2OT3A

Crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
253
structure length
253
Chain Sequence
b'SKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Structural basis for Rab GTPase activation by VPS9 domain exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 91
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2ot3A01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2ot3A02
2OT3A 2EFCA 4G01A 2EFDA 2EFEA 1TXUA 4N3ZA 2EFHA
chains in the Genus database with same CATH superfamily
2GUTA 3LXTA 1NT2B 3SWLA 2PMTA 4F5SA 6GSSA 1TU8A 6GSUA 3M3MA 2XVQA 3TOUA 4OFNA 1GWCA 3G7JA 4ZBAA 3IC8A 4EDYA 1SVMA 1GUMA 2A2RA 4ZBQA 1BG1A 3AY8A 5F8BA 4OTTA 3Q19A 2BXEA 2WRTA 2HSNA 4L5OA 2CA8A 1HK3A 1LBKA 3CSIA 5DCGA 4EXJA 3NVMA 1HQOA 3VQIA 1K0CA 2H1LA 4JK4A 2HSMB 5DQSA 1J7EA 1BM0A 2F8FA 1VF3A 4YQUA 3RBTA 3Q74A 3LU7A 1BAYA 1GNIA 3VURA 2C3TA 4EC0A 2BXOA 3G7IA 2DBUA 1E6BA 4D7XA 1G6YA 4FK5B 4ZBRA 4LUHA 4BY9C 1GTIA 2JUHA 4BVXB 3LXZA 4ZBDA 4Z69A 2GTUA 6GSWA 5A4UA 1U87A 2A2SA 2IL3A 1PKZA 4NAWB 1YQ1A 2BXAA 4AKGA 1SVLA 4YH2A 2UZ8A 1E7AA 2ON7A 4L9QA 1KBNA 5ELAA 1K0OA 4FXYP 5BPKA 5AIVA 2VD0A 1GSEA 1YJ6A 1N2AA 4JBBA 1F3BA 3W8SA 1B48A 3IBHA 1U3IA 3I69A 3A73A 5J40A 3EINA 1ML6A 4MPFA 2WVYA 3KM6A 2VD1A 4F03A 3ECPA 4ZC6A 4N3ZA 3NIVA 5IJFA 4WR4A 4G19A 5DJMA 3MHSB 2JL4A 2GSTA 1MD3A 4DM0A 1SVOA 2AAWA 1F2EA 4HI7A 5D7GA 4QQ7A 5EY6A 4KDUA 4N0UD 1O9XA 1M0UA 2BXGA 3C8EA 5IIXA 3HKRA 4K0GA 1VF2A 1MUSA 4IGJA 4N0FD 3GX0A 4F0CA 5LCZA 3EE2A 3HJOA 4ZXGA 4O7HA 3GURA 5A5KA 2OT3A 2E0YA 4LUFA 1UA5A 4MP4A 2F3MA 3UAPA 1AXDA 2DBXA 4I97A 4G0IA 2LOQA 4BKEA 3L0HA 4YQMA 4GDLB 2GSQA 5J47A 2GLRA 3TDLA 1OKTA 4OMVA 1GSSA 3Q18A 4ZB9A 1TU7A 3FR3A 4OTUA 3KIKA 1OYJA 1YKCA 3F6DA 4PUAA 4PNFA 5ECQB 4ECIA 5IJ5A 4PI2C 3B9MA 1H5WA 2VO4A 3GA9L 1XW6A 3CRTA 3LJRA 4PGTA 4KAEA 1K0AA 2VCZA 4AKIA 5ID9A 1MD4A 3KMNA 4KGIA 3WHSA 4KDXA 1JLVA 1MIYA 6GSXA 3LQ7A 2R3XA 1GNJA 5AN1A 5G5EA 16GSA 2HNLA 13GSA 3BPJA 4RI6A 1GSYA 1VZSA 2UV8G 7GSSA 4YAPA 2WW0A 2NNWA 2WJUA 3PGTA 1HK5A 4OT2A 5AGYA 4NHWA 4ID0A 1K3LA 1ZGNA 1FHEA 4TOPA 5BMUB 3TOTA 2NQOA 5D9WA 3FYGA 5FT3A 1NHYA 4LA0A 3GTUB 4JEDA 1BF5A 4WA6B 3P8WA 2OZBB 1UORA 2N5FA 4LB2A 3DD3A 4AKXB 4Z9OA 1K0DA 1PD21 5DDLA 4ZB6A 3UIVA 4PI0C 4E8HA 2O5VA 2CZ3A 2BXLA 4AKHA 5ECSA 1GULA 3LYPA 5A34A 1GLPA 5J4VA 4ZB8A 4F5VA 2YCDA 4GCIA 4Q5RA 3ERFA 4PHZC 1GSQA 1TF0A 5A1NB 4S1YA 1MA9A 3UBKA 5G5FA 2J9HA 4CHSA 4TQ1A 3GUSA 5IFOA 4RI7A 3VPTA 1PX7A 4G9HA 2BX8A 4EDZA 1HK4A 6GSTA 9GSSA 3FR9A 1PMTA 1C72A 2XVVA 4I9OA 4IW1A 1PL1A 3ZFBA 4ECJA 3SIVB 1JZRA 3V09A 1IYIA 3CSHA 5F07A 1TDIA 2CAQA 4PTSA 5GZZB 1G7OA 2HRAA 4BVYB 2HSMA 3UBLA 3U6VA 5IQYA 3LG6A 2C80A 3M0FA 4PX1A 4GDKB 2NTOA 5JCWA 2BXMA 2CAIA 4M70B 4E68A 18GSA 2XVWA 2ON5A 4HOJA 4MPGA 4BVXA 3LU8A 5ECRB 3O76A 5JCUA 1AQWA 2BXKA 4IKHA 3CRUA 2IMKA 4IVFA 3JRYA 4E8EA 3CHXC 4ACSA 2V36A 5J41A 4GSNA 4GSTA 5D9XA 2LJRA 5AIXA 2WS2A 4NAXA 3ZFLA 1B8XA 1VFIA 2DG5A 2WW2A 2BXFA 1MM8A 3KJYA 1E7IA 2DYOA 4K2CA 2HRKB 5DJLA 1LNSA 3WYWA 4KSMA 1USBA 1XW5A 3FNMA 2EFHA 5A5HB 4OFTA 3RFRC 1HNBA 5ECMB 3M99C 4PO0A 1TXUA 4USSA 3GQXA 1GSDA 4ISDA 5ECLB 4K71A 1BG5A 5J4UA 4JZQA 5KEJA 1E78A 4MF6A 1GUKA 1GLQA 1GTAA 5IIHA 4MZWA 4PQHA 3QR6A 4G0KA 5FWGA 4K0NA 1N25A 5ECPB 4BL7B 1BX9A 3W1SA 2PVQA 2V6KA 4J2VA 2CVDA 4G04A 19GSA 4LB9A 5AISA 3KXOA 1GUHA 2WDUA 4F5TA 3MDKA 5F06A 1HNCA 1EV4A 3FY7A 1K0BA 1MUHA 3H1NA 3IR4A 2VCWA 4W4UB 1GTBA 1RK4A 1F3AA 1XWKA 14GSA 2BXPA 2EFCA 4IQ1A 1JLWA 8GSSA 20GSA 1IYHA 2VCTA 2C4JA 3LYKA 4DEJA 1IJGA 1AO6A 2C8UA 3VK9A 5ECHB 2O3EA 5F05A 4KH7A 4PURA 4L9KA 1GNEA 5A4WA 1R5AA 4GF0A 3HJMA 1A0FA 2D2ZA 5DALB 1KXPD 1N5UA 3QAVA 4O92A 5ECOB 4ECCA 4PNGA 1HNAA 3VI7A 3A75A 5ECIB 3WHQA 2R5GA 3SQJA 5GSTA 1BYEA 3CBUA 3ZMLA 5GSSA 1EOGA 4L8UA 3CWGA 2C3NA 2WW1A 4LMWA 5B7CA 3VPQA 2WVXB 1K0MA 3KJLA 3MHHB 5DAKB 3UARA 2QM6A 5GHKA 2DYMA 5ID7A 3KTLA 1ZL9A 4L5LA 5D9TA 2DSAA 3NVKA 2VCVA 1Y1UA 4KE3A 3IK9A 1E7BA 4L8EA 3PR8A 3R3EA 4ZUXV 4LMVA 1HA2A 4MF5A 4MDCA 3VI5A 5A4VA 3WHRA 2DC5A 3VLNA 4GSSA 1Q4JA 2LQHA 3SIUB 2BXDA 2R4VA 4PXOA 4WR5A 1GTUA 5ELGA 1E7HA 3V08A 5J4YA 1PX6A 4Q5FA 6GSYA 2Z8IA 3VWXA 4G0LA 2DBWA 5B5TA 4G10A 1E7EA 5BMUA 2QHBA 4G01A 1B4PA 5GIPA 1S4BP 1TW9A 4F0BA 1YDKA 2AGHB 3ISOA 3GTUA 1PA3A 1SB0A 2XVUA 2C3QA 5A34B 1K3OA 1AQVA 4ZCGA 1H9ZA 2FNOA 5D9VA 2HSNB 4IQAA 5GIOA 1K0NA 2PGTA 5DBYA 1U88A 4W66A 4AGSA 3FRCA 1AW9A 3LSZA 2VDBA 2I30A 3QAGA 3F63A 4TQ0A 4GTUA 2BXIA 2GDRA 4OR0A 5A1NA 2FHEA 3FWBC 4ECBA 4NHZA 11GSA 2WVZA 4IW2A 1G6WA 2VCXA 3RGBC 1Y6EA 3IE3A 3QAWA 5GINA 4FIPB 4J2FA 2KBZA 2WB9A 2ROHA 5IIUA 2XW0A 1BKEA 1EOHA 1KW2A 2LXSA 3IK7A 2BXQA 1OE8A 1PGTA 5DQFA 10GSA 2BXBA 3CSJA 4BVYA 1K3YA 4Q5NA 4EMXA 1E7CA 4PQIA 1PN9A 3FR6A 1M9BA 3D0ZA 5ECKB 4Q5QA 2K0NA 1XWGA 1PL2A 3P90A 3O3TA 4IBPA 4GDFA 4KX4A 2AB6A 5F0GA 3V03A 1I1IP 1PKWA 1V40A 4GG2A 3BBYA 1GSFA 1MTCA 3NMUA 1YEWC 2AHEA 3GQUA 1E7GA 4N0VA 3MAKA 1AQXA 4HGMB 3I6AA 1MIVA 2HQTA 1OE7A 2VCQA 3ZMKA 2HRKA 3LFLA 4QMKA 1LOTA 2CZ2A 4KF9A 5FHIA 4G03A 2OADA 4YAVA 1DUGA 5HFKA 1FW1A 3ICXA 3F6FA 4IS0A 5A5HA 3TGZA 4YQVA 4HZ2A 2KWFA 4HZ4A 2XSIA 4ZBKA 4C31B 4HGKA 4ZB7A 4IW9A 4E99A 1M99A 3GH6A 3GSTA 3N5OA 2CKXA 2OA7A 2XW1A 1Z9HA 1EEMA 4HJ2A 2GSSA 2PERA 4GDXA 5EL8A 4GLTA 2EFEA 1FOUA 4BL7A 4FJCB 1VF4A 2AJEA 12GSA 5D73A 4IJIA 2R6KA 4F5UA 2OACA 2YV9A 2PBJA 1HK1A 22GSA 3HMJG 2YDFA 3H37A 4OFMA 3PLAA 1GNWA 3M8NA 5IJEA 2LQIA 1V2AA 3R2QA 1E7FA 2Z8KA 2YV7A 3H3AA 5LD0A 2QMCA 1LJRA 2BXNA 5EVOA 4DHXB 2E0XA 2LXTA 1EV9A 5J5NA 2VUEA 1YVLA 3TU3B 3FWCC 17GSA 2GSRA 3M1GA 4EE0A 1J78A 3G9KD 4KDYA 2VUFA 2WZSA 5DALA 4AI6A 1YY7A 2XMOA 4ZBBA 2O36A 2X64A 1HK2A 3CX9A 2BXHA 3NVIA 3GSSA 3UVHA 2Z8JA 3WD6A 2WVXA 2EFDA 3JQZA 5DAKA 2VKZG 5HOZA 1GSUA 4FQUA 4MBEC 3B9LA 2WW3A 1KDXA 1BJ5A 4MK3A 1JNBA 3N9JA 4MF7A 5ECNB 6GSVA 3KMOA 2BXCA 2I2ZA 5FUOA 1MIWA 1VF1A 4IELA 2IMIA 3ERGA 1M9AA 3DGQA 3LU6A 3PPUA
chains in the Genus database with same CATH topology
3LXTA 1NT2B 3SWLA 2PMTA 4F5SA 6GSSA 1TU8A 6GSUA 3M3MA 2XVQA 3TOUA 4OFNA 1GWCA 3G7JA 4ZBAA 3IC8A 4EDYA 1SVMA 1GUMA 2A2RA 4ZBQA 1BG1A 3AY8A 5F8BA 4OTTA 3Q19A 2BXEA 2WRTA 2HSNA 4L5OA 2CA8A 1HK3A 1LBKA 3CSIA 5DCGA 4EXJA 3NVMA 1HQOA 3VQIA 1K0CA 2H1LA 4JK4A 2HSMB 5DQSA 1J7EA 1BM0A 2F8FA 1VF3A 4YQUA 3RBTA 3Q74A 3LU7A 1BAYA 1GNIA 3VURA 2C3TA 4EC0A 2BXOA 3G7IA 2DBUA 1E6BA 1G6YA 4FK5B 4ZBRA 4LUHA 4BY9C 1GTIA 2JUHA 4BVXB 3LXZA 4ZBDA 4Z69A 2GTUA 6GSWA 5A4UA 1U87A 2A2SA 2IL3A 1PKZA 4NAWB 1YQ1A 2BXAA 4AKGA 1SVLA 4YH2A 2UZ8A 1E7AA 2ON7A 4L9QA 1KBNA 5ELAA 1K0OA 5AIVA 5BPKA 2VD0A 1GSEA 1YJ6A 1N2AA 4JBBA 1F3BA 3W8SA 1B48A 3IBHA 1U3IA 3I69A 3A73A 5J40A 3EINA 1ML6A 4MPFA 3KM6A 2VD1A 4F03A 4ZC6A 4N3ZA 3NIVA 5IJFA 4WR4A 4G19A 5DJMA 3MHSB 2JL4A 2GSTA 1MD3A 1SVOA 2AAWA 1F2EA 4HI7A 5D7GA 4QQ7A 5EY6A 4KDUA 4N0UD 1O9XA 1M0UA 2BXGA 3C8EA 5IIXA 3HKRA 4K0GA 1VF2A 4IGJA 4N0FD 3GX0A 4F0CA 5LCZA 3EE2A 3HJOA 4ZXGA 4O7HA 3GURA 5A5KA 2OT3A 2E0YA 4LUFA 1UA5A 4MP4A 2F3MA 3UAPA 1AXDA 2DBXA 4I97A 4G0IA 2LOQA 4BKEA 3L0HA 4YQMA 4GDLB 2GSQA 5J47A 2GLRA 3TDLA 1OKTA 4OMVA 1GSSA 3Q18A 4ZB9A 1TU7A 3FR3A 4OTUA 3KIKA 1OYJA 1YKCA 3F6DA 4PUAA 4PNFA 5ECQB 4ECIA 5IJ5A 3B9MA 1H5WA 2VO4A 3GA9L 1XW6A 3CRTA 3LJRA 4PGTA 4KAEA 1K0AA 2VCZA 4AKIA 5ID9A 1MD4A 3KMNA 4KGIA 3WHSA 4KDXA 1JLVA 1MIYA 6GSXA 3LQ7A 2R3XA 1GNJA 5AN1A 5G5EA 16GSA 2HNLA 13GSA 4RI6A 1GSYA 1VZSA 2UV8G 7GSSA 4YAPA 2NNWA 2WJUA 3PGTA 1HK5A 4OT2A 5AGYA 4NHWA 4ID0A 1K3LA 1ZGNA 1FHEA 4TOPA 5BMUB 3TOTA 2NQOA 5D9WA 3FYGA 5FT3A 1NHYA 4LA0A 3GTUB 4JEDA 1BF5A 4WA6B 3P8WA 2OZBB 1UORA 2N5FA 4LB2A 3DD3A 4AKXB 4Z9OA 1K0DA 1PD21 5DDLA 4ZB6A 3UIVA 4E8HA 2O5VA 2CZ3A 2BXLA 4AKHA 5ECSA 1GULA 3LYPA 5A34A 1GLPA 5J4VA 4ZB8A 4F5VA 2YCDA 4GCIA 4Q5RA 3ERFA 1GSQA 1TF0A 5A1NB 4S1YA 1MA9A 3UBKA 5G5FA 2J9HA 4CHSA 4TQ1A 3GUSA 5IFOA 4RI7A 3VPTA 1PX7A 4G9HA 2BX8A 4EDZA 1HK4A 6GSTA 9GSSA 3FR9A 1PMTA 1C72A 2XVVA 1PL1A 4IW1A 3ZFBA 4ECJA 3SIVB 1JZRA 3V09A 1IYIA 3CSHA 5F07A 1TDIA 2CAQA 4PTSA 5GZZB 1G7OA 2HRAA 4BVYB 2HSMA 3UBLA 3U6VA 5IQYA 3LG6A 2C80A 3M0FA 4PX1A 4GDKB 2NTOA 5JCWA 2BXMA 2CAIA 4M70B 4E68A 18GSA 2XVWA 2ON5A 4HOJA 4MPGA 4BVXA 3LU8A 5ECRB 3O76A 5JCUA 1AQWA 2BXKA 4IKHA 3CRUA 2IMKA 4IVFA 3JRYA 4E8EA 4ACSA 2V36A 5J41A 4GSNA 4GSTA 5D9XA 2LJRA 5AIXA 2WS2A 4NAXA 3ZFLA 1B8XA 1VFIA 2DG5A 2BXFA 3KJYA 1E7IA 2DYOA 4K2CA 2HRKB 5DJLA 1LNSA 3WYWA 4KSMA 1USBA 1XW5A 3FNMA 2EFHA 5A5HB 4OFTA 1HNBA 5ECMB 3M99C 4PO0A 1TXUA 4USSA 3GQXA 1GSDA 4ISDA 5ECLB 4K71A 1BG5A 5J4UA 4JZQA 5KEJA 1E78A 4MF6A 1GUKA 1GLQA 1GTAA 5IIHA 4MZWA 4PQHA 3QR6A 4G0KA 5FWGA 4K0NA 1N25A 5ECPB 4BL7B 1BX9A 3W1SA 2PVQA 2V6KA 4J2VA 2CVDA 4G04A 19GSA 4LB9A 5AISA 3KXOA 1GUHA 2WDUA 4F5TA 3MDKA 5F06A 1HNCA 1EV4A 3FY7A 1K0BA 3H1NA 3IR4A 2VCWA 4W4UB 1GTBA 1RK4A 1F3AA 1XWKA 14GSA 2BXPA 2EFCA 4IQ1A 1JLWA 8GSSA 20GSA 1IYHA 2VCTA 2C4JA 3LYKA 4DEJA 1IJGA 1AO6A 2C8UA 3VK9A 5ECHB 5F05A 4KH7A 4PURA 4L9KA 1GNEA 5A4WA 1R5AA 4GF0A 3HJMA 1A0FA 2D2ZA 5DALB 1KXPD 1N5UA 3QAVA 4O92A 5ECOB 4ECCA 4PNGA 1HNAA 3VI7A 3A75A 5ECIB 3WHQA 2R5GA 3SQJA 5GSTA 1BYEA 3CBUA 3ZMLA 5GSSA 1EOGA 4L8UA 3CWGA 2C3NA 4LMWA 5B7CA 3VPQA 1K0MA 3KJLA 3MHHB 5DAKB 3UARA 2QM6A 5GHKA 2DYMA 5ID7A 3KTLA 1ZL9A 4L5LA 5D9TA 2DSAA 3NVKA 2VCVA 1Y1UA 4KE3A 3IK9A 1E7BA 4L8EA 3PR8A 3R3EA 4ZUXV 4LMVA 1HA2A 4MF5A 4MDCA 3VI5A 5A4VA 3WHRA 2DC5A 3VLNA 4GSSA 1Q4JA 4WR5A 3SIUB 2BXDA 2R4VA 4PXOA 5J4YA 1GTUA 5ELGA 1E7HA 3V08A 1PX6A 4Q5FA 6GSYA 2Z8IA 3VWXA 4G0LA 2DBWA 5B5TA 4G10A 1E7EA 5BMUA 2QHBA 4G01A 1B4PA 5GIPA 4F0BA 1TW9A 1YDKA 3ISOA 3GTUA 1PA3A 2XVUA 2C3QA 5A34B 1K3OA 1AQVA 4ZCGA 1H9ZA 2FNOA 5D9VA 2HSNB 4IQAA 5GIOA 1K0NA 2PGTA 5DBYA 1U88A 4W66A 4AGSA 3FRCA 1AW9A 3LSZA 2VDBA 2I30A 3QAGA 3F63A 4TQ0A 4GTUA 2BXIA 2GDRA 4OR0A 5A1NA 2FHEA 3FWBC 4ECBA 4NHZA 11GSA 4IW2A 1G6WA 2VCXA 1Y6EA 3IE3A 3QAWA 5GINA 4FIPB 4J2FA 2KBZA 2WB9A 2ROHA 5IIUA 2XW0A 1BKEA 1EOHA 1KW2A 3IK7A 2BXQA 1OE8A 1PGTA 5DQFA 10GSA 2BXBA 3CSJA 4BVYA 1K3YA 4Q5NA 4EMXA 1E7CA 4PQIA 1PN9A 3FR6A 1M9BA 3D0ZA 5ECKB 4Q5QA 1XWGA 1PL2A 3P90A 3O3TA 4IBPA 4GDFA 4KX4A 2AB6A 5F0GA 3V03A 1PKWA 1V40A 4GG2A 3BBYA 1GSFA 1MTCA 3NMUA 2AHEA 3GQUA 1E7GA 4N0VA 3MAKA 1AQXA 4HGMB 3I6AA 1MIVA 2HQTA 1OE7A 2VCQA 3ZMKA 2HRKA 3LFLA 4QMKA 1LOTA 2CZ2A 4KF9A 5FHIA 4G03A 2OADA 4YAVA 1DUGA 5HFKA 1FW1A 3ICXA 3F6FA 4IS0A 5A5HA 3TGZA 4YQVA 4HZ2A 4HZ4A 2XSIA 4ZBKA 4C31B 4HGKA 4ZB7A 4IW9A 4E99A 1M99A 3GH6A 3GSTA 3N5OA 2CKXA 2OA7A 2XW1A 1Z9HA 1EEMA 4HJ2A 2GSSA 2PERA 4GDXA 5EL8A 4GLTA 2EFEA 1FOUA 4BL7A 4FJCB 1VF4A 2AJEA 12GSA 5D73A 4IJIA 2R6KA 4F5UA 2OACA 2YV9A 2PBJA 1HK1A 22GSA 3HMJG 2YDFA 3H37A 4OFMA 3PLAA 1GNWA 3M8NA 5IJEA 1V2AA 3R2QA 1E7FA 2Z8KA 2YV7A 3H3AA 5LD0A 2QMCA 1LJRA 2BXNA 5EVOA 4DHXB 2E0XA 5J5NA 1EV9A 2VUEA 1YVLA 3TU3B 3FWCC 17GSA 2GSRA 3M1GA 4EE0A 1J78A 3G9KD 4KDYA 2VUFA 4AI6A 5DALA 1YY7A 2XMOA 4ZBBA 2X64A 1HK2A 3CX9A 2BXHA 3NVIA 3GSSA 3UVHA 2Z8JA 3WD6A 2EFDA 3JQZA 5DAKA 2VKZG 5HOZA 1GSUA 4FQUA 4MBEC 3B9LA 1BJ5A 4MK3A 1JNBA 3N9JA 4MF7A 5ECNB 6GSVA 3KMOA 2BXCA 2I2ZA 5FUOA 1MIWA 1VF1A 4IELA 2IMIA 3ERGA 1M9AA 3DGQA 3LU6A 3PPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT3 A;  2EFC A;  4G01 A;  2EFD A;  2EFE A;  1TXU A;  4N3Z A;  2EFH A; 
#chains in the Genus database with same CATH topology
 2GUT A;  3LXT A;  1NT2 B;  3SWL A;  2PMT A;  4F5S A;  6GSS A;  1TU8 A;  6GSU A;  3M3M A;  2XVQ A;  3TOU A;  4OFN A;  1GWC A;  3G7J A;  4ZBA A;  3IC8 A;  4EDY A;  1SVM A;  1GUM A;  2A2R A;  4ZBQ A;  1BG1 A;  3AY8 A;  5F8B A;  4OTT A;  3Q19 A;  2BXE A;  2WRT A;  2HSN A;  4L5O A;  2CA8 A;  1HK3 A;  1LBK A;  3CSI A;  5DCG A;  4EXJ A;  3NVM A;  1HQO A;  3VQI A;  1K0C A;  2H1L A;  4JK4 A;  2HSM B;  5DQS A;  1J7E A;  1BM0 A;  2F8F A;  1VF3 A;  4YQU A;  3RBT A;  3Q74 A;  3LU7 A;  1BAY A;  1GNI A;  3VUR A;  2C3T A;  4EC0 A;  2BXO A;  3G7I A;  2DBU A;  1E6B A;  4D7X A;  1G6Y A;  4FK5 B;  4ZBR A;  4LUH A;  4BY9 C;  1GTI A;  2JUH A;  4BVX B;  3LXZ A;  4ZBD A;  4Z69 A;  2GTU A;  6GSW A;  5A4U A;  1U87 A;  2A2S A;  2IL3 A;  1PKZ A;  4NAW B;  1YQ1 A;  2BXA A;  4AKG A;  1SVL A;  4YH2 A;  2UZ8 A;  1E7A A;  2ON7 A;  4L9Q A;  1KBN A;  5ELA A;  1K0O A;  4FXY P;  5BPK A;  5AIV A;  2VD0 A;  1GSE A;  1YJ6 A;  1N2A A;  4JBB A;  1F3B A;  3W8S A;  1B48 A;  3IBH A;  1U3I A;  3I69 A;  3A73 A;  5J40 A;  3EIN A;  1ML6 A;  4MPF A;  2WVY A;  3KM6 A;  2VD1 A;  4F03 A;  3ECP A;  4ZC6 A;  4N3Z A;  3NIV A;  5IJF A;  4WR4 A;  4G19 A;  5DJM A;  3MHS B;  2JL4 A;  2GST A;  1MD3 A;  4DM0 A;  1SVO A;  2AAW A;  1F2E A;  4HI7 A;  5D7G A;  4QQ7 A;  5EY6 A;  4KDU A;  4N0U D;  1O9X A;  1M0U A;  2BXG A;  3C8E A;  5IIX A;  3HKR A;  4K0G A;  1VF2 A;  1MUS A;  4IGJ A;  4N0F D;  3GX0 A;  4F0C A;  5LCZ A;  3EE2 A;  3HJO A;  4ZXG A;  4O7H A;  3GUR A;  5A5K A;  2OT3 A;  2E0Y A;  4LUF A;  1UA5 A;  4MP4 A;  2F3M A;  3UAP A;  1AXD A;  2DBX A;  4I97 A;  4G0I A;  2LOQ A;  4BKE A;  3L0H A;  4YQM A;  4GDL B;  2GSQ A;  5J47 A;  2GLR A;  3TDL A;  1OKT A;  4OMV A;  1GSS A;  3Q18 A;  4ZB9 A;  1TU7 A;  3FR3 A;  4OTU A;  3KIK A;  1OYJ A;  1YKC A;  3F6D A;  4PUA A;  4PNF A;  5ECQ B;  4ECI A;  5IJ5 A;  4PI2 C;  3B9M A;  1H5W A;  2VO4 A;  3GA9 L;  1XW6 A;  3CRT A;  3LJR A;  4PGT A;  4KAE A;  1K0A A;  2VCZ A;  4AKI A;  5ID9 A;  1MD4 A;  3KMN A;  4KGI A;  3WHS A;  4KDX A;  1JLV A;  1MIY A;  6GSX A;  3LQ7 A;  2R3X A;  1GNJ A;  5AN1 A;  5G5E A;  16GS A;  2HNL A;  13GS A;  3BPJ A;  4RI6 A;  1GSY A;  1VZS A;  2UV8 G;  7GSS A;  4YAP A;  2WW0 A;  2NNW A;  2WJU A;  3PGT A;  1HK5 A;  4OT2 A;  5AGY A;  4NHW A;  4ID0 A;  1K3L A;  1ZGN A;  1FHE A;  4TOP A;  5BMU B;  3TOT A;  2NQO A;  5D9W A;  3FYG A;  5FT3 A;  1NHY A;  4LA0 A;  3GTU B;  4JED A;  1BF5 A;  4WA6 B;  3P8W A;  2OZB B;  1UOR A;  2N5F A;  4LB2 A;  3DD3 A;  4AKX B;  4Z9O A;  1K0D A;  1PD2 1;  5DDL A;  4ZB6 A;  3UIV A;  4PI0 C;  4E8H A;  2O5V A;  2CZ3 A;  2BXL A;  4AKH A;  5ECS A;  1GUL A;  3LYP A;  5A34 A;  1GLP A;  5J4V A;  4ZB8 A;  4F5V A;  2YCD A;  4GCI A;  4Q5R A;  3ERF A;  4PHZ C;  1GSQ A;  1TF0 A;  5A1N B;  4S1Y A;  1MA9 A;  3UBK A;  5G5F A;  2J9H A;  4CHS A;  4TQ1 A;  3GUS A;  5IFO A;  4RI7 A;  3VPT A;  1PX7 A;  4G9H A;  2BX8 A;  4EDZ A;  1HK4 A;  6GST A;  9GSS A;  3FR9 A;  1PMT A;  1C72 A;  2XVV A;  4I9O A;  4IW1 A;  1PL1 A;  3ZFB A;  4ECJ A;  3SIV B;  1JZR A;  3V09 A;  1IYI A;  3CSH A;  5F07 A;  1TDI A;  2CAQ A;  4PTS A;  5GZZ B;  1G7O A;  2HRA A;  4BVY B;  2HSM A;  3UBL A;  3U6V A;  5IQY A;  3LG6 A;  2C80 A;  3M0F A;  4PX1 A;  4GDK B;  2NTO A;  5JCW A;  2BXM A;  2CAI A;  4M70 B;  4E68 A;  18GS A;  2XVW A;  2ON5 A;  4HOJ A;  4MPG A;  4BVX A;  3LU8 A;  5ECR B;  3O76 A;  5JCU A;  1AQW A;  2BXK A;  4IKH A;  3CRU A;  2IMK A;  4IVF A;  3JRY A;  4E8E A;  3CHX C;  4ACS A;  2V36 A;  5J41 A;  4GSN A;  4GST A;  5D9X A;  2LJR A;  5AIX A;  2WS2 A;  4NAX A;  3ZFL A;  1B8X A;  1VFI A;  2DG5 A;  2WW2 A;  2BXF A;  1MM8 A;  3KJY A;  1E7I A;  2DYO A;  4K2C A;  2HRK B;  5DJL A;  1LNS A;  3WYW A;  4KSM A;  1USB A;  1XW5 A;  3FNM A;  2EFH A;  5A5H B;  4OFT A;  3RFR C;  1HNB A;  5ECM B;  3M99 C;  4PO0 A;  1TXU A;  4USS A;  3GQX A;  1GSD A;  4ISD A;  5ECL B;  4K71 A;  1BG5 A;  5J4U A;  4JZQ A;  5KEJ A;  1E78 A;  4MF6 A;  1GUK A;  1GLQ A;  1GTA A;  5IIH A;  4MZW A;  4PQH A;  3QR6 A;  4G0K A;  5FWG A;  4K0N A;  1N25 A;  5ECP B;  4BL7 B;  1BX9 A;  3W1S A;  2PVQ A;  2V6K A;  4J2V A;  2CVD A;  4G04 A;  19GS A;  4LB9 A;  5AIS A;  3KXO A;  1GUH A;  2WDU A;  4F5T A;  3MDK A;  5F06 A;  1HNC A;  1EV4 A;  3FY7 A;  1K0B A;  1MUH A;  3H1N A;  3IR4 A;  2VCW A;  4W4U B;  1GTB A;  1RK4 A;  1F3A A;  1XWK A;  14GS A;  2BXP A;  2EFC A;  4IQ1 A;  1JLW A;  8GSS A;  20GS A;  1IYH A;  2VCT A;  2C4J A;  3LYK A;  4DEJ A;  1IJG A;  1AO6 A;  2C8U A;  3VK9 A;  5ECH B;  2O3E A;  5F05 A;  4KH7 A;  4PUR A;  4L9K A;  1GNE A;  5A4W A;  1R5A A;  4GF0 A;  3HJM A;  1A0F A;  2D2Z A;  5DAL B;  1KXP D;  1N5U A;  3QAV A;  4O92 A;  5ECO B;  4ECC A;  4PNG A;  1HNA A;  3VI7 A;  3A75 A;  5ECI B;  3WHQ A;  2R5G A;  3SQJ A;  5GST A;  1BYE A;  3CBU A;  3ZML A;  5GSS A;  1EOG A;  4L8U A;  3CWG A;  2C3N A;  2WW1 A;  4LMW A;  5B7C A;  3VPQ A;  2WVX B;  1K0M A;  3KJL A;  3MHH B;  5DAK B;  3UAR A;  2QM6 A;  5GHK A;  2DYM A;  5ID7 A;  3KTL A;  1ZL9 A;  4L5L A;  5D9T A;  2DSA A;  3NVK A;  2VCV A;  1Y1U A;  4KE3 A;  3IK9 A;  1E7B A;  4L8E A;  3PR8 A;  3R3E A;  4ZUX V;  4LMV A;  1HA2 A;  4MF5 A;  4MDC A;  3VI5 A;  5A4V A;  3WHR A;  2DC5 A;  3VLN A;  4GSS A;  1Q4J A;  2LQH A;  3SIU B;  2BXD A;  2R4V A;  4PXO A;  4WR5 A;  1GTU A;  5ELG A;  1E7H A;  3V08 A;  5J4Y A;  1PX6 A;  4Q5F A;  6GSY A;  2Z8I A;  3VWX A;  4G0L A;  2DBW A;  5B5T A;  4G10 A;  1E7E A;  5BMU A;  2QHB A;  4G01 A;  1B4P A;  5GIP A;  1S4B P;  1TW9 A;  4F0B A;  1YDK A;  2AGH B;  3ISO A;  3GTU A;  1PA3 A;  1SB0 A;  2XVU A;  2C3Q A;  5A34 B;  1K3O A;  1AQV A;  4ZCG A;  1H9Z A;  2FNO A;  5D9V A;  2HSN B;  4IQA A;  5GIO A;  1K0N A;  2PGT A;  5DBY A;  1U88 A;  4W66 A;  4AGS A;  3FRC A;  1AW9 A;  3LSZ A;  2VDB A;  2I30 A;  3QAG A;  3F63 A;  4TQ0 A;  4GTU A;  2BXI A;  2GDR A;  4OR0 A;  5A1N A;  2FHE A;  3FWB C;  4ECB A;  4NHZ A;  11GS A;  2WVZ A;  4IW2 A;  1G6W A;  2VCX A;  3RGB C;  1Y6E A;  3IE3 A;  3QAW A;  5GIN A;  4FIP B;  4J2F A;  2KBZ A;  2WB9 A;  2ROH A;  5IIU A;  2XW0 A;  1BKE A;  1EOH A;  1KW2 A;  2LXS A;  3IK7 A;  2BXQ A;  1OE8 A;  1PGT A;  5DQF A;  10GS A;  2BXB A;  3CSJ A;  4BVY A;  1K3Y A;  4Q5N A;  4EMX A;  1E7C A;  4PQI A;  1PN9 A;  3FR6 A;  1M9B A;  3D0Z A;  5ECK B;  4Q5Q A;  2K0N A;  1XWG A;  1PL2 A;  3P90 A;  3O3T A;  4IBP A;  4GDF A;  4KX4 A;  2AB6 A;  5F0G A;  3V03 A;  1I1I P;  1PKW A;  1V40 A;  4GG2 A;  3BBY A;  1GSF A;  1MTC A;  3NMU A;  1YEW C;  2AHE A;  3GQU A;  1E7G A;  4N0V A;  3MAK A;  1AQX A;  4HGM B;  3I6A A;  1MIV A;  2HQT A;  1OE7 A;  2VCQ A;  3ZMK A;  2HRK A;  3LFL A;  4QMK A;  1LOT A;  2CZ2 A;  4KF9 A;  5FHI A;  4G03 A;  2OAD A;  4YAV A;  1DUG A;  5HFK A;  1FW1 A;  3ICX A;  3F6F A;  4IS0 A;  5A5H A;  3TGZ A;  4YQV A;  4HZ2 A;  2KWF A;  4HZ4 A;  2XSI A;  4ZBK A;  4C31 B;  4HGK A;  4ZB7 A;  4IW9 A;  4E99 A;  1M99 A;  3GH6 A;  3GST A;  3N5O A;  2CKX A;  2OA7 A;  2XW1 A;  1Z9H A;  1EEM A;  4HJ2 A;  2GSS A;  2PER A;  4GDX A;  5EL8 A;  4GLT A;  2EFE A;  1FOU A;  4BL7 A;  4FJC B;  1VF4 A;  2AJE A;  12GS A;  5D73 A;  4IJI A;  2R6K A;  4F5U A;  2OAC A;  2YV9 A;  2PBJ A;  1HK1 A;  22GS A;  3HMJ G;  2YDF A;  3H37 A;  4OFM A;  3PLA A;  1GNW A;  3M8N A;  5IJE A;  2LQI A;  1V2A A;  3R2Q A;  1E7F A;  2Z8K A;  2YV7 A;  3H3A A;  5LD0 A;  2QMC A;  1LJR A;  2BXN A;  5EVO A;  4DHX B;  2E0X A;  2LXT A;  1EV9 A;  5J5N A;  2VUE A;  1YVL A;  3TU3 B;  3FWC C;  17GS A;  2GSR A;  3M1G A;  4EE0 A;  1J78 A;  3G9K D;  4KDY A;  2VUF A;  2WZS A;  5DAL A;  4AI6 A;  1YY7 A;  2XMO A;  4ZBB A;  2O36 A;  2X64 A;  1HK2 A;  3CX9 A;  2BXH A;  3NVI A;  3GSS A;  3UVH A;  2Z8J A;  3WD6 A;  2WVX A;  2EFD A;  3JQZ A;  5DAK A;  2VKZ G;  5HOZ A;  1GSU A;  4FQU A;  4MBE C;  3B9L A;  2WW3 A;  1KDX A;  1BJ5 A;  4MK3 A;  1JNB A;  3N9J A;  4MF7 A;  5ECN B;  6GSV A;  3KMO A;  2BXC A;  2I2Z A;  5FUO A;  1MIW A;  1VF1 A;  4IEL A;  2IMI A;  3ERG A;  1M9A A;  3DGQ A;  3LU6 A;  3PPU A; 
#chains in the Genus database with same CATH homology
 3LXT A;  1NT2 B;  3SWL A;  2PMT A;  4F5S A;  6GSS A;  1TU8 A;  6GSU A;  3M3M A;  2XVQ A;  3TOU A;  4OFN A;  1GWC A;  3G7J A;  4ZBA A;  3IC8 A;  4EDY A;  1SVM A;  1GUM A;  2A2R A;  4ZBQ A;  1BG1 A;  3AY8 A;  5F8B A;  4OTT A;  3Q19 A;  2BXE A;  2WRT A;  2HSN A;  4L5O A;  2CA8 A;  1HK3 A;  1LBK A;  3CSI A;  5DCG A;  4EXJ A;  3NVM A;  1HQO A;  3VQI A;  1K0C A;  2H1L A;  4JK4 A;  2HSM B;  5DQS A;  1J7E A;  1BM0 A;  2F8F A;  1VF3 A;  4YQU A;  3RBT A;  3Q74 A;  3LU7 A;  1BAY A;  1GNI A;  3VUR A;  2C3T A;  4EC0 A;  2BXO A;  3G7I A;  2DBU A;  1E6B A;  1G6Y A;  4FK5 B;  4ZBR A;  4LUH A;  4BY9 C;  1GTI A;  2JUH A;  4BVX B;  3LXZ A;  4ZBD A;  4Z69 A;  2GTU A;  6GSW A;  5A4U A;  1U87 A;  2A2S A;  2IL3 A;  1PKZ A;  4NAW B;  1YQ1 A;  2BXA A;  4AKG A;  1SVL A;  4YH2 A;  2UZ8 A;  1E7A A;  2ON7 A;  4L9Q A;  1KBN A;  5ELA A;  1K0O A;  5AIV A;  5BPK A;  2VD0 A;  1GSE A;  1YJ6 A;  1N2A A;  4JBB A;  1F3B A;  3W8S A;  1B48 A;  3IBH A;  1U3I A;  3I69 A;  3A73 A;  5J40 A;  3EIN A;  1ML6 A;  4MPF A;  3KM6 A;  2VD1 A;  4F03 A;  4ZC6 A;  4N3Z A;  3NIV A;  5IJF A;  4WR4 A;  4G19 A;  5DJM A;  3MHS B;  2JL4 A;  2GST A;  1MD3 A;  1SVO A;  2AAW A;  1F2E A;  4HI7 A;  5D7G A;  4QQ7 A;  5EY6 A;  4KDU A;  4N0U D;  1O9X A;  1M0U A;  2BXG A;  3C8E A;  5IIX A;  3HKR A;  4K0G A;  1VF2 A;  4IGJ A;  4N0F D;  3GX0 A;  4F0C A;  5LCZ A;  3EE2 A;  3HJO A;  4ZXG A;  4O7H A;  3GUR A;  5A5K A;  2OT3 A;  2E0Y A;  4LUF A;  1UA5 A;  4MP4 A;  2F3M A;  3UAP A;  1AXD A;  2DBX A;  4I97 A;  4G0I A;  2LOQ A;  4BKE A;  3L0H A;  4YQM A;  4GDL B;  2GSQ A;  5J47 A;  2GLR A;  3TDL A;  1OKT A;  4OMV A;  1GSS A;  3Q18 A;  4ZB9 A;  1TU7 A;  3FR3 A;  4OTU A;  3KIK A;  1OYJ A;  1YKC A;  3F6D A;  4PUA A;  4PNF A;  5ECQ B;  4ECI A;  5IJ5 A;  3B9M A;  1H5W A;  2VO4 A;  3GA9 L;  1XW6 A;  3CRT A;  3LJR A;  4PGT A;  4KAE A;  1K0A A;  2VCZ A;  4AKI A;  5ID9 A;  1MD4 A;  3KMN A;  4KGI A;  3WHS A;  4KDX A;  1JLV A;  1MIY A;  6GSX A;  3LQ7 A;  2R3X A;  1GNJ A;  5AN1 A;  5G5E A;  16GS A;  2HNL A;  13GS A;  4RI6 A;  1GSY A;  1VZS A;  2UV8 G;  7GSS A;  4YAP A;  2NNW A;  2WJU A;  3PGT A;  1HK5 A;  4OT2 A;  5AGY A;  4NHW A;  4ID0 A;  1K3L A;  1ZGN A;  1FHE A;  4TOP A;  5BMU B;  3TOT A;  2NQO A;  5D9W A;  3FYG A;  5FT3 A;  1NHY A;  4LA0 A;  3GTU B;  4JED A;  1BF5 A;  4WA6 B;  3P8W A;  2OZB B;  1UOR A;  2N5F A;  4LB2 A;  3DD3 A;  4AKX B;  4Z9O A;  1K0D A;  1PD2 1;  5DDL A;  4ZB6 A;  3UIV A;  4E8H A;  2O5V A;  2CZ3 A;  2BXL A;  4AKH A;  5ECS A;  1GUL A;  3LYP A;  5A34 A;  1GLP A;  5J4V A;  4ZB8 A;  4F5V A;  2YCD A;  4GCI A;  4Q5R A;  3ERF A;  1GSQ A;  1TF0 A;  5A1N B;  4S1Y A;  1MA9 A;  3UBK A;  5G5F A;  2J9H A;  4CHS A;  4TQ1 A;  3GUS A;  5IFO A;  4RI7 A;  3VPT A;  1PX7 A;  4G9H A;  2BX8 A;  4EDZ A;  1HK4 A;  6GST A;  9GSS A;  3FR9 A;  1PMT A;  1C72 A;  2XVV A;  1PL1 A;  4IW1 A;  3ZFB A;  4ECJ A;  3SIV B;  1JZR A;  3V09 A;  1IYI A;  3CSH A;  5F07 A;  1TDI A;  2CAQ A;  4PTS A;  5GZZ B;  1G7O A;  2HRA A;  4BVY B;  2HSM A;  3UBL A;  3U6V A;  5IQY A;  3LG6 A;  2C80 A;  3M0F A;  4PX1 A;  4GDK B;  2NTO A;  5JCW A;  2BXM A;  2CAI A;  4M70 B;  4E68 A;  18GS A;  2XVW A;  2ON5 A;  4HOJ A;  4MPG A;  4BVX A;  3LU8 A;  5ECR B;  3O76 A;  5JCU A;  1AQW A;  2BXK A;  4IKH A;  3CRU A;  2IMK A;  4IVF A;  3JRY A;  4E8E A;  4ACS A;  2V36 A;  5J41 A;  4GSN A;  4GST A;  5D9X A;  2LJR A;  5AIX A;  2WS2 A;  4NAX A;  3ZFL A;  1B8X A;  1VFI A;  2DG5 A;  2BXF A;  3KJY A;  1E7I A;  2DYO A;  4K2C A;  2HRK B;  5DJL A;  1LNS A;  3WYW A;  4KSM A;  1USB A;  1XW5 A;  3FNM A;  2EFH A;  5A5H B;  4OFT A;  1HNB A;  5ECM B;  3M99 C;  4PO0 A;  1TXU A;  4USS A;  3GQX A;  1GSD A;  4ISD A;  5ECL B;  4K71 A;  1BG5 A;  5J4U A;  4JZQ A;  5KEJ A;  1E78 A;  4MF6 A;  1GUK A;  1GLQ A;  1GTA A;  5IIH A;  4MZW A;  4PQH A;  3QR6 A;  4G0K A;  5FWG A;  4K0N A;  1N25 A;  5ECP B;  4BL7 B;  1BX9 A;  3W1S A;  2PVQ A;  2V6K A;  4J2V A;  2CVD A;  4G04 A;  19GS A;  4LB9 A;  5AIS A;  3KXO A;  1GUH A;  2WDU A;  4F5T A;  3MDK A;  5F06 A;  1HNC A;  1EV4 A;  3FY7 A;  1K0B A;  3H1N A;  3IR4 A;  2VCW A;  4W4U B;  1GTB A;  1RK4 A;  1F3A A;  1XWK A;  14GS A;  2BXP A;  2EFC A;  4IQ1 A;  1JLW A;  8GSS A;  20GS A;  1IYH A;  2VCT A;  2C4J A;  3LYK A;  4DEJ A;  1IJG A;  1AO6 A;  2C8U A;  3VK9 A;  5ECH B;  5F05 A;  4KH7 A;  4PUR A;  4L9K A;  1GNE A;  5A4W A;  1R5A A;  4GF0 A;  3HJM A;  1A0F A;  2D2Z A;  5DAL B;  1KXP D;  1N5U A;  3QAV A;  4O92 A;  5ECO B;  4ECC A;  4PNG A;  1HNA A;  3VI7 A;  3A75 A;  5ECI B;  3WHQ A;  2R5G A;  3SQJ A;  5GST A;  1BYE A;  3CBU A;  3ZML A;  5GSS A;  1EOG A;  4L8U A;  3CWG A;  2C3N A;  4LMW A;  5B7C A;  3VPQ A;  1K0M A;  3KJL A;  3MHH B;  5DAK B;  3UAR A;  2QM6 A;  5GHK A;  2DYM A;  5ID7 A;  3KTL A;  1ZL9 A;  4L5L A;  5D9T A;  2DSA A;  3NVK A;  2VCV A;  1Y1U A;  4KE3 A;  3IK9 A;  1E7B A;  4L8E A;  3PR8 A;  3R3E A;  4ZUX V;  4LMV A;  1HA2 A;  4MF5 A;  4MDC A;  3VI5 A;  5A4V A;  3WHR A;  2DC5 A;  3VLN A;  4GSS A;  1Q4J A;  4WR5 A;  3SIU B;  2BXD A;  2R4V A;  4PXO A;  5J4Y A;  1GTU A;  5ELG A;  1E7H A;  3V08 A;  1PX6 A;  4Q5F A;  6GSY A;  2Z8I A;  3VWX A;  4G0L A;  2DBW A;  5B5T A;  4G10 A;  1E7E A;  5BMU A;  2QHB A;  4G01 A;  1B4P A;  5GIP A;  4F0B A;  1TW9 A;  1YDK A;  3ISO A;  3GTU A;  1PA3 A;  2XVU A;  2C3Q A;  5A34 B;  1K3O A;  1AQV A;  4ZCG A;  1H9Z A;  2FNO A;  5D9V A;  2HSN B;  4IQA A;  5GIO A;  1K0N A;  2PGT A;  5DBY A;  1U88 A;  4W66 A;  4AGS A;  3FRC A;  1AW9 A;  3LSZ A;  2VDB A;  2I30 A;  3QAG A;  3F63 A;  4TQ0 A;  4GTU A;  2BXI A;  2GDR A;  4OR0 A;  5A1N A;  2FHE A;  3FWB C;  4ECB A;  4NHZ A;  11GS A;  4IW2 A;  1G6W A;  2VCX A;  1Y6E A;  3IE3 A;  3QAW A;  5GIN A;  4FIP B;  4J2F A;  2KBZ A;  2WB9 A;  2ROH A;  5IIU A;  2XW0 A;  1BKE A;  1EOH A;  1KW2 A;  3IK7 A;  2BXQ A;  1OE8 A;  1PGT A;  5DQF A;  10GS A;  2BXB A;  3CSJ A;  4BVY A;  1K3Y A;  4Q5N A;  4EMX A;  1E7C A;  4PQI A;  1PN9 A;  3FR6 A;  1M9B A;  3D0Z A;  5ECK B;  4Q5Q A;  1XWG A;  1PL2 A;  3P90 A;  3O3T A;  4IBP A;  4GDF A;  4KX4 A;  2AB6 A;  5F0G A;  3V03 A;  1PKW A;  1V40 A;  4GG2 A;  3BBY A;  1GSF A;  1MTC A;  3NMU A;  2AHE A;  3GQU A;  1E7G A;  4N0V A;  3MAK A;  1AQX A;  4HGM B;  3I6A A;  1MIV A;  2HQT A;  1OE7 A;  2VCQ A;  3ZMK A;  2HRK A;  3LFL A;  4QMK A;  1LOT A;  2CZ2 A;  4KF9 A;  5FHI A;  4G03 A;  2OAD A;  4YAV A;  1DUG A;  5HFK A;  1FW1 A;  3ICX A;  3F6F A;  4IS0 A;  5A5H A;  3TGZ A;  4YQV A;  4HZ2 A;  4HZ4 A;  2XSI A;  4ZBK A;  4C31 B;  4HGK A;  4ZB7 A;  4IW9 A;  4E99 A;  1M99 A;  3GH6 A;  3GST A;  3N5O A;  2CKX A;  2OA7 A;  2XW1 A;  1Z9H A;  1EEM A;  4HJ2 A;  2GSS A;  2PER A;  4GDX A;  5EL8 A;  4GLT A;  2EFE A;  1FOU A;  4BL7 A;  4FJC B;  1VF4 A;  2AJE A;  12GS A;  5D73 A;  4IJI A;  2R6K A;  4F5U A;  2OAC A;  2YV9 A;  2PBJ A;  1HK1 A;  22GS A;  3HMJ G;  2YDF A;  3H37 A;  4OFM A;  3PLA A;  1GNW A;  3M8N A;  5IJE A;  1V2A A;  3R2Q A;  1E7F A;  2Z8K A;  2YV7 A;  3H3A A;  5LD0 A;  2QMC A;  1LJR A;  2BXN A;  5EVO A;  4DHX B;  2E0X A;  5J5N A;  1EV9 A;  2VUE A;  1YVL A;  3TU3 B;  3FWC C;  17GS A;  2GSR A;  3M1G A;  4EE0 A;  1J78 A;  3G9K D;  4KDY A;  2VUF A;  4AI6 A;  5DAL A;  1YY7 A;  2XMO A;  4ZBB A;  2X64 A;  1HK2 A;  3CX9 A;  2BXH A;  3NVI A;  3GSS A;  3UVH A;  2Z8J A;  3WD6 A;  2EFD A;  3JQZ A;  5DAK A;  2VKZ G;  5HOZ A;  1GSU A;  4FQU A;  4MBE C;  3B9L A;  1BJ5 A;  4MK3 A;  1JNB A;  3N9J A;  4MF7 A;  5ECN B;  6GSV A;  3KMO A;  2BXC A;  2I2Z A;  5FUO A;  1MIW A;  1VF1 A;  4IEL A;  2IMI A;  3ERG A;  1M9A A;  3DGQ A;  3LU6 A;  3PPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...