2XMOA

The crystal structure of lmo2642
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
409
Chain Sequence
PIEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYSDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDVKGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of the Lmo2642 Cyclic Nucleotide Phosphodiesterase from Listeria Monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords LMO2642 PROTEIN
total genus 154
structure length 409
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF17839 CNP_C_terminal C-terminal domain of cyclic nucleotide phosphodiesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.180 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2xmoA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2xmoA01
3C5WC 4H2IA 1II7A 3P71C 4WWLA 3EGGA 2WDEA 3C9FA 5JPEA 3RQZA 3K7VC 2Z1AA 4FBQA 4Q7FA 2IE4C 3FGAC 3T1IA 1T71A 2BCDA 2USHA 2HYPA 2JOGA 1QFCA 4V0XA 3TGHA 1WARA 2NPPC 3AV0A 3IB8A 4YKEA 4DT2A 2WDFA 4H1YP 3H68A 1Z2XA 1KBPA 2NYLC 1OI8A 4H2GA 1AUIA 3HVQA 4UT2A 1S3NA 3H66A 4UWQA 5EQVA 3DSCA 4J6OA 2QFRA 4NZVA 3H63A 1NNWA 5IOHA 2O8GA 1HO5A 3H69A 2YVTA 1V73A 1SU1A 2QFPA 1W24A 3H64A 4B2OA 5B8IA 4F0ZA 1FJMA 2Q8UA 4M0VA 2WDDA 4TUGA 1MF8A 3QFNA 3ICFA 4H2BA 1UTEA 1IT6A 5F3WA 4ORBA 4DHLA 3IB7A 3LL8A 2BDXA 3KBPA 4JA9A 1OIDA 3N5UA 1S70A 3RL5A 2AHDA 3V4YA 1TCOA 3DW8C 3RL4A 2P6BA 3QFOA 5GTUA 2Z06A 5INBA 3DSDA 4O43A 4UT3A 4I5NC 3GVEA 2R17A 2A22A 2NYMC 3EGHA 4XPNA 3CK2A 4UT3B 2CV9A 4ZVZA 4FBKA 3RL3A 3THNA 1OIEA 1JK7A 1WAO1 1XZWA 1XM7A 1QHWA 2Z72A 5DNYA 5JJTA 4FBWA 3E7AA 4KKZA 2KKNA 3JYFA 1HP1A 4LU9A 4JA7A 3QG5C 4OR9A 2IE3C 3IVEA 3ZU0A 5J28A 2GJUA 3THOB 1S3MA 4KBPA 5JPFA 1M63A 4DSYA 1S95A 4H2FA 2XMOA 4IL1A 4O5GA 4ORAA 4IYPC 4O24A 2QJCA 4MOYA 3H61A 4LTYA 3H60A 1USHA 4G9JA 3IVDA 3H67A 3PSOA 4ORCA 3K7WC 4O4KA 3QFMA 5C1VA 2BQ8X 2NXFA 3QFKA 4LACC 4V0VA 4FCXA 4MP0A 4MOVA 1U32A 2ZBMA 4H1SA 3AUZA 1G5BA 1UF3A 4ZX2A 3ZTVA 2HY1A 2IAEC 4V0WA 1S3LA 4I5LC 1T70A 2O8AA 1Z2WA 4HD0A 4TUIA 2WDCA 1HPUA 1S8EA 3PSNA 3H62B 2DFJA 5HPEA 2HYOA 3E7BA
chains in the Genus database with same CATH superfamily
1MIYA 4TQ1A 3TDLA 4FBQA 2IE4C 3FGAC 4PO0A 2HYPA 4V0XA 1E7BA 1E7CA 2OT3A 1HK2A 4DT2A 3V08A 3GQXA 2DBXA 3JQZA 2BXFA 4GDXA 4TQ0A 5B5TA 3G9KD 4UT2A 1J7EA 4FK5B 1S3NA 2NNWA 4BKEA 4G03A 3MHSB 2QMCA 1SU1A 1MIVA 5IJEA 4M0VA 2WDDA 3QFNA 1UTEA 4ORBA 3IB7A 1AO6A 3KBPA 5ID9A 2AJEA 5IIUA 3FNMA 3FWBC 5GTUA 4LA0A 4F5VA 2XW1A 4LUHA 3D03A 2NYMC 3EGHA 1IJGA 4ZVZA 2QM6A 1WAO1 2XSIA 2Z72A 4FBWA 1BM0A 3WHQA 2AGHB 3QG5C 3GQUA 2IE3C 5HOZA 3W1SA 5JPFA 4OTTA 1M63A 1S95A 4ORAA 4MOYA 2LXTA 4G9JA 4OT2A 1HK1A 2BXPA 1E7GA 1MUSA 3QFKA 4HGMB 5D7GA 4FCXA 3B9LA 2ZBMA 1GNIA 5IIHA 2XVVA 4GDKB 4LB2A 1UF3A 3LU6A 3ZTVA 2IAEC 4V0WA 1LOTA 4HD0A 1TXUA 2WDCA 1H5WA 1HPUA 1S8EA 1KW2A 1TF0A 4H2IA 2BXAA 1NT2B 3RQZA 3T1IA 2BXIA 2JOGA 2DXNA 3FLOA 3TGHA 4Z69A 1WARA 2NPPC 2CKXA 1J78A 3IB8A 3M99C 2DBWA 1O9XA 2ZOAA 4MBEC 1OI8A 3HVQA 3H66A 5EQVA 1E7EA 4NZVA 3H63A 2BXKA 4ZBRA 2LOQA 3H69A 1V73A 2VUFA 1MUHA 3H64A 2BXLA 2Q8UA 4LUFA 3V09A 1MF8A 3JRYA 1VFIA 4H2BA 2XVQA 4N0FD 2BDXA 4ZCGA 1S70A 5IFOA 1TCOA 3GA9L 1UORA 3LU7A 5ID7A 4O43A 2CV9A 2EFHA 2BXOA 1OIEA 3A73A 2EFDA 4G01A 1XM7A 2LXSA 4KKZA 4OR9A 3IVEA 3ZU0A 5J28A 1E7HA 4DSYA 4IL1A 2XMOA 4O5GA 2DYOA 4IYPC 4Z9OA 4O24A 4LTYA 4ORCA 3K7WC 2EFEA 4GDLB 5C1VA 4MP0A 3AUZA 1G5BA 1E7AA 2HY1A 1KDXA 4F5TA 3H3AA 4TUIA 2DFJA 4DHXB 3C5WC 1II7A 3P71C 3EGGA 2WDEA 3C9FA 5JPEA 2ZO9B 2Z1AA 1MM8A 5DQFA 4HGKA 1T71A 2BCDA 1QFCA 4OR0A 3WHRA 3SQJA 4YKEA 2E0XA 4D7XA 2WDFA 3H68A 4IW2A 2LQIA 2NYLC 4H2GA 1AUIA 3H37A 3DSCA 4FIPB 1NNWA 5DBYA 5GHKA 2QFPA 2KWFA 5GIPA 1FJMA 2GUTA 4TUGA 2Z8IA 1IT6A 5F3WA 1H9ZA 4DHLA 3LL8A 3ECPA 2K0NA 3MHHB 3N5UA 2DXLA 3NMUA 3V4YA 4G04A 2Z06A 5INBA 3PLAA 5IJFA 4I5NC 2VUEA 2A22A 4XPNA 2E0YA 2YDFA 4FBKA 3RL3A 1HA2A 3THNA 2BXGA 2XW0A 4N3ZA 1XZWA 4ZUXV 2KKNA 4FJCB 2I30A 1GNJA 4LU9A 4JA7A 3WHSA 2VDBA 1FOUA 2GJUA 3THOB 4WA6B 1VZSA 3NVMA 4H2FA 3VQIA 5GIOA 2XVUA 2Z8JA 3A75A 3BPJA 2QJCA 1USHA 4K2CA 2BQ8X 4M70B 4N0UD 4V0VA 4MOVA 1BKEA 3LU8A 4H1SA 5IJ5A 4ZBQA 3NVKA 1HK4A 4I5LC 2O8AA 1Z2WA 3PSNA 3H62B 5HPEA 2HYOA 3E7BA 4WWLA 3K7VC 1MA9A 4Q7FA 1HK5A 4LB9A 4W4UB 3CX9A 2YEQA 2DG5A 2USHA 2BXCA 4OTUA 4ZC6A 1SB0A 3AV0A 4L9QA 2EFCA 2OZBB 4H1YP 4BY9C 2DBUA 2BXHA 1Z2XA 1KBPA 2BXNA 4UWQA 5BPKA 4J6OA 2QFRA 3NVIA 5GINA 5IOHA 2O8GA 1HO5A 4F5UA 2YVTA 1E7FA 5B8IA 1W24A 4K71A 4C31B 1N5UA 4EMXA 1MIWA 4L9KA 4B2OA 4F0ZA 2Z8KA 2DYMA 3ICFA 4I9OA 3FWCC 4GG2A 4JA9A 1OIDA 3ICXA 5IIXA 3RL5A 2AHDA 3DW8C 1E7IA 2P6BA 3QFOA 3RL4A 1JNBA 2ROHA 3DSDA 4UT3A 3GVEA 5FUOA 2R17A 4L8UA 2BXBA 3CK2A 4UT3B 2BX8A 2BXEA 1JK7A 3KJLA 1KXPD 4IW1A 2NQOA 1QHWA 3E0JA 5DNYA 5JJTA 3E7AA 3UIVA 3B9MA 3JYFA 1HP1A 1BJ5A 4J2VA 1LNSA 4E99A 1S3MA 4KBPA 2BXQA 4JK4A 3V03A 3KIKA 3SIVB 1E78A 2XVWA 3H61A 3H60A 3IVDA 2BXMA 3H67A 3PSOA 4ZBKA 4NAWB 2QHBA 4O4KA 3QFMA 2V36A 2NXFA 4LACC 4DM0A 1U32A 2BXDA 2I2ZA 4ZX2A 2LQHA 1S3LA 4F5SA 1T70A 2KBZA 4S1YA 3SIUB 2JUHA 1HK3A
chains in the Genus database with same CATH topology
1MIYA 4TQ1A 3TDLA 4FBQA 2IE4C 3FGAC 4PO0A 2HYPA 4V0XA 1E7BA 1E7CA 2OT3A 1HK2A 4DT2A 3V08A 3GQXA 2DBXA 3JQZA 2BXFA 4GDXA 4TQ0A 5B5TA 3G9KD 4UT2A 1J7EA 4FK5B 1S3NA 2NNWA 4BKEA 4G03A 3MHSB 2QMCA 1SU1A 1MIVA 5IJEA 4M0VA 2WDDA 3QFNA 1UTEA 4ORBA 3IB7A 1AO6A 3KBPA 5ID9A 2AJEA 5IIUA 3FNMA 3FWBC 5GTUA 4LA0A 4F5VA 2XW1A 4LUHA 3D03A 2NYMC 3EGHA 1IJGA 4ZVZA 2QM6A 1WAO1 2XSIA 2Z72A 4FBWA 1BM0A 3WHQA 3QG5C 3GQUA 2IE3C 5HOZA 3W1SA 5JPFA 4OTTA 1M63A 1S95A 4ORAA 4MOYA 4G9JA 4OT2A 1HK1A 2BXPA 1E7GA 3QFKA 4HGMB 5D7GA 4FCXA 3B9LA 2ZBMA 1GNIA 5IIHA 2XVVA 4GDKB 4LB2A 1UF3A 3LU6A 3ZTVA 2IAEC 4V0WA 1LOTA 4HD0A 1TXUA 2WDCA 1H5WA 1HPUA 1S8EA 1KW2A 1TF0A 4H2IA 2BXAA 1NT2B 3RQZA 3T1IA 2BXIA 2JOGA 2DXNA 3FLOA 3TGHA 4Z69A 1WARA 2NPPC 2CKXA 1J78A 3IB8A 3M99C 2DBWA 1O9XA 2ZOAA 4MBEC 1OI8A 3HVQA 3H66A 5EQVA 1E7EA 4NZVA 3H63A 2BXKA 4ZBRA 3H69A 2LOQA 1V73A 2VUFA 3H64A 2BXLA 2Q8UA 4LUFA 3V09A 1MF8A 3JRYA 1VFIA 4H2BA 2XVQA 4N0FD 2BDXA 4ZCGA 1S70A 5IFOA 1TCOA 3GA9L 1UORA 3LU7A 5ID7A 4O43A 2CV9A 2EFHA 2BXOA 1OIEA 3A73A 2EFDA 4G01A 1XM7A 4KKZA 4OR9A 3IVEA 3ZU0A 5J28A 1E7HA 4DSYA 4IL1A 2XMOA 4O5GA 2DYOA 4IYPC 4Z9OA 4O24A 4LTYA 4ORCA 3K7WC 2EFEA 4GDLB 5C1VA 4MP0A 3AUZA 1G5BA 1E7AA 2HY1A 4F5TA 3H3AA 4TUIA 2DFJA 4DHXB 3C5WC 1II7A 3P71C 3EGGA 2WDEA 3C9FA 5JPEA 2ZO9B 2Z1AA 5DQFA 4HGKA 1T71A 2BCDA 1QFCA 4OR0A 3WHRA 3SQJA 4YKEA 2E0XA 2WDFA 3H68A 4IW2A 2NYLC 4H2GA 1AUIA 3H37A 3DSCA 4FIPB 1NNWA 5DBYA 5GHKA 2QFPA 5GIPA 1FJMA 4TUGA 2Z8IA 1IT6A 5F3WA 1H9ZA 4DHLA 3LL8A 3MHHB 3N5UA 2DXLA 3NMUA 3V4YA 4G04A 2Z06A 5INBA 3PLAA 5IJFA 4I5NC 2VUEA 2A22A 4XPNA 2E0YA 2YDFA 4FBKA 3RL3A 1HA2A 3THNA 2BXGA 2XW0A 4N3ZA 1XZWA 4ZUXV 2KKNA 4FJCB 2I30A 1GNJA 4LU9A 4JA7A 3WHSA 2VDBA 1FOUA 2GJUA 3THOB 4WA6B 1VZSA 3NVMA 4H2FA 3VQIA 5GIOA 2XVUA 2Z8JA 3A75A 2QJCA 1USHA 4K2CA 2BQ8X 4M70B 4N0UD 4V0VA 4MOVA 1BKEA 3LU8A 4H1SA 5IJ5A 4ZBQA 3NVKA 1HK4A 4I5LC 2O8AA 1Z2WA 3PSNA 3H62B 5HPEA 2HYOA 3E7BA 4WWLA 3K7VC 1MA9A 4Q7FA 1HK5A 4LB9A 4W4UB 3CX9A 2YEQA 2DG5A 2USHA 2BXCA 4OTUA 4ZC6A 3AV0A 4L9QA 2EFCA 2OZBB 4H1YP 4BY9C 2DBUA 2BXHA 1Z2XA 1KBPA 2BXNA 4UWQA 5BPKA 4J6OA 2QFRA 3NVIA 5GINA 5IOHA 2O8GA 1HO5A 4F5UA 2YVTA 1E7FA 5B8IA 1W24A 4K71A 4C31B 1N5UA 4EMXA 1MIWA 4L9KA 4B2OA 4F0ZA 2Z8KA 2DYMA 3ICFA 3FWCC 4GG2A 4JA9A 1OIDA 3ICXA 5IIXA 3RL5A 2AHDA 3DW8C 1E7IA 2P6BA 3QFOA 3RL4A 1JNBA 2ROHA 3DSDA 4UT3A 3GVEA 5FUOA 2R17A 4L8UA 2BXBA 3CK2A 4UT3B 2BX8A 2BXEA 1JK7A 3KJLA 1KXPD 4IW1A 2NQOA 1QHWA 3E0JA 5DNYA 5JJTA 3E7AA 3UIVA 3B9MA 3JYFA 1HP1A 1BJ5A 4J2VA 1LNSA 4E99A 1S3MA 4KBPA 2BXQA 4JK4A 3V03A 3KIKA 3SIVB 1E78A 2XVWA 3H61A 3H60A 3IVDA 2BXMA 3H67A 3PSOA 4ZBKA 4NAWB 2QHBA 4O4KA 3QFMA 2V36A 2NXFA 4LACC 1U32A 2BXDA 2I2ZA 4ZX2A 1S3LA 4F5SA 1T70A 2KBZA 4S1YA 3SIUB 2JUHA 1HK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5W C;  4H2I A;  1II7 A;  3P71 C;  4WWL A;  3EGG A;  2WDE A;  3C9F A;  5JPE A;  3RQZ A;  3K7V C;  2Z1A A;  4FBQ A;  4Q7F A;  2IE4 C;  3FGA C;  3T1I A;  1T71 A;  2BCD A;  2USH A;  2HYP A;  2JOG A;  1QFC A;  4V0X A;  3TGH A;  1WAR A;  2NPP C;  3AV0 A;  3IB8 A;  4YKE A;  4DT2 A;  2WDF A;  4H1Y P;  3H68 A;  1Z2X A;  1KBP A;  2NYL C;  1OI8 A;  4H2G A;  1AUI A;  3HVQ A;  4UT2 A;  1S3N A;  3H66 A;  4UWQ A;  5EQV A;  3DSC A;  4J6O A;  2QFR A;  4NZV A;  3H63 A;  1NNW A;  5IOH A;  2O8G A;  1HO5 A;  3H69 A;  2YVT A;  1V73 A;  1SU1 A;  2QFP A;  1W24 A;  3H64 A;  4B2O A;  5B8I A;  4F0Z A;  1FJM A;  2Q8U A;  4M0V A;  2WDD A;  4TUG A;  1MF8 A;  3QFN A;  3ICF A;  4H2B A;  1UTE A;  1IT6 A;  5F3W A;  4ORB A;  4DHL A;  3IB7 A;  3LL8 A;  2BDX A;  3KBP A;  4JA9 A;  1OID A;  3N5U A;  1S70 A;  3RL5 A;  2AHD A;  3V4Y A;  1TCO A;  3DW8 C;  3RL4 A;  2P6B A;  3QFO A;  5GTU A;  2Z06 A;  5INB A;  3DSD A;  4O43 A;  4UT3 A;  4I5N C;  3GVE A;  2R17 A;  2A22 A;  2NYM C;  3EGH A;  4XPN A;  3CK2 A;  4UT3 B;  2CV9 A;  4ZVZ A;  4FBK A;  3RL3 A;  3THN A;  1OIE A;  1JK7 A;  1WAO 1;  1XZW A;  1XM7 A;  1QHW A;  2Z72 A;  5DNY A;  5JJT A;  4FBW A;  3E7A A;  4KKZ A;  2KKN A;  3JYF A;  1HP1 A;  4LU9 A;  4JA7 A;  3QG5 C;  4OR9 A;  2IE3 C;  3IVE A;  3ZU0 A;  5J28 A;  2GJU A;  3THO B;  1S3M A;  4KBP A;  5JPF A;  1M63 A;  4DSY A;  1S95 A;  4H2F A;  2XMO A;  4IL1 A;  4O5G A;  4ORA A;  4IYP C;  4O24 A;  2QJC A;  4MOY A;  3H61 A;  4LTY A;  3H60 A;  1USH A;  4G9J A;  3IVD A;  3H67 A;  3PSO A;  4ORC A;  3K7W C;  4O4K A;  3QFM A;  5C1V A;  2BQ8 X;  2NXF A;  3QFK A;  4LAC C;  4V0V A;  4FCX A;  4MP0 A;  4MOV A;  1U32 A;  2ZBM A;  4H1S A;  3AUZ A;  1G5B A;  1UF3 A;  4ZX2 A;  3ZTV A;  2HY1 A;  2IAE C;  4V0W A;  1S3L A;  4I5L C;  1T70 A;  2O8A A;  1Z2W A;  4HD0 A;  4TUI A;  2WDC A;  1HPU A;  1S8E A;  3PSN A;  3H62 B;  2DFJ A;  5HPE A;  2HYO A;  3E7B A; 
#chains in the Genus database with same CATH topology
 1MIY A;  4TQ1 A;  3TDL A;  4FBQ A;  2IE4 C;  3FGA C;  4PO0 A;  2HYP A;  4V0X A;  1E7B A;  1E7C A;  2OT3 A;  1HK2 A;  4DT2 A;  3V08 A;  3GQX A;  2DBX A;  3JQZ A;  2BXF A;  4GDX A;  4TQ0 A;  5B5T A;  3G9K D;  4UT2 A;  1J7E A;  4FK5 B;  1S3N A;  2NNW A;  4BKE A;  4G03 A;  3MHS B;  2QMC A;  1SU1 A;  1MIV A;  5IJE A;  4M0V A;  2WDD A;  3QFN A;  1UTE A;  4ORB A;  3IB7 A;  1AO6 A;  3KBP A;  5ID9 A;  2AJE A;  5IIU A;  3FNM A;  3FWB C;  5GTU A;  4LA0 A;  4F5V A;  2XW1 A;  4LUH A;  3D03 A;  2NYM C;  3EGH A;  1IJG A;  4ZVZ A;  2QM6 A;  1WAO 1;  2XSI A;  2Z72 A;  4FBW A;  1BM0 A;  3WHQ A;  2AGH B;  3QG5 C;  3GQU A;  2IE3 C;  5HOZ A;  3W1S A;  5JPF A;  4OTT A;  1M63 A;  1S95 A;  4ORA A;  4MOY A;  2LXT A;  4G9J A;  4OT2 A;  1HK1 A;  2BXP A;  1E7G A;  1MUS A;  3QFK A;  4HGM B;  5D7G A;  4FCX A;  3B9L A;  2ZBM A;  1GNI A;  5IIH A;  2XVV A;  4GDK B;  4LB2 A;  1UF3 A;  3LU6 A;  3ZTV A;  2IAE C;  4V0W A;  1LOT A;  4HD0 A;  1TXU A;  2WDC A;  1H5W A;  1HPU A;  1S8E A;  1KW2 A;  1TF0 A;  4H2I A;  2BXA A;  1NT2 B;  3RQZ A;  3T1I A;  2BXI A;  2JOG A;  2DXN A;  3FLO A;  3TGH A;  4Z69 A;  1WAR A;  2NPP C;  2CKX A;  1J78 A;  3IB8 A;  3M99 C;  2DBW A;  1O9X A;  2ZOA A;  4MBE C;  1OI8 A;  3HVQ A;  3H66 A;  5EQV A;  1E7E A;  4NZV A;  3H63 A;  2BXK A;  4ZBR A;  2LOQ A;  3H69 A;  1V73 A;  2VUF A;  1MUH A;  3H64 A;  2BXL A;  2Q8U A;  4LUF A;  3V09 A;  1MF8 A;  3JRY A;  1VFI A;  4H2B A;  2XVQ A;  4N0F D;  2BDX A;  4ZCG A;  1S70 A;  5IFO A;  1TCO A;  3GA9 L;  1UOR A;  3LU7 A;  5ID7 A;  4O43 A;  2CV9 A;  2EFH A;  2BXO A;  1OIE A;  3A73 A;  2EFD A;  4G01 A;  1XM7 A;  2LXS A;  4KKZ A;  4OR9 A;  3IVE A;  3ZU0 A;  5J28 A;  1E7H A;  4DSY A;  4IL1 A;  2XMO A;  4O5G A;  2DYO A;  4IYP C;  4Z9O A;  4O24 A;  4LTY A;  4ORC A;  3K7W C;  2EFE A;  4GDL B;  5C1V A;  4MP0 A;  3AUZ A;  1G5B A;  1E7A A;  2HY1 A;  1KDX A;  4F5T A;  3H3A A;  4TUI A;  2DFJ A;  4DHX B;  3C5W C;  1II7 A;  3P71 C;  3EGG A;  2WDE A;  3C9F A;  5JPE A;  2ZO9 B;  2Z1A A;  1MM8 A;  5DQF A;  4HGK A;  1T71 A;  2BCD A;  1QFC A;  4OR0 A;  3WHR A;  3SQJ A;  4YKE A;  2E0X A;  4D7X A;  2WDF A;  3H68 A;  4IW2 A;  2LQI A;  2NYL C;  4H2G A;  1AUI A;  3H37 A;  3DSC A;  4FIP B;  1NNW A;  5DBY A;  5GHK A;  2QFP A;  2KWF A;  5GIP A;  1FJM A;  2GUT A;  4TUG A;  2Z8I A;  1IT6 A;  5F3W A;  1H9Z A;  4DHL A;  3LL8 A;  3ECP A;  2K0N A;  3MHH B;  3N5U A;  2DXL A;  3NMU A;  3V4Y A;  4G04 A;  2Z06 A;  5INB A;  3PLA A;  5IJF A;  4I5N C;  2VUE A;  2A22 A;  4XPN A;  2E0Y A;  2YDF A;  4FBK A;  3RL3 A;  1HA2 A;  3THN A;  2BXG A;  2XW0 A;  4N3Z A;  1XZW A;  4ZUX V;  2KKN A;  4FJC B;  2I30 A;  1GNJ A;  4LU9 A;  4JA7 A;  3WHS A;  2VDB A;  1FOU A;  2GJU A;  3THO B;  4WA6 B;  1VZS A;  3NVM A;  4H2F A;  3VQI A;  5GIO A;  2XVU A;  2Z8J A;  3A75 A;  3BPJ A;  2QJC A;  1USH A;  4K2C A;  2BQ8 X;  4M70 B;  4N0U D;  4V0V A;  4MOV A;  1BKE A;  3LU8 A;  4H1S A;  5IJ5 A;  4ZBQ A;  3NVK A;  1HK4 A;  4I5L C;  2O8A A;  1Z2W A;  3PSN A;  3H62 B;  5HPE A;  2HYO A;  3E7B A;  4WWL A;  3K7V C;  1MA9 A;  4Q7F A;  1HK5 A;  4LB9 A;  4W4U B;  3CX9 A;  2YEQ A;  2DG5 A;  2USH A;  2BXC A;  4OTU A;  4ZC6 A;  1SB0 A;  3AV0 A;  4L9Q A;  2EFC A;  2OZB B;  4H1Y P;  4BY9 C;  2DBU A;  2BXH A;  1Z2X A;  1KBP A;  2BXN A;  4UWQ A;  5BPK A;  4J6O A;  2QFR A;  3NVI A;  5GIN A;  5IOH A;  2O8G A;  1HO5 A;  4F5U A;  2YVT A;  1E7F A;  5B8I A;  1W24 A;  4K71 A;  4C31 B;  1N5U A;  4EMX A;  1MIW A;  4L9K A;  4B2O A;  4F0Z A;  2Z8K A;  2DYM A;  3ICF A;  4I9O A;  3FWC C;  4GG2 A;  4JA9 A;  1OID A;  3ICX A;  5IIX A;  3RL5 A;  2AHD A;  3DW8 C;  1E7I A;  2P6B A;  3QFO A;  3RL4 A;  1JNB A;  2ROH A;  3DSD A;  4UT3 A;  3GVE A;  5FUO A;  2R17 A;  4L8U A;  2BXB A;  3CK2 A;  4UT3 B;  2BX8 A;  2BXE A;  1JK7 A;  3KJL A;  1KXP D;  4IW1 A;  2NQO A;  1QHW A;  3E0J A;  5DNY A;  5JJT A;  3E7A A;  3UIV A;  3B9M A;  3JYF A;  1HP1 A;  1BJ5 A;  4J2V A;  1LNS A;  4E99 A;  1S3M A;  4KBP A;  2BXQ A;  4JK4 A;  3V03 A;  3KIK A;  3SIV B;  1E78 A;  2XVW A;  3H61 A;  3H60 A;  3IVD A;  2BXM A;  3H67 A;  3PSO A;  4ZBK A;  4NAW B;  2QHB A;  4O4K A;  3QFM A;  2V36 A;  2NXF A;  4LAC C;  4DM0 A;  1U32 A;  2BXD A;  2I2Z A;  4ZX2 A;  2LQH A;  1S3L A;  4F5S A;  1T70 A;  2KBZ A;  4S1Y A;  3SIU B;  2JUH A;  1HK3 A; 
#chains in the Genus database with same CATH homology
 1MIY A;  4TQ1 A;  3TDL A;  4FBQ A;  2IE4 C;  3FGA C;  4PO0 A;  2HYP A;  4V0X A;  1E7B A;  1E7C A;  2OT3 A;  1HK2 A;  4DT2 A;  3V08 A;  3GQX A;  2DBX A;  3JQZ A;  2BXF A;  4GDX A;  4TQ0 A;  5B5T A;  3G9K D;  4UT2 A;  1J7E A;  4FK5 B;  1S3N A;  2NNW A;  4BKE A;  4G03 A;  3MHS B;  2QMC A;  1SU1 A;  1MIV A;  5IJE A;  4M0V A;  2WDD A;  3QFN A;  1UTE A;  4ORB A;  3IB7 A;  1AO6 A;  3KBP A;  5ID9 A;  2AJE A;  5IIU A;  3FNM A;  3FWB C;  5GTU A;  4LA0 A;  4F5V A;  2XW1 A;  4LUH A;  3D03 A;  2NYM C;  3EGH A;  1IJG A;  4ZVZ A;  2QM6 A;  1WAO 1;  2XSI A;  2Z72 A;  4FBW A;  1BM0 A;  3WHQ A;  3QG5 C;  3GQU A;  2IE3 C;  5HOZ A;  3W1S A;  5JPF A;  4OTT A;  1M63 A;  1S95 A;  4ORA A;  4MOY A;  4G9J A;  4OT2 A;  1HK1 A;  2BXP A;  1E7G A;  3QFK A;  4HGM B;  5D7G A;  4FCX A;  3B9L A;  2ZBM A;  1GNI A;  5IIH A;  2XVV A;  4GDK B;  4LB2 A;  1UF3 A;  3LU6 A;  3ZTV A;  2IAE C;  4V0W A;  1LOT A;  4HD0 A;  1TXU A;  2WDC A;  1H5W A;  1HPU A;  1S8E A;  1KW2 A;  1TF0 A;  4H2I A;  2BXA A;  1NT2 B;  3RQZ A;  3T1I A;  2BXI A;  2JOG A;  2DXN A;  3FLO A;  3TGH A;  4Z69 A;  1WAR A;  2NPP C;  2CKX A;  1J78 A;  3IB8 A;  3M99 C;  2DBW A;  1O9X A;  2ZOA A;  4MBE C;  1OI8 A;  3HVQ A;  3H66 A;  5EQV A;  1E7E A;  4NZV A;  3H63 A;  2BXK A;  4ZBR A;  3H69 A;  2LOQ A;  1V73 A;  2VUF A;  3H64 A;  2BXL A;  2Q8U A;  4LUF A;  3V09 A;  1MF8 A;  3JRY A;  1VFI A;  4H2B A;  2XVQ A;  4N0F D;  2BDX A;  4ZCG A;  1S70 A;  5IFO A;  1TCO A;  3GA9 L;  1UOR A;  3LU7 A;  5ID7 A;  4O43 A;  2CV9 A;  2EFH A;  2BXO A;  1OIE A;  3A73 A;  2EFD A;  4G01 A;  1XM7 A;  4KKZ A;  4OR9 A;  3IVE A;  3ZU0 A;  5J28 A;  1E7H A;  4DSY A;  4IL1 A;  2XMO A;  4O5G A;  2DYO A;  4IYP C;  4Z9O A;  4O24 A;  4LTY A;  4ORC A;  3K7W C;  2EFE A;  4GDL B;  5C1V A;  4MP0 A;  3AUZ A;  1G5B A;  1E7A A;  2HY1 A;  4F5T A;  3H3A A;  4TUI A;  2DFJ A;  4DHX B;  3C5W C;  1II7 A;  3P71 C;  3EGG A;  2WDE A;  3C9F A;  5JPE A;  2ZO9 B;  2Z1A A;  5DQF A;  4HGK A;  1T71 A;  2BCD A;  1QFC A;  4OR0 A;  3WHR A;  3SQJ A;  4YKE A;  2E0X A;  2WDF A;  3H68 A;  4IW2 A;  2NYL C;  4H2G A;  1AUI A;  3H37 A;  3DSC A;  4FIP B;  1NNW A;  5DBY A;  5GHK A;  2QFP A;  5GIP A;  1FJM A;  4TUG A;  2Z8I A;  1IT6 A;  5F3W A;  1H9Z A;  4DHL A;  3LL8 A;  3MHH B;  3N5U A;  2DXL A;  3NMU A;  3V4Y A;  4G04 A;  2Z06 A;  5INB A;  3PLA A;  5IJF A;  4I5N C;  2VUE A;  2A22 A;  4XPN A;  2E0Y A;  2YDF A;  4FBK A;  3RL3 A;  1HA2 A;  3THN A;  2BXG A;  2XW0 A;  4N3Z A;  1XZW A;  4ZUX V;  2KKN A;  4FJC B;  2I30 A;  1GNJ A;  4LU9 A;  4JA7 A;  3WHS A;  2VDB A;  1FOU A;  2GJU A;  3THO B;  4WA6 B;  1VZS A;  3NVM A;  4H2F A;  3VQI A;  5GIO A;  2XVU A;  2Z8J A;  3A75 A;  2QJC A;  1USH A;  4K2C A;  2BQ8 X;  4M70 B;  4N0U D;  4V0V A;  4MOV A;  1BKE A;  3LU8 A;  4H1S A;  5IJ5 A;  4ZBQ A;  3NVK A;  1HK4 A;  4I5L C;  2O8A A;  1Z2W A;  3PSN A;  3H62 B;  5HPE A;  2HYO A;  3E7B A;  4WWL A;  3K7V C;  1MA9 A;  4Q7F A;  1HK5 A;  4LB9 A;  4W4U B;  3CX9 A;  2YEQ A;  2DG5 A;  2USH A;  2BXC A;  4OTU A;  4ZC6 A;  3AV0 A;  4L9Q A;  2EFC A;  2OZB B;  4H1Y P;  4BY9 C;  2DBU A;  2BXH A;  1Z2X A;  1KBP A;  2BXN A;  4UWQ A;  5BPK A;  4J6O A;  2QFR A;  3NVI A;  5GIN A;  5IOH A;  2O8G A;  1HO5 A;  4F5U A;  2YVT A;  1E7F A;  5B8I A;  1W24 A;  4K71 A;  4C31 B;  1N5U A;  4EMX A;  1MIW A;  4L9K A;  4B2O A;  4F0Z A;  2Z8K A;  2DYM A;  3ICF A;  3FWC C;  4GG2 A;  4JA9 A;  1OID A;  3ICX A;  5IIX A;  3RL5 A;  2AHD A;  3DW8 C;  1E7I A;  2P6B A;  3QFO A;  3RL4 A;  1JNB A;  2ROH A;  3DSD A;  4UT3 A;  3GVE A;  5FUO A;  2R17 A;  4L8U A;  2BXB A;  3CK2 A;  4UT3 B;  2BX8 A;  2BXE A;  1JK7 A;  3KJL A;  1KXP D;  4IW1 A;  2NQO A;  1QHW A;  3E0J A;  5DNY A;  5JJT A;  3E7A A;  3UIV A;  3B9M A;  3JYF A;  1HP1 A;  1BJ5 A;  4J2V A;  1LNS A;  4E99 A;  1S3M A;  4KBP A;  2BXQ A;  4JK4 A;  3V03 A;  3KIK A;  3SIV B;  1E78 A;  2XVW A;  3H61 A;  3H60 A;  3IVD A;  2BXM A;  3H67 A;  3PSO A;  4ZBK A;  4NAW B;  2QHB A;  4O4K A;  3QFM A;  2V36 A;  2NXF A;  4LAC C;  1U32 A;  2BXD A;  2I2Z A;  4ZX2 A;  1S3L A;  4F5S A;  1T70 A;  2KBZ A;  4S1Y A;  3SIU B;  2JUH A;  1HK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...