2XMOA

The crystal structure of lmo2642
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
409
Chain Sequence
PIEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYSDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDVKGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LMO2642 PROTEIN
publication title Structural and Functional Analysis of the Lmo2642 Cyclic Nucleotide Phosphodiesterase from Listeria Monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 154
structure length 409
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF17839 CNP_C_terminal C-terminal domain of cyclic nucleotide phosphodiesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.180 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2xmoA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2xmoA01
1M63A 3PSNA 4I5LC 4H2IA 1V73A 3GVEA 2AHDA 3IVDA 3EGHA 3TGHA 2Q8UA 5EQVA 1SU1A 2YVTA 3ZTVA 3QFOA 3LL8A 3EGGA 4H2GA 3ZU0A 4WWLA 3H66A 2Z1AA 3K7VC 4UWQA 2WDDA 1II7A 5F3WA 3H61A 3P71C 2XMOA 4F0ZA 1Z2XA 4IYPC 4NZVA 1OI8A 1S95A 2WDFA 4H2BA 4M0VA 3H68A 4IL1A 2IAEC 2GJUA 1S3LA 1WARA 3IVEA 4KKZA 4MP0A 2IE4C 3H60A 4ZX2A 1HO5A 4MOVA 2NYMC 3RQZA 4UT3B 4V0XA 5GTUA 3DSDA 2IE3C 3FGAC 4V0VA 4FBQA 4ZVZA 2WDEA 1UTEA 3RL5A 1QHWA 3QFMA 1IT6A 2WDCA 1U32A 3H62B 4ORAA 2QFPA 1S3MA 4ORCA 1MF8A 3HVQA 2O8AA 2NPPC 1KBPA 1XZWA 5JPEA 2BDXA 3DW8C 1HP1A 1OIEA 2CV9A 4H1SA 5INBA 2QJCA 1NNWA 3QG5C 1OIDA 3E7AA 1W24A 4H2FA 4J6OA 3H64A 2NXFA 3QFNA 4O24A 4G9JA 1JK7A 3E7BA 5JPFA 2HYPA 5J28A 5DNYA 3H67A 1S70A 3K7WC 1QFCA 4FBWA 1USHA 2ZBMA 4JA7A 4KBPA 1S8EA 2HY1A 2Z06A 4LU9A 4O5GA 4DSYA 3KBPA 4V0WA 1XM7A 3THOB 3CK2A 3IB8A 4OR9A 4FBKA 3RL4A 4UT2A 2JOGA 2KKNA 2DFJA 2NYLC 3IB7A 4I5NC 1T71A 3H63A 4LTYA 5C1VA 3V4YA 1Z2WA 3H69A 3DSCA 1T70A 2A22A 2BQ8X 4Q7FA 4TUGA 4B2OA 4JA9A 1UF3A 1AUIA 2USHA 3JYFA 4TUIA 3THNA 2HYOA 1S3NA 1FJMA 3T1IA 4LACC 4DHLA 3C5WC 3QFKA 4FCXA 5HPEA 1HPUA 3AV0A 3ICFA 3PSOA 4YKEA 1TCOA 1WAO1 2O8GA 4HD0A 4UT3A 5JJTA 4XPNA 4MOYA 2Z72A 2R17A 3N5UA 2QFRA 3C9FA 4H1YP 4ORBA 5IOHA 4DT2A 1G5BA 4O43A 2BCDA 5B8IA 3AUZA 4O4KA 3RL3A 2P6BA
chains in the Genus database with same CATH superfamily
3PSNA 4I5LC 3GVEA 2AHDA 2Q8UA 2YEQA 4S1YA 2AJEA 4WWLA 4NAWB 1II7A 3H61A 3P71C 2BXQA 3H68A 1S3LA 2DYOA 2OT3A 4E99A 4TQ0A 3WHRA 2IE4C 2BXCA 2BXFA 2NYMC 2IE3C 3FGAC 4V0VA 2DXNA 1QHWA 3QFMA 1SB0A 2DXLA 1U32A 2ZO9B 1S3MA 4MBEC 3VQIA 1KBPA 1XZWA 5JPEA 1E7GA 2QMCA 5IIUA 2BXHA 3TDLA 3V09A 2LXSA 4J6OA 2NXFA 5JPFA 3JRYA 3UIVA 3JQZA 5DNYA 2BXPA 3CX9A 1KXPD 1USHA 5FUOA 4KBPA 2OZBB 2Z06A 4L8UA 3A73A 1O9XA 4N0FD 4FBKA 3RL4A 3M99C 2DFJA 2NNWA 4J2VA 4LTYA 5GINA 3H69A 3DSCA 4G04A 2BQ8X 2E0XA 2EFDA 4B2OA 1UF3A 1AUIA 4TUIA 3JYFA 2V36A 4EMXA 5IJ5A 3ICFA 3E0JA 4ZC6A 2BXDA 1WAO1 5JJTA 2BXBA 2Z72A 3FWBC 5BPKA 2QFRA 4H1YP 5IOHA 1E7HA 2VUFA 3MHHB 4FK5B 1E7IA 1KDXA 2P6BA 5ID9A 4H2IA 3TGHA 2XSIA 3QFOA 3LL8A 3EGGA 4H2GA 4HGKA 3D03A 2Z1AA 2BXLA 4F0ZA 3V08A 5GIOA 1Z2XA 2LXTA 1H9ZA 1OI8A 1S95A 2IAEC 2GJUA 1WARA 3IVEA 2XVQA 1HO5A 2XVVA 2LQIA 2DBXA 2Z8JA 4UT3B 3DSDA 4FBQA 4ZVZA 2WDEA 3RL5A 1IT6A 2QFPA 2I2ZA 4G03A 1E7BA 2I30A 4LUFA 2Z8KA 3B9MA 2BDXA 3A75A 4OR0A 2CKXA 1HP1A 4H1SA 5INBA 4I9OA 2BXNA 2EFEA 3H64A 1E7AA 4N3ZA 3E7BA 2HYPA 3NVMA 2ROHA 2BXOA 3K7WC 1QFCA 2ZBMA 4FIPB 1S8EA 4GDLB 4DSYA 4OT2A 4UT2A 2DBUA 2NYLC 3IB7A 1T71A 3H63A 3LU8A 3V4YA 1Z2WA 1T70A 5HOZA 2K0NA 4M70B 4LB2A 4GDXA 5D7GA 2LOQA 1FJMA 4LACC 1HPUA 3PSOA 4GDKB 2O8GA 4XPNA 5ID7A 4G01A 2DBWA 4LA0A 1G5BA 4LB9A 1E7FA 3AUZA 3MHSB 5IIXA 4K2CA 1SU1A 3ZTVA 1BKEA 3ZU0A 4UWQA 1NT2B 2GUTA 2XMOA 4ZBKA 4NZVA 4H2BA 4IL1A 3FNMA 2AGHB 4KKZA 4MP0A 2NQOA 4ZX2A 3ECPA 4BY9C 5GTUA 4C31B 3SQJA 3H62B 4ORAA 5DBYA 4ORCA 4W4UB 1HK2A 3BPJA 2O8AA 5DQFA 2BXGA 1E7CA 1TXUA 3GQXA 3DW8C 1IJGA 1OIEA 1NNWA 3QG5C 1MUSA 4H2FA 4F5UA 4O24A 1E78A 1TF0A 1JK7A 4DM0A 5J28A 2ZOAA 3H67A 3LU7A 1S70A 4FBWA 1AO6A 3B9LA 4JA7A 4WA6B 4V0WA 3IB8A 4OR9A 1N5UA 4LUHA 3SIVB 1HA2A 2JOGA 2KKNA 4ZCGA 4D7XA 1H5WA 5C1VA 4ZBQA 3V03A 4Q7FA 1J7EA 1HK1A 4TUGA 1UORA 4JA9A 3THNA 4BKEA 2DG5A 1GNJA 5IFOA 3FWCC 3AV0A 3WHSA 1TCOA 4HD0A 4MOYA 2XW1A 3GQUA 2R17A 3WHQA 4ORBA 1MIYA 1HK4A 4OTUA 3KIKA 4TQ1A 2EFHA 3LU6A 5B8IA 1MIVA 3SIUB 4O4KA 1MM8A 2BXAA 1M63A 1GNIA 3H3AA 1V73A 1KW2A 3IVDA 3EGHA 4FJCB 2XVUA 5EQVA 2YVTA 4GG2A 1BM0A 2BXKA 3NVKA 2XVWA 2QHBA 3H66A 5IJFA 3K7VC 2WDDA 5F3WA 3NVIA 4F5VA 1FOUA 4ZUXV 4IYPC 2BXMA 2WDFA 4M0VA 2E0YA 2BXEA 2BXIA 1LOTA 4HGMB 4OTTA 3H60A 4MOVA 2YDFA 3RQZA 4L9KA 4V0XA 5B5TA 4IW2A 3KJLA 2Z8IA 1JNBA 1UTEA 1HK3A 4F5SA 4Z9OA 2WDCA 5GHKA 1MF8A 4L9QA 3HVQA 2NPPC 2BX8A 1MUHA 2KWFA 2LQHA 4DHXB 3G9KD 4F5TA 4N0UD 2CV9A 2QJCA 1OIDA 3E7AA 1W24A 2KBZA 4JK4A 4IW1A 2QM6A 3QFNA 4G9JA 3FLOA 1VFIA 4ZBRA 4Z69A 2XW0A 3W1SA 3PLAA 2HY1A 4LU9A 4O5GA 2JUHA 4PO0A 3KBPA 1XM7A 3THOB 3CK2A 5IJEA 1LNSA 1MA9A 4I5NC 3H37A 1J78A 1VZSA 1MIWA 2A22A 4K71A 2USHA 3GA9L 1E7EA 2HYOA 3ICXA 1S3NA 3T1IA 4DHLA 3C5WC 3QFKA 4FCXA 5HPEA 2VDBA 1BJ5A 4YKEA 4UT3A 2EFCA 5IIHA 2VUEA 3N5UA 3C9FA 4DT2A 1HK5A 5GIPA 3NMUA 4O43A 2BCDA 3RL3A 2DYMA
chains in the Genus database with same CATH topology
3PSNA 4I5LC 3GVEA 2AHDA 2Q8UA 2YEQA 4S1YA 2AJEA 4WWLA 4NAWB 1II7A 3H61A 3P71C 2BXQA 3H68A 1S3LA 2DYOA 2OT3A 4E99A 4TQ0A 3WHRA 2IE4C 2BXCA 2BXFA 2NYMC 2IE3C 3FGAC 4V0VA 2DXNA 1QHWA 3QFMA 2DXLA 1U32A 2ZO9B 1S3MA 4MBEC 3VQIA 1KBPA 1XZWA 5JPEA 1E7GA 2QMCA 5IIUA 2BXHA 3TDLA 3V09A 4J6OA 2NXFA 5JPFA 3JRYA 3UIVA 3JQZA 5DNYA 2BXPA 3CX9A 1KXPD 1USHA 5FUOA 4KBPA 2OZBB 2Z06A 4L8UA 3A73A 1O9XA 4N0FD 4FBKA 3RL4A 3M99C 2DFJA 2NNWA 4J2VA 4LTYA 5GINA 3H69A 3DSCA 4G04A 2BQ8X 2E0XA 2EFDA 4B2OA 1UF3A 1AUIA 4TUIA 3JYFA 2V36A 4EMXA 5IJ5A 3ICFA 3E0JA 4ZC6A 2BXDA 1WAO1 5JJTA 2BXBA 2Z72A 3FWBC 5BPKA 2QFRA 4H1YP 5IOHA 1E7HA 2VUFA 3MHHB 4FK5B 1E7IA 2P6BA 5ID9A 4H2IA 3TGHA 2XSIA 3QFOA 3LL8A 3EGGA 4H2GA 4HGKA 3D03A 2Z1AA 2BXLA 4F0ZA 3V08A 5GIOA 1Z2XA 1H9ZA 1OI8A 1S95A 2IAEC 2GJUA 1WARA 3IVEA 2XVQA 1HO5A 2XVVA 2DBXA 2Z8JA 4UT3B 3DSDA 4FBQA 4ZVZA 2WDEA 3RL5A 1IT6A 2QFPA 2I2ZA 4G03A 1E7BA 2I30A 4LUFA 2Z8KA 3B9MA 2BDXA 3A75A 4OR0A 2CKXA 1HP1A 4H1SA 5INBA 2BXNA 2EFEA 3H64A 1E7AA 4N3ZA 3E7BA 2HYPA 3NVMA 2ROHA 2BXOA 3K7WC 1QFCA 2ZBMA 4FIPB 1S8EA 4GDLB 4DSYA 4OT2A 4UT2A 2DBUA 2NYLC 3IB7A 1T71A 3H63A 3LU8A 3V4YA 1Z2WA 1T70A 5HOZA 4M70B 4LB2A 4GDXA 5D7GA 2LOQA 1FJMA 4LACC 1HPUA 3PSOA 4GDKB 2O8GA 4XPNA 5ID7A 4G01A 2DBWA 4LA0A 1G5BA 4LB9A 1E7FA 3AUZA 3MHSB 5IIXA 4K2CA 1SU1A 3ZTVA 1BKEA 3ZU0A 4UWQA 1NT2B 2XMOA 4ZBKA 4NZVA 4H2BA 4IL1A 3FNMA 4KKZA 4MP0A 2NQOA 4ZX2A 4BY9C 5GTUA 4C31B 3SQJA 3H62B 4ORAA 5DBYA 4ORCA 4W4UB 1HK2A 2O8AA 5DQFA 2BXGA 1E7CA 1TXUA 3GQXA 3DW8C 1IJGA 1OIEA 1NNWA 3QG5C 4H2FA 4F5UA 4O24A 1E78A 1TF0A 1JK7A 5J28A 2ZOAA 3H67A 3LU7A 1S70A 4FBWA 1AO6A 3B9LA 4JA7A 4WA6B 4V0WA 3IB8A 4OR9A 1N5UA 4LUHA 3SIVB 1HA2A 2JOGA 2KKNA 4ZCGA 1H5WA 5C1VA 4ZBQA 3V03A 4Q7FA 1J7EA 1HK1A 4TUGA 1UORA 4JA9A 3THNA 4BKEA 2DG5A 1GNJA 5IFOA 3FWCC 3AV0A 3WHSA 1TCOA 4HD0A 4MOYA 2XW1A 3GQUA 2R17A 3WHQA 4ORBA 1MIYA 1HK4A 4OTUA 3KIKA 4TQ1A 2EFHA 3LU6A 5B8IA 1MIVA 3SIUB 4O4KA 2BXAA 1M63A 1GNIA 3H3AA 1V73A 1KW2A 3IVDA 3EGHA 4FJCB 2XVUA 5EQVA 2YVTA 4GG2A 1BM0A 2BXKA 3NVKA 2XVWA 2QHBA 3H66A 5IJFA 3K7VC 2WDDA 5F3WA 3NVIA 4F5VA 1FOUA 4ZUXV 4IYPC 2BXMA 2WDFA 4M0VA 2E0YA 2BXEA 2BXIA 1LOTA 4HGMB 4OTTA 3H60A 4MOVA 2YDFA 3RQZA 4L9KA 4V0XA 5B5TA 4IW2A 3KJLA 2Z8IA 1JNBA 1UTEA 1HK3A 4F5SA 4Z9OA 2WDCA 5GHKA 1MF8A 4L9QA 3HVQA 2NPPC 2BX8A 4DHXB 3G9KD 4F5TA 4N0UD 2CV9A 2QJCA 1OIDA 3E7AA 1W24A 2KBZA 4JK4A 4IW1A 2QM6A 3QFNA 4G9JA 3FLOA 1VFIA 4ZBRA 4Z69A 2XW0A 3W1SA 3PLAA 2HY1A 4LU9A 4O5GA 2JUHA 4PO0A 3KBPA 1XM7A 3THOB 3CK2A 5IJEA 1LNSA 1MA9A 4I5NC 3H37A 1J78A 1VZSA 1MIWA 2A22A 4K71A 2USHA 3GA9L 1E7EA 2HYOA 3ICXA 1S3NA 3T1IA 4DHLA 3C5WC 3QFKA 4FCXA 5HPEA 2VDBA 1BJ5A 4YKEA 4UT3A 2EFCA 5IIHA 2VUEA 3N5UA 3C9FA 4DT2A 1HK5A 5GIPA 3NMUA 4O43A 2BCDA 3RL3A 2DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M63 A;  3PSN A;  4I5L C;  4H2I A;  1V73 A;  3GVE A;  2AHD A;  3IVD A;  3EGH A;  3TGH A;  2Q8U A;  5EQV A;  1SU1 A;  2YVT A;  3ZTV A;  3QFO A;  3LL8 A;  3EGG A;  4H2G A;  3ZU0 A;  4WWL A;  3H66 A;  2Z1A A;  3K7V C;  4UWQ A;  2WDD A;  1II7 A;  5F3W A;  3H61 A;  3P71 C;  2XMO A;  4F0Z A;  1Z2X A;  4IYP C;  4NZV A;  1OI8 A;  1S95 A;  2WDF A;  4H2B A;  4M0V A;  3H68 A;  4IL1 A;  2IAE C;  2GJU A;  1S3L A;  1WAR A;  3IVE A;  4KKZ A;  4MP0 A;  2IE4 C;  3H60 A;  4ZX2 A;  1HO5 A;  4MOV A;  2NYM C;  3RQZ A;  4UT3 B;  4V0X A;  5GTU A;  3DSD A;  2IE3 C;  3FGA C;  4V0V A;  4FBQ A;  4ZVZ A;  2WDE A;  1UTE A;  3RL5 A;  1QHW A;  3QFM A;  1IT6 A;  2WDC A;  1U32 A;  3H62 B;  4ORA A;  2QFP A;  1S3M A;  4ORC A;  1MF8 A;  3HVQ A;  2O8A A;  2NPP C;  1KBP A;  1XZW A;  5JPE A;  2BDX A;  3DW8 C;  1HP1 A;  1OIE A;  2CV9 A;  4H1S A;  5INB A;  2QJC A;  1NNW A;  3QG5 C;  1OID A;  3E7A A;  1W24 A;  4H2F A;  4J6O A;  3H64 A;  2NXF A;  3QFN A;  4O24 A;  4G9J A;  1JK7 A;  3E7B A;  5JPF A;  2HYP A;  5J28 A;  5DNY A;  3H67 A;  1S70 A;  3K7W C;  1QFC A;  4FBW A;  1USH A;  2ZBM A;  4JA7 A;  4KBP A;  1S8E A;  2HY1 A;  2Z06 A;  4LU9 A;  4O5G A;  4DSY A;  3KBP A;  4V0W A;  1XM7 A;  3THO B;  3CK2 A;  3IB8 A;  4OR9 A;  4FBK A;  3RL4 A;  4UT2 A;  2JOG A;  2KKN A;  2DFJ A;  2NYL C;  3IB7 A;  4I5N C;  1T71 A;  3H63 A;  4LTY A;  5C1V A;  3V4Y A;  1Z2W A;  3H69 A;  3DSC A;  1T70 A;  2A22 A;  2BQ8 X;  4Q7F A;  4TUG A;  4B2O A;  4JA9 A;  1UF3 A;  1AUI A;  2USH A;  3JYF A;  4TUI A;  3THN A;  2HYO A;  1S3N A;  1FJM A;  3T1I A;  4LAC C;  4DHL A;  3C5W C;  3QFK A;  4FCX A;  5HPE A;  1HPU A;  3AV0 A;  3ICF A;  3PSO A;  4YKE A;  1TCO A;  1WAO 1;  2O8G A;  4HD0 A;  4UT3 A;  5JJT A;  4XPN A;  4MOY A;  2Z72 A;  2R17 A;  3N5U A;  2QFR A;  3C9F A;  4H1Y P;  4ORB A;  5IOH A;  4DT2 A;  1G5B A;  4O43 A;  2BCD A;  5B8I A;  3AUZ A;  4O4K A;  3RL3 A;  2P6B A; 
#chains in the Genus database with same CATH topology
 3PSN A;  4I5L C;  3GVE A;  2AHD A;  2Q8U A;  2YEQ A;  4S1Y A;  2AJE A;  4WWL A;  4NAW B;  1II7 A;  3H61 A;  3P71 C;  2BXQ A;  3H68 A;  1S3L A;  2DYO A;  2OT3 A;  4E99 A;  4TQ0 A;  3WHR A;  2IE4 C;  2BXC A;  2BXF A;  2NYM C;  2IE3 C;  3FGA C;  4V0V A;  2DXN A;  1QHW A;  3QFM A;  1SB0 A;  2DXL A;  1U32 A;  2ZO9 B;  1S3M A;  4MBE C;  3VQI A;  1KBP A;  1XZW A;  5JPE A;  1E7G A;  2QMC A;  5IIU A;  2BXH A;  3TDL A;  3V09 A;  2LXS A;  4J6O A;  2NXF A;  5JPF A;  3JRY A;  3UIV A;  3JQZ A;  5DNY A;  2BXP A;  3CX9 A;  1KXP D;  1USH A;  5FUO A;  4KBP A;  2OZB B;  2Z06 A;  4L8U A;  3A73 A;  1O9X A;  4N0F D;  4FBK A;  3RL4 A;  3M99 C;  2DFJ A;  2NNW A;  4J2V A;  4LTY A;  5GIN A;  3H69 A;  3DSC A;  4G04 A;  2BQ8 X;  2E0X A;  2EFD A;  4B2O A;  1UF3 A;  1AUI A;  4TUI A;  3JYF A;  2V36 A;  4EMX A;  5IJ5 A;  3ICF A;  3E0J A;  4ZC6 A;  2BXD A;  1WAO 1;  5JJT A;  2BXB A;  2Z72 A;  3FWB C;  5BPK A;  2QFR A;  4H1Y P;  5IOH A;  1E7H A;  2VUF A;  3MHH B;  4FK5 B;  1E7I A;  1KDX A;  2P6B A;  5ID9 A;  4H2I A;  3TGH A;  2XSI A;  3QFO A;  3LL8 A;  3EGG A;  4H2G A;  4HGK A;  3D03 A;  2Z1A A;  2BXL A;  4F0Z A;  3V08 A;  5GIO A;  1Z2X A;  2LXT A;  1H9Z A;  1OI8 A;  1S95 A;  2IAE C;  2GJU A;  1WAR A;  3IVE A;  2XVQ A;  1HO5 A;  2XVV A;  2LQI A;  2DBX A;  2Z8J A;  4UT3 B;  3DSD A;  4FBQ A;  4ZVZ A;  2WDE A;  3RL5 A;  1IT6 A;  2QFP A;  2I2Z A;  4G03 A;  1E7B A;  2I30 A;  4LUF A;  2Z8K A;  3B9M A;  2BDX A;  3A75 A;  4OR0 A;  2CKX A;  1HP1 A;  4H1S A;  5INB A;  4I9O A;  2BXN A;  2EFE A;  3H64 A;  1E7A A;  4N3Z A;  3E7B A;  2HYP A;  3NVM A;  2ROH A;  2BXO A;  3K7W C;  1QFC A;  2ZBM A;  4FIP B;  1S8E A;  4GDL B;  4DSY A;  4OT2 A;  4UT2 A;  2DBU A;  2NYL C;  3IB7 A;  1T71 A;  3H63 A;  3LU8 A;  3V4Y A;  1Z2W A;  1T70 A;  5HOZ A;  2K0N A;  4M70 B;  4LB2 A;  4GDX A;  5D7G A;  2LOQ A;  1FJM A;  4LAC C;  1HPU A;  3PSO A;  4GDK B;  2O8G A;  4XPN A;  5ID7 A;  4G01 A;  2DBW A;  4LA0 A;  1G5B A;  4LB9 A;  1E7F A;  3AUZ A;  3MHS B;  5IIX A;  4K2C A;  1SU1 A;  3ZTV A;  1BKE A;  3ZU0 A;  4UWQ A;  1NT2 B;  2GUT A;  2XMO A;  4ZBK A;  4NZV A;  4H2B A;  4IL1 A;  3FNM A;  2AGH B;  4KKZ A;  4MP0 A;  2NQO A;  4ZX2 A;  3ECP A;  4BY9 C;  5GTU A;  4C31 B;  3SQJ A;  3H62 B;  4ORA A;  5DBY A;  4ORC A;  4W4U B;  1HK2 A;  3BPJ A;  2O8A A;  5DQF A;  2BXG A;  1E7C A;  1TXU A;  3GQX A;  3DW8 C;  1IJG A;  1OIE A;  1NNW A;  3QG5 C;  1MUS A;  4H2F A;  4F5U A;  4O24 A;  1E78 A;  1TF0 A;  1JK7 A;  4DM0 A;  5J28 A;  2ZOA A;  3H67 A;  3LU7 A;  1S70 A;  4FBW A;  1AO6 A;  3B9L A;  4JA7 A;  4WA6 B;  4V0W A;  3IB8 A;  4OR9 A;  1N5U A;  4LUH A;  3SIV B;  1HA2 A;  2JOG A;  2KKN A;  4ZCG A;  4D7X A;  1H5W A;  5C1V A;  4ZBQ A;  3V03 A;  4Q7F A;  1J7E A;  1HK1 A;  4TUG A;  1UOR A;  4JA9 A;  3THN A;  4BKE A;  2DG5 A;  1GNJ A;  5IFO A;  3FWC C;  3AV0 A;  3WHS A;  1TCO A;  4HD0 A;  4MOY A;  2XW1 A;  3GQU A;  2R17 A;  3WHQ A;  4ORB A;  1MIY A;  1HK4 A;  4OTU A;  3KIK A;  4TQ1 A;  2EFH A;  3LU6 A;  5B8I A;  1MIV A;  3SIU B;  4O4K A;  1MM8 A;  2BXA A;  1M63 A;  1GNI A;  3H3A A;  1V73 A;  1KW2 A;  3IVD A;  3EGH A;  4FJC B;  2XVU A;  5EQV A;  2YVT A;  4GG2 A;  1BM0 A;  2BXK A;  3NVK A;  2XVW A;  2QHB A;  3H66 A;  5IJF A;  3K7V C;  2WDD A;  5F3W A;  3NVI A;  4F5V A;  1FOU A;  4ZUX V;  4IYP C;  2BXM A;  2WDF A;  4M0V A;  2E0Y A;  2BXE A;  2BXI A;  1LOT A;  4HGM B;  4OTT A;  3H60 A;  4MOV A;  2YDF A;  3RQZ A;  4L9K A;  4V0X A;  5B5T A;  4IW2 A;  3KJL A;  2Z8I A;  1JNB A;  1UTE A;  1HK3 A;  4F5S A;  4Z9O A;  2WDC A;  5GHK A;  1MF8 A;  4L9Q A;  3HVQ A;  2NPP C;  2BX8 A;  1MUH A;  2KWF A;  2LQH A;  4DHX B;  3G9K D;  4F5T A;  4N0U D;  2CV9 A;  2QJC A;  1OID A;  3E7A A;  1W24 A;  2KBZ A;  4JK4 A;  4IW1 A;  2QM6 A;  3QFN A;  4G9J A;  3FLO A;  1VFI A;  4ZBR A;  4Z69 A;  2XW0 A;  3W1S A;  3PLA A;  2HY1 A;  4LU9 A;  4O5G A;  2JUH A;  4PO0 A;  3KBP A;  1XM7 A;  3THO B;  3CK2 A;  5IJE A;  1LNS A;  1MA9 A;  4I5N C;  3H37 A;  1J78 A;  1VZS A;  1MIW A;  2A22 A;  4K71 A;  2USH A;  3GA9 L;  1E7E A;  2HYO A;  3ICX A;  1S3N A;  3T1I A;  4DHL A;  3C5W C;  3QFK A;  4FCX A;  5HPE A;  2VDB A;  1BJ5 A;  4YKE A;  4UT3 A;  2EFC A;  5IIH A;  2VUE A;  3N5U A;  3C9F A;  4DT2 A;  1HK5 A;  5GIP A;  3NMU A;  4O43 A;  2BCD A;  3RL3 A;  2DYM A; 
#chains in the Genus database with same CATH homology
 3PSN A;  4I5L C;  3GVE A;  2AHD A;  2Q8U A;  2YEQ A;  4S1Y A;  2AJE A;  4WWL A;  4NAW B;  1II7 A;  3H61 A;  3P71 C;  2BXQ A;  3H68 A;  1S3L A;  2DYO A;  2OT3 A;  4E99 A;  4TQ0 A;  3WHR A;  2IE4 C;  2BXC A;  2BXF A;  2NYM C;  2IE3 C;  3FGA C;  4V0V A;  2DXN A;  1QHW A;  3QFM A;  2DXL A;  1U32 A;  2ZO9 B;  1S3M A;  4MBE C;  3VQI A;  1KBP A;  1XZW A;  5JPE A;  1E7G A;  2QMC A;  5IIU A;  2BXH A;  3TDL A;  3V09 A;  4J6O A;  2NXF A;  5JPF A;  3JRY A;  3UIV A;  3JQZ A;  5DNY A;  2BXP A;  3CX9 A;  1KXP D;  1USH A;  5FUO A;  4KBP A;  2OZB B;  2Z06 A;  4L8U A;  3A73 A;  1O9X A;  4N0F D;  4FBK A;  3RL4 A;  3M99 C;  2DFJ A;  2NNW A;  4J2V A;  4LTY A;  5GIN A;  3H69 A;  3DSC A;  4G04 A;  2BQ8 X;  2E0X A;  2EFD A;  4B2O A;  1UF3 A;  1AUI A;  4TUI A;  3JYF A;  2V36 A;  4EMX A;  5IJ5 A;  3ICF A;  3E0J A;  4ZC6 A;  2BXD A;  1WAO 1;  5JJT A;  2BXB A;  2Z72 A;  3FWB C;  5BPK A;  2QFR A;  4H1Y P;  5IOH A;  1E7H A;  2VUF A;  3MHH B;  4FK5 B;  1E7I A;  2P6B A;  5ID9 A;  4H2I A;  3TGH A;  2XSI A;  3QFO A;  3LL8 A;  3EGG A;  4H2G A;  4HGK A;  3D03 A;  2Z1A A;  2BXL A;  4F0Z A;  3V08 A;  5GIO A;  1Z2X A;  1H9Z A;  1OI8 A;  1S95 A;  2IAE C;  2GJU A;  1WAR A;  3IVE A;  2XVQ A;  1HO5 A;  2XVV A;  2DBX A;  2Z8J A;  4UT3 B;  3DSD A;  4FBQ A;  4ZVZ A;  2WDE A;  3RL5 A;  1IT6 A;  2QFP A;  2I2Z A;  4G03 A;  1E7B A;  2I30 A;  4LUF A;  2Z8K A;  3B9M A;  2BDX A;  3A75 A;  4OR0 A;  2CKX A;  1HP1 A;  4H1S A;  5INB A;  2BXN A;  2EFE A;  3H64 A;  1E7A A;  4N3Z A;  3E7B A;  2HYP A;  3NVM A;  2ROH A;  2BXO A;  3K7W C;  1QFC A;  2ZBM A;  4FIP B;  1S8E A;  4GDL B;  4DSY A;  4OT2 A;  4UT2 A;  2DBU A;  2NYL C;  3IB7 A;  1T71 A;  3H63 A;  3LU8 A;  3V4Y A;  1Z2W A;  1T70 A;  5HOZ A;  4M70 B;  4LB2 A;  4GDX A;  5D7G A;  2LOQ A;  1FJM A;  4LAC C;  1HPU A;  3PSO A;  4GDK B;  2O8G A;  4XPN A;  5ID7 A;  4G01 A;  2DBW A;  4LA0 A;  1G5B A;  4LB9 A;  1E7F A;  3AUZ A;  3MHS B;  5IIX A;  4K2C A;  1SU1 A;  3ZTV A;  1BKE A;  3ZU0 A;  4UWQ A;  1NT2 B;  2XMO A;  4ZBK A;  4NZV A;  4H2B A;  4IL1 A;  3FNM A;  4KKZ A;  4MP0 A;  2NQO A;  4ZX2 A;  4BY9 C;  5GTU A;  4C31 B;  3SQJ A;  3H62 B;  4ORA A;  5DBY A;  4ORC A;  4W4U B;  1HK2 A;  2O8A A;  5DQF A;  2BXG A;  1E7C A;  1TXU A;  3GQX A;  3DW8 C;  1IJG A;  1OIE A;  1NNW A;  3QG5 C;  4H2F A;  4F5U A;  4O24 A;  1E78 A;  1TF0 A;  1JK7 A;  5J28 A;  2ZOA A;  3H67 A;  3LU7 A;  1S70 A;  4FBW A;  1AO6 A;  3B9L A;  4JA7 A;  4WA6 B;  4V0W A;  3IB8 A;  4OR9 A;  1N5U A;  4LUH A;  3SIV B;  1HA2 A;  2JOG A;  2KKN A;  4ZCG A;  1H5W A;  5C1V A;  4ZBQ A;  3V03 A;  4Q7F A;  1J7E A;  1HK1 A;  4TUG A;  1UOR A;  4JA9 A;  3THN A;  4BKE A;  2DG5 A;  1GNJ A;  5IFO A;  3FWC C;  3AV0 A;  3WHS A;  1TCO A;  4HD0 A;  4MOY A;  2XW1 A;  3GQU A;  2R17 A;  3WHQ A;  4ORB A;  1MIY A;  1HK4 A;  4OTU A;  3KIK A;  4TQ1 A;  2EFH A;  3LU6 A;  5B8I A;  1MIV A;  3SIU B;  4O4K A;  2BXA A;  1M63 A;  1GNI A;  3H3A A;  1V73 A;  1KW2 A;  3IVD A;  3EGH A;  4FJC B;  2XVU A;  5EQV A;  2YVT A;  4GG2 A;  1BM0 A;  2BXK A;  3NVK A;  2XVW A;  2QHB A;  3H66 A;  5IJF A;  3K7V C;  2WDD A;  5F3W A;  3NVI A;  4F5V A;  1FOU A;  4ZUX V;  4IYP C;  2BXM A;  2WDF A;  4M0V A;  2E0Y A;  2BXE A;  2BXI A;  1LOT A;  4HGM B;  4OTT A;  3H60 A;  4MOV A;  2YDF A;  3RQZ A;  4L9K A;  4V0X A;  5B5T A;  4IW2 A;  3KJL A;  2Z8I A;  1JNB A;  1UTE A;  1HK3 A;  4F5S A;  4Z9O A;  2WDC A;  5GHK A;  1MF8 A;  4L9Q A;  3HVQ A;  2NPP C;  2BX8 A;  4DHX B;  3G9K D;  4F5T A;  4N0U D;  2CV9 A;  2QJC A;  1OID A;  3E7A A;  1W24 A;  2KBZ A;  4JK4 A;  4IW1 A;  2QM6 A;  3QFN A;  4G9J A;  3FLO A;  1VFI A;  4ZBR A;  4Z69 A;  2XW0 A;  3W1S A;  3PLA A;  2HY1 A;  4LU9 A;  4O5G A;  2JUH A;  4PO0 A;  3KBP A;  1XM7 A;  3THO B;  3CK2 A;  5IJE A;  1LNS A;  1MA9 A;  4I5N C;  3H37 A;  1J78 A;  1VZS A;  1MIW A;  2A22 A;  4K71 A;  2USH A;  3GA9 L;  1E7E A;  2HYO A;  3ICX A;  1S3N A;  3T1I A;  4DHL A;  3C5W C;  3QFK A;  4FCX A;  5HPE A;  2VDB A;  1BJ5 A;  4YKE A;  4UT3 A;  2EFC A;  5IIH A;  2VUE A;  3N5U A;  3C9F A;  4DT2 A;  1HK5 A;  5GIP A;  3NMU A;  4O43 A;  2BCD A;  3RL3 A;  2DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...