 2JYEA 4CQNA 1JROA 1WX7A 3NVIA 3MFGA 2KO3A 3RYTA 1LNSA 4EOYA 3DVGY 3VUXA 2ZCBA 3V60A 3KJLA 4C56C 1BT0A 4PS8A 1WRDB 1YN4A 1WGRA 1P7FA 3H37A 1E8WA 1HK4A 3RULA 3NVYA 1V5OA 2KWUB 3H8HA 2MEKA 3A4SC 3I9V1 1XLQA 2L0TA 4IW1A 2IZVB 3NY5A 1LQBA 3V6CB 4YTNB 1YQ4B 1YMHE 1L0YB 1N61A 2YEPF 2FIFA 2XVVA 2KFKB 3UI3A 1YD8U 3FWCC 3NZ3A 4HEA1 4A6QA 1WZ3A 2LZ6A 1FM0D 4WIPA 1GAQB 1HZ5A 3IFWB 4FK5B 2KTRB 1ZE3D 4MACA 2C7NB 3SIUB 4L1BA 2KJ6A 2CS4A 3KWLA 5G5GA 5EE1A 1SB3C 1E7CA 3U30A 3FILA 2BXAA 3PS6A 1WXSA 2G4DB 1SE3A 1Q0WB 1L4ZB 1QF6A 3HVZA 4F8CB 4G50A 2L0FA 2KD0A 1FIQA 4G01A 1WMHB 3T9LA 1KW2A 2DBUA 3JVZX 1VJKA 3PLAA 1E8YA 3SFEB 4BKSD 3NUHB 2ZJDA 2K9XA 2C7HA 2LGXA 2IO1B 3Q3JA 2NNWA 1EUVB 2GBMA 3IAM1 1TKYA 4DHJD 3R7QA 4B0MA 1MG8A 4IDIA 2BXDA 2N0SB 1ZOYB 1HK3A 4N9F4 1EWCA 4FIPB 1LM8B 3AE1B 3AECB 5IJ5A 5EE0A 1YQBA 2KN5A 1JWAD 4CHKA 4EZJA 2NCNA 3G9KD 2L83A 2Z8KA 2B76B 3AEFB 2KANA 2BXPA 2ACZB 4FJYA 3APFA 2AJEA 4HDQA 1ZGUB 3B2GA 1JWSD 5GIOA 2PTLA 3FAHA 1JALA 2WS3B 5ID7A 4WWNA 4RM9A 2KLGA 3RZWC 4I6LB 3EUB2 2C60A 2KQSA 4G3XB 4II3B 4MELA 1N63A 3FILB 4FHJA 2MSED 4ZCGA 1I4HA 4L2YA 2V4LA 1H4RA 4OR0A 4FJZA 3U7DA 5GIPA 2CHXA 2BXLA 1EF5A 4D2KA 3IHPC 1FFUA 2WXMA 2D10A 3Q69A 2WXGA 3R8BA 5H8YE 3SQJA 4GDXA 4KVGB 1ZDXA 2N7JA 5AEKB 4ZDVA 2LHDA 2OZBB 1FNWA 3V61A 3LJ3A 4IWOA 3FWBC 1WFYA 3ECIA 1WRIA 2KWCA 3HM3A 3HM6X 1IYFA 3HIZA 1H9ZA 1YJJA 5IJEA 4YWGG 3RFZB 1XLOA 3RT3B 3PLVA 3H6NA 3U8ZA 1JCKB 3P63A 2KK8A 1A70A 3WHSA 1UWXA 5IAAC 5EDSA 3KQ4A 2NTSA 1WM3A 1I35A 1KH0A 3QJZA 3ZNID 4NJ6A 2MBOA 1C4AA 1YN3A 1DYQA 5IJFA 4HK2A 3ENEA 1GJZA 4FHKA 1J0GA 5FKAC 3ZW3A 1N5WA 1L6VA 2LGIA 2CU1A 4IM3A 2NTTA 4LB9A 4E74A 4WWMA 3DVNV 3L13A 3UIOB 2RPQA 2OEDA 1WE6A 2KWVB 3AMZA 4W9KA 3BVGA 4DHZE 3J9CA 1NT2B 3AE8B 2YVCA 2QM6A 3W5UB 3ZDTA 3QARA 4OZCA 2A4ZA 1ZDVA 2XW0A 1X1MA 1TKEA 4HGKA 3ZKJC 3ZIMA 2AQ2B 3JYUA 1KLVA 1V6EA 1VDVA 4MGYE 1EM7A 3DDCB 5IIUA 3AE2B 3PV1A 2DAFA 4UDUC 4PYZA 2JF5A 4ZHOA 5EE9A 5DPRA 3H7PA 4KSLC 3NZUA 2WXHA 1C4PA 2K8CA 2R2QA 3WAMA 2KKCA 3VRAB 4FULA 4HCPB 2JU6X 2QSDA 3N32A 2BT6A 3VR9B 4TUUA 2UYZB 1NEKB 1HK1A 4J6IA 1FMAD 4KKIA 5FK9C 4ZYSA 5KHOA 3KYCD 2LI5A 1J7BA 3ML9A 2BWFA 3L54A 3VH4B 3QX1A 5DPWA 4FJVB 2AL6A 4NPNA 3W1SA 2DZMA 3ALBA 2BXBA 1KOTA 2C9WB 4XC2A 1NBFC 1JMLA 2YLMA 3DBLI 4EUTA 2GBRA 1E9MA 4FJCB 3AI5A 2PVOD 3TEXA 1CMXB 2C5LC 2N9EB 1TJEA 1C1YB 2BBCA 3P1MA 3PTFC 2MRPA 3AE4B 1QZEA 1RFKA 4ANWA 3PRPB 1Q10A 1E8XA 2Z59B 3ZVVA 3V09A 1PDXA 2KHWB 4HPMB 1D6EC 3ZGZA 3U4EG 1M4VA 3B9MA 2HTHA 1MI0A 4USAA 2SEBD 1Y56A 3FNMA 4MGZE 2RSUA 1ROEA 4MSQB 1JWBD 2EKIA 1I42A 2JYTA 3NVVA 3IT6B 3NOBA 1H5WA 1EO6A 1RAXA 3QC8B 1JRPA 4W4UB 3H7PB 1YNTE 3L10B 4WAAA 5GMVA 1K53A 4Z9OA 4LK0M 2K0PA 1WI0A 2BWES 1XT9B 3SIVB 5FR3A 3V03A 4P6VF 4RF1A 4GN1A 3GQUA 1UGJA 2TSSA 1HEZE 4N58A 4OZBA 5L95C 1ZUD2 3V08A 2LEKA 1LFDA 4LTUA 1JNBA 1AW7A 2BXNA 3ML8A 3SHQA 4YSZB 1SE4A 2WU5B 4Z69A 2LUEA 4PT5A 4RMAA 2MJDA 4YSYB 4B0EA 5EE3A 4A9AA 1DOXA 1WYGA 5G2NA 1VZSA 2ZCCA 3TSSA 3A9KA 3UIVA 4NNJB 3MHSD 2KBZA 1WX9A 2JSVX 3LU6A 2L8JA 1IJGA 1TZ1A 4ASWC 1WJ4A 2Q5WD 4AP4C 5BO4B 4AQ7A 1TY0A 3U2SC 1KRHA 3VAWA 2KMMA 3A33B 4IWQA 2BXMA 3WCQA 1ET9A 5E6NA 4MSMB 3Q8FA 3AM9A 2JZZA 2KN4A 3CIRB 3PVLA 3SFDB 3ONSA 3BZDB 3PLUA 2BXFA 3TBLD 2FCMA 1J78A 4WWPA 1NYRA 1SBBB 3M95A 3UGBB 4MM3A 2XVUA 1WSPA 3PZ8A 3UQAA 4BOSC 4MJSA 4TSSA 1XCTL 4NQLB 2DZKA 1P7EA 2KVRA 1TS2A 3ZNZB 2BS3B 1LO5D 2K22A 2R61A 3JSVA 4RGNA 3QAQA 4WAFA 1SF0A 2GB1A 4MGKE 1N62A 5JHBA 4DHZB 1EF1A 2W55A 3BINA 2LRUA 4G04A 4E71A 3M3JA 1KF6B 3EA6A 2LRWA 2KDIA 1OQRA 3BYTB 3GQXA 3A4RA 3H7SA 1Q1OA 2LVPA 2INNE 3EC8A 1VZ8A 3LDZE 1TZOA 2JVCA 4IG7B 2JZ3B 2IY0B 3A9KB 3IBEA 4LDTB 4AJWA 3MJ5A 3ZRCA 4OTTA 3VTWA 2WXNA 1V8CA 3Q8AA 1L0VB 4O1NA 4J2VA 3AEEB 5HHDG 2MBEA 1QLBB 2MJ3A 2DG5A 1TKGA 2FNJB 2Z8LA 4HXDA 5E6JA 4F5UA 2KQ7A 1N60A 4LB2A 3DPDA 3W5VB 1ZXIA 5J18A 1NYQA 3VUWA 3L17A 4A90A 1FRDA 1DOYA 5HOZA 2O2VA 1E5WA 3AE5B 1AO6A 4KSKC 3NVMA 4K2CA 3V6EB 2DHZA 3X0WA 2KJHB 4MM3B 4KV2A 5C2TB 1VCBA 5AZGA 2NBVB 4MJSB 1WGYA 4AS1A 1R7SA 2M4NA 2LUMA 3NZSA 3PT2B 3ZJTA 4W9GA 4DK5A 3JSVB 2WLBA 4TKNA 4N0UD 2ZEQA 4HRSA 1ACCA 2J0MA 5BMGA 1BXTA 1EWYC 2QHBA 1RWSA 2BXKA 2J0KA 2K39A 5BPKA 3TUOA 4MEMA 4ZYNA 5JHAA 2FCSA 1YJ1A 2JUHA 3Q8EA 1FCLA 5JZEB 2XBBC 1WY8A 4WJOA 2J42A 2Z0DB 2PLPA 4OT2A 3SD5A 1F2RC 5BYRA 1JWMD 3NVZA 1XEEA 3R66C 3QIJA 4US8A 3Q8BA 3HRDD 2PE9A 1I4RA 3TMPB 2VZKB 4TMAB 1V5TA 4W9LA 1ZKHA 4GU2A 2JRHA 2XEWA 2WP9B 2JQRB 3DBSA 2L52A 3GP7A 2I2ZA 3AEGB 3BVZA 4KZCA 4HKQA 4WURA 4GMVA 4REZA 5GXGB 2O2VB 4CYEA 3KUDB 1PGAA 2Z0EB 4JWUC 4L9QA 4FXCA 2G3QB 4K7WA 2DYMA 5D3IB 5JXVA 2AL3A 2K8HA 1VLBA 2PMVA 2BYTA 3T3NA 2J4XA 2Z8IA 5DCNA 3VUYA 3QQ8B 1WWTA 3WHQA 1V97A 1JRUA 3WAPA 2M56B 2L1AA 1GNIA 3OAWA 3LB8C 1RYJA 5E6OA 1TF0A 2XNAC 1QQRA 3CSTA 4BKSA 5HI1A 2N9LA 2WDRB 1WH3A 3TEZA 2MJEA 5LNK1 4URKA 3N30A 1UZXB 4GXBA 3NS1A 1E7GA 2DLBA 2MA9B 1FO4A 3ZNHB 4MH0E 3AE6B 2KC1A 2MW5A 2BX8A 1PGXA 1V2YA 4KGSA 4AOFA 5C3JB 3GZNI 1FXAA 1E7UA 5D7GA 2KMAA 5IA7A 4FLHA 1V1OA 1T5XD 1VFIA 4YXDB 3HUIA 1TGZB 2WWZA 4F5SA 4NAWA 3DVGX 4YL8A 1TS3A 2V3NA 3UINB 4B9KA 1WXMA 2J52A 4EMXA 2WDVB 2YEPB 4GSWA 4WJQA 4W9EA 4KGTA 4KDLB 5D94A 1UORA 2M8SA 4HVBA 1K8RB 1K51A 3AN1A 2HJ8A 4RF0A 2V3PA 1WR6E 3QCAA 5MPOA 2ONQA 3DBRI 4N59A 1J7CA 1HXYD 4OVUA 2ZVNA 4A3OA 1STEA 3P4QB 1AWDA 1WGHA 4C7ZA 4TV3A 3WA0A 1NI3A 3CF6E 4IWPA 1WGKA 3RCZA 4BKTA 2IGHA 1DGJA 2KACA 1FOUA 4BOZB 4B95A 2V1YA 1KLUD 1WM2A 4DHJB 3DWGC 1BJ5A 1UH6A 5IIHA 5G5HA 2EFHA 3NRZA 5AUIA 4IC7B 1CK1A 1L2NA 2INPE 1O9XA 1RRBA 4E99A 2IY1B 1LXDA 2KXJA 4F7ZA 3IT4B 1F9JA 2N1WA 4ZRQA 2GBNA 2NMQA 2IO0B 2RD0A 3A75A 4W9HA 2WDTB 3AU5A 3MHHB 2EKEC 2ZNVC 4NAWB 2RDGA 2JPHA 5FUOA 3P4PB 3D32A 4ZRIA 5LXIB 2BS4B 3H1UA 1MPEA 4C7YA 4ZHPA 3APDA 3OLMD 1HE8A 2M0AA 2KTFA 3R7RA 1FCCC 3KH0A 2HDEA 1XQQA 2BB5A 3KYDD 3B2FA 3DVNU 1CQVA 2DZJA 5TSSA 1PGBA 4C31B 4ANVA 2Z8JA 4JWSC 2FUHB 1UBQA 1F77A 3C8YA 2REXA 2KWDA 3S2AA 4DXAB 2DENB 3QHTA 1YX6B 4ZC6A 2Y5PA 1UELA 2G4SA 3IAS1 1ET6A 4RGOS 3URYA 2XVQA 3PZDA 4ZBQA 2W3RA 3OJ3A 4LUFA 2D5GA 3VTVA 2XN9C 2JXTA 3WIMA 1WR1A 2M1MA 2OT3A 1C78A 2W82A 2MBBB 3B9JA 2BXQA 4ZUXV 2BXIA 1YN5A 1S3SG 2EMSA 1KTKA 3VTUA 2WX1A 1YJIA 3I57A 1VZ6A 3VXWA 2HTME 4PO0A 3BK1A 3ZYYX 4P7IA 2WXRA 2G45B 1HK2A 1I4QA 1FXIA 5D3DA 2ASQA 3EHVA 2KLCA 2CKHB 4KDIC 1H8CA 2L05A 1UUPA 4X57B 5TR5A 4BVUC 2I1JA 2L00B 2MWSB 2QEJC 2LVOA 2PEAA 3NHEB 1UGMA 2PJHA 3LXFA 1P3QU 4HDOA 4A8XC 1PQSA 3VVWB 5CHVC 1RFAA 2BXCA 2LGDA 2XMOA 1NVID 1PYWD 4WH4A 2JZPA 1QOGA 2ZW0A 1G6JA 3K9OB 3Q8CA 2MX2A 3H9DA 4J3OD 1GOZA 2CR5A 2HE7A 2OOBB 2WU2B 4YTMB 2DYOA 1DOIA 2KAJA 3W9CB 3TEWA 3AEDB 1XD3B 1E7HA 1FRRA 5DQFA 1OEYA 4L23A 3BVMA 3A9JA 1I4GA 1MIVA 3KWVA 1QILA 2NBWB 5AUKA 3EFUA 3L0WB 2BYVE 2AYOB 2N9KA 1FEHA 1TYGB 3PHWB 4ANXA 2GRIA 2FIDA 4WA6B 1SSNA 2IYDB 4N6EB 1E8ZA 1C3TA 2XW1A 3KUZA 3H3AA 2L32A 1TS4A 4DBGA 2DX5B 3IVFA 4ZBRA 1WXQA 1E7AA 5L83A 4YTPB 3SEBA 3ZQ4A 5D6JB 2NPTA 2MP2A 3BY4B 1MVKA 5HKHA 2AQ3B 2V4IB 2A5UA 1C4CA 3BIID 3UIPB 2J53A 3SU8X 2BXEA 1YQ3B 1VD2A 2LXAA 2O6VD 4A55A 5CHWA 2NQOA 1MHXA 1SEBD 1E10A 1Z2MA 4JX1C 4K1RB 1F0ZA 1Q5WB 1L4DB 3LYYA 3ZDMC 4DXGA 2PPHA 4FADA 3DBHI 4IUMB 1GG3A 3ICXA 1Z5SB 2FUG1 3AU4A 4JIOU 2ZVOA 2MBHA 2GBKA 3VRBB 2MH7A 3TJPA 2XK5A 2MBQA 2KNBA 1D5XC 4KKJA 1XF5L 1FD6A 3M63B 2QJLA 4XWWA 1CJEA 4BBNC 1HZ6A 5JH5C 3A9JB 3DQVA 2KOXA 3ZRFA 1C9FA 2VUFA 4P16A 2NR2A 2WNMA 2D07B 1GB4A 4GB9A 1V80A 3VQIA 2QHOA 3ZLZA 2RGFA 4MBEC 2BKFA 5LXHA 3BYYB 3GA9L 3KUCB 2RR9A 5I4DA 2BB6A 2LWPA 2UWQA 3AH7A 5AZHA 1SIJA 2AX5A 4ARCA 3KW5B 2BPSA 1T3QA 3FC4A 4EE2A 2JY6A 3CWIA 1AN8A 2QILA 4OVZA 2GOWA 3CMMB 2NPTB 4HWIB 4N0FD 2MP2B 2KFKA 4F5VA 2FE8A 4XWTA 2LMCA 3AB5A 2LASA 2KDMA 1GC7A 2WXFA 2KDEB 4RGTA 5C23A 1FXTB 4OHJA 4YT0B 4RGMA 4GLSC 2CKXA 1WYWB 1PUTA 4AUQC 3IXSA 4HCNB 2ZPNA 1E7IA 5BMIA 1E6EB 1UD7A 2DBXA 3N3KB 2CJNA 4W9IA 3MHSB 1V9JA 3KVFB 4XDCA 1L7YA 1E7EA 2AWTA 3E56A 1NENB 2KMCA 3QK0A 4ANUA 3A1QA 3MP9A 3MTNB 4KIKA 3JW0X 4XX5A 1BM0A 3Q3FA 3CX9A 4OVVA 2GBJA 3DWMA 4KZ0A 4L9KA 2JRIB 2XK5B 1S1QB 1E7BA 2M19A 1GNUA 3LU8A 1WXVA 1D4BA 1TTNA 1OFFA 1LOTA 3DCGA 2QMTA 3ETRA 4K81A 2K3UA 1EU3A 2XSIA 1XCQL 3PO0A 1AYFA 2E0XA 4ZRPA 2NS5A 5KHQA 2W3SA 4RFBA 3WANA 2ZZPB 1YX5B 2N1VA 5T8IA 3NS8A 1JWUD 4G03A 1U4AA 5J17A 2WXPA 2K6DB 4LCDE 4W9FA 3MC0B 2D11A 4OTUA 4BFRA 4JL9A 1ZPSA 1BMLC 1J7AA 2IGGA 4LA0A 2K1FA 2V3SA 2ROHA 4AWJA 4WWOA 1UBIA 3RD2A 3VHTC 2ZPYA 3PZ7A 1XO3A 2L76A 2Y5CA 3AEAB 1ZXHA 5CHFA 1SJHD 2M17A 4L8UA 1BUIC 4MDKE 3LU7A 2KX0A 4NAMA 3VFKA 4EEWA 1MHHE 3RPFC 4DHXB 4TQ0A 1C79A 2I1KA 2FBWB 2DBYA 1J7EA 3A1QB 4RCOA 5HG2A 4GDKA 3AE3B 2IJ0A 4KIKB 3OJ4B 3PHXB 4JK4A 3AV8A 2WXQA 1AARA 2MQJA 2FCQA 1KLGD 4ZOHC 3PGEA 2JWUA 2LFIA 3JQZA 3VDZA 1SXTA 4M8NA 1N5XA 1GB1A 2PVGC 3BWUD 3O65B 1V81A 3GS2A 1WE7A 1VRAB 4WJNA 1RM6C 4BKEA 3C0RB 3EGRA 4ICVA 2MLBA 4HJKA 4E3CA 2G9HD 2PKOA 4LJOB 1GPXA 3CSFA 1T6BX 4OZAA 3VH3B 3U7ZA 3O13A 1P0RA 3PSEB 3HHMA 4EZKA 2KDFB 1IGDA 2D3GA 1E7FA 2N9PC 4FA6A 1E7VA 4I6PA 4BKGA 3U52E 3WALA 3ZNGC 2KC2A 4HROA 4K7SA 2BXOA 4JLCA 2PW9A 4FN2A 1GNJA 1XLNA 2JUOA 4WQMA 1L5PA 2GMIC 1FNUA 1IPGA 1B1ZA 4JE3B 5G55A 2K6QA 1WIAA 1WGGA 2N7EA 2N4FA 4IKGA 4IOIE 1RLFA 1HA5A 1UWMA 4MT5A 3E9SA 1VZ7A 1OQYA 1I4XA 3VR8B 2EFCA 4JPSA 2LD9A 4IM0A 4NY0A 2B3AA 2WXLA 4GDKB 2OJRA 1C77A 4HKZE 1YIWA 3TDLA 4IW0A 1MA9A 5BYSA 2K8BA 1KM7A 2BW2A 3WAOA 4HJGE 3JRYA 3K9PB 1HQRD 2LVQA 1QKZA 3HK0A 4ZBKA 3X23A 1E0ZA 2W54A 4XE0A 4R3DA 1JW9D 3APCA 1FFVA 4TQ1A 1QOFA 2XVWA 5GINA 5IIXA 1IP9A 2I30A 3B9LA 2RMMA 1OQQA 2JXXA 3T3OA 2VRRB 3W2DA 3HVDA 2E6XA 3AEBB 1WJUA 3TCAA 4B6WA 2D2QA 3P4RB 1OGWA 3KLSX 3GOEA 4ZRJA 3V05A 1IBXA 5GHKA 4G11A 1ISNA 1SIFA 3MHZA 1VR9A 4K7UA 3V62A 1E90A 3AXCA 3PREA 3EECA 2I38A 1BKEA 1NDDA 1FNVA 3ABVB 1P1AA 1WJ6A 3RUIB 5B5TA 4IW2A 3M62B 4KGRA 1ESFA 2L7RA 1J19A 1OTRB 1MIYA 2C7MB 4II2B 2CHZA 2WDQB 4NZLB 5FR6A 3I3TB 4DXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ7 A;  3EFU A;  3L0W B;  1WF9 A;  2BYV E;  2AYO B;  3DPD A;  4CHK A;  4EZJ A;  2NCN A;  5CTR C;  5J18 A;  3B08 A;  3PHW B;  4ANX A;  3VUW A;  2FID A;  3L17 A;  3ZTC A;  4F1S A;  2IYD B;  2IO2 B;  2KAN A;  3ZUN A;  1E8Z A;  1C3T A;  2M0X A;  4FJY A;  3KUZ A;  2O2V A;  1E5W A;  3APF A;  4DBG A;  4HDQ A;  1ZGU B;  4KSK C;  5J2R A;  2DX5 B;  3IVF A;  3V6E B;  2DHZ A;  1R4M I;  3X0W A;  5L83 A;  2KJH B;  1ZW7 A;  3AUL A;  2IO3 B;  5D6J B;  2NPT A;  3PRZ A;  4KV2 A;  4WWN A;  4RM9 A;  2KDB A;  2KLG A;  2MP2 A;  1VCB A;  3BY4 B;  2NBV B;  5AZG A;  3RZW C;  4A3P A;  5HKH A;  4MJS B;  1WGY A;  1GUA B;  4I6L B;  2C60 A;  2A5U A;  2KQS A;  2M4N A;  4G3X B;  4I6N B;  3UIP B;  1WGD A;  3NZS A;  4II3 B;  3PT2 B;  4MEL A;  3SU8 X;  4LJP B;  4W9G A;  1SE9 A;  4FHJ A;  2MSE D;  2V4L A;  4DK5 A;  3JSV B;  1H4R A;  4TKN A;  2J0J A;  1VD2 A;  4W9J A;  2LXA A;  4FJZ A;  2ZEQ A;  2O6V D;  3U7D A;  5CHW A;  3DOW A;  2CHX A;  2J0M A;  4EZL A;  1Z2M A;  1EF5 A;  4MGI E;  4K1R B;  3W1S C;  3IHP C;  1Q5W B;  2J0K A;  2K39 A;  2D10 A;  5C1Z A;  2BYE A;  3ZDM C;  4AJY B;  3T8M A;  4KVG B;  2PPH A;  4FAD A;  3DBH I;  4IUM B;  4MEM A;  4ZYN A;  1GG3 A;  1Z5S B;  5JHA A;  2FCS A;  3AU4 A;  1YJ1 A;  4JIO U;  4ZDV A;  5AEK B;  2BKR B;  2LJ5 A;  5JZE B;  2XBB C;  3V61 A;  1WY8 A;  3LJ3 A;  2ZVO A;  4IWO A;  1WFY A;  2PE6 B;  2MBH A;  2GBK A;  4WJO A;  3ECI A;  2Z0D B;  4NJ7 A;  2KWC A;  4HLE A;  3HM3 A;  3HM6 X;  1IYF A;  3TJP A;  3HIZ A;  2XK5 A;  3SD5 A;  2MBQ A;  2KNB A;  4GDL A;  3M63 B;  4DDG D;  3RT3 B;  3PLV A;  3H6N A;  3U8Z A;  3R66 C;  3QIJ A;  4BBN C;  2KK8 A;  5JH5 C;  3A9J B;  5IAA C;  5EDS A;  4W9D A;  3DQV A;  2KOX A;  2PE9 A;  3ZRF A;  3TMP B;  1D3Z A;  1V5T A;  3IG3 A;  2NR2 A;  4W9L A;  1ZKH A;  4JGH B;  4GU2 A;  2D07 B;  1WM3 A;  4GB9 A;  2ZNV B;  1V80 A;  2JRH A;  3VQI A;  2QHO A;  3PPA A;  3ZTD A;  4EFO A;  2XEW A;  3W1Y A;  3ZLZ A;  1I35 A;  2RGF A;  3DBS A;  2BKF A;  3QJZ A;  5LXH A;  3ZNI D;  1R4N I;  5LLI A;  4PS7 A;  4NJ6 A;  4GIV A;  2MBO A;  4M8M A;  2NBU A;  4KZC A;  3KUC B;  3PRM B;  2RR9 A;  4GMV A;  2O2V B;  2LWP A;  2UWQ A;  4HK2 A;  3ENE A;  5AZH A;  4CYE A;  1GJZ A;  3KUD B;  3KW5 B;  2BPS A;  2Z0E B;  4FHK A;  1J0G A;  3ZW3 A;  2G3Q B;  4K7W A;  2DYM A;  2JY6 A;  2CHW A;  2GOW A;  3CMM B;  2AL3 A;  2K8H A;  2CU1 A;  4IM3 A;  2NPT B;  4JQW C;  4E74 A;  4HWI B;  3DVN V;  2MP2 B;  2N7D A;  2KFK A;  2DZI A;  3L13 A;  3UIO B;  4CO7 A;  2RPQ A;  5DCN A;  3VUY A;  3R3M A;  1WE6 A;  3QQ8 B;  2KWV B;  2LAS A;  4W9K A;  4ICU A;  1JRU A;  4DHZ E;  3WAP A;  5E6P A;  1GC7 A;  2KDE B;  3OAW A;  5C23 A;  1FXT B;  3B1L X;  2YVC A;  3L08 A;  5E6O A;  3ZDT A;  1WYW B;  2LGY A;  3CST A;  4AUQ C;  4BKS A;  3QAR A;  1WZ0 A;  4HCN B;  2A4Z A;  2ZPN A;  3UF8 A;  1WH3 A;  1X1M A;  3ZKJ C;  3UQB A;  2BYF A;  1UD7 A;  4LDT D;  3N3K B;  3ZIM A;  4W9I A;  4URK A;  3KVF B;  1V9J A;  1L7Y A;  3N30 A;  1UZX B;  2KJR A;  4GXB A;  2AWT A;  3JYU A;  2KMC A;  2MA9 B;  1KLV A;  1V6E A;  1NI2 A;  4PYU A;  3QK0 A;  3ZNH B;  4MH0 E;  4MGY E;  3A1Q A;  4ANU A;  3DDC B;  4RM8 A;  3MTN B;  4KIK A;  3JW0 X;  4XX5 A;  3PV1 A;  3Q3F A;  2DAF A;  2WX0 A;  2KC1 A;  2GBJ A;  4OVV A;  4W9C A;  4KZ0 A;  4PYZ A;  2BGF A;  2JF5 A;  2JRI B;  2XK5 B;  1S1Q B;  2MW5 A;  1SGH A;  1P9D U;  4NQK E;  5DPR A;  1GNU A;  1WXV A;  3H7P A;  4KSL C;  4GDL B;  3NZU A;  1J8C A;  2K8C A;  1TTN A;  1V2Y A;  4AOF A;  2LXC A;  2R2Q A;  3WAM A;  2KKC A;  3DCG A;  3GZN I;  4GGQ A;  1E7U A;  5D7G A;  2KMA A;  4K81 A;  4XZ4 A;  5IA7 A;  4FLH A;  4FUL A;  4HCP B;  3RZF A;  2J7Q B;  2WYQ A;  1TGZ B;  2WWZ A;  4NAW A;  3DVG X;  4YL8 A;  3N32 A;  4TUU A;  2UYZ B;  2NS5 A;  4J6I A;  5KHQ A;  1Y8R C;  3UIN B;  4B9K A;  1WXM A;  2HD5 B;  1WJN A;  4BBN F;  4GOC A;  3WAN A;  1A5R A;  4DWF A;  5KHO A;  2ZZP B;  3KYC D;  1YX5 B;  2LI5 A;  4GSW A;  4W9E A;  2N1V A;  4WJQ A;  2JWZ A;  2AEH A;  3NS8 A;  4KDL B;  3ML9 A;  2BWF A;  4DDI D;  3L54 A;  1OEY J;  1V86 A;  5D94 A;  5DPS A;  3VH4 B;  3QX1 A;  5DPW A;  4FJV B;  2R2O A;  1U4A A;  2AL6 A;  5J17 A;  2M8S A;  4NPN A;  4HVB A;  3W1S A;  4IM2 A;  1K8R B;  2DZM A;  3ALB A;  2BF8 B;  1KOT A;  2K6D B;  2HJ8 A;  4LCD E;  5AZF A;  3B0A A;  4W9F A;  1WR6 E;  2O6V A;  2D11 A;  2C9W B;  3QCA A;  4XC2 A;  1NBF C;  4WJP A;  2YLM A;  3DBL I;  3L16 A;  3DBR I;  4BFR A;  4JL9 A;  2N9X A;  4EUT A;  4A20 A;  3MJW A;  4OVU A;  2GBR A;  2K1F A;  2V3S A;  2ZVN A;  4A3O A;  4AWJ A;  1TBE A;  1WGH A;  1UBI A;  2KZR A;  4WWO A;  4TV3 A;  3RD2 A;  3WA0 A;  3AI5 A;  3VHT C;  1CMX B;  2C5L C;  2N9E B;  3CF6 E;  1C1Y B;  2EMT A;  2ZPY A;  3PTF C;  4IWP A;  2MRP A;  3TL5 A;  1QZE A;  3RCZ A;  4BKT A;  4ANW A;  3PRP B;  1E8X A;  2L76 A;  2Z59 B;  3ZVV A;  2IBI B;  5CHF A;  2KHW B;  4BOZ B;  2M17 A;  4HPM B;  4MDK E;  4B95 A;  2V1Y A;  1WM2 A;  3QA8 A;  2KX0 A;  2HTH A;  4M0W B;  1KJT A;  3VFK A;  4EEW A;  4DHJ B;  1UH6 A;  4TQ0 A;  3ZO5 B;  2I1K A;  4IC7 B;  1L2N A;  3A1Q B;  4MGZ E;  5DPT A;  2RSU A;  4GDK A;  4KIK B;  5CX3 A;  4MSQ B;  3OJ4 B;  1I42 A;  1RRB A;  2FCN A;  3PHX B;  3NOB A;  1EO6 A;  1RAX A;  2IY1 B;  3QC8 B;  1P98 A;  1LXD A;  1AAR A;  2KXJ A;  3H7P B;  2MQJ A;  1F9J A;  5D2M B;  2N1W A;  2FCQ A;  4F7Z A;  2GBN A;  3L10 B;  4WAA A;  2IO0 B;  3PGE A;  2RD0 A;  4W9H A;  2DAJ A;  5GMV A;  3VDZ A;  1V49 A;  2WDT B;  4FBJ B;  3QWZ B;  4M8N A;  3O65 B;  1WI0 A;  2BWE S;  2Y5B B;  1XT9 B;  1T0Y A;  3AU5 A;  2KTR A;  1V81 A;  2EKE C;  4PS3 A;  2ZNV C;  4NAW B;  2FAZ A;  2JPH A;  1WE7 A;  4GN1 A;  3D32 A;  4WJN A;  4ZRI A;  2NVU I;  5LXI B;  2K25 A;  3C0R B;  3H1U A;  4ICV A;  2MLB A;  4HJK A;  4E3C A;  3SDL C;  4WQO B;  3APD A;  3OLM D;  1HE8 A;  3P2B A;  4LJO B;  2MCN B;  3TIX A;  3CSF A;  5L95 C;  1GC6 A;  2KTF A;  1LFD A;  3R7R A;  3VH3 B;  3KH0 A;  1P0R A;  1XQQ A;  3PSE B;  3HHM A;  1M94 A;  4EZK A;  2JT4 B;  3KYD D;  3ML8 A;  3SHQ A;  3DVN U;  1WX8 A;  2KDF B;  1WXA A;  1WMH A;  2DZJ A;  2LUE A;  2D3G A;  2DYB A;  2N9P C;  4FA6 A;  1E7V A;  2KX3 A;  4I6P A;  2O6V B;  4RMA A;  4ANV A;  4BKG A;  2FUH B;  4EKU A;  1UBQ A;  3WAL A;  3ZNG C;  2KC2 A;  2KFJ A;  4G0N B;  2W9N A;  4K7S A;  2REX A;  4ZRK A;  5G2N A;  3S2A A;  4DXA B;  2DEN B;  4JLC A;  3QHT A;  2ZCC A;  1YX6 B;  4FN2 A;  2L3Z A;  3A9K A;  1UEL A;  4HPL B;  2G4S A;  1WX7 A;  3MHS D;  4NNJ B;  2JUO A;  2GMI C;  1WX9 A;  2KO3 A;  3RYT A;  4EOY A;  3DVG Y;  3PZD A;  3OJ3 A;  3VUX A;  1IPG A;  2L8J A;  2ZCB A;  3VTV A;  5G55 A;  3V60 A;  1TZ1 A;  2K6Q A;  4ASW C;  1WJ4 A;  3WIM A;  1WIA A;  1WGG A;  2N7E A;  1WR1 A;  2N4F A;  4AP4 C;  5BO4 B;  2M1M A;  1BT0 A;  1RLF A;  4PS8 A;  1WRD B;  1WGR A;  2MBB B;  3VAW A;  1E8W A;  1OQY A;  3RUL A;  3A33 B;  1V5O A;  2KWU B;  4IWQ A;  3A4S C;  2LD9 A;  4IM0 A;  1S3S G;  2B3A A;  2L0T A;  2EMS A;  4NY0 A;  5E6N A;  2IZV B;  3NY5 A;  3VTU A;  1LQB A;  4GDK B;  2OJR A;  2WX1 A;  4MSM B;  3V6C B;  2JZZ A;  3VXW A;  1YIW A;  3PVL A;  3ONS A;  3PLU A;  4P7I A;  4IW0 A;  2FIF A;  2KFK B;  2G45 B;  3TBL D;  1YD8 U;  2K8B A;  2FCM A;  1KM7 A;  4WWP A;  3WAO A;  2ASQ A;  3EHV A;  3K9P B;  3M95 A;  2LVQ A;  3UGB B;  4MM3 A;  3HK0 A;  3X23 A;  1WZ3 A;  3UQA A;  2LZ6 A;  2KLC A;  2CKH B;  4KDI C;  3IFW B;  2KTR B;  4BOS C;  2L05 A;  2C7N B;  3APC A;  4MJS A;  1H8C A;  4TQ1 A;  2KJ6 A;  2CS4 A;  4NQL B;  2DZK A;  1IP9 A;  2KVR A;  4X57 B;  5TR5 A;  3U30 A;  3ZNZ B;  4BVU C;  2I1J A;  2JXX A;  2L00 B;  2MWS B;  3JSV A;  3PS6 A;  2LVO A;  2PEA A;  2VRR B;  3NHE B;  1UGM A;  3QAQ A;  2PJH A;  1WXS A;  1WJU A;  1P3Q U;  2G4D B;  1Q0W B;  4HDO A;  3TCA A;  4MGK E;  5JHB A;  4DHZ B;  1EF1 A;  1PQS A;  4B6W A;  3BIN A;  2D2Q A;  2LRU A;  4G50 A;  4F8C B;  4E71 A;  3VVW B;  3M3J A;  2L0F A;  2KD0 A;  1OGW A;  1WMH B;  3GOE A;  5CHV C;  4ZRJ A;  1RFA A;  2LRW A;  2KDI A;  3T9L A;  2LGD A;  4G11 A;  1ISN A;  3JVZ X;  3A4R A;  3H7S A;  1SIF A;  1E8Y A;  4BKS D;  1Q1O A;  2ZJD A;  2LVP A;  3EC8 A;  2C7H A;  2LGX A;  2IO1 B;  3LDZ E;  3Q3J A;  4K7U A;  1E90 A;  3AXC A;  3K9O B;  3V62 A;  1G6J A;  1EUV B;  3PRE A;  2MX2 A;  3EEC A;  3H9D A;  2JVC A;  2JZ3 B;  2CR5 A;  2HE7 A;  2IY0 B;  3A9K B;  2GBM A;  1NDD A;  2OOB B;  3IBE A;  4IG7 B;  4LDT B;  3VTW A;  3ZRC A;  4AJW A;  4DHJ D;  2DYO A;  3R7Q A;  1P1A A;  1MG8 A;  1WJ6 A;  3RUI B;  1XD3 B;  3M62 B;  1OEY A;  2MBE A;  2L7R A;  1J19 A;  4N9F 4;  3A9J A;  1LM8 B;  1OTR B;  2C7M B;  4II2 B;  2CHZ A;  2FNJ B;  1YQB A;  4HXD A;  2NBW B;  2KN5 A;  5FR6 A;  3I3T B; 
#chains in the Genus database with same CATH topology
 1WF9 A;  3I63 C;  2QIE B;  5CTR C;  3B08 A;  3NVW A;  3ZTC A;  4ITK A;  4F1S A;  2IO2 B;  3MC9 A;  3ZUN A;  4H2A A;  2M0X A;  3A73 A;  4US9 A;  1KXP D;  4N3Z A;  4K71 A;  2AQ1 B;  3P4S B;  2H89 B;  4ACF A;  5J2R A;  1V1P A;  4S1Y A;  3RNE C;  1R4M I;  1ZW7 A;  3AUL A;  2IO3 B;  3PRZ A;  2KDB A;  4Q2J A;  4GG2 A;  1ENF A;  4A3P A;  2LHE A;  1GUA B;  4I6N B;  1WGD A;  4LJP B;  1SE9 A;  1K52 A;  3SR6 A;  2J0J A;  4W9J A;  3DOW A;  3KIK A;  4EZL A;  4MGI E;  3W1S C;  2BTE A;  3RI7 C;  5C1Z A;  2BYE A;  1N6Z A;  1I4P A;  4AJY B;  3T8M A;  1IBX B;  2X38 A;  2ON8 A;  2V0G A;  1XXG A;  2WQY B;  2VUE A;  2ZW1 A;  3GB1 A;  2BKR B;  2LJ5 A;  2OHF A;  2PE6 B;  4NJ7 A;  2LQH A;  4HLE A;  3AE9 B;  1JQ4 A;  2K5P A;  1TY2 A;  4GDL A;  1HA2 A;  1N5U A;  4DDG D;  1K50 A;  2LGS A;  5BYQ A;  1UNS A;  3GZN B;  4W9D A;  1IUE A;  1D3Z A;  3IG3 A;  4JGH B;  2ZNV B;  3PPA A;  3ZTD A;  4EFO A;  2EEL A;  3W1Y A;  2WXO A;  1R4N I;  5LLI A;  4PS7 A;  4GIV A;  4M8M A;  2NBU A;  3PRM B;  3R2T A;  1QT9 A;  2QCZ A;  1V1P B;  4MH8 A;  3OWE B;  2CHW A;  5DBY A;  3L4P A;  3NVK A;  4JQW C;  4RH6 A;  1SE2 A;  2N7D A;  2DZI A;  4CO7 A;  3Q3M C;  3WHR A;  3R3M A;  3DBR B;  4ICU A;  1QOB A;  5E6P A;  3B1L X;  3L08 A;  4HGM B;  1QOA A;  2LGY A;  4KX6 B;  1WZ0 A;  2UU7 A;  5IO9 A;  3UF8 A;  5HFY A;  2DBW A;  3UQB A;  2BYF A;  4LDT D;  4M0W A;  2INC C;  2QMC A;  2KJR A;  1I7H A;  1NI2 A;  4PYU A;  2CJO A;  3V3X A;  4RM8 A;  2EFE A;  4YSX B;  1MG4 A;  1KFY B;  2WX0 A;  4W9C A;  1L0X B;  2BGF A;  2ICI A;  1SGH A;  1P9D U;  4NQK E;  2D3B A;  1TXU A;  2SAK A;  4GDL B;  1J8C A;  2LXC A;  4NJC A;  2VDB A;  4GGQ A;  1SJE D;  1D5Z C;  4XZ4 A;  1MIW A;  5ID9 A;  3RZF A;  2WXI A;  4DQO C;  2J7Q B;  2WYQ A;  2G1E A;  3N1X C;  2BS2 B;  1Y8R C;  5H92 C;  2H88 B;  2HD5 B;  5BMH A;  1WJN A;  4BBN F;  4GOC A;  1A5R A;  4DWF A;  2JX5 A;  2E3T A;  3RN9 C;  4C80 A;  4LNI A;  2JWZ A;  2AEH A;  2RDH A;  2GI9 A;  4DDI D;  1OEY J;  1V86 A;  5DPS A;  2R2O A;  4RNA A;  4IM2 A;  4M70 B;  2BF8 B;  2LOQ A;  5AZF A;  3B0A A;  1CZP A;  2CU3 A;  2O6V A;  3DHI C;  4WJP A;  3L16 A;  2LJI A;  2N9X A;  4A20 A;  3MJW A;  3Q3N C;  4XDD A;  1L6U A;  1TBE A;  2KZR A;  5IFO A;  1ZP0 B;  3FKY A;  2RPV A;  1PFD A;  2DWQ A;  2EMT A;  3TL5 A;  3TEY A;  1C76 A;  3NMU A;  2IBI B;  1D5M C;  2YDF A;  3QA8 A;  4M0W B;  2EFD A;  1KJT A;  1YOV B;  2IDY A;  3ZJU A;  2BXG A;  3ZO5 B;  4ARI A;  2WXK A;  5DPT A;  4BY9 C;  5CX3 A;  3AE7 B;  2VZK D;  4F5T A;  2FCN A;  2Y3A A;  1P98 A;  5D2M B;  1HK5 A;  3ZJV A;  1HTO A;  2PIA A;  2DAJ A;  1V49 A;  3P42 A;  4FBJ B;  3QWZ B;  1XLP A;  2I2Y A;  2Y5B B;  1T0Y A;  3R2I A;  2KTR A;  4OW0 A;  4PS3 A;  2IGD A;  2FAZ A;  1F2R I;  3NG0 A;  3N9Y C;  2V36 A;  2NVU I;  2K25 A;  2E0Y A;  1E78 A;  3SDL C;  4WQO B;  2KQ4 X;  3P2B A;  4LLG M;  3TIX A;  2MCN B;  1GC6 A;  4C4V A;  2BXH A;  1M94 A;  2JT4 B;  4K3C A;  2WXJ A;  1WX8 A;  1WXA A;  1WMH A;  4M01 A;  3BK2 A;  1EU4 A;  1IGC A;  2DYB A;  1B9R A;  2KX3 A;  2O6V B;  4EKU A;  2KFJ A;  1E7P B;  4G0N B;  2W9N A;  2IPK D;  4ZRK A;  3M99 C;  4LUH A;  2L3Z A;  1TS5 A;  4HPL B;  2JYE A;  4CQN A;  1JRO A;  1WX7 A;  3NVI A;  3MFG A;  2KO3 A;  3RYT A;  1LNS A;  4EOY A;  3DVG Y;  3VUX A;  2ZCB A;  3V60 A;  3KJL A;  4C56 C;  1BT0 A;  4PS8 A;  1WRD B;  1YN4 A;  1WGR A;  2MHJ A;  1P7F A;  3H37 A;  1E8W A;  1HK4 A;  3RUL A;  3NVY A;  1V5O A;  2KWU B;  3H8H A;  2MEK A;  3A4S C;  3I9V 1;  1XLQ A;  2L0T A;  4IW1 A;  2IZV B;  3NY5 A;  1LQB A;  3V6C B;  4YTN B;  1YQ4 B;  1YMH E;  1L0Y B;  1N61 A;  2YEP F;  2FIF A;  2XVV A;  2KFK B;  3UI3 A;  1YD8 U;  3FWC C;  3NZ3 A;  4HEA 1;  4A6Q A;  1WZ3 A;  1FM0 D;  2LZ6 A;  4WIP A;  1GAQ B;  1HZ5 A;  3IFW B;  4FK5 B;  1ZE3 D;  2KTR B;  4MAC A;  2C7N B;  3SIU B;  4L1B A;  2KJ6 A;  2CS4 A;  3KWL A;  5G5G A;  4C00 A;  5EE1 A;  1SB3 C;  1E7C A;  3U30 A;  3FIL A;  2BXA A;  3PS6 A;  1WXS A;  2G4D B;  1SE3 A;  4C4V B;  1Q0W B;  1L4Z B;  1QF6 A;  3HVZ A;  4F8C B;  4G50 A;  2L0F A;  2KD0 A;  1FIQ A;  4G01 A;  1WMH B;  3T9L A;  1KW2 A;  2DBU A;  3JVZ X;  1VJK A;  3PLA A;  1E8Y A;  3SFE B;  4BKS D;  3NUH B;  2ZJD A;  3RNC C;  2K9X A;  2C7H A;  2LGX A;  2IO1 B;  3Q3J A;  2NNW A;  1EUV B;  2GBM A;  3IAM 1;  1TKY A;  4DHJ D;  3R7Q A;  4B0M A;  1MG8 A;  4IDI A;  2BXD A;  2N0S B;  2LQI A;  1ZOY B;  1HK3 A;  4N9F 4;  1EWC A;  3Q14 C;  4FIP B;  1LM8 B;  3AE1 B;  3AEC B;  5IJ5 A;  5EE0 A;  1YQB A;  2KN5 A;  1JWA D;  4CHK A;  4EZJ A;  2NCN A;  3G9K D;  2L83 A;  2Z8K A;  2B76 B;  3AEF B;  2ACZ B;  2BXP A;  2KAN A;  4FJY A;  3APF A;  1MUS A;  2AJE A;  4HDQ A;  1ZGU B;  3B2G A;  1JWS D;  5GIO A;  5IP4 D;  2PTL A;  3FAH A;  1JAL A;  2WS3 B;  5ID7 A;  4WWN A;  4RM9 A;  2KLG A;  3RZW C;  3EUB 2;  4I6L B;  2C60 A;  2KQS A;  4G3X B;  4II3 B;  4MEL A;  1N63 A;  3FIL B;  4FHJ A;  2MSE D;  4ZCG A;  1I4H A;  4L2Y A;  2V4L A;  1H4R A;  4OR0 A;  4FJZ A;  3U7D A;  5GIP A;  2CHX A;  2BXL A;  1EF5 A;  2WGS A;  4D2K A;  3IHP C;  1FFU A;  2WXM A;  2D10 A;  3Q69 A;  2WXG A;  3R8B A;  5H8Y E;  3SQJ A;  4GDX A;  4KVG B;  1ZDX A;  2N7J A;  5AEK B;  4ZDV A;  2LHD A;  2OZB B;  1FNW A;  3V61 A;  3LJ3 A;  3RNA C;  4IWO A;  3FWB C;  1WFY A;  3ECI A;  1WRI A;  2KWC A;  3HM3 A;  3HM6 X;  1IYF A;  3Q2A C;  3HIZ A;  1H9Z A;  1YJJ A;  5IJE A;  4YWG G;  3RFZ B;  1XLO A;  3RT3 B;  3PLV A;  3H6N A;  3U8Z A;  1JCK B;  3P63 A;  2KK8 A;  1A70 A;  3WHS A;  1UWX A;  5IAA C;  5EDS A;  3KQ4 A;  2NTS A;  1WM3 A;  1I35 A;  1KH0 A;  3QJZ A;  3ZNI D;  4NJ6 A;  2MBO A;  1C4A A;  1YN3 A;  1DYQ A;  5IJF A;  4HK2 A;  3ENE A;  1GJZ A;  4FHK A;  1J0G A;  5FKA C;  3ZW3 A;  1N5W A;  1L6V A;  2LGI A;  2CU1 A;  4IM3 A;  4LNK A;  2NTT A;  4LB9 A;  4WWM A;  4E74 A;  3DVN V;  3L13 A;  3UIO B;  3N1Z C;  2RPQ A;  2OED A;  1T0Q C;  1WE6 A;  2KWV B;  3AMZ A;  4W9K A;  3BVG A;  4DHZ E;  3J9C A;  1NT2 B;  3AE8 B;  2YVC A;  2QM6 A;  3W5U B;  3ZDT A;  2V9H A;  3QAR A;  4OZC A;  2A4Z A;  1ZDV A;  2XW0 A;  1X1M A;  1TKE A;  4HGK A;  3ZKJ C;  3ZIM A;  2AQ2 B;  3JYU A;  1KLV A;  1V6E A;  1VDV A;  4MGY E;  1EM7 A;  3DDC B;  5IIU A;  3AE2 B;  3PV1 A;  2DAF A;  4UDU C;  4PYZ A;  2JF5 A;  4ZHO A;  5EE9 A;  5DPR A;  3H7P A;  2WXH A;  3NZU A;  4KSL C;  1C4P A;  2K8C A;  2R2Q A;  3WAM A;  2KKC A;  3VRA B;  4FUL A;  4HCP B;  2JU6 X;  2QSD A;  2BT6 A;  3N32 A;  3VR9 B;  4TUU A;  1NEK B;  2UYZ B;  1HK1 A;  1FMA D;  4J6I A;  4KKI A;  5FK9 C;  4ZYS A;  2D3C A;  5KHO A;  3KYC D;  2LI5 A;  1J7B A;  3ML9 A;  2BWF A;  3L54 A;  3VH4 B;  3QX1 A;  1FPY A;  4FJV B;  5DPW A;  2AL6 A;  4NPN A;  3W1S A;  2DZM A;  3ALB A;  2BXB A;  1KOT A;  2C9W B;  4XC2 A;  1NBF C;  1JML A;  2YLM A;  3DBL I;  4EUT A;  2GBR A;  1E9M A;  4FJC B;  3AI5 A;  2PVO D;  3TEX A;  1CMX B;  1TJE A;  2BBC A;  2C5L C;  1C1Y B;  2N9E B;  3P1M A;  3PTF C;  2MRP A;  3AE4 B;  1QZE A;  1RFK A;  4ANW A;  3PRP B;  1Q10 A;  1E8X A;  2Z59 B;  3ZVV A;  3V09 A;  1PDX A;  2KHW B;  1F1H A;  4HPM B;  3ZXV A;  1D6E C;  3ZGZ A;  3U4E G;  1M4V A;  3B9M A;  2HTH A;  1MI0 A;  2IND C;  4USA A;  2SEB D;  1F52 A;  3FNM A;  1Y56 A;  4MGZ E;  2RSU A;  1ROE A;  4MSQ B;  1JWB D;  2EKI A;  1I42 A;  2JYT A;  3NVV A;  3IT6 B;  3NOB A;  1H5W A;  1EO6 A;  1RAX A;  1JRP A;  3QC8 B;  4W4U B;  3H7P B;  1YNT E;  2GLS A;  3L10 B;  4WAA A;  5GMV A;  1K53 A;  4P1C C;  4Z9O A;  4PK1 A;  4LK0 M;  2K0P A;  1WI0 A;  2BWE S;  1XT9 B;  3SIV B;  5FR3 A;  3V03 A;  4P6V F;  4RF1 A;  4GN1 A;  3GQU A;  1UGJ A;  2TSS A;  1HEZ E;  4N58 A;  4OZB A;  5L95 C;  1MUH A;  1ZUD 2;  3V08 A;  2LEK A;  1LFD A;  4LTU A;  1JNB A;  1AW7 A;  2BXN A;  3ML8 A;  3SHQ A;  4M02 A;  1SE4 A;  4LNN A;  2WU5 B;  4YSZ B;  1KDX A;  4Z69 A;  2LUE A;  4PT5 A;  4RMA A;  2MJD A;  4YSY B;  4B0E A;  5EE3 A;  4A9A A;  1DOX A;  1WYG A;  5G2N A;  1VZS A;  2ZCC A;  3TSS A;  3A9K A;  3UIV A;  4NNJ B;  3MHS D;  2KBZ A;  2OJW A;  1WX9 A;  2JSV X;  3LU6 A;  2L8J A;  1IJG A;  1TZ1 A;  4ASW C;  1WJ4 A;  2Q5W D;  4AP4 C;  5BO4 B;  4AQ7 A;  1TY0 A;  3U2S C;  1KRH A;  3VAW A;  2KMM A;  3A33 B;  4IWQ A;  2BXM A;  3WCQ A;  1ET9 A;  5E6N A;  4MSM B;  3Q8F A;  3AM9 A;  2JZZ A;  2KN4 A;  3CIR B;  3PVL A;  3SFD B;  3BZD B;  3ONS A;  3PLU A;  2BXF A;  3TBL D;  2FCM A;  1J78 A;  4WWP A;  1NYR A;  1SBB B;  2D3A A;  3NJT A;  3M95 A;  3UGB B;  4MM3 A;  2XVU A;  1WSP A;  3PZ8 A;  3UQA A;  4BOS C;  2VH1 A;  4MJS A;  4TSS A;  1XCT L;  4NQL B;  1P7E A;  2DZK A;  2KVR A;  1TS2 A;  2BS3 B;  2K22 A;  1LO5 D;  3ZNZ B;  2R61 A;  3JSV A;  4RGN A;  3QAQ A;  1LGR A;  4WAF A;  1SF0 A;  3RNF C;  2GB1 A;  1N62 A;  4MGK E;  5JHB A;  4DHZ B;  1EF1 A;  2W55 A;  3BIN A;  2LRU A;  4G04 A;  4E71 A;  1KF6 B;  3M3J A;  3EA6 A;  2LRW A;  2KDI A;  1OQR A;  3BYT B;  3GQX A;  3A4R A;  3H7S A;  1Q1O A;  2DNF A;  2LVP A;  2INN E;  3EC8 A;  1VZ8 A;  3LDZ E;  1MJD A;  1TZO A;  2JVC A;  2JZ3 B;  3MJ5 A;  3A9K B;  2IY0 B;  3IBE A;  4IG7 B;  4LDT B;  4AJW A;  3ZRC A;  4OTT A;  3VTW A;  2WXN A;  1V8C A;  3Q8A A;  1L0V B;  4O1N A;  4J2V A;  3AEE B;  5HHD G;  2MBE A;  1QLB B;  2MJ3 A;  2DG5 A;  1TKG A;  2FNJ B;  2Z8L A;  4HXD A;  5E6J A;  4F5U A;  1N60 A;  2KQ7 A;  4LB2 A;  3DPD A;  3W5V B;  1ZXI A;  5J18 A;  1NYQ A;  3VUW A;  3L17 A;  4A90 A;  1T0S C;  1FRD A;  1DOY A;  1SB0 A;  5HOZ A;  2O2V A;  1E5W A;  3AE5 B;  1AO6 A;  4KSK C;  3NVM A;  4K2C A;  3V6E B;  2DHZ A;  3X0W A;  2KJH B;  4MM3 B;  4KV2 A;  5C2T B;  1VCB A;  5AZG A;  2NBV B;  4MJS B;  1WGY A;  4AS1 A;  1R7S A;  2M4N A;  2LUM A;  2KVZ A;  3NZS A;  3PT2 B;  3ZJT A;  4W9G A;  4DK5 A;  3JSV B;  2WLB A;  4TKN A;  4N0U D;  2ZEQ A;  4HRS A;  1ACC A;  2J0M A;  5BMG A;  1BXT A;  1EWY C;  2QHB A;  1RWS A;  2BXK A;  2J0K A;  2K39 A;  5BPK A;  3TUO A;  3EFC A;  4MEM A;  4ZYN A;  5JHA A;  2FCS A;  1YJ1 A;  2JUH A;  3Q8E A;  1FCL A;  5JZE B;  2XBB C;  1WY8 A;  4WJO A;  2J42 A;  2PLP A;  2Z0D B;  4OT2 A;  3SD5 A;  1F2R C;  5BYR A;  1JWM D;  3NVZ A;  1XEE A;  3R66 C;  3QIJ A;  4US8 A;  3Q8B A;  3HRD D;  2PE9 A;  1I4R A;  2VZK B;  4TMA B;  3TMP B;  1V5T A;  4W9L A;  1ZKH A;  4GU2 A;  3RNB C;  2JRH A;  2WP9 B;  2XEW A;  2JQR B;  3DBS A;  2L52 A;  3GP7 A;  2I2Z A;  3AEG B;  3BVZ A;  4KZC A;  4HKQ A;  3DBH B;  4GMV A;  4WUR A;  4REZ A;  5GXG B;  2O2V B;  4XGA B;  4CYE A;  3KUD B;  1PGA A;  2Z0E B;  4JWU C;  4L9Q A;  4FXC A;  2G3Q B;  4K7W A;  2DYM A;  5D3I B;  5JXV A;  1VLB A;  2AL3 A;  2K8H A;  2PMV A;  2BYT A;  3T3N A;  2J4X A;  2Z8I A;  5DCN A;  3VUY A;  3QQ8 B;  1WWT A;  3WHQ A;  3N1Y C;  1V97 A;  1JRU A;  3WAP A;  2M56 B;  2L1A A;  1GNI A;  3OAW A;  3LB8 C;  1RYJ A;  5E6O A;  1TF0 A;  2XNA C;  1QQR A;  3CST A;  4BKS A;  5HI1 A;  2N9L A;  2WDR B;  1WH3 A;  3TEZ A;  2VH2 A;  2MJE A;  5LNK 1;  4URK A;  3N30 A;  1UZX B;  3NS1 A;  4GXB A;  1E7G A;  2DLB A;  2MA9 B;  1FO4 A;  3ZNH B;  4MH0 E;  3AE6 B;  2KC1 A;  2MW5 A;  2BX8 A;  1PGX A;  1V2Y A;  4KGS A;  4AOF A;  5C3J B;  3GZN I;  3ZXR A;  1FXA A;  1E7U A;  5D7G A;  2KMA A;  4QAY A;  5IA7 A;  4FLH A;  1V1O A;  1T5X D;  1VFI A;  4YXD B;  3HUI A;  1TGZ B;  2WWZ A;  4F5S A;  4NAW A;  3DVG X;  1TS3 A;  2V3N A;  4YL8 A;  2K0N A;  3UIN B;  4B9K A;  1WXM A;  2J52 A;  4EMX A;  4BZA A;  2WDV B;  2YEP B;  4GSW A;  4WJQ A;  4W9E A;  4KGT A;  4KDL B;  2GUT A;  4P1B C;  5D94 A;  1UOR A;  2M8S A;  4HVB A;  1K8R B;  1K51 A;  3AN1 A;  2HJ8 A;  4RF0 A;  2V3P A;  1WR6 E;  3QCA A;  5MPO A;  2ONQ A;  1TIF A;  3DBR I;  4N59 A;  1J7C A;  1HXY D;  4OVU A;  2ZVN A;  4A3O A;  1STE A;  3P4Q B;  1AWD A;  1WGH A;  4C7Z A;  4TV3 A;  2AGH B;  3WA0 A;  1NI3 A;  3CF6 E;  4IWP A;  1WGK A;  2IGH A;  3RCZ A;  4BKT A;  1DGJ A;  2KAC A;  1FOU A;  4BOZ B;  4B95 A;  2V1Y A;  1KLU D;  1WM2 A;  2RDB C;  4DHJ B;  3DWG C;  1BJ5 A;  1UH6 A;  2QC8 A;  5IIH A;  5G5H A;  2EFH A;  3NRZ A;  5AUI A;  4IC7 B;  1CK1 A;  1L2N A;  2INP E;  1O9X A;  1RRB A;  5IKC M;  4E99 A;  2IY1 B;  4XYC A;  1LXD A;  2KXJ A;  3IT4 B;  4F7Z A;  1F9J A;  2N1W A;  4ZRQ A;  2GBN A;  2NMQ A;  2IO0 B;  2RD0 A;  3A75 A;  4W9H A;  2WDT B;  3AU5 A;  3MHH B;  2EKE C;  2ZNV C;  4NAW B;  2RDG A;  2JPH A;  5FUO A;  3P4P B;  3D32 A;  4ZRI A;  5LXI B;  2BS4 B;  3H1U A;  1MPE A;  3OG5 A;  4C7Y A;  4ZHP A;  3I5J C;  3APD A;  3OLM D;  1HE8 A;  2M0A A;  2KTF A;  3R7R A;  1FCC C;  3KH0 A;  2HDE A;  1XQQ A;  2BB5 A;  3KYD D;  3B2F A;  3DVN U;  1CQV A;  2DZJ A;  5TSS A;  1PGB A;  4C31 B;  4ANV A;  2Z8J A;  4JWS C;  2FUH B;  1UBQ A;  1F77 A;  3C8Y A;  2KWD A;  2REX A;  3S2A A;  4DXA B;  2DEN B;  3QHT A;  1YX6 B;  4ZC6 A;  2Y5P A;  1UEL A;  2G4S A;  3IAS 1;  1ET6 A;  4RGO S;  3URY A;  2XVQ A;  3PZD A;  4ZBQ A;  2W3R A;  3OJ3 A;  4LUF A;  2D5G A;  2XN9 C;  3VTV A;  2JXT A;  3WIM A;  1WR1 A;  4S0R A;  2M1M A;  2OT3 A;  1C78 A;  2W82 A;  2MBB B;  3B9J A;  2BXQ A;  4ZUX V;  2BXI A;  1YN5 A;  1S3S G;  2EMS A;  1KTK A;  3VTU A;  2WX1 A;  1YJI A;  3I57 A;  1VZ6 A;  3VXW A;  2HTM E;  4PO0 A;  2QDF A;  3BK1 A;  3ZYY X;  4P7I A;  2WXR A;  2G45 B;  1HK2 A;  1I4Q A;  5IOI A;  1FXI A;  5D3D A;  2ASQ A;  3EHV A;  2KLC A;  2CKH B;  4KDI C;  1H8C A;  2L05 A;  1UUP A;  4X57 B;  5TR5 A;  4BVU C;  2I1J A;  4S17 A;  2L00 B;  2MWS B;  2QEJ C;  2LVO A;  2PEA A;  3NHE B;  1UGM A;  2PJH A;  3GE3 C;  3LXF A;  1P3Q U;  4HDO A;  4A8X C;  1PQS A;  3VVW B;  4M00 A;  5CHV C;  1RFA A;  2BXC A;  1PYW D;  2XMO A;  1NVI D;  2LGD A;  4WH4 A;  2JZP A;  1QOG A;  2ZW0 A;  1G6J A;  3K9O B;  3Q8C A;  2MX2 A;  3H9D A;  4J3O D;  1GOZ A;  2CR5 A;  2HE7 A;  2OOB B;  2WU2 B;  4YTM B;  2DYO A;  1DOI A;  2KAJ A;  3W9C B;  3TEW A;  3AED B;  1XD3 B;  1E7H A;  1FRR A;  5DQF A;  1OEY A;  4L23 A;  3BVM A;  3A9J A;  4K3B A;  1I4G A;  2HJ1 A;  1MIV A;  3KWV A;  1QIL A;  2NBW B;  5AUK A;  3EFU A;  3L0W B;  2BYV E;  2AYO B;  3DHG C;  2N9K A;  1FEH A;  1TYG B;  3PHW B;  4ANX A;  2GRI A;  2FID A;  4WA6 B;  1SSN A;  2IYD B;  4N6E B;  1E8Z A;  1C3T A;  2XW1 A;  3KUZ A;  3H3A A;  2L32 A;  1TS4 A;  2BVC A;  4DBG A;  2DX5 B;  3IVF A;  4ZBR A;  3MC8 A;  1WXQ A;  1E7A A;  3SEB A;  4YTP B;  3ZQ4 A;  5L83 A;  5D6J B;  2NPT A;  1MVK A;  2MP2 A;  3BY4 B;  5HKH A;  2AQ3 B;  2V4I B;  2A5U A;  1C4C A;  3BII D;  3UIP B;  2J53 A;  3SU8 X;  4DM0 A;  3C19 A;  2BXE A;  1T0R C;  1YQ3 B;  1VD2 A;  2LXA A;  2O6V D;  4A55 A;  5CHW A;  2NQO A;  1MHX A;  1SEB D;  1E10 A;  1Z2M A;  4JX1 C;  4K1R B;  1F0Z A;  1Q5W B;  1L4D B;  3LYY A;  3ZDM C;  4DXG A;  2PPH A;  4FAD A;  2LXT A;  3DBH I;  4IUM B;  1GG3 A;  3ICX A;  1Z5S B;  2FUG 1;  4BAX A;  3AU4 A;  4JIO U;  2ZVO A;  2MBH A;  2GBK A;  1R4M B;  3VRB B;  2MH7 A;  3TJP A;  2XK5 A;  2MBQ A;  1D5X C;  2KNB A;  4KKJ A;  1XF5 L;  1FD6 A;  3M63 B;  2QJL A;  4XWW A;  1CJE A;  4BBN C;  1HZ6 A;  5JH5 C;  3A9J B;  3DQV A;  2KOX A;  3ZRF A;  1C9F A;  2VUF A;  4P16 A;  2NR2 A;  2WNM A;  2D07 B;  1GB4 A;  4GB9 A;  1V80 A;  3VQI A;  2QHO A;  2KYW A;  3ZLZ A;  2RGF A;  4MBE C;  2BKF A;  5LXH A;  3BYY B;  3N20 C;  3GA9 L;  3KUC B;  2RR9 A;  5I4D A;  2BB6 A;  2LWP A;  2UWQ A;  3AH7 A;  1SIJ A;  5AZH A;  2AX5 A;  4ARC A;  3KW5 B;  2BPS A;  1T3Q A;  3FC4 A;  4EE2 A;  2JY6 A;  3CWI A;  1AN8 A;  2QIL A;  4OVZ A;  2GOW A;  3CMM B;  2NPT B;  4HWI B;  4N0F D;  2MP2 B;  2KFK A;  4F5V A;  2FE8 A;  4XWT A;  2LMC A;  3DBL B;  3AB5 A;  2LAS A;  2KDM A;  1GC7 A;  2WXF A;  2KDE B;  4RGT A;  5C23 A;  1FXT B;  4OHJ A;  4YT0 B;  4RGM A;  4GLS C;  2CKX A;  1WYW B;  3ECP A;  1PUT A;  3Q3O C;  4AUQ C;  3IXS A;  4HCN B;  2ZPN A;  4HPP A;  3Q6B A;  1E7I A;  5BMI A;  1E6E B;  1R4N B;  2DBX A;  1UD7 A;  3N3K B;  2CJN A;  4W9I A;  3MHS B;  1V9J A;  3KVF B;  4XDC A;  1L7Y A;  1E7E A;  2AWT A;  3E56 A;  1NEN B;  2KMC A;  3RNG C;  3QK0 A;  4ANU A;  3A1Q A;  3MP9 A;  3MTN B;  4KIK A;  3JW0 X;  4XX5 A;  1BM0 A;  3Q3F A;  3CX9 A;  4OVV A;  2GBJ A;  3DWM A;  4KZ0 A;  4L9K A;  4D7X A;  2JRI B;  2XK5 B;  1S1Q B;  1E7B A;  2M19 A;  1GNU A;  3LU8 A;  1WXV A;  1D4B A;  1TTN A;  1OFF A;  1LOT A;  3DCG A;  2QMT A;  3ETR A;  4K81 A;  2K3U A;  1EU3 A;  2XSI A;  1XCQ L;  3PO0 A;  1AYF A;  2E0X A;  4ZRP A;  2NS5 A;  1UF0 A;  5KHQ A;  2W3S A;  4RFB A;  3WAN A;  1HTQ A;  2ZZP B;  1YX5 B;  2N1V A;  5T8I A;  3NS8 A;  1JWU D;  4G03 A;  1U4A A;  5J17 A;  2WXP A;  2K6D B;  4LCD E;  4W9F A;  1MFW A;  3MC0 B;  2D11 A;  2X8X X;  4OTU A;  4BFR A;  4JL9 A;  1ZPS A;  1BML C;  1J7A A;  2IGG A;  4LA0 A;  2K1F A;  2V3S A;  2ROH A;  4AWJ A;  4WWO A;  1UBI A;  3RD2 A;  4I9O A;  3VHT C;  2ZPY A;  3PZ7 A;  1XO3 A;  2KT7 A;  2L76 A;  2Y5C A;  3AEA B;  1ZXH A;  5CHF A;  1SJH D;  2M17 A;  4L8U A;  1BUI C;  4MDK E;  3LU7 A;  5IN7 A;  2KX0 A;  4NAM A;  1MHH E;  3VFK A;  4EEW A;  2BQQ A;  3RPF C;  4DHX B;  4TQ0 A;  1C79 A;  2I1K A;  2FBW B;  2DBY A;  1J7E A;  3A1Q B;  4RCO A;  5HG2 A;  4GDK A;  3AE3 B;  2IJ0 A;  4KIK B;  3OJ4 B;  3PHX B;  4JK4 A;  3AV8 A;  2WXQ A;  1AAR A;  2MQJ A;  2FCQ A;  1KLG D;  4ZOH C;  2JWU A;  3PGE A;  2LFI A;  3JQZ A;  3VDZ A;  1SXT A;  3GE8 C;  4M8N A;  1N5X A;  1GB1 A;  2PVG C;  3BWU D;  3O65 B;  1V81 A;  3GS2 A;  1WE7 A;  1VRA B;  4WJN A;  1RM6 C;  4BKE A;  3C0R B;  3EGR A;  4ICV A;  2MLB A;  4HJK A;  4E3C A;  2G9H D;  2PKO A;  4LJO B;  1GPX A;  3CSF A;  1T6B X;  4OZA A;  3VH3 B;  3U7Z A;  3O13 A;  1P0R A;  3PSE B;  3HHM A;  4EZK A;  1IGD A;  2KDF B;  2D3G A;  1E7F A;  2N9P C;  4FA6 A;  1E7V A;  4I6P A;  4BKG A;  3U52 E;  3WAL A;  3ZNG C;  2KC2 A;  4HRO A;  4K7S A;  2BXO A;  4JLC A;  2PW9 A;  4FN2 A;  1GNJ A;  1XLN A;  2JUO A;  4WQM A;  1L5P A;  2GMI C;  1FNU A;  1TT5 B;  1IPG A;  1B1Z A;  4JE3 B;  5G55 A;  2K6Q A;  1WIA A;  1WGG A;  2N7E A;  2N4F A;  4IKG A;  4IOI E;  1RLF A;  1HA5 A;  1UWM A;  4MT5 A;  3E9S A;  1VZ7 A;  1OQY A;  1I4X A;  3VR8 B;  2EFC A;  4JPS A;  2LD9 A;  2LXS A;  4IM0 A;  2B3A A;  4NY0 A;  2WXL A;  4GDK B;  2OJR A;  1C77 A;  4HKZ E;  1YIW A;  3TDL A;  4IW0 A;  1MA9 A;  2WHI A;  5BYS A;  2K8B A;  1KM7 A;  2BW2 A;  3WAO A;  4HJG E;  3JRY A;  3K9P B;  1HQR D;  2LVQ A;  1QKZ A;  3HK0 A;  4ZBK A;  3X23 A;  1E0Z A;  1MM8 A;  2W54 A;  4XE0 A;  4R3D A;  1JW9 D;  3APC A;  1FFV A;  4TQ1 A;  1QOF A;  2XVW A;  4LNF A;  5GIN A;  5IIX A;  1IP9 A;  2I30 A;  3B9L A;  2RMM A;  3DHH C;  1OQQ A;  2JXX A;  3T3O A;  2VRR B;  3RMK C;  3W2D A;  3HVD A;  2E6X A;  3AEB B;  1WJU A;  3TCA A;  4B6W A;  2D2Q A;  3P4R B;  3BPJ A;  1OGW A;  3KLS X;  3GOE A;  4ZRJ A;  3V05 A;  1IBX A;  5GHK A;  4G11 A;  1ISN A;  1SIF A;  3MHZ A;  1VR9 A;  4K7U A;  3V62 A;  1E90 A;  3AXC A;  3PRE A;  3EEC A;  2I38 A;  2KWF A;  1BKE A;  1NDD A;  1FNV A;  3ABV B;  1P1A A;  1WJ6 A;  3RUI B;  5B5T A;  4IW2 A;  3M62 B;  4KGR A;  1ESF A;  2L7R A;  1J19 A;  1OTR B;  1MIY A;  2C7M B;  4II2 B;  2CHZ A;  2WDQ B;  4LNO A;  4NZL B;  5FR6 A;  3I3T B;  4DXF A; 
#chains in the Genus database with same CATH homology
 1WF9 A;  5CTR C;  2QIE B;  3B08 A;  3NVW A;  3ZTC A;  4ITK A;  4F1S A;  2IO2 B;  3ZUN A;  4H2A A;  2M0X A;  3A73 A;  4US9 A;  1KXP D;  4N3Z A;  4K71 A;  2AQ1 B;  3P4S B;  2H89 B;  5J2R A;  1V1P A;  4S1Y A;  1R4M I;  1ZW7 A;  3AUL A;  2IO3 B;  3PRZ A;  2KDB A;  4Q2J A;  4GG2 A;  4A3P A;  1ENF A;  2LHE A;  1GUA B;  4I6N B;  1WGD A;  4LJP B;  1SE9 A;  1K52 A;  3SR6 A;  2J0J A;  4W9J A;  3DOW A;  3KIK A;  4EZL A;  4MGI E;  3W1S C;  2BTE A;  5C1Z A;  2BYE A;  4AJY B;  1I4P A;  3T8M A;  1IBX B;  2X38 A;  2ON8 A;  2V0G A;  1XXG A;  2WQY B;  2VUE A;  2ZW1 A;  3GB1 A;  2BKR B;  2LJ5 A;  2OHF A;  2PE6 B;  4NJ7 A;  4HLE A;  3AE9 B;  1JQ4 A;  2K5P A;  1TY2 A;  4GDL A;  1HA2 A;  1N5U A;  4DDG D;  1K50 A;  5BYQ A;  1UNS A;  4W9D A;  1IUE A;  1D3Z A;  3IG3 A;  4JGH B;  2ZNV B;  3PPA A;  3ZTD A;  4EFO A;  2EEL A;  3W1Y A;  2WXO A;  1R4N I;  5LLI A;  4PS7 A;  4GIV A;  4M8M A;  2NBU A;  3PRM B;  3R2T A;  1QT9 A;  1V1P B;  4MH8 A;  3OWE B;  2CHW A;  5DBY A;  3L4P A;  3NVK A;  4JQW C;  4RH6 A;  1SE2 A;  2N7D A;  2DZI A;  4CO7 A;  3WHR A;  3R3M A;  4ICU A;  1QOB A;  5E6P A;  3B1L X;  3L08 A;  4HGM B;  1QOA A;  2LGY A;  4KX6 B;  1WZ0 A;  3UF8 A;  5HFY A;  2DBW A;  3UQB A;  2BYF A;  4LDT D;  4M0W A;  2QMC A;  2KJR A;  1I7H A;  1NI2 A;  4PYU A;  2CJO A;  3V3X A;  4RM8 A;  2EFE A;  4YSX B;  1KFY B;  2WX0 A;  4W9C A;  2BGF A;  1L0X B;  4NQK E;  1SGH A;  1P9D U;  2ICI A;  1TXU A;  2SAK A;  4GDL B;  1J8C A;  2LXC A;  4NJC A;  2VDB A;  4GGQ A;  1SJE D;  4XZ4 A;  1D5Z C;  1MIW A;  5ID9 A;  3RZF A;  2WXI A;  4DQO C;  2J7Q B;  2WYQ A;  2G1E A;  2BS2 B;  1Y8R C;  5H92 C;  2H88 B;  2HD5 B;  5BMH A;  1WJN A;  4BBN F;  4GOC A;  1A5R A;  4DWF A;  2JX5 A;  2E3T A;  4C80 A;  2JWZ A;  2AEH A;  2RDH A;  2GI9 A;  4DDI D;  1OEY J;  1V86 A;  5DPS A;  2R2O A;  4RNA A;  4IM2 A;  4M70 B;  2BF8 B;  2LOQ A;  5AZF A;  3B0A A;  1CZP A;  2CU3 A;  2O6V A;  4WJP A;  3L16 A;  2LJI A;  2N9X A;  4A20 A;  3MJW A;  4XDD A;  1L6U A;  1TBE A;  2KZR A;  5IFO A;  1ZP0 B;  3TL5 A;  2RPV A;  2EMT A;  1PFD A;  2DWQ A;  3TEY A;  1C76 A;  3NMU A;  2IBI B;  1D5M C;  2YDF A;  3QA8 A;  4M0W B;  2EFD A;  1KJT A;  2IDY A;  3ZJU A;  2BXG A;  3ZO5 B;  4ARI A;  2WXK A;  5DPT A;  4BY9 C;  5CX3 A;  3AE7 B;  2VZK D;  4F5T A;  2FCN A;  2Y3A A;  1P98 A;  5D2M B;  1HK5 A;  3ZJV A;  2PIA A;  2DAJ A;  1V49 A;  3P42 A;  4FBJ B;  3QWZ B;  1XLP A;  2I2Y A;  2Y5B B;  1T0Y A;  3R2I A;  2KTR A;  4OW0 A;  4PS3 A;  2IGD A;  2FAZ A;  1F2R I;  3N9Y C;  2V36 A;  2NVU I;  2K25 A;  2E0Y A;  1E78 A;  3SDL C;  4WQO B;  2KQ4 X;  3P2B A;  3TIX A;  4LLG M;  2MCN B;  1GC6 A;  2BXH A;  1M94 A;  2JT4 B;  2WXJ A;  1WX8 A;  1WXA A;  1WMH A;  3BK2 A;  1EU4 A;  1IGC A;  2DYB A;  1B9R A;  2KX3 A;  2O6V B;  4EKU A;  2KFJ A;  1E7P B;  4G0N B;  2W9N A;  2IPK D;  4ZRK A;  3M99 C;  4LUH A;  2L3Z A;  1TS5 A;  4HPL B;  2JYE A;  4CQN A;  1JRO A;  1WX7 A;  3NVI A;  3MFG A;  2KO3 A;  3RYT A;  1LNS A;  4EOY A;  3DVG Y;  3VUX A;  2ZCB A;  3V60 A;  3KJL A;  4C56 C;  1BT0 A;  4PS8 A;  1WRD B;  1YN4 A;  1WGR A;  1P7F A;  3H37 A;  1E8W A;  1HK4 A;  3RUL A;  3NVY A;  1V5O A;  2KWU B;  3H8H A;  2MEK A;  3A4S C;  3I9V 1;  1XLQ A;  2L0T A;  4IW1 A;  2IZV B;  3NY5 A;  1LQB A;  3V6C B;  4YTN B;  1YQ4 B;  1YMH E;  1L0Y B;  1N61 A;  2YEP F;  2FIF A;  2XVV A;  2KFK B;  3UI3 A;  1YD8 U;  3FWC C;  3NZ3 A;  4HEA 1;  4A6Q A;  1WZ3 A;  2LZ6 A;  1FM0 D;  4WIP A;  1GAQ B;  1HZ5 A;  3IFW B;  4FK5 B;  2KTR B;  1ZE3 D;  4MAC A;  2C7N B;  3SIU B;  4L1B A;  2KJ6 A;  2CS4 A;  3KWL A;  5G5G A;  5EE1 A;  1SB3 C;  1E7C A;  3U30 A;  3FIL A;  2BXA A;  3PS6 A;  1WXS A;  2G4D B;  1SE3 A;  1Q0W B;  1L4Z B;  1QF6 A;  3HVZ A;  4F8C B;  4G50 A;  2L0F A;  2KD0 A;  1FIQ A;  4G01 A;  1WMH B;  3T9L A;  1KW2 A;  2DBU A;  3JVZ X;  1VJK A;  3PLA A;  1E8Y A;  3SFE B;  4BKS D;  3NUH B;  2ZJD A;  2K9X A;  2C7H A;  2LGX A;  2IO1 B;  3Q3J A;  2NNW A;  1EUV B;  2GBM A;  3IAM 1;  1TKY A;  4DHJ D;  3R7Q A;  4B0M A;  1MG8 A;  4IDI A;  2BXD A;  2N0S B;  1ZOY B;  1HK3 A;  4N9F 4;  1EWC A;  4FIP B;  1LM8 B;  3AE1 B;  3AEC B;  5IJ5 A;  5EE0 A;  1YQB A;  2KN5 A;  1JWA D;  4CHK A;  4EZJ A;  2NCN A;  3G9K D;  2L83 A;  2Z8K A;  2B76 B;  3AEF B;  2KAN A;  2BXP A;  2ACZ B;  4FJY A;  3APF A;  2AJE A;  4HDQ A;  1ZGU B;  3B2G A;  1JWS D;  5GIO A;  2PTL A;  3FAH A;  1JAL A;  2WS3 B;  5ID7 A;  4WWN A;  4RM9 A;  2KLG A;  3RZW C;  4I6L B;  3EUB 2;  2C60 A;  2KQS A;  4G3X B;  4II3 B;  4MEL A;  1N63 A;  3FIL B;  4FHJ A;  2MSE D;  4ZCG A;  1I4H A;  4L2Y A;  2V4L A;  1H4R A;  4OR0 A;  4FJZ A;  3U7D A;  5GIP A;  2CHX A;  2BXL A;  1EF5 A;  4D2K A;  3IHP C;  1FFU A;  2WXM A;  2D10 A;  3Q69 A;  2WXG A;  3R8B A;  5H8Y E;  3SQJ A;  4GDX A;  4KVG B;  1ZDX A;  2N7J A;  5AEK B;  4ZDV A;  2LHD A;  2OZB B;  1FNW A;  3V61 A;  3LJ3 A;  4IWO A;  3FWB C;  1WFY A;  3ECI A;  1WRI A;  2KWC A;  3HM3 A;  3HM6 X;  1IYF A;  3HIZ A;  1H9Z A;  1YJJ A;  5IJE A;  4YWG G;  3RFZ B;  1XLO A;  3RT3 B;  3PLV A;  3H6N A;  3U8Z A;  1JCK B;  3P63 A;  2KK8 A;  1A70 A;  3WHS A;  1UWX A;  5IAA C;  5EDS A;  3KQ4 A;  2NTS A;  1WM3 A;  1I35 A;  1KH0 A;  3QJZ A;  3ZNI D;  4NJ6 A;  2MBO A;  1C4A A;  1YN3 A;  1DYQ A;  5IJF A;  4HK2 A;  3ENE A;  1GJZ A;  4FHK A;  1J0G A;  5FKA C;  3ZW3 A;  1N5W A;  1L6V A;  2LGI A;  2CU1 A;  4IM3 A;  2NTT A;  4LB9 A;  4E74 A;  4WWM A;  3DVN V;  3L13 A;  3UIO B;  2RPQ A;  2OED A;  1WE6 A;  2KWV B;  3AMZ A;  4W9K A;  3BVG A;  4DHZ E;  3J9C A;  1NT2 B;  3AE8 B;  2YVC A;  2QM6 A;  3W5U B;  3ZDT A;  3QAR A;  4OZC A;  2A4Z A;  1ZDV A;  2XW0 A;  1X1M A;  1TKE A;  4HGK A;  3ZKJ C;  3ZIM A;  2AQ2 B;  3JYU A;  1KLV A;  1V6E A;  1VDV A;  4MGY E;  1EM7 A;  3DDC B;  5IIU A;  3AE2 B;  3PV1 A;  2DAF A;  4UDU C;  4PYZ A;  2JF5 A;  4ZHO A;  5EE9 A;  5DPR A;  3H7P A;  4KSL C;  3NZU A;  2WXH A;  1C4P A;  2K8C A;  2R2Q A;  3WAM A;  2KKC A;  3VRA B;  4FUL A;  4HCP B;  2JU6 X;  2QSD A;  3N32 A;  2BT6 A;  3VR9 B;  4TUU A;  2UYZ B;  1NEK B;  1HK1 A;  4J6I A;  1FMA D;  4KKI A;  5FK9 C;  4ZYS A;  5KHO A;  3KYC D;  2LI5 A;  1J7B A;  3ML9 A;  2BWF A;  3L54 A;  3VH4 B;  3QX1 A;  5DPW A;  4FJV B;  2AL6 A;  4NPN A;  3W1S A;  2DZM A;  3ALB A;  2BXB A;  1KOT A;  2C9W B;  4XC2 A;  1NBF C;  1JML A;  2YLM A;  3DBL I;  4EUT A;  2GBR A;  1E9M A;  4FJC B;  3AI5 A;  2PVO D;  3TEX A;  1CMX B;  2C5L C;  2N9E B;  1TJE A;  1C1Y B;  2BBC A;  3P1M A;  3PTF C;  2MRP A;  3AE4 B;  1QZE A;  1RFK A;  4ANW A;  3PRP B;  1Q10 A;  1E8X A;  2Z59 B;  3ZVV A;  3V09 A;  1PDX A;  2KHW B;  4HPM B;  1D6E C;  3ZGZ A;  3U4E G;  1M4V A;  3B9M A;  2HTH A;  1MI0 A;  4USA A;  2SEB D;  1Y56 A;  3FNM A;  4MGZ E;  2RSU A;  1ROE A;  4MSQ B;  1JWB D;  2EKI A;  1I42 A;  2JYT A;  3NVV A;  3IT6 B;  3NOB A;  1H5W A;  1EO6 A;  1RAX A;  3QC8 B;  1JRP A;  4W4U B;  3H7P B;  1YNT E;  3L10 B;  4WAA A;  5GMV A;  1K53 A;  4Z9O A;  4LK0 M;  2K0P A;  1WI0 A;  2BWE S;  1XT9 B;  3SIV B;  5FR3 A;  3V03 A;  4P6V F;  4RF1 A;  4GN1 A;  3GQU A;  1UGJ A;  2TSS A;  1HEZ E;  4N58 A;  4OZB A;  5L95 C;  1ZUD 2;  3V08 A;  2LEK A;  1LFD A;  4LTU A;  1JNB A;  1AW7 A;  2BXN A;  3ML8 A;  3SHQ A;  4YSZ B;  1SE4 A;  2WU5 B;  4Z69 A;  2LUE A;  4PT5 A;  4RMA A;  2MJD A;  4YSY B;  4B0E A;  5EE3 A;  4A9A A;  1DOX A;  1WYG A;  5G2N A;  1VZS A;  2ZCC A;  3TSS A;  3A9K A;  3UIV A;  4NNJ B;  3MHS D;  2KBZ A;  1WX9 A;  2JSV X;  3LU6 A;  2L8J A;  1IJG A;  1TZ1 A;  4ASW C;  1WJ4 A;  2Q5W D;  4AP4 C;  5BO4 B;  4AQ7 A;  1TY0 A;  3U2S C;  1KRH A;  3VAW A;  2KMM A;  3A33 B;  4IWQ A;  2BXM A;  3WCQ A;  1ET9 A;  5E6N A;  4MSM B;  3Q8F A;  3AM9 A;  2JZZ A;  2KN4 A;  3CIR B;  3PVL A;  3SFD B;  3ONS A;  3BZD B;  3PLU A;  2BXF A;  3TBL D;  2FCM A;  1J78 A;  4WWP A;  1NYR A;  1SBB B;  3M95 A;  3UGB B;  4MM3 A;  2XVU A;  1WSP A;  3PZ8 A;  3UQA A;  4BOS C;  4MJS A;  4TSS A;  1XCT L;  4NQL B;  2DZK A;  1P7E A;  2KVR A;  1TS2 A;  3ZNZ B;  2BS3 B;  1LO5 D;  2K22 A;  2R61 A;  3JSV A;  4RGN A;  3QAQ A;  4WAF A;  1SF0 A;  2GB1 A;  4MGK E;  1N62 A;  5JHB A;  4DHZ B;  1EF1 A;  2W55 A;  3BIN A;  2LRU A;  4G04 A;  4E71 A;  3M3J A;  1KF6 B;  3EA6 A;  2LRW A;  2KDI A;  1OQR A;  3BYT B;  3GQX A;  3A4R A;  3H7S A;  1Q1O A;  2LVP A;  2INN E;  3EC8 A;  1VZ8 A;  3LDZ E;  1TZO A;  2JVC A;  4IG7 B;  2JZ3 B;  2IY0 B;  3A9K B;  3IBE A;  4LDT B;  4AJW A;  3MJ5 A;  3ZRC A;  4OTT A;  3VTW A;  2WXN A;  1V8C A;  3Q8A A;  1L0V B;  4O1N A;  4J2V A;  3AEE B;  5HHD G;  2MBE A;  1QLB B;  2MJ3 A;  2DG5 A;  1TKG A;  2FNJ B;  2Z8L A;  4HXD A;  5E6J A;  4F5U A;  2KQ7 A;  1N60 A;  4LB2 A;  3DPD A;  3W5V B;  1ZXI A;  5J18 A;  1NYQ A;  3VUW A;  3L17 A;  4A90 A;  1FRD A;  1DOY A;  5HOZ A;  2O2V A;  1E5W A;  3AE5 B;  1AO6 A;  4KSK C;  3NVM A;  4K2C A;  3V6E B;  2DHZ A;  3X0W A;  2KJH B;  4MM3 B;  4KV2 A;  5C2T B;  1VCB A;  5AZG A;  2NBV B;  4MJS B;  1WGY A;  4AS1 A;  1R7S A;  2M4N A;  2LUM A;  3NZS A;  3PT2 B;  3ZJT A;  4W9G A;  4DK5 A;  3JSV B;  2WLB A;  4TKN A;  4N0U D;  2ZEQ A;  4HRS A;  1ACC A;  2J0M A;  5BMG A;  1BXT A;  1EWY C;  2QHB A;  1RWS A;  2BXK A;  2J0K A;  2K39 A;  5BPK A;  3TUO A;  4MEM A;  4ZYN A;  5JHA A;  2FCS A;  1YJ1 A;  2JUH A;  3Q8E A;  1FCL A;  5JZE B;  2XBB C;  1WY8 A;  4WJO A;  2J42 A;  2Z0D B;  2PLP A;  4OT2 A;  3SD5 A;  1F2R C;  5BYR A;  1JWM D;  3NVZ A;  1XEE A;  3R66 C;  3QIJ A;  4US8 A;  3Q8B A;  3HRD D;  2PE9 A;  1I4R A;  3TMP B;  2VZK B;  4TMA B;  1V5T A;  4W9L A;  1ZKH A;  4GU2 A;  2JRH A;  2XEW A;  2WP9 B;  2JQR B;  3DBS A;  2L52 A;  3GP7 A;  2I2Z A;  3AEG B;  3BVZ A;  4KZC A;  4HKQ A;  4WUR A;  4GMV A;  4REZ A;  5GXG B;  2O2V B;  4CYE A;  3KUD B;  1PGA A;  2Z0E B;  4JWU C;  4L9Q A;  4FXC A;  2G3Q B;  4K7W A;  2DYM A;  5D3I B;  5JXV A;  2AL3 A;  2K8H A;  1VLB A;  2PMV A;  2BYT A;  3T3N A;  2J4X A;  2Z8I A;  5DCN A;  3VUY A;  3QQ8 B;  1WWT A;  3WHQ A;  1V97 A;  1JRU A;  3WAP A;  2M56 B;  2L1A A;  1GNI A;  3OAW A;  3LB8 C;  1RYJ A;  5E6O A;  1TF0 A;  2XNA C;  1QQR A;  3CST A;  4BKS A;  5HI1 A;  2N9L A;  2WDR B;  1WH3 A;  3TEZ A;  2MJE A;  5LNK 1;  4URK A;  3N30 A;  1UZX B;  4GXB A;  3NS1 A;  1E7G A;  2DLB A;  2MA9 B;  1FO4 A;  3ZNH B;  4MH0 E;  3AE6 B;  2KC1 A;  2MW5 A;  2BX8 A;  1PGX A;  1V2Y A;  4KGS A;  4AOF A;  5C3J B;  3GZN I;  1FXA A;  1E7U A;  5D7G A;  2KMA A;  5IA7 A;  4FLH A;  1V1O A;  1T5X D;  1VFI A;  4YXD B;  3HUI A;  1TGZ B;  2WWZ A;  4F5S A;  4NAW A;  3DVG X;  4YL8 A;  1TS3 A;  2V3N A;  3UIN B;  4B9K A;  1WXM A;  2J52 A;  4EMX A;  2WDV B;  2YEP B;  4GSW A;  4WJQ A;  4W9E A;  4KGT A;  4KDL B;  5D94 A;  1UOR A;  2M8S A;  4HVB A;  1K8R B;  1K51 A;  3AN1 A;  2HJ8 A;  4RF0 A;  2V3P A;  1WR6 E;  3QCA A;  5MPO A;  2ONQ A;  3DBR I;  4N59 A;  1J7C A;  1HXY D;  4OVU A;  2ZVN A;  4A3O A;  1STE A;  3P4Q B;  1AWD A;  1WGH A;  4C7Z A;  4TV3 A;  3WA0 A;  1NI3 A;  3CF6 E;  4IWP A;  1WGK A;  3RCZ A;  4BKT A;  2IGH A;  1DGJ A;  2KAC A;  1FOU A;  4BOZ B;  4B95 A;  2V1Y A;  1KLU D;  1WM2 A;  4DHJ B;  3DWG C;  1BJ5 A;  1UH6 A;  5IIH A;  5G5H A;  2EFH A;  3NRZ A;  5AUI A;  4IC7 B;  1CK1 A;  1L2N A;  2INP E;  1O9X A;  1RRB A;  4E99 A;  2IY1 B;  1LXD A;  2KXJ A;  4F7Z A;  3IT4 B;  1F9J A;  2N1W A;  4ZRQ A;  2GBN A;  2NMQ A;  2IO0 B;  2RD0 A;  3A75 A;  4W9H A;  2WDT B;  3AU5 A;  3MHH B;  2EKE C;  2ZNV C;  4NAW B;  2RDG A;  2JPH A;  5FUO A;  3P4P B;  3D32 A;  4ZRI A;  5LXI B;  2BS4 B;  3H1U A;  1MPE A;  4C7Y A;  4ZHP A;  3APD A;  3OLM D;  1HE8 A;  2M0A A;  2KTF A;  3R7R A;  1FCC C;  3KH0 A;  2HDE A;  1XQQ A;  2BB5 A;  3KYD D;  3B2F A;  3DVN U;  1CQV A;  2DZJ A;  5TSS A;  1PGB A;  4C31 B;  4ANV A;  2Z8J A;  4JWS C;  2FUH B;  1UBQ A;  1F77 A;  3C8Y A;  2REX A;  2KWD A;  3S2A A;  4DXA B;  2DEN B;  3QHT A;  1YX6 B;  4ZC6 A;  2Y5P A;  1UEL A;  2G4S A;  3IAS 1;  1ET6 A;  4RGO S;  3URY A;  2XVQ A;  3PZD A;  4ZBQ A;  2W3R A;  3OJ3 A;  4LUF A;  2D5G A;  3VTV A;  2XN9 C;  2JXT A;  3WIM A;  1WR1 A;  2M1M A;  2OT3 A;  1C78 A;  2W82 A;  2MBB B;  3B9J A;  2BXQ A;  4ZUX V;  2BXI A;  1YN5 A;  1S3S G;  2EMS A;  1KTK A;  3VTU A;  2WX1 A;  1YJI A;  3I57 A;  1VZ6 A;  3VXW A;  2HTM E;  4PO0 A;  3BK1 A;  3ZYY X;  4P7I A;  2WXR A;  2G45 B;  1HK2 A;  1I4Q A;  1FXI A;  5D3D A;  2ASQ A;  3EHV A;  2KLC A;  2CKH B;  4KDI C;  1H8C A;  2L05 A;  1UUP A;  4X57 B;  5TR5 A;  4BVU C;  2I1J A;  2L00 B;  2MWS B;  2QEJ C;  2LVO A;  2PEA A;  3NHE B;  1UGM A;  2PJH A;  3LXF A;  1P3Q U;  4HDO A;  4A8X C;  1PQS A;  3VVW B;  5CHV C;  1RFA A;  2BXC A;  2LGD A;  2XMO A;  1NVI D;  1PYW D;  4WH4 A;  2JZP A;  1QOG A;  2ZW0 A;  1G6J A;  3K9O B;  3Q8C A;  2MX2 A;  3H9D A;  4J3O D;  1GOZ A;  2CR5 A;  2HE7 A;  2OOB B;  2WU2 B;  4YTM B;  2DYO A;  1DOI A;  2KAJ A;  3W9C B;  3TEW A;  3AED B;  1XD3 B;  1E7H A;  1FRR A;  5DQF A;  1OEY A;  4L23 A;  3BVM A;  3A9J A;  1I4G A;  1MIV A;  3KWV A;  1QIL A;  2NBW B;  5AUK A;  3EFU A;  3L0W B;  2BYV E;  2AYO B;  2N9K A;  1FEH A;  1TYG B;  3PHW B;  4ANX A;  2GRI A;  2FID A;  4WA6 B;  1SSN A;  2IYD B;  4N6E B;  1E8Z A;  1C3T A;  2XW1 A;  3KUZ A;  3H3A A;  2L32 A;  1TS4 A;  4DBG A;  2DX5 B;  3IVF A;  4ZBR A;  1WXQ A;  1E7A A;  5L83 A;  4YTP B;  3SEB A;  3ZQ4 A;  5D6J B;  2NPT A;  2MP2 A;  3BY4 B;  1MVK A;  5HKH A;  2AQ3 B;  2V4I B;  2A5U A;  1C4C A;  3BII D;  3UIP B;  2J53 A;  3SU8 X;  2BXE A;  1YQ3 B;  1VD2 A;  2LXA A;  2O6V D;  4A55 A;  5CHW A;  2NQO A;  1MHX A;  1SEB D;  1E10 A;  1Z2M A;  4JX1 C;  4K1R B;  1F0Z A;  1Q5W B;  1L4D B;  3LYY A;  3ZDM C;  4DXG A;  2PPH A;  4FAD A;  3DBH I;  4IUM B;  1GG3 A;  3ICX A;  1Z5S B;  2FUG 1;  3AU4 A;  4JIO U;  2ZVO A;  2MBH A;  2GBK A;  3VRB B;  2MH7 A;  3TJP A;  2XK5 A;  2MBQ A;  2KNB A;  1D5X C;  4KKJ A;  1XF5 L;  1FD6 A;  3M63 B;  2QJL A;  4XWW A;  1CJE A;  4BBN C;  1HZ6 A;  5JH5 C;  3A9J B;  3DQV A;  2KOX A;  3ZRF A;  1C9F A;  2VUF A;  4P16 A;  2NR2 A;  2WNM A;  2D07 B;  1GB4 A;  4GB9 A;  1V80 A;  3VQI A;  2QHO A;  3ZLZ A;  2RGF A;  4MBE C;  2BKF A;  5LXH A;  3BYY B;  3GA9 L;  3KUC B;  2RR9 A;  5I4D A;  2BB6 A;  2LWP A;  2UWQ A;  3AH7 A;  5AZH A;  1SIJ A;  2AX5 A;  4ARC A;  3KW5 B;  2BPS A;  1T3Q A;  3FC4 A;  4EE2 A;  2JY6 A;  3CWI A;  1AN8 A;  2QIL A;  4OVZ A;  2GOW A;  3CMM B;  2NPT B;  4HWI B;  4N0F D;  2MP2 B;  2KFK A;  4F5V A;  2FE8 A;  4XWT A;  2LMC A;  3AB5 A;  2LAS A;  2KDM A;  1GC7 A;  2WXF A;  2KDE B;  4RGT A;  5C23 A;  1FXT B;  4OHJ A;  4YT0 B;  4RGM A;  4GLS C;  2CKX A;  1WYW B;  1PUT A;  4AUQ C;  3IXS A;  4HCN B;  2ZPN A;  1E7I A;  5BMI A;  1E6E B;  1UD7 A;  2DBX A;  3N3K B;  2CJN A;  4W9I A;  3MHS B;  1V9J A;  3KVF B;  4XDC A;  1L7Y A;  1E7E A;  2AWT A;  3E56 A;  1NEN B;  2KMC A;  3QK0 A;  4ANU A;  3A1Q A;  3MP9 A;  3MTN B;  4KIK A;  3JW0 X;  4XX5 A;  1BM0 A;  3Q3F A;  3CX9 A;  4OVV A;  2GBJ A;  3DWM A;  4KZ0 A;  4L9K A;  2JRI B;  2XK5 B;  1S1Q B;  1E7B A;  2M19 A;  1GNU A;  3LU8 A;  1WXV A;  1D4B A;  1TTN A;  1OFF A;  1LOT A;  3DCG A;  2QMT A;  3ETR A;  4K81 A;  2K3U A;  1EU3 A;  2XSI A;  1XCQ L;  3PO0 A;  1AYF A;  2E0X A;  4ZRP A;  2NS5 A;  5KHQ A;  2W3S A;  4RFB A;  3WAN A;  2ZZP B;  1YX5 B;  2N1V A;  5T8I A;  3NS8 A;  1JWU D;  4G03 A;  1U4A A;  5J17 A;  2WXP A;  2K6D B;  4LCD E;  4W9F A;  3MC0 B;  2D11 A;  4OTU A;  4BFR A;  4JL9 A;  1ZPS A;  1BML C;  1J7A A;  2IGG A;  4LA0 A;  2K1F A;  2V3S A;  2ROH A;  4AWJ A;  4WWO A;  1UBI A;  3RD2 A;  3VHT C;  2ZPY A;  3PZ7 A;  1XO3 A;  2L76 A;  2Y5C A;  3AEA B;  1ZXH A;  5CHF A;  1SJH D;  2M17 A;  4L8U A;  1BUI C;  4MDK E;  3LU7 A;  2KX0 A;  4NAM A;  3VFK A;  4EEW A;  1MHH E;  3RPF C;  4DHX B;  4TQ0 A;  1C79 A;  2I1K A;  2FBW B;  2DBY A;  1J7E A;  3A1Q B;  4RCO A;  5HG2 A;  4GDK A;  3AE3 B;  2IJ0 A;  4KIK B;  3OJ4 B;  3PHX B;  4JK4 A;  3AV8 A;  2WXQ A;  1AAR A;  2MQJ A;  2FCQ A;  1KLG D;  4ZOH C;  3PGE A;  2JWU A;  2LFI A;  3JQZ A;  3VDZ A;  1SXT A;  4M8N A;  1N5X A;  1GB1 A;  2PVG C;  3BWU D;  3O65 B;  1V81 A;  3GS2 A;  1WE7 A;  1VRA B;  4WJN A;  1RM6 C;  4BKE A;  3C0R B;  3EGR A;  4ICV A;  2MLB A;  4HJK A;  4E3C A;  2G9H D;  2PKO A;  4LJO B;  1GPX A;  3CSF A;  1T6B X;  4OZA A;  3VH3 B;  3U7Z A;  3O13 A;  1P0R A;  3PSE B;  3HHM A;  4EZK A;  2KDF B;  1IGD A;  2D3G A;  1E7F A;  2N9P C;  4FA6 A;  1E7V A;  4I6P A;  4BKG A;  3U52 E;  3WAL A;  3ZNG C;  2KC2 A;  4HRO A;  4K7S A;  2BXO A;  4JLC A;  2PW9 A;  4FN2 A;  1GNJ A;  1XLN A;  2JUO A;  4WQM A;  1L5P A;  2GMI C;  1FNU A;  1IPG A;  1B1Z A;  4JE3 B;  5G55 A;  2K6Q A;  1WIA A;  1WGG A;  2N7E A;  2N4F A;  4IKG A;  4IOI E;  1RLF A;  1HA5 A;  1UWM A;  4MT5 A;  3E9S A;  1VZ7 A;  1OQY A;  1I4X A;  3VR8 B;  2EFC A;  4JPS A;  2LD9 A;  4IM0 A;  4NY0 A;  2B3A A;  2WXL A;  4GDK B;  2OJR A;  1C77 A;  4HKZ E;  1YIW A;  3TDL A;  4IW0 A;  1MA9 A;  5BYS A;  2K8B A;  1KM7 A;  2BW2 A;  3WAO A;  4HJG E;  3JRY A;  3K9P B;  1HQR D;  2LVQ A;  1QKZ A;  3HK0 A;  4ZBK A;  3X23 A;  1E0Z A;  2W54 A;  4XE0 A;  4R3D A;  1JW9 D;  3APC A;  1FFV A;  4TQ1 A;  1QOF A;  2XVW A;  5GIN A;  5IIX A;  1IP9 A;  2I30 A;  3B9L A;  2RMM A;  1OQQ A;  2JXX A;  3T3O A;  2VRR B;  3W2D A;  3HVD A;  2E6X A;  3AEB B;  1WJU A;  3TCA A;  4B6W A;  2D2Q A;  3P4R B;  1OGW A;  3KLS X;  3GOE A;  4ZRJ A;  3V05 A;  1IBX A;  5GHK A;  4G11 A;  1ISN A;  1SIF A;  3MHZ A;  1VR9 A;  4K7U A;  3V62 A;  1E90 A;  3AXC A;  3PRE A;  3EEC A;  2I38 A;  1BKE A;  1NDD A;  1FNV A;  3ABV B;  1P1A A;  1WJ6 A;  3RUI B;  5B5T A;  4IW2 A;  3M62 B;  4KGR A;  1ESF A;  2L7R A;  1J19 A;  1OTR B;  1MIY A;  2C7M B;  4II2 B;  2CHZ A;  2WDQ B;  4NZL B;  5FR6 A;  3I3T B;  4DXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...