1FOUA

Connector protein from bacteriophage phi29
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
275
structure length
257
Chain Sequence
SINEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNYRDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFKLQTDEQIDSSGTVFLKSREEACEKINELYGLNVKVKFRYDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords UPPER COLLAR PROTEIN
publication title Structure of the bacteriophage phi29 DNA packaging motor.
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 57
structure length 257
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2000-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05352 Phage_connector Phage Connector (GP10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.30 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1fouA01
2.40.500.10 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) 1fouA02
3.30.1350.20 Alpha Beta 2-Layer Sandwich Crambin Bacteriophage PHI-29 conector. Domain 3 1fouA03
1IJGA 1JNBA 1H5WA 1FOUA
chains in the Genus database with same CATH superfamily
1E7BA 4F5UA 2GDSA 5FUOA 4LB9A 2OZBB 1JA8A 3FNMA 3LSUA 1TXUA 2XVWA 3MHSB 1XILA 2BXQA 3CX9A 1MA9A 1KKCA 4L9QA 4DM0A 2Z8KA 4ZBKA 2EYBA 3A73A 3ICXA 1CCMA 1J78A 3NVMA 1XREA 3JQZA 2BXKA 3G9KD 1PM9A 1MIYA 4W4UB 2EYAA 1OKHA 2K0NA 3PLAA 3TDLA 1JXTA 1GN3A 3NIRA 2XVVA 4J2VA 2DYMA 2AJEA 1B06A 4ZCGA 2BXMA 1UORA 5IIUA 1MM8A 3NVIA 1BJ5A 4LA0A 4D7XA 1AB1A 1JMPA 2V36A 3GQXA 2Z8JA 1GN6A 1E78A 3M99C 1N0NA 2NQOA 5GIPA 4Z69A 3KIKA 1D5NA 3OT7A 4E99A 4L8UA 1WB7A 4LUHA 1N0JA 1E7FA 1AR4A 4Z9OA 3SIVB 4OTUA 1AVMA 1IX9A 1VFIA 3WHQA 2BXIA 2LQIA 1HK2A 3C3TA 4OT2A 1ZLZA 4FK5B 3DC5A 2VUFA 1JXXA 3W1SA 2XW1A 2E0XA 4OTTA 3SZSA 3TJTA 3H37A 5IJEA 2EFDA 3QVNA 4ZBQA 3BPJA 4K71A 5AG2A 1LNSA 2ADPA 1LOTA 4F6EA 1CRNA 3FWCC 2DBUA 1PL4A 3NVKA 4K2CA 1MIWA 4HGKA 4ZC6A 2KBZA 1EN5A 3V03A 2BXBA 1IDSA 2P4KA 3SIUB 4YIPA 1AP6A 3EVKA 4JK4A 1E7AA 3U7TA 2E0YA 2BXNA 4ZBRA 4GDXA 2XW0A 2LOQA 5GINA 1IXBA 4FC1A 1HK3A 1BHPA 3MHHB 4GDKB 1EJGA 1BKEA 4BY9C 1LUWA 1AR5A 1KXPD 1EN4A 3WHSA 3WHRA 2QHBA 2QKAA 4YIOA 5GIOA 1JXYA 1WB8A 2XMOA 2BXFA 3AK3A 2FD7A 1SZXA 4M70B 1NBLA 4S1YA 3AK2A 2VUEA 1VZSA 3ECPA 2LXSA 2OT3A 2EFHA 5IJ5A 4DHXB 3DC6A 2BXEA 4TQ1A 1I0HA 1KDXA 1QNMA 1YV8A 4OR0A 4L9KA 3GQUA 2V9BA 4GG2A 1BS3A 4I9OA 5ID9A 3B9MA 5IIXA 2EFCA 1CBNA 2QKCA 4C31B 1CCNA 2DYOA 1I08A 3KDRA 1CNRA 1GNIA 2BXCA 4F5VA 1MSDA 2BXDA 1MA1A 2CKXA 1NT2B 3CEIA 1EM1A 2BXOA 4FIPB 3JRYA 1GN4A 2DBWA 4F5TA 1BT8A 4JYYA 1XUQA 1MUSA 1E7GA 2DG5A 2AW9A 3GA9L 1CXRA 4LUFA 3NMUA 1HA2A 4IW2A 3MDSA 4LB2A 2EYDA 5IJFA 1E7HA 1AP5A 4HGMB 5B5TA 3BFRA 2BX8A 3UIVA 1IJGA 1E7CA 5BPKA 4C7UA 1H5WA 1ZSPA 4NAWB 3V08A 5IIHA 2RCVA 4EMXA 1MIVA 2I2ZA 1XDCA 4N0UD 1SB0A 1HK1A 1HK5A 1HK4A 1KW2A 2QM6A 3KKYA 1JNBA 1LUVA 5DBYA 2JUHA 2BXGA 4F5SA 2DBXA 4E4EA 3V09A 4BKEA 1ED0A 1AO6A 2LQHA 2CDYA 5IFOA 2XSIA 2EYCA 3B9LA 4GUNA 3A75A 2AGHB 3LU8A 2NNWA 1ZUQA 2KWFA 5A9GA 2FD9A 1MNGA 1WUWA 2GUTA 1EN6A 4WA6B 1ORLA 1GNJA 2BXHA 2EFEA 3LU7A 1ZTEA 1MUHA 1VARA 3H3AA 1Y67A 4BR6A 1GN2A 2Z8IA 2CE4A 5GHKA 1FOUA 3SQJA 1MMMA 2QMCA 2BXPA 2VDBA 2XVQA 1J7EA 4G03A 5HOZA 2PLHA 1N5UA 3K9SA 5DQFA 2BXLA 1JMNA 5ID7A 5D7GA 4X9QA 4JZ2A 3VQIA 1O9XA 2I30A 3LU6A 4N0FD 2LXTA 4FJCB 1TF0A 2ADQB 4N3ZA 1E7EA 2YDFA 4FFKA 3RN4A 4IW1A 4GDLB 4MBEC 4ZUXV 1VEWA 3KJLA 3AK1A 4G01A 1YVAA 1BM0A 4PO0A 4TQ0A 2XVUA 1JXUA 2BXAA 1BSMA 1E7IA 3FWBC 4G04A 3C3SA 3UE7B 3C8PA 1JR9A 4JZGA 2ROHA 1P7GA 1H9ZA 1JXWA
chains in the Genus database with same CATH topology
1E7BA 2XSIA 4M70B 4S1YA 3B9LA 1HK2A 2VUEA 1VZSA 3A75A 4F5UA 3LU8A 2NNWA 4OT2A 2OT3A 4LB9A 5FUOA 2EFHA 5IJ5A 4DHXB 4FK5B 2OZBB 2BXEA 2VUFA 3WHQA 4TQ1A 3FNMA 4OR0A 1TXUA 4L9KA 3GQUA 2XVWA 3MHSB 4GG2A 2BXQA 3CX9A 1MA9A 2XW1A 2E0XA 3W1SA 4WA6B 1GNJA 2BXHA 2EFEA 3LU7A 4L9QA 4OTTA 5ID9A 3B9MA 5IIXA 2EFCA 3H3AA 3H37A 5IJEA 2Z8KA 4C31B 2EFDA 2Z8IA 4ZBKA 2DYOA 4ZBQA 4K71A 1LNSA 1GNIA 3A73A 3ICXA 5GHKA 1FOUA 1LOTA 3SQJA 2BXCA 2QMCA 4F5VA 2BXPA 1J78A 2BXDA 3NVMA 2VDBA 2XVQA 2CKXA 1J7EA 1NT2B 3JQZA 2BXKA 2DBUA 3FWCC 3NVKA 2BXOA 1MIWA 3G9KD 3JRYA 4FIPB 4HGKA 4K2CA 4ZC6A 4G03A 1MIYA 2KBZA 4W4UB 2DBWA 5HOZA 3V03A 4F5TA 3PLAA 1N5UA 5DQFA 3TDLA 2BXBA 2BXLA 1E7GA 2DG5A 3SIUB 3GA9L 4LUFA 5ID7A 1HA2A 4IW2A 3NMUA 4LB2A 5D7GA 2XVVA 5IJFA 1E7HA 4J2VA 2DYMA 4HGMB 2AJEA 5B5TA 3VQIA 4JK4A 1O9XA 2BX8A 2I30A 4ZCGA 3LU6A 1IJGA 1E7AA 3UIVA 2BXMA 4N0FD 1E7CA 4FJCB 5BPKA 1UORA 1H5WA 1TF0A 5IIUA 2E0YA 3NVIA 1BJ5A 4LA0A 4NAWB 3V08A 5IIHA 2BXNA 4EMXA 1MIVA 4ZBRA 4GDXA 2I2ZA 2XW0A 4N3ZA 4N0UD 1E7EA 2V36A 2YDFA 1HK1A 2LOQA 5GINA 1HK5A 4IW1A 4GDLB 3GQXA 2Z8JA 4MBEC 1E78A 1HK3A 3M99C 1HK4A 4ZUXV 1KW2A 3MHHB 4GDKB 2NQOA 5GIPA 1BKEA 4BY9C 4Z69A 3KJLA 1KXPD 2QM6A 4G01A 1BM0A 1JNBA 3KIKA 4PO0A 3WHSA 3WHRA 4E99A 5DBYA 2JUHA 2BXGA 4F5SA 4L8UA 2QHBA 2DBXA 4TQ0A 5GIOA 4LUHA 2XVUA 1E7FA 2BXAA 1E7IA 3FWBC 3V09A 4BKEA 4G04A 4Z9OA 3SIVB 4OTUA 1AO6A 2ROHA 1VFIA 1H9ZA 5IFOA 2BXFA 2XMOA 2BXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJG A;  1JNB A;  1H5W A;  1FOU A; 
#chains in the Genus database with same CATH topology
 1E7B A;  4F5U A;  2GDS A;  5FUO A;  4LB9 A;  2OZB B;  1JA8 A;  3FNM A;  3LSU A;  1TXU A;  2XVW A;  3MHS B;  1XIL A;  2BXQ A;  3CX9 A;  1MA9 A;  1KKC A;  4L9Q A;  4DM0 A;  2Z8K A;  4ZBK A;  2EYB A;  3A73 A;  3ICX A;  1CCM A;  1J78 A;  3NVM A;  1XRE A;  3JQZ A;  2BXK A;  3G9K D;  1PM9 A;  1MIY A;  4W4U B;  2EYA A;  1OKH A;  2K0N A;  3PLA A;  3TDL A;  1JXT A;  1GN3 A;  3NIR A;  2XVV A;  4J2V A;  2DYM A;  2AJE A;  1B06 A;  4ZCG A;  2BXM A;  1UOR A;  5IIU A;  1MM8 A;  3NVI A;  1BJ5 A;  4LA0 A;  4D7X A;  1AB1 A;  1JMP A;  2V36 A;  3GQX A;  2Z8J A;  1GN6 A;  1E78 A;  3M99 C;  1N0N A;  2NQO A;  5GIP A;  4Z69 A;  3KIK A;  1D5N A;  3OT7 A;  4E99 A;  4L8U A;  1WB7 A;  4LUH A;  1N0J A;  1E7F A;  1AR4 A;  4Z9O A;  3SIV B;  4OTU A;  1AVM A;  1IX9 A;  1VFI A;  3WHQ A;  2BXI A;  2LQI A;  1HK2 A;  3C3T A;  4OT2 A;  1ZLZ A;  4FK5 B;  3DC5 A;  2VUF A;  1JXX A;  3W1S A;  2XW1 A;  2E0X A;  4OTT A;  3SZS A;  3TJT A;  3H37 A;  5IJE A;  2EFD A;  3QVN A;  4ZBQ A;  3BPJ A;  4K71 A;  5AG2 A;  1LNS A;  2ADP A;  1LOT A;  4F6E A;  1CRN A;  3FWC C;  2DBU A;  1PL4 A;  3NVK A;  4K2C A;  1MIW A;  4HGK A;  4ZC6 A;  2KBZ A;  1EN5 A;  3V03 A;  2BXB A;  1IDS A;  2P4K A;  3SIU B;  4YIP A;  1AP6 A;  3EVK A;  4JK4 A;  1E7A A;  3U7T A;  2E0Y A;  2BXN A;  4ZBR A;  4GDX A;  2XW0 A;  2LOQ A;  5GIN A;  1IXB A;  4FC1 A;  1HK3 A;  1BHP A;  3MHH B;  4GDK B;  1EJG A;  1BKE A;  4BY9 C;  1LUW A;  1AR5 A;  1KXP D;  1EN4 A;  3WHS A;  3WHR A;  2QHB A;  2QKA A;  4YIO A;  5GIO A;  1JXY A;  1WB8 A;  2XMO A;  2BXF A;  3AK3 A;  2FD7 A;  1SZX A;  4M70 B;  1NBL A;  4S1Y A;  3AK2 A;  2VUE A;  1VZS A;  3ECP A;  2LXS A;  2OT3 A;  2EFH A;  5IJ5 A;  4DHX B;  3DC6 A;  2BXE A;  4TQ1 A;  1I0H A;  1KDX A;  1QNM A;  1YV8 A;  4OR0 A;  4L9K A;  3GQU A;  2V9B A;  4GG2 A;  1BS3 A;  4I9O A;  5ID9 A;  3B9M A;  5IIX A;  2EFC A;  1CBN A;  2QKC A;  4C31 B;  1CCN A;  2DYO A;  1I08 A;  3KDR A;  1CNR A;  1GNI A;  2BXC A;  4F5V A;  1MSD A;  2BXD A;  1MA1 A;  2CKX A;  1NT2 B;  3CEI A;  1EM1 A;  2BXO A;  4FIP B;  3JRY A;  1GN4 A;  2DBW A;  4F5T A;  1BT8 A;  4JYY A;  1XUQ A;  1MUS A;  1E7G A;  2DG5 A;  2AW9 A;  3GA9 L;  1CXR A;  4LUF A;  3NMU A;  1HA2 A;  4IW2 A;  3MDS A;  4LB2 A;  2EYD A;  5IJF A;  1E7H A;  1AP5 A;  4HGM B;  5B5T A;  3BFR A;  2BX8 A;  3UIV A;  1IJG A;  1E7C A;  5BPK A;  4C7U A;  1H5W A;  1ZSP A;  4NAW B;  3V08 A;  5IIH A;  2RCV A;  4EMX A;  1MIV A;  2I2Z A;  1XDC A;  4N0U D;  1SB0 A;  1HK1 A;  1HK5 A;  1HK4 A;  1KW2 A;  2QM6 A;  3KKY A;  1JNB A;  1LUV A;  5DBY A;  2JUH A;  2BXG A;  4F5S A;  2DBX A;  4E4E A;  3V09 A;  4BKE A;  1ED0 A;  1AO6 A;  2LQH A;  2CDY A;  5IFO A;  2XSI A;  2EYC A;  3B9L A;  4GUN A;  3A75 A;  2AGH B;  3LU8 A;  2NNW A;  1ZUQ A;  2KWF A;  5A9G A;  2FD9 A;  1MNG A;  1WUW A;  2GUT A;  1EN6 A;  4WA6 B;  1ORL A;  1GNJ A;  2BXH A;  2EFE A;  3LU7 A;  1ZTE A;  1MUH A;  1VAR A;  3H3A A;  1Y67 A;  4BR6 A;  1GN2 A;  2Z8I A;  2CE4 A;  5GHK A;  1FOU A;  3SQJ A;  1MMM A;  2QMC A;  2BXP A;  2VDB A;  2XVQ A;  1J7E A;  4G03 A;  5HOZ A;  2PLH A;  1N5U A;  3K9S A;  5DQF A;  2BXL A;  1JMN A;  5ID7 A;  5D7G A;  4X9Q A;  4JZ2 A;  3VQI A;  1O9X A;  2I30 A;  3LU6 A;  4N0F D;  2LXT A;  4FJC B;  1TF0 A;  2ADQ B;  4N3Z A;  1E7E A;  2YDF A;  4FFK A;  3RN4 A;  4IW1 A;  4GDL B;  4MBE C;  4ZUX V;  1VEW A;  3KJL A;  3AK1 A;  4G01 A;  1YVA A;  1BM0 A;  4PO0 A;  4TQ0 A;  2XVU A;  1JXU A;  2BXA A;  1BSM A;  1E7I A;  3FWB C;  4G04 A;  3C3S A;  3UE7 B;  3C8P A;  1JR9 A;  4JZG A;  2ROH A;  1P7G A;  1H9Z A;  1JXW A; 
#chains in the Genus database with same CATH homology
 1E7B A;  2XSI A;  4M70 B;  4S1Y A;  3B9L A;  1HK2 A;  2VUE A;  1VZS A;  3A75 A;  4F5U A;  3LU8 A;  2NNW A;  4OT2 A;  2OT3 A;  4LB9 A;  5FUO A;  2EFH A;  5IJ5 A;  4DHX B;  4FK5 B;  2OZB B;  2BXE A;  2VUF A;  3WHQ A;  4TQ1 A;  3FNM A;  4OR0 A;  1TXU A;  4L9K A;  3GQU A;  2XVW A;  3MHS B;  4GG2 A;  2BXQ A;  3CX9 A;  1MA9 A;  2XW1 A;  2E0X A;  3W1S A;  4WA6 B;  1GNJ A;  2BXH A;  2EFE A;  3LU7 A;  4L9Q A;  4OTT A;  5ID9 A;  3B9M A;  5IIX A;  2EFC A;  3H3A A;  3H37 A;  5IJE A;  2Z8K A;  4C31 B;  2EFD A;  2Z8I A;  4ZBK A;  2DYO A;  4ZBQ A;  4K71 A;  1LNS A;  1GNI A;  3A73 A;  3ICX A;  5GHK A;  1FOU A;  1LOT A;  3SQJ A;  2BXC A;  2QMC A;  4F5V A;  2BXP A;  1J78 A;  2BXD A;  3NVM A;  2VDB A;  2XVQ A;  2CKX A;  1J7E A;  1NT2 B;  3JQZ A;  2BXK A;  2DBU A;  3FWC C;  3NVK A;  2BXO A;  1MIW A;  3G9K D;  3JRY A;  4FIP B;  4HGK A;  4K2C A;  4ZC6 A;  4G03 A;  1MIY A;  2KBZ A;  4W4U B;  2DBW A;  5HOZ A;  3V03 A;  4F5T A;  3PLA A;  1N5U A;  5DQF A;  3TDL A;  2BXB A;  2BXL A;  1E7G A;  2DG5 A;  3SIU B;  3GA9 L;  4LUF A;  5ID7 A;  1HA2 A;  4IW2 A;  3NMU A;  4LB2 A;  5D7G A;  2XVV A;  5IJF A;  1E7H A;  4J2V A;  2DYM A;  4HGM B;  2AJE A;  5B5T A;  3VQI A;  4JK4 A;  1O9X A;  2BX8 A;  2I30 A;  4ZCG A;  3LU6 A;  1IJG A;  1E7A A;  3UIV A;  2BXM A;  4N0F D;  1E7C A;  4FJC B;  5BPK A;  1UOR A;  1H5W A;  1TF0 A;  5IIU A;  2E0Y A;  3NVI A;  1BJ5 A;  4LA0 A;  4NAW B;  3V08 A;  5IIH A;  2BXN A;  4EMX A;  1MIV A;  4ZBR A;  4GDX A;  2I2Z A;  2XW0 A;  4N3Z A;  4N0U D;  1E7E A;  2V36 A;  2YDF A;  1HK1 A;  2LOQ A;  5GIN A;  1HK5 A;  4IW1 A;  4GDL B;  3GQX A;  2Z8J A;  4MBE C;  1E78 A;  1HK3 A;  3M99 C;  1HK4 A;  4ZUX V;  1KW2 A;  3MHH B;  4GDK B;  2NQO A;  5GIP A;  1BKE A;  4BY9 C;  4Z69 A;  3KJL A;  1KXP D;  2QM6 A;  4G01 A;  1BM0 A;  1JNB A;  3KIK A;  4PO0 A;  3WHS A;  3WHR A;  4E99 A;  5DBY A;  2JUH A;  2BXG A;  4F5S A;  4L8U A;  2QHB A;  2DBX A;  4TQ0 A;  5GIO A;  4LUH A;  2XVU A;  1E7F A;  2BXA A;  1E7I A;  3FWB C;  3V09 A;  4BKE A;  4G04 A;  4Z9O A;  3SIV B;  4OTU A;  1AO6 A;  2ROH A;  1VFI A;  1H9Z A;  5IFO A;  2BXF A;  2XMO A;  2BXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...