3VQIA

Crystal structure of kluyveromyces marxianus atg5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
252
Chain Sequence
b'MEELRERVWNGTINVEVVVSDAIVVPNTTLADKSCHIVMLRDAYLGFYLPTVVRKLADTIKVPYESDYRNWWFEYNGEGVPWEYPCGVLFDLLNKQMWELQLCHGDKYPRGILPLVDGHSQIKDYWRHQWKQACFILNGSAKRIMSLSIPDFENFWVSILSRNRSDFMAVRSKLFSMNKAKSLPVRVWTSNYAVLQPTVPVTLSVAELLDSIKLSSVKSVIIQGIDVSIEDNIFELYDIFASIDGFLYLVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Atg5
publication title Structural insights into atg10-mediated formation of the autophagy-essential atg12-atg5 conjugate
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Protein transport
total genus 76
structure length 252
sequence length 271
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3vqiA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vqiA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vqiA01
2K1FA 3L16A 5D7GA 2NS5A 3KYCD 2G4SA 3PHWB 3EC8A 3EECA 3H9DA 1V2YA 5AZHA 3ZNID 1AARA 3A33B 2KOXA 2MP2B 4TUUA 4WJPA 3VFKA 2MP2A 4E71A 1RFAA 3RULA 3EFUA 1LM8B 4ANVA 2DENB 2B3AA 4MGIE 1JRUA 2ZEQA 3A9JB 1UGMA 1WFYA 2BPSA 5CTRC 3V61A 2KVRA 3UIPB 2UYZB 3A9JA 3OJ4B 2XK5B 3SD5A 3PVLA 1ZW7A 3NOBA 2XK5A 4GMVA 3UGBB 4ZYNA 4I6LB 2LXCA 3KYDD 4K7SA 3DVGY 3DPDA 1U4AA 2KKCA 1WXAA 1Q5WB 4FLHA 4J6IA 2A5UA 1EF5A 1WZ0A 2CR5A 2N9XA 3QC8B 3S2AA 3M62B 5EDSA 2MSED 4DDID 4NJ7A 4ZRJA 2ZZPB 1E7VA 1HE8A 2CS4A 3ALBA 3NY5A 5J17A 4K1RB 1R4MI 4GDLB 1WR6E 4AOFA 3PV1A 4GDLA 2MQJA 1G6JA 5HKHA 1ZKHA 3VUXA 3HHMA 2R2QA 1X1MA 2L0FA 2JPHA 2FIFA 3NZUA 4TKNA 4DHJD 2N1WA 2ZJDA 1C3TA 3QIJA 3VHTC 4HVBA 2I1JA 2D2QA 1TGZB 4HDQA 2GBJA 4B9KA 2KXJA 5CHVC 2NBVB 4IUMB 4URKA 3B08A 3PRZA 4ZRKA 2YLMA 2ZPNA 2KFJA 4EUTA 1QZEA 5C1ZA 2LWPA 2C7MB 3DVGX 3Q3JA 3QWZB 4BKGA 4A3OA 4RM8A 5LXIB 3L08A 2D10A 3AU4A 3ZRFA 4GN1A 4PS3A 5E6NA 2KMCA 4FULA 3GZNI 3VXWA 3TIXA 3IFWB 4NPNA 3B0AA 2MCNB 5L95C 1KLVA 4ANWA 1E8WA 2C7NB 2FUHB 2N4FA 2JRIB 1OEYJ 1H8CA 1KJTA 4GDKB 3K9OB 3M63B 4AP4C 1P1AA 3VUYA 1MG8A 2KNBA 4GDKA 4KVGB 4NQKE 2K6DB 1WJ6A 1SIFA 4FBJB 4X57B 3PREA 2JXXA 3I3TB 4DHJB 1T0YA 3ZTDA 4NNJB 4DHZB 1E8YA 1V6EA 1WR1A 3A1QB 4PS7A 4MSQB 4K81A 4MGYE 4AWJA 1WGHA 3A1QA 3ML8A 1EO6A 4PYZA 4EZLA 5KHQA 2IBIB 3DBLI 2MWSB 3EHVA 4GOCA 3U30A 5D2MB 3ZW3A 1V86A 3AXCA 1YX5B 1OGWA 1FXTB 2MBEA 4BVUC 3PTFC 5BO4B 1ZGUB 2KD0A 4A3PA 4GU2A 3ZNGC 2BKFA 4HCNB 4M8MA 5FR6A 1OTRB 2IZVB 2YVCA 4BOZB 3UQAA 4FADA 1K8RB 4JLCA 4BBNC 4MDKE 3HK0A 4PS8A 1Z5SB 4IWQA 4KV2A 3R7QA 3N3KB 3M95A 4KDIC 4CO7A 1WXVA 1WJ4A 2LXAA 1GUAB 3NS8A 2PE9A 4FHJA 2K8BA 3L13A 4B95A 3TJPA 2IO1B 2BYEA 2JWZA 3QAQA 4KZ0A 2VRRB 1V81A 2Z59B 2KANA 2K39A 2M0XA 3HIZA 3SHQA 4WJQA 1GJZA 3IVFA 2FIDA 4EEWA 1IYFA 1J0GA 1UH6A 4F7ZA 2BKRB 2L3ZA 2RD0A 1WGRA 2GBKA 2LZ6A 2WYQA 3JYUA 3PRPB 3APCA 4MH0E 4IWPA 3WIMA 5JHAA 5JZEB 2KX3A 2KMAA 1I42A 2W9NA 2J0JA 2KWUB 1XQQA 2JZ3B 2Z0DB 4G11A 1Z2MA 3U8ZA 1E90A 1BT0A 3PGEA 2BF8B 3OAWA 3ONSA 5AZFA 2MBQA 3RYTA 3L54A 3ZLZA 3ZTCA 4FN2A 2XBBC 2ZNVB 1YX6B 3RZWC 3VTVA 3VAWA 2MBHA 5GMVA 5IA7A 1UBIA 3DBSA 3TCAA 2ASQA 2I1KA 2IY1B 2FCSA 2M17A 3D32A 2KQSA 3IBEA 1RRBA 3DQVA 4K7UA 1R4NI 3V62A 3QARA 4XC2A 3ZUNA 1GG3A 3NHEB 2CKHB 2BYVE 2IY0B 4EFOA 3HM6X 2UWQA 3QA8A 2JF5A 1VD2A 1V49A 2L8JA 1WJNA 2N9PC 2IO0B 4MM3A 4BFRA 1WIAA 1PQSA 2KHWB 3LDZE 5LLIA 1NI2A 2O2VB 4GSWA 4F8CB 4IW0A 2DZMA 2MLBA 1UZXB 2O2VA 5CX3A 1WM2A 4MGKE 4XZ4A 2KN5A 3PS6A 4W9DA 2C60A 2FCQA 4HK2A 5DPTA 3PRMB 1WE7A 2JZZA 1YQBA 2FCNA 2PEAA 5AEKB 2M4NA 1V5OA 2FCMA 4HPMB 4NY0A 2K25A 3H7SA 1YIWA 3PLUA 3ZNHB 2CHWA 2N7EA 4M0WB 2O6VD 2KLGA 3V6CB 2LUEA 2KTFA 1CMXB 2KK8A 5CHWA 4EZKA 2LGDA 3KVFB 5L83A 4IM3A 3RCZA 4OVVA 2NBWB 1Y8RC 3TBLD 2KLCA 3ZIMA 2KJ6A 1V9JA 4B6WA 4WJNA 3RZFA 2ZVOA 4AJWA 3CF6E 4CHKA 2DAFA 4AUQC 2GMIC 4IM0A 1GNUA 2Z0EB 5TR5A 1WZ3A 1WX9A 2QHOA 2C5LC 4LJPB 1A5RA 2KFKB 4GIVA 3DOWA 1V80A 5AZGA 2KFKA 4ICVA 3C0RB 2NCNA 2KQ7A 3H7PB 4HPLB 4KSLC 3H7PA 3QK0A 4ICUA 2LRWA 3ZRCA 2K8HA 3HM3A 1WI0A 3X23A 2JY6A 1WE6A 4EKUA 3KUCB 2RPQA 3L10B 3SDLC 4FHKA 2AL6A 2BWES 4KZCA 3DBRI 3T9LA 3WAOA 4FJZA 3X0WA 4BKSD 3JSVB 2IO3B 2JT4B 3ENEA 2KDEB 2NR2A 1GC6A 3VUWA 4EOYA 3DCGA 5G2NA 3K9PB 4W9FA 2O6VB 3PHXB 3H6NA 4II2B 2AWTA 3A4RA 4JIOU 1WRDB 2O6VA 4W9CA 4F1SA 4WQOB 4W9KA 2C7HA 1P0RA 4ZDVA 2MBBB 1SE9A 3QX1A 1EUVB 2V1YA 4IM2A 1YJ1A 4BKTA 2NPTB 3W1YA 1GC7A 2N1VA 4II3B 2L00B 3DBHI 1P9DU 4W9IA 2R2OA 3A9KB 2LRUA 1P3QU 3AU5A 4G0NB 1P98A 2L76A 1WGYA 3A9KA 3KUZA 4I6NB 4KDLB 4MSMB 4ZRIA 2KO3A 3VQIA 4EZJA 4NAWB 1WX8A 4K7WA 3APFA 3DVNV 4NAWA 2MA9B 3KH0A 2C9WB 2KDFB 5G55A 3T8MA 2XEWA 3ZO5B 5E6OA 4TQ1A 4KIKB 3ZNZB 5DPSA 2AEHA 4OVUA 3IG3A 3R66C 3U7DA 4KIKA 3L0WB 2FNJB 2PPHA 3PLVA 5DPWA 2MW5A 1UD7A 4I6PA 2ZNVC 1TBEA 2EKEC 2WX0A 3PPAA 3R3MA 4M8NA 2D07B 1WMHB 4W9HA 4BKSA 2L05A 4TV3A 2DX5B 1WMHA 1C1YB 2RSUA 3AULA 2EMTA 4DK5A 3W1SC 2DYBA 3N32A 2GBNA 4E74A 4KSKC 1KM7A 3QJZA 2BWFA 2V4LA 3P2BA 2PJHA 2GBMA 3PSEB 5D94A 2ZCBA 1SGHA 5J18A 4AJYB 3W1SA 2CU1A 3QQ8B 2GOWA 3V6EB 1L2NA 3V60A 3RD2A 2HD5B 1WYWB 5DPRA 3RT3B 3APDA 3BINA 1IPGA 2WX1A 1NDDA 3AI5A 2J0KA 4RM9A 2HTHA 3TMPB 3KW5B 2CHXA 3O65B 4MEMA 2PE6B 2FAZA 2A4ZA 4HWIB 2KJHB 3VVWB 1WM3A 3CSFA 3H1UA 3OJ3A 1WXSA 2BYFA 4G50A 4LJOB 4A20A 2M8SA 2JUOA 2RGFA 3OLMD 3MTNB 4LCDE 2LVQA 4LDTD 3ML9A 1S1QB 3GOEA 4HCPB 2Y5BB 5LXHA 4W9EA 1LXDA 2LGYA 2LASA 3NZSA 3VDZA 1I35A 4WAAA 2GBRA 3WALA 2KWCA 1M94A 3PT2B 3M3JA 5KHOA 1V5TA 2OJRA 2CHZA 4BOSC 2ZVNA 3JW0X 4ASWC 3WA0A 3IHPC 2NVUI 1VCBA 2ZPYA 4W9LA 1WY8A 1XD3B 2WDTB 4FJVB 2DZJA 4FA6A 1D3ZA 1LQBA 4WWPA 3ECIA 3MJWA 2LD9A 4E3CA 1J8CA 1Q1OA 4IG7B 2K6QA 2IYDB 1IP9A 2L7RA 1WJUA 4MGZE 4ANUA 1RAXA 4YL8A 1NBFC 1EF1A 2DHZA 3VH3B 5JHBA 4DWFA 2DZKA 2LGXA 3BY4B 3LJ3A 4RMAA 2N7DA 5IAAC 3TL5A 4IC7B 1XT9B 4BBNF 3WANA 4ANXA 2MRPA 1WX7A 1YD8U 3B1LX 3A4SC 3UINB 4FJYA 2KJRA 3L17A 4DHZE 2DYOA 2J7QB 4WJOA 4HDOA 1OQYA 4JL9A 3CMMB 2KTRB 4W9JA 1E8ZA 2KTRA 4HLEA 2LI5A 4P7IA 2KZRA 4GGQA 4CYEA 4LDTB 1KOTA 2HE7A 1E8XA 4TQ0A 2D11A 2MX2A 1E5WA 3VH4B 5C23A 3JSVA 1H4RA 3QHTA 4XX5A 2BGFA 5D6JB 3Q3FA 2KC1A 1WGDA 4MELA 2KDIA 3VTUA 2LVOA 3CSTA 1RLFA 2OOBB 5DCNA 1UBQA 2WWZA 2LJ5A 2IO2B 1ISNA 3N30A 2JRHA 2KWVB 2DZIA 1WXMA 2G4DB 1UELA 4WWOA 3ZKJC 1S3SG 3ZDTA 4DXAB 4N9F4 5J2RA 2J0MA 3JVZX 3QCAA 1WH3A 3DDCB 1LFDA 4JQWC 3UIOB 3VTWA 1TTNA 2JVCA 1Q0WB 3R7RA 2NPTA 3RUIB 2KDBA 2RR9A 3UF8A 1WF9A 4G3XB 4DBGA 1J19A 4HJKA 2G3QB 2KX0A 2REXA 2MBOA 4HXDA 4JGHB 3ZDMC 4IWOA 1F9JA 2DAJA 4W9GA 1TZ1A 2K8CA 2V3SA 5CHFA 4GXBA 3ZVVA 5E6PA 3SU8X 1L7YA 2D3GA 2LVPA 2N9EB 4WWNA 2L0TA 4MJSB 1WGGA 5JH5C 2KC2A 3UQBA 2M1MA 4MJSA 2AL3A 2AYOB 2ZCCA 1E7UA 2G45B 3KUDB 4NJ6A 4GB9A 3WAMA 3DVNU 4PYUA 4DDGD 2DYMA 3PZDA 3WAPA 1OEYA 2HJ8A 3MHSD 2NBUA 4NQLB 2EMSA
chains in the Genus database with same CATH superfamily
2R61A 2BXKA 5D7GA 2NS5A 3EECA 4N0UD 5T8IA 4E71A 4TMAB 4ANVA 2DENB 4KKIA 1UGMA 1WFYA 5CTRC 3UIPB 3A9JA 2XVVA 2DG5A 2WXMA 4GMVA 3Q14C 3B9MA 2KKCA 4J6IA 2RPVA 1L4ZB 3AEEB 5MPOA 1B1ZA 1TKYA 2MSED 4DDID 2CKXA 2TSSA 3RNAC 2RDHA 4N3ZA 3PV1A 2WLBA 1G6JA 1FM0D 5HKHA 2VDBA 2JQRB 4DHJD 4TKNA 2ZJDA 3NVMA 1SB3C 3RNFC 1GAQB 4R3DA 3VR8B 2QIEB 4XDCA 2Z8IA 1V1PB 1VZSA 1R4NB 3B08A 2OJWA 3ABVB 2YLMA 2ZPNA 4WURA 3WCQA 4E99A 4LTUA 2C7MB 5BYRA 3Q3JA 1KH0A 4BKGA 3L08A 3KWVA 3GE8C 1RFKA 2RDGA 3IAM1 2KWFA 3B0AA 4ARCA 3AM9A 1H8CA 1KJTA 5B5TA 4AP4C 1MG8A 2LXSA 2KNBA 4GDKA 3TSSA 4NQKE 2K6DB 1SIFA 4MH8A 4X57B 4DHJB 1I4PA 5GXGB 1HTOA 1N6ZA 4PS7A 4BY9C 3Q8FA 1UF0A 4MGYE 2G1EA 2IBIB 2MWSB 4GOCA 4BAXA 3B2FA 1YX5B 3GQUA 1E7BA 1OGWA 3I9V1 5HHDG 5BO4B 1ZGUB 4A3PA 4GU2A 3ZNGC 1P7FA 1OTRB 2YVCA 4FADA 1K8RB 1FNVA 4PS8A 4ZRPA 3M95A 2PE9A 1FOUA 3PLAA 3TJPA 2CJNA 3CIRB 3V08A 2JWZA 3QAQA 4YSXB 3AEAB 3ZYYX 2V3PA 3BZDB 3UIVA 3N1ZC 1GJZA 1ENFA 2WDQB 1UH6A 1LO5D 1C4PA 3B9JA 2GBKA 1AW7A 1TY2A 3JYUA 3PRPB 1IGDA 2XVQA 4IWPA 1DOYA 2WU5B 2J0JA 2JZ3B 1Z2MA 3HVZA 1BT0A 3DBHB 2GLSA 1YX6B 3RZWC 3AB5A 3VAWA 5GMVA 3MC0B 2ASQA 4YSYB 4EMXA 1GB4A 3AE1B 2KQSA 3BYTB 1E7IA 3EGRA 3IBEA 1R4NI 4BKEA 1VR9A 4XC2A 2VH2A 2IY0B 2L83A 3HM6X 2JF5A 1V49A 2IO0B 4MM3A 4RGNA 3T3OA 3LDZE 3RNGC 5BYQA 2O2VB 4GSWA 5HFYA 2DZMA 2MLBA 4OVZA 1JWAD 1WM2A 4QAYA 3Q8EA 3NVVA 4K2CA 2WXQA 4O1NA 3R8BA 2BB5A 1YQBA 4ZC6A 2M4NA 3P4RB 2FCMA 4NY0A 1MHHE 3ZNHB 2ACZB 2CHWA 2N7EA 3A73A 4IOIE 2LUEA 4W4UB 2LGDA 2FBWB 1SJED 2QEJC 1Y8RC 3TBLD 2IGGA 2KJ6A 4AJWA 1ZUD2 2DAFA 2GMIC 1WX9A 2QHOA 2C5LC 3Q2AC 3FILA 2KFKA 3C0RB 5DBYA 3H7PA 3QK0A 4HKQA 3P4SB 1VZ6A 3HM3A 5IKCM 4P1BC 4OR0A 1V97A 3X0WA 2K9XA 2IO3B 3ENEA 2KDEB 2NR2A 5EE1A 3VRAB 4WA6B 3DCGA 3NVZA 3PHXB 3H6NA 4II2B 2AWTA 4JIOU 4F1SA 2C7HA 1P0RA 3QX1A 1YJ1A 3Q8AA 1GC7A 4II3B 1T0QC 3DBHI 1O9XA 2R2OA 4A90A 2X38A 3AU5A 3TEYA 4I6NB 4ZRIA 2KO3A 1SSNA 1K51A 3Q3NC 4NAWB 4K7WA 3APFA 2KDFB 4OZBA 5E6OA 3GB1A 5DPSA 3IG3A 4KIKA 3L0WB 3CWIA 2WX0A 3PPAA 2D07B 1WMHB 3KQ4A 2MHJA 4BKSA 2DX5B 1C1YB 3AULA 3PZ7A 3QJZA 2BVCA 2XMOA 2ZCBA 3U52E 3SEBA 1HA5A 3V60A 1E0ZA 5DPRA 3RT3B 1I4QA 3E56A 2JWUA 4RM9A 3TMPB 3KW5B 2CHXA 3O65B 5GIPA 2PE6B 3MFGA 1NVID 1NT2B 4HKZE 2ICIA 2VZKD 4HWIB 3OJ3A 3KIKA 3BVZA 2BXPA 2LHEA 4A8XC 2LVQA 4LDTD 3MJ5A 1FMAD 1S1QB 3R2IA 1RM6C 3U4EG 4W9EA 1BXTA 2QMTA 1V1OA 1SB0A 5KHOA 4JE3B 5IIHA 4ASWC 1VCBA 1XD3B 3AE3B 1D3ZA 4FA6A 2GUTA 3MJWA 2BXAA 2DBYA 1J8CA 4HGKA 2L7RA 1IP9A 4B0MA 2XN9C 1EF1A 2QC8A 1FO4A 2JYEA 2N7DA 5IAAC 2LMCA 3WANA 1SJHD 2BXMA 3A4SC 3L17A 1OQYA 3CMMB 2VZKB 1FNUA 1E7GA 1YJJA 1L5PA 2KZRA 4GGQA 2LGIA 2VUFA 4LDTB 2BS2B 4G04A 3Q3FA 1UBQA 1WXMA 2G4DB 1N61A 1YQ3B 1S3SG 3ZDTA 4DXAB 2BS3B 5J2RA 3BK1A 3AMZA 3VTWA 1TY0A 4YWGG 2RR9A 2BT6A 2DNFA 4G3XB 2BXHA 3GZNB 4HJKA 2G3QB 1ZXIA 4HXDA 4WWMA 2K8CA 4HGMB 1C9FA 2D3GA 2N9EB 4ZHOA 1KW2A 4IDIA 1MM8A 4MJSB 2KC2A 2BXIA 2Y5PA 3KUDB 5JXVA 4EE2A 3BWUD 3CX9A 3AH7A 1YJIA 3KYCD 3I63C 1N5WA 3H9DA 1ZOYB 3ZNID 5IFOA 4M70B 2I2ZA 2KOXA 3Q3MC 2WXIA 4L2YA 4WJPA 2MP2A 1RFAA 3EFUA 4LB2A 1J7EA 2ZEQA 3A9JB 3V61A 5GHKA 3GQXA 3MHHB 2UYZB 1RWSA 1ROEA 3PVLA 1ZW7A 3NOBA 3SFEB 2XK5A 3P63A 2PLPA 4I6LB 4OW0A 2LXCA 3AE5B 1D5ZC 3DPDA 4TSSA 1LNSA 5ID9A 2N9XA 2WNMA 2NMQA 2RMMA 1NYRA 4PO0A 1YNTE 1E7VA 2JU6X 2OEDA 1C79A 3NY5A 5J17A 4AOFA 1H5WA 1HK5A 4GDLA 2N7JA 2G9HD 3VUXA 1HZ5A 2I30A 3TEWA 1X1MA 2FIFA 1GOZA 2N1WA 3BVMA 1C3TA 3QIJA 3URYA 1L6VA 3H3AA 2I1JA 3FAHA 2D2QA 4HDQA 1TKGA 2KXJA 1NI3A 3IT6B 1TYGB 1N62A 4URKA 2BXNA 3TDLA 2AQ3B 2KFJA 1QZEA 5IIUA 2LWPA 1F1HA 4A3OA 4RM8A 2D10A 1UWMA 3AE6B 4F5VA 4LNFA 5E6NA 1OFFA 3GZNI 2XW1A 1KLVA 4ANWA 3AE7B 1CK1A 3IXSA 4GDKB 3M63B 3VUYA 2WXJA 4KVGB 4FBJB 2V4IB 3PREA 4MBEC 1JMLA 2JYTA 4NNJB 4DHZB 1E10A 1E8YA 1V6EA 5LNK1 4K81A 1E78A 3A1QA 4EZLA 5KHQA 3RMKC 3U30A 3EHVA 2BXLA 5D2MB 3AXCA 1FXTB 1TXUA 2BKFA 4IW2A 1J7BA 4BOZB 2J52A 4MDKE 3NZ3A 4LLGM 4IWQA 4KV2A 3R7QA 1FFVA 1WXVA 5EE9A 2LQIA 2LXAA 1D4BA 3ZGZA 2K8BA 2YEPB 5H8YE 4K3CA 4KZ0A 2VRRB 2XSIA 2Z59B 2K39A 2M0XA 4G03A 4WJQA 1ZXHA 2QILA 1RYJA 1SEBD 1J0GA 3LU8A 2BKRB 5HI1A 2WDRB 2RD0A 1WGRA 2LZ6A 3DWMA 1FEHA 4ZCGA 5TSSA 5JHAA 1I42A 2KVZA 2W9NA 2D3AA 2Z0DB 4G01A 4G11A 1E90A 2BXBA 2BF8B 3OAWA 1BMLC 2NTSA 3NS1A 2ZNVB 3VTVA 5IA7A 3DBSA 3TCAA 4L1BA 1QOAA 2I1KA 3D32A 1QOFA 1QLBB 2PKOA 1RRBA 3M99C 4K7UA 1WSPA 4RF1A 2M19A 5BYSA 2CKHB 2M56B 4EFOA 2I2YA 1VD2A 2Y3AA 2WXLA 4MM3B 2IJ0A 2IGDA 1WIAA 1PQSA 1FPYA 2KHWB 4F8CB 4IW0A 4IW1A 1AYFA 3PZ8A 4MGKE 4JWSC 2KN5A 3PS6A 2C60A 4HK2A 5D3IB 5BMIA 2AX5A 1XCQL 5IO9A 2WQYB 4HPMB 2EKIA 3C19A 2WXPA 3V6CB 2KLGA 1GPXA 2KTFA 2KK8A 5CHWA 4EZKA 2QSDA 4IM3A 3RCZA 4OVVA 2NBWB 3ZIMA 2KLCA 3DHGC 4JPSA 4J3OD 4WJNA 3O13A 4D7XA 3RPFC 3Q8BA 4IM0A 1WZ3A 2WXHA 3FILB 2KFKB 3DOWA 3H7PB 4ICUA 4KKJA 1TKEA 1L0YB 1K50A 1JWUD 2K8HA 1VRAB 1YN4A 3MHZA 3SDLC 3NVIA 2BWES 4BKSD 3LXFA 2NTTA 2K22A 1ZDXA 2NNWA 1C4CA 4EOYA 2RDBC 4PK1A 3K9PB 2O6VA 1L0VB 3OWEB 4W9KA 1KDXA 4ZDVA 4Z9OA 1SE9A 1EUVB 4BKTA 1JROA 3ZXVA 1EWCA 4WAFA 1P9DU 2LRUA 2XVUA 4E74A 3KUZA 1WGYA 3A9KA 4LNIA 1IGCA 4L8UA 4M01A 2HTME 5FUOA 3DVNV 1C4AA 5D3DA 5G55A 3W2DA 2KYWA 1E7HA 4TQ1A 4KIKB 1XCTL 3LU6A 3PLVA 2QJLA 2ZNVC 3AE9B 4M8NA 2CU3A 2LXTA 2RSUA 4DK5A 2DYBA 4J2VA 1I7HA 2MJ3A 3BYYB 2V4LA 2W54A 1K53A 5D94A 1F52A 1SGHA 5J18A 2BXFA 3TEZA 1DGJA 4BZAA 3AI5A 2HTHA 2FAZA 1FIQA 1MUSA 3V3XA 2BYFA 4G50A 4LJOB 4A20A 2M8SA 2JUOA 2RGFA 3MTNB 2KMMA 3GOEA 4HCPB 2VUEA 2LGYA 2LASA 3BVGA 4K3BA 1PGAA 4ZUXV 1M94A 3PT2B 2CHZA 4P6VF 2EELA 2NVUI 1I4GA 2ROHA 4DXGA 2J42A 3WHSA 2IYDB 4MGZE 1WJUA 4YL8A 3LU7A 1FXIA 3VH3B 5JHBA 3LJ3A 2W3SA 2BW2A 2QHBA 4N6EB 3B1LX 2KJRA 2DYOA 2PVGC 1J7AA 3RI7C 1GB1A 1E8ZA 1WYGA 2KTRA 1ET9A 1MIWA 4CYEA 2HE7A 4TQ0A 3VH4B 3QHTA 4XX5A 2BGFA 1IJGA 1FXAA 2KC1A 3MP9A 2KDIA 2OOBB 5DCNA 2KWVB 2DZIA 3ZKJC 4OZAA 3N1XC 5EE0A 1F2RI 1D5XC 2ZW1A 4JQWC 1LFDA 4REZA 3NVWA 3G9KD 3R7RA 4ZRQA 3FWCC 2KX0A 1HEZE 4IWOA 2BB6A 1TZ1A 1BM0A 5CHFA 1F2RC 4WWNA 5G5GA 3LYYA 5G5HA 3P4PB 4S17A 1WGGA 4D2KA 2G45B 4NJ6A 2LGSA 3WAMA 1HK3A 3DVNU 1TZOA 4DDGD 2DYMA 2GRIA 3PZDA 1OEYA 1SE3A 3ECPA 2HJ8A 3MHSD 4W9LA 4AQ7A 2EMSA 1E7EA 2BBCA 3L16A 4YTPB 1LOTA 2E0XA 2G4SA 1PYWD 4FIPB 1V2YA 4FK5B 1AARA 3A33B 4OZCA 2MP2B 4TUUA 3H8HA 3VFKA 3RNBC 3RULA 1LM8B 4CQNA 2B3AA 4MGIE 1PGXA 2BPSA 2EFEA 3KLSX 3VRBB 2KVRA 1E7PB 2XK5B 3SD5A 2IGHA 5IJ5A 1N5UA 2INDC 2LHDA 4S1YA 3KYDD 3I57A 1Q5WB 4FLHA 5C2TB 1UORA 3S2AA 2CR5A 3QC8B 4Z69A 2HDEA 1I4RA 4RH6A 4NJ7A 2ZZPB 1HE8A 5H92C 5DQFA 3ALBA 1KLUD 2B76B 4GDLB 1MIVA 1JWBD 5IN7A 2L0FA 2JPHA 2AGHB 2WGSA 3W9CB 2M0AA 1J78A 4H2AA 1NENB 1TS2A 2NBVB 1MIYA 4MACA 3PRZA 2PIAA 4ZRKA 2WDVB 2KDMA 5C1ZA 4NZLB 1XLOA 4L9KA 2YEPF 3V09A 5LXIB 3Q3OC 1MUHA 1DYQA 3ZRFA 1HK1A 4GN1A 3ZJVA 2X8XX 3ZJTA 4FULA 1I4XA 1CJEA 3GA9L 2MCNB 5L95C 2C7NB 3T3NA 4ARIA 3K9OB 2UU7A 2SEBD 1HA2A 2JXXA 1T0YA 5AUKA 3P1MA 1WR1A 3A1QB 1QQRA 4MSQB 4AWJA 1WGHA 3ML8A 1EO6A 4PYZA 3UI3A 1VDVA 3AECB 1V86A 3AEGB 3SIUB 2MBEA 3N9YC 4HCNB 2IZVB 4JLCA 1AWDA 4HROA 4HJGE 4BBNC 1CQVA 1XEEA 3N3KB 1XLQA 4OTUA 3NS8A 2INCC 1JWSD 3ZQ4A 2PW9A 4MT5A 4DM0A 2BYEA 3DBRB 4A9AA 3W5UB 2KANA 2E3TA 3HIZA 4RGTA 4K71A 5BMGA 4EEWA 1IYFA 4F7ZA 2QCZA 2L3ZA 4C80A 3AE4B 2WYQA 2Z8LA 4P1CC 5JZEB 2KMAA 1IUEA 4YTNB 3U8ZA 5BMHA 2GI9A 2LJIA 3PGEA 5AZFA 3ONSA 3U7ZA 1YN5A 4FN2A 2XBBC 4WQMA 2BX8A 1UBIA 5IJEA 2OZBB 2IY1B 3PO0A 3QARA 1STEA 3ZUNA 2BYVE 3AEBB 1H9ZA 1WXQA 2L8JA 3NMUA 2BXGA 5IOIA 1WJNA 2N9PC 1NI2A 3GP7A 3FWBC 1BKEA 5CX3A 1L0XB 4XZ4A 4W9DA 2FCQA 4C00A 2L1AA 3B2GA 1FCLA 2BTEA 1V5OA 5GINA 2K25A 1P7EA 3H7SA 1YIWA 4XWWA 3H37A 4HEA1 1TJEA 2O6VD 3GS2A 2INNE 4XGAB 3ICXA 2V36A 4LNOA 1V9JA 4YT0B 4B6WA 2ZVOA 1XLNA 4CHKA 4AUQC 2Z0EB 1BJ5A 5TR5A 1JCKB 3RNCC 1A5RA 5AZGA 1V80A 4ICVA 1E7FA 2QMCA 1K52A 1JWMD 2KT7A 4XYCA 2LRWA 3ZRCA 1WI0A 2JY6A 1WE6A 3KUCB 2RPQA 1ET6A 3B9LA 3T9LA 4FHKA 2AL6A 4KZCA 3DBRI 3WAOA 2DWQA 4FJZA 1HQRD 4RCOA 3HUIA 1KLGD 3IAS1 3JSVB 1PUTA 1TIFA 1GC6A 1E6EB 4W9FA 1MPEA 2O6VB 1QILA 2E6XA 4WQOB 2CJOA 4LUFA 3JQZA 3ETRA 4IM2A 3W1YA 2N1VA 3KWLA 3A9KB 2L76A 3AE8B 3SR6A 1FD6A 1FNWA 1ACCA 3N20C 4EZJA 4GG2A 2MA9B 3KH0A 3MC9A 3AV8A 3T8MA 2XEWA 3ZNZB 2AEHA 4OVUA 3R66C 2FNJB 5DPWA 1EU4A 2MW5A 4OT2A 4I6PA 1QOBA 1TBEA 1PDXA 3R3MA 1WRIA 4RGOS 4N0FD 2MJEA 1J7CA 2EMTA 1ESFA 4LNNA 4ZBQA 2PJHA 3Q69A 2GBMA 1IBXA 5I4DA 4AJYB 2CU1A 3QQ8B 1L2NA 2PMVA 3RD2A 1WYWB 3APDA 2WX1A 1NDDA 2J0KA 5FR3A 1AN8A 4ZBKA 4GLSC 2KJHB 1WM3A 3CSFA 3H1UA 4LCDE 3ML9A 2Q5WD 1LXDA 1LGRA 4WAAA 3WALA 2KWCA 4LK0M 1SE2A 2EFHA 4KGSA 1V5TA 2OJRA 4BOSC 2WU2B 3IHPC 1WY8A 2WDTB 4FJVB 4AS1A 1JALA 3ECIA 4E3CA 2LD9A 1Q1OA 2K6QA 1UGJA 1FCCC 4ANUA 1RAXA 4I9OA 1NBFC 1N63A 5EE3A 3Q6BA 2LGXA 3BY4B 4JX1C 2N9KA 1R4MB 1XT9B 4BBNF 1HK4A 1WX7A 5C3JB 1UUPA 3VR9B 1GNJA 4FJYA 5HG2A 3UINB 2JXTA 4WJOA 2KTRB 3C8YA 2KAJA 4JK4A 4P7IA 1KRHA 5BPKA 1T0SC 1KOTA 1E8XA 2D11A 2MX2A 3AN1A 1E5WA 4WIPA 3JSVA 1H4RA 2KWDA 3BK2A 2JSVX 4MELA 3VTUA 2LVOA 3CSTA 1HTQA 4NJCA 2JRHA 2MEKA 1KFYB 2BXQA 3ZJUA 2GB1A 2XVWA 3DDCB 2ON8A 4NAMA 1I4HA 1TTNA 2JVCA 1QOGA 1J19A 1MFWA 1YQ4B 2MBOA 1B9RA 2DBUA 1F0ZA 1D5MC 1JNBA 1F9JA 2DAJA 4W9GA 3V05A 3P42A 2LVPA 4US8A 2AJEA 4C4VA 5JH5C 3UQBA 2XW0A 2WXNA 4RF0A 1E7UA 2JX5A 4GB9A 4A55A 4PYUA 3WAPA 3DBLB 4NQLB 2K1FA 3PHWB 3EC8A 1TS4A 5AZHA 3EFCA 3FC4A 1JRUA 5GIOA 2L32A 3MC8A 3OJ4B 3A75A 2OHFA 3UGBB 2ZW0A 3NVKA 4ZYNA 4K7SA 3DVGY 1U4AA 4JWUC 1WXAA 1N5XA 1F77A 2A5UA 3BIID 1EF5A 1WZ0A 3M62B 5FKAC 5EDSA 3FNMA 1YOVB 1VJKA 4ZRJA 3HRDD 1ZE3D 2J53A 2CS4A 4K1RB 1R4MI 2V0GA 1WR6E 2DLBA 2MQJA 1ZKHA 3HHMA 1HZ6A 2ONQA 2R2QA 3NZUA 1V8CA 3AE2B 3VHTC 4HVBA 1TGZB 3SIVB 2VH1A 2GBJA 4B9KA 5CHVC 1MHXA 3IT4B 4IUMB 1QT9A 1V1PA 2QDFA 1R7SA 4N59A 4EUTA 2W3RA 3DVGX 4ZHPA 1OQRA 3QWZB 2EFDA 1ZDVA 3AU4A 1D6EC 2K0PA 3NG0A 4PS3A 2KMCA 1MVKA 3VXWA 3TIXA 3IFWB 4NPNA 3OG5A 1CZPA 1E8WA 2FUHB 4F5TA 2N4FA 1HXYD 2JRIB 1OEYJ 3ZXRA 1WGKA 1P1AA 1WJ6A 5IP4D 3NJTA 3I3TB 1EM7A 3RNEC 4ACFA 2INPE 1FFUA 4ZYSA 4C7ZA 2I38A 3DBLI 1XO3A 1JRPA 3KJLA 1M4VA 3ZW3A 4BVUC 3PTFC 2KD0A 1FRDA 1ZPSA 3NRZA 4M8MA 5FR6A 3UQAA 2KQ4X 3AEFB 1E9MA 4F5UA 4HRSA 3HK0A 1Z5SB 2H88B 3RFZB 4KDIC 4CO7A 1WJ4A 1GUAB 4YSZB 4FHJA 3L13A 4B95A 1SF0A 2NQOA 4LA0A 2IO1B 1V81A 1VZ7A 3SHQA 3IVFA 3WHQA 2D3BA 2MJDA 2FIDA 1Y56A 4C31B 4XWTA 4KGTA 1MA9A 4MH0E 3APCA 2DBXA 2WXKA 3WIMA 2Y5CA 4LUHA 2KX3A 2J4XA 2KWUB 1XQQA 2LFIA 2IDYA 3RYTA 2MBQA 3L54A 3ZLZA 1YN3A 3ZTCA 4HPPA 2YDFA 1T3QA 3V03A 2MBHA 4L23A 2KACA 3U2SC 2FCSA 2M17A 3DQVA 2PTLA 3V62A 1GG3A 3NHEB 2UWQA 3QA8A 1ZP0B 4IKGA 1JQ4A 1QKZA 2EFCA 3MHSB 1XXGA 2WP9B 4BFRA 1BUIC 5LLIA 4LNKA 4USAA 1EWYC 1UZXB 2O2VA 1TT5B 5IJFA 2WHIA 1HK2A 5DPTA 3PRMB 1E7AA 1WE7A 2JZZA 2FE8A 2DBWA 2FCNA 2PEAA 5AEKB 2IPKD 1E7CA 3PLUA 4M0WB 3TEXA 1CMXB 2Z8KA 1KTKA 3KVFB 4DQOC 4YXDB 5L83A 3JRYA 1DOIA 2W55A 3RZFA 3CF6E 2K0NA 1FRRA 2K5PA 1GNUA 1AO6A 4LJPB 2LEKA 1QF6A 3Q8CA 4GIVA 2NCNA 2KQ7A 4HPLB 3L4PA 4KSLC 1SIJA 2WXOA 3BPJA 3FKYA 4C7YA 4OHJA 2BXCA 2Z8JA 4LB9A 2N0SB 3X23A 4EKUA 2BXOA 4Q2JA 1C78A 3L10B 1KXPD 2FUG1 1C77A 1T0RC 4M02A 2JT4B 2E0YA 2WXFA 1N60A 2QM6A 2V3NA 1T5XD 3VUWA 5G2NA 3AEDB 3A4RA 4XE0A 1SXTA 1WRDB 1TF0A 2HJ1A 4W9CA 2D3CA 1TS3A 2MBBB 3SQJA 2V1YA 2KBZA 2KN4A 4FXCA 2NPTB 2L00B 3I5JC 2BXEA 4W9IA 4US9A 4P16A 1P3QU 4G0NB 1P98A 4KDLB 1NEKB 4MSMB 2JZPA 3VQIA 4DHXB 1YMHE 2BXDA 2L52A 1WX8A 4NAWA 2W82A 4UDUC 1GNIA 2C9WB 1WWTA 3ZO5B 2K3UA 3U7DA 1TS5A 5FK9C 1UNSA 2PPHA 3NVYA 1UD7A 2EKEC 3DWGC 1MG4A 1MI0A 5IIXA 4DXFA 1SBBB 4KX6B 2V9HA 4W9HA 2L05A 4TV3A 1WMHA 3E9SA 1L6UA 3W1SC 3N32A 2GBNA 4GDXA 4KSKC 1KM7A 2BWFA 3P2BA 1IBXB 3PSEB 1UWXA 3TUOA 3W1SA 3WHRA 1L4DB 1SE4A 2GOWA 4RGMA 3V6EB 2H89B 2HD5B 3SFDB 3BINA 1IPGA 2D5GA 4MEMA 4B0EA 2A4ZA 4FJCB 3VVWB 1EU3A 1WXSA 4L9QA 4WH4A 3OLMD 2JUHA 1T6BX 4F5SA 2Y5BB 4ITKA 5LXHA 3NZSA 3VDZA 1I35A 2GBRA 2LUMA 3M3JA 1PFDA 3W5VB 2ZVNA 3JW0X 3WA0A 3RN9C 2LQHA 2ZPYA 3R2TA 4M0WA 1VFIA 2WS3B 2DZJA 1LQBA 4PT5A 3DHIC 4WWPA 3EA6A 5HOZA 1VZ8A 4IG7B 2DHZA 4DWFA 2DZKA 1Q10A 4RMAA 3NUHB 2N9LA 4N58A 3TL5A 4IC7B 4ANXA 2XNAC 2MRPA 1YD8U 3DHHC 4DHZE 2SAKA 2J7QB 4S0RA 3GE3C 4HDOA 4JL9A 4W9JA 4XDDA 2AQ1B 4HLEA 2LI5A 1A70A 1C76A 4A6QA 4ZBRA 3EUB2 2PVOD 4KGRA 5E6JA 3J9CA 5C23A 2OT3A 4C56C 5D6JB 2WXGA 1WGDA 1RLFA 2WWZA 2LJ5A 2IO2B 1ISNA 3N30A 1XF5L 1UELA 4WWOA 2WXRA 3LB8C 4ZOHC 4N9F4 2BS4B 2J0MA 2AQ2B 3JVZX 3QCAA 1WH3A 2MH7A 3HVDA 3UIOB 5ID7A 4OTTA 1Q0WB 1XLPA 2NPTA 3RUIB 4RFBA 2KDBA 3UF8A 5AUIA 1WF9A 1PGBA 4DBGA 2REXA 4JGHB 1DOXA 3ZDMC 1OQQA 3P4QB 4M00A 2V3SA 4GXBA 3ZVVA 5E6PA 3SU8X 1L7YA 4C4VB 1MJDA 1NYQA 1JW9D 2L0TA 3N1YC 2M1MA 4MJSA 2AL3A 2AYOB 2ZCCA 2BQQA 1KF6B 4YTMB 4RNAA 2LOQA 2BYTA 3ZTDA 2NBUA 1VLBA
chains in the Genus database with same CATH topology
2R61A 2BXKA 5D7GA 2NS5A 3EECA 4N0UD 4E71A 5T8IA 4TMAB 4ANVA 2DENB 4KKIA 1UGMA 1WFYA 5CTRC 3UIPB 3A9JA 2XVVA 2DG5A 2WXMA 4GMVA 3B9MA 2KKCA 4J6IA 2RPVA 1L4ZB 3AEEB 5MPOA 1B1ZA 1TKYA 2MSED 4DDID 2CKXA 2TSSA 2RDHA 4N3ZA 3PV1A 2WLBA 1G6JA 1FM0D 5HKHA 2VDBA 2JQRB 4DHJD 4TKNA 2ZJDA 3NVMA 1SB3C 1GAQB 4R3DA 3VR8B 2QIEB 4XDCA 2Z8IA 1V1PB 1VZSA 3B08A 3ABVB 2YLMA 2ZPNA 4WURA 3WCQA 4E99A 4LTUA 2C7MB 5BYRA 3Q3JA 4BKGA 1KH0A 3L08A 3KWVA 1RFKA 2RDGA 3IAM1 3B0AA 4ARCA 3AM9A 1H8CA 1KJTA 5B5TA 4AP4C 1MG8A 2KNBA 4GDKA 3TSSA 4NQKE 2K6DB 1SIFA 4MH8A 4X57B 4DHJB 1I4PA 5GXGB 4PS7A 4BY9C 3Q8FA 4MGYE 2G1EA 2IBIB 2MWSB 4GOCA 3B2FA 1YX5B 3GQUA 1E7BA 1OGWA 3I9V1 5HHDG 5BO4B 1ZGUB 4A3PA 4GU2A 3ZNGC 1P7FA 1OTRB 2YVCA 4FADA 1K8RB 1FNVA 4PS8A 4ZRPA 3M95A 2PE9A 1FOUA 3PLAA 3TJPA 2CJNA 3CIRB 3V08A 2JWZA 3QAQA 4YSXB 3AEAB 3ZYYX 2V3PA 3BZDB 3UIVA 1GJZA 1ENFA 2WDQB 1UH6A 1LO5D 1C4PA 3B9JA 2GBKA 1AW7A 1TY2A 3JYUA 3PRPB 1IGDA 2XVQA 4IWPA 1DOYA 2WU5B 2J0JA 2JZ3B 1Z2MA 3HVZA 1BT0A 1YX6B 3RZWC 3AB5A 3VAWA 5GMVA 3MC0B 2ASQA 4YSYB 4EMXA 1GB4A 3AE1B 2KQSA 3BYTB 1E7IA 3EGRA 3IBEA 1R4NI 4BKEA 1VR9A 4XC2A 2IY0B 3HM6X 2L83A 2JF5A 1V49A 2IO0B 4MM3A 4RGNA 3T3OA 3LDZE 5BYQA 2O2VB 4GSWA 5HFYA 2DZMA 2MLBA 4OVZA 1JWAD 1WM2A 3Q8EA 3NVVA 4K2CA 2WXQA 4O1NA 3R8BA 2BB5A 1YQBA 4ZC6A 2M4NA 3P4RB 2FCMA 4NY0A 1MHHE 3ZNHB 2ACZB 2CHWA 2N7EA 3A73A 4IOIE 2LUEA 4W4UB 2LGDA 2FBWB 1SJED 2QEJC 1Y8RC 3TBLD 2KJ6A 2IGGA 4AJWA 1ZUD2 2DAFA 2GMIC 1WX9A 2QHOA 2C5LC 3FILA 2KFKA 3C0RB 5DBYA 3H7PA 3QK0A 4HKQA 3P4SB 1VZ6A 3HM3A 4OR0A 1V97A 3X0WA 2K9XA 2IO3B 3ENEA 2KDEB 2NR2A 5EE1A 3VRAB 4WA6B 3DCGA 3NVZA 3PHXB 3H6NA 4II2B 2AWTA 4JIOU 4F1SA 2C7HA 1P0RA 3QX1A 1YJ1A 3Q8AA 1GC7A 4II3B 3DBHI 1O9XA 2R2OA 4A90A 2X38A 3AU5A 3TEYA 4I6NB 4ZRIA 2KO3A 1SSNA 1K51A 4NAWB 4K7WA 3APFA 2KDFB 4OZBA 5E6OA 5DPSA 3GB1A 3IG3A 4KIKA 3L0WB 3CWIA 2WX0A 3PPAA 2D07B 1WMHB 3KQ4A 4BKSA 2DX5B 1C1YB 3AULA 3PZ7A 3QJZA 2XMOA 2ZCBA 3U52E 3SEBA 1HA5A 3V60A 1E0ZA 5DPRA 3RT3B 1I4QA 3E56A 2JWUA 4RM9A 3TMPB 3KW5B 2CHXA 3O65B 5GIPA 2PE6B 3MFGA 1NVID 1NT2B 4HKZE 2ICIA 4HWIB 2VZKD 3OJ3A 3KIKA 3BVZA 2BXPA 2LHEA 4A8XC 2LVQA 4LDTD 3MJ5A 1FMAD 1S1QB 3R2IA 1RM6C 3U4EG 4W9EA 1BXTA 2QMTA 1V1OA 5KHOA 4JE3B 5IIHA 4ASWC 1VCBA 1XD3B 3AE3B 1D3ZA 4FA6A 3MJWA 2BXAA 2DBYA 1J8CA 4HGKA 2L7RA 1IP9A 4B0MA 2XN9C 1EF1A 1FO4A 2JYEA 2N7DA 5IAAC 2LMCA 3WANA 1SJHD 2BXMA 3A4SC 3L17A 1OQYA 3CMMB 2VZKB 1FNUA 1E7GA 1YJJA 1L5PA 2KZRA 4GGQA 2LGIA 2VUFA 4LDTB 2BS2B 4G04A 3Q3FA 1UBQA 1WXMA 2G4DB 1N61A 1YQ3B 1S3SG 3ZDTA 4DXAB 5J2RA 2BS3B 3BK1A 3VTWA 3AMZA 1TY0A 4YWGG 2RR9A 2BT6A 4G3XB 2BXHA 4HJKA 2G3QB 4HXDA 1ZXIA 4WWMA 2K8CA 4HGMB 1C9FA 2D3GA 2N9EB 4ZHOA 1KW2A 4IDIA 4MJSB 2KC2A 2BXIA 2Y5PA 3KUDB 5JXVA 4EE2A 3BWUD 3CX9A 3AH7A 1YJIA 3KYCD 1N5WA 3H9DA 3ZNID 1ZOYB 5IFOA 4M70B 2I2ZA 2KOXA 2WXIA 4WJPA 4L2YA 2MP2A 1RFAA 3EFUA 4LB2A 1J7EA 2ZEQA 3A9JB 3V61A 5GHKA 3GQXA 3MHHB 2UYZB 1RWSA 3PVLA 1ROEA 1ZW7A 3NOBA 3SFEB 2XK5A 3P63A 2PLPA 4I6LB 4OW0A 2LXCA 3AE5B 1D5ZC 3DPDA 4TSSA 1LNSA 5ID9A 2N9XA 2WNMA 2NMQA 2RMMA 1NYRA 4PO0A 1YNTE 1E7VA 2JU6X 2OEDA 1C79A 3NY5A 5J17A 4AOFA 1H5WA 1HK5A 4GDLA 2N7JA 2G9HD 3VUXA 1HZ5A 2I30A 3TEWA 1X1MA 2FIFA 1GOZA 2N1WA 3BVMA 1C3TA 3QIJA 3URYA 1L6VA 3H3AA 2I1JA 3FAHA 2D2QA 4HDQA 1TKGA 2KXJA 1NI3A 3IT6B 1TYGB 4URKA 1N62A 2BXNA 3TDLA 2AQ3B 2KFJA 1QZEA 5IIUA 2LWPA 4A3OA 4RM8A 2D10A 1UWMA 3AE6B 4F5VA 5E6NA 1OFFA 3GZNI 2XW1A 1KLVA 4ANWA 3AE7B 1CK1A 3IXSA 4GDKB 3M63B 3VUYA 2WXJA 4KVGB 4FBJB 3PREA 2V4IB 4MBEC 1JMLA 4DHZB 4NNJB 2JYTA 1E10A 1E8YA 1V6EA 5LNK1 4K81A 1E78A 3A1QA 4EZLA 5KHQA 3U30A 3EHVA 2BXLA 5D2MB 3AXCA 1FXTB 1TXUA 2BKFA 4IW2A 1J7BA 4BOZB 2J52A 4MDKE 3NZ3A 4LLGM 4IWQA 4KV2A 3R7QA 1FFVA 1WXVA 5EE9A 2LXAA 1D4BA 3ZGZA 2K8BA 2YEPB 5H8YE 4KZ0A 2VRRB 2XSIA 2Z59B 2K39A 2M0XA 4G03A 4WJQA 1ZXHA 2QILA 1RYJA 1J0GA 1SEBD 3LU8A 2BKRB 5HI1A 2WDRB 2RD0A 1WGRA 2LZ6A 3DWMA 1FEHA 4ZCGA 5TSSA 5JHAA 1I42A 2W9NA 2Z0DB 4G01A 4G11A 1E90A 2BXBA 2BF8B 3OAWA 1BMLC 2NTSA 3NS1A 2ZNVB 3VTVA 5IA7A 3DBSA 3TCAA 4L1BA 1QOAA 2I1KA 3D32A 1QOFA 1QLBB 2PKOA 1RRBA 3M99C 4K7UA 1WSPA 4RF1A 2M19A 5BYSA 2CKHB 2M56B 4EFOA 2I2YA 1VD2A 2Y3AA 2WXLA 4MM3B 2IJ0A 2IGDA 1WIAA 1PQSA 2KHWB 4F8CB 4IW0A 4IW1A 1AYFA 3PZ8A 4MGKE 4JWSC 2KN5A 3PS6A 2C60A 4HK2A 5D3IB 5BMIA 2AX5A 1XCQL 2WQYB 4HPMB 2EKIA 2WXPA 3V6CB 2KLGA 1GPXA 2KTFA 2KK8A 5CHWA 4EZKA 2QSDA 4IM3A 3RCZA 4OVVA 2NBWB 3ZIMA 2KLCA 4JPSA 4WJNA 4J3OD 3O13A 3RPFC 4IM0A 3Q8BA 1WZ3A 2WXHA 3FILB 2KFKB 3DOWA 3H7PB 4ICUA 4KKJA 1TKEA 1L0YB 1K50A 1JWUD 2K8HA 1VRAB 1YN4A 3MHZA 3SDLC 3NVIA 2BWES 4BKSD 3LXFA 2NTTA 2K22A 1ZDXA 2NNWA 1C4CA 4EOYA 3K9PB 2O6VA 1L0VB 3OWEB 4W9KA 4ZDVA 4Z9OA 1SE9A 1EUVB 4BKTA 1JROA 1EWCA 4WAFA 1P9DU 2LRUA 2XVUA 4E74A 3KUZA 1WGYA 3A9KA 1IGCA 4L8UA 2HTME 5FUOA 3DVNV 1C4AA 5D3DA 5G55A 3W2DA 1E7HA 4TQ1A 4KIKB 1XCTL 3LU6A 3PLVA 2QJLA 2ZNVC 3AE9B 4M8NA 2CU3A 2RSUA 4DK5A 2DYBA 4J2VA 1I7HA 2MJ3A 3BYYB 2V4LA 2W54A 1K53A 5D94A 1SGHA 5J18A 2BXFA 3TEZA 1DGJA 3AI5A 2HTHA 2FAZA 1FIQA 3V3XA 2BYFA 4G50A 4LJOB 4A20A 2M8SA 2JUOA 2RGFA 3MTNB 2KMMA 3GOEA 4HCPB 2VUEA 2LGYA 2LASA 3BVGA 1PGAA 4ZUXV 1M94A 3PT2B 2CHZA 4P6VF 2EELA 2NVUI 1I4GA 2ROHA 4DXGA 2J42A 3WHSA 2IYDB 4MGZE 1WJUA 4YL8A 3LU7A 1FXIA 3VH3B 5JHBA 3LJ3A 2W3SA 2BW2A 2QHBA 4N6EB 3B1LX 2KJRA 2DYOA 2PVGC 1J7AA 1GB1A 1E8ZA 1WYGA 2KTRA 1ET9A 1MIWA 4CYEA 2HE7A 4TQ0A 3VH4B 3QHTA 4XX5A 2BGFA 1IJGA 1FXAA 2KC1A 3MP9A 2KDIA 2OOBB 5DCNA 2KWVB 2DZIA 3ZKJC 4OZAA 5EE0A 1F2RI 1D5XC 2ZW1A 4JQWC 1LFDA 4REZA 3NVWA 3G9KD 3R7RA 4ZRQA 3FWCC 2KX0A 1HEZE 4IWOA 2BB6A 1TZ1A 1BM0A 5CHFA 4WWNA 1F2RC 5G5GA 3LYYA 5G5HA 3P4PB 1WGGA 4D2KA 2G45B 4NJ6A 3WAMA 1HK3A 3DVNU 1TZOA 4DDGD 2DYMA 3PZDA 2GRIA 1OEYA 1SE3A 2HJ8A 4W9LA 3MHSD 4AQ7A 2EMSA 1E7EA 2BBCA 3L16A 4YTPB 1LOTA 2E0XA 2G4SA 1PYWD 4FIPB 1V2YA 4FK5B 1AARA 3A33B 4OZCA 2MP2B 4TUUA 3H8HA 3VFKA 3RULA 1LM8B 4CQNA 2B3AA 4MGIE 1PGXA 2BPSA 2EFEA 3KLSX 3VRBB 2KVRA 1E7PB 2XK5B 3SD5A 2IGHA 5IJ5A 1N5UA 2LHDA 4S1YA 3KYDD 3I57A 1Q5WB 4FLHA 5C2TB 1UORA 3S2AA 2CR5A 3QC8B 4Z69A 2HDEA 1I4RA 4RH6A 4NJ7A 2ZZPB 1HE8A 5H92C 5DQFA 3ALBA 1KLUD 2B76B 4GDLB 1MIVA 1JWBD 2L0FA 2JPHA 3W9CB 2M0AA 1J78A 4H2AA 1NENB 1TS2A 2NBVB 1MIYA 4MACA 3PRZA 2PIAA 4ZRKA 2WDVB 2KDMA 5C1ZA 4NZLB 1XLOA 4L9KA 2YEPF 3V09A 5LXIB 1DYQA 3ZRFA 1HK1A 4GN1A 3ZJVA 3ZJTA 4FULA 1I4XA 1CJEA 3GA9L 2MCNB 5L95C 2C7NB 3T3NA 4ARIA 3K9OB 2SEBD 1HA2A 2JXXA 1T0YA 5AUKA 3P1MA 1WR1A 3A1QB 4MSQB 4AWJA 1QQRA 1WGHA 3ML8A 1EO6A 4PYZA 3UI3A 1VDVA 3AECB 1V86A 3AEGB 3SIUB 2MBEA 3N9YC 4HCNB 2IZVB 4JLCA 4BBNC 1AWDA 4HJGE 4HROA 1CQVA 1XEEA 3N3KB 1XLQA 4OTUA 3NS8A 1JWSD 3ZQ4A 2PW9A 4MT5A 2BYEA 4A9AA 3W5UB 2KANA 2E3TA 3HIZA 4RGTA 4K71A 5BMGA 4EEWA 1IYFA 4F7ZA 2L3ZA 4C80A 3AE4B 2WYQA 2Z8LA 5JZEB 2KMAA 1IUEA 3U8ZA 4YTNB 5BMHA 2GI9A 3PGEA 2LJIA 5AZFA 3ONSA 3U7ZA 1YN5A 4FN2A 2XBBC 4WQMA 2BX8A 1UBIA 5IJEA 2OZBB 2IY1B 3PO0A 3QARA 1STEA 3ZUNA 2BYVE 3AEBB 1H9ZA 1WXQA 2L8JA 3NMUA 2BXGA 1WJNA 2N9PC 1NI2A 3GP7A 3FWBC 1BKEA 5CX3A 1L0XB 4XZ4A 4W9DA 2FCQA 2L1AA 3B2GA 1FCLA 2BTEA 1V5OA 5GINA 2K25A 1P7EA 3H7SA 1YIWA 4XWWA 3H37A 4HEA1 1TJEA 2O6VD 3GS2A 2INNE 3ICXA 2V36A 1V9JA 4YT0B 4B6WA 2ZVOA 4CHKA 1XLNA 4AUQC 2Z0EB 1BJ5A 5TR5A 1JCKB 1A5RA 5AZGA 1V80A 4ICVA 1E7FA 2QMCA 1K52A 1JWMD 2LRWA 3ZRCA 1WI0A 2JY6A 1WE6A 3KUCB 2RPQA 1ET6A 3T9LA 3B9LA 4FHKA 2AL6A 4KZCA 3DBRI 3WAOA 4FJZA 2DWQA 1HQRD 4RCOA 3HUIA 1KLGD 3IAS1 3JSVB 1PUTA 1GC6A 1E6EB 4W9FA 2O6VB 1MPEA 1QILA 2E6XA 4WQOB 2CJOA 4LUFA 3JQZA 3ETRA 4IM2A 3W1YA 2N1VA 3KWLA 3A9KB 2L76A 3AE8B 3SR6A 1FD6A 1FNWA 1ACCA 4EZJA 4GG2A 2MA9B 3KH0A 3AV8A 3T8MA 2XEWA 3ZNZB 2AEHA 4OVUA 3R66C 2FNJB 5DPWA 2MW5A 1EU4A 4OT2A 4I6PA 1QOBA 1TBEA 1PDXA 3R3MA 1WRIA 4RGOS 4N0FD 2MJEA 1J7CA 2EMTA 1ESFA 4ZBQA 2PJHA 3Q69A 2GBMA 1IBXA 5I4DA 4AJYB 2CU1A 3QQ8B 1L2NA 2PMVA 3RD2A 1WYWB 3APDA 2WX1A 1NDDA 2J0KA 5FR3A 1AN8A 4ZBKA 4GLSC 2KJHB 1WM3A 3CSFA 3H1UA 4LCDE 3ML9A 2Q5WD 1LXDA 4WAAA 3WALA 2KWCA 4LK0M 1SE2A 2EFHA 4KGSA 1V5TA 2OJRA 4BOSC 3IHPC 2WU2B 1WY8A 2WDTB 4FJVB 4AS1A 1JALA 3ECIA 4E3CA 2LD9A 1Q1OA 2K6QA 1UGJA 1FCCC 4ANUA 1RAXA 1NBFC 1N63A 5EE3A 2LGXA 3BY4B 4JX1C 2N9KA 1XT9B 4BBNF 1HK4A 1WX7A 5C3JB 1UUPA 3VR9B 1GNJA 4FJYA 3UINB 5HG2A 2JXTA 4WJOA 2KTRB 3C8YA 2KAJA 4JK4A 4P7IA 1KRHA 5BPKA 1KOTA 1E8XA 2D11A 2MX2A 3AN1A 1E5WA 4WIPA 3JSVA 1H4RA 2KWDA 3BK2A 2JSVX 4MELA 3VTUA 2LVOA 3CSTA 4NJCA 2JRHA 2MEKA 1KFYB 2BXQA 3ZJUA 2GB1A 2XVWA 3DDCB 2ON8A 4NAMA 1TTNA 1I4HA 2JVCA 1QOGA 1J19A 1YQ4B 2MBOA 1B9RA 2DBUA 1F0ZA 1D5MC 1JNBA 1F9JA 2DAJA 4W9GA 3V05A 3P42A 2LVPA 4US8A 2AJEA 5JH5C 3UQBA 2XW0A 2WXNA 4RF0A 1E7UA 2JX5A 4GB9A 4A55A 4PYUA 3WAPA 4NQLB 2K1FA 3PHWB 3EC8A 1TS4A 5AZHA 3FC4A 1JRUA 5GIOA 2L32A 3OJ4B 3A75A 2OHFA 3UGBB 2ZW0A 3NVKA 4ZYNA 4K7SA 3DVGY 1U4AA 4JWUC 1WXAA 1N5XA 1F77A 2A5UA 3BIID 1EF5A 1WZ0A 3M62B 5FKAC 5EDSA 3FNMA 1VJKA 4ZRJA 3HRDD 1ZE3D 2J53A 2CS4A 4K1RB 1R4MI 2V0GA 1WR6E 2DLBA 2MQJA 1ZKHA 3HHMA 1HZ6A 2ONQA 2R2QA 3NZUA 1V8CA 3AE2B 3VHTC 4HVBA 1TGZB 3SIVB 2GBJA 4B9KA 5CHVC 1MHXA 3IT4B 4IUMB 1QT9A 1V1PA 1R7SA 4N59A 4EUTA 2W3RA 3DVGX 4ZHPA 1OQRA 3QWZB 2EFDA 1ZDVA 3AU4A 1D6EC 2K0PA 4PS3A 2KMCA 3VXWA 1MVKA 3TIXA 3IFWB 4NPNA 1CZPA 1E8WA 2FUHB 4F5TA 2N4FA 1HXYD 2JRIB 1OEYJ 1WGKA 1P1AA 1WJ6A 3I3TB 1EM7A 2INPE 1FFUA 4ZYSA 4C7ZA 2I38A 3DBLI 1XO3A 1JRPA 3KJLA 3ZW3A 1M4VA 4BVUC 3PTFC 2KD0A 1FRDA 1ZPSA 3NRZA 4M8MA 5FR6A 3UQAA 2KQ4X 3AEFB 1E9MA 4F5UA 4HRSA 3HK0A 1Z5SB 2H88B 3RFZB 4KDIC 4CO7A 1WJ4A 1GUAB 4YSZB 4FHJA 3L13A 4B95A 1SF0A 2NQOA 4LA0A 2IO1B 1V81A 1VZ7A 3SHQA 3IVFA 3WHQA 2MJDA 2FIDA 1Y56A 4C31B 4XWTA 4KGTA 1MA9A 4MH0E 3APCA 2DBXA 2WXKA 3WIMA 2Y5CA 4LUHA 2KX3A 2J4XA 2KWUB 1XQQA 2LFIA 2IDYA 3RYTA 2MBQA 3L54A 3ZLZA 3ZTCA 1YN3A 2YDFA 1T3QA 3V03A 2MBHA 4L23A 2KACA 3U2SC 2FCSA 2M17A 3DQVA 2PTLA 3V62A 1GG3A 3NHEB 2UWQA 3QA8A 1ZP0B 4IKGA 1JQ4A 1QKZA 2EFCA 3MHSB 4BFRA 1XXGA 2WP9B 1BUIC 5LLIA 4USAA 1EWYC 1UZXB 2O2VA 5IJFA 1HK2A 5DPTA 3PRMB 1E7AA 1WE7A 2JZZA 2FE8A 2DBWA 2FCNA 2PEAA 5AEKB 2IPKD 1E7CA 3PLUA 4M0WB 3TEXA 1CMXB 2Z8KA 3KVFB 5L83A 1KTKA 4DQOC 4YXDB 3JRYA 1DOIA 2W55A 3RZFA 3CF6E 1FRRA 2K5PA 1GNUA 1AO6A 4LJPB 2LEKA 1QF6A 3Q8CA 4GIVA 2NCNA 2KQ7A 4HPLB 3L4PA 4KSLC 1SIJA 2WXOA 4C7YA 4OHJA 2BXCA 2Z8JA 4LB9A 2N0SB 3X23A 4EKUA 2BXOA 4Q2JA 1C78A 3L10B 1KXPD 2FUG1 1C77A 2JT4B 2E0YA 2WXFA 1N60A 2QM6A 2V3NA 3VUWA 1T5XD 5G2NA 3AEDB 3A4RA 4XE0A 1SXTA 1WRDB 1TF0A 4W9CA 1TS3A 2MBBB 3SQJA 2V1YA 2KBZA 2KN4A 4FXCA 2NPTB 2L00B 2BXEA 4W9IA 4US9A 4P16A 1P3QU 4G0NB 1P98A 4KDLB 4MSMB 1NEKB 2JZPA 3VQIA 4DHXB 1YMHE 2BXDA 2L52A 1WX8A 4NAWA 2W82A 4UDUC 1GNIA 2C9WB 1WWTA 3ZO5B 2K3UA 3U7DA 1TS5A 5FK9C 1UNSA 2PPHA 3NVYA 1UD7A 2EKEC 3DWGC 1MI0A 4DXFA 5IIXA 1SBBB 4KX6B 4W9HA 2L05A 4TV3A 1WMHA 3E9SA 1L6UA 3W1SC 3N32A 2GBNA 4GDXA 4KSKC 1KM7A 2BWFA 3P2BA 1IBXB 3PSEB 1UWXA 3TUOA 3W1SA 3WHRA 1L4DB 1SE4A 2GOWA 3V6EB 4RGMA 2HD5B 2H89B 3SFDB 3BINA 1IPGA 2D5GA 4MEMA 4B0EA 2A4ZA 4FJCB 3VVWB 1EU3A 1WXSA 4L9QA 4WH4A 3OLMD 2JUHA 1T6BX 4F5SA 2Y5BB 5LXHA 4ITKA 3NZSA 3VDZA 1I35A 2GBRA 2LUMA 3M3JA 1PFDA 3W5VB 2ZVNA 3JW0X 3WA0A 2ZPYA 3R2TA 4M0WA 1VFIA 2WS3B 2DZJA 1LQBA 4PT5A 4WWPA 3EA6A 5HOZA 1VZ8A 4IG7B 2DHZA 4DWFA 2DZKA 1Q10A 4RMAA 3NUHB 2N9LA 4N58A 3TL5A 4IC7B 4ANXA 2XNAC 2MRPA 1YD8U 4DHZE 2SAKA 2J7QB 4HDOA 4JL9A 4W9JA 4XDDA 2AQ1B 4HLEA 2LI5A 1A70A 1C76A 4A6QA 4ZBRA 3EUB2 2PVOD 4KGRA 5E6JA 5C23A 3J9CA 2OT3A 4C56C 5D6JB 2WXGA 1WGDA 1RLFA 2WWZA 2LJ5A 2IO2B 1ISNA 3N30A 1XF5L 1UELA 4WWOA 2WXRA 3LB8C 4ZOHC 4N9F4 2BS4B 2J0MA 3JVZX 2AQ2B 3QCAA 1WH3A 2MH7A 3HVDA 3UIOB 5ID7A 4OTTA 1Q0WB 2NPTA 3RUIB 1XLPA 4RFBA 2KDBA 3UF8A 5AUIA 1WF9A 1PGBA 4DBGA 2REXA 4JGHB 1DOXA 3ZDMC 1OQQA 3P4QB 2V3SA 4GXBA 3ZVVA 5E6PA 3SU8X 1L7YA 1NYQA 2L0TA 1JW9D 2M1MA 4MJSA 2AL3A 2AYOB 2ZCCA 1KF6B 4YTMB 4RNAA 2LOQA 2BYTA 3ZTDA 2NBUA 1VLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1F A;  3L16 A;  5D7G A;  2NS5 A;  3KYC D;  2G4S A;  3PHW B;  3EC8 A;  3EEC A;  3H9D A;  1V2Y A;  5AZH A;  3ZNI D;  1AAR A;  3A33 B;  2KOX A;  2MP2 B;  4TUU A;  4WJP A;  3VFK A;  2MP2 A;  4E71 A;  1RFA A;  3RUL A;  3EFU A;  1LM8 B;  4ANV A;  2DEN B;  2B3A A;  4MGI E;  1JRU A;  2ZEQ A;  3A9J B;  1UGM A;  1WFY A;  2BPS A;  5CTR C;  3V61 A;  2KVR A;  3UIP B;  2UYZ B;  3A9J A;  3OJ4 B;  2XK5 B;  3SD5 A;  3PVL A;  1ZW7 A;  3NOB A;  2XK5 A;  4GMV A;  3UGB B;  4ZYN A;  4I6L B;  2LXC A;  3KYD D;  4K7S A;  3DVG Y;  3DPD A;  1U4A A;  2KKC A;  1WXA A;  1Q5W B;  4FLH A;  4J6I A;  2A5U A;  1EF5 A;  1WZ0 A;  2CR5 A;  2N9X A;  3QC8 B;  3S2A A;  3M62 B;  5EDS A;  2MSE D;  4DDI D;  4NJ7 A;  4ZRJ A;  2ZZP B;  1E7V A;  1HE8 A;  2CS4 A;  3ALB A;  3NY5 A;  5J17 A;  4K1R B;  1R4M I;  4GDL B;  1WR6 E;  4AOF A;  3PV1 A;  4GDL A;  2MQJ A;  1G6J A;  5HKH A;  1ZKH A;  3VUX A;  3HHM A;  2R2Q A;  1X1M A;  2L0F A;  2JPH A;  2FIF A;  3NZU A;  4TKN A;  4DHJ D;  2N1W A;  2ZJD A;  1C3T A;  3QIJ A;  3VHT C;  4HVB A;  2I1J A;  2D2Q A;  1TGZ B;  4HDQ A;  2GBJ A;  4B9K A;  2KXJ A;  5CHV C;  2NBV B;  4IUM B;  4URK A;  3B08 A;  3PRZ A;  4ZRK A;  2YLM A;  2ZPN A;  2KFJ A;  4EUT A;  1QZE A;  5C1Z A;  2LWP A;  2C7M B;  3DVG X;  3Q3J A;  3QWZ B;  4BKG A;  4A3O A;  4RM8 A;  5LXI B;  3L08 A;  2D10 A;  3AU4 A;  3ZRF A;  4GN1 A;  4PS3 A;  5E6N A;  2KMC A;  4FUL A;  3GZN I;  3VXW A;  3TIX A;  3IFW B;  4NPN A;  3B0A A;  2MCN B;  5L95 C;  1KLV A;  4ANW A;  1E8W A;  2C7N B;  2FUH B;  2N4F A;  2JRI B;  1OEY J;  1H8C A;  1KJT A;  4GDK B;  3K9O B;  3M63 B;  4AP4 C;  1P1A A;  3VUY A;  1MG8 A;  2KNB A;  4GDK A;  4KVG B;  4NQK E;  2K6D B;  1WJ6 A;  1SIF A;  4FBJ B;  4X57 B;  3PRE A;  2JXX A;  3I3T B;  4DHJ B;  1T0Y A;  3ZTD A;  4NNJ B;  4DHZ B;  1E8Y A;  1V6E A;  1WR1 A;  3A1Q B;  4PS7 A;  4MSQ B;  4K81 A;  4MGY E;  4AWJ A;  1WGH A;  3A1Q A;  3ML8 A;  1EO6 A;  4PYZ A;  4EZL A;  5KHQ A;  2IBI B;  3DBL I;  2MWS B;  3EHV A;  4GOC A;  3U30 A;  5D2M B;  3ZW3 A;  1V86 A;  3AXC A;  1YX5 B;  1OGW A;  1FXT B;  2MBE A;  4BVU C;  3PTF C;  5BO4 B;  1ZGU B;  2KD0 A;  4A3P A;  4GU2 A;  3ZNG C;  2BKF A;  4HCN B;  4M8M A;  5FR6 A;  1OTR B;  2IZV B;  2YVC A;  4BOZ B;  3UQA A;  4FAD A;  1K8R B;  4JLC A;  4BBN C;  4MDK E;  3HK0 A;  4PS8 A;  1Z5S B;  4IWQ A;  4KV2 A;  3R7Q A;  3N3K B;  3M95 A;  4KDI C;  4CO7 A;  1WXV A;  1WJ4 A;  2LXA A;  1GUA B;  3NS8 A;  2PE9 A;  4FHJ A;  2K8B A;  3L13 A;  4B95 A;  3TJP A;  2IO1 B;  2BYE A;  2JWZ A;  3QAQ A;  4KZ0 A;  2VRR B;  1V81 A;  2Z59 B;  2KAN A;  2K39 A;  2M0X A;  3HIZ A;  3SHQ A;  4WJQ A;  1GJZ A;  3IVF A;  2FID A;  4EEW A;  1IYF A;  1J0G A;  1UH6 A;  4F7Z A;  2BKR B;  2L3Z A;  2RD0 A;  1WGR A;  2GBK A;  2LZ6 A;  2WYQ A;  3JYU A;  3PRP B;  3APC A;  4MH0 E;  4IWP A;  3WIM A;  5JHA A;  5JZE B;  2KX3 A;  2KMA A;  1I42 A;  2W9N A;  2J0J A;  2KWU B;  1XQQ A;  2JZ3 B;  2Z0D B;  4G11 A;  1Z2M A;  3U8Z A;  1E90 A;  1BT0 A;  3PGE A;  2BF8 B;  3OAW A;  3ONS A;  5AZF A;  2MBQ A;  3RYT A;  3L54 A;  3ZLZ A;  3ZTC A;  4FN2 A;  2XBB C;  2ZNV B;  1YX6 B;  3RZW C;  3VTV A;  3VAW A;  2MBH A;  5GMV A;  5IA7 A;  1UBI A;  3DBS A;  3TCA A;  2ASQ A;  2I1K A;  2IY1 B;  2FCS A;  2M17 A;  3D32 A;  2KQS A;  3IBE A;  1RRB A;  3DQV A;  4K7U A;  1R4N I;  3V62 A;  3QAR A;  4XC2 A;  3ZUN A;  1GG3 A;  3NHE B;  2CKH B;  2BYV E;  2IY0 B;  4EFO A;  3HM6 X;  2UWQ A;  3QA8 A;  2JF5 A;  1VD2 A;  1V49 A;  2L8J A;  1WJN A;  2N9P C;  2IO0 B;  4MM3 A;  4BFR A;  1WIA A;  1PQS A;  2KHW B;  3LDZ E;  5LLI A;  1NI2 A;  2O2V B;  4GSW A;  4F8C B;  4IW0 A;  2DZM A;  2MLB A;  1UZX B;  2O2V A;  5CX3 A;  1WM2 A;  4MGK E;  4XZ4 A;  2KN5 A;  3PS6 A;  4W9D A;  2C60 A;  2FCQ A;  4HK2 A;  5DPT A;  3PRM B;  1WE7 A;  2JZZ A;  1YQB A;  2FCN A;  2PEA A;  5AEK B;  2M4N A;  1V5O A;  2FCM A;  4HPM B;  4NY0 A;  2K25 A;  3H7S A;  1YIW A;  3PLU A;  3ZNH B;  2CHW A;  2N7E A;  4M0W B;  2O6V D;  2KLG A;  3V6C B;  2LUE A;  2KTF A;  1CMX B;  2KK8 A;  5CHW A;  4EZK A;  2LGD A;  3KVF B;  5L83 A;  4IM3 A;  3RCZ A;  4OVV A;  2NBW B;  1Y8R C;  3TBL D;  2KLC A;  3ZIM A;  2KJ6 A;  1V9J A;  4B6W A;  4WJN A;  3RZF A;  2ZVO A;  4AJW A;  3CF6 E;  4CHK A;  2DAF A;  4AUQ C;  2GMI C;  4IM0 A;  1GNU A;  2Z0E B;  5TR5 A;  1WZ3 A;  1WX9 A;  2QHO A;  2C5L C;  4LJP B;  1A5R A;  2KFK B;  4GIV A;  3DOW A;  1V80 A;  5AZG A;  2KFK A;  4ICV A;  3C0R B;  2NCN A;  2KQ7 A;  3H7P B;  4HPL B;  4KSL C;  3H7P A;  3QK0 A;  4ICU A;  2LRW A;  3ZRC A;  2K8H A;  3HM3 A;  1WI0 A;  3X23 A;  2JY6 A;  1WE6 A;  4EKU A;  3KUC B;  2RPQ A;  3L10 B;  3SDL C;  4FHK A;  2AL6 A;  2BWE S;  4KZC A;  3DBR I;  3T9L A;  3WAO A;  4FJZ A;  3X0W A;  4BKS D;  3JSV B;  2IO3 B;  2JT4 B;  3ENE A;  2KDE B;  2NR2 A;  1GC6 A;  3VUW A;  4EOY A;  3DCG A;  5G2N A;  3K9P B;  4W9F A;  2O6V B;  3PHX B;  3H6N A;  4II2 B;  2AWT A;  3A4R A;  4JIO U;  1WRD B;  2O6V A;  4W9C A;  4F1S A;  4WQO B;  4W9K A;  2C7H A;  1P0R A;  4ZDV A;  2MBB B;  1SE9 A;  3QX1 A;  1EUV B;  2V1Y A;  4IM2 A;  1YJ1 A;  4BKT A;  2NPT B;  3W1Y A;  1GC7 A;  2N1V A;  4II3 B;  2L00 B;  3DBH I;  1P9D U;  4W9I A;  2R2O A;  3A9K B;  2LRU A;  1P3Q U;  3AU5 A;  4G0N B;  1P98 A;  2L76 A;  1WGY A;  3A9K A;  3KUZ A;  4I6N B;  4KDL B;  4MSM B;  4ZRI A;  2KO3 A;  3VQI A;  4EZJ A;  4NAW B;  1WX8 A;  4K7W A;  3APF A;  3DVN V;  4NAW A;  2MA9 B;  3KH0 A;  2C9W B;  2KDF B;  5G55 A;  3T8M A;  2XEW A;  3ZO5 B;  5E6O A;  4TQ1 A;  4KIK B;  3ZNZ B;  5DPS A;  2AEH A;  4OVU A;  3IG3 A;  3R66 C;  3U7D A;  4KIK A;  3L0W B;  2FNJ B;  2PPH A;  3PLV A;  5DPW A;  2MW5 A;  1UD7 A;  4I6P A;  2ZNV C;  1TBE A;  2EKE C;  2WX0 A;  3PPA A;  3R3M A;  4M8N A;  2D07 B;  1WMH B;  4W9H A;  4BKS A;  2L05 A;  4TV3 A;  2DX5 B;  1WMH A;  1C1Y B;  2RSU A;  3AUL A;  2EMT A;  4DK5 A;  3W1S C;  2DYB A;  3N32 A;  2GBN A;  4E74 A;  4KSK C;  1KM7 A;  3QJZ A;  2BWF A;  2V4L A;  3P2B A;  2PJH A;  2GBM A;  3PSE B;  5D94 A;  2ZCB A;  1SGH A;  5J18 A;  4AJY B;  3W1S A;  2CU1 A;  3QQ8 B;  2GOW A;  3V6E B;  1L2N A;  3V60 A;  3RD2 A;  2HD5 B;  1WYW B;  5DPR A;  3RT3 B;  3APD A;  3BIN A;  1IPG A;  2WX1 A;  1NDD A;  3AI5 A;  2J0K A;  4RM9 A;  2HTH A;  3TMP B;  3KW5 B;  2CHX A;  3O65 B;  4MEM A;  2PE6 B;  2FAZ A;  2A4Z A;  4HWI B;  2KJH B;  3VVW B;  1WM3 A;  3CSF A;  3H1U A;  3OJ3 A;  1WXS A;  2BYF A;  4G50 A;  4LJO B;  4A20 A;  2M8S A;  2JUO A;  2RGF A;  3OLM D;  3MTN B;  4LCD E;  2LVQ A;  4LDT D;  3ML9 A;  1S1Q B;  3GOE A;  4HCP B;  2Y5B B;  5LXH A;  4W9E A;  1LXD A;  2LGY A;  2LAS A;  3NZS A;  3VDZ A;  1I35 A;  4WAA A;  2GBR A;  3WAL A;  2KWC A;  1M94 A;  3PT2 B;  3M3J A;  5KHO A;  1V5T A;  2OJR A;  2CHZ A;  4BOS C;  2ZVN A;  3JW0 X;  4ASW C;  3WA0 A;  3IHP C;  2NVU I;  1VCB A;  2ZPY A;  4W9L A;  1WY8 A;  1XD3 B;  2WDT B;  4FJV B;  2DZJ A;  4FA6 A;  1D3Z A;  1LQB A;  4WWP A;  3ECI A;  3MJW A;  2LD9 A;  4E3C A;  1J8C A;  1Q1O A;  4IG7 B;  2K6Q A;  2IYD B;  1IP9 A;  2L7R A;  1WJU A;  4MGZ E;  4ANU A;  1RAX A;  4YL8 A;  1NBF C;  1EF1 A;  2DHZ A;  3VH3 B;  5JHB A;  4DWF A;  2DZK A;  2LGX A;  3BY4 B;  3LJ3 A;  4RMA A;  2N7D A;  5IAA C;  3TL5 A;  4IC7 B;  1XT9 B;  4BBN F;  3WAN A;  4ANX A;  2MRP A;  1WX7 A;  1YD8 U;  3B1L X;  3A4S C;  3UIN B;  4FJY A;  2KJR A;  3L17 A;  4DHZ E;  2DYO A;  2J7Q B;  4WJO A;  4HDO A;  1OQY A;  4JL9 A;  3CMM B;  2KTR B;  4W9J A;  1E8Z A;  2KTR A;  4HLE A;  2LI5 A;  4P7I A;  2KZR A;  4GGQ A;  4CYE A;  4LDT B;  1KOT A;  2HE7 A;  1E8X A;  4TQ0 A;  2D11 A;  2MX2 A;  1E5W A;  3VH4 B;  5C23 A;  3JSV A;  1H4R A;  3QHT A;  4XX5 A;  2BGF A;  5D6J B;  3Q3F A;  2KC1 A;  1WGD A;  4MEL A;  2KDI A;  3VTU A;  2LVO A;  3CST A;  1RLF A;  2OOB B;  5DCN A;  1UBQ A;  2WWZ A;  2LJ5 A;  2IO2 B;  1ISN A;  3N30 A;  2JRH A;  2KWV B;  2DZI A;  1WXM A;  2G4D B;  1UEL A;  4WWO A;  3ZKJ C;  1S3S G;  3ZDT A;  4DXA B;  4N9F 4;  5J2R A;  2J0M A;  3JVZ X;  3QCA A;  1WH3 A;  3DDC B;  1LFD A;  4JQW C;  3UIO B;  3VTW A;  1TTN A;  2JVC A;  1Q0W B;  3R7R A;  2NPT A;  3RUI B;  2KDB A;  2RR9 A;  3UF8 A;  1WF9 A;  4G3X B;  4DBG A;  1J19 A;  4HJK A;  2G3Q B;  2KX0 A;  2REX A;  2MBO A;  4HXD A;  4JGH B;  3ZDM C;  4IWO A;  1F9J A;  2DAJ A;  4W9G A;  1TZ1 A;  2K8C A;  2V3S A;  5CHF A;  4GXB A;  3ZVV A;  5E6P A;  3SU8 X;  1L7Y A;  2D3G A;  2LVP A;  2N9E B;  4WWN A;  2L0T A;  4MJS B;  1WGG A;  5JH5 C;  2KC2 A;  3UQB A;  2M1M A;  4MJS A;  2AL3 A;  2AYO B;  2ZCC A;  1E7U A;  2G45 B;  3KUD B;  4NJ6 A;  4GB9 A;  3WAM A;  3DVN U;  4PYU A;  4DDG D;  2DYM A;  3PZD A;  3WAP A;  1OEY A;  2HJ8 A;  3MHS D;  2NBU A;  4NQL B;  2EMS A; 
#chains in the Genus database with same CATH topology
 2R61 A;  2BXK A;  5D7G A;  2NS5 A;  3EEC A;  4N0U D;  5T8I A;  4E71 A;  4TMA B;  4ANV A;  2DEN B;  4KKI A;  1UGM A;  1WFY A;  5CTR C;  3UIP B;  3A9J A;  2XVV A;  2DG5 A;  2WXM A;  4GMV A;  3Q14 C;  3B9M A;  2KKC A;  4J6I A;  2RPV A;  1L4Z B;  3AEE B;  5MPO A;  1B1Z A;  1TKY A;  2MSE D;  4DDI D;  2CKX A;  2TSS A;  3RNA C;  2RDH A;  4N3Z A;  3PV1 A;  2WLB A;  1G6J A;  1FM0 D;  5HKH A;  2VDB A;  2JQR B;  4DHJ D;  4TKN A;  2ZJD A;  3NVM A;  1SB3 C;  3RNF C;  1GAQ B;  4R3D A;  3VR8 B;  2QIE B;  4XDC A;  2Z8I A;  1V1P B;  1VZS A;  1R4N B;  3B08 A;  2OJW A;  3ABV B;  2YLM A;  2ZPN A;  4WUR A;  3WCQ A;  4E99 A;  4LTU A;  2C7M B;  5BYR A;  3Q3J A;  1KH0 A;  4BKG A;  3L08 A;  3KWV A;  3GE8 C;  1RFK A;  2RDG A;  3IAM 1;  2KWF A;  3B0A A;  4ARC A;  3AM9 A;  1H8C A;  1KJT A;  5B5T A;  4AP4 C;  1MG8 A;  2LXS A;  2KNB A;  4GDK A;  3TSS A;  4NQK E;  2K6D B;  1SIF A;  4MH8 A;  4X57 B;  4DHJ B;  1I4P A;  5GXG B;  1HTO A;  1N6Z A;  4PS7 A;  4BY9 C;  3Q8F A;  1UF0 A;  4MGY E;  2G1E A;  2IBI B;  2MWS B;  4GOC A;  4BAX A;  3B2F A;  1YX5 B;  3GQU A;  1E7B A;  1OGW A;  3I9V 1;  5HHD G;  5BO4 B;  1ZGU B;  4A3P A;  4GU2 A;  3ZNG C;  1P7F A;  1OTR B;  2YVC A;  4FAD A;  1K8R B;  1FNV A;  4PS8 A;  4ZRP A;  3M95 A;  2PE9 A;  1FOU A;  3PLA A;  3TJP A;  2CJN A;  3CIR B;  3V08 A;  2JWZ A;  3QAQ A;  4YSX B;  3AEA B;  3ZYY X;  2V3P A;  3BZD B;  3UIV A;  3N1Z C;  1GJZ A;  1ENF A;  2WDQ B;  1UH6 A;  1LO5 D;  1C4P A;  3B9J A;  2GBK A;  1AW7 A;  1TY2 A;  3JYU A;  3PRP B;  1IGD A;  2XVQ A;  4IWP A;  1DOY A;  2WU5 B;  2J0J A;  2JZ3 B;  1Z2M A;  3HVZ A;  1BT0 A;  3DBH B;  2GLS A;  1YX6 B;  3RZW C;  3AB5 A;  3VAW A;  5GMV A;  3MC0 B;  2ASQ A;  4YSY B;  4EMX A;  1GB4 A;  3AE1 B;  2KQS A;  3BYT B;  1E7I A;  3EGR A;  3IBE A;  1R4N I;  4BKE A;  1VR9 A;  4XC2 A;  2VH2 A;  2IY0 B;  2L83 A;  3HM6 X;  2JF5 A;  1V49 A;  2IO0 B;  4MM3 A;  4RGN A;  3T3O A;  3LDZ E;  3RNG C;  5BYQ A;  2O2V B;  4GSW A;  5HFY A;  2DZM A;  2MLB A;  4OVZ A;  1JWA D;  1WM2 A;  4QAY A;  3Q8E A;  3NVV A;  4K2C A;  2WXQ A;  4O1N A;  3R8B A;  2BB5 A;  1YQB A;  4ZC6 A;  2M4N A;  3P4R B;  2FCM A;  4NY0 A;  1MHH E;  3ZNH B;  2ACZ B;  2CHW A;  2N7E A;  3A73 A;  4IOI E;  2LUE A;  4W4U B;  2LGD A;  2FBW B;  1SJE D;  2QEJ C;  1Y8R C;  3TBL D;  2IGG A;  2KJ6 A;  4AJW A;  1ZUD 2;  2DAF A;  2GMI C;  1WX9 A;  2QHO A;  2C5L C;  3Q2A C;  3FIL A;  2KFK A;  3C0R B;  5DBY A;  3H7P A;  3QK0 A;  4HKQ A;  3P4S B;  1VZ6 A;  3HM3 A;  5IKC M;  4P1B C;  4OR0 A;  1V97 A;  3X0W A;  2K9X A;  2IO3 B;  3ENE A;  2KDE B;  2NR2 A;  5EE1 A;  3VRA B;  4WA6 B;  3DCG A;  3NVZ A;  3PHX B;  3H6N A;  4II2 B;  2AWT A;  4JIO U;  4F1S A;  2C7H A;  1P0R A;  3QX1 A;  1YJ1 A;  3Q8A A;  1GC7 A;  4II3 B;  1T0Q C;  3DBH I;  1O9X A;  2R2O A;  4A90 A;  2X38 A;  3AU5 A;  3TEY A;  4I6N B;  4ZRI A;  2KO3 A;  1SSN A;  1K51 A;  3Q3N C;  4NAW B;  4K7W A;  3APF A;  2KDF B;  4OZB A;  5E6O A;  3GB1 A;  5DPS A;  3IG3 A;  4KIK A;  3L0W B;  3CWI A;  2WX0 A;  3PPA A;  2D07 B;  1WMH B;  3KQ4 A;  2MHJ A;  4BKS A;  2DX5 B;  1C1Y B;  3AUL A;  3PZ7 A;  3QJZ A;  2BVC A;  2XMO A;  2ZCB A;  3U52 E;  3SEB A;  1HA5 A;  3V60 A;  1E0Z A;  5DPR A;  3RT3 B;  1I4Q A;  3E56 A;  2JWU A;  4RM9 A;  3TMP B;  3KW5 B;  2CHX A;  3O65 B;  5GIP A;  2PE6 B;  3MFG A;  1NVI D;  1NT2 B;  4HKZ E;  2ICI A;  2VZK D;  4HWI B;  3OJ3 A;  3KIK A;  3BVZ A;  2BXP A;  2LHE A;  4A8X C;  2LVQ A;  4LDT D;  3MJ5 A;  1FMA D;  1S1Q B;  3R2I A;  1RM6 C;  3U4E G;  4W9E A;  1BXT A;  2QMT A;  1V1O A;  1SB0 A;  5KHO A;  4JE3 B;  5IIH A;  4ASW C;  1VCB A;  1XD3 B;  3AE3 B;  1D3Z A;  4FA6 A;  2GUT A;  3MJW A;  2BXA A;  2DBY A;  1J8C A;  4HGK A;  2L7R A;  1IP9 A;  4B0M A;  2XN9 C;  1EF1 A;  2QC8 A;  1FO4 A;  2JYE A;  2N7D A;  5IAA C;  2LMC A;  3WAN A;  1SJH D;  2BXM A;  3A4S C;  3L17 A;  1OQY A;  3CMM B;  2VZK B;  1FNU A;  1E7G A;  1YJJ A;  1L5P A;  2KZR A;  4GGQ A;  2LGI A;  2VUF A;  4LDT B;  2BS2 B;  4G04 A;  3Q3F A;  1UBQ A;  1WXM A;  2G4D B;  1N61 A;  1YQ3 B;  1S3S G;  3ZDT A;  4DXA B;  2BS3 B;  5J2R A;  3BK1 A;  3AMZ A;  3VTW A;  1TY0 A;  4YWG G;  2RR9 A;  2BT6 A;  2DNF A;  4G3X B;  2BXH A;  3GZN B;  4HJK A;  2G3Q B;  1ZXI A;  4HXD A;  4WWM A;  2K8C A;  4HGM B;  1C9F A;  2D3G A;  2N9E B;  4ZHO A;  1KW2 A;  4IDI A;  1MM8 A;  4MJS B;  2KC2 A;  2BXI A;  2Y5P A;  3KUD B;  5JXV A;  4EE2 A;  3BWU D;  3CX9 A;  3AH7 A;  1YJI A;  3KYC D;  3I63 C;  1N5W A;  3H9D A;  1ZOY B;  3ZNI D;  5IFO A;  4M70 B;  2I2Z A;  2KOX A;  3Q3M C;  2WXI A;  4L2Y A;  4WJP A;  2MP2 A;  1RFA A;  3EFU A;  4LB2 A;  1J7E A;  2ZEQ A;  3A9J B;  3V61 A;  5GHK A;  3GQX A;  3MHH B;  2UYZ B;  1RWS A;  1ROE A;  3PVL A;  1ZW7 A;  3NOB A;  3SFE B;  2XK5 A;  3P63 A;  2PLP A;  4I6L B;  4OW0 A;  2LXC A;  3AE5 B;  1D5Z C;  3DPD A;  4TSS A;  1LNS A;  5ID9 A;  2N9X A;  2WNM A;  2NMQ A;  2RMM A;  1NYR A;  4PO0 A;  1YNT E;  1E7V A;  2JU6 X;  2OED A;  1C79 A;  3NY5 A;  5J17 A;  4AOF A;  1H5W A;  1HK5 A;  4GDL A;  2N7J A;  2G9H D;  3VUX A;  1HZ5 A;  2I30 A;  3TEW A;  1X1M A;  2FIF A;  1GOZ A;  2N1W A;  3BVM A;  1C3T A;  3QIJ A;  3URY A;  1L6V A;  3H3A A;  2I1J A;  3FAH A;  2D2Q A;  4HDQ A;  1TKG A;  2KXJ A;  1NI3 A;  3IT6 B;  1TYG B;  1N62 A;  4URK A;  2BXN A;  3TDL A;  2AQ3 B;  2KFJ A;  1QZE A;  5IIU A;  2LWP A;  1F1H A;  4A3O A;  4RM8 A;  2D10 A;  1UWM A;  3AE6 B;  4F5V A;  4LNF A;  5E6N A;  1OFF A;  3GZN I;  2XW1 A;  1KLV A;  4ANW A;  3AE7 B;  1CK1 A;  3IXS A;  4GDK B;  3M63 B;  3VUY A;  2WXJ A;  4KVG B;  4FBJ B;  2V4I B;  3PRE A;  4MBE C;  1JML A;  2JYT A;  4NNJ B;  4DHZ B;  1E10 A;  1E8Y A;  1V6E A;  5LNK 1;  4K81 A;  1E78 A;  3A1Q A;  4EZL A;  5KHQ A;  3RMK C;  3U30 A;  3EHV A;  2BXL A;  5D2M B;  3AXC A;  1FXT B;  1TXU A;  2BKF A;  4IW2 A;  1J7B A;  4BOZ B;  2J52 A;  4MDK E;  3NZ3 A;  4LLG M;  4IWQ A;  4KV2 A;  3R7Q A;  1FFV A;  1WXV A;  5EE9 A;  2LQI A;  2LXA A;  1D4B A;  3ZGZ A;  2K8B A;  2YEP B;  5H8Y E;  4K3C A;  4KZ0 A;  2VRR B;  2XSI A;  2Z59 B;  2K39 A;  2M0X A;  4G03 A;  4WJQ A;  1ZXH A;  2QIL A;  1RYJ A;  1SEB D;  1J0G A;  3LU8 A;  2BKR B;  5HI1 A;  2WDR B;  2RD0 A;  1WGR A;  2LZ6 A;  3DWM A;  1FEH A;  4ZCG A;  5TSS A;  5JHA A;  1I42 A;  2KVZ A;  2W9N A;  2D3A A;  2Z0D B;  4G01 A;  4G11 A;  1E90 A;  2BXB A;  2BF8 B;  3OAW A;  1BML C;  2NTS A;  3NS1 A;  2ZNV B;  3VTV A;  5IA7 A;  3DBS A;  3TCA A;  4L1B A;  1QOA A;  2I1K A;  3D32 A;  1QOF A;  1QLB B;  2PKO A;  1RRB A;  3M99 C;  4K7U A;  1WSP A;  4RF1 A;  2M19 A;  5BYS A;  2CKH B;  2M56 B;  4EFO A;  2I2Y A;  1VD2 A;  2Y3A A;  2WXL A;  4MM3 B;  2IJ0 A;  2IGD A;  1WIA A;  1PQS A;  1FPY A;  2KHW B;  4F8C B;  4IW0 A;  4IW1 A;  1AYF A;  3PZ8 A;  4MGK E;  4JWS C;  2KN5 A;  3PS6 A;  2C60 A;  4HK2 A;  5D3I B;  5BMI A;  2AX5 A;  1XCQ L;  5IO9 A;  2WQY B;  4HPM B;  2EKI A;  3C19 A;  2WXP A;  3V6C B;  2KLG A;  1GPX A;  2KTF A;  2KK8 A;  5CHW A;  4EZK A;  2QSD A;  4IM3 A;  3RCZ A;  4OVV A;  2NBW B;  3ZIM A;  2KLC A;  3DHG C;  4JPS A;  4J3O D;  4WJN A;  3O13 A;  4D7X A;  3RPF C;  3Q8B A;  4IM0 A;  1WZ3 A;  2WXH A;  3FIL B;  2KFK B;  3DOW A;  3H7P B;  4ICU A;  4KKJ A;  1TKE A;  1L0Y B;  1K50 A;  1JWU D;  2K8H A;  1VRA B;  1YN4 A;  3MHZ A;  3SDL C;  3NVI A;  2BWE S;  4BKS D;  3LXF A;  2NTT A;  2K22 A;  1ZDX A;  2NNW A;  1C4C A;  4EOY A;  2RDB C;  4PK1 A;  3K9P B;  2O6V A;  1L0V B;  3OWE B;  4W9K A;  1KDX A;  4ZDV A;  4Z9O A;  1SE9 A;  1EUV B;  4BKT A;  1JRO A;  3ZXV A;  1EWC A;  4WAF A;  1P9D U;  2LRU A;  2XVU A;  4E74 A;  3KUZ A;  1WGY A;  3A9K A;  4LNI A;  1IGC A;  4L8U A;  4M01 A;  2HTM E;  5FUO A;  3DVN V;  1C4A A;  5D3D A;  5G55 A;  3W2D A;  2KYW A;  1E7H A;  4TQ1 A;  4KIK B;  1XCT L;  3LU6 A;  3PLV A;  2QJL A;  2ZNV C;  3AE9 B;  4M8N A;  2CU3 A;  2LXT A;  2RSU A;  4DK5 A;  2DYB A;  4J2V A;  1I7H A;  2MJ3 A;  3BYY B;  2V4L A;  2W54 A;  1K53 A;  5D94 A;  1F52 A;  1SGH A;  5J18 A;  2BXF A;  3TEZ A;  1DGJ A;  4BZA A;  3AI5 A;  2HTH A;  2FAZ A;  1FIQ A;  1MUS A;  3V3X A;  2BYF A;  4G50 A;  4LJO B;  4A20 A;  2M8S A;  2JUO A;  2RGF A;  3MTN B;  2KMM A;  3GOE A;  4HCP B;  2VUE A;  2LGY A;  2LAS A;  3BVG A;  4K3B A;  1PGA A;  4ZUX V;  1M94 A;  3PT2 B;  2CHZ A;  4P6V F;  2EEL A;  2NVU I;  1I4G A;  2ROH A;  4DXG A;  2J42 A;  3WHS A;  2IYD B;  4MGZ E;  1WJU A;  4YL8 A;  3LU7 A;  1FXI A;  3VH3 B;  5JHB A;  3LJ3 A;  2W3S A;  2BW2 A;  2QHB A;  4N6E B;  3B1L X;  2KJR A;  2DYO A;  2PVG C;  1J7A A;  3RI7 C;  1GB1 A;  1E8Z A;  1WYG A;  2KTR A;  1ET9 A;  1MIW A;  4CYE A;  2HE7 A;  4TQ0 A;  3VH4 B;  3QHT A;  4XX5 A;  2BGF A;  1IJG A;  1FXA A;  2KC1 A;  3MP9 A;  2KDI A;  2OOB B;  5DCN A;  2KWV B;  2DZI A;  3ZKJ C;  4OZA A;  3N1X C;  5EE0 A;  1F2R I;  1D5X C;  2ZW1 A;  4JQW C;  1LFD A;  4REZ A;  3NVW A;  3G9K D;  3R7R A;  4ZRQ A;  3FWC C;  2KX0 A;  1HEZ E;  4IWO A;  2BB6 A;  1TZ1 A;  1BM0 A;  5CHF A;  1F2R C;  4WWN A;  5G5G A;  3LYY A;  5G5H A;  3P4P B;  4S17 A;  1WGG A;  4D2K A;  2G45 B;  4NJ6 A;  2LGS A;  3WAM A;  1HK3 A;  3DVN U;  1TZO A;  4DDG D;  2DYM A;  2GRI A;  3PZD A;  1OEY A;  1SE3 A;  3ECP A;  2HJ8 A;  3MHS D;  4W9L A;  4AQ7 A;  2EMS A;  1E7E A;  2BBC A;  3L16 A;  4YTP B;  1LOT A;  2E0X A;  2G4S A;  1PYW D;  4FIP B;  1V2Y A;  4FK5 B;  1AAR A;  3A33 B;  4OZC A;  2MP2 B;  4TUU A;  3H8H A;  3VFK A;  3RNB C;  3RUL A;  1LM8 B;  4CQN A;  2B3A A;  4MGI E;  1PGX A;  2BPS A;  2EFE A;  3KLS X;  3VRB B;  2KVR A;  1E7P B;  2XK5 B;  3SD5 A;  2IGH A;  5IJ5 A;  1N5U A;  2IND C;  2LHD A;  4S1Y A;  3KYD D;  3I57 A;  1Q5W B;  4FLH A;  5C2T B;  1UOR A;  3S2A A;  2CR5 A;  3QC8 B;  4Z69 A;  2HDE A;  1I4R A;  4RH6 A;  4NJ7 A;  2ZZP B;  1HE8 A;  5H92 C;  5DQF A;  3ALB A;  1KLU D;  2B76 B;  4GDL B;  1MIV A;  1JWB D;  5IN7 A;  2L0F A;  2JPH A;  2AGH B;  2WGS A;  3W9C B;  2M0A A;  1J78 A;  4H2A A;  1NEN B;  1TS2 A;  2NBV B;  1MIY A;  4MAC A;  3PRZ A;  2PIA A;  4ZRK A;  2WDV B;  2KDM A;  5C1Z A;  4NZL B;  1XLO A;  4L9K A;  2YEP F;  3V09 A;  5LXI B;  3Q3O C;  1MUH A;  1DYQ A;  3ZRF A;  1HK1 A;  4GN1 A;  3ZJV A;  2X8X X;  3ZJT A;  4FUL A;  1I4X A;  1CJE A;  3GA9 L;  2MCN B;  5L95 C;  2C7N B;  3T3N A;  4ARI A;  3K9O B;  2UU7 A;  2SEB D;  1HA2 A;  2JXX A;  1T0Y A;  5AUK A;  3P1M A;  1WR1 A;  3A1Q B;  1QQR A;  4MSQ B;  4AWJ A;  1WGH A;  3ML8 A;  1EO6 A;  4PYZ A;  3UI3 A;  1VDV A;  3AEC B;  1V86 A;  3AEG B;  3SIU B;  2MBE A;  3N9Y C;  4HCN B;  2IZV B;  4JLC A;  1AWD A;  4HRO A;  4HJG E;  4BBN C;  1CQV A;  1XEE A;  3N3K B;  1XLQ A;  4OTU A;  3NS8 A;  2INC C;  1JWS D;  3ZQ4 A;  2PW9 A;  4MT5 A;  4DM0 A;  2BYE A;  3DBR B;  4A9A A;  3W5U B;  2KAN A;  2E3T A;  3HIZ A;  4RGT A;  4K71 A;  5BMG A;  4EEW A;  1IYF A;  4F7Z A;  2QCZ A;  2L3Z A;  4C80 A;  3AE4 B;  2WYQ A;  2Z8L A;  4P1C C;  5JZE B;  2KMA A;  1IUE A;  4YTN B;  3U8Z A;  5BMH A;  2GI9 A;  2LJI A;  3PGE A;  5AZF A;  3ONS A;  3U7Z A;  1YN5 A;  4FN2 A;  2XBB C;  4WQM A;  2BX8 A;  1UBI A;  5IJE A;  2OZB B;  2IY1 B;  3PO0 A;  3QAR A;  1STE A;  3ZUN A;  2BYV E;  3AEB B;  1H9Z A;  1WXQ A;  2L8J A;  3NMU A;  2BXG A;  5IOI A;  1WJN A;  2N9P C;  1NI2 A;  3GP7 A;  3FWB C;  1BKE A;  5CX3 A;  1L0X B;  4XZ4 A;  4W9D A;  2FCQ A;  4C00 A;  2L1A A;  3B2G A;  1FCL A;  2BTE A;  1V5O A;  5GIN A;  2K25 A;  1P7E A;  3H7S A;  1YIW A;  4XWW A;  3H37 A;  4HEA 1;  1TJE A;  2O6V D;  3GS2 A;  2INN E;  4XGA B;  3ICX A;  2V36 A;  4LNO A;  1V9J A;  4YT0 B;  4B6W A;  2ZVO A;  1XLN A;  4CHK A;  4AUQ C;  2Z0E B;  1BJ5 A;  5TR5 A;  1JCK B;  3RNC C;  1A5R A;  5AZG A;  1V80 A;  4ICV A;  1E7F A;  2QMC A;  1K52 A;  1JWM D;  2KT7 A;  4XYC A;  2LRW A;  3ZRC A;  1WI0 A;  2JY6 A;  1WE6 A;  3KUC B;  2RPQ A;  1ET6 A;  3B9L A;  3T9L A;  4FHK A;  2AL6 A;  4KZC A;  3DBR I;  3WAO A;  2DWQ A;  4FJZ A;  1HQR D;  4RCO A;  3HUI A;  1KLG D;  3IAS 1;  3JSV B;  1PUT A;  1TIF A;  1GC6 A;  1E6E B;  4W9F A;  1MPE A;  2O6V B;  1QIL A;  2E6X A;  4WQO B;  2CJO A;  4LUF A;  3JQZ A;  3ETR A;  4IM2 A;  3W1Y A;  2N1V A;  3KWL A;  3A9K B;  2L76 A;  3AE8 B;  3SR6 A;  1FD6 A;  1FNW A;  1ACC A;  3N20 C;  4EZJ A;  4GG2 A;  2MA9 B;  3KH0 A;  3MC9 A;  3AV8 A;  3T8M A;  2XEW A;  3ZNZ B;  2AEH A;  4OVU A;  3R66 C;  2FNJ B;  5DPW A;  1EU4 A;  2MW5 A;  4OT2 A;  4I6P A;  1QOB A;  1TBE A;  1PDX A;  3R3M A;  1WRI A;  4RGO S;  4N0F D;  2MJE A;  1J7C A;  2EMT A;  1ESF A;  4LNN A;  4ZBQ A;  2PJH A;  3Q69 A;  2GBM A;  1IBX A;  5I4D A;  4AJY B;  2CU1 A;  3QQ8 B;  1L2N A;  2PMV A;  3RD2 A;  1WYW B;  3APD A;  2WX1 A;  1NDD A;  2J0K A;  5FR3 A;  1AN8 A;  4ZBK A;  4GLS C;  2KJH B;  1WM3 A;  3CSF A;  3H1U A;  4LCD E;  3ML9 A;  2Q5W D;  1LXD A;  1LGR A;  4WAA A;  3WAL A;  2KWC A;  4LK0 M;  1SE2 A;  2EFH A;  4KGS A;  1V5T A;  2OJR A;  4BOS C;  2WU2 B;  3IHP C;  1WY8 A;  2WDT B;  4FJV B;  4AS1 A;  1JAL A;  3ECI A;  4E3C A;  2LD9 A;  1Q1O A;  2K6Q A;  1UGJ A;  1FCC C;  4ANU A;  1RAX A;  4I9O A;  1NBF C;  1N63 A;  5EE3 A;  3Q6B A;  2LGX A;  3BY4 B;  4JX1 C;  2N9K A;  1R4M B;  1XT9 B;  4BBN F;  1HK4 A;  1WX7 A;  5C3J B;  1UUP A;  3VR9 B;  1GNJ A;  4FJY A;  5HG2 A;  3UIN B;  2JXT A;  4WJO A;  2KTR B;  3C8Y A;  2KAJ A;  4JK4 A;  4P7I A;  1KRH A;  5BPK A;  1T0S C;  1KOT A;  1E8X A;  2D11 A;  2MX2 A;  3AN1 A;  1E5W A;  4WIP A;  3JSV A;  1H4R A;  2KWD A;  3BK2 A;  2JSV X;  4MEL A;  3VTU A;  2LVO A;  3CST A;  1HTQ A;  4NJC A;  2JRH A;  2MEK A;  1KFY B;  2BXQ A;  3ZJU A;  2GB1 A;  2XVW A;  3DDC B;  2ON8 A;  4NAM A;  1I4H A;  1TTN A;  2JVC A;  1QOG A;  1J19 A;  1MFW A;  1YQ4 B;  2MBO A;  1B9R A;  2DBU A;  1F0Z A;  1D5M C;  1JNB A;  1F9J A;  2DAJ A;  4W9G A;  3V05 A;  3P42 A;  2LVP A;  4US8 A;  2AJE A;  4C4V A;  5JH5 C;  3UQB A;  2XW0 A;  2WXN A;  4RF0 A;  1E7U A;  2JX5 A;  4GB9 A;  4A55 A;  4PYU A;  3WAP A;  3DBL B;  4NQL B;  2K1F A;  3PHW B;  3EC8 A;  1TS4 A;  5AZH A;  3EFC A;  3FC4 A;  1JRU A;  5GIO A;  2L32 A;  3MC8 A;  3OJ4 B;  3A75 A;  2OHF A;  3UGB B;  2ZW0 A;  3NVK A;  4ZYN A;  4K7S A;  3DVG Y;  1U4A A;  4JWU C;  1WXA A;  1N5X A;  1F77 A;  2A5U A;  3BII D;  1EF5 A;  1WZ0 A;  3M62 B;  5FKA C;  5EDS A;  3FNM A;  1YOV B;  1VJK A;  4ZRJ A;  3HRD D;  1ZE3 D;  2J53 A;  2CS4 A;  4K1R B;  1R4M I;  2V0G A;  1WR6 E;  2DLB A;  2MQJ A;  1ZKH A;  3HHM A;  1HZ6 A;  2ONQ A;  2R2Q A;  3NZU A;  1V8C A;  3AE2 B;  3VHT C;  4HVB A;  1TGZ B;  3SIV B;  2VH1 A;  2GBJ A;  4B9K A;  5CHV C;  1MHX A;  3IT4 B;  4IUM B;  1QT9 A;  1V1P A;  2QDF A;  1R7S A;  4N59 A;  4EUT A;  2W3R A;  3DVG X;  4ZHP A;  1OQR A;  3QWZ B;  2EFD A;  1ZDV A;  3AU4 A;  1D6E C;  2K0P A;  3NG0 A;  4PS3 A;  2KMC A;  1MVK A;  3VXW A;  3TIX A;  3IFW B;  4NPN A;  3OG5 A;  1CZP A;  1E8W A;  2FUH B;  4F5T A;  2N4F A;  1HXY D;  2JRI B;  1OEY J;  3ZXR A;  1WGK A;  1P1A A;  1WJ6 A;  5IP4 D;  3NJT A;  3I3T B;  1EM7 A;  3RNE C;  4ACF A;  2INP E;  1FFU A;  4ZYS A;  4C7Z A;  2I38 A;  3DBL I;  1XO3 A;  1JRP A;  3KJL A;  1M4V A;  3ZW3 A;  4BVU C;  3PTF C;  2KD0 A;  1FRD A;  1ZPS A;  3NRZ A;  4M8M A;  5FR6 A;  3UQA A;  2KQ4 X;  3AEF B;  1E9M A;  4F5U A;  4HRS A;  3HK0 A;  1Z5S B;  2H88 B;  3RFZ B;  4KDI C;  4CO7 A;  1WJ4 A;  1GUA B;  4YSZ B;  4FHJ A;  3L13 A;  4B95 A;  1SF0 A;  2NQO A;  4LA0 A;  2IO1 B;  1V81 A;  1VZ7 A;  3SHQ A;  3IVF A;  3WHQ A;  2D3B A;  2MJD A;  2FID A;  1Y56 A;  4C31 B;  4XWT A;  4KGT A;  1MA9 A;  4MH0 E;  3APC A;  2DBX A;  2WXK A;  3WIM A;  2Y5C A;  4LUH A;  2KX3 A;  2J4X A;  2KWU B;  1XQQ A;  2LFI A;  2IDY A;  3RYT A;  2MBQ A;  3L54 A;  3ZLZ A;  1YN3 A;  3ZTC A;  4HPP A;  2YDF A;  1T3Q A;  3V03 A;  2MBH A;  4L23 A;  2KAC A;  3U2S C;  2FCS A;  2M17 A;  3DQV A;  2PTL A;  3V62 A;  1GG3 A;  3NHE B;  2UWQ A;  3QA8 A;  1ZP0 B;  4IKG A;  1JQ4 A;  1QKZ A;  2EFC A;  3MHS B;  1XXG A;  2WP9 B;  4BFR A;  1BUI C;  5LLI A;  4LNK A;  4USA A;  1EWY C;  1UZX B;  2O2V A;  1TT5 B;  5IJF A;  2WHI A;  1HK2 A;  5DPT A;  3PRM B;  1E7A A;  1WE7 A;  2JZZ A;  2FE8 A;  2DBW A;  2FCN A;  2PEA A;  5AEK B;  2IPK D;  1E7C A;  3PLU A;  4M0W B;  3TEX A;  1CMX B;  2Z8K A;  1KTK A;  3KVF B;  4DQO C;  4YXD B;  5L83 A;  3JRY A;  1DOI A;  2W55 A;  3RZF A;  3CF6 E;  2K0N A;  1FRR A;  2K5P A;  1GNU A;  1AO6 A;  4LJP B;  2LEK A;  1QF6 A;  3Q8C A;  4GIV A;  2NCN A;  2KQ7 A;  4HPL B;  3L4P A;  4KSL C;  1SIJ A;  2WXO A;  3BPJ A;  3FKY A;  4C7Y A;  4OHJ A;  2BXC A;  2Z8J A;  4LB9 A;  2N0S B;  3X23 A;  4EKU A;  2BXO A;  4Q2J A;  1C78 A;  3L10 B;  1KXP D;  2FUG 1;  1C77 A;  1T0R C;  4M02 A;  2JT4 B;  2E0Y A;  2WXF A;  1N60 A;  2QM6 A;  2V3N A;  1T5X D;  3VUW A;  5G2N A;  3AED B;  3A4R A;  4XE0 A;  1SXT A;  1WRD B;  1TF0 A;  2HJ1 A;  4W9C A;  2D3C A;  1TS3 A;  2MBB B;  3SQJ A;  2V1Y A;  2KBZ A;  2KN4 A;  4FXC A;  2NPT B;  2L00 B;  3I5J C;  2BXE A;  4W9I A;  4US9 A;  4P16 A;  1P3Q U;  4G0N B;  1P98 A;  4KDL B;  1NEK B;  4MSM B;  2JZP A;  3VQI A;  4DHX B;  1YMH E;  2BXD A;  2L52 A;  1WX8 A;  4NAW A;  2W82 A;  4UDU C;  1GNI A;  2C9W B;  1WWT A;  3ZO5 B;  2K3U A;  3U7D A;  1TS5 A;  5FK9 C;  1UNS A;  2PPH A;  3NVY A;  1UD7 A;  2EKE C;  3DWG C;  1MG4 A;  1MI0 A;  5IIX A;  4DXF A;  1SBB B;  4KX6 B;  2V9H A;  4W9H A;  2L05 A;  4TV3 A;  1WMH A;  3E9S A;  1L6U A;  3W1S C;  3N32 A;  2GBN A;  4GDX A;  4KSK C;  1KM7 A;  2BWF A;  3P2B A;  1IBX B;  3PSE B;  1UWX A;  3TUO A;  3W1S A;  3WHR A;  1L4D B;  1SE4 A;  2GOW A;  4RGM A;  3V6E B;  2H89 B;  2HD5 B;  3SFD B;  3BIN A;  1IPG A;  2D5G A;  4MEM A;  4B0E A;  2A4Z A;  4FJC B;  3VVW B;  1EU3 A;  1WXS A;  4L9Q A;  4WH4 A;  3OLM D;  2JUH A;  1T6B X;  4F5S A;  2Y5B B;  4ITK A;  5LXH A;  3NZS A;  3VDZ A;  1I35 A;  2GBR A;  2LUM A;  3M3J A;  1PFD A;  3W5V B;  2ZVN A;  3JW0 X;  3WA0 A;  3RN9 C;  2LQH A;  2ZPY A;  3R2T A;  4M0W A;  1VFI A;  2WS3 B;  2DZJ A;  1LQB A;  4PT5 A;  3DHI C;  4WWP A;  3EA6 A;  5HOZ A;  1VZ8 A;  4IG7 B;  2DHZ A;  4DWF A;  2DZK A;  1Q10 A;  4RMA A;  3NUH B;  2N9L A;  4N58 A;  3TL5 A;  4IC7 B;  4ANX A;  2XNA C;  2MRP A;  1YD8 U;  3DHH C;  4DHZ E;  2SAK A;  2J7Q B;  4S0R A;  3GE3 C;  4HDO A;  4JL9 A;  4W9J A;  4XDD A;  2AQ1 B;  4HLE A;  2LI5 A;  1A70 A;  1C76 A;  4A6Q A;  4ZBR A;  3EUB 2;  2PVO D;  4KGR A;  5E6J A;  3J9C A;  5C23 A;  2OT3 A;  4C56 C;  5D6J B;  2WXG A;  1WGD A;  1RLF A;  2WWZ A;  2LJ5 A;  2IO2 B;  1ISN A;  3N30 A;  1XF5 L;  1UEL A;  4WWO A;  2WXR A;  3LB8 C;  4ZOH C;  4N9F 4;  2BS4 B;  2J0M A;  2AQ2 B;  3JVZ X;  3QCA A;  1WH3 A;  2MH7 A;  3HVD A;  3UIO B;  5ID7 A;  4OTT A;  1Q0W B;  1XLP A;  2NPT A;  3RUI B;  4RFB A;  2KDB A;  3UF8 A;  5AUI A;  1WF9 A;  1PGB A;  4DBG A;  2REX A;  4JGH B;  1DOX A;  3ZDM C;  1OQQ A;  3P4Q B;  4M00 A;  2V3S A;  4GXB A;  3ZVV A;  5E6P A;  3SU8 X;  1L7Y A;  4C4V B;  1MJD A;  1NYQ A;  1JW9 D;  2L0T A;  3N1Y C;  2M1M A;  4MJS A;  2AL3 A;  2AYO B;  2ZCC A;  2BQQ A;  1KF6 B;  4YTM B;  4RNA A;  2LOQ A;  2BYT A;  3ZTD A;  2NBU A;  1VLB A; 
#chains in the Genus database with same CATH homology
 2R61 A;  2BXK A;  5D7G A;  2NS5 A;  3EEC A;  4N0U D;  4E71 A;  5T8I A;  4TMA B;  4ANV A;  2DEN B;  4KKI A;  1UGM A;  1WFY A;  5CTR C;  3UIP B;  3A9J A;  2XVV A;  2DG5 A;  2WXM A;  4GMV A;  3B9M A;  2KKC A;  4J6I A;  2RPV A;  1L4Z B;  3AEE B;  5MPO A;  1B1Z A;  1TKY A;  2MSE D;  4DDI D;  2CKX A;  2TSS A;  2RDH A;  4N3Z A;  3PV1 A;  2WLB A;  1G6J A;  1FM0 D;  5HKH A;  2VDB A;  2JQR B;  4DHJ D;  4TKN A;  2ZJD A;  3NVM A;  1SB3 C;  1GAQ B;  4R3D A;  3VR8 B;  2QIE B;  4XDC A;  2Z8I A;  1V1P B;  1VZS A;  3B08 A;  3ABV B;  2YLM A;  2ZPN A;  4WUR A;  3WCQ A;  4E99 A;  4LTU A;  2C7M B;  5BYR A;  3Q3J A;  4BKG A;  1KH0 A;  3L08 A;  3KWV A;  1RFK A;  2RDG A;  3IAM 1;  3B0A A;  4ARC A;  3AM9 A;  1H8C A;  1KJT A;  5B5T A;  4AP4 C;  1MG8 A;  2KNB A;  4GDK A;  3TSS A;  4NQK E;  2K6D B;  1SIF A;  4MH8 A;  4X57 B;  4DHJ B;  1I4P A;  5GXG B;  4PS7 A;  4BY9 C;  3Q8F A;  4MGY E;  2G1E A;  2IBI B;  2MWS B;  4GOC A;  3B2F A;  1YX5 B;  3GQU A;  1E7B A;  1OGW A;  3I9V 1;  5HHD G;  5BO4 B;  1ZGU B;  4A3P A;  4GU2 A;  3ZNG C;  1P7F A;  1OTR B;  2YVC A;  4FAD A;  1K8R B;  1FNV A;  4PS8 A;  4ZRP A;  3M95 A;  2PE9 A;  1FOU A;  3PLA A;  3TJP A;  2CJN A;  3CIR B;  3V08 A;  2JWZ A;  3QAQ A;  4YSX B;  3AEA B;  3ZYY X;  2V3P A;  3BZD B;  3UIV A;  1GJZ A;  1ENF A;  2WDQ B;  1UH6 A;  1LO5 D;  1C4P A;  3B9J A;  2GBK A;  1AW7 A;  1TY2 A;  3JYU A;  3PRP B;  1IGD A;  2XVQ A;  4IWP A;  1DOY A;  2WU5 B;  2J0J A;  2JZ3 B;  1Z2M A;  3HVZ A;  1BT0 A;  1YX6 B;  3RZW C;  3AB5 A;  3VAW A;  5GMV A;  3MC0 B;  2ASQ A;  4YSY B;  4EMX A;  1GB4 A;  3AE1 B;  2KQS A;  3BYT B;  1E7I A;  3EGR A;  3IBE A;  1R4N I;  4BKE A;  1VR9 A;  4XC2 A;  2IY0 B;  3HM6 X;  2L83 A;  2JF5 A;  1V49 A;  2IO0 B;  4MM3 A;  4RGN A;  3T3O A;  3LDZ E;  5BYQ A;  2O2V B;  4GSW A;  5HFY A;  2DZM A;  2MLB A;  4OVZ A;  1JWA D;  1WM2 A;  3Q8E A;  3NVV A;  4K2C A;  2WXQ A;  4O1N A;  3R8B A;  2BB5 A;  1YQB A;  4ZC6 A;  2M4N A;  3P4R B;  2FCM A;  4NY0 A;  1MHH E;  3ZNH B;  2ACZ B;  2CHW A;  2N7E A;  3A73 A;  4IOI E;  2LUE A;  4W4U B;  2LGD A;  2FBW B;  1SJE D;  2QEJ C;  1Y8R C;  3TBL D;  2KJ6 A;  2IGG A;  4AJW A;  1ZUD 2;  2DAF A;  2GMI C;  1WX9 A;  2QHO A;  2C5L C;  3FIL A;  2KFK A;  3C0R B;  5DBY A;  3H7P A;  3QK0 A;  4HKQ A;  3P4S B;  1VZ6 A;  3HM3 A;  4OR0 A;  1V97 A;  3X0W A;  2K9X A;  2IO3 B;  3ENE A;  2KDE B;  2NR2 A;  5EE1 A;  3VRA B;  4WA6 B;  3DCG A;  3NVZ A;  3PHX B;  3H6N A;  4II2 B;  2AWT A;  4JIO U;  4F1S A;  2C7H A;  1P0R A;  3QX1 A;  1YJ1 A;  3Q8A A;  1GC7 A;  4II3 B;  3DBH I;  1O9X A;  2R2O A;  4A90 A;  2X38 A;  3AU5 A;  3TEY A;  4I6N B;  4ZRI A;  2KO3 A;  1SSN A;  1K51 A;  4NAW B;  4K7W A;  3APF A;  2KDF B;  4OZB A;  5E6O A;  5DPS A;  3GB1 A;  3IG3 A;  4KIK A;  3L0W B;  3CWI A;  2WX0 A;  3PPA A;  2D07 B;  1WMH B;  3KQ4 A;  4BKS A;  2DX5 B;  1C1Y B;  3AUL A;  3PZ7 A;  3QJZ A;  2XMO A;  2ZCB A;  3U52 E;  3SEB A;  1HA5 A;  3V60 A;  1E0Z A;  5DPR A;  3RT3 B;  1I4Q A;  3E56 A;  2JWU A;  4RM9 A;  3TMP B;  3KW5 B;  2CHX A;  3O65 B;  5GIP A;  2PE6 B;  3MFG A;  1NVI D;  1NT2 B;  4HKZ E;  2ICI A;  4HWI B;  2VZK D;  3OJ3 A;  3KIK A;  3BVZ A;  2BXP A;  2LHE A;  4A8X C;  2LVQ A;  4LDT D;  3MJ5 A;  1FMA D;  1S1Q B;  3R2I A;  1RM6 C;  3U4E G;  4W9E A;  1BXT A;  2QMT A;  1V1O A;  5KHO A;  4JE3 B;  5IIH A;  4ASW C;  1VCB A;  1XD3 B;  3AE3 B;  1D3Z A;  4FA6 A;  3MJW A;  2BXA A;  2DBY A;  1J8C A;  4HGK A;  2L7R A;  1IP9 A;  4B0M A;  2XN9 C;  1EF1 A;  1FO4 A;  2JYE A;  2N7D A;  5IAA C;  2LMC A;  3WAN A;  1SJH D;  2BXM A;  3A4S C;  3L17 A;  1OQY A;  3CMM B;  2VZK B;  1FNU A;  1E7G A;  1YJJ A;  1L5P A;  2KZR A;  4GGQ A;  2LGI A;  2VUF A;  4LDT B;  2BS2 B;  4G04 A;  3Q3F A;  1UBQ A;  1WXM A;  2G4D B;  1N61 A;  1YQ3 B;  1S3S G;  3ZDT A;  4DXA B;  5J2R A;  2BS3 B;  3BK1 A;  3VTW A;  3AMZ A;  1TY0 A;  4YWG G;  2RR9 A;  2BT6 A;  4G3X B;  2BXH A;  4HJK A;  2G3Q B;  4HXD A;  1ZXI A;  4WWM A;  2K8C A;  4HGM B;  1C9F A;  2D3G A;  2N9E B;  4ZHO A;  1KW2 A;  4IDI A;  4MJS B;  2KC2 A;  2BXI A;  2Y5P A;  3KUD B;  5JXV A;  4EE2 A;  3BWU D;  3CX9 A;  3AH7 A;  1YJI A;  3KYC D;  1N5W A;  3H9D A;  3ZNI D;  1ZOY B;  5IFO A;  4M70 B;  2I2Z A;  2KOX A;  2WXI A;  4WJP A;  4L2Y A;  2MP2 A;  1RFA A;  3EFU A;  4LB2 A;  1J7E A;  2ZEQ A;  3A9J B;  3V61 A;  5GHK A;  3GQX A;  3MHH B;  2UYZ B;  1RWS A;  3PVL A;  1ROE A;  1ZW7 A;  3NOB A;  3SFE B;  2XK5 A;  3P63 A;  2PLP A;  4I6L B;  4OW0 A;  2LXC A;  3AE5 B;  1D5Z C;  3DPD A;  4TSS A;  1LNS A;  5ID9 A;  2N9X A;  2WNM A;  2NMQ A;  2RMM A;  1NYR A;  4PO0 A;  1YNT E;  1E7V A;  2JU6 X;  2OED A;  1C79 A;  3NY5 A;  5J17 A;  4AOF A;  1H5W A;  1HK5 A;  4GDL A;  2N7J A;  2G9H D;  3VUX A;  1HZ5 A;  2I30 A;  3TEW A;  1X1M A;  2FIF A;  1GOZ A;  2N1W A;  3BVM A;  1C3T A;  3QIJ A;  3URY A;  1L6V A;  3H3A A;  2I1J A;  3FAH A;  2D2Q A;  4HDQ A;  1TKG A;  2KXJ A;  1NI3 A;  3IT6 B;  1TYG B;  4URK A;  1N62 A;  2BXN A;  3TDL A;  2AQ3 B;  2KFJ A;  1QZE A;  5IIU A;  2LWP A;  4A3O A;  4RM8 A;  2D10 A;  1UWM A;  3AE6 B;  4F5V A;  5E6N A;  1OFF A;  3GZN I;  2XW1 A;  1KLV A;  4ANW A;  3AE7 B;  1CK1 A;  3IXS A;  4GDK B;  3M63 B;  3VUY A;  2WXJ A;  4KVG B;  4FBJ B;  3PRE A;  2V4I B;  4MBE C;  1JML A;  4DHZ B;  4NNJ B;  2JYT A;  1E10 A;  1E8Y A;  1V6E A;  5LNK 1;  4K81 A;  1E78 A;  3A1Q A;  4EZL A;  5KHQ A;  3U30 A;  3EHV A;  2BXL A;  5D2M B;  3AXC A;  1FXT B;  1TXU A;  2BKF A;  4IW2 A;  1J7B A;  4BOZ B;  2J52 A;  4MDK E;  3NZ3 A;  4LLG M;  4IWQ A;  4KV2 A;  3R7Q A;  1FFV A;  1WXV A;  5EE9 A;  2LXA A;  1D4B A;  3ZGZ A;  2K8B A;  2YEP B;  5H8Y E;  4KZ0 A;  2VRR B;  2XSI A;  2Z59 B;  2K39 A;  2M0X A;  4G03 A;  4WJQ A;  1ZXH A;  2QIL A;  1RYJ A;  1J0G A;  1SEB D;  3LU8 A;  2BKR B;  5HI1 A;  2WDR B;  2RD0 A;  1WGR A;  2LZ6 A;  3DWM A;  1FEH A;  4ZCG A;  5TSS A;  5JHA A;  1I42 A;  2W9N A;  2Z0D B;  4G01 A;  4G11 A;  1E90 A;  2BXB A;  2BF8 B;  3OAW A;  1BML C;  2NTS A;  3NS1 A;  2ZNV B;  3VTV A;  5IA7 A;  3DBS A;  3TCA A;  4L1B A;  1QOA A;  2I1K A;  3D32 A;  1QOF A;  1QLB B;  2PKO A;  1RRB A;  3M99 C;  4K7U A;  1WSP A;  4RF1 A;  2M19 A;  5BYS A;  2CKH B;  2M56 B;  4EFO A;  2I2Y A;  1VD2 A;  2Y3A A;  2WXL A;  4MM3 B;  2IJ0 A;  2IGD A;  1WIA A;  1PQS A;  2KHW B;  4F8C B;  4IW0 A;  4IW1 A;  1AYF A;  3PZ8 A;  4MGK E;  4JWS C;  2KN5 A;  3PS6 A;  2C60 A;  4HK2 A;  5D3I B;  5BMI A;  2AX5 A;  1XCQ L;  2WQY B;  4HPM B;  2EKI A;  2WXP A;  3V6C B;  2KLG A;  1GPX A;  2KTF A;  2KK8 A;  5CHW A;  4EZK A;  2QSD A;  4IM3 A;  3RCZ A;  4OVV A;  2NBW B;  3ZIM A;  2KLC A;  4JPS A;  4WJN A;  4J3O D;  3O13 A;  3RPF C;  4IM0 A;  3Q8B A;  1WZ3 A;  2WXH A;  3FIL B;  2KFK B;  3DOW A;  3H7P B;  4ICU A;  4KKJ A;  1TKE A;  1L0Y B;  1K50 A;  1JWU D;  2K8H A;  1VRA B;  1YN4 A;  3MHZ A;  3SDL C;  3NVI A;  2BWE S;  4BKS D;  3LXF A;  2NTT A;  2K22 A;  1ZDX A;  2NNW A;  1C4C A;  4EOY A;  3K9P B;  2O6V A;  1L0V B;  3OWE B;  4W9K A;  4ZDV A;  4Z9O A;  1SE9 A;  1EUV B;  4BKT A;  1JRO A;  1EWC A;  4WAF A;  1P9D U;  2LRU A;  2XVU A;  4E74 A;  3KUZ A;  1WGY A;  3A9K A;  1IGC A;  4L8U A;  2HTM E;  5FUO A;  3DVN V;  1C4A A;  5D3D A;  5G55 A;  3W2D A;  1E7H A;  4TQ1 A;  4KIK B;  1XCT L;  3LU6 A;  3PLV A;  2QJL A;  2ZNV C;  3AE9 B;  4M8N A;  2CU3 A;  2RSU A;  4DK5 A;  2DYB A;  4J2V A;  1I7H A;  2MJ3 A;  3BYY B;  2V4L A;  2W54 A;  1K53 A;  5D94 A;  1SGH A;  5J18 A;  2BXF A;  3TEZ A;  1DGJ A;  3AI5 A;  2HTH A;  2FAZ A;  1FIQ A;  3V3X A;  2BYF A;  4G50 A;  4LJO B;  4A20 A;  2M8S A;  2JUO A;  2RGF A;  3MTN B;  2KMM A;  3GOE A;  4HCP B;  2VUE A;  2LGY A;  2LAS A;  3BVG A;  1PGA A;  4ZUX V;  1M94 A;  3PT2 B;  2CHZ A;  4P6V F;  2EEL A;  2NVU I;  1I4G A;  2ROH A;  4DXG A;  2J42 A;  3WHS A;  2IYD B;  4MGZ E;  1WJU A;  4YL8 A;  3LU7 A;  1FXI A;  3VH3 B;  5JHB A;  3LJ3 A;  2W3S A;  2BW2 A;  2QHB A;  4N6E B;  3B1L X;  2KJR A;  2DYO A;  2PVG C;  1J7A A;  1GB1 A;  1E8Z A;  1WYG A;  2KTR A;  1ET9 A;  1MIW A;  4CYE A;  2HE7 A;  4TQ0 A;  3VH4 B;  3QHT A;  4XX5 A;  2BGF A;  1IJG A;  1FXA A;  2KC1 A;  3MP9 A;  2KDI A;  2OOB B;  5DCN A;  2KWV B;  2DZI A;  3ZKJ C;  4OZA A;  5EE0 A;  1F2R I;  1D5X C;  2ZW1 A;  4JQW C;  1LFD A;  4REZ A;  3NVW A;  3G9K D;  3R7R A;  4ZRQ A;  3FWC C;  2KX0 A;  1HEZ E;  4IWO A;  2BB6 A;  1TZ1 A;  1BM0 A;  5CHF A;  4WWN A;  1F2R C;  5G5G A;  3LYY A;  5G5H A;  3P4P B;  1WGG A;  4D2K A;  2G45 B;  4NJ6 A;  3WAM A;  1HK3 A;  3DVN U;  1TZO A;  4DDG D;  2DYM A;  3PZD A;  2GRI A;  1OEY A;  1SE3 A;  2HJ8 A;  4W9L A;  3MHS D;  4AQ7 A;  2EMS A;  1E7E A;  2BBC A;  3L16 A;  4YTP B;  1LOT A;  2E0X A;  2G4S A;  1PYW D;  4FIP B;  1V2Y A;  4FK5 B;  1AAR A;  3A33 B;  4OZC A;  2MP2 B;  4TUU A;  3H8H A;  3VFK A;  3RUL A;  1LM8 B;  4CQN A;  2B3A A;  4MGI E;  1PGX A;  2BPS A;  2EFE A;  3KLS X;  3VRB B;  2KVR A;  1E7P B;  2XK5 B;  3SD5 A;  2IGH A;  5IJ5 A;  1N5U A;  2LHD A;  4S1Y A;  3KYD D;  3I57 A;  1Q5W B;  4FLH A;  5C2T B;  1UOR A;  3S2A A;  2CR5 A;  3QC8 B;  4Z69 A;  2HDE A;  1I4R A;  4RH6 A;  4NJ7 A;  2ZZP B;  1HE8 A;  5H92 C;  5DQF A;  3ALB A;  1KLU D;  2B76 B;  4GDL B;  1MIV A;  1JWB D;  2L0F A;  2JPH A;  3W9C B;  2M0A A;  1J78 A;  4H2A A;  1NEN B;  1TS2 A;  2NBV B;  1MIY A;  4MAC A;  3PRZ A;  2PIA A;  4ZRK A;  2WDV B;  2KDM A;  5C1Z A;  4NZL B;  1XLO A;  4L9K A;  2YEP F;  3V09 A;  5LXI B;  1DYQ A;  3ZRF A;  1HK1 A;  4GN1 A;  3ZJV A;  3ZJT A;  4FUL A;  1I4X A;  1CJE A;  3GA9 L;  2MCN B;  5L95 C;  2C7N B;  3T3N A;  4ARI A;  3K9O B;  2SEB D;  1HA2 A;  2JXX A;  1T0Y A;  5AUK A;  3P1M A;  1WR1 A;  3A1Q B;  4MSQ B;  4AWJ A;  1QQR A;  1WGH A;  3ML8 A;  1EO6 A;  4PYZ A;  3UI3 A;  1VDV A;  3AEC B;  1V86 A;  3AEG B;  3SIU B;  2MBE A;  3N9Y C;  4HCN B;  2IZV B;  4JLC A;  4BBN C;  1AWD A;  4HJG E;  4HRO A;  1CQV A;  1XEE A;  3N3K B;  1XLQ A;  4OTU A;  3NS8 A;  1JWS D;  3ZQ4 A;  2PW9 A;  4MT5 A;  2BYE A;  4A9A A;  3W5U B;  2KAN A;  2E3T A;  3HIZ A;  4RGT A;  4K71 A;  5BMG A;  4EEW A;  1IYF A;  4F7Z A;  2L3Z A;  4C80 A;  3AE4 B;  2WYQ A;  2Z8L A;  5JZE B;  2KMA A;  1IUE A;  3U8Z A;  4YTN B;  5BMH A;  2GI9 A;  3PGE A;  2LJI A;  5AZF A;  3ONS A;  3U7Z A;  1YN5 A;  4FN2 A;  2XBB C;  4WQM A;  2BX8 A;  1UBI A;  5IJE A;  2OZB B;  2IY1 B;  3PO0 A;  3QAR A;  1STE A;  3ZUN A;  2BYV E;  3AEB B;  1H9Z A;  1WXQ A;  2L8J A;  3NMU A;  2BXG A;  1WJN A;  2N9P C;  1NI2 A;  3GP7 A;  3FWB C;  1BKE A;  5CX3 A;  1L0X B;  4XZ4 A;  4W9D A;  2FCQ A;  2L1A A;  3B2G A;  1FCL A;  2BTE A;  1V5O A;  5GIN A;  2K25 A;  1P7E A;  3H7S A;  1YIW A;  4XWW A;  3H37 A;  4HEA 1;  1TJE A;  2O6V D;  3GS2 A;  2INN E;  3ICX A;  2V36 A;  1V9J A;  4YT0 B;  4B6W A;  2ZVO A;  4CHK A;  1XLN A;  4AUQ C;  2Z0E B;  1BJ5 A;  5TR5 A;  1JCK B;  1A5R A;  5AZG A;  1V80 A;  4ICV A;  1E7F A;  2QMC A;  1K52 A;  1JWM D;  2LRW A;  3ZRC A;  1WI0 A;  2JY6 A;  1WE6 A;  3KUC B;  2RPQ A;  1ET6 A;  3T9L A;  3B9L A;  4FHK A;  2AL6 A;  4KZC A;  3DBR I;  3WAO A;  4FJZ A;  2DWQ A;  1HQR D;  4RCO A;  3HUI A;  1KLG D;  3IAS 1;  3JSV B;  1PUT A;  1GC6 A;  1E6E B;  4W9F A;  2O6V B;  1MPE A;  1QIL A;  2E6X A;  4WQO B;  2CJO A;  4LUF A;  3JQZ A;  3ETR A;  4IM2 A;  3W1Y A;  2N1V A;  3KWL A;  3A9K B;  2L76 A;  3AE8 B;  3SR6 A;  1FD6 A;  1FNW A;  1ACC A;  4EZJ A;  4GG2 A;  2MA9 B;  3KH0 A;  3AV8 A;  3T8M A;  2XEW A;  3ZNZ B;  2AEH A;  4OVU A;  3R66 C;  2FNJ B;  5DPW A;  2MW5 A;  1EU4 A;  4OT2 A;  4I6P A;  1QOB A;  1TBE A;  1PDX A;  3R3M A;  1WRI A;  4RGO S;  4N0F D;  2MJE A;  1J7C A;  2EMT A;  1ESF A;  4ZBQ A;  2PJH A;  3Q69 A;  2GBM A;  1IBX A;  5I4D A;  4AJY B;  2CU1 A;  3QQ8 B;  1L2N A;  2PMV A;  3RD2 A;  1WYW B;  3APD A;  2WX1 A;  1NDD A;  2J0K A;  5FR3 A;  1AN8 A;  4ZBK A;  4GLS C;  2KJH B;  1WM3 A;  3CSF A;  3H1U A;  4LCD E;  3ML9 A;  2Q5W D;  1LXD A;  4WAA A;  3WAL A;  2KWC A;  4LK0 M;  1SE2 A;  2EFH A;  4KGS A;  1V5T A;  2OJR A;  4BOS C;  3IHP C;  2WU2 B;  1WY8 A;  2WDT B;  4FJV B;  4AS1 A;  1JAL A;  3ECI A;  4E3C A;  2LD9 A;  1Q1O A;  2K6Q A;  1UGJ A;  1FCC C;  4ANU A;  1RAX A;  1NBF C;  1N63 A;  5EE3 A;  2LGX A;  3BY4 B;  4JX1 C;  2N9K A;  1XT9 B;  4BBN F;  1HK4 A;  1WX7 A;  5C3J B;  1UUP A;  3VR9 B;  1GNJ A;  4FJY A;  3UIN B;  5HG2 A;  2JXT A;  4WJO A;  2KTR B;  3C8Y A;  2KAJ A;  4JK4 A;  4P7I A;  1KRH A;  5BPK A;  1KOT A;  1E8X A;  2D11 A;  2MX2 A;  3AN1 A;  1E5W A;  4WIP A;  3JSV A;  1H4R A;  2KWD A;  3BK2 A;  2JSV X;  4MEL A;  3VTU A;  2LVO A;  3CST A;  4NJC A;  2JRH A;  2MEK A;  1KFY B;  2BXQ A;  3ZJU A;  2GB1 A;  2XVW A;  3DDC B;  2ON8 A;  4NAM A;  1TTN A;  1I4H A;  2JVC A;  1QOG A;  1J19 A;  1YQ4 B;  2MBO A;  1B9R A;  2DBU A;  1F0Z A;  1D5M C;  1JNB A;  1F9J A;  2DAJ A;  4W9G A;  3V05 A;  3P42 A;  2LVP A;  4US8 A;  2AJE A;  5JH5 C;  3UQB A;  2XW0 A;  2WXN A;  4RF0 A;  1E7U A;  2JX5 A;  4GB9 A;  4A55 A;  4PYU A;  3WAP A;  4NQL B;  2K1F A;  3PHW B;  3EC8 A;  1TS4 A;  5AZH A;  3FC4 A;  1JRU A;  5GIO A;  2L32 A;  3OJ4 B;  3A75 A;  2OHF A;  3UGB B;  2ZW0 A;  3NVK A;  4ZYN A;  4K7S A;  3DVG Y;  1U4A A;  4JWU C;  1WXA A;  1N5X A;  1F77 A;  2A5U A;  3BII D;  1EF5 A;  1WZ0 A;  3M62 B;  5FKA C;  5EDS A;  3FNM A;  1VJK A;  4ZRJ A;  3HRD D;  1ZE3 D;  2J53 A;  2CS4 A;  4K1R B;  1R4M I;  2V0G A;  1WR6 E;  2DLB A;  2MQJ A;  1ZKH A;  3HHM A;  1HZ6 A;  2ONQ A;  2R2Q A;  3NZU A;  1V8C A;  3AE2 B;  3VHT C;  4HVB A;  1TGZ B;  3SIV B;  2GBJ A;  4B9K A;  5CHV C;  1MHX A;  3IT4 B;  4IUM B;  1QT9 A;  1V1P A;  1R7S A;  4N59 A;  4EUT A;  2W3R A;  3DVG X;  4ZHP A;  1OQR A;  3QWZ B;  2EFD A;  1ZDV A;  3AU4 A;  1D6E C;  2K0P A;  4PS3 A;  2KMC A;  3VXW A;  1MVK A;  3TIX A;  3IFW B;  4NPN A;  1CZP A;  1E8W A;  2FUH B;  4F5T A;  2N4F A;  1HXY D;  2JRI B;  1OEY J;  1WGK A;  1P1A A;  1WJ6 A;  3I3T B;  1EM7 A;  2INP E;  1FFU A;  4ZYS A;  4C7Z A;  2I38 A;  3DBL I;  1XO3 A;  1JRP A;  3KJL A;  3ZW3 A;  1M4V A;  4BVU C;  3PTF C;  2KD0 A;  1FRD A;  1ZPS A;  3NRZ A;  4M8M A;  5FR6 A;  3UQA A;  2KQ4 X;  3AEF B;  1E9M A;  4F5U A;  4HRS A;  3HK0 A;  1Z5S B;  2H88 B;  3RFZ B;  4KDI C;  4CO7 A;  1WJ4 A;  1GUA B;  4YSZ B;  4FHJ A;  3L13 A;  4B95 A;  1SF0 A;  2NQO A;  4LA0 A;  2IO1 B;  1V81 A;  1VZ7 A;  3SHQ A;  3IVF A;  3WHQ A;  2MJD A;  2FID A;  1Y56 A;  4C31 B;  4XWT A;  4KGT A;  1MA9 A;  4MH0 E;  3APC A;  2DBX A;  2WXK A;  3WIM A;  2Y5C A;  4LUH A;  2KX3 A;  2J4X A;  2KWU B;  1XQQ A;  2LFI A;  2IDY A;  3RYT A;  2MBQ A;  3L54 A;  3ZLZ A;  3ZTC A;  1YN3 A;  2YDF A;  1T3Q A;  3V03 A;  2MBH A;  4L23 A;  2KAC A;  3U2S C;  2FCS A;  2M17 A;  3DQV A;  2PTL A;  3V62 A;  1GG3 A;  3NHE B;  2UWQ A;  3QA8 A;  1ZP0 B;  4IKG A;  1JQ4 A;  1QKZ A;  2EFC A;  3MHS B;  4BFR A;  1XXG A;  2WP9 B;  1BUI C;  5LLI A;  4USA A;  1EWY C;  1UZX B;  2O2V A;  5IJF A;  1HK2 A;  5DPT A;  3PRM B;  1E7A A;  1WE7 A;  2JZZ A;  2FE8 A;  2DBW A;  2FCN A;  2PEA A;  5AEK B;  2IPK D;  1E7C A;  3PLU A;  4M0W B;  3TEX A;  1CMX B;  2Z8K A;  3KVF B;  5L83 A;  1KTK A;  4DQO C;  4YXD B;  3JRY A;  1DOI A;  2W55 A;  3RZF A;  3CF6 E;  1FRR A;  2K5P A;  1GNU A;  1AO6 A;  4LJP B;  2LEK A;  1QF6 A;  3Q8C A;  4GIV A;  2NCN A;  2KQ7 A;  4HPL B;  3L4P A;  4KSL C;  1SIJ A;  2WXO A;  4C7Y A;  4OHJ A;  2BXC A;  2Z8J A;  4LB9 A;  2N0S B;  3X23 A;  4EKU A;  2BXO A;  4Q2J A;  1C78 A;  3L10 B;  1KXP D;  2FUG 1;  1C77 A;  2JT4 B;  2E0Y A;  2WXF A;  1N60 A;  2QM6 A;  2V3N A;  3VUW A;  1T5X D;  5G2N A;  3AED B;  3A4R A;  4XE0 A;  1SXT A;  1WRD B;  1TF0 A;  4W9C A;  1TS3 A;  2MBB B;  3SQJ A;  2V1Y A;  2KBZ A;  2KN4 A;  4FXC A;  2NPT B;  2L00 B;  2BXE A;  4W9I A;  4US9 A;  4P16 A;  1P3Q U;  4G0N B;  1P98 A;  4KDL B;  4MSM B;  1NEK B;  2JZP A;  3VQI A;  4DHX B;  1YMH E;  2BXD A;  2L52 A;  1WX8 A;  4NAW A;  2W82 A;  4UDU C;  1GNI A;  2C9W B;  1WWT A;  3ZO5 B;  2K3U A;  3U7D A;  1TS5 A;  5FK9 C;  1UNS A;  2PPH A;  3NVY A;  1UD7 A;  2EKE C;  3DWG C;  1MI0 A;  4DXF A;  5IIX A;  1SBB B;  4KX6 B;  4W9H A;  2L05 A;  4TV3 A;  1WMH A;  3E9S A;  1L6U A;  3W1S C;  3N32 A;  2GBN A;  4GDX A;  4KSK C;  1KM7 A;  2BWF A;  3P2B A;  1IBX B;  3PSE B;  1UWX A;  3TUO A;  3W1S A;  3WHR A;  1L4D B;  1SE4 A;  2GOW A;  3V6E B;  4RGM A;  2HD5 B;  2H89 B;  3SFD B;  3BIN A;  1IPG A;  2D5G A;  4MEM A;  4B0E A;  2A4Z A;  4FJC B;  3VVW B;  1EU3 A;  1WXS A;  4L9Q A;  4WH4 A;  3OLM D;  2JUH A;  1T6B X;  4F5S A;  2Y5B B;  5LXH A;  4ITK A;  3NZS A;  3VDZ A;  1I35 A;  2GBR A;  2LUM A;  3M3J A;  1PFD A;  3W5V B;  2ZVN A;  3JW0 X;  3WA0 A;  2ZPY A;  3R2T A;  4M0W A;  1VFI A;  2WS3 B;  2DZJ A;  1LQB A;  4PT5 A;  4WWP A;  3EA6 A;  5HOZ A;  1VZ8 A;  4IG7 B;  2DHZ A;  4DWF A;  2DZK A;  1Q10 A;  4RMA A;  3NUH B;  2N9L A;  4N58 A;  3TL5 A;  4IC7 B;  4ANX A;  2XNA C;  2MRP A;  1YD8 U;  4DHZ E;  2SAK A;  2J7Q B;  4HDO A;  4JL9 A;  4W9J A;  4XDD A;  2AQ1 B;  4HLE A;  2LI5 A;  1A70 A;  1C76 A;  4A6Q A;  4ZBR A;  3EUB 2;  2PVO D;  4KGR A;  5E6J A;  5C23 A;  3J9C A;  2OT3 A;  4C56 C;  5D6J B;  2WXG A;  1WGD A;  1RLF A;  2WWZ A;  2LJ5 A;  2IO2 B;  1ISN A;  3N30 A;  1XF5 L;  1UEL A;  4WWO A;  2WXR A;  3LB8 C;  4ZOH C;  4N9F 4;  2BS4 B;  2J0M A;  3JVZ X;  2AQ2 B;  3QCA A;  1WH3 A;  2MH7 A;  3HVD A;  3UIO B;  5ID7 A;  4OTT A;  1Q0W B;  2NPT A;  3RUI B;  1XLP A;  4RFB A;  2KDB A;  3UF8 A;  5AUI A;  1WF9 A;  1PGB A;  4DBG A;  2REX A;  4JGH B;  1DOX A;  3ZDM C;  1OQQ A;  3P4Q B;  2V3S A;  4GXB A;  3ZVV A;  5E6P A;  3SU8 X;  1L7Y A;  1NYQ A;  2L0T A;  1JW9 D;  2M1M A;  4MJS A;  2AL3 A;  2AYO B;  2ZCC A;  1KF6 B;  4YTM B;  4RNA A;  2LOQ A;  2BYT A;  3ZTD A;  2NBU A;  1VLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...