2OT3A

Crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
253
structure length
253
Chain Sequence
SKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Structural basis for Rab GTPase activation by VPS9 domain exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 91
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2ot3A01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2ot3A02
4N3ZA 2EFHA 4G01A 2EFEA 1TXUA 2EFCA 2OT3A 2EFDA
chains in the Genus database with same CATH superfamily
1N5UA 5EY6A 2FHEA 3M0FA 5AIXA 2WB9A 5DCGA 5A1NA 2YV7A 4JZQA 3UAPA 2ON5A 5ID9A 2GSQA 2IMIA 5A1NB 1GNJA 4EDZA 2QMCA 3N5OA 4N3ZA 4J2FA 2IL3A 4DHXB 1KDXA 4M70B 4I97A 1PKWA 4HZ4A 1AXDA 2LXSA 1AW9A 2BXNA 3FR3A 3A75A 2YCDA 2KBZA 1JNBA 3FRCA 3I69A 5A4UA 2O3EA 1SVLA 1OKTA 4EXJA 5FUOA 1EV4A 3VLNA 10GSA 3G7JA 2F8FA 2K0NA 3B9MA 1K0CA 5D7GA 1VF1A 1KBNA 2BXEA 1GUKA 18GSA 1YY7A 1ZL9A 2HNLA 1K3YA 4G04A 4EC0A 2I2ZA 4S1YA 2GSTA 3RGBC 2BXAA 2CVDA 4IW9A 5IFOA 1B48A 3CRUA 2BXHA 3GH6A 3VI5A 4ID0A 4GDKB 3KMOA 1GSFA 1XWKA 2GDRA 4PO0A 2DBWA 1PL1A 5D73A 3A73A 1E7GA 1MUSA 1MIWA 1E6BA 1M99A 4ZB9A 5J4VA 4LB2A 1MTCA 3FY7A 4PURA 5IJ5A 2OACA 3KTLA 3TU3B 4ECIA 4N0VA 2OT3A 2VCWA 3Q18A 4AKHA 1IYIA 3FYGA 2WZSA 3F6DA 4KDUA 4WR5A 2CAQA 3LG6A 1H9ZA 1K0OA 5G5FA 3NVKA 1PX6A 4MF6A 4ZBBA 4KX4A 5A4WA 6GSTA 3QAGA 5JCWA 1S4BP 1LBKA 4QQ7A 1ZGNA 5A34A 1OYJA 4JK4A 1M9BA 6GSVA 2WJUA 5DJMA 2PGTA 4MPFA 4GDLB 5A34B 2FNOA 4KGIA 3W1SA 5GIPA 3WHSA 4ZBAA 1PN9A 2CA8A 2X64A 2BX8A 5ECRB 1YEWC 3M3MA 5AIVA 4LB9A 4KF9A 3CSIA 5ECOB 2LJRA 5D9XA 2EFCA 4F03A 3MHHB 4F5TA 2GTUA 2R6KA 2R3XA 4E68A 2J9HA 2GLRA 5F0GA 4HJ2A 5DBYA 2UV8G 1VF3A 2EFDA 4FJCB 5AISA 1FHEA 2PBJA 4C31B 1K0AA 6GSSA 1UORA 4FQUA 2WVYA 5ECPB 2EFEA 4Z9OA 1EEMA 4ZC6A 3BBYA 1USBA 1XWGA 2HRKA 3JQZA 3RFRC 2VCVA 2VKZG 5GZZB 2GSRA 2HRKB 3U6VA 4KAEA 4Q5NA 3HMJG 2AJEA 1H5WA 1HQOA 5B5TA 3PLAA 1F3BA 3NVMA 5DALA 4CHSA 6GSYA 5GINA 1O9XA 2NNWA 5DALB 2BXPA 2C80A 2V6KA 4YAVA 5ECIB 2N5FA 4OT2A 13GSA 4N0UD 4E8EA 3WD6A 4D7XA 5DQFA 2JL4A 4G10A 2LOQA 1SVMA 4LMVA 1GSDA 4G0IA 2XSIA 2E0YA 4PX1A 1U87A 4N0FD 5J4UA 4IQ1A 5D9WA 5IJFA 5D9VA 1K0BA 1YJ6A 2UZ8A 3F63A 12GSA 3MDKA 2DYOA 3TGZA 2XMOA 4W66A 4WR4A 2YDFA 2BXIA 4TQ0A 4L9QA 4G9HA 3GA9L 3FNMA 1K3LA 3NVIA 4MPGA 1IYHA 1PD21 1TU7A 5ECKB 4OFMA 3B9LA 2OZBB 2GUTA 3D0ZA 4HOJA 2BXGA 3GTUA 2VUFA 1MM8A 2YV9A 1UA5A 5DDLA 5A5KA 4GDXA 1TF0A 1VFIA 2XVVA 3GTUB 3TOUA 2DG5A 2VUEA 4BVXA 3V08A 2DSAA 4IVFA 5A5HA 5J4YA 1JLWA 1GSQA 1BAYA 4BVXB 4GDFA 5A5HB 5F05A 4K71A 5J47A 1EOGA 2VD0A 4W4UB 4K0GA 4NHZA 5AGYA 4BL7A 2QM6A 1LNSA 2BXBA 4BKEA 2ON7A 4BL7B 3VI7A 4L9KA 5GHKA 4WA6B 1E7FA 4ZB6A 5IIUA 1Y6EA 6GSXA 5ECMB 4JEDA 2NQOA 1EV9A 2WS2A 5LD0A 3QAWA 3LSZA 3MHSB 1RK4A 3M1GA 1PKZA 1J78A 3DD3A 3W8SA 1F3AA 2LXTA 2PVQA 2DC5A 1HK4A 2KWFA 3LU7A 3F6FA 4YQMA 5D9TA 2HSMA 3LYPA 3ERGA 5F8BA 5FT3A 2HSMB 1BKEA 4L8EA 2JUHA 3VURA 3WHQA 2A2RA 4K0NA 3CX9A 4FK5B 1HNAA 3SIVB 4PHZC 3UARA 1BYEA 3ZFBA 3P8WA 2E0XA 4LUFA 1B8XA 4ZXGA 4IELA 4FXYP 3L0HA 4HGMB 4L5LA 4TQ1A 3FR6A 4IW1A 1BG5A 2WW3A 4JBBA 4HI7A 3DGQA 4QMKA 4L5OA 2HQTA 2C4JA 5EVOA 5J40A 3KIKA 20GSA 3LXTA 4IS0A 4NAXA 2BXQA 5LCZA 1G6WA 3SIUB 6GSWA 1GUMA 4ZBRA 3WHRA 4PGTA 1U88A 1GSYA 4OFNA 4G19A 4ZB7A 5G5EA 4GLTA 1E7IA 3JRYA 1MD3A 2BXKA 2HRAA 3KM6A 4G0KA 3LJRA 3ZMLA 1E7BA 2XW0A 1YVLA 4HZ2A 4KE3A 4F0BA 5A4VA 4E99A 2F3MA 4ZB8A 5ECQB 2WRTA 3GQUA 3NMUA 5F06A 1YQ1A 4EE0A 4MDCA 1E7HA 4ZBQA 2GSSA 2BXOA 4MP4A 4Q5FA 1V2AA 3Q74A 2PMTA 3IE3A 1MD4A 3KMNA 3V03A 8GSSA 4K2CA 3UIVA 5ECSA 5FHIA 2VCZA 1HK3A 4KSMA 3GSSA 2VD1A 4PXOA 4OTTA 2AGHB 4LA0A 4OTUA 4Q5QA 2WW2A 3BPJA 2XW1A 1K0DA 1OE7A 5B7CA 1E7AA 3IK9A 4BVYA 2DBXA 2NTOA 2WW1A 3PR8A 4LUHA 3KXOA 4J2VA 4BVYB 2C3NA 4RI7A 3KJLA 3TDLA 3VPQA 4Q5RA 5DJLA 1C72A 1IJGA 1PGTA 1Y1UA 4O92A 2EFHA 1GTIA 4ACSA 3UVHA 3QAVA 4GF0A 4IW2A 3SQJA 3EE2A 4PNFA 1GTUA 3VQIA 2XVQA 4TOPA 4PNGA 3GSTA 4YH2A 1YKCA 1BX9A 3PGTA 5J41A 4F5SA 1GSEA 3GUSA 3UBKA 4MF5A 3RBTA 22GSA 2AHEA 3QR6A 4F0CA 3LFLA 7GSSA 1K0NA 3CSHA 3O3TA 2BXDA 3C8EA 4EDYA 3G7IA 3GQXA 1SVOA 17GSA 2H1LA 5JCUA 1TXUA 2CZ2A 4GSNA 1R5AA 4KDYA 5IIXA 3IBHA 4IBPA 1LOTA 1HK1A 3ISOA 1AO6A 1V40A 3H3AA 4AKXB 5DAKA 1GSSA 4AGSA 2QHBA 5DAKB 3ZMKA 4O7HA 5ECNB 3I6AA 3GX0A 3CWGA 1KXPD 3FR9A 3NIVA 3HJOA 1MIVA 4DEJA 3CBUA 1HK5A 1KW2A 4IJIA 2WVZA 1TW9A 3EINA 1HA2A 2PERA 3PPUA 1MIYA 19GSA 1SB0A 2WW0A 5IQYA 1G7OA 4ECJA 2VDBA 2R5GA 3TOTA 3AY8A 5FWGA 3ZFLA 2Z8JA 4YAPA 2DBUA 1BJ5A 2XVUA 2Z8KA 5ID7A 2C3QA 4IKHA 4GSTA 1YDKA 2OA7A 5ECLB 1GNIA 3VWXA 2VCQA 1GTBA 1LJRA 1Q4JA 2BXLA 1HK2A 1G6YA 2VO4A 4PI0C 1PX7A 2O5VA 4DM0A 1GLPA 3CHXC 4USSA 5ECHB 6GSUA 4G0LA 3SWLA 3LU8A 4IQAA 3MAKA 4GCIA 5HFKA 5KEJA 2LQIA 5ELGA 4F5VA 3LYKA 5DQSA 5AN1A 1PMTA 1XW6A 4L8UA 1NT2B 1BF5A 1Z9HA 2VCXA 1BG1A 4ECBA 2ROHA 1VZSA 2BXMA 1E78A 4MF7A 4OFTA 1HNBA 1M9AA 1N2AA 2V36A 3G9KD 4FIPB 1BM0A 3VK9A 1TU8A 2AAWA 2D2ZA 5EL8A 2BXFA 3ECPA 3IR4A 3R3EA 4GTUA 4PUAA 4GSSA 1GNEA 1F2EA 5F07A 5GSTA 3O76A 5BMUA 9GSSA 2R4VA 5IJEA 4E8HA 4KH7A 4GG2A 4RI6A 4IGJA 1EOHA 1VF2A 3H1NA 5BMUB 2DYMA 1U3IA 2C3TA 1K3OA 2IMKA 3IC8A 3HKRA 3VPTA 4ZUXV 2A2SA 4G03A 2C8UA 1HNCA 5GSSA 4AKIA 1A0FA 1ML6A 4F5UA 1I1IP 4PI2C 16GSA 2OADA 4PTSA 1GTAA 3LXZA 4ZBDA 5J5NA 1N25A 2WDUA 3ICXA 3H37A 2CZ3A 1MA9A 2LQHA 3M99C 3V09A 1M0UA 1TDIA 3P90A 4EMXA 1PL2A 4OMVA 4PQHA 14GSA 1DUGA 1AQWA 3N9JA 2I30A 2WVXA 3Q19A 4YQUA 3UBLA 1K0MA 1JZRA 1AQXA 3LU6A 5ELAA 4YQVA 1B4PA 3LQ7A 1MUHA 1GUHA 4LMWA 4OR0A 1GLQA 2WVXB 1J7EA 1NHYA 1XW5A 5GIOA 1AQVA 1JLVA 2AB6A 1GNWA 4AKGA 1GWCA 4G01A 5HOZA 4AI6A 1E7EA 4ECCA 2VCTA 3CSJA 3IK7A 4NHWA 3FWCC 4I9OA 4ZCGA 3HJMA 3R2QA 3ERFA 5IIHA 4ISDA 2CAIA 3GURA 4MK3A 5BPKA 2HSNA 1E7CA 4ZBKA 4HGKA 1GULA 1GSUA 4MZWA 3WYWA 4Z69A 2O36A 2HSNB 2CKXA 3KJYA 4NAWB 3M8NA 1FOUA 4PQIA 4BY9C 1VF4A 1OE8A 11GSA 2Z8IA 4MBEC 1PA3A 2XVWA 3FWBC 1FW1A 4KDXA 3CRTA 2BXCA
chains in the Genus database with same CATH topology
1N5UA 5EY6A 2FHEA 3M0FA 5AIXA 2WB9A 5DCGA 5A1NA 2YV7A 4JZQA 3UAPA 2ON5A 5ID9A 2GSQA 2IMIA 5A1NB 1GNJA 4EDZA 2QMCA 3N5OA 4N3ZA 4J2FA 2IL3A 4DHXB 4M70B 4I97A 1PKWA 4HZ4A 1AXDA 1AW9A 2BXNA 3FR3A 3A75A 2YCDA 2KBZA 1JNBA 3FRCA 3I69A 5A4UA 4EXJA 1SVLA 1OKTA 5FUOA 1EV4A 3VLNA 10GSA 3G7JA 2F8FA 3B9MA 1K0CA 5D7GA 1VF1A 1KBNA 2BXEA 1GUKA 18GSA 1YY7A 1ZL9A 2HNLA 1K3YA 4G04A 4EC0A 2I2ZA 4S1YA 2GSTA 2BXAA 2CVDA 4IW9A 5IFOA 1B48A 3CRUA 2BXHA 3GH6A 3VI5A 4ID0A 4GDKB 3KMOA 1GSFA 1XWKA 2GDRA 4PO0A 2DBWA 1PL1A 5D73A 3A73A 1E7GA 1E6BA 1MIWA 1M99A 4ZB9A 5J4VA 4LB2A 1MTCA 3FY7A 4PURA 5IJ5A 2OACA 3KTLA 3TU3B 4ECIA 4N0VA 2OT3A 2VCWA 3Q18A 4AKHA 1IYIA 3FYGA 3F6DA 4WR5A 4KDUA 2CAQA 3LG6A 1H9ZA 1K0OA 5G5FA 3NVKA 1PX6A 4MF6A 4ZBBA 4KX4A 5A4WA 6GSTA 3QAGA 1LBKA 4QQ7A 1ZGNA 5A34A 1OYJA 4JK4A 1M9BA 6GSVA 2WJUA 5DJMA 2PGTA 4MPFA 4GDLB 5A34B 2FNOA 4KGIA 3W1SA 5GIPA 3WHSA 4ZBAA 1PN9A 2CA8A 2X64A 2BX8A 5ECRB 3M3MA 5AIVA 4LB9A 4KF9A 3CSIA 5ECOB 2LJRA 5D9XA 2EFCA 4F03A 3MHHB 4F5TA 2GTUA 2R6KA 2R3XA 4E68A 2J9HA 2GLRA 5F0GA 4HJ2A 5DBYA 2UV8G 1VF3A 2EFDA 4FJCB 5AISA 1FHEA 2PBJA 4C31B 1K0AA 6GSSA 1UORA 4FQUA 5ECPB 2EFEA 4Z9OA 1EEMA 4ZC6A 3BBYA 1USBA 1XWGA 2HRKA 3JQZA 2VCVA 2VKZG 5GZZB 2GSRA 2HRKB 3U6VA 4KAEA 4Q5NA 3HMJG 2AJEA 1H5WA 1HQOA 5B5TA 3PLAA 1F3BA 3NVMA 5DALA 4CHSA 6GSYA 5GINA 1O9XA 2NNWA 5DALB 2BXPA 2C80A 2V6KA 4YAVA 5ECIB 2N5FA 4OT2A 13GSA 4N0UD 4E8EA 3WD6A 5DQFA 2JL4A 4G10A 2LOQA 1SVMA 4LMVA 1GSDA 4G0IA 2XSIA 2E0YA 4PX1A 1U87A 4N0FD 5J4UA 4IQ1A 5D9WA 5IJFA 5D9VA 1K0BA 1YJ6A 2UZ8A 3F63A 12GSA 3MDKA 2DYOA 3TGZA 2XMOA 4W66A 4WR4A 2YDFA 2BXIA 4TQ0A 4L9QA 4G9HA 3GA9L 3FNMA 1K3LA 3NVIA 4MPGA 1IYHA 1PD21 1TU7A 5ECKB 4OFMA 3B9LA 2OZBB 3D0ZA 4HOJA 2BXGA 3GTUA 2VUFA 2YV9A 5DDLA 1UA5A 5A5KA 4GDXA 1TF0A 1VFIA 2XVVA 3GTUB 3TOUA 2DG5A 2VUEA 4BVXA 3V08A 2DSAA 4IVFA 5A5HA 5J4YA 1JLWA 1GSQA 1BAYA 4BVXB 4GDFA 5A5HB 5F05A 4K71A 5J47A 1EOGA 2VD0A 4W4UB 4K0GA 4NHZA 5AGYA 4BL7A 2QM6A 1LNSA 2BXBA 4BKEA 2ON7A 4BL7B 3VI7A 4L9KA 5GHKA 4WA6B 1E7FA 4ZB6A 5IIUA 1Y6EA 6GSXA 5ECMB 4JEDA 2NQOA 1EV9A 2WS2A 5LD0A 3QAWA 3LSZA 3MHSB 1RK4A 3M1GA 1PKZA 1J78A 3DD3A 3W8SA 1F3AA 2PVQA 2DC5A 1HK4A 3LU7A 3F6FA 4YQMA 5D9TA 2HSMA 3LYPA 3ERGA 5F8BA 5FT3A 2HSMB 1BKEA 4L8EA 2JUHA 3VURA 3WHQA 2A2RA 4K0NA 3CX9A 4FK5B 1HNAA 3SIVB 3UARA 1BYEA 3ZFBA 3P8WA 2E0XA 4LUFA 1B8XA 4ZXGA 4IELA 3L0HA 4HGMB 4L5LA 4TQ1A 3FR6A 4IW1A 1BG5A 4JBBA 4HI7A 3DGQA 4QMKA 4L5OA 2HQTA 2C4JA 5EVOA 5J40A 3KIKA 20GSA 3LXTA 4IS0A 4NAXA 2BXQA 5LCZA 1G6WA 3SIUB 6GSWA 1GUMA 4ZBRA 3WHRA 4PGTA 1U88A 1GSYA 4OFNA 4G19A 4ZB7A 5G5EA 4GLTA 1E7IA 3JRYA 1MD3A 2BXKA 2HRAA 3KM6A 4G0KA 3LJRA 3ZMLA 1E7BA 2XW0A 1YVLA 4HZ2A 4KE3A 4F0BA 5A4VA 4E99A 2F3MA 4ZB8A 5ECQB 2WRTA 3GQUA 3NMUA 5F06A 1YQ1A 4EE0A 4MDCA 1E7HA 4ZBQA 2GSSA 2BXOA 4MP4A 4Q5FA 1V2AA 3Q74A 2PMTA 3IE3A 1MD4A 3KMNA 3V03A 8GSSA 4K2CA 3UIVA 5ECSA 5FHIA 2VCZA 1HK3A 4KSMA 3GSSA 2VD1A 4PXOA 4OTTA 4LA0A 4OTUA 4Q5QA 2XW1A 1K0DA 1OE7A 5B7CA 1E7AA 3IK9A 4BVYA 2DBXA 2NTOA 3PR8A 4LUHA 3KXOA 4J2VA 4BVYB 2C3NA 4RI7A 3KJLA 3TDLA 3VPQA 4Q5RA 5DJLA 1C72A 1IJGA 1PGTA 1Y1UA 4O92A 2EFHA 1GTIA 4ACSA 3UVHA 3QAVA 4GF0A 4IW2A 3SQJA 3EE2A 4PNFA 1GTUA 3VQIA 2XVQA 4TOPA 4PNGA 3GSTA 4YH2A 1YKCA 1BX9A 3PGTA 5J41A 4F5SA 1GSEA 3GUSA 3UBKA 4MF5A 3RBTA 22GSA 2AHEA 3QR6A 4F0CA 3LFLA 7GSSA 1K0NA 3CSHA 3O3TA 2BXDA 3C8EA 4EDYA 3G7IA 3GQXA 1SVOA 17GSA 2H1LA 5JCUA 1TXUA 2CZ2A 4GSNA 1R5AA 4KDYA 5IIXA 3IBHA 4IBPA 1LOTA 1HK1A 3ISOA 1AO6A 1V40A 3H3AA 4AKXB 5DAKA 1GSSA 4AGSA 2QHBA 5DAKB 3ZMKA 4O7HA 5ECNB 3I6AA 3GX0A 3CWGA 1KXPD 3FR9A 3NIVA 3HJOA 1MIVA 4DEJA 3CBUA 1HK5A 1KW2A 4IJIA 1TW9A 3EINA 1HA2A 2PERA 3PPUA 1MIYA 19GSA 5IQYA 1G7OA 4ECJA 2VDBA 2R5GA 3TOTA 3AY8A 5FWGA 3ZFLA 2Z8JA 4YAPA 2DBUA 1BJ5A 2XVUA 2Z8KA 5ID7A 2C3QA 4IKHA 4GSTA 1YDKA 2OA7A 5ECLB 1GNIA 3VWXA 2VCQA 1GTBA 1LJRA 1Q4JA 2BXLA 1HK2A 1G6YA 2VO4A 1PX7A 2O5VA 1GLPA 5ECHB 4USSA 6GSUA 4G0LA 3SWLA 3LU8A 4IQAA 3MAKA 4GCIA 5HFKA 5KEJA 5ELGA 4F5VA 3LYKA 5DQSA 5AN1A 1PMTA 1XW6A 4L8UA 1NT2B 1BF5A 1Z9HA 2VCXA 1BG1A 4ECBA 2ROHA 1VZSA 2BXMA 1E78A 4MF7A 4OFTA 1HNBA 1M9AA 1N2AA 2V36A 3G9KD 4FIPB 1BM0A 3VK9A 1TU8A 2AAWA 2D2ZA 5EL8A 2BXFA 3IR4A 3R3EA 4GTUA 4PUAA 4GSSA 1GNEA 1F2EA 5F07A 5GSTA 3O76A 5BMUA 9GSSA 2R4VA 5IJEA 4E8HA 4KH7A 4GG2A 4RI6A 4IGJA 1EOHA 1VF2A 3H1NA 5BMUB 2DYMA 1U3IA 2C3TA 1K3OA 2IMKA 3IC8A 3HKRA 3VPTA 4ZUXV 2A2SA 4G03A 2C8UA 1HNCA 5GSSA 4AKIA 1A0FA 1ML6A 4F5UA 16GSA 2OADA 4PTSA 1GTAA 3LXZA 4ZBDA 5J5NA 1N25A 2WDUA 3ICXA 3H37A 2CZ3A 1MA9A 1M0UA 3M99C 3V09A 1TDIA 3P90A 4EMXA 1PL2A 4OMVA 4PQHA 14GSA 1DUGA 1AQWA 3N9JA 2I30A 3Q19A 4YQUA 3UBLA 1K0MA 1JZRA 1AQXA 3LU6A 5ELAA 4YQVA 1B4PA 3LQ7A 1GUHA 4LMWA 4OR0A 1GLQA 1J7EA 1NHYA 1XW5A 5GIOA 1AQVA 1JLVA 2AB6A 1GNWA 4AKGA 1GWCA 4G01A 5HOZA 4AI6A 1E7EA 4ECCA 2VCTA 3CSJA 3IK7A 4NHWA 3FWCC 4ZCGA 3HJMA 3R2QA 3ERFA 5IIHA 4ISDA 2CAIA 3GURA 4MK3A 5BPKA 2HSNA 1E7CA 4ZBKA 4HGKA 1GULA 1GSUA 4MZWA 3WYWA 4Z69A 3KJYA 2HSNB 2CKXA 5JCWA 4NAWB 3M8NA 1FOUA 4PQIA 4BY9C 1VF4A 1OE8A 11GSA 2Z8IA 4MBEC 1PA3A 2XVWA 3FWBC 1FW1A 4KDXA 3CRTA 2BXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3Z A;  2EFH A;  4G01 A;  2EFE A;  1TXU A;  2EFC A;  2OT3 A;  2EFD A; 
#chains in the Genus database with same CATH topology
 1N5U A;  5EY6 A;  2FHE A;  3M0F A;  5AIX A;  2WB9 A;  5DCG A;  5A1N A;  2YV7 A;  4JZQ A;  3UAP A;  2ON5 A;  5ID9 A;  2GSQ A;  2IMI A;  5A1N B;  1GNJ A;  4EDZ A;  2QMC A;  3N5O A;  4N3Z A;  4J2F A;  2IL3 A;  4DHX B;  1KDX A;  4M70 B;  4I97 A;  1PKW A;  4HZ4 A;  1AXD A;  2LXS A;  1AW9 A;  2BXN A;  3FR3 A;  3A75 A;  2YCD A;  2KBZ A;  1JNB A;  3FRC A;  3I69 A;  5A4U A;  2O3E A;  1SVL A;  1OKT A;  4EXJ A;  5FUO A;  1EV4 A;  3VLN A;  10GS A;  3G7J A;  2F8F A;  2K0N A;  3B9M A;  1K0C A;  5D7G A;  1VF1 A;  1KBN A;  2BXE A;  1GUK A;  18GS A;  1YY7 A;  1ZL9 A;  2HNL A;  1K3Y A;  4G04 A;  4EC0 A;  2I2Z A;  4S1Y A;  2GST A;  3RGB C;  2BXA A;  2CVD A;  4IW9 A;  5IFO A;  1B48 A;  3CRU A;  2BXH A;  3GH6 A;  3VI5 A;  4ID0 A;  4GDK B;  3KMO A;  1GSF A;  1XWK A;  2GDR A;  4PO0 A;  2DBW A;  1PL1 A;  5D73 A;  3A73 A;  1E7G A;  1MUS A;  1MIW A;  1E6B A;  1M99 A;  4ZB9 A;  5J4V A;  4LB2 A;  1MTC A;  3FY7 A;  4PUR A;  5IJ5 A;  2OAC A;  3KTL A;  3TU3 B;  4ECI A;  4N0V A;  2OT3 A;  2VCW A;  3Q18 A;  4AKH A;  1IYI A;  3FYG A;  2WZS A;  3F6D A;  4KDU A;  4WR5 A;  2CAQ A;  3LG6 A;  1H9Z A;  1K0O A;  5G5F A;  3NVK A;  1PX6 A;  4MF6 A;  4ZBB A;  4KX4 A;  5A4W A;  6GST A;  3QAG A;  5JCW A;  1S4B P;  1LBK A;  4QQ7 A;  1ZGN A;  5A34 A;  1OYJ A;  4JK4 A;  1M9B A;  6GSV A;  2WJU A;  5DJM A;  2PGT A;  4MPF A;  4GDL B;  5A34 B;  2FNO A;  4KGI A;  3W1S A;  5GIP A;  3WHS A;  4ZBA A;  1PN9 A;  2CA8 A;  2X64 A;  2BX8 A;  5ECR B;  1YEW C;  3M3M A;  5AIV A;  4LB9 A;  4KF9 A;  3CSI A;  5ECO B;  2LJR A;  5D9X A;  2EFC A;  4F03 A;  3MHH B;  4F5T A;  2GTU A;  2R6K A;  2R3X A;  4E68 A;  2J9H A;  2GLR A;  5F0G A;  4HJ2 A;  5DBY A;  2UV8 G;  1VF3 A;  2EFD A;  4FJC B;  5AIS A;  1FHE A;  2PBJ A;  4C31 B;  1K0A A;  6GSS A;  1UOR A;  4FQU A;  2WVY A;  5ECP B;  2EFE A;  4Z9O A;  1EEM A;  4ZC6 A;  3BBY A;  1USB A;  1XWG A;  2HRK A;  3JQZ A;  3RFR C;  2VCV A;  2VKZ G;  5GZZ B;  2GSR A;  2HRK B;  3U6V A;  4KAE A;  4Q5N A;  3HMJ G;  2AJE A;  1H5W A;  1HQO A;  5B5T A;  3PLA A;  1F3B A;  3NVM A;  5DAL A;  4CHS A;  6GSY A;  5GIN A;  1O9X A;  2NNW A;  5DAL B;  2BXP A;  2C80 A;  2V6K A;  4YAV A;  5ECI B;  2N5F A;  4OT2 A;  13GS A;  4N0U D;  4E8E A;  3WD6 A;  4D7X A;  5DQF A;  2JL4 A;  4G10 A;  2LOQ A;  1SVM A;  4LMV A;  1GSD A;  4G0I A;  2XSI A;  2E0Y A;  4PX1 A;  1U87 A;  4N0F D;  5J4U A;  4IQ1 A;  5D9W A;  5IJF A;  5D9V A;  1K0B A;  1YJ6 A;  2UZ8 A;  3F63 A;  12GS A;  3MDK A;  2DYO A;  3TGZ A;  2XMO A;  4W66 A;  4WR4 A;  2YDF A;  2BXI A;  4TQ0 A;  4L9Q A;  4G9H A;  3GA9 L;  3FNM A;  1K3L A;  3NVI A;  4MPG A;  1IYH A;  1PD2 1;  1TU7 A;  5ECK B;  4OFM A;  3B9L A;  2OZB B;  2GUT A;  3D0Z A;  4HOJ A;  2BXG A;  3GTU A;  2VUF A;  1MM8 A;  2YV9 A;  1UA5 A;  5DDL A;  5A5K A;  4GDX A;  1TF0 A;  1VFI A;  2XVV A;  3GTU B;  3TOU A;  2DG5 A;  2VUE A;  4BVX A;  3V08 A;  2DSA A;  4IVF A;  5A5H A;  5J4Y A;  1JLW A;  1GSQ A;  1BAY A;  4BVX B;  4GDF A;  5A5H B;  5F05 A;  4K71 A;  5J47 A;  1EOG A;  2VD0 A;  4W4U B;  4K0G A;  4NHZ A;  5AGY A;  4BL7 A;  2QM6 A;  1LNS A;  2BXB A;  4BKE A;  2ON7 A;  4BL7 B;  3VI7 A;  4L9K A;  5GHK A;  4WA6 B;  1E7F A;  4ZB6 A;  5IIU A;  1Y6E A;  6GSX A;  5ECM B;  4JED A;  2NQO A;  1EV9 A;  2WS2 A;  5LD0 A;  3QAW A;  3LSZ A;  3MHS B;  1RK4 A;  3M1G A;  1PKZ A;  1J78 A;  3DD3 A;  3W8S A;  1F3A A;  2LXT A;  2PVQ A;  2DC5 A;  1HK4 A;  2KWF A;  3LU7 A;  3F6F A;  4YQM A;  5D9T A;  2HSM A;  3LYP A;  3ERG A;  5F8B A;  5FT3 A;  2HSM B;  1BKE A;  4L8E A;  2JUH A;  3VUR A;  3WHQ A;  2A2R A;  4K0N A;  3CX9 A;  4FK5 B;  1HNA A;  3SIV B;  4PHZ C;  3UAR A;  1BYE A;  3ZFB A;  3P8W A;  2E0X A;  4LUF A;  1B8X A;  4ZXG A;  4IEL A;  4FXY P;  3L0H A;  4HGM B;  4L5L A;  4TQ1 A;  3FR6 A;  4IW1 A;  1BG5 A;  2WW3 A;  4JBB A;  4HI7 A;  3DGQ A;  4QMK A;  4L5O A;  2HQT A;  2C4J A;  5EVO A;  5J40 A;  3KIK A;  20GS A;  3LXT A;  4IS0 A;  4NAX A;  2BXQ A;  5LCZ A;  1G6W A;  3SIU B;  6GSW A;  1GUM A;  4ZBR A;  3WHR A;  4PGT A;  1U88 A;  1GSY A;  4OFN A;  4G19 A;  4ZB7 A;  5G5E A;  4GLT A;  1E7I A;  3JRY A;  1MD3 A;  2BXK A;  2HRA A;  3KM6 A;  4G0K A;  3LJR A;  3ZML A;  1E7B A;  2XW0 A;  1YVL A;  4HZ2 A;  4KE3 A;  4F0B A;  5A4V A;  4E99 A;  2F3M A;  4ZB8 A;  5ECQ B;  2WRT A;  3GQU A;  3NMU A;  5F06 A;  1YQ1 A;  4EE0 A;  4MDC A;  1E7H A;  4ZBQ A;  2GSS A;  2BXO A;  4MP4 A;  4Q5F A;  1V2A A;  3Q74 A;  2PMT A;  3IE3 A;  1MD4 A;  3KMN A;  3V03 A;  8GSS A;  4K2C A;  3UIV A;  5ECS A;  5FHI A;  2VCZ A;  1HK3 A;  4KSM A;  3GSS A;  2VD1 A;  4PXO A;  4OTT A;  2AGH B;  4LA0 A;  4OTU A;  4Q5Q A;  2WW2 A;  3BPJ A;  2XW1 A;  1K0D A;  1OE7 A;  5B7C A;  1E7A A;  3IK9 A;  4BVY A;  2DBX A;  2NTO A;  2WW1 A;  3PR8 A;  4LUH A;  3KXO A;  4J2V A;  4BVY B;  2C3N A;  4RI7 A;  3KJL A;  3TDL A;  3VPQ A;  4Q5R A;  5DJL A;  1C72 A;  1IJG A;  1PGT A;  1Y1U A;  4O92 A;  2EFH A;  1GTI A;  4ACS A;  3UVH A;  3QAV A;  4GF0 A;  4IW2 A;  3SQJ A;  3EE2 A;  4PNF A;  1GTU A;  3VQI A;  2XVQ A;  4TOP A;  4PNG A;  3GST A;  4YH2 A;  1YKC A;  1BX9 A;  3PGT A;  5J41 A;  4F5S A;  1GSE A;  3GUS A;  3UBK A;  4MF5 A;  3RBT A;  22GS A;  2AHE A;  3QR6 A;  4F0C A;  3LFL A;  7GSS A;  1K0N A;  3CSH A;  3O3T A;  2BXD A;  3C8E A;  4EDY A;  3G7I A;  3GQX A;  1SVO A;  17GS A;  2H1L A;  5JCU A;  1TXU A;  2CZ2 A;  4GSN A;  1R5A A;  4KDY A;  5IIX A;  3IBH A;  4IBP A;  1LOT A;  1HK1 A;  3ISO A;  1AO6 A;  1V40 A;  3H3A A;  4AKX B;  5DAK A;  1GSS A;  4AGS A;  2QHB A;  5DAK B;  3ZMK A;  4O7H A;  5ECN B;  3I6A A;  3GX0 A;  3CWG A;  1KXP D;  3FR9 A;  3NIV A;  3HJO A;  1MIV A;  4DEJ A;  3CBU A;  1HK5 A;  1KW2 A;  4IJI A;  2WVZ A;  1TW9 A;  3EIN A;  1HA2 A;  2PER A;  3PPU A;  1MIY A;  19GS A;  1SB0 A;  2WW0 A;  5IQY A;  1G7O A;  4ECJ A;  2VDB A;  2R5G A;  3TOT A;  3AY8 A;  5FWG A;  3ZFL A;  2Z8J A;  4YAP A;  2DBU A;  1BJ5 A;  2XVU A;  2Z8K A;  5ID7 A;  2C3Q A;  4IKH A;  4GST A;  1YDK A;  2OA7 A;  5ECL B;  1GNI A;  3VWX A;  2VCQ A;  1GTB A;  1LJR A;  1Q4J A;  2BXL A;  1HK2 A;  1G6Y A;  2VO4 A;  4PI0 C;  1PX7 A;  2O5V A;  4DM0 A;  1GLP A;  3CHX C;  4USS A;  5ECH B;  6GSU A;  4G0L A;  3SWL A;  3LU8 A;  4IQA A;  3MAK A;  4GCI A;  5HFK A;  5KEJ A;  2LQI A;  5ELG A;  4F5V A;  3LYK A;  5DQS A;  5AN1 A;  1PMT A;  1XW6 A;  4L8U A;  1NT2 B;  1BF5 A;  1Z9H A;  2VCX A;  1BG1 A;  4ECB A;  2ROH A;  1VZS A;  2BXM A;  1E78 A;  4MF7 A;  4OFT A;  1HNB A;  1M9A A;  1N2A A;  2V36 A;  3G9K D;  4FIP B;  1BM0 A;  3VK9 A;  1TU8 A;  2AAW A;  2D2Z A;  5EL8 A;  2BXF A;  3ECP A;  3IR4 A;  3R3E A;  4GTU A;  4PUA A;  4GSS A;  1GNE A;  1F2E A;  5F07 A;  5GST A;  3O76 A;  5BMU A;  9GSS A;  2R4V A;  5IJE A;  4E8H A;  4KH7 A;  4GG2 A;  4RI6 A;  4IGJ A;  1EOH A;  1VF2 A;  3H1N A;  5BMU B;  2DYM A;  1U3I A;  2C3T A;  1K3O A;  2IMK A;  3IC8 A;  3HKR A;  3VPT A;  4ZUX V;  2A2S A;  4G03 A;  2C8U A;  1HNC A;  5GSS A;  4AKI A;  1A0F A;  1ML6 A;  4F5U A;  1I1I P;  4PI2 C;  16GS A;  2OAD A;  4PTS A;  1GTA A;  3LXZ A;  4ZBD A;  5J5N A;  1N25 A;  2WDU A;  3ICX A;  3H37 A;  2CZ3 A;  1MA9 A;  2LQH A;  3M99 C;  3V09 A;  1M0U A;  1TDI A;  3P90 A;  4EMX A;  1PL2 A;  4OMV A;  4PQH A;  14GS A;  1DUG A;  1AQW A;  3N9J A;  2I30 A;  2WVX A;  3Q19 A;  4YQU A;  3UBL A;  1K0M A;  1JZR A;  1AQX A;  3LU6 A;  5ELA A;  4YQV A;  1B4P A;  3LQ7 A;  1MUH A;  1GUH A;  4LMW A;  4OR0 A;  1GLQ A;  2WVX B;  1J7E A;  1NHY A;  1XW5 A;  5GIO A;  1AQV A;  1JLV A;  2AB6 A;  1GNW A;  4AKG A;  1GWC A;  4G01 A;  5HOZ A;  4AI6 A;  1E7E A;  4ECC A;  2VCT A;  3CSJ A;  3IK7 A;  4NHW A;  3FWC C;  4I9O A;  4ZCG A;  3HJM A;  3R2Q A;  3ERF A;  5IIH A;  4ISD A;  2CAI A;  3GUR A;  4MK3 A;  5BPK A;  2HSN A;  1E7C A;  4ZBK A;  4HGK A;  1GUL A;  1GSU A;  4MZW A;  3WYW A;  4Z69 A;  2O36 A;  2HSN B;  2CKX A;  3KJY A;  4NAW B;  3M8N A;  1FOU A;  4PQI A;  4BY9 C;  1VF4 A;  1OE8 A;  11GS A;  2Z8I A;  4MBE C;  1PA3 A;  2XVW A;  3FWB C;  1FW1 A;  4KDX A;  3CRT A;  2BXC A; 
#chains in the Genus database with same CATH homology
 1N5U A;  5EY6 A;  2FHE A;  3M0F A;  5AIX A;  2WB9 A;  5DCG A;  5A1N A;  2YV7 A;  4JZQ A;  3UAP A;  2ON5 A;  5ID9 A;  2GSQ A;  2IMI A;  5A1N B;  1GNJ A;  4EDZ A;  2QMC A;  3N5O A;  4N3Z A;  4J2F A;  2IL3 A;  4DHX B;  4M70 B;  4I97 A;  1PKW A;  4HZ4 A;  1AXD A;  1AW9 A;  2BXN A;  3FR3 A;  3A75 A;  2YCD A;  2KBZ A;  1JNB A;  3FRC A;  3I69 A;  5A4U A;  4EXJ A;  1SVL A;  1OKT A;  5FUO A;  1EV4 A;  3VLN A;  10GS A;  3G7J A;  2F8F A;  3B9M A;  1K0C A;  5D7G A;  1VF1 A;  1KBN A;  2BXE A;  1GUK A;  18GS A;  1YY7 A;  1ZL9 A;  2HNL A;  1K3Y A;  4G04 A;  4EC0 A;  2I2Z A;  4S1Y A;  2GST A;  2BXA A;  2CVD A;  4IW9 A;  5IFO A;  1B48 A;  3CRU A;  2BXH A;  3GH6 A;  3VI5 A;  4ID0 A;  4GDK B;  3KMO A;  1GSF A;  1XWK A;  2GDR A;  4PO0 A;  2DBW A;  1PL1 A;  5D73 A;  3A73 A;  1E7G A;  1E6B A;  1MIW A;  1M99 A;  4ZB9 A;  5J4V A;  4LB2 A;  1MTC A;  3FY7 A;  4PUR A;  5IJ5 A;  2OAC A;  3KTL A;  3TU3 B;  4ECI A;  4N0V A;  2OT3 A;  2VCW A;  3Q18 A;  4AKH A;  1IYI A;  3FYG A;  3F6D A;  4WR5 A;  4KDU A;  2CAQ A;  3LG6 A;  1H9Z A;  1K0O A;  5G5F A;  3NVK A;  1PX6 A;  4MF6 A;  4ZBB A;  4KX4 A;  5A4W A;  6GST A;  3QAG A;  1LBK A;  4QQ7 A;  1ZGN A;  5A34 A;  1OYJ A;  4JK4 A;  1M9B A;  6GSV A;  2WJU A;  5DJM A;  2PGT A;  4MPF A;  4GDL B;  5A34 B;  2FNO A;  4KGI A;  3W1S A;  5GIP A;  3WHS A;  4ZBA A;  1PN9 A;  2CA8 A;  2X64 A;  2BX8 A;  5ECR B;  3M3M A;  5AIV A;  4LB9 A;  4KF9 A;  3CSI A;  5ECO B;  2LJR A;  5D9X A;  2EFC A;  4F03 A;  3MHH B;  4F5T A;  2GTU A;  2R6K A;  2R3X A;  4E68 A;  2J9H A;  2GLR A;  5F0G A;  4HJ2 A;  5DBY A;  2UV8 G;  1VF3 A;  2EFD A;  4FJC B;  5AIS A;  1FHE A;  2PBJ A;  4C31 B;  1K0A A;  6GSS A;  1UOR A;  4FQU A;  5ECP B;  2EFE A;  4Z9O A;  1EEM A;  4ZC6 A;  3BBY A;  1USB A;  1XWG A;  2HRK A;  3JQZ A;  2VCV A;  2VKZ G;  5GZZ B;  2GSR A;  2HRK B;  3U6V A;  4KAE A;  4Q5N A;  3HMJ G;  2AJE A;  1H5W A;  1HQO A;  5B5T A;  3PLA A;  1F3B A;  3NVM A;  5DAL A;  4CHS A;  6GSY A;  5GIN A;  1O9X A;  2NNW A;  5DAL B;  2BXP A;  2C80 A;  2V6K A;  4YAV A;  5ECI B;  2N5F A;  4OT2 A;  13GS A;  4N0U D;  4E8E A;  3WD6 A;  5DQF A;  2JL4 A;  4G10 A;  2LOQ A;  1SVM A;  4LMV A;  1GSD A;  4G0I A;  2XSI A;  2E0Y A;  4PX1 A;  1U87 A;  4N0F D;  5J4U A;  4IQ1 A;  5D9W A;  5IJF A;  5D9V A;  1K0B A;  1YJ6 A;  2UZ8 A;  3F63 A;  12GS A;  3MDK A;  2DYO A;  3TGZ A;  2XMO A;  4W66 A;  4WR4 A;  2YDF A;  2BXI A;  4TQ0 A;  4L9Q A;  4G9H A;  3GA9 L;  3FNM A;  1K3L A;  3NVI A;  4MPG A;  1IYH A;  1PD2 1;  1TU7 A;  5ECK B;  4OFM A;  3B9L A;  2OZB B;  3D0Z A;  4HOJ A;  2BXG A;  3GTU A;  2VUF A;  2YV9 A;  5DDL A;  1UA5 A;  5A5K A;  4GDX A;  1TF0 A;  1VFI A;  2XVV A;  3GTU B;  3TOU A;  2DG5 A;  2VUE A;  4BVX A;  3V08 A;  2DSA A;  4IVF A;  5A5H A;  5J4Y A;  1JLW A;  1GSQ A;  1BAY A;  4BVX B;  4GDF A;  5A5H B;  5F05 A;  4K71 A;  5J47 A;  1EOG A;  2VD0 A;  4W4U B;  4K0G A;  4NHZ A;  5AGY A;  4BL7 A;  2QM6 A;  1LNS A;  2BXB A;  4BKE A;  2ON7 A;  4BL7 B;  3VI7 A;  4L9K A;  5GHK A;  4WA6 B;  1E7F A;  4ZB6 A;  5IIU A;  1Y6E A;  6GSX A;  5ECM B;  4JED A;  2NQO A;  1EV9 A;  2WS2 A;  5LD0 A;  3QAW A;  3LSZ A;  3MHS B;  1RK4 A;  3M1G A;  1PKZ A;  1J78 A;  3DD3 A;  3W8S A;  1F3A A;  2PVQ A;  2DC5 A;  1HK4 A;  3LU7 A;  3F6F A;  4YQM A;  5D9T A;  2HSM A;  3LYP A;  3ERG A;  5F8B A;  5FT3 A;  2HSM B;  1BKE A;  4L8E A;  2JUH A;  3VUR A;  3WHQ A;  2A2R A;  4K0N A;  3CX9 A;  4FK5 B;  1HNA A;  3SIV B;  3UAR A;  1BYE A;  3ZFB A;  3P8W A;  2E0X A;  4LUF A;  1B8X A;  4ZXG A;  4IEL A;  3L0H A;  4HGM B;  4L5L A;  4TQ1 A;  3FR6 A;  4IW1 A;  1BG5 A;  4JBB A;  4HI7 A;  3DGQ A;  4QMK A;  4L5O A;  2HQT A;  2C4J A;  5EVO A;  5J40 A;  3KIK A;  20GS A;  3LXT A;  4IS0 A;  4NAX A;  2BXQ A;  5LCZ A;  1G6W A;  3SIU B;  6GSW A;  1GUM A;  4ZBR A;  3WHR A;  4PGT A;  1U88 A;  1GSY A;  4OFN A;  4G19 A;  4ZB7 A;  5G5E A;  4GLT A;  1E7I A;  3JRY A;  1MD3 A;  2BXK A;  2HRA A;  3KM6 A;  4G0K A;  3LJR A;  3ZML A;  1E7B A;  2XW0 A;  1YVL A;  4HZ2 A;  4KE3 A;  4F0B A;  5A4V A;  4E99 A;  2F3M A;  4ZB8 A;  5ECQ B;  2WRT A;  3GQU A;  3NMU A;  5F06 A;  1YQ1 A;  4EE0 A;  4MDC A;  1E7H A;  4ZBQ A;  2GSS A;  2BXO A;  4MP4 A;  4Q5F A;  1V2A A;  3Q74 A;  2PMT A;  3IE3 A;  1MD4 A;  3KMN A;  3V03 A;  8GSS A;  4K2C A;  3UIV A;  5ECS A;  5FHI A;  2VCZ A;  1HK3 A;  4KSM A;  3GSS A;  2VD1 A;  4PXO A;  4OTT A;  4LA0 A;  4OTU A;  4Q5Q A;  2XW1 A;  1K0D A;  1OE7 A;  5B7C A;  1E7A A;  3IK9 A;  4BVY A;  2DBX A;  2NTO A;  3PR8 A;  4LUH A;  3KXO A;  4J2V A;  4BVY B;  2C3N A;  4RI7 A;  3KJL A;  3TDL A;  3VPQ A;  4Q5R A;  5DJL A;  1C72 A;  1IJG A;  1PGT A;  1Y1U A;  4O92 A;  2EFH A;  1GTI A;  4ACS A;  3UVH A;  3QAV A;  4GF0 A;  4IW2 A;  3SQJ A;  3EE2 A;  4PNF A;  1GTU A;  3VQI A;  2XVQ A;  4TOP A;  4PNG A;  3GST A;  4YH2 A;  1YKC A;  1BX9 A;  3PGT A;  5J41 A;  4F5S A;  1GSE A;  3GUS A;  3UBK A;  4MF5 A;  3RBT A;  22GS A;  2AHE A;  3QR6 A;  4F0C A;  3LFL A;  7GSS A;  1K0N A;  3CSH A;  3O3T A;  2BXD A;  3C8E A;  4EDY A;  3G7I A;  3GQX A;  1SVO A;  17GS A;  2H1L A;  5JCU A;  1TXU A;  2CZ2 A;  4GSN A;  1R5A A;  4KDY A;  5IIX A;  3IBH A;  4IBP A;  1LOT A;  1HK1 A;  3ISO A;  1AO6 A;  1V40 A;  3H3A A;  4AKX B;  5DAK A;  1GSS A;  4AGS A;  2QHB A;  5DAK B;  3ZMK A;  4O7H A;  5ECN B;  3I6A A;  3GX0 A;  3CWG A;  1KXP D;  3FR9 A;  3NIV A;  3HJO A;  1MIV A;  4DEJ A;  3CBU A;  1HK5 A;  1KW2 A;  4IJI A;  1TW9 A;  3EIN A;  1HA2 A;  2PER A;  3PPU A;  1MIY A;  19GS A;  5IQY A;  1G7O A;  4ECJ A;  2VDB A;  2R5G A;  3TOT A;  3AY8 A;  5FWG A;  3ZFL A;  2Z8J A;  4YAP A;  2DBU A;  1BJ5 A;  2XVU A;  2Z8K A;  5ID7 A;  2C3Q A;  4IKH A;  4GST A;  1YDK A;  2OA7 A;  5ECL B;  1GNI A;  3VWX A;  2VCQ A;  1GTB A;  1LJR A;  1Q4J A;  2BXL A;  1HK2 A;  1G6Y A;  2VO4 A;  1PX7 A;  2O5V A;  1GLP A;  5ECH B;  4USS A;  6GSU A;  4G0L A;  3SWL A;  3LU8 A;  4IQA A;  3MAK A;  4GCI A;  5HFK A;  5KEJ A;  5ELG A;  4F5V A;  3LYK A;  5DQS A;  5AN1 A;  1PMT A;  1XW6 A;  4L8U A;  1NT2 B;  1BF5 A;  1Z9H A;  2VCX A;  1BG1 A;  4ECB A;  2ROH A;  1VZS A;  2BXM A;  1E78 A;  4MF7 A;  4OFT A;  1HNB A;  1M9A A;  1N2A A;  2V36 A;  3G9K D;  4FIP B;  1BM0 A;  3VK9 A;  1TU8 A;  2AAW A;  2D2Z A;  5EL8 A;  2BXF A;  3IR4 A;  3R3E A;  4GTU A;  4PUA A;  4GSS A;  1GNE A;  1F2E A;  5F07 A;  5GST A;  3O76 A;  5BMU A;  9GSS A;  2R4V A;  5IJE A;  4E8H A;  4KH7 A;  4GG2 A;  4RI6 A;  4IGJ A;  1EOH A;  1VF2 A;  3H1N A;  5BMU B;  2DYM A;  1U3I A;  2C3T A;  1K3O A;  2IMK A;  3IC8 A;  3HKR A;  3VPT A;  4ZUX V;  2A2S A;  4G03 A;  2C8U A;  1HNC A;  5GSS A;  4AKI A;  1A0F A;  1ML6 A;  4F5U A;  16GS A;  2OAD A;  4PTS A;  1GTA A;  3LXZ A;  4ZBD A;  5J5N A;  1N25 A;  2WDU A;  3ICX A;  3H37 A;  2CZ3 A;  1MA9 A;  1M0U A;  3M99 C;  3V09 A;  1TDI A;  3P90 A;  4EMX A;  1PL2 A;  4OMV A;  4PQH A;  14GS A;  1DUG A;  1AQW A;  3N9J A;  2I30 A;  3Q19 A;  4YQU A;  3UBL A;  1K0M A;  1JZR A;  1AQX A;  3LU6 A;  5ELA A;  4YQV A;  1B4P A;  3LQ7 A;  1GUH A;  4LMW A;  4OR0 A;  1GLQ A;  1J7E A;  1NHY A;  1XW5 A;  5GIO A;  1AQV A;  1JLV A;  2AB6 A;  1GNW A;  4AKG A;  1GWC A;  4G01 A;  5HOZ A;  4AI6 A;  1E7E A;  4ECC A;  2VCT A;  3CSJ A;  3IK7 A;  4NHW A;  3FWC C;  4ZCG A;  3HJM A;  3R2Q A;  3ERF A;  5IIH A;  4ISD A;  2CAI A;  3GUR A;  4MK3 A;  5BPK A;  2HSN A;  1E7C A;  4ZBK A;  4HGK A;  1GUL A;  1GSU A;  4MZW A;  3WYW A;  4Z69 A;  3KJY A;  2HSN B;  2CKX A;  5JCW A;  4NAW B;  3M8N A;  1FOU A;  4PQI A;  4BY9 C;  1VF4 A;  1OE8 A;  11GS A;  2Z8I A;  4MBE C;  1PA3 A;  2XVW A;  3FWB C;  1FW1 A;  4KDX A;  3CRT A;  2BXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...