2XMOA

The crystal structure of lmo2642
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
409
Chain Sequence
PIEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYSDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDVKGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LMO2642 PROTEIN
publication title Structural and Functional Analysis of the Lmo2642 Cyclic Nucleotide Phosphodiesterase from Listeria Monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 154
structure length 409
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF17839 CNP_C_terminal C-terminal domain of cyclic nucleotide phosphodiesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.180 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2xmoA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2xmoA01
3V4YA 1HP1A 1II7A 1S95A 2YVTA 5GTUA 3H63A 4TUIA 2WDFA 3H69A 4YKEA 2HYPA 4FBQA 1OIEA 3HVQA 3THOB 1IT6A 4I5LC 4IL1A 2BDXA 4H2GA 4KBPA 2USHA 4ZVZA 1S3MA 1USHA 5C1VA 4J6OA 5JJTA 1WAO1 3CK2A 3DSDA 1S70A 1S3NA 4H1YP 1XM7A 1S8EA 3PSOA 5INBA 1AUIA 2KKNA 4OR9A 2Z06A 4TUGA 4JA9A 2XMOA 2Z72A 4MP0A 1S3LA 4O5GA 1T71A 4MOVA 4MOYA 2WDEA 1QFCA 4ORAA 3H64A 3H68A 4O43A 3AUZA 3RL3A 3FGAC 2ZBMA 4LU9A 4B2OA 1G5BA 3P71C 4HD0A 4V0WA 2NXFA 1KBPA 2O8GA 3QFNA 3T1IA 1SU1A 5J28A 4KKZA 3QFOA 4M0VA 4UT3A 3PSNA 4WWLA 1HO5A 3KBPA 2QJCA 2CV9A 4FBKA 2QFPA 4JA7A 3E7BA 1MF8A 5JPFA 1Z2WA 3E7AA 4F0ZA 3H60A 2GJUA 3RQZA 4ZX2A 5JPEA 4ORBA 1TCOA 5DNYA 4LACC 2WDDA 1JK7A 3K7VC 1M63A 4NZVA 4V0XA 3LL8A 3JYFA 4UWQA 2O8AA 2BCDA 2JOGA 4FBWA 3EGGA 2R17A 2NPPC 3IB7A 5F3WA 2IE4C 3C5WC 1UTEA 3QG5C 4I5NC 2NYLC 4ORCA 3DW8C 1U32A 1FJMA 4H2BA 1W24A 3H62B 4DHLA 2HYOA 2AHDA 2IE3C 4H2IA 3N5UA 3TGHA 1NNWA 3ICFA 5HPEA 3H66A 1WARA 2P6BA 3GVEA 3EGHA 4UT2A 2Z1AA 4G9JA 4V0VA 1HPUA 1UF3A 2A22A 4IYPC 3RL4A 1OIDA 2HY1A 1OI8A 3K7WC 1Z2XA 3C9FA 4UT3B 1XZWA 2WDCA 4O24A 5EQVA 4FCXA 5B8IA 4H1SA 4DT2A 2DFJA 3IVEA 4Q7FA 2IAEC 3IB8A 4H2FA 4XPNA 3ZU0A 1QHWA 1T70A 3QFKA 3H61A 3RL5A 2BQ8X 3DSCA 4O4KA 2Q8UA 4DSYA 3THNA 3QFMA 5IOHA 4LTYA 2QFRA 3ZTVA 1V73A 3IVDA 3H67A 3AV0A 2NYMC
chains in the Genus database with same CATH superfamily
1N5UA 3M99C 1S95A 1JNBA 4HGKA 2DXLA 3BPJA 5IJ5A 3JRYA 3H37A 4IL1A 4GDXA 5DQFA 3NVMA 5JJTA 1S70A 1KXPD 3PSOA 2VDBA 1MIWA 3MHHB 4TUGA 4JA9A 1LOTA 2XW1A 1S3LA 2NQOA 3B9LA 4MOVA 4MOYA 4ZBRA 1QFCA 4ORAA 5HOZA 2QM6A 4B2OA 4BY9C 4OT2A 3FWBC 2NXFA 1KBPA 2O8GA 1MUSA 2BXQA 1SU1A 3QFOA 4M0VA 4WWLA 3GQXA 4BKEA 3SQJA 1FOUA 4F0ZA 2XSIA 3H60A 4D7XA 2GJUA 2XW0A 2E0YA 3K7VC 3JYFA 3GA9L 1MIYA 2BXGA 4DM0A 3EGGA 2NPPC 2IE4C 3QG5C 1UTEA 4I5NC 3DW8C 3H62B 4DHLA 2YEQA 3D03A 2VUEA 2IE3C 5DBYA 4N0UD 3N5UA 1HA2A 1NNWA 2BXMA 2BXHA 4G01A 4UT2A 2Z1AA 1OIDA 3E0JA 4UT3B 4O24A 4IW2A 5D7GA 2IAEC 5IJFA 1T70A 3ICXA 2BQ8X 4N3ZA 4DSYA 3WHRA 3THNA 2BXNA 1GNJA 1E7AA 4G03A 4L9QA 4LA0A 1II7A 4FIPB 4GDKB 3H69A 4YKEA 4FBQA 4DHXB 1HK1A 2YDFA 4I5LC 2BXIA 1S3MA 2DG5A 3CK2A 3DSDA 1S3NA 1XM7A 5INBA 1AUIA 1T71A 2V36A 3H64A 4O43A 1NT2B 1E7IA 2KBZA 3W1SA 4HD0A 3QFNA 5GIOA 4ZCGA 3T1IA 4JK4A 4F5TA 4FK5B 4UT3A 2QJCA 4K71A 4FBKA 4GDLB 2ZOAA 2VUFA 3E7AA 5FUOA 2OZBB 4ZX2A 1TCOA 3PLAA 4V0XA 4NZVA 4UWQA 3V08A 2O8AA 2BCDA 4L8UA 2JOGA 4FBWA 2XVUA 5F3WA 3C5WC 4ZBKA 1U32A 5B5TA 3SIUB 4OTUA 5IJEA 3FLOA 3ICFA 1E7FA 5GHKA 3H66A 1WARA 3EGHA 1E7EA 2LQIA 2A22A 4IYPC 2CKXA 1OI8A 3ECPA 4ZBQA 2WDCA 5B8IA 2GUTA 2DFJA 3IVEA 1O9XA 2BX8A 4H2FA 4XPNA 2QHBA 1QHWA 3QFKA 3H61A 3KJLA 2I30A 2Q8UA 3GQUA 5IOHA 4LTYA 3FNMA 4FJCB 1V73A 3ZTVA 3AV0A 3WHSA 5GTUA 4TUIA 3H3AA 2DBXA 4IW1A 3NMUA 2Z8KA 3HVQA 1HK5A 1IT6A 3TDLA 4KBPA 2USHA 4ZVZA 1H9ZA 2EFDA 5C1VA 1E7CA 1KW2A 3A73A 1WAO1 2AJEA 2BXAA 5BPKA 4OR9A 3KIKA 1BKEA 1HK4A 2XMOA 5ID7A 2WDEA 3B9MA 2LQHA 3RL3A 3FGAC 2BXLA 2DBWA 2ZBMA 4LU9A 4G04A 1VFIA 2K0NA 4KKZA 2AGHB 4NAWB 1HK2A 5IIUA 2CV9A 4JA7A 1TF0A 3UIVA 1E7GA 3E7BA 4F5VA 1MF8A 2BXOA 1Z2WA 2BXBA 2QMCA 2LOQA 4HGMB 1IJGA 1E7BA 5GIPA 5JPEA 4ORBA 3MHSB 1JK7A 1GNIA 4TQ1A 1BJ5A 2DYOA 2ROHA 3LL8A 4OTTA 2BXCA 2BXFA 2EFHA 3LU8A 4K2CA 5IIHA 1HK3A 2BXEA 3VQIA 2EFEA 1FJMA 2HYOA 4F5SA 4E99A 3A75A 4H2IA 3TGHA 5HPEA 5ID9A 3GVEA 1HPUA 3WHQA 2KWFA 4WA6B 1Z2XA 3C9FA 1XZWA 2BXKA 5EQVA 4PO0A 4H1SA 3ZU0A 4N0FD 4ZC6A 4O4KA 3QFMA 4C31B 2QFRA 3LU6A 3NVIA 3H67A 2Z8JA 2NYMC 2DBUA 3V4YA 2XVVA 1HP1A 2YVTA 3H63A 2BXPA 2WDFA 2HYPA 1AO6A 2BXDA 1MM8A 1KDXA 1OIEA 3THOB 5IIXA 4S1YA 1LNSA 4L9KA 2BDXA 4H2GA 1E78A 3FWCC 1USHA 4J6OA 2DXNA 4H1YP 1S8EA 2KKNA 4LUFA 2Z06A 4MP0A 2Z72A 4O5GA 3LU7A 3H68A 3AUZA 1J7EA 4EMXA 5GINA 4LUHA 3JQZA 1G5BA 3P71C 4V0WA 4LB9A 3SIVB 2LXTA 5J28A 1TXUA 4M70B 2E0XA 3PSNA 1HO5A 3KBPA 2QFPA 1UORA 2XVWA 4Z69A 1BM0A 5JPFA 4TQ0A 3RQZA 3V03A 2I2ZA 5DNYA 4LB2A 4LACC 2WDDA 1M63A 2OT3A 1H5WA 1MUHA 4Z9OA 1J78A 2ZO9B 2R17A 1MIVA 3IB7A 2EFCA 2Z8IA 2NYLC 4ORCA 4J2VA 1E7HA 3G9KD 4I9OA 1W24A 4H2BA 3CX9A 1VZSA 2AHDA 3V09A 4OR0A 2XVQA 2P6BA 3NVKA 4G9JA 4V0VA 1UF3A 4GG2A 3RL4A 2HY1A 4F5UA 3K7WC 5IFOA 2DYMA 2LXSA 4FCXA 4DT2A 4Q7FA 3IB8A 1MA9A 3RL5A 3DSCA 4MBEC 4W4UB 3IVDA 1SB0A 2JUHA 4ZUXV 2NNWA
chains in the Genus database with same CATH topology
1N5UA 3M99C 1S95A 1JNBA 4HGKA 2DXLA 5IJ5A 3JRYA 3H37A 4IL1A 4GDXA 5DQFA 3NVMA 5JJTA 1S70A 1KXPD 3PSOA 2VDBA 1MIWA 3MHHB 4TUGA 4JA9A 1LOTA 2XW1A 1S3LA 2NQOA 3B9LA 4MOVA 4MOYA 4ZBRA 1QFCA 4ORAA 5HOZA 2QM6A 4B2OA 4BY9C 4OT2A 3FWBC 2NXFA 1KBPA 2O8GA 2BXQA 1SU1A 3QFOA 4M0VA 4WWLA 3GQXA 4BKEA 3SQJA 1FOUA 4F0ZA 2XSIA 3H60A 2GJUA 2XW0A 2E0YA 3K7VC 3JYFA 3GA9L 1MIYA 2BXGA 3EGGA 2NPPC 2IE4C 3QG5C 1UTEA 4I5NC 3DW8C 3H62B 4DHLA 2YEQA 3D03A 2VUEA 2IE3C 5DBYA 4N0UD 3N5UA 1HA2A 1NNWA 2BXMA 2BXHA 4G01A 4UT2A 2Z1AA 1OIDA 3E0JA 4UT3B 4O24A 4IW2A 5D7GA 2IAEC 5IJFA 1T70A 3ICXA 2BQ8X 4N3ZA 4DSYA 3WHRA 3THNA 2BXNA 1GNJA 1E7AA 4G03A 4L9QA 4LA0A 1II7A 4FIPB 4GDKB 3H69A 4YKEA 4FBQA 4DHXB 1HK1A 2YDFA 4I5LC 2BXIA 1S3MA 2DG5A 3CK2A 3DSDA 1S3NA 1XM7A 5INBA 1AUIA 1T71A 2V36A 3H64A 4O43A 1NT2B 1E7IA 2KBZA 3W1SA 4HD0A 3QFNA 5GIOA 4ZCGA 3T1IA 4JK4A 4F5TA 4FK5B 4UT3A 2QJCA 4K71A 4FBKA 4GDLB 2ZOAA 2VUFA 3E7AA 5FUOA 2OZBB 4ZX2A 1TCOA 3PLAA 4V0XA 4NZVA 4UWQA 3V08A 2O8AA 2BCDA 4L8UA 2JOGA 4FBWA 2XVUA 5F3WA 3C5WC 4ZBKA 1U32A 5B5TA 3SIUB 4OTUA 5IJEA 3FLOA 3ICFA 1E7FA 5GHKA 3H66A 1WARA 3EGHA 1E7EA 2A22A 4IYPC 2CKXA 1OI8A 4ZBQA 2WDCA 5B8IA 2DFJA 3IVEA 1O9XA 2BX8A 4H2FA 4XPNA 2QHBA 1QHWA 3QFKA 3H61A 3KJLA 2I30A 2Q8UA 3GQUA 5IOHA 4LTYA 3FNMA 4FJCB 1V73A 3ZTVA 3AV0A 3WHSA 5GTUA 4TUIA 3H3AA 2DBXA 4IW1A 3NMUA 2Z8KA 3HVQA 1HK5A 1IT6A 3TDLA 4KBPA 2USHA 4ZVZA 1H9ZA 2EFDA 5C1VA 1E7CA 1KW2A 3A73A 1WAO1 2AJEA 2BXAA 5BPKA 4OR9A 3KIKA 1BKEA 1HK4A 2XMOA 5ID7A 2WDEA 3B9MA 3RL3A 3FGAC 2BXLA 2DBWA 2ZBMA 4LU9A 4G04A 1VFIA 4KKZA 4NAWB 1HK2A 5IIUA 2CV9A 4JA7A 1TF0A 3UIVA 1E7GA 3E7BA 4F5VA 1MF8A 2BXOA 1Z2WA 2BXBA 2QMCA 2LOQA 4HGMB 1IJGA 1E7BA 5GIPA 5JPEA 4ORBA 3MHSB 1JK7A 1GNIA 4TQ1A 1BJ5A 2DYOA 2ROHA 3LL8A 4OTTA 2BXCA 2BXFA 2EFHA 3LU8A 4K2CA 5IIHA 1HK3A 2BXEA 3VQIA 2EFEA 1FJMA 2HYOA 4F5SA 4E99A 3A75A 4H2IA 3TGHA 5HPEA 5ID9A 3GVEA 1HPUA 3WHQA 4WA6B 1Z2XA 3C9FA 1XZWA 2BXKA 5EQVA 4PO0A 4H1SA 3ZU0A 4N0FD 4ZC6A 4O4KA 3QFMA 4C31B 2QFRA 3LU6A 3NVIA 3H67A 2Z8JA 2NYMC 2DBUA 3V4YA 2XVVA 1HP1A 2YVTA 3H63A 2BXPA 2WDFA 2HYPA 1AO6A 2BXDA 1OIEA 3THOB 5IIXA 4S1YA 1LNSA 4L9KA 2BDXA 4H2GA 1E78A 3FWCC 1USHA 4J6OA 2DXNA 4H1YP 1S8EA 2KKNA 4LUFA 2Z06A 4MP0A 2Z72A 4O5GA 3LU7A 3H68A 3AUZA 1J7EA 4EMXA 5GINA 4LUHA 3JQZA 1G5BA 3P71C 4V0WA 4LB9A 3SIVB 5J28A 1TXUA 4M70B 2E0XA 3PSNA 1HO5A 3KBPA 2QFPA 1UORA 2XVWA 4Z69A 1BM0A 5JPFA 4TQ0A 3RQZA 3V03A 2I2ZA 5DNYA 4LB2A 4LACC 2WDDA 1M63A 2OT3A 1H5WA 4Z9OA 1J78A 2ZO9B 2R17A 1MIVA 3IB7A 2EFCA 2Z8IA 2NYLC 4ORCA 4J2VA 1E7HA 3G9KD 4H2BA 1W24A 3CX9A 1VZSA 2AHDA 3V09A 4OR0A 2XVQA 2P6BA 3NVKA 4G9JA 4V0VA 1UF3A 4GG2A 3RL4A 2HY1A 4F5UA 3K7WC 5IFOA 2DYMA 4FCXA 4DT2A 4Q7FA 3IB8A 1MA9A 3RL5A 3DSCA 4MBEC 4W4UB 3IVDA 2JUHA 4ZUXV 2NNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4Y A;  1HP1 A;  1II7 A;  1S95 A;  2YVT A;  5GTU A;  3H63 A;  4TUI A;  2WDF A;  3H69 A;  4YKE A;  2HYP A;  4FBQ A;  1OIE A;  3HVQ A;  3THO B;  1IT6 A;  4I5L C;  4IL1 A;  2BDX A;  4H2G A;  4KBP A;  2USH A;  4ZVZ A;  1S3M A;  1USH A;  5C1V A;  4J6O A;  5JJT A;  1WAO 1;  3CK2 A;  3DSD A;  1S70 A;  1S3N A;  4H1Y P;  1XM7 A;  1S8E A;  3PSO A;  5INB A;  1AUI A;  2KKN A;  4OR9 A;  2Z06 A;  4TUG A;  4JA9 A;  2XMO A;  2Z72 A;  4MP0 A;  1S3L A;  4O5G A;  1T71 A;  4MOV A;  4MOY A;  2WDE A;  1QFC A;  4ORA A;  3H64 A;  3H68 A;  4O43 A;  3AUZ A;  3RL3 A;  3FGA C;  2ZBM A;  4LU9 A;  4B2O A;  1G5B A;  3P71 C;  4HD0 A;  4V0W A;  2NXF A;  1KBP A;  2O8G A;  3QFN A;  3T1I A;  1SU1 A;  5J28 A;  4KKZ A;  3QFO A;  4M0V A;  4UT3 A;  3PSN A;  4WWL A;  1HO5 A;  3KBP A;  2QJC A;  2CV9 A;  4FBK A;  2QFP A;  4JA7 A;  3E7B A;  1MF8 A;  5JPF A;  1Z2W A;  3E7A A;  4F0Z A;  3H60 A;  2GJU A;  3RQZ A;  4ZX2 A;  5JPE A;  4ORB A;  1TCO A;  5DNY A;  4LAC C;  2WDD A;  1JK7 A;  3K7V C;  1M63 A;  4NZV A;  4V0X A;  3LL8 A;  3JYF A;  4UWQ A;  2O8A A;  2BCD A;  2JOG A;  4FBW A;  3EGG A;  2R17 A;  2NPP C;  3IB7 A;  5F3W A;  2IE4 C;  3C5W C;  1UTE A;  3QG5 C;  4I5N C;  2NYL C;  4ORC A;  3DW8 C;  1U32 A;  1FJM A;  4H2B A;  1W24 A;  3H62 B;  4DHL A;  2HYO A;  2AHD A;  2IE3 C;  4H2I A;  3N5U A;  3TGH A;  1NNW A;  3ICF A;  5HPE A;  3H66 A;  1WAR A;  2P6B A;  3GVE A;  3EGH A;  4UT2 A;  2Z1A A;  4G9J A;  4V0V A;  1HPU A;  1UF3 A;  2A22 A;  4IYP C;  3RL4 A;  1OID A;  2HY1 A;  1OI8 A;  3K7W C;  1Z2X A;  3C9F A;  4UT3 B;  1XZW A;  2WDC A;  4O24 A;  5EQV A;  4FCX A;  5B8I A;  4H1S A;  4DT2 A;  2DFJ A;  3IVE A;  4Q7F A;  2IAE C;  3IB8 A;  4H2F A;  4XPN A;  3ZU0 A;  1QHW A;  1T70 A;  3QFK A;  3H61 A;  3RL5 A;  2BQ8 X;  3DSC A;  4O4K A;  2Q8U A;  4DSY A;  3THN A;  3QFM A;  5IOH A;  4LTY A;  2QFR A;  3ZTV A;  1V73 A;  3IVD A;  3H67 A;  3AV0 A;  2NYM C; 
#chains in the Genus database with same CATH topology
 1N5U A;  3M99 C;  1S95 A;  1JNB A;  4HGK A;  2DXL A;  3BPJ A;  5IJ5 A;  3JRY A;  3H37 A;  4IL1 A;  4GDX A;  5DQF A;  3NVM A;  5JJT A;  1S70 A;  1KXP D;  3PSO A;  2VDB A;  1MIW A;  3MHH B;  4TUG A;  4JA9 A;  1LOT A;  2XW1 A;  1S3L A;  2NQO A;  3B9L A;  4MOV A;  4MOY A;  4ZBR A;  1QFC A;  4ORA A;  5HOZ A;  2QM6 A;  4B2O A;  4BY9 C;  4OT2 A;  3FWB C;  2NXF A;  1KBP A;  2O8G A;  1MUS A;  2BXQ A;  1SU1 A;  3QFO A;  4M0V A;  4WWL A;  3GQX A;  4BKE A;  3SQJ A;  1FOU A;  4F0Z A;  2XSI A;  3H60 A;  4D7X A;  2GJU A;  2XW0 A;  2E0Y A;  3K7V C;  3JYF A;  3GA9 L;  1MIY A;  2BXG A;  4DM0 A;  3EGG A;  2NPP C;  2IE4 C;  3QG5 C;  1UTE A;  4I5N C;  3DW8 C;  3H62 B;  4DHL A;  2YEQ A;  3D03 A;  2VUE A;  2IE3 C;  5DBY A;  4N0U D;  3N5U A;  1HA2 A;  1NNW A;  2BXM A;  2BXH A;  4G01 A;  4UT2 A;  2Z1A A;  1OID A;  3E0J A;  4UT3 B;  4O24 A;  4IW2 A;  5D7G A;  2IAE C;  5IJF A;  1T70 A;  3ICX A;  2BQ8 X;  4N3Z A;  4DSY A;  3WHR A;  3THN A;  2BXN A;  1GNJ A;  1E7A A;  4G03 A;  4L9Q A;  4LA0 A;  1II7 A;  4FIP B;  4GDK B;  3H69 A;  4YKE A;  4FBQ A;  4DHX B;  1HK1 A;  2YDF A;  4I5L C;  2BXI A;  1S3M A;  2DG5 A;  3CK2 A;  3DSD A;  1S3N A;  1XM7 A;  5INB A;  1AUI A;  1T71 A;  2V36 A;  3H64 A;  4O43 A;  1NT2 B;  1E7I A;  2KBZ A;  3W1S A;  4HD0 A;  3QFN A;  5GIO A;  4ZCG A;  3T1I A;  4JK4 A;  4F5T A;  4FK5 B;  4UT3 A;  2QJC A;  4K71 A;  4FBK A;  4GDL B;  2ZOA A;  2VUF A;  3E7A A;  5FUO A;  2OZB B;  4ZX2 A;  1TCO A;  3PLA A;  4V0X A;  4NZV A;  4UWQ A;  3V08 A;  2O8A A;  2BCD A;  4L8U A;  2JOG A;  4FBW A;  2XVU A;  5F3W A;  3C5W C;  4ZBK A;  1U32 A;  5B5T A;  3SIU B;  4OTU A;  5IJE A;  3FLO A;  3ICF A;  1E7F A;  5GHK A;  3H66 A;  1WAR A;  3EGH A;  1E7E A;  2LQI A;  2A22 A;  4IYP C;  2CKX A;  1OI8 A;  3ECP A;  4ZBQ A;  2WDC A;  5B8I A;  2GUT A;  2DFJ A;  3IVE A;  1O9X A;  2BX8 A;  4H2F A;  4XPN A;  2QHB A;  1QHW A;  3QFK A;  3H61 A;  3KJL A;  2I30 A;  2Q8U A;  3GQU A;  5IOH A;  4LTY A;  3FNM A;  4FJC B;  1V73 A;  3ZTV A;  3AV0 A;  3WHS A;  5GTU A;  4TUI A;  3H3A A;  2DBX A;  4IW1 A;  3NMU A;  2Z8K A;  3HVQ A;  1HK5 A;  1IT6 A;  3TDL A;  4KBP A;  2USH A;  4ZVZ A;  1H9Z A;  2EFD A;  5C1V A;  1E7C A;  1KW2 A;  3A73 A;  1WAO 1;  2AJE A;  2BXA A;  5BPK A;  4OR9 A;  3KIK A;  1BKE A;  1HK4 A;  2XMO A;  5ID7 A;  2WDE A;  3B9M A;  2LQH A;  3RL3 A;  3FGA C;  2BXL A;  2DBW A;  2ZBM A;  4LU9 A;  4G04 A;  1VFI A;  2K0N A;  4KKZ A;  2AGH B;  4NAW B;  1HK2 A;  5IIU A;  2CV9 A;  4JA7 A;  1TF0 A;  3UIV A;  1E7G A;  3E7B A;  4F5V A;  1MF8 A;  2BXO A;  1Z2W A;  2BXB A;  2QMC A;  2LOQ A;  4HGM B;  1IJG A;  1E7B A;  5GIP A;  5JPE A;  4ORB A;  3MHS B;  1JK7 A;  1GNI A;  4TQ1 A;  1BJ5 A;  2DYO A;  2ROH A;  3LL8 A;  4OTT A;  2BXC A;  2BXF A;  2EFH A;  3LU8 A;  4K2C A;  5IIH A;  1HK3 A;  2BXE A;  3VQI A;  2EFE A;  1FJM A;  2HYO A;  4F5S A;  4E99 A;  3A75 A;  4H2I A;  3TGH A;  5HPE A;  5ID9 A;  3GVE A;  1HPU A;  3WHQ A;  2KWF A;  4WA6 B;  1Z2X A;  3C9F A;  1XZW A;  2BXK A;  5EQV A;  4PO0 A;  4H1S A;  3ZU0 A;  4N0F D;  4ZC6 A;  4O4K A;  3QFM A;  4C31 B;  2QFR A;  3LU6 A;  3NVI A;  3H67 A;  2Z8J A;  2NYM C;  2DBU A;  3V4Y A;  2XVV A;  1HP1 A;  2YVT A;  3H63 A;  2BXP A;  2WDF A;  2HYP A;  1AO6 A;  2BXD A;  1MM8 A;  1KDX A;  1OIE A;  3THO B;  5IIX A;  4S1Y A;  1LNS A;  4L9K A;  2BDX A;  4H2G A;  1E78 A;  3FWC C;  1USH A;  4J6O A;  2DXN A;  4H1Y P;  1S8E A;  2KKN A;  4LUF A;  2Z06 A;  4MP0 A;  2Z72 A;  4O5G A;  3LU7 A;  3H68 A;  3AUZ A;  1J7E A;  4EMX A;  5GIN A;  4LUH A;  3JQZ A;  1G5B A;  3P71 C;  4V0W A;  4LB9 A;  3SIV B;  2LXT A;  5J28 A;  1TXU A;  4M70 B;  2E0X A;  3PSN A;  1HO5 A;  3KBP A;  2QFP A;  1UOR A;  2XVW A;  4Z69 A;  1BM0 A;  5JPF A;  4TQ0 A;  3RQZ A;  3V03 A;  2I2Z A;  5DNY A;  4LB2 A;  4LAC C;  2WDD A;  1M63 A;  2OT3 A;  1H5W A;  1MUH A;  4Z9O A;  1J78 A;  2ZO9 B;  2R17 A;  1MIV A;  3IB7 A;  2EFC A;  2Z8I A;  2NYL C;  4ORC A;  4J2V A;  1E7H A;  3G9K D;  4I9O A;  1W24 A;  4H2B A;  3CX9 A;  1VZS A;  2AHD A;  3V09 A;  4OR0 A;  2XVQ A;  2P6B A;  3NVK A;  4G9J A;  4V0V A;  1UF3 A;  4GG2 A;  3RL4 A;  2HY1 A;  4F5U A;  3K7W C;  5IFO A;  2DYM A;  2LXS A;  4FCX A;  4DT2 A;  4Q7F A;  3IB8 A;  1MA9 A;  3RL5 A;  3DSC A;  4MBE C;  4W4U B;  3IVD A;  1SB0 A;  2JUH A;  4ZUX V;  2NNW A; 
#chains in the Genus database with same CATH homology
 1N5U A;  3M99 C;  1S95 A;  1JNB A;  4HGK A;  2DXL A;  5IJ5 A;  3JRY A;  3H37 A;  4IL1 A;  4GDX A;  5DQF A;  3NVM A;  5JJT A;  1S70 A;  1KXP D;  3PSO A;  2VDB A;  1MIW A;  3MHH B;  4TUG A;  4JA9 A;  1LOT A;  2XW1 A;  1S3L A;  2NQO A;  3B9L A;  4MOV A;  4MOY A;  4ZBR A;  1QFC A;  4ORA A;  5HOZ A;  2QM6 A;  4B2O A;  4BY9 C;  4OT2 A;  3FWB C;  2NXF A;  1KBP A;  2O8G A;  2BXQ A;  1SU1 A;  3QFO A;  4M0V A;  4WWL A;  3GQX A;  4BKE A;  3SQJ A;  1FOU A;  4F0Z A;  2XSI A;  3H60 A;  2GJU A;  2XW0 A;  2E0Y A;  3K7V C;  3JYF A;  3GA9 L;  1MIY A;  2BXG A;  3EGG A;  2NPP C;  2IE4 C;  3QG5 C;  1UTE A;  4I5N C;  3DW8 C;  3H62 B;  4DHL A;  2YEQ A;  3D03 A;  2VUE A;  2IE3 C;  5DBY A;  4N0U D;  3N5U A;  1HA2 A;  1NNW A;  2BXM A;  2BXH A;  4G01 A;  4UT2 A;  2Z1A A;  1OID A;  3E0J A;  4UT3 B;  4O24 A;  4IW2 A;  5D7G A;  2IAE C;  5IJF A;  1T70 A;  3ICX A;  2BQ8 X;  4N3Z A;  4DSY A;  3WHR A;  3THN A;  2BXN A;  1GNJ A;  1E7A A;  4G03 A;  4L9Q A;  4LA0 A;  1II7 A;  4FIP B;  4GDK B;  3H69 A;  4YKE A;  4FBQ A;  4DHX B;  1HK1 A;  2YDF A;  4I5L C;  2BXI A;  1S3M A;  2DG5 A;  3CK2 A;  3DSD A;  1S3N A;  1XM7 A;  5INB A;  1AUI A;  1T71 A;  2V36 A;  3H64 A;  4O43 A;  1NT2 B;  1E7I A;  2KBZ A;  3W1S A;  4HD0 A;  3QFN A;  5GIO A;  4ZCG A;  3T1I A;  4JK4 A;  4F5T A;  4FK5 B;  4UT3 A;  2QJC A;  4K71 A;  4FBK A;  4GDL B;  2ZOA A;  2VUF A;  3E7A A;  5FUO A;  2OZB B;  4ZX2 A;  1TCO A;  3PLA A;  4V0X A;  4NZV A;  4UWQ A;  3V08 A;  2O8A A;  2BCD A;  4L8U A;  2JOG A;  4FBW A;  2XVU A;  5F3W A;  3C5W C;  4ZBK A;  1U32 A;  5B5T A;  3SIU B;  4OTU A;  5IJE A;  3FLO A;  3ICF A;  1E7F A;  5GHK A;  3H66 A;  1WAR A;  3EGH A;  1E7E A;  2A22 A;  4IYP C;  2CKX A;  1OI8 A;  4ZBQ A;  2WDC A;  5B8I A;  2DFJ A;  3IVE A;  1O9X A;  2BX8 A;  4H2F A;  4XPN A;  2QHB A;  1QHW A;  3QFK A;  3H61 A;  3KJL A;  2I30 A;  2Q8U A;  3GQU A;  5IOH A;  4LTY A;  3FNM A;  4FJC B;  1V73 A;  3ZTV A;  3AV0 A;  3WHS A;  5GTU A;  4TUI A;  3H3A A;  2DBX A;  4IW1 A;  3NMU A;  2Z8K A;  3HVQ A;  1HK5 A;  1IT6 A;  3TDL A;  4KBP A;  2USH A;  4ZVZ A;  1H9Z A;  2EFD A;  5C1V A;  1E7C A;  1KW2 A;  3A73 A;  1WAO 1;  2AJE A;  2BXA A;  5BPK A;  4OR9 A;  3KIK A;  1BKE A;  1HK4 A;  2XMO A;  5ID7 A;  2WDE A;  3B9M A;  3RL3 A;  3FGA C;  2BXL A;  2DBW A;  2ZBM A;  4LU9 A;  4G04 A;  1VFI A;  4KKZ A;  4NAW B;  1HK2 A;  5IIU A;  2CV9 A;  4JA7 A;  1TF0 A;  3UIV A;  1E7G A;  3E7B A;  4F5V A;  1MF8 A;  2BXO A;  1Z2W A;  2BXB A;  2QMC A;  2LOQ A;  4HGM B;  1IJG A;  1E7B A;  5GIP A;  5JPE A;  4ORB A;  3MHS B;  1JK7 A;  1GNI A;  4TQ1 A;  1BJ5 A;  2DYO A;  2ROH A;  3LL8 A;  4OTT A;  2BXC A;  2BXF A;  2EFH A;  3LU8 A;  4K2C A;  5IIH A;  1HK3 A;  2BXE A;  3VQI A;  2EFE A;  1FJM A;  2HYO A;  4F5S A;  4E99 A;  3A75 A;  4H2I A;  3TGH A;  5HPE A;  5ID9 A;  3GVE A;  1HPU A;  3WHQ A;  4WA6 B;  1Z2X A;  3C9F A;  1XZW A;  2BXK A;  5EQV A;  4PO0 A;  4H1S A;  3ZU0 A;  4N0F D;  4ZC6 A;  4O4K A;  3QFM A;  4C31 B;  2QFR A;  3LU6 A;  3NVI A;  3H67 A;  2Z8J A;  2NYM C;  2DBU A;  3V4Y A;  2XVV A;  1HP1 A;  2YVT A;  3H63 A;  2BXP A;  2WDF A;  2HYP A;  1AO6 A;  2BXD A;  1OIE A;  3THO B;  5IIX A;  4S1Y A;  1LNS A;  4L9K A;  2BDX A;  4H2G A;  1E78 A;  3FWC C;  1USH A;  4J6O A;  2DXN A;  4H1Y P;  1S8E A;  2KKN A;  4LUF A;  2Z06 A;  4MP0 A;  2Z72 A;  4O5G A;  3LU7 A;  3H68 A;  3AUZ A;  1J7E A;  4EMX A;  5GIN A;  4LUH A;  3JQZ A;  1G5B A;  3P71 C;  4V0W A;  4LB9 A;  3SIV B;  5J28 A;  1TXU A;  4M70 B;  2E0X A;  3PSN A;  1HO5 A;  3KBP A;  2QFP A;  1UOR A;  2XVW A;  4Z69 A;  1BM0 A;  5JPF A;  4TQ0 A;  3RQZ A;  3V03 A;  2I2Z A;  5DNY A;  4LB2 A;  4LAC C;  2WDD A;  1M63 A;  2OT3 A;  1H5W A;  4Z9O A;  1J78 A;  2ZO9 B;  2R17 A;  1MIV A;  3IB7 A;  2EFC A;  2Z8I A;  2NYL C;  4ORC A;  4J2V A;  1E7H A;  3G9K D;  4H2B A;  1W24 A;  3CX9 A;  1VZS A;  2AHD A;  3V09 A;  4OR0 A;  2XVQ A;  2P6B A;  3NVK A;  4G9J A;  4V0V A;  1UF3 A;  4GG2 A;  3RL4 A;  2HY1 A;  4F5U A;  3K7W C;  5IFO A;  2DYM A;  4FCX A;  4DT2 A;  4Q7F A;  3IB8 A;  1MA9 A;  3RL5 A;  3DSC A;  4MBE C;  4W4U B;  3IVD A;  2JUH A;  4ZUX V;  2NNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...