2XMOA

The crystal structure of lmo2642
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
409
Chain Sequence
PIEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYSDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDVKGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of the Lmo2642 Cyclic Nucleotide Phosphodiesterase from Listeria Monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords LMO2642 PROTEIN
total genus 154
structure length 409
sequence length 411
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF17839 CNP_C_terminal C-terminal domain of cyclic nucleotide phosphodiesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.180 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2xmoA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2xmoA01
3DSCA 3N5UA 3K7VC 3THNA 1OI8A 2QJCA 5JJTA 5C1VA 1WARA 4DT2A 3DSDA 4WWLA 3EGGA 1T70A 1G5BA 3RL5A 3AV0A 4V0WA 4LACC 3E7BA 3QG5C 4XPNA 1II7A 2WDDA 2WDFA 1V73A 1SU1A 4B2OA 4OR9A 4MOVA 4DSYA 3H61A 1HP1A 2AHDA 1HPUA 1UF3A 3THOB 4ZVZA 3IB7A 4UT3A 2BQ8X 2KKNA 4O43A 3ZU0A 3DW8C 3EGHA 4I5LC 1T71A 4LU9A 1HO5A 2XMOA 3QFMA 5JPFA 1USHA 2HY1A 3QFKA 2Z1AA 1S3LA 5EQVA 1OIDA 4MP0A 1OIEA 4F0ZA 1JK7A 2Z06A 2NXFA 4H1YP 3ZTVA 1S8EA 2IE4C 4FBWA 3HVQA 3T1IA 2ZBMA 2QFRA 4J6OA 4UT3B 5JPEA 2O8GA 2IAEC 4NZVA 5J28A 4FCXA 1S70A 2DFJA 4KKZA 5IOHA 2R17A 2GJUA 3C9FA 4FBQA 4Q7FA 5GTUA 3JYFA 5B8IA 4TUGA 3CK2A 4MOYA 4O24A 5INBA 2IE3C 4H2IA 2WDEA 2YVTA 2Z72A 3P71C 4I5NC 1QFCA 2O8AA 3QFNA 3GVEA 4M0VA 4V0XA 1AUIA 1Z2WA 1MF8A 3RQZA 1NNWA 2HYOA 3LL8A 1S95A 3KBPA 1S3NA 2CV9A 4JA9A 2HYPA 2BDXA 2WDCA 3PSOA 3QFOA 4G9JA 4HD0A 1UTEA 4H2GA 4IYPC 1U32A 3H60A 1FJMA 3H67A 4ORBA 3H69A 3RL4A 3V4YA 1XM7A 3AUZA 3H64A 2Q8UA 4FBKA 5HPEA 4ORAA 4V0VA 4ZX2A 2NPPC 2NYLC 4IL1A 3PSNA 3IVDA 4JA7A 4YKEA 3FGAC 2P6BA 3TGHA 2QFPA 1WAO1 3K7WC 3IVEA 4H1SA 1KBPA 5DNYA 4UWQA 4LTYA 3IB8A 3ICFA 4ORCA 1S3MA 1QHWA 1IT6A 2A22A 1W24A 3RL3A 2JOGA 1Z2XA 4H2FA 4O4KA 2BCDA 4O5GA 3E7AA 1M63A 4UT2A 1XZWA 5F3WA 4H2BA 3C5WC 4KBPA 4DHLA 1TCOA 2NYMC 3H63A 3H66A 2USHA 3H68A 3H62B 4TUIA
chains in the Genus database with same CATH superfamily
2CKXA 2VUEA 1KW2A 5C1VA 4V0WA 1HK3A 3A73A 3E7BA 1V73A 2BXDA 3FNMA 4DSYA 3SQJA 2JUHA 4LB2A 4UT3A 1MIWA 2EFHA 4O43A 1O9XA 2Z8JA 3ZU0A 1HO5A 5BPKA 1USHA 2HY1A 2LQHA 4F5TA 1NT2B 5ID9A 1UORA 5EQVA 4C31B 3MHSB 1OIEA 3ZTVA 2IE4C 2QM6A 2XVWA 2ZBMA 4NZVA 2DG5A 5J28A 2DFJA 1MUHA 4KKZA 2GJUA 4HGMB 3JYFA 5GTUA 2E0XA 4DHXB 5ID7A 1BKEA 2IE3C 2WDEA 2OZBB 1E7FA 4I5NC 3ICXA 1QFCA 3NVIA 1MUSA 3GVEA 4F5SA 1Z2WA 1MF8A 2XW1A 4LA0A 3CX9A 2HYOA 3W1SA 3KBPA 3LL8A 2BXGA 2WDCA 3PSOA 4G9JA 4HD0A 1UTEA 1N5UA 2K0NA 4ZBQA 3RL4A 3V4YA 1XM7A 3AUZA 3H64A 2Q8UA 5HPEA 2NYLC 4IL1A 3WHRA 3D03A 3K7WC 1SB0A 4H1SA 1KBPA 2Z8KA 4UWQA 5DNYA 4G01A 4G04A 4ORCA 1QHWA 1E7CA 2ROHA 3RL3A 4FK5B 2VDBA 1LOTA 1E7BA 4O4KA 1BM0A 3NMUA 1FOUA 2DBXA 4K71A 1E7AA 4KBPA 4TQ0A 1HK2A 2NYMC 4DHLA 4S1YA 4LACC 2EFDA 3N5UA 2QJCA 2V36A 3EGGA 1T70A 2AJEA 3AV0A 4GDKB 1II7A 1AO6A 3FWBC 1J7EA 4HGKA 4OR9A 2I2ZA 1HP1A 3NVMA 1HPUA 4N0FD 1HK5A 5D7GA 2LXTA 4LU9A 5JPFA 2DBUA 3QFKA 5GHKA 1JK7A 3SIUB 4DM0A 4J6OA 2O8GA 4ZC6A 2R17A 4Q7FA 4FBQA 3B9MA 3E0JA 5B8IA 4TUGA 3CK2A 5INBA 4GDLB 2Z72A 3WHSA 2GUTA 1HK1A 5DBYA 4F5VA 4V0XA 3KJLA 2BXBA 2BXIA 4N3ZA 4H2GA 4OTUA 4ZBKA 1MIVA 4IW2A 2ZO9B 1E7GA 2NPPC 1E78A 2P6BA 3TGHA 1WAO1 3IB8A 3ICFA 4BY9C 2BXFA 4OT2A 1IT6A 3GQUA 5FUOA 1W24A 5IJ5A 4EMXA 1Z2XA 1H5WA 5IIUA 2EFEA 3NVKA 4OTTA 1XZWA 5F3WA 4H2BA 3V03A 3H62B 3DSCA 3K7VC 3THNA 5JJTA 4DT2A 3FWCC 1G5BA 1GNJA 3QG5C 1HA2A 2WDDA 1SU1A 1KXPD 3WHQA 2KWFA 1HK4A 4LB9A 4MOVA 5B5TA 4L8UA 3KIKA 1UF3A 3GQXA 5IIHA 3FLOA 3IB7A 3ECPA 2EFCA 3DW8C 3EGHA 4I5LC 1E7HA 2XMOA 2BX8A 4ZCGA 2VUFA 4BKEA 4F5UA 1OIDA 4F0ZA 2BXCA 2XW0A 2Z06A 1LNSA 5GIOA 2NXFA 4H1YP 4FBWA 3HVQA 3T1IA 4UT3B 3GA9L 4FJCB 2IAEC 4FCXA 1S70A 2BXHA 4L9KA 4L9QA 5IOHA 2NNWA 3PLAA 3JQZA 1VFIA 2KBZA 3LU8A 4OR0A 2YVTA 2QHBA 2BXPA 3QFNA 4M0VA 1AUIA 2BXAA 2BXOA 2CV9A 2XVQA 4IW1A 4E99A 3QFOA 4MBEC 3H60A 5IJFA 2LXSA 2BXMA 4ORAA 4V0VA 3LU7A 2E0YA 3FGAC 4W4UB 5IIXA 3TDLA 2DBWA 1S3MA 3B9LA 2A22A 3SIVB 3MHHB 1MM8A 4H2FA 2BCDA 4K2CA 4UT2A 4LUHA 4ZBRA 3G9KD 3H66A 2USHA 2YDFA 4TUIA 4D7XA 4Z9OA 1OI8A 3DSDA 1WARA 3UIVA 4WWLA 4ZUXV 3RL5A 1IJGA 4XPNA 2WDFA 5GINA 4B2OA 2DYMA 4J2VA 2BXNA 1E7EA 2Z8IA 2AHDA 3H61A 2XSIA 1MIYA 3THOB 4ZVZA 2BQ8X 2KKNA 2BXLA 1J78A 1T71A 3QFMA 4PO0A 3M99C 2BXEA 2Z1AA 1S3LA 3H37A 3VQIA 4MP0A 4GDXA 3JRYA 2YEQA 1E7IA 1S8EA 2XVUA 5JPEA 2QFRA 4I9OA 4TQ1A 1BJ5A 2DYOA 2XVVA 3LU6A 3C9FA 5IJEA 2QMCA 2BXKA 4O24A 4MOYA 3V08A 3V09A 4H2IA 2AGHB 4Z69A 1TXUA 3P71C 3H3AA 1MA9A 2O8AA 4JK4A 1KDXA 3RQZA 4NAWB 1NNWA 4N0UD 1S95A 1S3NA 4JA9A 2HYPA 2BDXA 4IYPC 4FIPB 2BXQA 5HOZA 1U32A 1FJMA 3H67A 4ORBA 3H69A 2NQOA 4WA6B 4FBKA 1H9ZA 2OT3A 3BPJA 4ZX2A 2I30A 2ZOAA 5GIPA 3PSNA 3IVDA 4JA7A 4YKEA 2LQIA 4GG2A 2QFPA 3IVEA 4M70B 3H68A 4LTYA 2DXNA 2DXLA 2JOGA 2LOQA 1VZSA 4G03A 5IFOA 4O5GA 1JNBA 3E7AA 1M63A 5DQFA 3C5WC 1GNIA 1TF0A 1TCOA 3H63A 3A75A 4LUFA
chains in the Genus database with same CATH topology
2CKXA 2VUEA 1KW2A 5C1VA 4V0WA 1HK3A 3A73A 3E7BA 1V73A 2BXDA 3FNMA 4DSYA 3SQJA 2JUHA 4LB2A 4UT3A 1MIWA 2EFHA 4O43A 1O9XA 2Z8JA 3ZU0A 1HO5A 5BPKA 1USHA 2HY1A 4F5TA 1NT2B 5ID9A 1UORA 5EQVA 4C31B 3MHSB 1OIEA 3ZTVA 2IE4C 2QM6A 2XVWA 2ZBMA 4NZVA 2DG5A 5J28A 2DFJA 4KKZA 2GJUA 4HGMB 3JYFA 5GTUA 2E0XA 4DHXB 5ID7A 1BKEA 2IE3C 2WDEA 2OZBB 1E7FA 4I5NC 3ICXA 1QFCA 3NVIA 3GVEA 4F5SA 1Z2WA 1MF8A 2XW1A 4LA0A 3CX9A 2HYOA 3W1SA 3KBPA 3LL8A 2BXGA 2WDCA 3PSOA 4G9JA 4HD0A 1UTEA 1N5UA 4ZBQA 3RL4A 3V4YA 1XM7A 3AUZA 3H64A 2Q8UA 5HPEA 2NYLC 4IL1A 3WHRA 3D03A 3K7WC 4H1SA 5DNYA 1KBPA 2Z8KA 4UWQA 4G01A 4G04A 4ORCA 1QHWA 1E7CA 2ROHA 3RL3A 4FK5B 2VDBA 1LOTA 1E7BA 4O4KA 1BM0A 3NMUA 1FOUA 2DBXA 4K71A 1E7AA 4KBPA 4TQ0A 1HK2A 2NYMC 4DHLA 4S1YA 4LACC 2EFDA 3N5UA 2QJCA 2V36A 3EGGA 1T70A 2AJEA 3AV0A 4GDKB 1II7A 1AO6A 3FWBC 1J7EA 4HGKA 4OR9A 2I2ZA 1HP1A 3NVMA 1HPUA 4N0FD 1HK5A 5D7GA 4LU9A 5JPFA 2DBUA 3QFKA 5GHKA 1JK7A 3SIUB 4J6OA 2O8GA 4ZC6A 2R17A 4Q7FA 4FBQA 3B9MA 3E0JA 5B8IA 4TUGA 3CK2A 5INBA 4GDLB 2Z72A 3WHSA 1HK1A 5DBYA 4F5VA 4V0XA 3KJLA 2BXBA 2BXIA 4N3ZA 4H2GA 4OTUA 4ZBKA 1MIVA 4IW2A 2ZO9B 1E7GA 2NPPC 1E78A 2P6BA 3TGHA 1WAO1 3IB8A 3ICFA 4BY9C 2BXFA 4OT2A 1IT6A 3GQUA 5FUOA 1W24A 5IJ5A 4EMXA 1Z2XA 1H5WA 5IIUA 2EFEA 3NVKA 4OTTA 1XZWA 5F3WA 4H2BA 3V03A 3H62B 3DSCA 3K7VC 3THNA 5JJTA 4DT2A 3FWCC 1G5BA 1GNJA 3QG5C 1HA2A 2WDDA 1SU1A 1KXPD 3WHQA 1HK4A 4LB9A 4MOVA 5B5TA 4L8UA 3KIKA 1UF3A 3GQXA 5IIHA 3FLOA 3IB7A 2EFCA 3DW8C 3EGHA 4I5LC 1E7HA 2XMOA 2BX8A 4ZCGA 2VUFA 4BKEA 4F5UA 1OIDA 4F0ZA 2BXCA 2XW0A 2Z06A 1LNSA 5GIOA 2NXFA 4H1YP 4FBWA 3HVQA 3T1IA 4UT3B 3GA9L 4FJCB 2IAEC 4FCXA 1S70A 2BXHA 4L9KA 4L9QA 5IOHA 2NNWA 3PLAA 3JQZA 1VFIA 2KBZA 3LU8A 4OR0A 2YVTA 2QHBA 2BXPA 3QFNA 4M0VA 1AUIA 2BXAA 2BXOA 2CV9A 2XVQA 4IW1A 4E99A 3QFOA 4MBEC 3H60A 5IJFA 2BXMA 4ORAA 4V0VA 3LU7A 2E0YA 3FGAC 4W4UB 5IIXA 3TDLA 2DBWA 1S3MA 3B9LA 2A22A 3SIVB 3MHHB 4H2FA 2BCDA 4K2CA 4UT2A 4LUHA 4ZBRA 3G9KD 3H66A 2USHA 2YDFA 4TUIA 4Z9OA 1OI8A 3DSDA 1WARA 3UIVA 4WWLA 4ZUXV 3RL5A 1IJGA 4XPNA 2WDFA 5GINA 4B2OA 2DYMA 4J2VA 2BXNA 1E7EA 2Z8IA 2AHDA 3H61A 2XSIA 1MIYA 3THOB 4ZVZA 2BQ8X 2KKNA 2BXLA 1J78A 1T71A 3QFMA 4PO0A 3M99C 2BXEA 2Z1AA 1S3LA 3H37A 3VQIA 4MP0A 4GDXA 3JRYA 2YEQA 1E7IA 1S8EA 2XVUA 5JPEA 2QFRA 4TQ1A 1BJ5A 2DYOA 2XVVA 3LU6A 3C9FA 5IJEA 2QMCA 2BXKA 4O24A 4MOYA 3V08A 3V09A 4H2IA 4Z69A 1TXUA 3P71C 3H3AA 1MA9A 2O8AA 4JK4A 3RQZA 4NAWB 1NNWA 4N0UD 1S95A 1S3NA 4JA9A 2HYPA 2BDXA 4IYPC 4FIPB 2BXQA 5HOZA 1U32A 1FJMA 3H67A 4ORBA 3H69A 2NQOA 4WA6B 4FBKA 1H9ZA 2OT3A 4ZX2A 2I30A 2ZOAA 5GIPA 3PSNA 3IVDA 4JA7A 4YKEA 4GG2A 2QFPA 3IVEA 4M70B 3H68A 4LTYA 2DXNA 2DXLA 2JOGA 2LOQA 1VZSA 4G03A 5IFOA 4O5GA 1JNBA 3E7AA 1M63A 5DQFA 3C5WC 1GNIA 1TF0A 1TCOA 3H63A 3A75A 4LUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSC A;  3N5U A;  3K7V C;  3THN A;  1OI8 A;  2QJC A;  5JJT A;  5C1V A;  1WAR A;  4DT2 A;  3DSD A;  4WWL A;  3EGG A;  1T70 A;  1G5B A;  3RL5 A;  3AV0 A;  4V0W A;  4LAC C;  3E7B A;  3QG5 C;  4XPN A;  1II7 A;  2WDD A;  2WDF A;  1V73 A;  1SU1 A;  4B2O A;  4OR9 A;  4MOV A;  4DSY A;  3H61 A;  1HP1 A;  2AHD A;  1HPU A;  1UF3 A;  3THO B;  4ZVZ A;  3IB7 A;  4UT3 A;  2BQ8 X;  2KKN A;  4O43 A;  3ZU0 A;  3DW8 C;  3EGH A;  4I5L C;  1T71 A;  4LU9 A;  1HO5 A;  2XMO A;  3QFM A;  5JPF A;  1USH A;  2HY1 A;  3QFK A;  2Z1A A;  1S3L A;  5EQV A;  1OID A;  4MP0 A;  1OIE A;  4F0Z A;  1JK7 A;  2Z06 A;  2NXF A;  4H1Y P;  3ZTV A;  1S8E A;  2IE4 C;  4FBW A;  3HVQ A;  3T1I A;  2ZBM A;  2QFR A;  4J6O A;  4UT3 B;  5JPE A;  2O8G A;  2IAE C;  4NZV A;  5J28 A;  4FCX A;  1S70 A;  2DFJ A;  4KKZ A;  5IOH A;  2R17 A;  2GJU A;  3C9F A;  4FBQ A;  4Q7F A;  5GTU A;  3JYF A;  5B8I A;  4TUG A;  3CK2 A;  4MOY A;  4O24 A;  5INB A;  2IE3 C;  4H2I A;  2WDE A;  2YVT A;  2Z72 A;  3P71 C;  4I5N C;  1QFC A;  2O8A A;  3QFN A;  3GVE A;  4M0V A;  4V0X A;  1AUI A;  1Z2W A;  1MF8 A;  3RQZ A;  1NNW A;  2HYO A;  3LL8 A;  1S95 A;  3KBP A;  1S3N A;  2CV9 A;  4JA9 A;  2HYP A;  2BDX A;  2WDC A;  3PSO A;  3QFO A;  4G9J A;  4HD0 A;  1UTE A;  4H2G A;  4IYP C;  1U32 A;  3H60 A;  1FJM A;  3H67 A;  4ORB A;  3H69 A;  3RL4 A;  3V4Y A;  1XM7 A;  3AUZ A;  3H64 A;  2Q8U A;  4FBK A;  5HPE A;  4ORA A;  4V0V A;  4ZX2 A;  2NPP C;  2NYL C;  4IL1 A;  3PSN A;  3IVD A;  4JA7 A;  4YKE A;  3FGA C;  2P6B A;  3TGH A;  2QFP A;  1WAO 1;  3K7W C;  3IVE A;  4H1S A;  1KBP A;  5DNY A;  4UWQ A;  4LTY A;  3IB8 A;  3ICF A;  4ORC A;  1S3M A;  1QHW A;  1IT6 A;  2A22 A;  1W24 A;  3RL3 A;  2JOG A;  1Z2X A;  4H2F A;  4O4K A;  2BCD A;  4O5G A;  3E7A A;  1M63 A;  4UT2 A;  1XZW A;  5F3W A;  4H2B A;  3C5W C;  4KBP A;  4DHL A;  1TCO A;  2NYM C;  3H63 A;  3H66 A;  2USH A;  3H68 A;  3H62 B;  4TUI A; 
#chains in the Genus database with same CATH topology
 2CKX A;  2VUE A;  1KW2 A;  5C1V A;  4V0W A;  1HK3 A;  3A73 A;  3E7B A;  1V73 A;  2BXD A;  3FNM A;  4DSY A;  3SQJ A;  2JUH A;  4LB2 A;  4UT3 A;  1MIW A;  2EFH A;  4O43 A;  1O9X A;  2Z8J A;  3ZU0 A;  1HO5 A;  5BPK A;  1USH A;  2HY1 A;  2LQH A;  4F5T A;  1NT2 B;  5ID9 A;  1UOR A;  5EQV A;  4C31 B;  3MHS B;  1OIE A;  3ZTV A;  2IE4 C;  2QM6 A;  2XVW A;  2ZBM A;  4NZV A;  2DG5 A;  5J28 A;  2DFJ A;  1MUH A;  4KKZ A;  2GJU A;  4HGM B;  3JYF A;  5GTU A;  2E0X A;  4DHX B;  5ID7 A;  1BKE A;  2IE3 C;  2WDE A;  2OZB B;  1E7F A;  4I5N C;  3ICX A;  1QFC A;  3NVI A;  1MUS A;  3GVE A;  4F5S A;  1Z2W A;  1MF8 A;  2XW1 A;  4LA0 A;  3CX9 A;  2HYO A;  3W1S A;  3KBP A;  3LL8 A;  2BXG A;  2WDC A;  3PSO A;  4G9J A;  4HD0 A;  1UTE A;  1N5U A;  2K0N A;  4ZBQ A;  3RL4 A;  3V4Y A;  1XM7 A;  3AUZ A;  3H64 A;  2Q8U A;  5HPE A;  2NYL C;  4IL1 A;  3WHR A;  3D03 A;  3K7W C;  1SB0 A;  4H1S A;  1KBP A;  2Z8K A;  4UWQ A;  5DNY A;  4G01 A;  4G04 A;  4ORC A;  1QHW A;  1E7C A;  2ROH A;  3RL3 A;  4FK5 B;  2VDB A;  1LOT A;  1E7B A;  4O4K A;  1BM0 A;  3NMU A;  1FOU A;  2DBX A;  4K71 A;  1E7A A;  4KBP A;  4TQ0 A;  1HK2 A;  2NYM C;  4DHL A;  4S1Y A;  4LAC C;  2EFD A;  3N5U A;  2QJC A;  2V36 A;  3EGG A;  1T70 A;  2AJE A;  3AV0 A;  4GDK B;  1II7 A;  1AO6 A;  3FWB C;  1J7E A;  4HGK A;  4OR9 A;  2I2Z A;  1HP1 A;  3NVM A;  1HPU A;  4N0F D;  1HK5 A;  5D7G A;  2LXT A;  4LU9 A;  5JPF A;  2DBU A;  3QFK A;  5GHK A;  1JK7 A;  3SIU B;  4DM0 A;  4J6O A;  2O8G A;  4ZC6 A;  2R17 A;  4Q7F A;  4FBQ A;  3B9M A;  3E0J A;  5B8I A;  4TUG A;  3CK2 A;  5INB A;  4GDL B;  2Z72 A;  3WHS A;  2GUT A;  1HK1 A;  5DBY A;  4F5V A;  4V0X A;  3KJL A;  2BXB A;  2BXI A;  4N3Z A;  4H2G A;  4OTU A;  4ZBK A;  1MIV A;  4IW2 A;  2ZO9 B;  1E7G A;  2NPP C;  1E78 A;  2P6B A;  3TGH A;  1WAO 1;  3IB8 A;  3ICF A;  4BY9 C;  2BXF A;  4OT2 A;  1IT6 A;  3GQU A;  5FUO A;  1W24 A;  5IJ5 A;  4EMX A;  1Z2X A;  1H5W A;  5IIU A;  2EFE A;  3NVK A;  4OTT A;  1XZW A;  5F3W A;  4H2B A;  3V03 A;  3H62 B;  3DSC A;  3K7V C;  3THN A;  5JJT A;  4DT2 A;  3FWC C;  1G5B A;  1GNJ A;  3QG5 C;  1HA2 A;  2WDD A;  1SU1 A;  1KXP D;  3WHQ A;  2KWF A;  1HK4 A;  4LB9 A;  4MOV A;  5B5T A;  4L8U A;  3KIK A;  1UF3 A;  3GQX A;  5IIH A;  3FLO A;  3IB7 A;  3ECP A;  2EFC A;  3DW8 C;  3EGH A;  4I5L C;  1E7H A;  2XMO A;  2BX8 A;  4ZCG A;  2VUF A;  4BKE A;  4F5U A;  1OID A;  4F0Z A;  2BXC A;  2XW0 A;  2Z06 A;  1LNS A;  5GIO A;  2NXF A;  4H1Y P;  4FBW A;  3HVQ A;  3T1I A;  4UT3 B;  3GA9 L;  4FJC B;  2IAE C;  4FCX A;  1S70 A;  2BXH A;  4L9K A;  4L9Q A;  5IOH A;  2NNW A;  3PLA A;  3JQZ A;  1VFI A;  2KBZ A;  3LU8 A;  4OR0 A;  2YVT A;  2QHB A;  2BXP A;  3QFN A;  4M0V A;  1AUI A;  2BXA A;  2BXO A;  2CV9 A;  2XVQ A;  4IW1 A;  4E99 A;  3QFO A;  4MBE C;  3H60 A;  5IJF A;  2LXS A;  2BXM A;  4ORA A;  4V0V A;  3LU7 A;  2E0Y A;  3FGA C;  4W4U B;  5IIX A;  3TDL A;  2DBW A;  1S3M A;  3B9L A;  2A22 A;  3SIV B;  3MHH B;  1MM8 A;  4H2F A;  2BCD A;  4K2C A;  4UT2 A;  4LUH A;  4ZBR A;  3G9K D;  3H66 A;  2USH A;  2YDF A;  4TUI A;  4D7X A;  4Z9O A;  1OI8 A;  3DSD A;  1WAR A;  3UIV A;  4WWL A;  4ZUX V;  3RL5 A;  1IJG A;  4XPN A;  2WDF A;  5GIN A;  4B2O A;  2DYM A;  4J2V A;  2BXN A;  1E7E A;  2Z8I A;  2AHD A;  3H61 A;  2XSI A;  1MIY A;  3THO B;  4ZVZ A;  2BQ8 X;  2KKN A;  2BXL A;  1J78 A;  1T71 A;  3QFM A;  4PO0 A;  3M99 C;  2BXE A;  2Z1A A;  1S3L A;  3H37 A;  3VQI A;  4MP0 A;  4GDX A;  3JRY A;  2YEQ A;  1E7I A;  1S8E A;  2XVU A;  5JPE A;  2QFR A;  4I9O A;  4TQ1 A;  1BJ5 A;  2DYO A;  2XVV A;  3LU6 A;  3C9F A;  5IJE A;  2QMC A;  2BXK A;  4O24 A;  4MOY A;  3V08 A;  3V09 A;  4H2I A;  2AGH B;  4Z69 A;  1TXU A;  3P71 C;  3H3A A;  1MA9 A;  2O8A A;  4JK4 A;  1KDX A;  3RQZ A;  4NAW B;  1NNW A;  4N0U D;  1S95 A;  1S3N A;  4JA9 A;  2HYP A;  2BDX A;  4IYP C;  4FIP B;  2BXQ A;  5HOZ A;  1U32 A;  1FJM A;  3H67 A;  4ORB A;  3H69 A;  2NQO A;  4WA6 B;  4FBK A;  1H9Z A;  2OT3 A;  3BPJ A;  4ZX2 A;  2I30 A;  2ZOA A;  5GIP A;  3PSN A;  3IVD A;  4JA7 A;  4YKE A;  2LQI A;  4GG2 A;  2QFP A;  3IVE A;  4M70 B;  3H68 A;  4LTY A;  2DXN A;  2DXL A;  2JOG A;  2LOQ A;  1VZS A;  4G03 A;  5IFO A;  4O5G A;  1JNB A;  3E7A A;  1M63 A;  5DQF A;  3C5W C;  1GNI A;  1TF0 A;  1TCO A;  3H63 A;  3A75 A;  4LUF A; 
#chains in the Genus database with same CATH homology
 2CKX A;  2VUE A;  1KW2 A;  5C1V A;  4V0W A;  1HK3 A;  3A73 A;  3E7B A;  1V73 A;  2BXD A;  3FNM A;  4DSY A;  3SQJ A;  2JUH A;  4LB2 A;  4UT3 A;  1MIW A;  2EFH A;  4O43 A;  1O9X A;  2Z8J A;  3ZU0 A;  1HO5 A;  5BPK A;  1USH A;  2HY1 A;  4F5T A;  1NT2 B;  5ID9 A;  1UOR A;  5EQV A;  4C31 B;  3MHS B;  1OIE A;  3ZTV A;  2IE4 C;  2QM6 A;  2XVW A;  2ZBM A;  4NZV A;  2DG5 A;  5J28 A;  2DFJ A;  4KKZ A;  2GJU A;  4HGM B;  3JYF A;  5GTU A;  2E0X A;  4DHX B;  5ID7 A;  1BKE A;  2IE3 C;  2WDE A;  2OZB B;  1E7F A;  4I5N C;  3ICX A;  1QFC A;  3NVI A;  3GVE A;  4F5S A;  1Z2W A;  1MF8 A;  2XW1 A;  4LA0 A;  3CX9 A;  2HYO A;  3W1S A;  3KBP A;  3LL8 A;  2BXG A;  2WDC A;  3PSO A;  4G9J A;  4HD0 A;  1UTE A;  1N5U A;  4ZBQ A;  3RL4 A;  3V4Y A;  1XM7 A;  3AUZ A;  3H64 A;  2Q8U A;  5HPE A;  2NYL C;  4IL1 A;  3WHR A;  3D03 A;  3K7W C;  4H1S A;  5DNY A;  1KBP A;  2Z8K A;  4UWQ A;  4G01 A;  4G04 A;  4ORC A;  1QHW A;  1E7C A;  2ROH A;  3RL3 A;  4FK5 B;  2VDB A;  1LOT A;  1E7B A;  4O4K A;  1BM0 A;  3NMU A;  1FOU A;  2DBX A;  4K71 A;  1E7A A;  4KBP A;  4TQ0 A;  1HK2 A;  2NYM C;  4DHL A;  4S1Y A;  4LAC C;  2EFD A;  3N5U A;  2QJC A;  2V36 A;  3EGG A;  1T70 A;  2AJE A;  3AV0 A;  4GDK B;  1II7 A;  1AO6 A;  3FWB C;  1J7E A;  4HGK A;  4OR9 A;  2I2Z A;  1HP1 A;  3NVM A;  1HPU A;  4N0F D;  1HK5 A;  5D7G A;  4LU9 A;  5JPF A;  2DBU A;  3QFK A;  5GHK A;  1JK7 A;  3SIU B;  4J6O A;  2O8G A;  4ZC6 A;  2R17 A;  4Q7F A;  4FBQ A;  3B9M A;  3E0J A;  5B8I A;  4TUG A;  3CK2 A;  5INB A;  4GDL B;  2Z72 A;  3WHS A;  1HK1 A;  5DBY A;  4F5V A;  4V0X A;  3KJL A;  2BXB A;  2BXI A;  4N3Z A;  4H2G A;  4OTU A;  4ZBK A;  1MIV A;  4IW2 A;  2ZO9 B;  1E7G A;  2NPP C;  1E78 A;  2P6B A;  3TGH A;  1WAO 1;  3IB8 A;  3ICF A;  4BY9 C;  2BXF A;  4OT2 A;  1IT6 A;  3GQU A;  5FUO A;  1W24 A;  5IJ5 A;  4EMX A;  1Z2X A;  1H5W A;  5IIU A;  2EFE A;  3NVK A;  4OTT A;  1XZW A;  5F3W A;  4H2B A;  3V03 A;  3H62 B;  3DSC A;  3K7V C;  3THN A;  5JJT A;  4DT2 A;  3FWC C;  1G5B A;  1GNJ A;  3QG5 C;  1HA2 A;  2WDD A;  1SU1 A;  1KXP D;  3WHQ A;  1HK4 A;  4LB9 A;  4MOV A;  5B5T A;  4L8U A;  3KIK A;  1UF3 A;  3GQX A;  5IIH A;  3FLO A;  3IB7 A;  2EFC A;  3DW8 C;  3EGH A;  4I5L C;  1E7H A;  2XMO A;  2BX8 A;  4ZCG A;  2VUF A;  4BKE A;  4F5U A;  1OID A;  4F0Z A;  2BXC A;  2XW0 A;  2Z06 A;  1LNS A;  5GIO A;  2NXF A;  4H1Y P;  4FBW A;  3HVQ A;  3T1I A;  4UT3 B;  3GA9 L;  4FJC B;  2IAE C;  4FCX A;  1S70 A;  2BXH A;  4L9K A;  4L9Q A;  5IOH A;  2NNW A;  3PLA A;  3JQZ A;  1VFI A;  2KBZ A;  3LU8 A;  4OR0 A;  2YVT A;  2QHB A;  2BXP A;  3QFN A;  4M0V A;  1AUI A;  2BXA A;  2BXO A;  2CV9 A;  2XVQ A;  4IW1 A;  4E99 A;  3QFO A;  4MBE C;  3H60 A;  5IJF A;  2BXM A;  4ORA A;  4V0V A;  3LU7 A;  2E0Y A;  3FGA C;  4W4U B;  5IIX A;  3TDL A;  2DBW A;  1S3M A;  3B9L A;  2A22 A;  3SIV B;  3MHH B;  4H2F A;  2BCD A;  4K2C A;  4UT2 A;  4LUH A;  4ZBR A;  3G9K D;  3H66 A;  2USH A;  2YDF A;  4TUI A;  4Z9O A;  1OI8 A;  3DSD A;  1WAR A;  3UIV A;  4WWL A;  4ZUX V;  3RL5 A;  1IJG A;  4XPN A;  2WDF A;  5GIN A;  4B2O A;  2DYM A;  4J2V A;  2BXN A;  1E7E A;  2Z8I A;  2AHD A;  3H61 A;  2XSI A;  1MIY A;  3THO B;  4ZVZ A;  2BQ8 X;  2KKN A;  2BXL A;  1J78 A;  1T71 A;  3QFM A;  4PO0 A;  3M99 C;  2BXE A;  2Z1A A;  1S3L A;  3H37 A;  3VQI A;  4MP0 A;  4GDX A;  3JRY A;  2YEQ A;  1E7I A;  1S8E A;  2XVU A;  5JPE A;  2QFR A;  4TQ1 A;  1BJ5 A;  2DYO A;  2XVV A;  3LU6 A;  3C9F A;  5IJE A;  2QMC A;  2BXK A;  4O24 A;  4MOY A;  3V08 A;  3V09 A;  4H2I A;  4Z69 A;  1TXU A;  3P71 C;  3H3A A;  1MA9 A;  2O8A A;  4JK4 A;  3RQZ A;  4NAW B;  1NNW A;  4N0U D;  1S95 A;  1S3N A;  4JA9 A;  2HYP A;  2BDX A;  4IYP C;  4FIP B;  2BXQ A;  5HOZ A;  1U32 A;  1FJM A;  3H67 A;  4ORB A;  3H69 A;  2NQO A;  4WA6 B;  4FBK A;  1H9Z A;  2OT3 A;  4ZX2 A;  2I30 A;  2ZOA A;  5GIP A;  3PSN A;  3IVD A;  4JA7 A;  4YKE A;  4GG2 A;  2QFP A;  3IVE A;  4M70 B;  3H68 A;  4LTY A;  2DXN A;  2DXL A;  2JOG A;  2LOQ A;  1VZS A;  4G03 A;  5IFO A;  4O5G A;  1JNB A;  3E7A A;  1M63 A;  5DQF A;  3C5W C;  1GNI A;  1TF0 A;  1TCO A;  3H63 A;  3A75 A;  4LUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...