3VQIA

Crystal structure of kluyveromyces marxianus atg5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
252
Chain Sequence
MEELRERVWNGTINVEVVVSDAIVVPNTTLADKSCHIVMLRDAYLGFYLPTVVRKLADTIKVPYESDYRNWWFEYNGEGVPWEYPCGVLFDLLNKQMWELQLCHGDKYPRGILPLVDGHSQIKDYWRHQWKQACFILNGSAKRIMSLSIPDFENFWVSILSRNRSDFMAVRSKLFSMNKAKSLPVRVWTSNYAVLQPTVPVTLSVAELLDSIKLSSVKSVIIQGIDVSIEDNIFELYDIFASIDGFLYLVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Atg5
publication title Structural insights into atg10-mediated formation of the autophagy-essential atg12-atg5 conjugate
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Protein transport
total genus 76
structure length 252
sequence length 271
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3vqiA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vqiA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vqiA01
3B1LX 2YVCA 2NVUI 3L54A 1J19A 1GNUA 2MBEA 2MLBA 3CMMB 3KYCD 4ZYNA 4GMVA 4W9FA 4DDID 2MBQA 2MP2B 4I6PA 3H7PA 4JIOU 2JVCA 3ECIA 4I6NB 5D6JB 3L08A 2FCQA 4AWJA 2HD5B 1Z5SB 2M0XA 4NAWB 1WXSA 1V5TA 5DPRA 4FULA 1ZGUB 4MSQB 4IM0A 5KHQA 2V3SA 2D2QA 4BBNF 2NR2A 2LGDA 1LFDA 3MTNB 4B95A 4MGYE 3ZRCA 1IP9A 1WF9A 2G4SA 2D11A 5J18A 2DYOA 4TV3A 2ZVOA 4FJZA 4W9HA 4GDKB 4AUQC 2HJ8A 2LZ6A 4GOCA 3A1QA 1RRBA 4BKTA 2KLCA 3AULA 5FR6A 4K7WA 5DPTA 3APFA 1V49A 4IWOA 2LWPA 3QX1A 1AARA 2KJHB 2J0KA 3BINA 3KH0A 4EKUA 4TKNA 1E7VA 4NNJB 1WJUA 1P1AA 2RSUA 1GJZA 3KW5B 2OJRA 1E8XA 2K6DB 2DYMA 3A1QB 1SE9A 2WX1A 1EF1A 2A5UA 4GDLB 1WGGA 2I1KA 2C9WB 3DBSA 2UYZB 3CF6E 2IYDB 2AL6A 2BKRB 3UGBB 3L10B 3QQ8B 1XQQA 2DX5B 3NZSA 3BY4B 1YD8U 2PE6B 3V61A 4EEWA 4FBJB 1V9JA 3EECA 3HHMA 1Q1OA 3DBHI 5L83A 1ZW7A 1R4NI 3L0WB 2JZ3B 1JRUA 1V80A 1UD7A 2KANA 3GZNI 1WMHA 2BGFA 3HK0A 3R7QA 3VXWA 3KUCB 4LDTD 4NPNA 3OJ4B 4RM9A 3K9PB 2MRPA 3NS8A 2J0MA 3UF8A 1P3QU 1UH6A 2KQ7A 3DVNV 2PEAA 1D3ZA 2KDEB 3L16A 2IY0B 4FADA 5G2NA 3HM3A 5E6NA 1WE6A 3UIPB 2GBNA 2RPQA 2KHWB 1U4AA 4EZJA 4J6IA 1K8RB 2GBMA 3DBLI 4HLEA 3PREA 5D94A 3ZTCA 1H8CA 2DZKA 3ALBA 3TJPA 2N7DA 4GXBA 5JHAA 2PPHA 2PJHA 4DHZB 3RYTA 5GMVA 3WAOA 3OLMD 3V6EB 2CHZA 4KIKA 2JUOA 1RFAA 2O2VA 4TQ0A 1QZEA 1WGHA 4ANWA 3ZTDA 4BBNC 3ENEA 3JW0X 1KOTA 1P0RA 4IWQA 4LJPB 2NPTB 4A3PA 2JZZA 1E5WA 4HXDA 4KIKB 2NBVB 2ZNVB 3A4SC 4KSLC 3TL5A 1WE7A 2FAZA 4BFRA 3RUIB 2NBWB 3PPAA 4W9JA 1NDDA 3ZDTA 2KWVB 4I6LB 4W9DA 4W9IA 4G11A 4EZLA 3PLVA 1Z2MA 3N3KB 5LXIB 1V81A 3UIOB 2KTFA 2KFJA 4M8MA 2KJ6A 1KJTA 2VRRB 2FIDA 2K8BA 1WZ3A 3ZO5B 2N1WA 4ZRIA 3AXCA 3QAQA 4E71A 3ZNZB 3ZDMC 4FHJA 2KFKA 1YIWA 1VD2A 3X23A 4JLCA 4K1RB 4BOZB 4FJVB 4PS3A 4ICUA 4DWFA 1YQBA 5KHOA 1I42A 2DAJA 2EMTA 5CX3A 2IZVB 3RT3B 4IW0A 1WXMA 4TQ1A 4BKSD 2GOWA 2BWFA 1GC7A 3SDLC 4BOSC 2KDFB 3HM6X 4JGHB 4EZKA 1TBEA 4MGIE 4MGZE 3QA8A 1OGWA 1UGMA 2MQJA 3ML9A 3L13A 3QIJA 3R7RA 4IM2A 3SU8X 3EC8A 4EFOA 4NAWA 4DBGA 3RD2A 4ANUA 3A4RA 2K39A 3U8ZA 2ZZPB 3VAWA 1LXDA 4CO7A 3IBEA 5BO4B 2A4ZA 2KD0A 2D3GA 1V5OA 2EKEC 2MW5A 1C3TA 1TZ1A 2BYEA 2M17A 3VTVA 1XD3B 3A9JB 4B6WA 4LDTB 3PSEB 2MX2A 2BYVE 4GDKA 4KDLB 3VQIA 3RZWC 1WY8A 4A20A 2O6VB 3DVNU 2JRIB 2JPHA 2KC2A 4XC2A 3M95A 4ZRJA 1V86A 4MEMA 2JY6A 3UQAA 4WWOA 3X0WA 3H7SA 3ZLZA 4K7SA 3QWZB 4PS7A 2DHZA 3ZRFA 4IM3A 3NHEB 1WJ4A 3CSFA 2FCMA 4GDLA 4KDIC 1TGZB 4MGKE 1WM2A 4KZCA 4IUMB 2LRUA 3KVFB 3PRPB 1YX5B 2I1JA 3O65B 3PRMB 1WZ0A 2OOBB 3RULA 3V62A 3QHTA 1UZXB 3SHQA 4FJYA 2KMCA 4HPLB 5D7GA 2FNJB 4W9EA 2ZNVC 5JH5C 2XBBC 3IHPC 2KO3A 4AJWA 3ZNHB 2LUEA 5CHVC 2IY1B 1CMXB 3S2AA 2WWZA 3VH3B 1WI0A 3VHTC 2KKCA 2KWUB 3I3TB 3QK0A 4ZRKA 2GBRA 3VFKA 2ZCBA 4DHJB 2V4LA 2Z0DB 2ZJDA 1WXAA 4URKA 3PZDA 4OVVA 4PYZA 1S3SG 2LGXA 4NY0A 2O6VD 4AJYB 1UBQA 2IO3B 3A33B 1YX6B 2KNBA 1E7UA 3PHXB 4ZDVA 3APCA 3IVFA 1YJ1A 4CHKA 1FXTB 5L95C 2HTHA 1WR1A 3VTUA 1P98A 4PS8A 2LD9A 2N4FA 1TTNA 2KXJA 1EUVB 2LRWA 4GN1A 4MM3A 4HVBA 3MJWA 2IO0B 4GIVA 4II2B 2KX0A 1E8ZA 3NOBA 3RCZA 4BKSA 2FCSA 2L76A 3B08A 4W9CA 3W1SA 1RAXA 2NPTA 2JRHA 4PYUA 3WAPA 1KLVA 5JZEB 2L0FA 4W9GA 1KM7A 2K1FA 2KQSA 3QJZA 2RGFA 3Q3FA 4B9KA 4K81A 2AL3A 3M62B 1R4MI 5JHBA 3AU4A 1SIFA 4HWIB 3GOEA 1WRDB 2M1MA 4HDOA 4M8NA 4DHJD 2WDTB 2AEHA 2DYBA 3Q3JA 5E6PA 4WAAA 2KC1A 2KLGA 3ML8A 3QC8B 3JSVA 4ANVA 2GMIC 2NCNA 5C1ZA 2LGYA 4KSKC 4IC7B 4MSMB 3V60A 2NS5A 3DPDA 2DAFA 1V6EA 2K6QA 4WJPA 4FA6A 5DPWA 3PV1A 3JSVB 4MH0E 4ASWC 1SGHA 2N9PC 2LVOA 3JVZX 4MDKE 5J2RA 2L00B 2KDBA 3PLUA 2L3ZA 1EF5A 2WYQA 4F8CB 5CHFA 3C0RB 2ZPNA 4IWPA 2LJ5A 3DBRI 4DHZE 2L0TA 2M4NA 3P2BA 2FIFA 2J7QB 1WYWB 4HJKA 1WX9A 4WJOA 5CHWA 3T8MA 3IG3A 1MG8A 4CYEA 3DDCB 4N9F4 4WJNA 2G4DB 2JXXA 2KK8A 1C1YB 1J0GA 1VCBA 1Q5WB 4G50A 4HK2A 4EOYA 3UINB 1WH3A 3H6NA 2K25A 1I35A 4IG7B 2ZPYA 1WFYA 3A9JA 2ZCCA 2LASA 1WX7A 2N9EB 5AZHA 2MCNB 1GC6A 1WGRA 3ZIMA 1E8WA 4WWNA 4G3XB 2GBJA 3N32A 2O6VA 4JL9A 5LXHA 3PT2B 2L05A 4ICVA 3R66C 4EUTA 2CHWA 2ZEQA 2G45B 1L2NA 4X57B 4FLHA 1BT0A 3UQBA 3EFUA 2G3QB 1X1MA 2BYFA 2R2QA 4XZ4A 3APDA 5DCNA 3DOWA 2WX0A 4KZ0A 2QHOA 1T0YA 3ZUNA 2D10A 5CTRC 3WIMA 3NZUA 2JT4B 4HPMB 2DZMA 2JF5A 4WWPA 4II3B 3PVLA 2DZIA 1L7YA 4NQLB 1OQYA 2KJRA 2GBKA 2HE7A 3KYDD 3QARA 1Q0WB 5IAAC 3WAMA 2FUHB 3H7PB 2LVPA 2BF8B 3W1SC 3RZFA 4W9KA 1RLFA 3LDZE 2MBBB 2MWSB 2PE9A 5AZGA 3TMPB 4LJOB 2YLMA 2AWTA 3PTFC 3VUWA 4F7ZA 5J17A 1EO6A 3PRZA 3JYUA 2XEWA 3H1UA 5TR5A 3AI5A 4JQWC 4E3CA 3VDZA 2D07B 3LJ3A 1IPGA 3WA0A 3MHSD 3WALA 4AOFA 1J8CA 2EMSA 5EDSA 4NQKE 4ANXA 2CS4A 2N7EA 4LCDE 4HDQA 2V1YA 3U30A 3VTWA 1IYFA 1OEYA 2IO1B 2MSED 3ZW3A 4DDGD 2LXCA 3K9OB 2N1VA 1LQBA 3ZKJC 3A9KA 3TIXA 1HE8A 1E8YA 2KOXA 1PQSA 2J0JA 4K7UA 4BVUC 2M8SA 1H4RA 2KWCA 3W1YA 4G0NB 5D2MB 4FN2A 3WANA 3DQVA 3R3MA 3A9KB 1WJNA 2CHXA 2KZRA 2ZVNA 1WXVA 4NJ6A 2ASQA 2L8JA 1WX8A 2N9XA 3SD5A 3OJ3A 4E74A 2IO2B 2K8CA 2NBUA 5G55A 1M94A 2BWES 1OTRB 2R2OA 2W9NA 1G6JA 4NJ7A 3TBLD 3PS6A 2K8HA 4TUUA 3M63B 4WJQA 1WMHB 2Z0EB 4GSWA 3H9DA 1WGYA 4BKGA 4MELA 1ISNA 3VVWB 4XX5A 4W9LA 1NBFC 2KN5A 1WGDA 2IBIB 3D32A 2JWZA 1WJ6A 4YL8A 1NI2A 5LLIA 3NY5A 1ZKHA 2AYOB 2BKFA 4RM8A 3VUXA 2KTRA 4DXAB 2C7HA 3KUZA 2XK5A 1A5RA 2LI5A 3QCAA 2C7MB 4HCPB 1E90A 1LM8B 3T9LA 5IA7A 2RR9A 3DCGA 1XT9B 3L17A 1P9DU 3DVGY 2C7NB 1Y8RC 2KTRB 3N30A 3OAWA 2FCNA 4GB9A 1WR6E 5AZFA 5AEKB 3HIZA 2XK5B 5E6OA 2BPSA 5C23A 2KMAA 2REXA 2UWQA 3ZNID 4RMAA 3U7DA 2Z59B 5DPSA 2MBOA 2O2VB 1GUAB 4HCNB 1F9JA 1OEYJ 2CU1A 2DENB 2DZJA 1WIAA 4KVGB 2KDIA 3PHWB 2LXAA 3VH4B 4KV2A 4FHKA 1GG3A 2KVRA 4DK5A 4MJSA 2B3AA 2LVQA 3DVGX 3CSTA 3IFWB 4OVUA 2Y5BB 2RD0A 4GGQA 4GU2A 3EHVA 3VUYA 3AU5A 2C5LC 4MJSB 2MA9B 2C60A 3ZNGC 4AP4C 2CKHB 1UELA 3ZVVA 2CR5A 1S1QB 4WQOB 3PGEA 1UBIA 3M3JA 1WM3A 3KUDB 2KX3A 3TCAA 3V6CB 4M0WB 2L7RA 3B0AA 4P7IA 3ONSA 4A3OA 4F1SA 1V2YA 5HKHA 2KFKB 2MBHA 2MP2A
chains in the Genus database with same CATH superfamily
3B1LX 2RDBC 1XLPA 3CMMB 4YT0B 4GMVA 2QJLA 4DDID 4C4VA 3H8HA 3NRZA 4I6PA 1KLGD 2HD5B 2M0XA 4O1NA 4NAWB 1V5TA 4ZBQA 4FULA 3Q8EA 1T0RC 4IM0A 4BBNF 3ABVB 1LFDA 2WNMA 5IO9A 1FFVA 2M19A 4S0RA 2ZVOA 4FJZA 4W9HA 2FE8A 5GINA 1RRBA 2GB1A 3APFA 1V49A 2LWPA 4HKQA 1AARA 4EKUA 4F5VA 4NNJB 2OHFA 3KW5B 2BXCA 4P1BC 1SE9A 1N63A 5BPKA 1WGGA 3DBSA 2UYZB 3MHZA 4H2AA 2IYDB 4ZUXV 2AX5A 2AL6A 3Q3OC 4WURA 1XQQA 2DX5B 3NZSA 2GI9A 1YD8U 4FBJB 1Q1OA 1JMLA 1E7HA 5L83A 2WXQA 1SJHD 3EA6A 2JX5A 1EM7A 3R7QA 1V8CA 1N5UA 4B0MA 4RM9A 3NS8A 1J7CA 1UUPA 1ZDXA 2PEAA 4OTUA 1D3ZA 2TSSA 2IY0B 3N9YC 1E0ZA 2FUG1 5E6NA 1WE6A 1TZOA 1YN5A 2GBNA 3UIPB 2RPQA 2PVGC 3DBLI 4HLEA 3ZTCA 3AE8B 2DZKA 3ALBA 4GXBA 5JHAA 5G5HA 1KFYB 3OLMD 3V6EB 5HOZA 5HG2A 1E7CA 3NJTA 2JUOA 4HPPA 1WGHA 1TF0A 3ZTDA 1KOTA 1P0RA 4LJPB 5IJFA 2JZZA 3V09A 4HXDA 2WXKA 3AB5A 3RUIB 1NDDA 3ZDTA 4I6LB 1RYJA 4W9IA 4EZLA 2VDBA 3PLVA 1Z2MA 2RPVA 4BZAA 2KT7A 2G9HD 2QHBA 1KJTA 2AJEA 5FKAC 1WZ3A 3P4SB 4M0WA 4E71A 1LGRA 2ACZB 3ZDMC 1YIWA 2BW2A 4P6VF 4BOZB 1F52A 1MFWA 4HJGE 4ICUA 3R8BA 2BXEA 1YQBA 1XLQA 4XGAB 2EMTA 5CX3A 4BKSD 4DM0A 3AE5B 3Q6BA 4BOSC 4MGZE 4MGIE 4EFOA 3U7ZA 4DBGA 3KWLA 3RD2A 1JWBD 1HK3A 3LU6A 3U8ZA 5HFYA 3IBEA 3MHHB 2A4ZA 4I9OA 1IGCA 3B9JA 1TZ1A 2WXPA 3VTVA 4B6WA 1XD3B 3MC9A 3SFEB 2BYVE 4A20A 1A70A 1D5XC 1WY8A 2O6VB 4N6EB 2JRIB 4XC2A 1IBXA 4WWOA 4ZHPA 3X0WA 5ID9A 4K7SA 3QWZB 2DHZA 1JWAD 4GDLA 4KDIC 2FCMA 4IW1A 1IBXB 4REZA 3NS1A 4XDCA 4J3OD 4ZYSA 3DHIC 1E7EA 4YTMB 3RULA 3V62A 1UZXB 1L4ZB 1KH0A 5IIUA 4W9EA 2ZNVC 5JH5C 1SE3A 1TY0A 2IY1B 3B9LA 1RFKA 2KKCA 2KWUB 3I3TB 4E99A 1UBQA 1XEEA 3RNAC 5BYSA 1BM0A 3IVFA 1YJ1A 3BIID 3RI7C 2J53A 4IW2A 2HTHA 2LUMA 1BXTA 1EUVB 3SFDB 3NUHB 3MJWA 4S1YA 3NOBA 4BKSA 1FIQA 2L76A 3B08A 4W9CA 1YN4A 4C7ZA 3AE9B 1RAXA 4M70B 1KLVA 1MI0A 1KM7A 2K1FA 2L52A 2RGFA 2XSIA 4PK1A 1FOUA 2ROHA 3GOEA 3DHGC 2M1MA 1XXGA 1E78A 2DYBA 3Q3JA 2KLGA 2BXMA 3N1YC 3ML8A 1LOTA 2GMIC 2NCNA 4HEA1 1PFDA 1HK5A 2LGYA 3AE2B 2BXBA 4IC7B 3VRAB 4MSMB 2NNWA 3IAM1 3V60A 4FA6A 1B1ZA 1ENFA 3W5VB 2LVOA 4MDKE 5J2RA 3PLUA 4F8CB 2LJ5A 2L0TA 2WGSA 4EE2A 1MG4A 2M4NA 1WYWB 2WXLA 1HA5A 4CYEA 4WJNA 2G4DB 2BXLA 1C1YB 4C80A 1VCBA 4M02A 3FNMA 3NMUA 3H6NA 4XWTA 2LHEA 1D5ZC 2N9EB 2MCNB 3MHSB 2LXTA 1I4RA 1WGRA 1E8WA 3I5JC 1NEKB 4JL9A 3TEWA 2L05A 2XVUA 5ID7A 3OWEB 3E56A 4FLHA 1BT0A 2Z8KA 3EFUA 3WHRA 1X1MA 2BYFA 4YTNB 2XN9C 2Y5PA 3DOWA 2D10A 4M01A 5CTRC 3WIMA 3LXFA 1NYRA 2N9LA 2QSDA 3PVLA 2DZIA 4OT2A 3C19A 4R3DA 4HROA 1N5XA 4EMXA 2VZKB 3GE8C 2HE7A 5C2TB 2LVPA 3W1SC 3RZFA 4W9KA 5J17A 2BB5A 3WCQA 2K9XA 3AI5A 3BZDB 3VDZA 3LJ3A 4LA0A 2IGHA 1KLUD 2CS4A 4LCDE 2V1YA 2BYTA 1GPXA 1IYFA 2BXKA 1IGDA 1GAQB 2MSED 5FK9C 3K9OB 2N1VA 2IPKD 2KN4A 3A9KA 3TIXA 1PQSA 2MJDA 4K7UA 4BVUC 4G0NB 3V05A 3AEFB 3GB1A 4HGMB 3R3MA 2X38A 3A9KB 2EFEA 1WJNA 2N0SB 3GQUA 1PGAA 1MHHE 3E9SA 1QQRA 1CZPA 2IO2B 2NBUA 2WXRA 1EU3A 1HK2A 3RPFC 2W9NA 1G6JA 1L6VA 1WMHB 3U52E 3TDLA 3IT4B 4W9LA 3RFZB 3D32A 2JWZA 3NVZA 1WJ6A 4ZBKA 1NI2A 5LLIA 3VUXA 2KTRA 2BX8A 3MC0B 2CJOA 1MIVA 4BKEA 1LM8B 1WXQA 3DCGA 1XT9B 3N30A 2C7NB 2KTRB 4K2CA 3OAWA 5EE3A 2FCNA 3ZGZA 3AEDB 4XWWA 2FBWB 2UWQA 3ZNID 3U7DA 4N59A 5EE9A 4HCNB 1JNBA 1PDXA 2GLSA 3DVGX 3IFWB 3EHVA 1C79A 1L5PA 2BXOA 2C5LC 2CKHB 2K0NA 1UBIA 2KX3A 1FD6A 3ONSA 2ZPYA 3DWMA 1HTQA 2YVCA 3RNEC 1J19A 2NTTA 3JRYA 1T0QC 4XDDA 3KWVA 2MLBA 3KYCD 1ZDVA 2MBQA 4RGTA 4JIOU 4CQNA 5D6JB 3ECIA 4ARCA 2QM6A 3NVMA 4ZRQA 2DNFA 3UIVA 1XO3A 4QAYA 1IP9A 2D11A 3M99C 4GDKB 4BKTA 3A1QA 5DPTA 3TEYA 4XYCA 2J0KA 1E7BA 4TKNA 1WJUA 1P1AA 2K3UA 4WA6B 2OJRA 2X8XX 3A1QB 5IP4D 1ROEA 1V1PA 3NZ3A 4MT5A 3UGBB 3L10B 1AWDA 1T3QA 4LNOA 4L9KA 2CJNA 3EECA 3HHMA 3ZQ4A 3L0WB 1E7FA 1XF5L 3VXWA 3ECPA 1DYQA 3IXSA 2V36A 4LUHA 2E0YA 2J0MA 3AE4B 5H92C 1F2RI 3V03A 3VRBB 3EUB2 2XVVA 2V3PA 4MBEC 2PLPA 4FADA 1PGXA 4FXCA 1ESFA 2J52A 2XNAC 4L9QA 2KHWB 4RNAA 4KX6B 3PREA 2N7DA 3AEEB 2JUHA 5IIHA 1RFAA 2BS3B 2O2VA 4TQ0A 1QZEA 3JW0X 4IWQA 2NPTB 1E5WA 5D3IB 2NBVB 4KSLC 2LXSA 3TL5A 1WE7A 5C3JB 2NBWB 4JPSA 4W9JA 2KWVB 4W9DA 1XLOA 2NQOA 3N3KB 1V81A 3BYTB 2KTFA 3DHHC 2WXNA 1FXAA 3L4PA 2KYWA 2VRRB 2FIDA 3DBRB 2EFDA 2HDEA 3ZO5B 2N1WA 2WXIA 3AXCA 3QAQA 1DOXA 2KFKA 2D3AA 1VD2A 2LMCA 4FJVB 4PS3A 5BYQA 1UORA 5KHOA 1I42A 2R61A 2V4IB 2IZVB 3RT3B 1WXMA 4TQ1A 4WQMA 1N61A 2BWFA 3SDLC 3HM6X 5IIXA 4JGHB 1TBEA 3X23A 1ZXIA 3QA8A 3R7RA 3SU8X 3L13A 2WP9B 4IM2A 4NAWA 2K39A 5I4DA 2ZZPB 1HK1A 4CO7A 2WDRB 5BO4B 2MW5A 1V5OA 2EKEC 1C3TA 2BYEA 1T0SC 1Y56A 3VQIA 3DVNU 2JPHA 1TS2A 4ZRJA 1AO6A 5LNK1 3NVYA 2JY6A 3ZRFA 4IM3A 3CSFA 1WM2A 4KZCA 1C4CA 3PRPB 2BXPA 2MJEA 1YQ4B 2HTME 5AUKA 5MPOA 2OOBB 2Z8JA 3SHQA 4FJYA 1JWUD 2BT6A 4HPLB 2INDC 2XBBC 3ZNHB 1D4BA 3BVMA 2ZCBA 4DHJB 1FRRA 2Z0DB 2EFCA 2ZJDA 4YSZB 4URKA 4OVVA 1S3SG 3ZYYX 1NYQA 4NY0A 2O6VD 1FCLA 4LNKA 4OZAA 3PHXB 1E7UA 4ZDVA 2PMVA 1QF6A 1JCKB 4F5SA 4CHKA 1SF0A 2W3RA 1WR1A 3VTUA 4PS8A 2LD9A 4GN1A 4HVBA 2IO0B 1HTOA 4GIVA 1E8ZA 1QOBA 2Q5WD 3W5UB 4N3ZA 4PYUA 1DOIA 5JZEB 2L0FA 4W9GA 3LYYA 3Q3FA 4K81A 2G1EA 3FC4A 3AU4A 1NENB 2WXOA 4HDOA 2WDTB 3CX9A 1VJKA 1MIYA 1O9XA 2BXFA 1XCTL 4WJPA 4MH0E 4ASWC 1N5WA 2BXDA 5CHFA 3Q2AC 1SJED 3DBRI 1VRAB 4DHZE 4IKGA 1WYGA 1KDXA 2BXNA 2KVZA 2RDHA 1PUTA 4HK2A 3BK2A 4JK4A 2D3BA 4IOIE 2J42A 3DWGC 3ZIMA 4WWNA 2O6VA 4ICVA 4EUTA 1KTKA 1F77A 1L2NA 4D7XA 1I4QA 2G3QB 2R2QA 2QEJC 5DCNA 1DOYA 2WX0A 3ZUNA 3Q3MC 2WDQB 1SEBD 3U2SC 4D2KA 2EELA 2W82A 3PO0A 4WWPA 4OW0A 4NQLB 2LEKA 4KGRA 1MUSA 1OQYA 2GBKA 2AQ1B 4P1CC 1VDVA 3H7PB 3BVZA 1RLFA 5AZGA 2MWSB 3KQ4A 2INNE 4LJOB 3VUWA 2AWTA 3MC8A 3PTFC 1EO6A 3H1UA 4E3CA 3GQXA 3MHSD 2J4XA 4HDQA 3VTWA 2AQ3B 2IO1B 1M4VA 3SQJA 3ZW3A 2MJ3A 3ZKJC 2KOXA 2J0JA 3DBHB 2JYEA 1R4NB 3W1YA 1H4RA 1WSPA 3WANA 3GZNB 1ZXHA 2KZRA 2CHXA 1WXVA 2SAKA 2ASQA 2L8JA 2VZKD 2ON8A 2N9XA 2PTLA 5G55A 1KRHA 1OTRB 3NVIA 4NJ7A 2CKXA 3SR6A 4OVZA 2W55A 1WGYA 1R7SA 4BKGA 2BVCA 2BXGA 4MELA 1ISNA 4XX5A 4J2VA 2KN5A 2QDFA 4B0EA 2IBIB 1TXUA 1FM0D 1QKZA 2V0GA 1C4PA 3NY5A 2BKFA 2H89B 4TMAB 3LU8A 1GOZA 5GXGB 3WHSA 3KUZA 2XK5A 1A5RA 2C7MB 2HJ1A 5IA7A 1P9DU 3DVGY 4NZLB 1Y8RC 1WR6E 1GB1A 2XK5B 5E6OA 2BPSA 1J7BA 3A75A 5IOIA 1E7PB 3ICXA 1MJDA 4A8XC 1SB0A 2DZJA 3FILB 1J78A 1TT5B 1FNUA 2ZW0A 4DK5A 1I7HA 4MJSA 2B3AA 2DBYA 1K50A 1P7FA 3CSTA 4RFBA 2Y5BB 4GU2A 1WRIA 3T3NA 3AU5A 1MHXA 4MJSB 2MA9B 4US9A 2XW0A 1S1QB 2N9KA 1WM3A 2JZPA 1YN3A 3V6CB 4ZHOA 5HKHA 1FCCC 4OTTA 4BY9C 1TIFA 3EGRA 3Q8FA 1GNUA 5AUIA 1JRPA 3GS2A 2WDVB 4ZYNA 2JVCA 4I6NB 2FCQA 3P42A 4AWJA 1CK1A 1Z5SB 1WXSA 1AW7A 1ZGUB 4US8A 5KHQA 1WWTA 2D2QA 2K5PA 1BUIC 4RGOS 5IFOA 4B95A 3ZRCA 1FPYA 2PKOA 2G4SA 1FNVA 2DYOA 2DBWA 4AUQC 4GOCA 2LZ6A 2KLCA 3AULA 4K7WA 5T8IA 3P1MA 1TYGB 1E7VA 3O13A 1GJZA 1ZUD2 1E8XA 4ARIA 2DYMA 1EF1A 1QILA 2I1KA 3AECB 3CIRB 4KGSA 3V61A 3BY4B 4EEWA 2Z8LA 4KKIA 1V9JA 4P16A 2B76B 3DBHI 1R4NI 1JRUA 3GZNI 1WMHA 3HK0A 1MUHA 3OJ4B 3K9PB 1E7AA 2QC8A 3R2TA 1P3QU 2KQ7A 1QT9A 2KDEB 5FR3A 2KQ4X 5E6JA 1QOAA 3HM3A 5G2NA 4L23A 3P4PB 3GE3C 4J6IA 1SE4A 1I4XA 3JQZA 5IJEA 1BKEA 2PPHA 4DHZB 2V9HA 3RYTA 3AE7B 4KIKA 4FK5B 5H8YE 3BVGA 4K71A 1HA2A 1RM6C 4BBNC 5EE0A 3ENEA 4KIKB 2ZNVB 5BMHA 3PPAA 4UDUC 1TS4A 3UIOB 4M8MA 1I4PA 2K8BA 2DWQA 4ZRIA 4G03A 3ZNZB 1TJEA 3G9KD 2WU2B 3OG5A 2M0AA 1NI3A 2DAJA 2W54A 4GG2A 2GOWA 1GC7A 4EZKA 2KDFB 1SB3C 1OGWA 1UGMA 3ML9A 1QLBB 3KIKA 1HZ5A 1ZOYB 1V97A 2KD0A 3A9JB 2WHIA 4WH4A 2MX2A 4GDKA 4RCOA 3RZWC 2KAJA 5B5TA 3FKYA 1OFFA 2KC2A 3M95A 2MH7A 1V86A 4MEMA 4A9AA 3UQAA 3Q14C 3H7SA 1VFIA 3ZLZA 1AN8A 4PS7A 1TGZB 4MGKE 1VZ7A 2LRUA 3KVFB 1YMHE 3MJ5A 2OT3A 1VZ8A 2BS4B 3QHTA 2KMCA 3URYA 5D7GA 2OEDA 3IHPC 2LUEA 4KGTA 1CMXB 2WWZA 1WI0A 5HHDG 4ZRKA 5HI1A 3QK0A 3UI3A 2GBRA 1HEZE 2L83A 1WXAA 1YOVB 3PZDA 1IUEA 2LFIA 2XW1A 2VUFA 4ACFA 2KNBA 1P7EA 2MEKA 1FRDA 1FXTB 1FMAD 1ZPSA 5BMIA 2LRWA 2KXJA 4II2B 2KX0A 3RCZA 2LGIA 2WU5B 3W1SA 4PO0A 2NPTA 2JRHA 1OQQA 1YJIA 2KWFA 3QJZA 4B9KA 2Z8IA 3M62B 2QMCA 4M8NA 4DHJD 1T5XD 4LNFA 3Q69A 4WAAA 5E6PA 3JSVA 4ANVA 2QILA 1QOFA 3DPDA 1MIWA 2DAFA 1V6EA 5DPWA 3JSVB 1N6ZA 2L00B 4AS1A 2RMMA 3HRDD 2BTEA 2L3ZA 4WIPA 2MHJA 4LUFA 1HK4A 2KACA 3B9MA 3P2BA 2FIFA 2J7QB 3N1XC 4HJKA 3T8MA 3KLSX 4WJOA 5CHWA 1MG8A 3DDCB 4N9F4 2JXTA 1LO5D 2H88B 4G50A 4YSXB 1DGJA 3UINB 1NVID 3MP9A 4IG7B 4WWMA 2ZCCA 1WX7A 1B9RA 1GC6A 1LNSA 4G3XB 4LNIA 5LXHA 4ZC6A 2WXJA 3R66C 2CHWA 4X57B 3B2FA 1SXTA 3VR8B 1H5WA 3Q8BA 4C31B 3APDA 1FNWA 2QHOA 1J7EA 1JWMD 1YNTE 3NZUA 3W2DA 4HPMB 2JF5A 1FEHA 5EE1A 1J7AA 3NVWA 2VH1A 5BMGA 3QARA 3KYDD 1Q0WB 4C4VB 1VR9A 2ICIA 2I38A 3TMPB 2PE9A 1HXYD 2XEWA 5GIOA 2D07B 1IPGA 2BB6A 3AH7A 4AOFA 2IGGA 2EMSA 5EDSA 4ANXA 3U30A 1OEYA 2WXFA 5GHKA 2LXCA 2GUTA 1XCQL 2LHDA 1HE8A 3AN1A 3MFGA 3DQVA 2PVOD 1ZP0B 2XMOA 1KW2A 1GNIA 1UNSA 1VLBA 1WX8A 2KDMA 3SD5A 2PW9A 2IJ0A 2JQRB 2INPE 1M94A 2BWES 2R2OA 2BXAA 3TBLD 4LTUA 4WJQA 1V1OA 3M63B 4TUUA 2Z0EB 3H9DA 3LB8C 3VVWB 4A6QA 1TKGA 2E0XA 1QOGA 1TKYA 2K22A 4YL8A 4HKZE 1ZKHA 2AYOB 4DXAB 2C7HA 5FUOA 3QCAA 3T9LA 4HCPB 4C7YA 4Z69A 2RR9A 3L17A 3KJLA 4GB9A 1ET9A 2XVQA 2PIAA 2Y5CA 5AEKB 3HIZA 2YDFA 2QCZA 2REXA 3TEXA 1MVKA 1E7GA 4G01A 1BMLC 1Q10A 2Z59B 5DPSA 4RGMA 3FWBC 2MBOA 2ZW1A 1GUAB 3AE3B 1F0ZA 1I4GA 1OEYJ 3RN9C 2DENB 1WIAA 4KVGB 2KDIA 3PHWB 2LXAA 3GP7A 4KV2A 2RD0A 4GGQA 3VUYA 3I63C 1MPEA 4BAXA 3ZVVA 2CR5A 1E6EB 4JX1C 2KBZA 1EU4A 3M3JA 2GRIA 3KUDB 1YQ3B 3TCAA 4M0WB 5IKCM 2QMTA 2WS3B 4F1SA 2MBHA 1KXPD 4ZCGA 1GNJA 2MP2A 4ZRPA 5GIPA 2NVUI 3I9V1 1JALA 3L54A 4OHJA 3RNGC 2KWDA 2MBEA 1F2RC 4L2YA 4W9FA 4OR0A 1HZ6A 2MP2B 4N0UD 1E9MA 3H7PA 1MM8A 3L08A 1JQ4A 2E6XA 3BYYB 3IT6B 5DPRA 4MSQB 2V3SA 4LK0M 2NR2A 2LGDA 3MTNB 1KF6B 4MGYE 1WF9A 5J18A 4TV3A 2HJ8A 5FR6A 4IWOA 3QX1A 2KJHB 1D5MC 3BINA 3KH0A 1L0VB 4GDXA 2RSUA 4WAFA 2K6DB 2IDYA 2WX1A 2A5UA 4HRSA 4GDLB 2C9WB 3CF6E 1SSNA 4M00A 2EFHA 1L4DB 2BKRB 2JYTA 3QQ8B 1JROA 5JXVA 2PE6B 4DHXB 3ZXRA 1ZW7A 2QIEB 2XVWA 2JZ3B 4MH8A 1V80A 1UD7A 2KANA 5D3DA 2BGFA 3Q3NC 3KUCB 4LDTD 4NPNA 1TY2A 2MRPA 4LNNA 3UF8A 1K52A 3N1ZC 1UH6A 1VZ6A 4L8UA 3DVNV 1C77A 2DBXA 4A55A 3L16A 1ZE3D 4S17A 4EZJA 1U4AA 4HGKA 1K51A 2JWUA 4YTPB 1K8RB 2GBMA 3EFCA 1YJJA 1N60A 5D94A 1H8CA 3TJPA 4XE0A 4MACA 2PJHA 5GMVA 3WAOA 1I4HA 4YWGG 2CHZA 1R4MB 2V3NA 3BWUD 2WXHA 1EWCA 2WXGA 4ANWA 4Z9OA 1STEA 3FILA 2D3CA 4A3PA 3A4SC 1F1HA 2FAZA 4BFRA 2VUEA 2DLBA 1C9FA 4G11A 5LXIB 3AMZA 2KFJA 2KJ6A 2W3SA 3Q8AA 1TS3A 4PT5A 4FHJA 3PZ8A 4JLCA 4K1RB 2JSVX 2M56B 3ZJTA 4DWFA 1E10A 3CWIA 1MA9A 5DQFA 4IW0A 3AE1B 4JWSC 2UU7A 4N0FD 1PGBA 3AM9A 2MQJA 3QIJA 3FWCC 3EC8A 4ANUA 3A4RA 2INCC 3AE6B 3VAWA 2EKIA 3FAHA 1LXDA 2D3GA 4LB9A 2M17A 3RNFC 4LDTB 3PSEB 4KDLB 1IJGA 2BBCA 4LB2A 4NAMA 3V3XA 3V08A 2E3TA 3W9CB 3NHEB 1WJ4A 4RF0A 3NVVA 3SIVB 4IUMB 5IJ5A 3AEGB 3AEBB 1YX5B 2I1JA 4F5UA 1E7IA 3O65B 3PRMB 1PYWD 1WZ0A 3NVKA 3BPJA 2N7JA 4IDIA 3VR9B 2FNJB 3B2GA 1GB4A 1CQVA 2KO3A 4AJWA 4YSYB 5CHVC 1ET6A 3S2AA 3VH3B 1TKEA 4TSSA 3VHTC 3VFKA 2V4LA 4ZOHC 2ONQA 4PYZA 2LGXA 4AJYB 2IO3B 3A33B 1YX6B 3TEZA 3APCA 3P63A 3H3AA 5L95C 2BXQA 1RWSA 1P98A 2N4FA 1TTNA 4MM3A 2I2YA 2BXHA 3LU7A 2FCSA 4C56C 4JWUC 1UF0A 4MM3B 3WAPA 3T3OA 3R2IA 3RNCC 2KQSA 2WXMA 1SIJA 2AL3A 5JHBA 1R4MI 3C8YA 1WGKA 5TSSA 1SIFA 3P4QB 1BJ5A 1UWMA 4HWIB 1WRDB 1T6BX 3TUOA 4C00A 2AEHA 2KC1A 3PZ7A 2Y3AA 3QC8B 1OQRA 1JW9D 5C1ZA 4KSKC 2NS5A 3SIUB 2BQQA 2K6QA 4L1BA 3PV1A 1SGHA 2N9PC 3JVZX 2LQIA 1CJEA 2KDBA 3TSSA 1EF5A 2WYQA 2AGHB 3C0RB 2ZPNA 1HQRD 4IWPA 4RGNA 2LGSA 4LLGM 4FIPB 1WX9A 1L0YB 3IG3A 1L6UA 1C78A 1L0XB 2JXXA 2KK8A 4DQOC 1C76A 3WHQA 1K53A 1J0GA 3PLAA 1Q5WB 4EOYA 2KMMA 2WLBA 2LOQA 2DG5A 1WH3A 3ZJUA 2K25A 3BK1A 1I35A 1WFYA 3A9JA 2LASA 4FJCB 5AZHA 4N58A 2BXIA 1C4AA 2GBJA 3N32A 3N20C 3U4EG 3PT2B 2ZEQA 2G45B 3A73A 1VZSA 3UQBA 1JWSD 3HUIA 4XZ4A 4KZ0A 5IN7A 1T0YA 5DBYA 2SEBD 3RNBC 1H9ZA 2JT4B 1FXIA 3IAS1 1AYFA 2DZMA 2VH2A 4K3BA 3AV8A 4II3B 1L7YA 2KJRA 2I30A 4W4UB 4G04A 3GA9L 3I57A 5IAAC 3WAMA 2FUHB 2BF8B 3H37A 3LDZE 2MBBB 2AQ2B 3P4RB 4F7ZA 2YLMA 2I2ZA 3PRZA 1SE2A 3JYUA 5TR5A 4JQWC 1ACCA 4GLSC 3WA0A 4DXFA 4JE3B 3WALA 1J8CA 4NQKE 2N7EA 4DDGD 3J9CA 5BYRA 1D6EC 4OZBA 1LQBA 2LQHA 3AEAB 1E8YA 4OZCA 4YXDB 2M8SA 2KWCA 5D2MB 4FN2A 1V1PB 2L32A 2ZVNA 4ZBRA 2NTSA 4NJ6A 4RF1A 4DXGA 1UWXA 2IGDA 3OJ3A 2DBUA 4E74A 4RH6A 2K8CA 4ITKA 3PS6A 2K8HA 2LJIA 4GSWA 2L1AA 3DBLB 1NBFC 2NMQA 1WGDA 4KKJA 3ZXVA 1UGJA 4RM8A 1NT2B 1SBBB 3NG0A 1FFUA 2OZBB 2OJWA 3ZJVA 2LI5A 3RMKC 1E90A 1XLNA 5AZFA 2WQYB 5C23A 2KMAA 5G5GA 4F5TA 2D5GA 4K3CA 4RMAA 4Q2JA 2O2VB 1F9JA 2CU1A 4AQ7A 1EWYC 3VH4B 3SEBA 4FHKA 1GG3A 2KVRA 2LVQA 2RDGA 4OVUA 2YEPB 4A90A 4USAA 2C60A 3ZNGC 4AP4C 1UELA 3HVZA 4WQOB 2JU6X 2YEPF 3PGEA 2CU3A 1TS5A 3ETRA 2L7RA 3B0AA 4P7IA 1FO4A 4A3OA 4NJCA 2K0PA 1N62A 1V2YA 2BS2B 2KFKB 3Q8CA 3HVDA
chains in the Genus database with same CATH topology
3B1LX 3CMMB 1XLPA 4YT0B 4GMVA 4DDID 2QJLA 3H8HA 3NRZA 4I6PA 1KLGD 2HD5B 2M0XA 4O1NA 4NAWB 1V5TA 4ZBQA 4FULA 3Q8EA 4IM0A 4BBNF 3ABVB 1LFDA 2WNMA 1FFVA 2M19A 2ZVOA 4FJZA 4W9HA 2FE8A 5GINA 1RRBA 2GB1A 3APFA 1V49A 2LWPA 4HKQA 1AARA 4EKUA 4F5VA 4NNJB 2OHFA 3KW5B 2BXCA 1SE9A 1N63A 5BPKA 1WGGA 3DBSA 2UYZB 3MHZA 4H2AA 2IYDB 4ZUXV 2AX5A 2AL6A 4WURA 1XQQA 2DX5B 3NZSA 2GI9A 1YD8U 4FBJB 1Q1OA 1JMLA 1E7HA 5L83A 2WXQA 1SJHD 3EA6A 2JX5A 1EM7A 3R7QA 1V8CA 1N5UA 4B0MA 4RM9A 3NS8A 1J7CA 1UUPA 1ZDXA 2PEAA 4OTUA 1D3ZA 2TSSA 2IY0B 3N9YC 1E0ZA 2FUG1 5E6NA 1WE6A 3UIPB 1TZOA 2GBNA 1YN5A 2RPQA 2PVGC 3DBLI 4HLEA 3ZTCA 3AE8B 2DZKA 3ALBA 4GXBA 5JHAA 5G5HA 3OLMD 3V6EB 1KFYB 5HOZA 5HG2A 1E7CA 2JUOA 1WGHA 1TF0A 3ZTDA 1KOTA 1P0RA 4LJPB 5IJFA 2JZZA 3V09A 4HXDA 2WXKA 3AB5A 3RUIB 1NDDA 3ZDTA 4I6LB 4W9IA 4EZLA 1RYJA 2VDBA 3PLVA 1Z2MA 2RPVA 2G9HD 2QHBA 1KJTA 2AJEA 5FKAC 1WZ3A 3P4SB 4M0WA 4E71A 2ACZB 3ZDMC 1YIWA 2BW2A 4BOZB 4P6VF 4HJGE 4ICUA 3R8BA 2BXEA 1YQBA 1XLQA 2EMTA 5CX3A 4BKSD 3AE5B 4BOSC 4MGZE 4MGIE 4EFOA 3U7ZA 4DBGA 3RD2A 3KWLA 1JWBD 1HK3A 3LU6A 3U8ZA 5HFYA 3IBEA 3MHHB 2A4ZA 1IGCA 3B9JA 1TZ1A 3VTVA 4B6WA 2WXPA 1XD3B 3SFEB 2BYVE 4A20A 1A70A 1WY8A 1D5XC 2O6VB 4N6EB 2JRIB 4XC2A 1IBXA 4WWOA 4ZHPA 3X0WA 5ID9A 4K7SA 3QWZB 2DHZA 1JWAD 4GDLA 4KDIC 2FCMA 4IW1A 1IBXB 4REZA 3NS1A 4XDCA 4J3OD 4ZYSA 1E7EA 4YTMB 3RULA 3V62A 1UZXB 1L4ZB 1KH0A 5IIUA 4W9EA 2ZNVC 5JH5C 1SE3A 1TY0A 2IY1B 3B9LA 1RFKA 2KKCA 2KWUB 3I3TB 4E99A 1UBQA 1XEEA 5BYSA 1BM0A 3IVFA 1YJ1A 3BIID 2J53A 4IW2A 2HTHA 2LUMA 1BXTA 1EUVB 3SFDB 3NUHB 3MJWA 4S1YA 3NOBA 4BKSA 1FIQA 2L76A 3B08A 4W9CA 1YN4A 4C7ZA 3AE9B 1RAXA 4M70B 1KLVA 1MI0A 1KM7A 2K1FA 2L52A 2RGFA 2XSIA 1FOUA 2ROHA 3GOEA 2M1MA 1XXGA 1E78A 2DYBA 3Q3JA 2KLGA 2BXMA 3ML8A 1LOTA 2GMIC 2NCNA 4HEA1 1PFDA 1HK5A 2LGYA 3AE2B 2BXBA 4IC7B 3VRAB 4MSMB 2NNWA 3V60A 3IAM1 4FA6A 1B1ZA 1ENFA 3W5VB 2LVOA 4MDKE 5J2RA 3PLUA 4F8CB 2LJ5A 2L0TA 4EE2A 2M4NA 1WYWB 2WXLA 1HA5A 4CYEA 4WJNA 2G4DB 2BXLA 1C1YB 4C80A 1VCBA 3FNMA 3NMUA 3H6NA 4XWTA 2LHEA 1D5ZC 2N9EB 2MCNB 3MHSB 1WGRA 1I4RA 1E8WA 1NEKB 4JL9A 3TEWA 2L05A 2XVUA 5ID7A 3OWEB 3E56A 4FLHA 1BT0A 2Z8KA 3EFUA 3WHRA 1X1MA 2BYFA 4YTNB 3DOWA 2XN9C 2Y5PA 2D10A 5CTRC 3WIMA 3LXFA 1NYRA 2N9LA 2QSDA 3PVLA 2DZIA 4OT2A 4R3DA 4HROA 1N5XA 4EMXA 2VZKB 2HE7A 5C2TB 2LVPA 3W1SC 3RZFA 4W9KA 5J17A 2BB5A 3WCQA 3AI5A 2K9XA 3BZDB 3VDZA 3LJ3A 4LA0A 2IGHA 1KLUD 2CS4A 4LCDE 2V1YA 2BYTA 1GPXA 1IYFA 2BXKA 1IGDA 2MSED 1GAQB 5FK9C 3K9OB 2N1VA 2IPKD 2KN4A 3A9KA 3TIXA 1PQSA 2MJDA 4K7UA 4BVUC 4G0NB 3V05A 3AEFB 3GB1A 4HGMB 3R3MA 2X38A 3A9KB 2EFEA 1WJNA 2N0SB 3GQUA 1PGAA 1MHHE 3E9SA 1QQRA 1CZPA 2IO2B 2NBUA 2WXRA 1EU3A 1HK2A 3RPFC 2W9NA 1G6JA 1L6VA 1WMHB 3U52E 3TDLA 3IT4B 4W9LA 3RFZB 3D32A 2JWZA 3NVZA 1WJ6A 4ZBKA 1NI2A 5LLIA 3VUXA 2KTRA 2BX8A 3MC0B 2CJOA 1MIVA 4BKEA 1LM8B 1WXQA 3DCGA 1XT9B 3N30A 2C7NB 2KTRB 4K2CA 3OAWA 5EE3A 2FCNA 3ZGZA 3AEDB 4XWWA 2FBWB 2UWQA 3ZNID 3U7DA 4N59A 5EE9A 4HCNB 1JNBA 1PDXA 3DVGX 3IFWB 3EHVA 1C79A 1L5PA 2BXOA 2C5LC 2CKHB 1UBIA 2KX3A 1FD6A 3ONSA 2ZPYA 3DWMA 2YVCA 1J19A 2NTTA 3JRYA 4XDDA 3KWVA 2MLBA 3KYCD 1ZDVA 2MBQA 4RGTA 4JIOU 4CQNA 5D6JB 3ECIA 4ARCA 2QM6A 3NVMA 4ZRQA 3UIVA 1XO3A 1IP9A 2D11A 3M99C 4GDKB 4BKTA 3A1QA 5DPTA 3TEYA 2J0KA 1E7BA 4TKNA 1WJUA 1P1AA 2K3UA 4WA6B 2OJRA 3A1QB 1ROEA 1V1PA 3NZ3A 4MT5A 3UGBB 3L10B 1AWDA 1T3QA 4L9KA 2CJNA 3EECA 3HHMA 3ZQ4A 3L0WB 1E7FA 1XF5L 3VXWA 1DYQA 3IXSA 2V36A 4LUHA 2E0YA 2J0MA 3AE4B 5H92C 1F2RI 3V03A 3VRBB 3EUB2 2XVVA 2V3PA 4MBEC 2PLPA 4FADA 1PGXA 4FXCA 1ESFA 2J52A 2XNAC 4L9QA 2KHWB 4RNAA 4KX6B 3PREA 2N7DA 3AEEB 2JUHA 5IIHA 1RFAA 2O2VA 2BS3B 4TQ0A 1QZEA 3JW0X 4IWQA 2NPTB 1E5WA 5D3IB 2NBVB 4KSLC 3TL5A 1WE7A 5C3JB 2NBWB 4W9JA 4JPSA 2KWVB 4W9DA 1XLOA 2NQOA 3N3KB 1V81A 3BYTB 2KTFA 2WXNA 1FXAA 3L4PA 2VRRB 2FIDA 2EFDA 2HDEA 3ZO5B 2N1WA 2WXIA 3AXCA 3QAQA 1DOXA 2KFKA 1VD2A 2LMCA 4FJVB 4PS3A 5BYQA 1UORA 5KHOA 1I42A 2R61A 2V4IB 2IZVB 3RT3B 1WXMA 4TQ1A 4WQMA 1N61A 2BWFA 3SDLC 3HM6X 5IIXA 4JGHB 1TBEA 3X23A 3QA8A 3SU8X 3R7RA 1ZXIA 3L13A 2WP9B 4IM2A 4NAWA 2K39A 5I4DA 2ZZPB 1HK1A 4CO7A 2WDRB 5BO4B 2MW5A 1V5OA 2EKEC 1C3TA 2BYEA 1Y56A 3VQIA 3DVNU 2JPHA 1TS2A 4ZRJA 1AO6A 5LNK1 3NVYA 2JY6A 3ZRFA 4IM3A 3CSFA 1WM2A 4KZCA 1C4CA 3PRPB 2BXPA 2MJEA 1YQ4B 2HTME 5AUKA 5MPOA 2OOBB 2Z8JA 3SHQA 4FJYA 1JWUD 2BT6A 4HPLB 2XBBC 3ZNHB 1D4BA 3BVMA 2ZCBA 4DHJB 2Z0DB 2ZJDA 2EFCA 1FRRA 4YSZB 4URKA 4OVVA 1S3SG 3ZYYX 1NYQA 4NY0A 2O6VD 1FCLA 4OZAA 3PHXB 1E7UA 4ZDVA 2PMVA 1QF6A 1JCKB 4F5SA 4CHKA 1SF0A 2W3RA 1WR1A 3VTUA 4PS8A 2LD9A 4GN1A 4HVBA 2IO0B 4GIVA 1E8ZA 1QOBA 2Q5WD 3W5UB 4N3ZA 4PYUA 1DOIA 5JZEB 2L0FA 4W9GA 3LYYA 3Q3FA 4K81A 2G1EA 3FC4A 3AU4A 1NENB 2WXOA 4HDOA 2WDTB 3CX9A 1VJKA 1MIYA 1O9XA 2BXFA 1XCTL 4WJPA 4MH0E 4ASWC 1N5WA 2BXDA 5CHFA 1SJED 3DBRI 1VRAB 4DHZE 4IKGA 1WYGA 2BXNA 2RDHA 1PUTA 4HK2A 3BK2A 4JK4A 4IOIE 2J42A 3ZIMA 3DWGC 4WWNA 2O6VA 4ICVA 4EUTA 1KTKA 1F77A 1L2NA 1I4QA 2G3QB 2R2QA 2QEJC 5DCNA 1DOYA 2WX0A 3ZUNA 2WDQB 1SEBD 3U2SC 4D2KA 2EELA 2W82A 4WWPA 3PO0A 4OW0A 4NQLB 2LEKA 4KGRA 1OQYA 2GBKA 2AQ1B 1VDVA 3H7PB 3BVZA 1RLFA 5AZGA 2MWSB 3KQ4A 3VUWA 4LJOB 2INNE 2AWTA 3PTFC 1EO6A 3H1UA 4E3CA 3GQXA 3MHSD 2J4XA 4HDQA 3VTWA 2AQ3B 2IO1B 1M4VA 3SQJA 3ZW3A 2MJ3A 3ZKJC 2KOXA 2J0JA 2JYEA 3W1YA 1H4RA 1WSPA 3WANA 1ZXHA 2KZRA 2CHXA 1WXVA 2SAKA 2ASQA 2L8JA 2VZKD 2ON8A 2N9XA 2PTLA 5G55A 1KRHA 1OTRB 3NVIA 4NJ7A 2CKXA 3SR6A 4OVZA 2W55A 1WGYA 1R7SA 4BKGA 2BXGA 4MELA 1ISNA 4XX5A 4J2VA 2KN5A 4B0EA 2IBIB 1TXUA 1FM0D 1QKZA 2V0GA 3NY5A 1C4PA 2BKFA 2H89B 4TMAB 3LU8A 1GOZA 5GXGB 3WHSA 3KUZA 2XK5A 1A5RA 2C7MB 5IA7A 1P9DU 3DVGY 4NZLB 1Y8RC 1WR6E 1GB1A 2XK5B 5E6OA 2BPSA 1J7BA 3A75A 1E7PB 3ICXA 4A8XC 2DZJA 3FILB 1J78A 1FNUA 2ZW0A 4DK5A 1I7HA 4MJSA 2B3AA 2DBYA 3CSTA 1K50A 1P7FA 4RFBA 2Y5BB 4GU2A 1WRIA 3T3NA 3AU5A 4MJSB 1MHXA 2MA9B 4US9A 1S1QB 2XW0A 2N9KA 1WM3A 2JZPA 1YN3A 3V6CB 4ZHOA 5HKHA 1FCCC 4OTTA 4BY9C 3EGRA 3Q8FA 1GNUA 5AUIA 1JRPA 3GS2A 2WDVB 4ZYNA 2JVCA 4I6NB 2FCQA 3P42A 4AWJA 1Z5SB 1CK1A 1WXSA 1AW7A 1ZGUB 4US8A 5KHQA 1WWTA 2D2QA 2K5PA 1BUIC 4RGOS 5IFOA 4B95A 3ZRCA 2PKOA 2G4SA 1FNVA 2DYOA 2DBWA 4AUQC 4GOCA 2LZ6A 2KLCA 3AULA 4K7WA 5T8IA 3P1MA 1TYGB 1E7VA 3O13A 1GJZA 1ZUD2 1E8XA 4ARIA 2DYMA 1EF1A 1QILA 2I1KA 3AECB 3CIRB 4KGSA 3V61A 3BY4B 4EEWA 2Z8LA 4KKIA 1V9JA 4P16A 2B76B 3DBHI 1R4NI 1JRUA 3GZNI 1WMHA 3HK0A 3OJ4B 3K9PB 1E7AA 3R2TA 1P3QU 2KQ7A 1QT9A 2KDEB 5FR3A 2KQ4X 5E6JA 5G2NA 3HM3A 1QOAA 4L23A 3P4PB 4J6IA 1SE4A 1I4XA 3JQZA 5IJEA 1BKEA 2PPHA 4DHZB 3RYTA 3AE7B 4KIKA 4FK5B 5H8YE 3BVGA 4K71A 1HA2A 1RM6C 4BBNC 5EE0A 3ENEA 4KIKB 2ZNVB 5BMHA 3PPAA 4UDUC 1TS4A 3UIOB 4M8MA 1I4PA 2K8BA 2DWQA 4ZRIA 4G03A 3ZNZB 1TJEA 3G9KD 2WU2B 2M0AA 1NI3A 2DAJA 2W54A 4GG2A 2GOWA 1GC7A 4EZKA 2KDFB 1SB3C 1OGWA 1UGMA 3ML9A 1QLBB 3KIKA 1HZ5A 1ZOYB 1V97A 2KD0A 3A9JB 4WH4A 2MX2A 4GDKA 4RCOA 3RZWC 2KAJA 5B5TA 1OFFA 2KC2A 3M95A 2MH7A 1V86A 4MEMA 4A9AA 3UQAA 3H7SA 1VFIA 3ZLZA 1AN8A 4PS7A 1TGZB 4MGKE 1VZ7A 2LRUA 3KVFB 1YMHE 3MJ5A 2OT3A 1VZ8A 2BS4B 3QHTA 2KMCA 3URYA 5D7GA 2OEDA 3IHPC 2LUEA 4KGTA 1CMXB 2WWZA 1WI0A 5HHDG 4ZRKA 5HI1A 3QK0A 3UI3A 2GBRA 1HEZE 2L83A 1WXAA 3PZDA 1IUEA 2LFIA 2XW1A 2VUFA 2KNBA 1P7EA 2MEKA 1FRDA 1FXTB 1FMAD 1ZPSA 5BMIA 2LRWA 2KXJA 4II2B 2KX0A 3RCZA 2LGIA 2WU5B 3W1SA 4PO0A 2NPTA 2JRHA 1OQQA 1YJIA 3QJZA 4B9KA 2Z8IA 3M62B 2QMCA 4M8NA 4DHJD 1T5XD 5E6PA 4WAAA 3Q69A 3JSVA 4ANVA 2QILA 1QOFA 3DPDA 1MIWA 2DAFA 1V6EA 5DPWA 3JSVB 2L00B 4AS1A 2RMMA 3HRDD 2BTEA 2L3ZA 4WIPA 4LUFA 1HK4A 2KACA 3B9MA 3P2BA 2FIFA 2J7QB 4HJKA 3T8MA 4WJOA 5CHWA 3KLSX 1MG8A 3DDCB 4N9F4 2JXTA 1LO5D 2H88B 4G50A 4YSXB 1DGJA 3UINB 1NVID 3MP9A 4IG7B 4WWMA 2ZCCA 1WX7A 1B9RA 1GC6A 1LNSA 4G3XB 5LXHA 4ZC6A 2WXJA 3R66C 2CHWA 4X57B 3B2FA 1SXTA 3VR8B 1H5WA 3Q8BA 4C31B 3APDA 1FNWA 2QHOA 1J7EA 1JWMD 1YNTE 3NZUA 3W2DA 4HPMB 2JF5A 1FEHA 5EE1A 1J7AA 3NVWA 5BMGA 3QARA 3KYDD 1Q0WB 1VR9A 2ICIA 2I38A 3TMPB 2PE9A 2XEWA 1HXYD 5GIOA 2D07B 1IPGA 2BB6A 3AH7A 4AOFA 2IGGA 2EMSA 5EDSA 4ANXA 3U30A 1OEYA 2WXFA 5GHKA 2LXCA 1XCQL 2LHDA 1HE8A 3AN1A 3MFGA 3DQVA 2PVOD 1ZP0B 2XMOA 1KW2A 1GNIA 1UNSA 1VLBA 1WX8A 2KDMA 3SD5A 2PW9A 2IJ0A 2JQRB 2INPE 1M94A 2BWES 2R2OA 2BXAA 3TBLD 4LTUA 4WJQA 4TUUA 3M63B 1V1OA 2Z0EB 3H9DA 3LB8C 3VVWB 4A6QA 1TKGA 2E0XA 1QOGA 1TKYA 2K22A 4YL8A 4HKZE 1ZKHA 2AYOB 4DXAB 2C7HA 5FUOA 3QCAA 3T9LA 4HCPB 4C7YA 4Z69A 2RR9A 3L17A 3KJLA 4GB9A 1ET9A 2XVQA 2PIAA 5AEKB 2Y5CA 3HIZA 2YDFA 2REXA 3TEXA 1MVKA 1E7GA 4G01A 1BMLC 2Z59B 1Q10A 5DPSA 4RGMA 3FWBC 2MBOA 2ZW1A 1GUAB 3AE3B 1F0ZA 1I4GA 1OEYJ 2DENB 1WIAA 4KVGB 2KDIA 3PHWB 2LXAA 3GP7A 4KV2A 2RD0A 4GGQA 3VUYA 1MPEA 3ZVVA 2CR5A 1E6EB 4JX1C 2KBZA 3M3JA 1EU4A 2GRIA 3KUDB 3TCAA 1YQ3B 4M0WB 2QMTA 2WS3B 4F1SA 2MBHA 1KXPD 4ZCGA 1GNJA 2MP2A 4ZRPA 5GIPA 2NVUI 3L54A 1JALA 3I9V1 4OHJA 2MBEA 2KWDA 1F2RC 4L2YA 4W9FA 4OR0A 1HZ6A 2MP2B 4N0UD 1E9MA 3H7PA 3L08A 1JQ4A 2E6XA 3BYYB 5DPRA 3IT6B 4MSQB 2V3SA 4LK0M 2NR2A 2LGDA 3MTNB 1KF6B 4MGYE 1WF9A 5J18A 4TV3A 2HJ8A 5FR6A 4IWOA 3QX1A 2KJHB 1D5MC 3BINA 3KH0A 1L0VB 4GDXA 2RSUA 4WAFA 2K6DB 2WX1A 2IDYA 2A5UA 4HRSA 4GDLB 2C9WB 3CF6E 1SSNA 2EFHA 1L4DB 2BKRB 2JYTA 3QQ8B 1JROA 5JXVA 2PE6B 4DHXB 1ZW7A 2QIEB 2XVWA 2JZ3B 4MH8A 1V80A 1UD7A 2KANA 5D3DA 2BGFA 3KUCB 4LDTD 4NPNA 2MRPA 1TY2A 3UF8A 1K52A 1UH6A 1VZ6A 4L8UA 3DVNV 2DBXA 1C77A 4A55A 3L16A 1ZE3D 4EZJA 1U4AA 4HGKA 1K51A 2JWUA 4YTPB 1K8RB 2GBMA 1YJJA 5D94A 1N60A 1H8CA 3TJPA 4XE0A 4MACA 2PJHA 5GMVA 3WAOA 1I4HA 4YWGG 2CHZA 2V3NA 3BWUD 2WXHA 1EWCA 2WXGA 4ANWA 4Z9OA 1STEA 3FILA 4A3PA 3A4SC 2FAZA 4BFRA 2VUEA 2DLBA 1C9FA 4G11A 5LXIB 3AMZA 2KFJA 2KJ6A 2W3SA 3Q8AA 1TS3A 4PT5A 4FHJA 3PZ8A 4JLCA 4K1RB 2JSVX 2M56B 3ZJTA 4DWFA 1E10A 3CWIA 1MA9A 5DQFA 4IW0A 3AE1B 4JWSC 4N0FD 1PGBA 3AM9A 2MQJA 3QIJA 3FWCC 3EC8A 4ANUA 3A4RA 3VAWA 3AE6B 2EKIA 3FAHA 1LXDA 2D3GA 4LB9A 2M17A 4LDTB 3PSEB 4KDLB 1IJGA 2BBCA 4LB2A 4NAMA 3V3XA 3V08A 2E3TA 3W9CB 3NHEB 1WJ4A 4RF0A 3NVVA 3SIVB 4IUMB 5IJ5A 3AEGB 3AEBB 1YX5B 2I1JA 4F5UA 1E7IA 3O65B 3PRMB 1PYWD 1WZ0A 3NVKA 2N7JA 4IDIA 3VR9B 2FNJB 3B2GA 1GB4A 1CQVA 2KO3A 4AJWA 4YSYB 5CHVC 1ET6A 3S2AA 3VH3B 3VHTC 1TKEA 4TSSA 3VFKA 2V4LA 4ZOHC 2ONQA 4PYZA 2LGXA 4AJYB 2IO3B 3A33B 1YX6B 3TEZA 3APCA 3P63A 3H3AA 5L95C 2BXQA 1RWSA 1P98A 2N4FA 1TTNA 4MM3A 2I2YA 2BXHA 3LU7A 2FCSA 4C56C 4JWUC 4MM3B 3WAPA 3T3OA 3R2IA 2KQSA 2WXMA 1SIJA 2AL3A 5JHBA 1R4MI 3C8YA 1WGKA 5TSSA 1SIFA 3P4QB 1BJ5A 4HWIB 1UWMA 1WRDB 1T6BX 3TUOA 2AEHA 2KC1A 3PZ7A 2Y3AA 3QC8B 1OQRA 1JW9D 5C1ZA 4KSKC 2NS5A 3SIUB 2K6QA 4L1BA 3PV1A 1SGHA 2N9PC 3JVZX 2KDBA 1CJEA 3TSSA 1EF5A 2WYQA 3C0RB 2ZPNA 4IWPA 1HQRD 4RGNA 4LLGM 4FIPB 1WX9A 1L0YB 3IG3A 1L6UA 1C78A 1L0XB 2JXXA 2KK8A 4DQOC 1C76A 3WHQA 1J0GA 1K53A 3PLAA 1Q5WB 4EOYA 2KMMA 2WLBA 2LOQA 2DG5A 1WH3A 3ZJUA 2K25A 3BK1A 1I35A 1WFYA 3A9JA 2LASA 4FJCB 5AZHA 4N58A 2BXIA 1C4AA 2GBJA 3N32A 3U4EG 3PT2B 2ZEQA 2G45B 3A73A 1VZSA 3UQBA 1JWSD 3HUIA 4XZ4A 4KZ0A 1T0YA 5DBYA 2SEBD 1H9ZA 2JT4B 1FXIA 3IAS1 2DZMA 1AYFA 3AV8A 4II3B 1L7YA 2KJRA 2I30A 4W4UB 4G04A 3GA9L 3I57A 5IAAC 3WAMA 2FUHB 2BF8B 3H37A 3LDZE 2MBBB 2AQ2B 4F7ZA 3P4RB 2YLMA 2I2ZA 3PRZA 3JYUA 1SE2A 5TR5A 4JQWC 1ACCA 3WA0A 4GLSC 4DXFA 4JE3B 3WALA 1J8CA 4NQKE 2N7EA 4DDGD 3J9CA 5BYRA 1D6EC 4OZBA 1LQBA 3AEAB 4OZCA 1E8YA 4YXDB 2M8SA 2KWCA 5D2MB 4FN2A 1V1PB 2L32A 4ZBRA 2ZVNA 2NTSA 4NJ6A 4RF1A 4DXGA 1UWXA 2IGDA 3OJ3A 2DBUA 4E74A 4RH6A 2K8CA 4ITKA 3PS6A 2K8HA 2LJIA 4GSWA 2L1AA 1NBFC 2NMQA 1WGDA 4KKJA 1UGJA 4RM8A 1NT2B 1SBBB 1FFUA 2OZBB 3ZJVA 2LI5A 1E90A 1XLNA 5AZFA 2WQYB 5C23A 2KMAA 5G5GA 4F5TA 2D5GA 4RMAA 4Q2JA 2O2VB 1F9JA 2CU1A 4AQ7A 1EWYC 3VH4B 3SEBA 4FHKA 1GG3A 2KVRA 2LVQA 2RDGA 4OVUA 2YEPB 4A90A 4USAA 2C60A 3ZNGC 4AP4C 1UELA 3HVZA 4WQOB 2JU6X 2YEPF 3PGEA 2CU3A 1TS5A 3ETRA 2L7RA 3B0AA 4P7IA 1FO4A 4A3OA 4NJCA 2K0PA 1V2YA 1N62A 2KFKB 2BS2B 3Q8CA 3HVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B1L X;  2YVC A;  2NVU I;  3L54 A;  1J19 A;  1GNU A;  2MBE A;  2MLB A;  3CMM B;  3KYC D;  4ZYN A;  4GMV A;  4W9F A;  4DDI D;  2MBQ A;  2MP2 B;  4I6P A;  3H7P A;  4JIO U;  2JVC A;  3ECI A;  4I6N B;  5D6J B;  3L08 A;  2FCQ A;  4AWJ A;  2HD5 B;  1Z5S B;  2M0X A;  4NAW B;  1WXS A;  1V5T A;  5DPR A;  4FUL A;  1ZGU B;  4MSQ B;  4IM0 A;  5KHQ A;  2V3S A;  2D2Q A;  4BBN F;  2NR2 A;  2LGD A;  1LFD A;  3MTN B;  4B95 A;  4MGY E;  3ZRC A;  1IP9 A;  1WF9 A;  2G4S A;  2D11 A;  5J18 A;  2DYO A;  4TV3 A;  2ZVO A;  4FJZ A;  4W9H A;  4GDK B;  4AUQ C;  2HJ8 A;  2LZ6 A;  4GOC A;  3A1Q A;  1RRB A;  4BKT A;  2KLC A;  3AUL A;  5FR6 A;  4K7W A;  5DPT A;  3APF A;  1V49 A;  4IWO A;  2LWP A;  3QX1 A;  1AAR A;  2KJH B;  2J0K A;  3BIN A;  3KH0 A;  4EKU A;  4TKN A;  1E7V A;  4NNJ B;  1WJU A;  1P1A A;  2RSU A;  1GJZ A;  3KW5 B;  2OJR A;  1E8X A;  2K6D B;  2DYM A;  3A1Q B;  1SE9 A;  2WX1 A;  1EF1 A;  2A5U A;  4GDL B;  1WGG A;  2I1K A;  2C9W B;  3DBS A;  2UYZ B;  3CF6 E;  2IYD B;  2AL6 A;  2BKR B;  3UGB B;  3L10 B;  3QQ8 B;  1XQQ A;  2DX5 B;  3NZS A;  3BY4 B;  1YD8 U;  2PE6 B;  3V61 A;  4EEW A;  4FBJ B;  1V9J A;  3EEC A;  3HHM A;  1Q1O A;  3DBH I;  5L83 A;  1ZW7 A;  1R4N I;  3L0W B;  2JZ3 B;  1JRU A;  1V80 A;  1UD7 A;  2KAN A;  3GZN I;  1WMH A;  2BGF A;  3HK0 A;  3R7Q A;  3VXW A;  3KUC B;  4LDT D;  4NPN A;  3OJ4 B;  4RM9 A;  3K9P B;  2MRP A;  3NS8 A;  2J0M A;  3UF8 A;  1P3Q U;  1UH6 A;  2KQ7 A;  3DVN V;  2PEA A;  1D3Z A;  2KDE B;  3L16 A;  2IY0 B;  4FAD A;  5G2N A;  3HM3 A;  5E6N A;  1WE6 A;  3UIP B;  2GBN A;  2RPQ A;  2KHW B;  1U4A A;  4EZJ A;  4J6I A;  1K8R B;  2GBM A;  3DBL I;  4HLE A;  3PRE A;  5D94 A;  3ZTC A;  1H8C A;  2DZK A;  3ALB A;  3TJP A;  2N7D A;  4GXB A;  5JHA A;  2PPH A;  2PJH A;  4DHZ B;  3RYT A;  5GMV A;  3WAO A;  3OLM D;  3V6E B;  2CHZ A;  4KIK A;  2JUO A;  1RFA A;  2O2V A;  4TQ0 A;  1QZE A;  1WGH A;  4ANW A;  3ZTD A;  4BBN C;  3ENE A;  3JW0 X;  1KOT A;  1P0R A;  4IWQ A;  4LJP B;  2NPT B;  4A3P A;  2JZZ A;  1E5W A;  4HXD A;  4KIK B;  2NBV B;  2ZNV B;  3A4S C;  4KSL C;  3TL5 A;  1WE7 A;  2FAZ A;  4BFR A;  3RUI B;  2NBW B;  3PPA A;  4W9J A;  1NDD A;  3ZDT A;  2KWV B;  4I6L B;  4W9D A;  4W9I A;  4G11 A;  4EZL A;  3PLV A;  1Z2M A;  3N3K B;  5LXI B;  1V81 A;  3UIO B;  2KTF A;  2KFJ A;  4M8M A;  2KJ6 A;  1KJT A;  2VRR B;  2FID A;  2K8B A;  1WZ3 A;  3ZO5 B;  2N1W A;  4ZRI A;  3AXC A;  3QAQ A;  4E71 A;  3ZNZ B;  3ZDM C;  4FHJ A;  2KFK A;  1YIW A;  1VD2 A;  3X23 A;  4JLC A;  4K1R B;  4BOZ B;  4FJV B;  4PS3 A;  4ICU A;  4DWF A;  1YQB A;  5KHO A;  1I42 A;  2DAJ A;  2EMT A;  5CX3 A;  2IZV B;  3RT3 B;  4IW0 A;  1WXM A;  4TQ1 A;  4BKS D;  2GOW A;  2BWF A;  1GC7 A;  3SDL C;  4BOS C;  2KDF B;  3HM6 X;  4JGH B;  4EZK A;  1TBE A;  4MGI E;  4MGZ E;  3QA8 A;  1OGW A;  1UGM A;  2MQJ A;  3ML9 A;  3L13 A;  3QIJ A;  3R7R A;  4IM2 A;  3SU8 X;  3EC8 A;  4EFO A;  4NAW A;  4DBG A;  3RD2 A;  4ANU A;  3A4R A;  2K39 A;  3U8Z A;  2ZZP B;  3VAW A;  1LXD A;  4CO7 A;  3IBE A;  5BO4 B;  2A4Z A;  2KD0 A;  2D3G A;  1V5O A;  2EKE C;  2MW5 A;  1C3T A;  1TZ1 A;  2BYE A;  2M17 A;  3VTV A;  1XD3 B;  3A9J B;  4B6W A;  4LDT B;  3PSE B;  2MX2 A;  2BYV E;  4GDK A;  4KDL B;  3VQI A;  3RZW C;  1WY8 A;  4A20 A;  2O6V B;  3DVN U;  2JRI B;  2JPH A;  2KC2 A;  4XC2 A;  3M95 A;  4ZRJ A;  1V86 A;  4MEM A;  2JY6 A;  3UQA A;  4WWO A;  3X0W A;  3H7S A;  3ZLZ A;  4K7S A;  3QWZ B;  4PS7 A;  2DHZ A;  3ZRF A;  4IM3 A;  3NHE B;  1WJ4 A;  3CSF A;  2FCM A;  4GDL A;  4KDI C;  1TGZ B;  4MGK E;  1WM2 A;  4KZC A;  4IUM B;  2LRU A;  3KVF B;  3PRP B;  1YX5 B;  2I1J A;  3O65 B;  3PRM B;  1WZ0 A;  2OOB B;  3RUL A;  3V62 A;  3QHT A;  1UZX B;  3SHQ A;  4FJY A;  2KMC A;  4HPL B;  5D7G A;  2FNJ B;  4W9E A;  2ZNV C;  5JH5 C;  2XBB C;  3IHP C;  2KO3 A;  4AJW A;  3ZNH B;  2LUE A;  5CHV C;  2IY1 B;  1CMX B;  3S2A A;  2WWZ A;  3VH3 B;  1WI0 A;  3VHT C;  2KKC A;  2KWU B;  3I3T B;  3QK0 A;  4ZRK A;  2GBR A;  3VFK A;  2ZCB A;  4DHJ B;  2V4L A;  2Z0D B;  2ZJD A;  1WXA A;  4URK A;  3PZD A;  4OVV A;  4PYZ A;  1S3S G;  2LGX A;  4NY0 A;  2O6V D;  4AJY B;  1UBQ A;  2IO3 B;  3A33 B;  1YX6 B;  2KNB A;  1E7U A;  3PHX B;  4ZDV A;  3APC A;  3IVF A;  1YJ1 A;  4CHK A;  1FXT B;  5L95 C;  2HTH A;  1WR1 A;  3VTU A;  1P98 A;  4PS8 A;  2LD9 A;  2N4F A;  1TTN A;  2KXJ A;  1EUV B;  2LRW A;  4GN1 A;  4MM3 A;  4HVB A;  3MJW A;  2IO0 B;  4GIV A;  4II2 B;  2KX0 A;  1E8Z A;  3NOB A;  3RCZ A;  4BKS A;  2FCS A;  2L76 A;  3B08 A;  4W9C A;  3W1S A;  1RAX A;  2NPT A;  2JRH A;  4PYU A;  3WAP A;  1KLV A;  5JZE B;  2L0F A;  4W9G A;  1KM7 A;  2K1F A;  2KQS A;  3QJZ A;  2RGF A;  3Q3F A;  4B9K A;  4K81 A;  2AL3 A;  3M62 B;  1R4M I;  5JHB A;  3AU4 A;  1SIF A;  4HWI B;  3GOE A;  1WRD B;  2M1M A;  4HDO A;  4M8N A;  4DHJ D;  2WDT B;  2AEH A;  2DYB A;  3Q3J A;  5E6P A;  4WAA A;  2KC1 A;  2KLG A;  3ML8 A;  3QC8 B;  3JSV A;  4ANV A;  2GMI C;  2NCN A;  5C1Z A;  2LGY A;  4KSK C;  4IC7 B;  4MSM B;  3V60 A;  2NS5 A;  3DPD A;  2DAF A;  1V6E A;  2K6Q A;  4WJP A;  4FA6 A;  5DPW A;  3PV1 A;  3JSV B;  4MH0 E;  4ASW C;  1SGH A;  2N9P C;  2LVO A;  3JVZ X;  4MDK E;  5J2R A;  2L00 B;  2KDB A;  3PLU A;  2L3Z A;  1EF5 A;  2WYQ A;  4F8C B;  5CHF A;  3C0R B;  2ZPN A;  4IWP A;  2LJ5 A;  3DBR I;  4DHZ E;  2L0T A;  2M4N A;  3P2B A;  2FIF A;  2J7Q B;  1WYW B;  4HJK A;  1WX9 A;  4WJO A;  5CHW A;  3T8M A;  3IG3 A;  1MG8 A;  4CYE A;  3DDC B;  4N9F 4;  4WJN A;  2G4D B;  2JXX A;  2KK8 A;  1C1Y B;  1J0G A;  1VCB A;  1Q5W B;  4G50 A;  4HK2 A;  4EOY A;  3UIN B;  1WH3 A;  3H6N A;  2K25 A;  1I35 A;  4IG7 B;  2ZPY A;  1WFY A;  3A9J A;  2ZCC A;  2LAS A;  1WX7 A;  2N9E B;  5AZH A;  2MCN B;  1GC6 A;  1WGR A;  3ZIM A;  1E8W A;  4WWN A;  4G3X B;  2GBJ A;  3N32 A;  2O6V A;  4JL9 A;  5LXH A;  3PT2 B;  2L05 A;  4ICV A;  3R66 C;  4EUT A;  2CHW A;  2ZEQ A;  2G45 B;  1L2N A;  4X57 B;  4FLH A;  1BT0 A;  3UQB A;  3EFU A;  2G3Q B;  1X1M A;  2BYF A;  2R2Q A;  4XZ4 A;  3APD A;  5DCN A;  3DOW A;  2WX0 A;  4KZ0 A;  2QHO A;  1T0Y A;  3ZUN A;  2D10 A;  5CTR C;  3WIM A;  3NZU A;  2JT4 B;  4HPM B;  2DZM A;  2JF5 A;  4WWP A;  4II3 B;  3PVL A;  2DZI A;  1L7Y A;  4NQL B;  1OQY A;  2KJR A;  2GBK A;  2HE7 A;  3KYD D;  3QAR A;  1Q0W B;  5IAA C;  3WAM A;  2FUH B;  3H7P B;  2LVP A;  2BF8 B;  3W1S C;  3RZF A;  4W9K A;  1RLF A;  3LDZ E;  2MBB B;  2MWS B;  2PE9 A;  5AZG A;  3TMP B;  4LJO B;  2YLM A;  2AWT A;  3PTF C;  3VUW A;  4F7Z A;  5J17 A;  1EO6 A;  3PRZ A;  3JYU A;  2XEW A;  3H1U A;  5TR5 A;  3AI5 A;  4JQW C;  4E3C A;  3VDZ A;  2D07 B;  3LJ3 A;  1IPG A;  3WA0 A;  3MHS D;  3WAL A;  4AOF A;  1J8C A;  2EMS A;  5EDS A;  4NQK E;  4ANX A;  2CS4 A;  2N7E A;  4LCD E;  4HDQ A;  2V1Y A;  3U30 A;  3VTW A;  1IYF A;  1OEY A;  2IO1 B;  2MSE D;  3ZW3 A;  4DDG D;  2LXC A;  3K9O B;  2N1V A;  1LQB A;  3ZKJ C;  3A9K A;  3TIX A;  1HE8 A;  1E8Y A;  2KOX A;  1PQS A;  2J0J A;  4K7U A;  4BVU C;  2M8S A;  1H4R A;  2KWC A;  3W1Y A;  4G0N B;  5D2M B;  4FN2 A;  3WAN A;  3DQV A;  3R3M A;  3A9K B;  1WJN A;  2CHX A;  2KZR A;  2ZVN A;  1WXV A;  4NJ6 A;  2ASQ A;  2L8J A;  1WX8 A;  2N9X A;  3SD5 A;  3OJ3 A;  4E74 A;  2IO2 B;  2K8C A;  2NBU A;  5G55 A;  1M94 A;  2BWE S;  1OTR B;  2R2O A;  2W9N A;  1G6J A;  4NJ7 A;  3TBL D;  3PS6 A;  2K8H A;  4TUU A;  3M63 B;  4WJQ A;  1WMH B;  2Z0E B;  4GSW A;  3H9D A;  1WGY A;  4BKG A;  4MEL A;  1ISN A;  3VVW B;  4XX5 A;  4W9L A;  1NBF C;  2KN5 A;  1WGD A;  2IBI B;  3D32 A;  2JWZ A;  1WJ6 A;  4YL8 A;  1NI2 A;  5LLI A;  3NY5 A;  1ZKH A;  2AYO B;  2BKF A;  4RM8 A;  3VUX A;  2KTR A;  4DXA B;  2C7H A;  3KUZ A;  2XK5 A;  1A5R A;  2LI5 A;  3QCA A;  2C7M B;  4HCP B;  1E90 A;  1LM8 B;  3T9L A;  5IA7 A;  2RR9 A;  3DCG A;  1XT9 B;  3L17 A;  1P9D U;  3DVG Y;  2C7N B;  1Y8R C;  2KTR B;  3N30 A;  3OAW A;  2FCN A;  4GB9 A;  1WR6 E;  5AZF A;  5AEK B;  3HIZ A;  2XK5 B;  5E6O A;  2BPS A;  5C23 A;  2KMA A;  2REX A;  2UWQ A;  3ZNI D;  4RMA A;  3U7D A;  2Z59 B;  5DPS A;  2MBO A;  2O2V B;  1GUA B;  4HCN B;  1F9J A;  1OEY J;  2CU1 A;  2DEN B;  2DZJ A;  1WIA A;  4KVG B;  2KDI A;  3PHW B;  2LXA A;  3VH4 B;  4KV2 A;  4FHK A;  1GG3 A;  2KVR A;  4DK5 A;  4MJS A;  2B3A A;  2LVQ A;  3DVG X;  3CST A;  3IFW B;  4OVU A;  2Y5B B;  2RD0 A;  4GGQ A;  4GU2 A;  3EHV A;  3VUY A;  3AU5 A;  2C5L C;  4MJS B;  2MA9 B;  2C60 A;  3ZNG C;  4AP4 C;  2CKH B;  1UEL A;  3ZVV A;  2CR5 A;  1S1Q B;  4WQO B;  3PGE A;  1UBI A;  3M3J A;  1WM3 A;  3KUD B;  2KX3 A;  3TCA A;  3V6C B;  4M0W B;  2L7R A;  3B0A A;  4P7I A;  3ONS A;  4A3O A;  4F1S A;  1V2Y A;  5HKH A;  2KFK B;  2MBH A;  2MP2 A; 
#chains in the Genus database with same CATH topology
 3B1L X;  2RDB C;  1XLP A;  3CMM B;  4YT0 B;  4GMV A;  2QJL A;  4DDI D;  4C4V A;  3H8H A;  3NRZ A;  4I6P A;  1KLG D;  2HD5 B;  2M0X A;  4O1N A;  4NAW B;  1V5T A;  4ZBQ A;  4FUL A;  3Q8E A;  1T0R C;  4IM0 A;  4BBN F;  3ABV B;  1LFD A;  2WNM A;  5IO9 A;  1FFV A;  2M19 A;  4S0R A;  2ZVO A;  4FJZ A;  4W9H A;  2FE8 A;  5GIN A;  1RRB A;  2GB1 A;  3APF A;  1V49 A;  2LWP A;  4HKQ A;  1AAR A;  4EKU A;  4F5V A;  4NNJ B;  2OHF A;  3KW5 B;  2BXC A;  4P1B C;  1SE9 A;  1N63 A;  5BPK A;  1WGG A;  3DBS A;  2UYZ B;  3MHZ A;  4H2A A;  2IYD B;  4ZUX V;  2AX5 A;  2AL6 A;  3Q3O C;  4WUR A;  1XQQ A;  2DX5 B;  3NZS A;  2GI9 A;  1YD8 U;  4FBJ B;  1Q1O A;  1JML A;  1E7H A;  5L83 A;  2WXQ A;  1SJH D;  3EA6 A;  2JX5 A;  1EM7 A;  3R7Q A;  1V8C A;  1N5U A;  4B0M A;  4RM9 A;  3NS8 A;  1J7C A;  1UUP A;  1ZDX A;  2PEA A;  4OTU A;  1D3Z A;  2TSS A;  2IY0 B;  3N9Y C;  1E0Z A;  2FUG 1;  5E6N A;  1WE6 A;  1TZO A;  1YN5 A;  2GBN A;  3UIP B;  2RPQ A;  2PVG C;  3DBL I;  4HLE A;  3ZTC A;  3AE8 B;  2DZK A;  3ALB A;  4GXB A;  5JHA A;  5G5H A;  1KFY B;  3OLM D;  3V6E B;  5HOZ A;  5HG2 A;  1E7C A;  3NJT A;  2JUO A;  4HPP A;  1WGH A;  1TF0 A;  3ZTD A;  1KOT A;  1P0R A;  4LJP B;  5IJF A;  2JZZ A;  3V09 A;  4HXD A;  2WXK A;  3AB5 A;  3RUI B;  1NDD A;  3ZDT A;  4I6L B;  1RYJ A;  4W9I A;  4EZL A;  2VDB A;  3PLV A;  1Z2M A;  2RPV A;  4BZA A;  2KT7 A;  2G9H D;  2QHB A;  1KJT A;  2AJE A;  5FKA C;  1WZ3 A;  3P4S B;  4M0W A;  4E71 A;  1LGR A;  2ACZ B;  3ZDM C;  1YIW A;  2BW2 A;  4P6V F;  4BOZ B;  1F52 A;  1MFW A;  4HJG E;  4ICU A;  3R8B A;  2BXE A;  1YQB A;  1XLQ A;  4XGA B;  2EMT A;  5CX3 A;  4BKS D;  4DM0 A;  3AE5 B;  3Q6B A;  4BOS C;  4MGZ E;  4MGI E;  4EFO A;  3U7Z A;  4DBG A;  3KWL A;  3RD2 A;  1JWB D;  1HK3 A;  3LU6 A;  3U8Z A;  5HFY A;  3IBE A;  3MHH B;  2A4Z A;  4I9O A;  1IGC A;  3B9J A;  1TZ1 A;  2WXP A;  3VTV A;  4B6W A;  1XD3 B;  3MC9 A;  3SFE B;  2BYV E;  4A20 A;  1A70 A;  1D5X C;  1WY8 A;  2O6V B;  4N6E B;  2JRI B;  4XC2 A;  1IBX A;  4WWO A;  4ZHP A;  3X0W A;  5ID9 A;  4K7S A;  3QWZ B;  2DHZ A;  1JWA D;  4GDL A;  4KDI C;  2FCM A;  4IW1 A;  1IBX B;  4REZ A;  3NS1 A;  4XDC A;  4J3O D;  4ZYS A;  3DHI C;  1E7E A;  4YTM B;  3RUL A;  3V62 A;  1UZX B;  1L4Z B;  1KH0 A;  5IIU A;  4W9E A;  2ZNV C;  5JH5 C;  1SE3 A;  1TY0 A;  2IY1 B;  3B9L A;  1RFK A;  2KKC A;  2KWU B;  3I3T B;  4E99 A;  1UBQ A;  1XEE A;  3RNA C;  5BYS A;  1BM0 A;  3IVF A;  1YJ1 A;  3BII D;  3RI7 C;  2J53 A;  4IW2 A;  2HTH A;  2LUM A;  1BXT A;  1EUV B;  3SFD B;  3NUH B;  3MJW A;  4S1Y A;  3NOB A;  4BKS A;  1FIQ A;  2L76 A;  3B08 A;  4W9C A;  1YN4 A;  4C7Z A;  3AE9 B;  1RAX A;  4M70 B;  1KLV A;  1MI0 A;  1KM7 A;  2K1F A;  2L52 A;  2RGF A;  2XSI A;  4PK1 A;  1FOU A;  2ROH A;  3GOE A;  3DHG C;  2M1M A;  1XXG A;  1E78 A;  2DYB A;  3Q3J A;  2KLG A;  2BXM A;  3N1Y C;  3ML8 A;  1LOT A;  2GMI C;  2NCN A;  4HEA 1;  1PFD A;  1HK5 A;  2LGY A;  3AE2 B;  2BXB A;  4IC7 B;  3VRA B;  4MSM B;  2NNW A;  3IAM 1;  3V60 A;  4FA6 A;  1B1Z A;  1ENF A;  3W5V B;  2LVO A;  4MDK E;  5J2R A;  3PLU A;  4F8C B;  2LJ5 A;  2L0T A;  2WGS A;  4EE2 A;  1MG4 A;  2M4N A;  1WYW B;  2WXL A;  1HA5 A;  4CYE A;  4WJN A;  2G4D B;  2BXL A;  1C1Y B;  4C80 A;  1VCB A;  4M02 A;  3FNM A;  3NMU A;  3H6N A;  4XWT A;  2LHE A;  1D5Z C;  2N9E B;  2MCN B;  3MHS B;  2LXT A;  1I4R A;  1WGR A;  1E8W A;  3I5J C;  1NEK B;  4JL9 A;  3TEW A;  2L05 A;  2XVU A;  5ID7 A;  3OWE B;  3E56 A;  4FLH A;  1BT0 A;  2Z8K A;  3EFU A;  3WHR A;  1X1M A;  2BYF A;  4YTN B;  2XN9 C;  2Y5P A;  3DOW A;  2D10 A;  4M01 A;  5CTR C;  3WIM A;  3LXF A;  1NYR A;  2N9L A;  2QSD A;  3PVL A;  2DZI A;  4OT2 A;  3C19 A;  4R3D A;  4HRO A;  1N5X A;  4EMX A;  2VZK B;  3GE8 C;  2HE7 A;  5C2T B;  2LVP A;  3W1S C;  3RZF A;  4W9K A;  5J17 A;  2BB5 A;  3WCQ A;  2K9X A;  3AI5 A;  3BZD B;  3VDZ A;  3LJ3 A;  4LA0 A;  2IGH A;  1KLU D;  2CS4 A;  4LCD E;  2V1Y A;  2BYT A;  1GPX A;  1IYF A;  2BXK A;  1IGD A;  1GAQ B;  2MSE D;  5FK9 C;  3K9O B;  2N1V A;  2IPK D;  2KN4 A;  3A9K A;  3TIX A;  1PQS A;  2MJD A;  4K7U A;  4BVU C;  4G0N B;  3V05 A;  3AEF B;  3GB1 A;  4HGM B;  3R3M A;  2X38 A;  3A9K B;  2EFE A;  1WJN A;  2N0S B;  3GQU A;  1PGA A;  1MHH E;  3E9S A;  1QQR A;  1CZP A;  2IO2 B;  2NBU A;  2WXR A;  1EU3 A;  1HK2 A;  3RPF C;  2W9N A;  1G6J A;  1L6V A;  1WMH B;  3U52 E;  3TDL A;  3IT4 B;  4W9L A;  3RFZ B;  3D32 A;  2JWZ A;  3NVZ A;  1WJ6 A;  4ZBK A;  1NI2 A;  5LLI A;  3VUX A;  2KTR A;  2BX8 A;  3MC0 B;  2CJO A;  1MIV A;  4BKE A;  1LM8 B;  1WXQ A;  3DCG A;  1XT9 B;  3N30 A;  2C7N B;  2KTR B;  4K2C A;  3OAW A;  5EE3 A;  2FCN A;  3ZGZ A;  3AED B;  4XWW A;  2FBW B;  2UWQ A;  3ZNI D;  3U7D A;  4N59 A;  5EE9 A;  4HCN B;  1JNB A;  1PDX A;  2GLS A;  3DVG X;  3IFW B;  3EHV A;  1C79 A;  1L5P A;  2BXO A;  2C5L C;  2CKH B;  2K0N A;  1UBI A;  2KX3 A;  1FD6 A;  3ONS A;  2ZPY A;  3DWM A;  1HTQ A;  2YVC A;  3RNE C;  1J19 A;  2NTT A;  3JRY A;  1T0Q C;  4XDD A;  3KWV A;  2MLB A;  3KYC D;  1ZDV A;  2MBQ A;  4RGT A;  4JIO U;  4CQN A;  5D6J B;  3ECI A;  4ARC A;  2QM6 A;  3NVM A;  4ZRQ A;  2DNF A;  3UIV A;  1XO3 A;  4QAY A;  1IP9 A;  2D11 A;  3M99 C;  4GDK B;  4BKT A;  3A1Q A;  5DPT A;  3TEY A;  4XYC A;  2J0K A;  1E7B A;  4TKN A;  1WJU A;  1P1A A;  2K3U A;  4WA6 B;  2OJR A;  2X8X X;  3A1Q B;  5IP4 D;  1ROE A;  1V1P A;  3NZ3 A;  4MT5 A;  3UGB B;  3L10 B;  1AWD A;  1T3Q A;  4LNO A;  4L9K A;  2CJN A;  3EEC A;  3HHM A;  3ZQ4 A;  3L0W B;  1E7F A;  1XF5 L;  3VXW A;  3ECP A;  1DYQ A;  3IXS A;  2V36 A;  4LUH A;  2E0Y A;  2J0M A;  3AE4 B;  5H92 C;  1F2R I;  3V03 A;  3VRB B;  3EUB 2;  2XVV A;  2V3P A;  4MBE C;  2PLP A;  4FAD A;  1PGX A;  4FXC A;  1ESF A;  2J52 A;  2XNA C;  4L9Q A;  2KHW B;  4RNA A;  4KX6 B;  3PRE A;  2N7D A;  3AEE B;  2JUH A;  5IIH A;  1RFA A;  2BS3 B;  2O2V A;  4TQ0 A;  1QZE A;  3JW0 X;  4IWQ A;  2NPT B;  1E5W A;  5D3I B;  2NBV B;  4KSL C;  2LXS A;  3TL5 A;  1WE7 A;  5C3J B;  2NBW B;  4JPS A;  4W9J A;  2KWV B;  4W9D A;  1XLO A;  2NQO A;  3N3K B;  1V81 A;  3BYT B;  2KTF A;  3DHH C;  2WXN A;  1FXA A;  3L4P A;  2KYW A;  2VRR B;  2FID A;  3DBR B;  2EFD A;  2HDE A;  3ZO5 B;  2N1W A;  2WXI A;  3AXC A;  3QAQ A;  1DOX A;  2KFK A;  2D3A A;  1VD2 A;  2LMC A;  4FJV B;  4PS3 A;  5BYQ A;  1UOR A;  5KHO A;  1I42 A;  2R61 A;  2V4I B;  2IZV B;  3RT3 B;  1WXM A;  4TQ1 A;  4WQM A;  1N61 A;  2BWF A;  3SDL C;  3HM6 X;  5IIX A;  4JGH B;  1TBE A;  3X23 A;  1ZXI A;  3QA8 A;  3R7R A;  3SU8 X;  3L13 A;  2WP9 B;  4IM2 A;  4NAW A;  2K39 A;  5I4D A;  2ZZP B;  1HK1 A;  4CO7 A;  2WDR B;  5BO4 B;  2MW5 A;  1V5O A;  2EKE C;  1C3T A;  2BYE A;  1T0S C;  1Y56 A;  3VQI A;  3DVN U;  2JPH A;  1TS2 A;  4ZRJ A;  1AO6 A;  5LNK 1;  3NVY A;  2JY6 A;  3ZRF A;  4IM3 A;  3CSF A;  1WM2 A;  4KZC A;  1C4C A;  3PRP B;  2BXP A;  2MJE A;  1YQ4 B;  2HTM E;  5AUK A;  5MPO A;  2OOB B;  2Z8J A;  3SHQ A;  4FJY A;  1JWU D;  2BT6 A;  4HPL B;  2IND C;  2XBB C;  3ZNH B;  1D4B A;  3BVM A;  2ZCB A;  4DHJ B;  1FRR A;  2Z0D B;  2EFC A;  2ZJD A;  4YSZ B;  4URK A;  4OVV A;  1S3S G;  3ZYY X;  1NYQ A;  4NY0 A;  2O6V D;  1FCL A;  4LNK A;  4OZA A;  3PHX B;  1E7U A;  4ZDV A;  2PMV A;  1QF6 A;  1JCK B;  4F5S A;  4CHK A;  1SF0 A;  2W3R A;  1WR1 A;  3VTU A;  4PS8 A;  2LD9 A;  4GN1 A;  4HVB A;  2IO0 B;  1HTO A;  4GIV A;  1E8Z A;  1QOB A;  2Q5W D;  3W5U B;  4N3Z A;  4PYU A;  1DOI A;  5JZE B;  2L0F A;  4W9G A;  3LYY A;  3Q3F A;  4K81 A;  2G1E A;  3FC4 A;  3AU4 A;  1NEN B;  2WXO A;  4HDO A;  2WDT B;  3CX9 A;  1VJK A;  1MIY A;  1O9X A;  2BXF A;  1XCT L;  4WJP A;  4MH0 E;  4ASW C;  1N5W A;  2BXD A;  5CHF A;  3Q2A C;  1SJE D;  3DBR I;  1VRA B;  4DHZ E;  4IKG A;  1WYG A;  1KDX A;  2BXN A;  2KVZ A;  2RDH A;  1PUT A;  4HK2 A;  3BK2 A;  4JK4 A;  2D3B A;  4IOI E;  2J42 A;  3DWG C;  3ZIM A;  4WWN A;  2O6V A;  4ICV A;  4EUT A;  1KTK A;  1F77 A;  1L2N A;  4D7X A;  1I4Q A;  2G3Q B;  2R2Q A;  2QEJ C;  5DCN A;  1DOY A;  2WX0 A;  3ZUN A;  3Q3M C;  2WDQ B;  1SEB D;  3U2S C;  4D2K A;  2EEL A;  2W82 A;  3PO0 A;  4WWP A;  4OW0 A;  4NQL B;  2LEK A;  4KGR A;  1MUS A;  1OQY A;  2GBK A;  2AQ1 B;  4P1C C;  1VDV A;  3H7P B;  3BVZ A;  1RLF A;  5AZG A;  2MWS B;  3KQ4 A;  2INN E;  4LJO B;  3VUW A;  2AWT A;  3MC8 A;  3PTF C;  1EO6 A;  3H1U A;  4E3C A;  3GQX A;  3MHS D;  2J4X A;  4HDQ A;  3VTW A;  2AQ3 B;  2IO1 B;  1M4V A;  3SQJ A;  3ZW3 A;  2MJ3 A;  3ZKJ C;  2KOX A;  2J0J A;  3DBH B;  2JYE A;  1R4N B;  3W1Y A;  1H4R A;  1WSP A;  3WAN A;  3GZN B;  1ZXH A;  2KZR A;  2CHX A;  1WXV A;  2SAK A;  2ASQ A;  2L8J A;  2VZK D;  2ON8 A;  2N9X A;  2PTL A;  5G55 A;  1KRH A;  1OTR B;  3NVI A;  4NJ7 A;  2CKX A;  3SR6 A;  4OVZ A;  2W55 A;  1WGY A;  1R7S A;  4BKG A;  2BVC A;  2BXG A;  4MEL A;  1ISN A;  4XX5 A;  4J2V A;  2KN5 A;  2QDF A;  4B0E A;  2IBI B;  1TXU A;  1FM0 D;  1QKZ A;  2V0G A;  1C4P A;  3NY5 A;  2BKF A;  2H89 B;  4TMA B;  3LU8 A;  1GOZ A;  5GXG B;  3WHS A;  3KUZ A;  2XK5 A;  1A5R A;  2C7M B;  2HJ1 A;  5IA7 A;  1P9D U;  3DVG Y;  4NZL B;  1Y8R C;  1WR6 E;  1GB1 A;  2XK5 B;  5E6O A;  2BPS A;  1J7B A;  3A75 A;  5IOI A;  1E7P B;  3ICX A;  1MJD A;  4A8X C;  1SB0 A;  2DZJ A;  3FIL B;  1J78 A;  1TT5 B;  1FNU A;  2ZW0 A;  4DK5 A;  1I7H A;  4MJS A;  2B3A A;  2DBY A;  1K50 A;  1P7F A;  3CST A;  4RFB A;  2Y5B B;  4GU2 A;  1WRI A;  3T3N A;  3AU5 A;  1MHX A;  4MJS B;  2MA9 B;  4US9 A;  2XW0 A;  1S1Q B;  2N9K A;  1WM3 A;  2JZP A;  1YN3 A;  3V6C B;  4ZHO A;  5HKH A;  1FCC C;  4OTT A;  4BY9 C;  1TIF A;  3EGR A;  3Q8F A;  1GNU A;  5AUI A;  1JRP A;  3GS2 A;  2WDV B;  4ZYN A;  2JVC A;  4I6N B;  2FCQ A;  3P42 A;  4AWJ A;  1CK1 A;  1Z5S B;  1WXS A;  1AW7 A;  1ZGU B;  4US8 A;  5KHQ A;  1WWT A;  2D2Q A;  2K5P A;  1BUI C;  4RGO S;  5IFO A;  4B95 A;  3ZRC A;  1FPY A;  2PKO A;  2G4S A;  1FNV A;  2DYO A;  2DBW A;  4AUQ C;  4GOC A;  2LZ6 A;  2KLC A;  3AUL A;  4K7W A;  5T8I A;  3P1M A;  1TYG B;  1E7V A;  3O13 A;  1GJZ A;  1ZUD 2;  1E8X A;  4ARI A;  2DYM A;  1EF1 A;  1QIL A;  2I1K A;  3AEC B;  3CIR B;  4KGS A;  3V61 A;  3BY4 B;  4EEW A;  2Z8L A;  4KKI A;  1V9J A;  4P16 A;  2B76 B;  3DBH I;  1R4N I;  1JRU A;  3GZN I;  1WMH A;  3HK0 A;  1MUH A;  3OJ4 B;  3K9P B;  1E7A A;  2QC8 A;  3R2T A;  1P3Q U;  2KQ7 A;  1QT9 A;  2KDE B;  5FR3 A;  2KQ4 X;  5E6J A;  1QOA A;  3HM3 A;  5G2N A;  4L23 A;  3P4P B;  3GE3 C;  4J6I A;  1SE4 A;  1I4X A;  3JQZ A;  5IJE A;  1BKE A;  2PPH A;  4DHZ B;  2V9H A;  3RYT A;  3AE7 B;  4KIK A;  4FK5 B;  5H8Y E;  3BVG A;  4K71 A;  1HA2 A;  1RM6 C;  4BBN C;  5EE0 A;  3ENE A;  4KIK B;  2ZNV B;  5BMH A;  3PPA A;  4UDU C;  1TS4 A;  3UIO B;  4M8M A;  1I4P A;  2K8B A;  2DWQ A;  4ZRI A;  4G03 A;  3ZNZ B;  1TJE A;  3G9K D;  2WU2 B;  3OG5 A;  2M0A A;  1NI3 A;  2DAJ A;  2W54 A;  4GG2 A;  2GOW A;  1GC7 A;  4EZK A;  2KDF B;  1SB3 C;  1OGW A;  1UGM A;  3ML9 A;  1QLB B;  3KIK A;  1HZ5 A;  1ZOY B;  1V97 A;  2KD0 A;  3A9J B;  2WHI A;  4WH4 A;  2MX2 A;  4GDK A;  4RCO A;  3RZW C;  2KAJ A;  5B5T A;  3FKY A;  1OFF A;  2KC2 A;  3M95 A;  2MH7 A;  1V86 A;  4MEM A;  4A9A A;  3UQA A;  3Q14 C;  3H7S A;  1VFI A;  3ZLZ A;  1AN8 A;  4PS7 A;  1TGZ B;  4MGK E;  1VZ7 A;  2LRU A;  3KVF B;  1YMH E;  3MJ5 A;  2OT3 A;  1VZ8 A;  2BS4 B;  3QHT A;  2KMC A;  3URY A;  5D7G A;  2OED A;  3IHP C;  2LUE A;  4KGT A;  1CMX B;  2WWZ A;  1WI0 A;  5HHD G;  4ZRK A;  5HI1 A;  3QK0 A;  3UI3 A;  2GBR A;  1HEZ E;  2L83 A;  1WXA A;  1YOV B;  3PZD A;  1IUE A;  2LFI A;  2XW1 A;  2VUF A;  4ACF A;  2KNB A;  1P7E A;  2MEK A;  1FRD A;  1FXT B;  1FMA D;  1ZPS A;  5BMI A;  2LRW A;  2KXJ A;  4II2 B;  2KX0 A;  3RCZ A;  2LGI A;  2WU5 B;  3W1S A;  4PO0 A;  2NPT A;  2JRH A;  1OQQ A;  1YJI A;  2KWF A;  3QJZ A;  4B9K A;  2Z8I A;  3M62 B;  2QMC A;  4M8N A;  4DHJ D;  1T5X D;  4LNF A;  3Q69 A;  4WAA A;  5E6P A;  3JSV A;  4ANV A;  2QIL A;  1QOF A;  3DPD A;  1MIW A;  2DAF A;  1V6E A;  5DPW A;  3JSV B;  1N6Z A;  2L00 B;  4AS1 A;  2RMM A;  3HRD D;  2BTE A;  2L3Z A;  4WIP A;  2MHJ A;  4LUF A;  1HK4 A;  2KAC A;  3B9M A;  3P2B A;  2FIF A;  2J7Q B;  3N1X C;  4HJK A;  3T8M A;  3KLS X;  4WJO A;  5CHW A;  1MG8 A;  3DDC B;  4N9F 4;  2JXT A;  1LO5 D;  2H88 B;  4G50 A;  4YSX B;  1DGJ A;  3UIN B;  1NVI D;  3MP9 A;  4IG7 B;  4WWM A;  2ZCC A;  1WX7 A;  1B9R A;  1GC6 A;  1LNS A;  4G3X B;  4LNI A;  5LXH A;  4ZC6 A;  2WXJ A;  3R66 C;  2CHW A;  4X57 B;  3B2F A;  1SXT A;  3VR8 B;  1H5W A;  3Q8B A;  4C31 B;  3APD A;  1FNW A;  2QHO A;  1J7E A;  1JWM D;  1YNT E;  3NZU A;  3W2D A;  4HPM B;  2JF5 A;  1FEH A;  5EE1 A;  1J7A A;  3NVW A;  2VH1 A;  5BMG A;  3QAR A;  3KYD D;  1Q0W B;  4C4V B;  1VR9 A;  2ICI A;  2I38 A;  3TMP B;  2PE9 A;  1HXY D;  2XEW A;  5GIO A;  2D07 B;  1IPG A;  2BB6 A;  3AH7 A;  4AOF A;  2IGG A;  2EMS A;  5EDS A;  4ANX A;  3U30 A;  1OEY A;  2WXF A;  5GHK A;  2LXC A;  2GUT A;  1XCQ L;  2LHD A;  1HE8 A;  3AN1 A;  3MFG A;  3DQV A;  2PVO D;  1ZP0 B;  2XMO A;  1KW2 A;  1GNI A;  1UNS A;  1VLB A;  1WX8 A;  2KDM A;  3SD5 A;  2PW9 A;  2IJ0 A;  2JQR B;  2INP E;  1M94 A;  2BWE S;  2R2O A;  2BXA A;  3TBL D;  4LTU A;  4WJQ A;  1V1O A;  3M63 B;  4TUU A;  2Z0E B;  3H9D A;  3LB8 C;  3VVW B;  4A6Q A;  1TKG A;  2E0X A;  1QOG A;  1TKY A;  2K22 A;  4YL8 A;  4HKZ E;  1ZKH A;  2AYO B;  4DXA B;  2C7H A;  5FUO A;  3QCA A;  3T9L A;  4HCP B;  4C7Y A;  4Z69 A;  2RR9 A;  3L17 A;  3KJL A;  4GB9 A;  1ET9 A;  2XVQ A;  2PIA A;  2Y5C A;  5AEK B;  3HIZ A;  2YDF A;  2QCZ A;  2REX A;  3TEX A;  1MVK A;  1E7G A;  4G01 A;  1BML C;  1Q10 A;  2Z59 B;  5DPS A;  4RGM A;  3FWB C;  2MBO A;  2ZW1 A;  1GUA B;  3AE3 B;  1F0Z A;  1I4G A;  1OEY J;  3RN9 C;  2DEN B;  1WIA A;  4KVG B;  2KDI A;  3PHW B;  2LXA A;  3GP7 A;  4KV2 A;  2RD0 A;  4GGQ A;  3VUY A;  3I63 C;  1MPE A;  4BAX A;  3ZVV A;  2CR5 A;  1E6E B;  4JX1 C;  2KBZ A;  1EU4 A;  3M3J A;  2GRI A;  3KUD B;  1YQ3 B;  3TCA A;  4M0W B;  5IKC M;  2QMT A;  2WS3 B;  4F1S A;  2MBH A;  1KXP D;  4ZCG A;  1GNJ A;  2MP2 A;  4ZRP A;  5GIP A;  2NVU I;  3I9V 1;  1JAL A;  3L54 A;  4OHJ A;  3RNG C;  2KWD A;  2MBE A;  1F2R C;  4L2Y A;  4W9F A;  4OR0 A;  1HZ6 A;  2MP2 B;  4N0U D;  1E9M A;  3H7P A;  1MM8 A;  3L08 A;  1JQ4 A;  2E6X A;  3BYY B;  3IT6 B;  5DPR A;  4MSQ B;  2V3S A;  4LK0 M;  2NR2 A;  2LGD A;  3MTN B;  1KF6 B;  4MGY E;  1WF9 A;  5J18 A;  4TV3 A;  2HJ8 A;  5FR6 A;  4IWO A;  3QX1 A;  2KJH B;  1D5M C;  3BIN A;  3KH0 A;  1L0V B;  4GDX A;  2RSU A;  4WAF A;  2K6D B;  2IDY A;  2WX1 A;  2A5U A;  4HRS A;  4GDL B;  2C9W B;  3CF6 E;  1SSN A;  4M00 A;  2EFH A;  1L4D B;  2BKR B;  2JYT A;  3QQ8 B;  1JRO A;  5JXV A;  2PE6 B;  4DHX B;  3ZXR A;  1ZW7 A;  2QIE B;  2XVW A;  2JZ3 B;  4MH8 A;  1V80 A;  1UD7 A;  2KAN A;  5D3D A;  2BGF A;  3Q3N C;  3KUC B;  4LDT D;  4NPN A;  1TY2 A;  2MRP A;  4LNN A;  3UF8 A;  1K52 A;  3N1Z C;  1UH6 A;  1VZ6 A;  4L8U A;  3DVN V;  1C77 A;  2DBX A;  4A55 A;  3L16 A;  1ZE3 D;  4S17 A;  4EZJ A;  1U4A A;  4HGK A;  1K51 A;  2JWU A;  4YTP B;  1K8R B;  2GBM A;  3EFC A;  1YJJ A;  1N60 A;  5D94 A;  1H8C A;  3TJP A;  4XE0 A;  4MAC A;  2PJH A;  5GMV A;  3WAO A;  1I4H A;  4YWG G;  2CHZ A;  1R4M B;  2V3N A;  3BWU D;  2WXH A;  1EWC A;  2WXG A;  4ANW A;  4Z9O A;  1STE A;  3FIL A;  2D3C A;  4A3P A;  3A4S C;  1F1H A;  2FAZ A;  4BFR A;  2VUE A;  2DLB A;  1C9F A;  4G11 A;  5LXI B;  3AMZ A;  2KFJ A;  2KJ6 A;  2W3S A;  3Q8A A;  1TS3 A;  4PT5 A;  4FHJ A;  3PZ8 A;  4JLC A;  4K1R B;  2JSV X;  2M56 B;  3ZJT A;  4DWF A;  1E10 A;  3CWI A;  1MA9 A;  5DQF A;  4IW0 A;  3AE1 B;  4JWS C;  2UU7 A;  4N0F D;  1PGB A;  3AM9 A;  2MQJ A;  3QIJ A;  3FWC C;  3EC8 A;  4ANU A;  3A4R A;  2INC C;  3AE6 B;  3VAW A;  2EKI A;  3FAH A;  1LXD A;  2D3G A;  4LB9 A;  2M17 A;  3RNF C;  4LDT B;  3PSE B;  4KDL B;  1IJG A;  2BBC A;  4LB2 A;  4NAM A;  3V3X A;  3V08 A;  2E3T A;  3W9C B;  3NHE B;  1WJ4 A;  4RF0 A;  3NVV A;  3SIV B;  4IUM B;  5IJ5 A;  3AEG B;  3AEB B;  1YX5 B;  2I1J A;  4F5U A;  1E7I A;  3O65 B;  3PRM B;  1PYW D;  1WZ0 A;  3NVK A;  3BPJ A;  2N7J A;  4IDI A;  3VR9 B;  2FNJ B;  3B2G A;  1GB4 A;  1CQV A;  2KO3 A;  4AJW A;  4YSY B;  5CHV C;  1ET6 A;  3S2A A;  3VH3 B;  1TKE A;  4TSS A;  3VHT C;  3VFK A;  2V4L A;  4ZOH C;  2ONQ A;  4PYZ A;  2LGX A;  4AJY B;  2IO3 B;  3A33 B;  1YX6 B;  3TEZ A;  3APC A;  3P63 A;  3H3A A;  5L95 C;  2BXQ A;  1RWS A;  1P98 A;  2N4F A;  1TTN A;  4MM3 A;  2I2Y A;  2BXH A;  3LU7 A;  2FCS A;  4C56 C;  4JWU C;  1UF0 A;  4MM3 B;  3WAP A;  3T3O A;  3R2I A;  3RNC C;  2KQS A;  2WXM A;  1SIJ A;  2AL3 A;  5JHB A;  1R4M I;  3C8Y A;  1WGK A;  5TSS A;  1SIF A;  3P4Q B;  1BJ5 A;  1UWM A;  4HWI B;  1WRD B;  1T6B X;  3TUO A;  4C00 A;  2AEH A;  2KC1 A;  3PZ7 A;  2Y3A A;  3QC8 B;  1OQR A;  1JW9 D;  5C1Z A;  4KSK C;  2NS5 A;  3SIU B;  2BQQ A;  2K6Q A;  4L1B A;  3PV1 A;  1SGH A;  2N9P C;  3JVZ X;  2LQI A;  1CJE A;  2KDB A;  3TSS A;  1EF5 A;  2WYQ A;  2AGH B;  3C0R B;  2ZPN A;  1HQR D;  4IWP A;  4RGN A;  2LGS A;  4LLG M;  4FIP B;  1WX9 A;  1L0Y B;  3IG3 A;  1L6U A;  1C78 A;  1L0X B;  2JXX A;  2KK8 A;  4DQO C;  1C76 A;  3WHQ A;  1K53 A;  1J0G A;  3PLA A;  1Q5W B;  4EOY A;  2KMM A;  2WLB A;  2LOQ A;  2DG5 A;  1WH3 A;  3ZJU A;  2K25 A;  3BK1 A;  1I35 A;  1WFY A;  3A9J A;  2LAS A;  4FJC B;  5AZH A;  4N58 A;  2BXI A;  1C4A A;  2GBJ A;  3N32 A;  3N20 C;  3U4E G;  3PT2 B;  2ZEQ A;  2G45 B;  3A73 A;  1VZS A;  3UQB A;  1JWS D;  3HUI A;  4XZ4 A;  4KZ0 A;  5IN7 A;  1T0Y A;  5DBY A;  2SEB D;  3RNB C;  1H9Z A;  2JT4 B;  1FXI A;  3IAS 1;  1AYF A;  2DZM A;  2VH2 A;  4K3B A;  3AV8 A;  4II3 B;  1L7Y A;  2KJR A;  2I30 A;  4W4U B;  4G04 A;  3GA9 L;  3I57 A;  5IAA C;  3WAM A;  2FUH B;  2BF8 B;  3H37 A;  3LDZ E;  2MBB B;  2AQ2 B;  3P4R B;  4F7Z A;  2YLM A;  2I2Z A;  3PRZ A;  1SE2 A;  3JYU A;  5TR5 A;  4JQW C;  1ACC A;  4GLS C;  3WA0 A;  4DXF A;  4JE3 B;  3WAL A;  1J8C A;  4NQK E;  2N7E A;  4DDG D;  3J9C A;  5BYR A;  1D6E C;  4OZB A;  1LQB A;  2LQH A;  3AEA B;  1E8Y A;  4OZC A;  4YXD B;  2M8S A;  2KWC A;  5D2M B;  4FN2 A;  1V1P B;  2L32 A;  2ZVN A;  4ZBR A;  2NTS A;  4NJ6 A;  4RF1 A;  4DXG A;  1UWX A;  2IGD A;  3OJ3 A;  2DBU A;  4E74 A;  4RH6 A;  2K8C A;  4ITK A;  3PS6 A;  2K8H A;  2LJI A;  4GSW A;  2L1A A;  3DBL B;  1NBF C;  2NMQ A;  1WGD A;  4KKJ A;  3ZXV A;  1UGJ A;  4RM8 A;  1NT2 B;  1SBB B;  3NG0 A;  1FFU A;  2OZB B;  2OJW A;  3ZJV A;  2LI5 A;  3RMK C;  1E90 A;  1XLN A;  5AZF A;  2WQY B;  5C23 A;  2KMA A;  5G5G A;  4F5T A;  2D5G A;  4K3C A;  4RMA A;  4Q2J A;  2O2V B;  1F9J A;  2CU1 A;  4AQ7 A;  1EWY C;  3VH4 B;  3SEB A;  4FHK A;  1GG3 A;  2KVR A;  2LVQ A;  2RDG A;  4OVU A;  2YEP B;  4A90 A;  4USA A;  2C60 A;  3ZNG C;  4AP4 C;  1UEL A;  3HVZ A;  4WQO B;  2JU6 X;  2YEP F;  3PGE A;  2CU3 A;  1TS5 A;  3ETR A;  2L7R A;  3B0A A;  4P7I A;  1FO4 A;  4A3O A;  4NJC A;  2K0P A;  1N62 A;  1V2Y A;  2BS2 B;  2KFK B;  3Q8C A;  3HVD A; 
#chains in the Genus database with same CATH homology
 3B1L X;  3CMM B;  1XLP A;  4YT0 B;  4GMV A;  4DDI D;  2QJL A;  3H8H A;  3NRZ A;  4I6P A;  1KLG D;  2HD5 B;  2M0X A;  4O1N A;  4NAW B;  1V5T A;  4ZBQ A;  4FUL A;  3Q8E A;  4IM0 A;  4BBN F;  3ABV B;  1LFD A;  2WNM A;  1FFV A;  2M19 A;  2ZVO A;  4FJZ A;  4W9H A;  2FE8 A;  5GIN A;  1RRB A;  2GB1 A;  3APF A;  1V49 A;  2LWP A;  4HKQ A;  1AAR A;  4EKU A;  4F5V A;  4NNJ B;  2OHF A;  3KW5 B;  2BXC A;  1SE9 A;  1N63 A;  5BPK A;  1WGG A;  3DBS A;  2UYZ B;  3MHZ A;  4H2A A;  2IYD B;  4ZUX V;  2AX5 A;  2AL6 A;  4WUR A;  1XQQ A;  2DX5 B;  3NZS A;  2GI9 A;  1YD8 U;  4FBJ B;  1Q1O A;  1JML A;  1E7H A;  5L83 A;  2WXQ A;  1SJH D;  3EA6 A;  2JX5 A;  1EM7 A;  3R7Q A;  1V8C A;  1N5U A;  4B0M A;  4RM9 A;  3NS8 A;  1J7C A;  1UUP A;  1ZDX A;  2PEA A;  4OTU A;  1D3Z A;  2TSS A;  2IY0 B;  3N9Y C;  1E0Z A;  2FUG 1;  5E6N A;  1WE6 A;  3UIP B;  1TZO A;  2GBN A;  1YN5 A;  2RPQ A;  2PVG C;  3DBL I;  4HLE A;  3ZTC A;  3AE8 B;  2DZK A;  3ALB A;  4GXB A;  5JHA A;  5G5H A;  3OLM D;  3V6E B;  1KFY B;  5HOZ A;  5HG2 A;  1E7C A;  2JUO A;  1WGH A;  1TF0 A;  3ZTD A;  1KOT A;  1P0R A;  4LJP B;  5IJF A;  2JZZ A;  3V09 A;  4HXD A;  2WXK A;  3AB5 A;  3RUI B;  1NDD A;  3ZDT A;  4I6L B;  4W9I A;  4EZL A;  1RYJ A;  2VDB A;  3PLV A;  1Z2M A;  2RPV A;  2G9H D;  2QHB A;  1KJT A;  2AJE A;  5FKA C;  1WZ3 A;  3P4S B;  4M0W A;  4E71 A;  2ACZ B;  3ZDM C;  1YIW A;  2BW2 A;  4BOZ B;  4P6V F;  4HJG E;  4ICU A;  3R8B A;  2BXE A;  1YQB A;  1XLQ A;  2EMT A;  5CX3 A;  4BKS D;  3AE5 B;  4BOS C;  4MGZ E;  4MGI E;  4EFO A;  3U7Z A;  4DBG A;  3RD2 A;  3KWL A;  1JWB D;  1HK3 A;  3LU6 A;  3U8Z A;  5HFY A;  3IBE A;  3MHH B;  2A4Z A;  1IGC A;  3B9J A;  1TZ1 A;  3VTV A;  4B6W A;  2WXP A;  1XD3 B;  3SFE B;  2BYV E;  4A20 A;  1A70 A;  1WY8 A;  1D5X C;  2O6V B;  4N6E B;  2JRI B;  4XC2 A;  1IBX A;  4WWO A;  4ZHP A;  3X0W A;  5ID9 A;  4K7S A;  3QWZ B;  2DHZ A;  1JWA D;  4GDL A;  4KDI C;  2FCM A;  4IW1 A;  1IBX B;  4REZ A;  3NS1 A;  4XDC A;  4J3O D;  4ZYS A;  1E7E A;  4YTM B;  3RUL A;  3V62 A;  1UZX B;  1L4Z B;  1KH0 A;  5IIU A;  4W9E A;  2ZNV C;  5JH5 C;  1SE3 A;  1TY0 A;  2IY1 B;  3B9L A;  1RFK A;  2KKC A;  2KWU B;  3I3T B;  4E99 A;  1UBQ A;  1XEE A;  5BYS A;  1BM0 A;  3IVF A;  1YJ1 A;  3BII D;  2J53 A;  4IW2 A;  2HTH A;  2LUM A;  1BXT A;  1EUV B;  3SFD B;  3NUH B;  3MJW A;  4S1Y A;  3NOB A;  4BKS A;  1FIQ A;  2L76 A;  3B08 A;  4W9C A;  1YN4 A;  4C7Z A;  3AE9 B;  1RAX A;  4M70 B;  1KLV A;  1MI0 A;  1KM7 A;  2K1F A;  2L52 A;  2RGF A;  2XSI A;  1FOU A;  2ROH A;  3GOE A;  2M1M A;  1XXG A;  1E78 A;  2DYB A;  3Q3J A;  2KLG A;  2BXM A;  3ML8 A;  1LOT A;  2GMI C;  2NCN A;  4HEA 1;  1PFD A;  1HK5 A;  2LGY A;  3AE2 B;  2BXB A;  4IC7 B;  3VRA B;  4MSM B;  2NNW A;  3V60 A;  3IAM 1;  4FA6 A;  1B1Z A;  1ENF A;  3W5V B;  2LVO A;  4MDK E;  5J2R A;  3PLU A;  4F8C B;  2LJ5 A;  2L0T A;  4EE2 A;  2M4N A;  1WYW B;  2WXL A;  1HA5 A;  4CYE A;  4WJN A;  2G4D B;  2BXL A;  1C1Y B;  4C80 A;  1VCB A;  3FNM A;  3NMU A;  3H6N A;  4XWT A;  2LHE A;  1D5Z C;  2N9E B;  2MCN B;  3MHS B;  1WGR A;  1I4R A;  1E8W A;  1NEK B;  4JL9 A;  3TEW A;  2L05 A;  2XVU A;  5ID7 A;  3OWE B;  3E56 A;  4FLH A;  1BT0 A;  2Z8K A;  3EFU A;  3WHR A;  1X1M A;  2BYF A;  4YTN B;  3DOW A;  2XN9 C;  2Y5P A;  2D10 A;  5CTR C;  3WIM A;  3LXF A;  1NYR A;  2N9L A;  2QSD A;  3PVL A;  2DZI A;  4OT2 A;  4R3D A;  4HRO A;  1N5X A;  4EMX A;  2VZK B;  2HE7 A;  5C2T B;  2LVP A;  3W1S C;  3RZF A;  4W9K A;  5J17 A;  2BB5 A;  3WCQ A;  3AI5 A;  2K9X A;  3BZD B;  3VDZ A;  3LJ3 A;  4LA0 A;  2IGH A;  1KLU D;  2CS4 A;  4LCD E;  2V1Y A;  2BYT A;  1GPX A;  1IYF A;  2BXK A;  1IGD A;  2MSE D;  1GAQ B;  5FK9 C;  3K9O B;  2N1V A;  2IPK D;  2KN4 A;  3A9K A;  3TIX A;  1PQS A;  2MJD A;  4K7U A;  4BVU C;  4G0N B;  3V05 A;  3AEF B;  3GB1 A;  4HGM B;  3R3M A;  2X38 A;  3A9K B;  2EFE A;  1WJN A;  2N0S B;  3GQU A;  1PGA A;  1MHH E;  3E9S A;  1QQR A;  1CZP A;  2IO2 B;  2NBU A;  2WXR A;  1EU3 A;  1HK2 A;  3RPF C;  2W9N A;  1G6J A;  1L6V A;  1WMH B;  3U52 E;  3TDL A;  3IT4 B;  4W9L A;  3RFZ B;  3D32 A;  2JWZ A;  3NVZ A;  1WJ6 A;  4ZBK A;  1NI2 A;  5LLI A;  3VUX A;  2KTR A;  2BX8 A;  3MC0 B;  2CJO A;  1MIV A;  4BKE A;  1LM8 B;  1WXQ A;  3DCG A;  1XT9 B;  3N30 A;  2C7N B;  2KTR B;  4K2C A;  3OAW A;  5EE3 A;  2FCN A;  3ZGZ A;  3AED B;  4XWW A;  2FBW B;  2UWQ A;  3ZNI D;  3U7D A;  4N59 A;  5EE9 A;  4HCN B;  1JNB A;  1PDX A;  3DVG X;  3IFW B;  3EHV A;  1C79 A;  1L5P A;  2BXO A;  2C5L C;  2CKH B;  1UBI A;  2KX3 A;  1FD6 A;  3ONS A;  2ZPY A;  3DWM A;  2YVC A;  1J19 A;  2NTT A;  3JRY A;  4XDD A;  3KWV A;  2MLB A;  3KYC D;  1ZDV A;  2MBQ A;  4RGT A;  4JIO U;  4CQN A;  5D6J B;  3ECI A;  4ARC A;  2QM6 A;  3NVM A;  4ZRQ A;  3UIV A;  1XO3 A;  1IP9 A;  2D11 A;  3M99 C;  4GDK B;  4BKT A;  3A1Q A;  5DPT A;  3TEY A;  2J0K A;  1E7B A;  4TKN A;  1WJU A;  1P1A A;  2K3U A;  4WA6 B;  2OJR A;  3A1Q B;  1ROE A;  1V1P A;  3NZ3 A;  4MT5 A;  3UGB B;  3L10 B;  1AWD A;  1T3Q A;  4L9K A;  2CJN A;  3EEC A;  3HHM A;  3ZQ4 A;  3L0W B;  1E7F A;  1XF5 L;  3VXW A;  1DYQ A;  3IXS A;  2V36 A;  4LUH A;  2E0Y A;  2J0M A;  3AE4 B;  5H92 C;  1F2R I;  3V03 A;  3VRB B;  3EUB 2;  2XVV A;  2V3P A;  4MBE C;  2PLP A;  4FAD A;  1PGX A;  4FXC A;  1ESF A;  2J52 A;  2XNA C;  4L9Q A;  2KHW B;  4RNA A;  4KX6 B;  3PRE A;  2N7D A;  3AEE B;  2JUH A;  5IIH A;  1RFA A;  2O2V A;  2BS3 B;  4TQ0 A;  1QZE A;  3JW0 X;  4IWQ A;  2NPT B;  1E5W A;  5D3I B;  2NBV B;  4KSL C;  3TL5 A;  1WE7 A;  5C3J B;  2NBW B;  4W9J A;  4JPS A;  2KWV B;  4W9D A;  1XLO A;  2NQO A;  3N3K B;  1V81 A;  3BYT B;  2KTF A;  2WXN A;  1FXA A;  3L4P A;  2VRR B;  2FID A;  2EFD A;  2HDE A;  3ZO5 B;  2N1W A;  2WXI A;  3AXC A;  3QAQ A;  1DOX A;  2KFK A;  1VD2 A;  2LMC A;  4FJV B;  4PS3 A;  5BYQ A;  1UOR A;  5KHO A;  1I42 A;  2R61 A;  2V4I B;  2IZV B;  3RT3 B;  1WXM A;  4TQ1 A;  4WQM A;  1N61 A;  2BWF A;  3SDL C;  3HM6 X;  5IIX A;  4JGH B;  1TBE A;  3X23 A;  3QA8 A;  3SU8 X;  3R7R A;  1ZXI A;  3L13 A;  2WP9 B;  4IM2 A;  4NAW A;  2K39 A;  5I4D A;  2ZZP B;  1HK1 A;  4CO7 A;  2WDR B;  5BO4 B;  2MW5 A;  1V5O A;  2EKE C;  1C3T A;  2BYE A;  1Y56 A;  3VQI A;  3DVN U;  2JPH A;  1TS2 A;  4ZRJ A;  1AO6 A;  5LNK 1;  3NVY A;  2JY6 A;  3ZRF A;  4IM3 A;  3CSF A;  1WM2 A;  4KZC A;  1C4C A;  3PRP B;  2BXP A;  2MJE A;  1YQ4 B;  2HTM E;  5AUK A;  5MPO A;  2OOB B;  2Z8J A;  3SHQ A;  4FJY A;  1JWU D;  2BT6 A;  4HPL B;  2XBB C;  3ZNH B;  1D4B A;  3BVM A;  2ZCB A;  4DHJ B;  2Z0D B;  2ZJD A;  2EFC A;  1FRR A;  4YSZ B;  4URK A;  4OVV A;  1S3S G;  3ZYY X;  1NYQ A;  4NY0 A;  2O6V D;  1FCL A;  4OZA A;  3PHX B;  1E7U A;  4ZDV A;  2PMV A;  1QF6 A;  1JCK B;  4F5S A;  4CHK A;  1SF0 A;  2W3R A;  1WR1 A;  3VTU A;  4PS8 A;  2LD9 A;  4GN1 A;  4HVB A;  2IO0 B;  4GIV A;  1E8Z A;  1QOB A;  2Q5W D;  3W5U B;  4N3Z A;  4PYU A;  1DOI A;  5JZE B;  2L0F A;  4W9G A;  3LYY A;  3Q3F A;  4K81 A;  2G1E A;  3FC4 A;  3AU4 A;  1NEN B;  2WXO A;  4HDO A;  2WDT B;  3CX9 A;  1VJK A;  1MIY A;  1O9X A;  2BXF A;  1XCT L;  4WJP A;  4MH0 E;  4ASW C;  1N5W A;  2BXD A;  5CHF A;  1SJE D;  3DBR I;  1VRA B;  4DHZ E;  4IKG A;  1WYG A;  2BXN A;  2RDH A;  1PUT A;  4HK2 A;  3BK2 A;  4JK4 A;  4IOI E;  2J42 A;  3ZIM A;  3DWG C;  4WWN A;  2O6V A;  4ICV A;  4EUT A;  1KTK A;  1F77 A;  1L2N A;  1I4Q A;  2G3Q B;  2R2Q A;  2QEJ C;  5DCN A;  1DOY A;  2WX0 A;  3ZUN A;  2WDQ B;  1SEB D;  3U2S C;  4D2K A;  2EEL A;  2W82 A;  4WWP A;  3PO0 A;  4OW0 A;  4NQL B;  2LEK A;  4KGR A;  1OQY A;  2GBK A;  2AQ1 B;  1VDV A;  3H7P B;  3BVZ A;  1RLF A;  5AZG A;  2MWS B;  3KQ4 A;  3VUW A;  4LJO B;  2INN E;  2AWT A;  3PTF C;  1EO6 A;  3H1U A;  4E3C A;  3GQX A;  3MHS D;  2J4X A;  4HDQ A;  3VTW A;  2AQ3 B;  2IO1 B;  1M4V A;  3SQJ A;  3ZW3 A;  2MJ3 A;  3ZKJ C;  2KOX A;  2J0J A;  2JYE A;  3W1Y A;  1H4R A;  1WSP A;  3WAN A;  1ZXH A;  2KZR A;  2CHX A;  1WXV A;  2SAK A;  2ASQ A;  2L8J A;  2VZK D;  2ON8 A;  2N9X A;  2PTL A;  5G55 A;  1KRH A;  1OTR B;  3NVI A;  4NJ7 A;  2CKX A;  3SR6 A;  4OVZ A;  2W55 A;  1WGY A;  1R7S A;  4BKG A;  2BXG A;  4MEL A;  1ISN A;  4XX5 A;  4J2V A;  2KN5 A;  4B0E A;  2IBI B;  1TXU A;  1FM0 D;  1QKZ A;  2V0G A;  3NY5 A;  1C4P A;  2BKF A;  2H89 B;  4TMA B;  3LU8 A;  1GOZ A;  5GXG B;  3WHS A;  3KUZ A;  2XK5 A;  1A5R A;  2C7M B;  5IA7 A;  1P9D U;  3DVG Y;  4NZL B;  1Y8R C;  1WR6 E;  1GB1 A;  2XK5 B;  5E6O A;  2BPS A;  1J7B A;  3A75 A;  1E7P B;  3ICX A;  4A8X C;  2DZJ A;  3FIL B;  1J78 A;  1FNU A;  2ZW0 A;  4DK5 A;  1I7H A;  4MJS A;  2B3A A;  2DBY A;  3CST A;  1K50 A;  1P7F A;  4RFB A;  2Y5B B;  4GU2 A;  1WRI A;  3T3N A;  3AU5 A;  4MJS B;  1MHX A;  2MA9 B;  4US9 A;  1S1Q B;  2XW0 A;  2N9K A;  1WM3 A;  2JZP A;  1YN3 A;  3V6C B;  4ZHO A;  5HKH A;  1FCC C;  4OTT A;  4BY9 C;  3EGR A;  3Q8F A;  1GNU A;  5AUI A;  1JRP A;  3GS2 A;  2WDV B;  4ZYN A;  2JVC A;  4I6N B;  2FCQ A;  3P42 A;  4AWJ A;  1Z5S B;  1CK1 A;  1WXS A;  1AW7 A;  1ZGU B;  4US8 A;  5KHQ A;  1WWT A;  2D2Q A;  2K5P A;  1BUI C;  4RGO S;  5IFO A;  4B95 A;  3ZRC A;  2PKO A;  2G4S A;  1FNV A;  2DYO A;  2DBW A;  4AUQ C;  4GOC A;  2LZ6 A;  2KLC A;  3AUL A;  4K7W A;  5T8I A;  3P1M A;  1TYG B;  1E7V A;  3O13 A;  1GJZ A;  1ZUD 2;  1E8X A;  4ARI A;  2DYM A;  1EF1 A;  1QIL A;  2I1K A;  3AEC B;  3CIR B;  4KGS A;  3V61 A;  3BY4 B;  4EEW A;  2Z8L A;  4KKI A;  1V9J A;  4P16 A;  2B76 B;  3DBH I;  1R4N I;  1JRU A;  3GZN I;  1WMH A;  3HK0 A;  3OJ4 B;  3K9P B;  1E7A A;  3R2T A;  1P3Q U;  2KQ7 A;  1QT9 A;  2KDE B;  5FR3 A;  2KQ4 X;  5E6J A;  5G2N A;  3HM3 A;  1QOA A;  4L23 A;  3P4P B;  4J6I A;  1SE4 A;  1I4X A;  3JQZ A;  5IJE A;  1BKE A;  2PPH A;  4DHZ B;  3RYT A;  3AE7 B;  4KIK A;  4FK5 B;  5H8Y E;  3BVG A;  4K71 A;  1HA2 A;  1RM6 C;  4BBN C;  5EE0 A;  3ENE A;  4KIK B;  2ZNV B;  5BMH A;  3PPA A;  4UDU C;  1TS4 A;  3UIO B;  4M8M A;  1I4P A;  2K8B A;  2DWQ A;  4ZRI A;  4G03 A;  3ZNZ B;  1TJE A;  3G9K D;  2WU2 B;  2M0A A;  1NI3 A;  2DAJ A;  2W54 A;  4GG2 A;  2GOW A;  1GC7 A;  4EZK A;  2KDF B;  1SB3 C;  1OGW A;  1UGM A;  3ML9 A;  1QLB B;  3KIK A;  1HZ5 A;  1ZOY B;  1V97 A;  2KD0 A;  3A9J B;  4WH4 A;  2MX2 A;  4GDK A;  4RCO A;  3RZW C;  2KAJ A;  5B5T A;  1OFF A;  2KC2 A;  3M95 A;  2MH7 A;  1V86 A;  4MEM A;  4A9A A;  3UQA A;  3H7S A;  1VFI A;  3ZLZ A;  1AN8 A;  4PS7 A;  1TGZ B;  4MGK E;  1VZ7 A;  2LRU A;  3KVF B;  1YMH E;  3MJ5 A;  2OT3 A;  1VZ8 A;  2BS4 B;  3QHT A;  2KMC A;  3URY A;  5D7G A;  2OED A;  3IHP C;  2LUE A;  4KGT A;  1CMX B;  2WWZ A;  1WI0 A;  5HHD G;  4ZRK A;  5HI1 A;  3QK0 A;  3UI3 A;  2GBR A;  1HEZ E;  2L83 A;  1WXA A;  3PZD A;  1IUE A;  2LFI A;  2XW1 A;  2VUF A;  2KNB A;  1P7E A;  2MEK A;  1FRD A;  1FXT B;  1FMA D;  1ZPS A;  5BMI A;  2LRW A;  2KXJ A;  4II2 B;  2KX0 A;  3RCZ A;  2LGI A;  2WU5 B;  3W1S A;  4PO0 A;  2NPT A;  2JRH A;  1OQQ A;  1YJI A;  3QJZ A;  4B9K A;  2Z8I A;  3M62 B;  2QMC A;  4M8N A;  4DHJ D;  1T5X D;  5E6P A;  4WAA A;  3Q69 A;  3JSV A;  4ANV A;  2QIL A;  1QOF A;  3DPD A;  1MIW A;  2DAF A;  1V6E A;  5DPW A;  3JSV B;  2L00 B;  4AS1 A;  2RMM A;  3HRD D;  2BTE A;  2L3Z A;  4WIP A;  4LUF A;  1HK4 A;  2KAC A;  3B9M A;  3P2B A;  2FIF A;  2J7Q B;  4HJK A;  3T8M A;  4WJO A;  5CHW A;  3KLS X;  1MG8 A;  3DDC B;  4N9F 4;  2JXT A;  1LO5 D;  2H88 B;  4G50 A;  4YSX B;  1DGJ A;  3UIN B;  1NVI D;  3MP9 A;  4IG7 B;  4WWM A;  2ZCC A;  1WX7 A;  1B9R A;  1GC6 A;  1LNS A;  4G3X B;  5LXH A;  4ZC6 A;  2WXJ A;  3R66 C;  2CHW A;  4X57 B;  3B2F A;  1SXT A;  3VR8 B;  1H5W A;  3Q8B A;  4C31 B;  3APD A;  1FNW A;  2QHO A;  1J7E A;  1JWM D;  1YNT E;  3NZU A;  3W2D A;  4HPM B;  2JF5 A;  1FEH A;  5EE1 A;  1J7A A;  3NVW A;  5BMG A;  3QAR A;  3KYD D;  1Q0W B;  1VR9 A;  2ICI A;  2I38 A;  3TMP B;  2PE9 A;  2XEW A;  1HXY D;  5GIO A;  2D07 B;  1IPG A;  2BB6 A;  3AH7 A;  4AOF A;  2IGG A;  2EMS A;  5EDS A;  4ANX A;  3U30 A;  1OEY A;  2WXF A;  5GHK A;  2LXC A;  1XCQ L;  2LHD A;  1HE8 A;  3AN1 A;  3MFG A;  3DQV A;  2PVO D;  1ZP0 B;  2XMO A;  1KW2 A;  1GNI A;  1UNS A;  1VLB A;  1WX8 A;  2KDM A;  3SD5 A;  2PW9 A;  2IJ0 A;  2JQR B;  2INP E;  1M94 A;  2BWE S;  2R2O A;  2BXA A;  3TBL D;  4LTU A;  4WJQ A;  4TUU A;  3M63 B;  1V1O A;  2Z0E B;  3H9D A;  3LB8 C;  3VVW B;  4A6Q A;  1TKG A;  2E0X A;  1QOG A;  1TKY A;  2K22 A;  4YL8 A;  4HKZ E;  1ZKH A;  2AYO B;  4DXA B;  2C7H A;  5FUO A;  3QCA A;  3T9L A;  4HCP B;  4C7Y A;  4Z69 A;  2RR9 A;  3L17 A;  3KJL A;  4GB9 A;  1ET9 A;  2XVQ A;  2PIA A;  5AEK B;  2Y5C A;  3HIZ A;  2YDF A;  2REX A;  3TEX A;  1MVK A;  1E7G A;  4G01 A;  1BML C;  2Z59 B;  1Q10 A;  5DPS A;  4RGM A;  3FWB C;  2MBO A;  2ZW1 A;  1GUA B;  3AE3 B;  1F0Z A;  1I4G A;  1OEY J;  2DEN B;  1WIA A;  4KVG B;  2KDI A;  3PHW B;  2LXA A;  3GP7 A;  4KV2 A;  2RD0 A;  4GGQ A;  3VUY A;  1MPE A;  3ZVV A;  2CR5 A;  1E6E B;  4JX1 C;  2KBZ A;  3M3J A;  1EU4 A;  2GRI A;  3KUD B;  3TCA A;  1YQ3 B;  4M0W B;  2QMT A;  2WS3 B;  4F1S A;  2MBH A;  1KXP D;  4ZCG A;  1GNJ A;  2MP2 A;  4ZRP A;  5GIP A;  2NVU I;  3L54 A;  1JAL A;  3I9V 1;  4OHJ A;  2MBE A;  2KWD A;  1F2R C;  4L2Y A;  4W9F A;  4OR0 A;  1HZ6 A;  2MP2 B;  4N0U D;  1E9M A;  3H7P A;  3L08 A;  1JQ4 A;  2E6X A;  3BYY B;  5DPR A;  3IT6 B;  4MSQ B;  2V3S A;  4LK0 M;  2NR2 A;  2LGD A;  3MTN B;  1KF6 B;  4MGY E;  1WF9 A;  5J18 A;  4TV3 A;  2HJ8 A;  5FR6 A;  4IWO A;  3QX1 A;  2KJH B;  1D5M C;  3BIN A;  3KH0 A;  1L0V B;  4GDX A;  2RSU A;  4WAF A;  2K6D B;  2WX1 A;  2IDY A;  2A5U A;  4HRS A;  4GDL B;  2C9W B;  3CF6 E;  1SSN A;  2EFH A;  1L4D B;  2BKR B;  2JYT A;  3QQ8 B;  1JRO A;  5JXV A;  2PE6 B;  4DHX B;  1ZW7 A;  2QIE B;  2XVW A;  2JZ3 B;  4MH8 A;  1V80 A;  1UD7 A;  2KAN A;  5D3D A;  2BGF A;  3KUC B;  4LDT D;  4NPN A;  2MRP A;  1TY2 A;  3UF8 A;  1K52 A;  1UH6 A;  1VZ6 A;  4L8U A;  3DVN V;  2DBX A;  1C77 A;  4A55 A;  3L16 A;  1ZE3 D;  4EZJ A;  1U4A A;  4HGK A;  1K51 A;  2JWU A;  4YTP B;  1K8R B;  2GBM A;  1YJJ A;  5D94 A;  1N60 A;  1H8C A;  3TJP A;  4XE0 A;  4MAC A;  2PJH A;  5GMV A;  3WAO A;  1I4H A;  4YWG G;  2CHZ A;  2V3N A;  3BWU D;  2WXH A;  1EWC A;  2WXG A;  4ANW A;  4Z9O A;  1STE A;  3FIL A;  4A3P A;  3A4S C;  2FAZ A;  4BFR A;  2VUE A;  2DLB A;  1C9F A;  4G11 A;  5LXI B;  3AMZ A;  2KFJ A;  2KJ6 A;  2W3S A;  3Q8A A;  1TS3 A;  4PT5 A;  4FHJ A;  3PZ8 A;  4JLC A;  4K1R B;  2JSV X;  2M56 B;  3ZJT A;  4DWF A;  1E10 A;  3CWI A;  1MA9 A;  5DQF A;  4IW0 A;  3AE1 B;  4JWS C;  4N0F D;  1PGB A;  3AM9 A;  2MQJ A;  3QIJ A;  3FWC C;  3EC8 A;  4ANU A;  3A4R A;  3VAW A;  3AE6 B;  2EKI A;  3FAH A;  1LXD A;  2D3G A;  4LB9 A;  2M17 A;  4LDT B;  3PSE B;  4KDL B;  1IJG A;  2BBC A;  4LB2 A;  4NAM A;  3V3X A;  3V08 A;  2E3T A;  3W9C B;  3NHE B;  1WJ4 A;  4RF0 A;  3NVV A;  3SIV B;  4IUM B;  5IJ5 A;  3AEG B;  3AEB B;  1YX5 B;  2I1J A;  4F5U A;  1E7I A;  3O65 B;  3PRM B;  1PYW D;  1WZ0 A;  3NVK A;  2N7J A;  4IDI A;  3VR9 B;  2FNJ B;  3B2G A;  1GB4 A;  1CQV A;  2KO3 A;  4AJW A;  4YSY B;  5CHV C;  1ET6 A;  3S2A A;  3VH3 B;  3VHT C;  1TKE A;  4TSS A;  3VFK A;  2V4L A;  4ZOH C;  2ONQ A;  4PYZ A;  2LGX A;  4AJY B;  2IO3 B;  3A33 B;  1YX6 B;  3TEZ A;  3APC A;  3P63 A;  3H3A A;  5L95 C;  2BXQ A;  1RWS A;  1P98 A;  2N4F A;  1TTN A;  4MM3 A;  2I2Y A;  2BXH A;  3LU7 A;  2FCS A;  4C56 C;  4JWU C;  4MM3 B;  3WAP A;  3T3O A;  3R2I A;  2KQS A;  2WXM A;  1SIJ A;  2AL3 A;  5JHB A;  1R4M I;  3C8Y A;  1WGK A;  5TSS A;  1SIF A;  3P4Q B;  1BJ5 A;  4HWI B;  1UWM A;  1WRD B;  1T6B X;  3TUO A;  2AEH A;  2KC1 A;  3PZ7 A;  2Y3A A;  3QC8 B;  1OQR A;  1JW9 D;  5C1Z A;  4KSK C;  2NS5 A;  3SIU B;  2K6Q A;  4L1B A;  3PV1 A;  1SGH A;  2N9P C;  3JVZ X;  2KDB A;  1CJE A;  3TSS A;  1EF5 A;  2WYQ A;  3C0R B;  2ZPN A;  4IWP A;  1HQR D;  4RGN A;  4LLG M;  4FIP B;  1WX9 A;  1L0Y B;  3IG3 A;  1L6U A;  1C78 A;  1L0X B;  2JXX A;  2KK8 A;  4DQO C;  1C76 A;  3WHQ A;  1J0G A;  1K53 A;  3PLA A;  1Q5W B;  4EOY A;  2KMM A;  2WLB A;  2LOQ A;  2DG5 A;  1WH3 A;  3ZJU A;  2K25 A;  3BK1 A;  1I35 A;  1WFY A;  3A9J A;  2LAS A;  4FJC B;  5AZH A;  4N58 A;  2BXI A;  1C4A A;  2GBJ A;  3N32 A;  3U4E G;  3PT2 B;  2ZEQ A;  2G45 B;  3A73 A;  1VZS A;  3UQB A;  1JWS D;  3HUI A;  4XZ4 A;  4KZ0 A;  1T0Y A;  5DBY A;  2SEB D;  1H9Z A;  2JT4 B;  1FXI A;  3IAS 1;  2DZM A;  1AYF A;  3AV8 A;  4II3 B;  1L7Y A;  2KJR A;  2I30 A;  4W4U B;  4G04 A;  3GA9 L;  3I57 A;  5IAA C;  3WAM A;  2FUH B;  2BF8 B;  3H37 A;  3LDZ E;  2MBB B;  2AQ2 B;  4F7Z A;  3P4R B;  2YLM A;  2I2Z A;  3PRZ A;  3JYU A;  1SE2 A;  5TR5 A;  4JQW C;  1ACC A;  3WA0 A;  4GLS C;  4DXF A;  4JE3 B;  3WAL A;  1J8C A;  4NQK E;  2N7E A;  4DDG D;  3J9C A;  5BYR A;  1D6E C;  4OZB A;  1LQB A;  3AEA B;  4OZC A;  1E8Y A;  4YXD B;  2M8S A;  2KWC A;  5D2M B;  4FN2 A;  1V1P B;  2L32 A;  4ZBR A;  2ZVN A;  2NTS A;  4NJ6 A;  4RF1 A;  4DXG A;  1UWX A;  2IGD A;  3OJ3 A;  2DBU A;  4E74 A;  4RH6 A;  2K8C A;  4ITK A;  3PS6 A;  2K8H A;  2LJI A;  4GSW A;  2L1A A;  1NBF C;  2NMQ A;  1WGD A;  4KKJ A;  1UGJ A;  4RM8 A;  1NT2 B;  1SBB B;  1FFU A;  2OZB B;  3ZJV A;  2LI5 A;  1E90 A;  1XLN A;  5AZF A;  2WQY B;  5C23 A;  2KMA A;  5G5G A;  4F5T A;  2D5G A;  4RMA A;  4Q2J A;  2O2V B;  1F9J A;  2CU1 A;  4AQ7 A;  1EWY C;  3VH4 B;  3SEB A;  4FHK A;  1GG3 A;  2KVR A;  2LVQ A;  2RDG A;  4OVU A;  2YEP B;  4A90 A;  4USA A;  2C60 A;  3ZNG C;  4AP4 C;  1UEL A;  3HVZ A;  4WQO B;  2JU6 X;  2YEP F;  3PGE A;  2CU3 A;  1TS5 A;  3ETR A;  2L7R A;  3B0A A;  4P7I A;  1FO4 A;  4A3O A;  4NJC A;  2K0P A;  1V2Y A;  1N62 A;  2KFK B;  2BS2 B;  3Q8C A;  3HVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...