1FOUA

Connector protein from bacteriophage phi29
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
275
structure length
257
Chain Sequence
SINEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNYRDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFKLQTDEQIDSSGTVFLKSREEACEKINELYGLNVKVKFRYDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPPER COLLAR PROTEIN
publication title Structure of the bacteriophage phi29 DNA packaging motor.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 57
structure length 257
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2000-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05352 Phage_connector Phage Connector (GP10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.30 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1fouA01
2.40.500.10 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) 1fouA02
3.30.1350.20 Alpha Beta 2-Layer Sandwich Crambin Bacteriophage PHI-29 conector. Domain 3 1fouA03
1FOUA 1JNBA 1IJGA 1H5WA
chains in the Genus database with same CATH superfamily
1AR5A 4BKEA 2V36A 2LQIA 4NAWB 1SB0A 2DBXA 2QHBA 5IJEA 3ECPA 2LQHA 3FNMA 3H37A 3FWCC 4X9QA 2GDSA 2DG5A 1SZXA 1CXRA 1YV8A 2OZBB 1JMNA 4JZGA 1PM9A 2Z8KA 4N0FD 4ZBRA 4DHXB 1N0JA 3AK3A 2V9BA 1AP6A 1UORA 3LU8A 4K71A 5AG2A 2BXCA 5BPKA 1KW2A 2P4KA 1E7HA 3SQJA 1BT8A 2RCVA 4E99A 1JA8A 2EYDA 2KWFA 1HK1A 4ZUXV 4LB9A 1IJGA 4Z69A 3OT7A 3UE7B 4FFKA 1XDCA 1EN5A 3NVIA 2NNWA 1KXPD 3KDRA 2BXOA 4LUHA 4JZ2A 3K9SA 1HK3A 1VZSA 5GIPA 1HK2A 4ZC6A 4C7UA 4ZCGA 2XVWA 4S1YA 3MHHB 4GDLB 2K0NA 2YDFA 4F5SA 3WHQA 1MNGA 1KKCA 1JXXA 2PLHA 1OKHA 1P7GA 3V08A 4FK5B 3NVKA 1XUQA 2CDYA 5HOZA 1NT2B 2LXSA 4OTTA 5GHKA 4L9KA 1QNMA 3GA9L 1GN4A 1CNRA 2OT3A 3CX9A 3GQXA 1MMMA 3VQIA 1E7AA 1AVMA 4N0UD 3V09A 3WHSA 4Z9OA 1E7BA 3MDSA 2EFDA 3ICXA 5DQFA 3DC6A 4F6EA 1IXBA 3M99C 1EN6A 1JNBA 1GN6A 4DM0A 3FWBC 1GNIA 1BSMA 1ED0A 1MM8A 2BXHA 3H3AA 2BX8A 3PLAA 4YIOA 4G01A 1LUWA 5ID9A 2XW1A 2XMOA 3AK2A 2BXKA 1XILA 1H9ZA 1BHPA 2BXPA 3KJLA 1WB7A 1KDXA 3A75A 3U7TA 3GQUA 2CKXA 1ORLA 2AGHB 1MA1A 3QVNA 2VUEA 1ZLZA 1AR4A 5A9GA 1GNJA 1CCMA 1ZUQA 2I2ZA 3C3SA 5B5TA 2CE4A 1MIYA 1VEWA 1MSDA 3B9LA 4ZBQA 1E7CA 2LXTA 3W1SA 5IFOA 1EN4A 2XVVA 4E4EA 4EMXA 4W4UB 2BXEA 4PO0A 1TF0A 2BXMA 4LA0A 4JYYA 2LOQA 1JXYA 1JXTA 4OTUA 1EJGA 1JXWA 2KBZA 2BXAA 1BKEA 4L9QA 4FIPB 4YIPA 4GDKB 3LSUA 1IDSA 1HK5A 2DYOA 2DYMA 2E0YA 1I08A 5IJFA 4OT2A 2ADQB 4GUNA 4I9OA 3BPJA 1I0HA 2Z8IA 4L8UA 4MBEC 2EYAA 1BJ5A 2DBUA 1YVAA 3JRYA 1XREA 3EVKA 1E78A 3A73A 2BXDA 1WB8A 4WA6B 3UIVA 1Y67A 3SIUB 4GG2A 4J2VA 1GN2A 2BXBA 4HGMB 3NIRA 1TXUA 1EM1A 4N3ZA 4G04A 5IIUA 4IW2A 2AW9A 2BXNA 2XVQA 4BY9C 3NVMA 4JK4A 1BM0A 3MHSB 1O9XA 2VUFA 1CRNA 1LNSA 1AP5A 2E0XA 1BS3A 2NQOA 4OR0A 1J78A 1WUWA 2EFEA 1D5NA 1FOUA 1AB1A 2BXQA 2BXLA 2EFCA 3V03A 3B9MA 4M70B 4HGKA 1GN3A 1PL4A 1E7FA 3JQZA 4TQ1A 3SIVB 2FD9A 3SZSA 5FUOA 5IIHA 2EYCA 1JR9A 1CBNA 3CEIA 5D7GA 1HA2A 3LU7A 2QMCA 2XW0A 1N5UA 1MIWA 1AO6A 4D7XA 1VARA 1MIVA 2XVUA 3C8PA 4F5TA 4GDXA 4G03A 2Z8JA 1MUHA 4K2CA 3G9KD 3TDLA 4C31B 3NMUA 4FC1A 3KKYA 2QKCA 1JMPA 2QM6A 3C3TA 5ID7A 2EFHA 1J7EA 5GIOA 2DBWA 4FJCB 4ZBKA 1LOTA 3TJTA 4IW1A 3AK1A 5DBYA 5GINA 2EYBA 2JUHA 1NBLA 1E7EA 2XSIA 1B06A 1H5WA 2ROHA 1JXUA 3WHRA 1LUVA 3DC5A 5IIXA 1ZTEA 1HK4A 2I30A 2GUTA 1E7IA 2BXFA 1CCNA 2BXGA 1IX9A 4TQ0A 3KIKA 3BFRA 2AJEA 2BXIA 4F5VA 2FD7A 1MUSA 3RN4A 5IJ5A 4BR6A 1VFIA 4LB2A 1N0NA 2QKAA 2VDBA 4F5UA 1E7GA 2ADPA 1ZSPA 3LU6A 4LUFA 1MA9A
chains in the Genus database with same CATH topology
1MIWA 5HOZA 1AO6A 2KBZA 1MIVA 1NT2B 4BKEA 2V36A 4NAWB 4OTTA 5GHKA 2XVUA 2DBXA 2QHBA 4L9KA 2BXAA 4F5TA 1BKEA 4GDXA 5IJEA 3GA9L 4G03A 4L9QA 2Z8JA 4FIPB 4K2CA 3FNMA 4GDKB 2OT3A 3CX9A 3H37A 3GQXA 1HK5A 3FWCC 3G9KD 2DYOA 3VQIA 1E7AA 2DG5A 3TDLA 2DYMA 2E0YA 4N0UD 4C31B 3NMUA 5IJFA 3V09A 3WHSA 4Z9OA 4OT2A 2OZBB 1E7BA 2EFDA 2Z8IA 3ICXA 4L8UA 4MBEC 2Z8KA 4N0FD 5DQFA 4ZBRA 4DHXB 1BJ5A 2DBUA 2QM6A 3M99C 3JRYA 1JNBA 5ID7A 2EFHA 3FWBC 1J7EA 5GIOA 1E78A 3A73A 1GNIA 2DBWA 1UORA 4FJCB 3LU8A 4ZBKA 2BXDA 4K71A 1LOTA 2BXCA 2BXHA 3H3AA 4WA6B 2BX8A 3UIVA 3PLAA 5BPKA 4IW1A 1KW2A 3SIUB 4G01A 4GG2A 5ID9A 1E7HA 2XW1A 5DBYA 2XMOA 3SQJA 5GINA 2JUHA 4J2VA 2BXKA 2BXBA 4HGMB 4E99A 1TXUA 1E7EA 2XSIA 1H9ZA 4G04A 4N3ZA 5IIUA 4IW2A 2BXPA 2BXNA 1HK1A 2XVQA 3KJLA 4LB9A 1IJGA 4ZUXV 4BY9C 3NVMA 4Z69A 1H5WA 4JK4A 3A75A 1BM0A 3GQUA 3MHSB 2NNWA 3NVIA 1O9XA 2VUFA 2CKXA 1LNSA 2ROHA 2E0XA 1KXPD 3WHRA 2BXOA 4LUHA 5IIXA 1HK3A 2NQOA 2VUEA 4OR0A 1VZSA 5GIPA 1HK2A 1HK4A 4ZC6A 1J78A 1GNJA 4ZCGA 2I30A 1E7IA 2XVWA 2EFEA 4S1YA 2BXFA 2I2ZA 2BXGA 1FOUA 5B5TA 3MHHB 4GDLB 2BXQA 1MIYA 2BXLA 2EFCA 3V03A 3B9MA 4TQ0A 4M70B 3KIKA 4HGKA 3B9LA 4ZBQA 1E7CA 3W1SA 5IFOA 2YDFA 4F5SA 1E7FA 2AJEA 3JQZA 2XVVA 3WHQA 2BXIA 4EMXA 4F5VA 4TQ1A 4W4UB 3SIVB 5IJ5A 2BXEA 5FUOA 1VFIA 5IIHA 4PO0A 1TF0A 4LB2A 2BXMA 4LA0A 2LOQA 5D7GA 1HA2A 2VDBA 3LU7A 4F5UA 1E7GA 4OTUA 2QMCA 3V08A 4FK5B 3NVKA 2XW0A 1N5UA 3LU6A 4LUFA 1MA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOU A;  1JNB A;  1IJG A;  1H5W A; 
#chains in the Genus database with same CATH topology
 1AR5 A;  4BKE A;  2V36 A;  2LQI A;  4NAW B;  1SB0 A;  2DBX A;  2QHB A;  5IJE A;  3ECP A;  2LQH A;  3FNM A;  3H37 A;  3FWC C;  4X9Q A;  2GDS A;  2DG5 A;  1SZX A;  1CXR A;  1YV8 A;  2OZB B;  1JMN A;  4JZG A;  1PM9 A;  2Z8K A;  4N0F D;  4ZBR A;  4DHX B;  1N0J A;  3AK3 A;  2V9B A;  1AP6 A;  1UOR A;  3LU8 A;  4K71 A;  5AG2 A;  2BXC A;  5BPK A;  1KW2 A;  2P4K A;  1E7H A;  3SQJ A;  1BT8 A;  2RCV A;  4E99 A;  1JA8 A;  2EYD A;  2KWF A;  1HK1 A;  4ZUX V;  4LB9 A;  1IJG A;  4Z69 A;  3OT7 A;  3UE7 B;  4FFK A;  1XDC A;  1EN5 A;  3NVI A;  2NNW A;  1KXP D;  3KDR A;  2BXO A;  4LUH A;  4JZ2 A;  3K9S A;  1HK3 A;  1VZS A;  5GIP A;  1HK2 A;  4ZC6 A;  4C7U A;  4ZCG A;  2XVW A;  4S1Y A;  3MHH B;  4GDL B;  2K0N A;  2YDF A;  4F5S A;  3WHQ A;  1MNG A;  1KKC A;  1JXX A;  2PLH A;  1OKH A;  1P7G A;  3V08 A;  4FK5 B;  3NVK A;  1XUQ A;  2CDY A;  5HOZ A;  1NT2 B;  2LXS A;  4OTT A;  5GHK A;  4L9K A;  1QNM A;  3GA9 L;  1GN4 A;  1CNR A;  2OT3 A;  3CX9 A;  3GQX A;  1MMM A;  3VQI A;  1E7A A;  1AVM A;  4N0U D;  3V09 A;  3WHS A;  4Z9O A;  1E7B A;  3MDS A;  2EFD A;  3ICX A;  5DQF A;  3DC6 A;  4F6E A;  1IXB A;  3M99 C;  1EN6 A;  1JNB A;  1GN6 A;  4DM0 A;  3FWB C;  1GNI A;  1BSM A;  1ED0 A;  1MM8 A;  2BXH A;  3H3A A;  2BX8 A;  3PLA A;  4YIO A;  4G01 A;  1LUW A;  5ID9 A;  2XW1 A;  2XMO A;  3AK2 A;  2BXK A;  1XIL A;  1H9Z A;  1BHP A;  2BXP A;  3KJL A;  1WB7 A;  1KDX A;  3A75 A;  3U7T A;  3GQU A;  2CKX A;  1ORL A;  2AGH B;  1MA1 A;  3QVN A;  2VUE A;  1ZLZ A;  1AR4 A;  5A9G A;  1GNJ A;  1CCM A;  1ZUQ A;  2I2Z A;  3C3S A;  5B5T A;  2CE4 A;  1MIY A;  1VEW A;  1MSD A;  3B9L A;  4ZBQ A;  1E7C A;  2LXT A;  3W1S A;  5IFO A;  1EN4 A;  2XVV A;  4E4E A;  4EMX A;  4W4U B;  2BXE A;  4PO0 A;  1TF0 A;  2BXM A;  4LA0 A;  4JYY A;  2LOQ A;  1JXY A;  1JXT A;  4OTU A;  1EJG A;  1JXW A;  2KBZ A;  2BXA A;  1BKE A;  4L9Q A;  4FIP B;  4YIP A;  4GDK B;  3LSU A;  1IDS A;  1HK5 A;  2DYO A;  2DYM A;  2E0Y A;  1I08 A;  5IJF A;  4OT2 A;  2ADQ B;  4GUN A;  4I9O A;  3BPJ A;  1I0H A;  2Z8I A;  4L8U A;  4MBE C;  2EYA A;  1BJ5 A;  2DBU A;  1YVA A;  3JRY A;  1XRE A;  3EVK A;  1E78 A;  3A73 A;  2BXD A;  1WB8 A;  4WA6 B;  3UIV A;  1Y67 A;  3SIU B;  4GG2 A;  4J2V A;  1GN2 A;  2BXB A;  4HGM B;  3NIR A;  1TXU A;  1EM1 A;  4N3Z A;  4G04 A;  5IIU A;  4IW2 A;  2AW9 A;  2BXN A;  2XVQ A;  4BY9 C;  3NVM A;  4JK4 A;  1BM0 A;  3MHS B;  1O9X A;  2VUF A;  1CRN A;  1LNS A;  1AP5 A;  2E0X A;  1BS3 A;  2NQO A;  4OR0 A;  1J78 A;  1WUW A;  2EFE A;  1D5N A;  1FOU A;  1AB1 A;  2BXQ A;  2BXL A;  2EFC A;  3V03 A;  3B9M A;  4M70 B;  4HGK A;  1GN3 A;  1PL4 A;  1E7F A;  3JQZ A;  4TQ1 A;  3SIV B;  2FD9 A;  3SZS A;  5FUO A;  5IIH A;  2EYC A;  1JR9 A;  1CBN A;  3CEI A;  5D7G A;  1HA2 A;  3LU7 A;  2QMC A;  2XW0 A;  1N5U A;  1MIW A;  1AO6 A;  4D7X A;  1VAR A;  1MIV A;  2XVU A;  3C8P A;  4F5T A;  4GDX A;  4G03 A;  2Z8J A;  1MUH A;  4K2C A;  3G9K D;  3TDL A;  4C31 B;  3NMU A;  4FC1 A;  3KKY A;  2QKC A;  1JMP A;  2QM6 A;  3C3T A;  5ID7 A;  2EFH A;  1J7E A;  5GIO A;  2DBW A;  4FJC B;  4ZBK A;  1LOT A;  3TJT A;  4IW1 A;  3AK1 A;  5DBY A;  5GIN A;  2EYB A;  2JUH A;  1NBL A;  1E7E A;  2XSI A;  1B06 A;  1H5W A;  2ROH A;  1JXU A;  3WHR A;  1LUV A;  3DC5 A;  5IIX A;  1ZTE A;  1HK4 A;  2I30 A;  2GUT A;  1E7I A;  2BXF A;  1CCN A;  2BXG A;  1IX9 A;  4TQ0 A;  3KIK A;  3BFR A;  2AJE A;  2BXI A;  4F5V A;  2FD7 A;  1MUS A;  3RN4 A;  5IJ5 A;  4BR6 A;  1VFI A;  4LB2 A;  1N0N A;  2QKA A;  2VDB A;  4F5U A;  1E7G A;  2ADP A;  1ZSP A;  3LU6 A;  4LUF A;  1MA9 A; 
#chains in the Genus database with same CATH homology
 1MIW A;  5HOZ A;  1AO6 A;  2KBZ A;  1MIV A;  1NT2 B;  4BKE A;  2V36 A;  4NAW B;  4OTT A;  5GHK A;  2XVU A;  2DBX A;  2QHB A;  4L9K A;  2BXA A;  4F5T A;  1BKE A;  4GDX A;  5IJE A;  3GA9 L;  4G03 A;  4L9Q A;  2Z8J A;  4FIP B;  4K2C A;  3FNM A;  4GDK B;  2OT3 A;  3CX9 A;  3H37 A;  3GQX A;  1HK5 A;  3FWC C;  3G9K D;  2DYO A;  3VQI A;  1E7A A;  2DG5 A;  3TDL A;  2DYM A;  2E0Y A;  4N0U D;  4C31 B;  3NMU A;  5IJF A;  3V09 A;  3WHS A;  4Z9O A;  4OT2 A;  2OZB B;  1E7B A;  2EFD A;  2Z8I A;  3ICX A;  4L8U A;  4MBE C;  2Z8K A;  4N0F D;  5DQF A;  4ZBR A;  4DHX B;  1BJ5 A;  2DBU A;  2QM6 A;  3M99 C;  3JRY A;  1JNB A;  5ID7 A;  2EFH A;  3FWB C;  1J7E A;  5GIO A;  1E78 A;  3A73 A;  1GNI A;  2DBW A;  1UOR A;  4FJC B;  3LU8 A;  4ZBK A;  2BXD A;  4K71 A;  1LOT A;  2BXC A;  2BXH A;  3H3A A;  4WA6 B;  2BX8 A;  3UIV A;  3PLA A;  5BPK A;  4IW1 A;  1KW2 A;  3SIU B;  4G01 A;  4GG2 A;  5ID9 A;  1E7H A;  2XW1 A;  5DBY A;  2XMO A;  3SQJ A;  5GIN A;  2JUH A;  4J2V A;  2BXK A;  2BXB A;  4HGM B;  4E99 A;  1TXU A;  1E7E A;  2XSI A;  1H9Z A;  4G04 A;  4N3Z A;  5IIU A;  4IW2 A;  2BXP A;  2BXN A;  1HK1 A;  2XVQ A;  3KJL A;  4LB9 A;  1IJG A;  4ZUX V;  4BY9 C;  3NVM A;  4Z69 A;  1H5W A;  4JK4 A;  3A75 A;  1BM0 A;  3GQU A;  3MHS B;  2NNW A;  3NVI A;  1O9X A;  2VUF A;  2CKX A;  1LNS A;  2ROH A;  2E0X A;  1KXP D;  3WHR A;  2BXO A;  4LUH A;  5IIX A;  1HK3 A;  2NQO A;  2VUE A;  4OR0 A;  1VZS A;  5GIP A;  1HK2 A;  1HK4 A;  4ZC6 A;  1J78 A;  1GNJ A;  4ZCG A;  2I30 A;  1E7I A;  2XVW A;  2EFE A;  4S1Y A;  2BXF A;  2I2Z A;  2BXG A;  1FOU A;  5B5T A;  3MHH B;  4GDL B;  2BXQ A;  1MIY A;  2BXL A;  2EFC A;  3V03 A;  3B9M A;  4TQ0 A;  4M70 B;  3KIK A;  4HGK A;  3B9L A;  4ZBQ A;  1E7C A;  3W1S A;  5IFO A;  2YDF A;  4F5S A;  1E7F A;  2AJE A;  3JQZ A;  2XVV A;  3WHQ A;  2BXI A;  4EMX A;  4F5V A;  4TQ1 A;  4W4U B;  3SIV B;  5IJ5 A;  2BXE A;  5FUO A;  1VFI A;  5IIH A;  4PO0 A;  1TF0 A;  4LB2 A;  2BXM A;  4LA0 A;  2LOQ A;  5D7G A;  1HA2 A;  2VDB A;  3LU7 A;  4F5U A;  1E7G A;  4OTU A;  2QMC A;  3V08 A;  4FK5 B;  3NVK A;  2XW0 A;  1N5U A;  3LU6 A;  4LUF A;  1MA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...