2OT3A

Crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
253
structure length
253
Chain Sequence
SKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Rab5 GDP/GTP exchange factor
publication title Structural basis for Rab GTPase activation by VPS9 domain exchange factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2ot3A01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2ot3A02
2EFHA 2OT3A 1TXUA 2EFEA 2EFCA 4G01A 2EFDA 4N3ZA
chains in the Genus database with same CATH superfamily
5GIOA 5A34A 1GSFA 2YCDA 5JCWA 4MDCA 4Q5NA 4EDZA 4BVXB 4L5OA 6GSUA 3LU7A 5D9XA 2HSNA 3N9JA 4MK3A 4ISDA 4YQUA 3PPUA 2OA7A 5BPKA 4IELA 1HNCA 4N3ZA 1ML6A 1VF4A 3SWLA 3LJRA 3WYWA 5F06A 4ECIA 2GLRA 4DEJA 4LB9A 4M70B 2F8FA 3TGZA 1KW2A 3LSZA 1ZGNA 4HJ2A 1E78A 4JK4A 4IBPA 4AKIA 2WW3A 4NAWB 2AHEA 5FT3A 1YY7A 4PNGA 1BG1A 13GSA 1B4PA 4JBBA 6GSSA 20GSA 1AQWA 3EE2A 3LQ7A 5IQYA 4FJCB 1BKEA 1K0CA 1HK1A 3QAGA 3H37A 2R6KA 5B7CA 1TF0A 3NMUA 5F0GA 6GSYA 3C8EA 4MBEC 5DDLA 3DGQA 4PI2C 4K2CA 1OE7A 3UBKA 3O3TA 1IJGA 1PX6A 3TOUA 4ECBA 1DUGA 4FXYP 1PMTA 4BVYB 3ECPA 5JCUA 2R3XA 4LA0A 2QHBA 2BXEA 1GTUA 3MDKA 3W1SA 4KX4A 1PX7A 1G6WA 1MUHA 5D9VA 1FOUA 1XW5A 2ROHA 4HOJA 5ECPB 4I9OA 4YAVA 1KXPD 1PKZA 4IJIA 2IMKA 4PQIA 4W4UB 4KDUA 5J5NA 3GTUB 4EMXA 4OMVA 1SB0A 2Z8JA 2GSQA 6GSTA 2GSSA 3P90A 4G19A 2XVWA 3M3MA 2KWFA 3KM6A 4F0CA 2BXPA 4GSNA 3M99C 3ZMKA 2XVQA 8GSSA 1EOGA 5AN1A 1F3AA 2WRTA 4G9HA 3WD6A 5IJEA 5ECNB 1E7GA 2HSMB 4ZBAA 4BKEA 4ZB6A 5BMUB 4F5SA 1PKWA 3G9KD 2VCZA 10GSA 3FRCA 5FUOA 4QMKA 1J78A 2A2SA 4O7HA 2BXKA 1F2EA 3IK7A 1GNJA 1USBA 4WR4A 1HA2A 2DG5A 3UIVA 2YV7A 5IIHA 3F6FA 4E68A 1MIWA 1TU8A 3VPQA 4HZ2A 4ECJA 3ZFBA 1E7BA 4GDXA 5IFOA 4F03A 4RI7A 5A1NB 4DHXB 2F3MA 4K71A 1SVLA 2X64A 3CSHA 5DALB 4HGMB 3R3EA 2O3EA 1EV4A 4OT2A 4O92A 3G7IA 2EFDA 1HQOA 3QAVA 4Q5RA 3LYKA 4YAPA 5F05A 3RFRC 2HRKA 4MP4A 2AB6A 5ECQB 3UVHA 4D7XA 4Z69A 5LCZA 1Y6EA 2AAWA 4KGIA 1M99A 3Q18A 3GX0A 5A5HB 2O5VA 3N5OA 4GDKB 3O76A 3FR3A 1GSSA 2HRAA 4E8HA 1U88A 4GSSA 3P8WA 1AXDA 4IGJA 1IYHA 3GQUA 1JLVA 4BY9C 3JQZA 2FNOA 3HKRA 4AI6A 2EFEA 4MPGA 5J4YA 5J4UA 2DYOA 4C31B 4TQ1A 2WW1A 5FWGA 1MUSA 5GIPA 4ZB7A 3ZFLA 4CHSA 4PUAA 5D7GA 1UORA 3VI7A 3SIVB 3LYPA 3SQJA 4ID0A 4AKXB 4KSMA 1GSUA 4N0FD 5AGYA 3TOTA 2YDFA 3IK9A 3D0ZA 4ZUXV 18GSA 4ACSA 5IIUA 2GSTA 3LXZA 1EOHA 3M8NA 1BYEA 2VD1A 4ZB9A 1BG5A 1LBKA 3CSJA 3FR6A 5AIVA 2BXIA 3CSIA 2Z8KA 1GNIA 4DM0A 2UZ8A 4L9KA 4LMWA 1SVMA 2WDUA 1GTBA 4L9QA 1HK2A 4LB2A 4IW2A 2LXSA 2LXTA 1K0NA 1TXUA 4OFTA 6GSXA 3IBHA 3NVMA 2WVYA 5DAKB 4E8EA 4G01A 1BX9A 1M9BA 1E7IA 5GHKA 4IW1A 3EINA 2VUFA 3B9LA 3H3AA 5G5FA 2WW0A 4NAXA 2E0XA 3ICXA 3V09A 4E99A 2C8UA 3CRTA 22GSA 3M1GA 3CRUA 4F5UA 1JZRA 1Y1UA 2R4VA 2VO4A 5J47A 4GTUA 3MAKA 3CBUA 4OTUA 5ID9A 4EXJA 2CAQA 1Z9HA 2OADA 4KDXA 4W66A 4LMVA 4LUFA 2DYMA 1K3LA 2J9HA 2C3QA 1SVOA 2C4JA 3Q19A 4L5LA 2BXFA 1YVLA 3TDLA 5ELAA 4YQMA 4LUHA 3ERGA 1K3OA 5ECHB 5EY6A 4BVXA 4EC0A 3LG6A 4OTTA 3HMJG 4BL7B 5DJMA 5ECLB 2DBXA 2LQHA 2KBZA 4PURA 3Q74A 3VQIA 2DSAA 3KJYA 2IMIA 2LJRA 1MD3A 2LOQA 1V2AA 1M0UA 1BM0A 5D73A 6GSWA 1G6YA 3MHSB 2XMOA 2C80A 2JUHA 1GNEA 5A4WA 3UBLA 3B9MA 2XW0A 4TOPA 2WVZA 5FHIA 5GSSA 4ZBKA 1YKCA 2GDRA 4IQAA 4JEDA 2NQOA 2BXNA 1XWKA 1N5UA 3GSSA 3IE3A 5ECMB 5IJ5A 4I97A 3LU6A 3I6AA 4KH7A 1G7OA 3KJLA 5D9TA 4PGTA 2VCVA 4QQ7A 2EFHA 1EEMA 1S4BP 2O36A 2WVXB 2BXGA 5A34B 1GUKA 1GUMA 2WB9A 3HJMA 3BPJA 5ID7A 4Q5QA 3ZMLA 4BVYA 1Q4JA 2BXCA 5DCGA 1GTAA 4G10A 4PO0A 2HSNB 1H5WA 4N0UD 3R2QA 3VI5A 2VDBA 1YQ1A 2C3TA 5IJFA 7GSSA 5LD0A 3IR4A 5GINA 4IQ1A 5KEJA 3CX9A 1A0FA 3MHHB 4KF9A 4GDFA 1TW9A 4MF6A 3IC8A 2BXQA 1OE8A 1YDKA 2DBWA 3F63A 3GTUA 3NIVA 2VD0A 4Z9OA 4MF7A 3FR9A 2DBUA 2GTUA 2WW2A 2AJEA 4HZ4A 5HFKA 3UARA 5J41A 5A4UA 1AQXA 4IW9A 2V36A 1N25A 3F6DA 1I1IP 4AKGA 4HI7A 2WZSA 1GNWA 2A2RA 3QR6A 5J40A 3VPTA 3M0FA 3FWBC 1JLWA 5ELGA 3VWXA 4ZBRA 4J2FA 3KXOA 3PGTA 1MA9A 1AW9A 2BX8A 4IS0A 2HSMA 5BMUA 2ON5A 3PR8A 2VUEA 4K0GA 4YQVA 4MPFA 4TQ0A 1K0BA 2I30A 1LJRA 2PGTA 1VF1A 1XW6A 2PERA 4ZXGA 2V6KA 2DC5A 4KDYA 3WHSA 4ZBBA 1FHEA 6GSVA 1HK4A 4ECCA 5A5KA 3GH6A 1GUHA 4G0KA 4GLTA 3V08A 5J4VA 4KE3A 2XW1A 4N0VA 1AQVA 4RI6A 4NHZA 5A1NA 5F8BA 1AO6A 1LOTA 2CAIA 3GURA 3LXTA 3ISOA 3BBYA 1PL2A 5DALA 1J7EA 3V03A 1VF3A 2FHEA 2XVVA 3RBTA 1GLPA 3FWCC 1C72A 2CKXA 4ZB8A 1E7AA 2PVQA 3ERFA 5DQFA 3I69A 2XVUA 1M9AA 4G0LA 2VCXA 2CZ3A 4NHWA 1FW1A 4S1YA 1U87A 2VCTA 5ECKB 1MTCA 5A5HA 5ECOB 2JL4A 4FIPB 19GSA 3A73A 17GSA 4MZWA 4IVFA 1K0DA 2ON7A 2AGHB 2K0NA 5EVOA 1IYIA 1OYJA 2QMCA 4PQHA 1TDIA 1VFIA 5A4VA 1MM8A 4GSTA 5DJLA 1NHYA 1HK5A 1PGTA 5GZZB 2VKZG 1K3YA 2GSRA 9GSSA 4L8EA 4K0NA 4HGKA 2BXOA 2OT3A 3LFLA 3KMNA 2VCWA 4USSA 4GCIA 12GSA 3GSTA 3VK9A 4AKHA 1KDXA 3NVKA 1MD4A 1GWCA 2H1LA 3GQXA 3SIUB 1UA5A 4JZQA 4G04A 4IKHA 1O9XA 4WR5A 4ZBDA 3GA9L 4ZC6A 5D9WA 2OZBB 4WA6B 2BXBA 1JNBA 3A75A 2HRKB 1GSDA 3FY7A 4L8UA 1BF5A 1E7CA 1E7HA 2WS2A 1VF2A 1MIVA 5G5EA 4OFNA 3PLAA 4GF0A 1BAYA 1HNAA 1GSYA 1GTIA 1F3BA 5DAKA 5EL8A 5AIXA 3RGBC 3CWGA 2YV9A 1B48A 4ZCGA 2PMTA 5GSTA 1BJ5A 1EV9A 2C3NA 4PNFA 3KIKA 1VZSA 2Z8IA 14GSA 1E7EA 4FQUA 3W8SA 1V40A 2NNWA 4FK5B 3UAPA 3KMOA 5F07A 3WHQA 1YJ6A 2CA8A 3KTLA 1GLQA 5B5TA 3VURA 2UV8G 5ECSA 2R5GA 4KAEA 3U6VA 4GG2A 2NTOA 1E7FA 1B8XA 1KBNA 3L0HA 2CVDA 1K0MA 11GSA 1LNSA 5HOZA 4G03A 2BXAA 4OR0A 5ECRB 2EFCA 2IL3A 4EE0A 4EDYA 3JRYA 1K0AA 1PA3A 1PN9A 5ECIB 2HQTA 1PL1A 2PBJA 3LU8A 3WHRA 1K0OA 1ZL9A 1HNBA 2D2ZA 3HJOA 16GSA 4Q5FA 5AISA 1H9ZA 3FYGA 3H1NA 4J2VA 3AY8A 4OFMA 1GSEA 1PD21 2OACA 4ZBQA 4PTSA 4BL7A 4PHZC 3NVIA 3G7JA 3FNMA 1NT2B 4MF5A 4F0BA 3TU3B 4PX1A 3CHXC 4AGSA 1RK4A 1XWGA 2E0YA 3DD3A 1R5AA 1HK3A 2VCQA 1YEWC 2XSIA 1OKTA 1U3IA 1GSQA 3GUSA 1GULA 1N2AA 1MIYA 2BXLA 2BXDA 2QM6A 2N5FA 4F5TA 2WJUA 2LQIA 5DBYA 2HNLA 4YH2A 3QAWA 2GUTA 1TU7A 1E6BA 2BXMA 4F5VA 5IIXA 5DQSA 4G0IA 4PXOA 3VLNA 2BXHA 4GDLB 2CZ2A 4PI0C 2I2ZA 2WVXA
chains in the Genus database with same CATH topology
5GIOA 5A34A 1GSFA 2YCDA 5JCWA 4MDCA 4Q5NA 4EDZA 4BVXB 4L5OA 6GSUA 3LU7A 5D9XA 2HSNA 3N9JA 4MK3A 4ISDA 4YQUA 3PPUA 2OA7A 5BPKA 4IELA 1HNCA 4N3ZA 1ML6A 1VF4A 3SWLA 3LJRA 3WYWA 5F06A 4ECIA 2GLRA 4DEJA 4LB9A 4M70B 2F8FA 3TGZA 1KW2A 3LSZA 1ZGNA 4HJ2A 1E78A 4JK4A 4IBPA 4AKIA 4NAWB 2AHEA 5FT3A 1YY7A 4PNGA 1BG1A 13GSA 1B4PA 4JBBA 6GSSA 20GSA 1AQWA 3EE2A 3LQ7A 5IQYA 4FJCB 1BKEA 1K0CA 1HK1A 3QAGA 3H37A 2R6KA 5B7CA 1TF0A 3NMUA 5F0GA 6GSYA 3C8EA 4MBEC 5DDLA 3DGQA 4K2CA 1OE7A 3UBKA 3O3TA 1IJGA 1PX6A 3TOUA 4ECBA 1DUGA 1PMTA 4BVYB 5JCUA 2R3XA 4LA0A 2QHBA 2BXEA 1GTUA 3MDKA 3W1SA 4KX4A 1PX7A 1G6WA 5D9VA 1FOUA 1XW5A 2ROHA 4HOJA 5ECPB 4YAVA 1KXPD 1PKZA 4IJIA 2IMKA 4PQIA 4W4UB 4KDUA 5J5NA 3GTUB 4EMXA 4OMVA 2Z8JA 2GSQA 6GSTA 2GSSA 3P90A 4G19A 2XVWA 3M3MA 3KM6A 4F0CA 2BXPA 4GSNA 3M99C 3ZMKA 2XVQA 8GSSA 1EOGA 5AN1A 1F3AA 2WRTA 4G9HA 3WD6A 5IJEA 5ECNB 1E7GA 2HSMB 4ZBAA 4BKEA 4ZB6A 5BMUB 4F5SA 1PKWA 3G9KD 2VCZA 10GSA 3FRCA 5FUOA 4QMKA 1J78A 2A2SA 4O7HA 2BXKA 1F2EA 3IK7A 1GNJA 1USBA 4WR4A 1HA2A 2DG5A 3UIVA 2YV7A 5IIHA 3F6FA 4E68A 1MIWA 1TU8A 3VPQA 4HZ2A 4ECJA 3ZFBA 1E7BA 4GDXA 5IFOA 4F03A 4RI7A 5A1NB 4DHXB 2F3MA 4K71A 1SVLA 2X64A 3CSHA 5DALB 4HGMB 3R3EA 1EV4A 4OT2A 4O92A 3G7IA 2EFDA 1HQOA 3QAVA 4Q5RA 3LYKA 4YAPA 5F05A 2HRKA 4MP4A 2AB6A 5ECQB 3UVHA 5LCZA 4Z69A 1Y6EA 2AAWA 4KGIA 1M99A 3Q18A 3GX0A 5A5HB 2O5VA 3N5OA 4GDKB 3O76A 3FR3A 1GSSA 2HRAA 4E8HA 1U88A 4GSSA 3P8WA 1AXDA 4IGJA 1IYHA 3GQUA 1JLVA 4BY9C 3JQZA 2FNOA 3HKRA 4AI6A 2EFEA 4MPGA 5J4YA 5J4UA 2DYOA 4C31B 4TQ1A 5FWGA 5GIPA 4ZB7A 4CHSA 4PUAA 5D7GA 1UORA 3VI7A 3SIVB 3LYPA 3SQJA 4ID0A 4AKXB 4KSMA 1GSUA 4N0FD 5AGYA 3TOTA 2YDFA 3IK9A 3D0ZA 4ZUXV 18GSA 4ACSA 5IIUA 2GSTA 3LXZA 1EOHA 3M8NA 1BYEA 2VD1A 4ZB9A 1BG5A 1LBKA 3CSJA 3FR6A 5AIVA 2BXIA 3CSIA 2Z8KA 1GNIA 2UZ8A 4L9KA 4LMWA 1SVMA 2WDUA 1GTBA 4L9QA 1HK2A 4LB2A 4IW2A 1K0NA 1TXUA 4OFTA 6GSXA 3IBHA 3NVMA 4E8EA 5DAKB 4G01A 1BX9A 1M9BA 1E7IA 5GHKA 4IW1A 3EINA 2VUFA 3B9LA 3H3AA 5G5FA 4NAXA 2E0XA 3ICXA 3V09A 4E99A 2C8UA 3CRTA 22GSA 3M1GA 3CRUA 4F5UA 1JZRA 1Y1UA 2R4VA 2VO4A 5J47A 4GTUA 3MAKA 3CBUA 4OTUA 5ID9A 4EXJA 2CAQA 1Z9HA 2OADA 4KDXA 4W66A 4LMVA 4LUFA 2DYMA 1K3LA 2J9HA 2C3QA 1SVOA 2C4JA 3Q19A 4L5LA 2BXFA 1YVLA 3TDLA 5ELAA 4YQMA 4LUHA 3ERGA 1K3OA 5ECHB 5EY6A 4BVXA 4EC0A 3LG6A 4OTTA 3HMJG 4BL7B 5DJMA 5ECLB 2DBXA 2KBZA 4PURA 3Q74A 3VQIA 2DSAA 3KJYA 2IMIA 2LJRA 1MD3A 2LOQA 1V2AA 1M0UA 1BM0A 5D73A 6GSWA 1G6YA 3MHSB 2XMOA 2C80A 2JUHA 1GNEA 5A4WA 3UBLA 3B9MA 2XW0A 4TOPA 5FHIA 5GSSA 4ZBKA 1YKCA 2GDRA 4IQAA 4JEDA 2NQOA 2BXNA 1XWKA 1N5UA 3GSSA 3IE3A 5ECMB 5IJ5A 4I97A 3LU6A 3I6AA 4KH7A 1G7OA 3KJLA 5D9TA 4PGTA 2VCVA 4QQ7A 2EFHA 1EEMA 5A34B 2BXGA 1GUKA 1GUMA 2WB9A 3HJMA 5ID7A 4Q5QA 3ZMLA 4BVYA 1Q4JA 2BXCA 5DCGA 1GTAA 4G10A 4PO0A 2HSNB 1H5WA 4N0UD 3R2QA 3VI5A 2VDBA 1YQ1A 2C3TA 5IJFA 7GSSA 5LD0A 3IR4A 5GINA 4IQ1A 5KEJA 3CX9A 1A0FA 3MHHB 4KF9A 4GDFA 1TW9A 4MF6A 3IC8A 2BXQA 1OE8A 1YDKA 2DBWA 3F63A 3GTUA 3NIVA 2VD0A 4Z9OA 4MF7A 3FR9A 2DBUA 2GTUA 4HZ4A 2AJEA 5HFKA 3UARA 5J41A 5A4UA 1AQXA 4IW9A 2V36A 1N25A 3F6DA 4AKGA 4HI7A 1GNWA 2A2RA 3QR6A 5J40A 3VPTA 3M0FA 3FWBC 1JLWA 5ELGA 3VWXA 4ZBRA 4J2FA 3KXOA 3PGTA 1MA9A 1AW9A 2BX8A 4IS0A 2HSMA 5BMUA 2ON5A 3PR8A 2VUEA 4K0GA 4YQVA 4MPFA 1K0BA 4TQ0A 2I30A 1LJRA 2PGTA 1VF1A 1XW6A 2PERA 4ZXGA 2V6KA 2DC5A 4KDYA 3WHSA 4ZBBA 1FHEA 6GSVA 1HK4A 4ECCA 5A5KA 3GH6A 1GUHA 4G0KA 4GLTA 3V08A 5J4VA 4KE3A 2XW1A 4N0VA 1AQVA 4RI6A 4NHZA 5A1NA 5F8BA 1AO6A 1LOTA 2CAIA 3GURA 3LXTA 3ISOA 3BBYA 1PL2A 5DALA 1J7EA 3V03A 1VF3A 2FHEA 2XVVA 3RBTA 1GLPA 3FWCC 1C72A 2CKXA 4ZB8A 1E7AA 2PVQA 3ERFA 5DQFA 3I69A 2XVUA 1M9AA 4G0LA 2VCXA 2CZ3A 4NHWA 1FW1A 4S1YA 1U87A 2VCTA 5ECKB 1MTCA 5A5HA 5ECOB 2JL4A 4FIPB 19GSA 3A73A 17GSA 4MZWA 4IVFA 1K0DA 2ON7A 5EVOA 1IYIA 1OYJA 2QMCA 4PQHA 1TDIA 1VFIA 5A4VA 4GSTA 5DJLA 1NHYA 1HK5A 1PGTA 5GZZB 2VKZG 1K3YA 2GSRA 9GSSA 4L8EA 4K0NA 4HGKA 2BXOA 2OT3A 3LFLA 3KMNA 2VCWA 4USSA 4GCIA 12GSA 3GSTA 3VK9A 4AKHA 3NVKA 1MD4A 1GWCA 2H1LA 3GQXA 3SIUB 1UA5A 4JZQA 4G04A 4IKHA 1O9XA 4ZBDA 3GA9L 4ZC6A 5D9WA 2OZBB 4WA6B 2BXBA 1JNBA 3A75A 2HRKB 1GSDA 3FY7A 4L8UA 1BF5A 1E7CA 1E7HA 2WS2A 1VF2A 1MIVA 5G5EA 4OFNA 3PLAA 4GF0A 1BAYA 1HNAA 1GSYA 1GTIA 1F3BA 5DAKA 5EL8A 5AIXA 3CWGA 2YV9A 1B48A 4ZCGA 2PMTA 5GSTA 1BJ5A 1EV9A 2C3NA 4PNFA 3KIKA 1VZSA 2Z8IA 14GSA 1E7EA 4FQUA 3W8SA 1V40A 2NNWA 4FK5B 3UAPA 3KMOA 5F07A 3WHQA 1YJ6A 2CA8A 3KTLA 1GLQA 5B5TA 3VURA 2UV8G 5ECSA 2R5GA 4KAEA 3U6VA 4GG2A 2NTOA 1E7FA 1B8XA 1KBNA 3L0HA 2CVDA 1K0MA 11GSA 1LNSA 5HOZA 4G03A 2BXAA 4OR0A 5ECRB 2EFCA 2IL3A 4EE0A 4EDYA 3JRYA 1K0AA 1PA3A 1PN9A 5ECIB 2HQTA 1PL1A 2PBJA 3LU8A 3WHRA 1K0OA 1ZL9A 1HNBA 2D2ZA 3HJOA 16GSA 4Q5FA 5AISA 1H9ZA 3FYGA 3H1NA 4J2VA 3AY8A 4OFMA 1GSEA 1PD21 2OACA 4ZBQA 4PTSA 4BL7A 3NVIA 3G7JA 3FNMA 1NT2B 4MF5A 4F0BA 3TU3B 4PX1A 4AGSA 1RK4A 1XWGA 2E0YA 3DD3A 1R5AA 1HK3A 2VCQA 2XSIA 1OKTA 1U3IA 1GSQA 3GUSA 1GULA 1N2AA 1MIYA 2BXLA 2BXDA 2QM6A 2N5FA 4F5TA 2WJUA 5DBYA 2HNLA 4YH2A 3QAWA 1TU7A 1E6BA 2BXMA 4F5VA 5IIXA 5DQSA 4G0IA 4PXOA 3VLNA 2BXHA 4GDLB 2CZ2A 4WR5A 2I2ZA 3ZFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFH A;  2OT3 A;  1TXU A;  2EFE A;  2EFC A;  4G01 A;  2EFD A;  4N3Z A; 
#chains in the Genus database with same CATH topology
 5GIO A;  5A34 A;  1GSF A;  2YCD A;  5JCW A;  4MDC A;  4Q5N A;  4EDZ A;  4BVX B;  4L5O A;  6GSU A;  3LU7 A;  5D9X A;  2HSN A;  3N9J A;  4MK3 A;  4ISD A;  4YQU A;  3PPU A;  2OA7 A;  5BPK A;  4IEL A;  1HNC A;  4N3Z A;  1ML6 A;  1VF4 A;  3SWL A;  3LJR A;  3WYW A;  5F06 A;  4ECI A;  2GLR A;  4DEJ A;  4LB9 A;  4M70 B;  2F8F A;  3TGZ A;  1KW2 A;  3LSZ A;  1ZGN A;  4HJ2 A;  1E78 A;  4JK4 A;  4IBP A;  4AKI A;  2WW3 A;  4NAW B;  2AHE A;  5FT3 A;  1YY7 A;  4PNG A;  1BG1 A;  13GS A;  1B4P A;  4JBB A;  6GSS A;  20GS A;  1AQW A;  3EE2 A;  3LQ7 A;  5IQY A;  4FJC B;  1BKE A;  1K0C A;  1HK1 A;  3QAG A;  3H37 A;  2R6K A;  5B7C A;  1TF0 A;  3NMU A;  5F0G A;  6GSY A;  3C8E A;  4MBE C;  5DDL A;  3DGQ A;  4PI2 C;  4K2C A;  1OE7 A;  3UBK A;  3O3T A;  1IJG A;  1PX6 A;  3TOU A;  4ECB A;  1DUG A;  4FXY P;  1PMT A;  4BVY B;  3ECP A;  5JCU A;  2R3X A;  4LA0 A;  2QHB A;  2BXE A;  1GTU A;  3MDK A;  3W1S A;  4KX4 A;  1PX7 A;  1G6W A;  1MUH A;  5D9V A;  1FOU A;  1XW5 A;  2ROH A;  4HOJ A;  5ECP B;  4I9O A;  4YAV A;  1KXP D;  1PKZ A;  4IJI A;  2IMK A;  4PQI A;  4W4U B;  4KDU A;  5J5N A;  3GTU B;  4EMX A;  4OMV A;  1SB0 A;  2Z8J A;  2GSQ A;  6GST A;  2GSS A;  3P90 A;  4G19 A;  2XVW A;  3M3M A;  2KWF A;  3KM6 A;  4F0C A;  2BXP A;  4GSN A;  3M99 C;  3ZMK A;  2XVQ A;  8GSS A;  1EOG A;  5AN1 A;  1F3A A;  2WRT A;  4G9H A;  3WD6 A;  5IJE A;  5ECN B;  1E7G A;  2HSM B;  4ZBA A;  4BKE A;  4ZB6 A;  5BMU B;  4F5S A;  1PKW A;  3G9K D;  2VCZ A;  10GS A;  3FRC A;  5FUO A;  4QMK A;  1J78 A;  2A2S A;  4O7H A;  2BXK A;  1F2E A;  3IK7 A;  1GNJ A;  1USB A;  4WR4 A;  1HA2 A;  2DG5 A;  3UIV A;  2YV7 A;  5IIH A;  3F6F A;  4E68 A;  1MIW A;  1TU8 A;  3VPQ A;  4HZ2 A;  4ECJ A;  3ZFB A;  1E7B A;  4GDX A;  5IFO A;  4F03 A;  4RI7 A;  5A1N B;  4DHX B;  2F3M A;  4K71 A;  1SVL A;  2X64 A;  3CSH A;  5DAL B;  4HGM B;  3R3E A;  2O3E A;  1EV4 A;  4OT2 A;  4O92 A;  3G7I A;  2EFD A;  1HQO A;  3QAV A;  4Q5R A;  3LYK A;  4YAP A;  5F05 A;  3RFR C;  2HRK A;  4MP4 A;  2AB6 A;  5ECQ B;  3UVH A;  4D7X A;  4Z69 A;  5LCZ A;  1Y6E A;  2AAW A;  4KGI A;  1M99 A;  3Q18 A;  3GX0 A;  5A5H B;  2O5V A;  3N5O A;  4GDK B;  3O76 A;  3FR3 A;  1GSS A;  2HRA A;  4E8H A;  1U88 A;  4GSS A;  3P8W A;  1AXD A;  4IGJ A;  1IYH A;  3GQU A;  1JLV A;  4BY9 C;  3JQZ A;  2FNO A;  3HKR A;  4AI6 A;  2EFE A;  4MPG A;  5J4Y A;  5J4U A;  2DYO A;  4C31 B;  4TQ1 A;  2WW1 A;  5FWG A;  1MUS A;  5GIP A;  4ZB7 A;  3ZFL A;  4CHS A;  4PUA A;  5D7G A;  1UOR A;  3VI7 A;  3SIV B;  3LYP A;  3SQJ A;  4ID0 A;  4AKX B;  4KSM A;  1GSU A;  4N0F D;  5AGY A;  3TOT A;  2YDF A;  3IK9 A;  3D0Z A;  4ZUX V;  18GS A;  4ACS A;  5IIU A;  2GST A;  3LXZ A;  1EOH A;  3M8N A;  1BYE A;  2VD1 A;  4ZB9 A;  1BG5 A;  1LBK A;  3CSJ A;  3FR6 A;  5AIV A;  2BXI A;  3CSI A;  2Z8K A;  1GNI A;  4DM0 A;  2UZ8 A;  4L9K A;  4LMW A;  1SVM A;  2WDU A;  1GTB A;  4L9Q A;  1HK2 A;  4LB2 A;  4IW2 A;  2LXS A;  2LXT A;  1K0N A;  1TXU A;  4OFT A;  6GSX A;  3IBH A;  3NVM A;  2WVY A;  5DAK B;  4E8E A;  4G01 A;  1BX9 A;  1M9B A;  1E7I A;  5GHK A;  4IW1 A;  3EIN A;  2VUF A;  3B9L A;  3H3A A;  5G5F A;  2WW0 A;  4NAX A;  2E0X A;  3ICX A;  3V09 A;  4E99 A;  2C8U A;  3CRT A;  22GS A;  3M1G A;  3CRU A;  4F5U A;  1JZR A;  1Y1U A;  2R4V A;  2VO4 A;  5J47 A;  4GTU A;  3MAK A;  3CBU A;  4OTU A;  5ID9 A;  4EXJ A;  2CAQ A;  1Z9H A;  2OAD A;  4KDX A;  4W66 A;  4LMV A;  4LUF A;  2DYM A;  1K3L A;  2J9H A;  2C3Q A;  1SVO A;  2C4J A;  3Q19 A;  4L5L A;  2BXF A;  1YVL A;  3TDL A;  5ELA A;  4YQM A;  4LUH A;  3ERG A;  1K3O A;  5ECH B;  5EY6 A;  4BVX A;  4EC0 A;  3LG6 A;  4OTT A;  3HMJ G;  4BL7 B;  5DJM A;  5ECL B;  2DBX A;  2LQH A;  2KBZ A;  4PUR A;  3Q74 A;  3VQI A;  2DSA A;  3KJY A;  2IMI A;  2LJR A;  1MD3 A;  2LOQ A;  1V2A A;  1M0U A;  1BM0 A;  5D73 A;  6GSW A;  1G6Y A;  3MHS B;  2XMO A;  2C80 A;  2JUH A;  1GNE A;  5A4W A;  3UBL A;  3B9M A;  2XW0 A;  4TOP A;  2WVZ A;  5FHI A;  5GSS A;  4ZBK A;  1YKC A;  2GDR A;  4IQA A;  4JED A;  2NQO A;  2BXN A;  1XWK A;  1N5U A;  3GSS A;  3IE3 A;  5ECM B;  5IJ5 A;  4I97 A;  3LU6 A;  3I6A A;  4KH7 A;  1G7O A;  3KJL A;  5D9T A;  4PGT A;  2VCV A;  4QQ7 A;  2EFH A;  1EEM A;  1S4B P;  2O36 A;  2WVX B;  2BXG A;  5A34 B;  1GUK A;  1GUM A;  2WB9 A;  3HJM A;  3BPJ A;  5ID7 A;  4Q5Q A;  3ZML A;  4BVY A;  1Q4J A;  2BXC A;  5DCG A;  1GTA A;  4G10 A;  4PO0 A;  2HSN B;  1H5W A;  4N0U D;  3R2Q A;  3VI5 A;  2VDB A;  1YQ1 A;  2C3T A;  5IJF A;  7GSS A;  5LD0 A;  3IR4 A;  5GIN A;  4IQ1 A;  5KEJ A;  3CX9 A;  1A0F A;  3MHH B;  4KF9 A;  4GDF A;  1TW9 A;  4MF6 A;  3IC8 A;  2BXQ A;  1OE8 A;  1YDK A;  2DBW A;  3F63 A;  3GTU A;  3NIV A;  2VD0 A;  4Z9O A;  4MF7 A;  3FR9 A;  2DBU A;  2GTU A;  2WW2 A;  2AJE A;  4HZ4 A;  5HFK A;  3UAR A;  5J41 A;  5A4U A;  1AQX A;  4IW9 A;  2V36 A;  1N25 A;  3F6D A;  1I1I P;  4AKG A;  4HI7 A;  2WZS A;  1GNW A;  2A2R A;  3QR6 A;  5J40 A;  3VPT A;  3M0F A;  3FWB C;  1JLW A;  5ELG A;  3VWX A;  4ZBR A;  4J2F A;  3KXO A;  3PGT A;  1MA9 A;  1AW9 A;  2BX8 A;  4IS0 A;  2HSM A;  5BMU A;  2ON5 A;  3PR8 A;  2VUE A;  4K0G A;  4YQV A;  4MPF A;  4TQ0 A;  1K0B A;  2I30 A;  1LJR A;  2PGT A;  1VF1 A;  1XW6 A;  2PER A;  4ZXG A;  2V6K A;  2DC5 A;  4KDY A;  3WHS A;  4ZBB A;  1FHE A;  6GSV A;  1HK4 A;  4ECC A;  5A5K A;  3GH6 A;  1GUH A;  4G0K A;  4GLT A;  3V08 A;  5J4V A;  4KE3 A;  2XW1 A;  4N0V A;  1AQV A;  4RI6 A;  4NHZ A;  5A1N A;  5F8B A;  1AO6 A;  1LOT A;  2CAI A;  3GUR A;  3LXT A;  3ISO A;  3BBY A;  1PL2 A;  5DAL A;  1J7E A;  3V03 A;  1VF3 A;  2FHE A;  2XVV A;  3RBT A;  1GLP A;  3FWC C;  1C72 A;  2CKX A;  4ZB8 A;  1E7A A;  2PVQ A;  3ERF A;  5DQF A;  3I69 A;  2XVU A;  1M9A A;  4G0L A;  2VCX A;  2CZ3 A;  4NHW A;  1FW1 A;  4S1Y A;  1U87 A;  2VCT A;  5ECK B;  1MTC A;  5A5H A;  5ECO B;  2JL4 A;  4FIP B;  19GS A;  3A73 A;  17GS A;  4MZW A;  4IVF A;  1K0D A;  2ON7 A;  2AGH B;  2K0N A;  5EVO A;  1IYI A;  1OYJ A;  2QMC A;  4PQH A;  1TDI A;  1VFI A;  5A4V A;  1MM8 A;  4GST A;  5DJL A;  1NHY A;  1HK5 A;  1PGT A;  5GZZ B;  2VKZ G;  1K3Y A;  2GSR A;  9GSS A;  4L8E A;  4K0N A;  4HGK A;  2BXO A;  2OT3 A;  3LFL A;  3KMN A;  2VCW A;  4USS A;  4GCI A;  12GS A;  3GST A;  3VK9 A;  4AKH A;  1KDX A;  3NVK A;  1MD4 A;  1GWC A;  2H1L A;  3GQX A;  3SIU B;  1UA5 A;  4JZQ A;  4G04 A;  4IKH A;  1O9X A;  4WR5 A;  4ZBD A;  3GA9 L;  4ZC6 A;  5D9W A;  2OZB B;  4WA6 B;  2BXB A;  1JNB A;  3A75 A;  2HRK B;  1GSD A;  3FY7 A;  4L8U A;  1BF5 A;  1E7C A;  1E7H A;  2WS2 A;  1VF2 A;  1MIV A;  5G5E A;  4OFN A;  3PLA A;  4GF0 A;  1BAY A;  1HNA A;  1GSY A;  1GTI A;  1F3B A;  5DAK A;  5EL8 A;  5AIX A;  3RGB C;  3CWG A;  2YV9 A;  1B48 A;  4ZCG A;  2PMT A;  5GST A;  1BJ5 A;  1EV9 A;  2C3N A;  4PNF A;  3KIK A;  1VZS A;  2Z8I A;  14GS A;  1E7E A;  4FQU A;  3W8S A;  1V40 A;  2NNW A;  4FK5 B;  3UAP A;  3KMO A;  5F07 A;  3WHQ A;  1YJ6 A;  2CA8 A;  3KTL A;  1GLQ A;  5B5T A;  3VUR A;  2UV8 G;  5ECS A;  2R5G A;  4KAE A;  3U6V A;  4GG2 A;  2NTO A;  1E7F A;  1B8X A;  1KBN A;  3L0H A;  2CVD A;  1K0M A;  11GS A;  1LNS A;  5HOZ A;  4G03 A;  2BXA A;  4OR0 A;  5ECR B;  2EFC A;  2IL3 A;  4EE0 A;  4EDY A;  3JRY A;  1K0A A;  1PA3 A;  1PN9 A;  5ECI B;  2HQT A;  1PL1 A;  2PBJ A;  3LU8 A;  3WHR A;  1K0O A;  1ZL9 A;  1HNB A;  2D2Z A;  3HJO A;  16GS A;  4Q5F A;  5AIS A;  1H9Z A;  3FYG A;  3H1N A;  4J2V A;  3AY8 A;  4OFM A;  1GSE A;  1PD2 1;  2OAC A;  4ZBQ A;  4PTS A;  4BL7 A;  4PHZ C;  3NVI A;  3G7J A;  3FNM A;  1NT2 B;  4MF5 A;  4F0B A;  3TU3 B;  4PX1 A;  3CHX C;  4AGS A;  1RK4 A;  1XWG A;  2E0Y A;  3DD3 A;  1R5A A;  1HK3 A;  2VCQ A;  1YEW C;  2XSI A;  1OKT A;  1U3I A;  1GSQ A;  3GUS A;  1GUL A;  1N2A A;  1MIY A;  2BXL A;  2BXD A;  2QM6 A;  2N5F A;  4F5T A;  2WJU A;  2LQI A;  5DBY A;  2HNL A;  4YH2 A;  3QAW A;  2GUT A;  1TU7 A;  1E6B A;  2BXM A;  4F5V A;  5IIX A;  5DQS A;  4G0I A;  4PXO A;  3VLN A;  2BXH A;  4GDL B;  2CZ2 A;  4PI0 C;  2I2Z A;  2WVX A; 
#chains in the Genus database with same CATH homology
 5GIO A;  5A34 A;  1GSF A;  2YCD A;  5JCW A;  4MDC A;  4Q5N A;  4EDZ A;  4BVX B;  4L5O A;  6GSU A;  3LU7 A;  5D9X A;  2HSN A;  3N9J A;  4MK3 A;  4ISD A;  4YQU A;  3PPU A;  2OA7 A;  5BPK A;  4IEL A;  1HNC A;  4N3Z A;  1ML6 A;  1VF4 A;  3SWL A;  3LJR A;  3WYW A;  5F06 A;  4ECI A;  2GLR A;  4DEJ A;  4LB9 A;  4M70 B;  2F8F A;  3TGZ A;  1KW2 A;  3LSZ A;  1ZGN A;  4HJ2 A;  1E78 A;  4JK4 A;  4IBP A;  4AKI A;  4NAW B;  2AHE A;  5FT3 A;  1YY7 A;  4PNG A;  1BG1 A;  13GS A;  1B4P A;  4JBB A;  6GSS A;  20GS A;  1AQW A;  3EE2 A;  3LQ7 A;  5IQY A;  4FJC B;  1BKE A;  1K0C A;  1HK1 A;  3QAG A;  3H37 A;  2R6K A;  5B7C A;  1TF0 A;  3NMU A;  5F0G A;  6GSY A;  3C8E A;  4MBE C;  5DDL A;  3DGQ A;  4K2C A;  1OE7 A;  3UBK A;  3O3T A;  1IJG A;  1PX6 A;  3TOU A;  4ECB A;  1DUG A;  1PMT A;  4BVY B;  5JCU A;  2R3X A;  4LA0 A;  2QHB A;  2BXE A;  1GTU A;  3MDK A;  3W1S A;  4KX4 A;  1PX7 A;  1G6W A;  5D9V A;  1FOU A;  1XW5 A;  2ROH A;  4HOJ A;  5ECP B;  4YAV A;  1KXP D;  1PKZ A;  4IJI A;  2IMK A;  4PQI A;  4W4U B;  4KDU A;  5J5N A;  3GTU B;  4EMX A;  4OMV A;  2Z8J A;  2GSQ A;  6GST A;  2GSS A;  3P90 A;  4G19 A;  2XVW A;  3M3M A;  3KM6 A;  4F0C A;  2BXP A;  4GSN A;  3M99 C;  3ZMK A;  2XVQ A;  8GSS A;  1EOG A;  5AN1 A;  1F3A A;  2WRT A;  4G9H A;  3WD6 A;  5IJE A;  5ECN B;  1E7G A;  2HSM B;  4ZBA A;  4BKE A;  4ZB6 A;  5BMU B;  4F5S A;  1PKW A;  3G9K D;  2VCZ A;  10GS A;  3FRC A;  5FUO A;  4QMK A;  1J78 A;  2A2S A;  4O7H A;  2BXK A;  1F2E A;  3IK7 A;  1GNJ A;  1USB A;  4WR4 A;  1HA2 A;  2DG5 A;  3UIV A;  2YV7 A;  5IIH A;  3F6F A;  4E68 A;  1MIW A;  1TU8 A;  3VPQ A;  4HZ2 A;  4ECJ A;  3ZFB A;  1E7B A;  4GDX A;  5IFO A;  4F03 A;  4RI7 A;  5A1N B;  4DHX B;  2F3M A;  4K71 A;  1SVL A;  2X64 A;  3CSH A;  5DAL B;  4HGM B;  3R3E A;  1EV4 A;  4OT2 A;  4O92 A;  3G7I A;  2EFD A;  1HQO A;  3QAV A;  4Q5R A;  3LYK A;  4YAP A;  5F05 A;  2HRK A;  4MP4 A;  2AB6 A;  5ECQ B;  3UVH A;  5LCZ A;  4Z69 A;  1Y6E A;  2AAW A;  4KGI A;  1M99 A;  3Q18 A;  3GX0 A;  5A5H B;  2O5V A;  3N5O A;  4GDK B;  3O76 A;  3FR3 A;  1GSS A;  2HRA A;  4E8H A;  1U88 A;  4GSS A;  3P8W A;  1AXD A;  4IGJ A;  1IYH A;  3GQU A;  1JLV A;  4BY9 C;  3JQZ A;  2FNO A;  3HKR A;  4AI6 A;  2EFE A;  4MPG A;  5J4Y A;  5J4U A;  2DYO A;  4C31 B;  4TQ1 A;  5FWG A;  5GIP A;  4ZB7 A;  4CHS A;  4PUA A;  5D7G A;  1UOR A;  3VI7 A;  3SIV B;  3LYP A;  3SQJ A;  4ID0 A;  4AKX B;  4KSM A;  1GSU A;  4N0F D;  5AGY A;  3TOT A;  2YDF A;  3IK9 A;  3D0Z A;  4ZUX V;  18GS A;  4ACS A;  5IIU A;  2GST A;  3LXZ A;  1EOH A;  3M8N A;  1BYE A;  2VD1 A;  4ZB9 A;  1BG5 A;  1LBK A;  3CSJ A;  3FR6 A;  5AIV A;  2BXI A;  3CSI A;  2Z8K A;  1GNI A;  2UZ8 A;  4L9K A;  4LMW A;  1SVM A;  2WDU A;  1GTB A;  4L9Q A;  1HK2 A;  4LB2 A;  4IW2 A;  1K0N A;  1TXU A;  4OFT A;  6GSX A;  3IBH A;  3NVM A;  4E8E A;  5DAK B;  4G01 A;  1BX9 A;  1M9B A;  1E7I A;  5GHK A;  4IW1 A;  3EIN A;  2VUF A;  3B9L A;  3H3A A;  5G5F A;  4NAX A;  2E0X A;  3ICX A;  3V09 A;  4E99 A;  2C8U A;  3CRT A;  22GS A;  3M1G A;  3CRU A;  4F5U A;  1JZR A;  1Y1U A;  2R4V A;  2VO4 A;  5J47 A;  4GTU A;  3MAK A;  3CBU A;  4OTU A;  5ID9 A;  4EXJ A;  2CAQ A;  1Z9H A;  2OAD A;  4KDX A;  4W66 A;  4LMV A;  4LUF A;  2DYM A;  1K3L A;  2J9H A;  2C3Q A;  1SVO A;  2C4J A;  3Q19 A;  4L5L A;  2BXF A;  1YVL A;  3TDL A;  5ELA A;  4YQM A;  4LUH A;  3ERG A;  1K3O A;  5ECH B;  5EY6 A;  4BVX A;  4EC0 A;  3LG6 A;  4OTT A;  3HMJ G;  4BL7 B;  5DJM A;  5ECL B;  2DBX A;  2KBZ A;  4PUR A;  3Q74 A;  3VQI A;  2DSA A;  3KJY A;  2IMI A;  2LJR A;  1MD3 A;  2LOQ A;  1V2A A;  1M0U A;  1BM0 A;  5D73 A;  6GSW A;  1G6Y A;  3MHS B;  2XMO A;  2C80 A;  2JUH A;  1GNE A;  5A4W A;  3UBL A;  3B9M A;  2XW0 A;  4TOP A;  5FHI A;  5GSS A;  4ZBK A;  1YKC A;  2GDR A;  4IQA A;  4JED A;  2NQO A;  2BXN A;  1XWK A;  1N5U A;  3GSS A;  3IE3 A;  5ECM B;  5IJ5 A;  4I97 A;  3LU6 A;  3I6A A;  4KH7 A;  1G7O A;  3KJL A;  5D9T A;  4PGT A;  2VCV A;  4QQ7 A;  2EFH A;  1EEM A;  5A34 B;  2BXG A;  1GUK A;  1GUM A;  2WB9 A;  3HJM A;  5ID7 A;  4Q5Q A;  3ZML A;  4BVY A;  1Q4J A;  2BXC A;  5DCG A;  1GTA A;  4G10 A;  4PO0 A;  2HSN B;  1H5W A;  4N0U D;  3R2Q A;  3VI5 A;  2VDB A;  1YQ1 A;  2C3T A;  5IJF A;  7GSS A;  5LD0 A;  3IR4 A;  5GIN A;  4IQ1 A;  5KEJ A;  3CX9 A;  1A0F A;  3MHH B;  4KF9 A;  4GDF A;  1TW9 A;  4MF6 A;  3IC8 A;  2BXQ A;  1OE8 A;  1YDK A;  2DBW A;  3F63 A;  3GTU A;  3NIV A;  2VD0 A;  4Z9O A;  4MF7 A;  3FR9 A;  2DBU A;  2GTU A;  4HZ4 A;  2AJE A;  5HFK A;  3UAR A;  5J41 A;  5A4U A;  1AQX A;  4IW9 A;  2V36 A;  1N25 A;  3F6D A;  4AKG A;  4HI7 A;  1GNW A;  2A2R A;  3QR6 A;  5J40 A;  3VPT A;  3M0F A;  3FWB C;  1JLW A;  5ELG A;  3VWX A;  4ZBR A;  4J2F A;  3KXO A;  3PGT A;  1MA9 A;  1AW9 A;  2BX8 A;  4IS0 A;  2HSM A;  5BMU A;  2ON5 A;  3PR8 A;  2VUE A;  4K0G A;  4YQV A;  4MPF A;  1K0B A;  4TQ0 A;  2I30 A;  1LJR A;  2PGT A;  1VF1 A;  1XW6 A;  2PER A;  4ZXG A;  2V6K A;  2DC5 A;  4KDY A;  3WHS A;  4ZBB A;  1FHE A;  6GSV A;  1HK4 A;  4ECC A;  5A5K A;  3GH6 A;  1GUH A;  4G0K A;  4GLT A;  3V08 A;  5J4V A;  4KE3 A;  2XW1 A;  4N0V A;  1AQV A;  4RI6 A;  4NHZ A;  5A1N A;  5F8B A;  1AO6 A;  1LOT A;  2CAI A;  3GUR A;  3LXT A;  3ISO A;  3BBY A;  1PL2 A;  5DAL A;  1J7E A;  3V03 A;  1VF3 A;  2FHE A;  2XVV A;  3RBT A;  1GLP A;  3FWC C;  1C72 A;  2CKX A;  4ZB8 A;  1E7A A;  2PVQ A;  3ERF A;  5DQF A;  3I69 A;  2XVU A;  1M9A A;  4G0L A;  2VCX A;  2CZ3 A;  4NHW A;  1FW1 A;  4S1Y A;  1U87 A;  2VCT A;  5ECK B;  1MTC A;  5A5H A;  5ECO B;  2JL4 A;  4FIP B;  19GS A;  3A73 A;  17GS A;  4MZW A;  4IVF A;  1K0D A;  2ON7 A;  5EVO A;  1IYI A;  1OYJ A;  2QMC A;  4PQH A;  1TDI A;  1VFI A;  5A4V A;  4GST A;  5DJL A;  1NHY A;  1HK5 A;  1PGT A;  5GZZ B;  2VKZ G;  1K3Y A;  2GSR A;  9GSS A;  4L8E A;  4K0N A;  4HGK A;  2BXO A;  2OT3 A;  3LFL A;  3KMN A;  2VCW A;  4USS A;  4GCI A;  12GS A;  3GST A;  3VK9 A;  4AKH A;  3NVK A;  1MD4 A;  1GWC A;  2H1L A;  3GQX A;  3SIU B;  1UA5 A;  4JZQ A;  4G04 A;  4IKH A;  1O9X A;  4ZBD A;  3GA9 L;  4ZC6 A;  5D9W A;  2OZB B;  4WA6 B;  2BXB A;  1JNB A;  3A75 A;  2HRK B;  1GSD A;  3FY7 A;  4L8U A;  1BF5 A;  1E7C A;  1E7H A;  2WS2 A;  1VF2 A;  1MIV A;  5G5E A;  4OFN A;  3PLA A;  4GF0 A;  1BAY A;  1HNA A;  1GSY A;  1GTI A;  1F3B A;  5DAK A;  5EL8 A;  5AIX A;  3CWG A;  2YV9 A;  1B48 A;  4ZCG A;  2PMT A;  5GST A;  1BJ5 A;  1EV9 A;  2C3N A;  4PNF A;  3KIK A;  1VZS A;  2Z8I A;  14GS A;  1E7E A;  4FQU A;  3W8S A;  1V40 A;  2NNW A;  4FK5 B;  3UAP A;  3KMO A;  5F07 A;  3WHQ A;  1YJ6 A;  2CA8 A;  3KTL A;  1GLQ A;  5B5T A;  3VUR A;  2UV8 G;  5ECS A;  2R5G A;  4KAE A;  3U6V A;  4GG2 A;  2NTO A;  1E7F A;  1B8X A;  1KBN A;  3L0H A;  2CVD A;  1K0M A;  11GS A;  1LNS A;  5HOZ A;  4G03 A;  2BXA A;  4OR0 A;  5ECR B;  2EFC A;  2IL3 A;  4EE0 A;  4EDY A;  3JRY A;  1K0A A;  1PA3 A;  1PN9 A;  5ECI B;  2HQT A;  1PL1 A;  2PBJ A;  3LU8 A;  3WHR A;  1K0O A;  1ZL9 A;  1HNB A;  2D2Z A;  3HJO A;  16GS A;  4Q5F A;  5AIS A;  1H9Z A;  3FYG A;  3H1N A;  4J2V A;  3AY8 A;  4OFM A;  1GSE A;  1PD2 1;  2OAC A;  4ZBQ A;  4PTS A;  4BL7 A;  3NVI A;  3G7J A;  3FNM A;  1NT2 B;  4MF5 A;  4F0B A;  3TU3 B;  4PX1 A;  4AGS A;  1RK4 A;  1XWG A;  2E0Y A;  3DD3 A;  1R5A A;  1HK3 A;  2VCQ A;  2XSI A;  1OKT A;  1U3I A;  1GSQ A;  3GUS A;  1GUL A;  1N2A A;  1MIY A;  2BXL A;  2BXD A;  2QM6 A;  2N5F A;  4F5T A;  2WJU A;  5DBY A;  2HNL A;  4YH2 A;  3QAW A;  1TU7 A;  1E6B A;  2BXM A;  4F5V A;  5IIX A;  5DQS A;  4G0I A;  4PXO A;  3VLN A;  2BXH A;  4GDL B;  2CZ2 A;  4WR5 A;  2I2Z A;  3ZFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...