1JNBA

Connector protein from bacteriophage phi29
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
275
structure length
257
Chain Sequence
SINEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNYRDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFLGIKDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords UPPER COLLAR PROTEIN
publication title Structure determination of the head-tail connector of bacteriophage phi29.
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 57
structure length 257
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05352 Phage_connector Phage Connector (GP10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.30 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1jnbA01
2.40.500.10 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) 1jnbA02
3.30.1350.20 Alpha Beta 2-Layer Sandwich Crambin Bacteriophage PHI-29 conector. Domain 3 1jnbA03
1FOUA 1H5WA 1IJGA 1JNBA
chains in the Genus database with same CATH superfamily
3V09A 1VZSA 1OKHA 4F5UA 2BXDA 3CX9A 2GDSA 2XMOA 1ED0A 2BXMA 1IDSA 2EYAA 4JYYA 4HGMB 1N5UA 1E7BA 4W4UB 4ZC6A 4MBEC 4GDLB 3EVKA 1QNMA 1WUWA 2BXNA 4IW2A 1CBNA 1SZXA 1N0NA 1EJGA 2XVQA 3OT7A 1E7CA 1CRNA 1LUWA 1NBLA 2LXSA 4G01A 2GUTA 3PLAA 2EFCA 3B9LA 4NAWB 1PM9A 2LOQA 2BX8A 4L9QA 2Z8JA 4LUFA 1MIVA 1MA1A 1O9XA 3H3AA 3KKYA 4IW1A 2DG5A 3SIUB 4C31B 2XW0A 3V03A 2BXCA 3LSUA 1EN6A 1GNJA 2BXBA 2BXLA 1MMMA 4ZBRA 1IXBA 2V9BA 3WHQA 4J2VA 1N0JA 3DC6A 2EYCA 5BPKA 1SB0A 2BXEA 1YV8A 2BXAA 4FFKA 1EM1A 1XUQA 2EFEA 4YIOA 3TJTA 2KBZA 3NVKA 1EN4A 3MHSB 2DYMA 1JR9A 1EN5A 4LB9A 1HK4A 1XREA 1MM8A 4GUNA 1E7EA 3V08A 1ZUQA 4ZUXV 3C3SA 5HOZA 2AJEA 4OTTA 2LQHA 4I9OA 2CKXA 4C7UA 2NQOA 1MA9A 1BHPA 1AO6A 5IIHA 1MIYA 1CNRA 5A9GA 1BKEA 5DBYA 2OZBB 1Y67A 3KJLA 3GQXA 5IFOA 2EYDA 3RN4A 1E7FA 1UORA 4N0FD 2Z8IA 5IJFA 3C3TA 2EYBA 1I08A 3SQJA 5IJEA 4GDKB 2ADPA 4G04A 3H37A 4FJCB 3BFRA 2LQIA 5IIUA 4Z69A 1FOUA 2YDFA 2DBWA 1MIWA 5FUOA 1VARA 2BXGA 2XVVA 4BR6A 1CCNA 1IX9A 3LU8A 2K0NA 4LUHA 5AG2A 2QHBA 1JMPA 1NT2B 3KIKA 4OT2A 3UIVA 3JRYA 2LXTA 3NIRA 1TXUA 1AB1A 1BS3A 1MSDA 1ORLA 1JXXA 1GN3A 3G9KD 3FWCC 2ROHA 1ZTEA 3NVIA 1WB7A 2BXQA 5B5TA 3VQIA 1MUHA 1JMNA 2P4KA 4F6EA 2BXHA 4LA0A 3GQUA 2AW9A 1ZSPA 2DBUA 4JZ2A 3B9MA 1BM0A 2DBXA 2RCVA 4EMXA 1LOTA 1AR5A 1H5WA 1CXRA 3MDSA 2XVUA 2I2ZA 2VUEA 5GHKA 4WA6B 1AVMA 1IJGA 4GDXA 1BT8A 4D7XA 4GG2A 3CEIA 1HK2A 3A73A 4YIPA 4HGKA 5DQFA 3BPJA 4JK4A 5GIOA 4X9QA 3C8PA 4E99A 1JXYA 4ZCGA 3K9SA 5ID9A 1JNBA 4OTUA 3AK1A 5GINA 4ZBKA 2PLHA 1E7GA 1BSMA 1E78A 3FWBC 1ZLZA 5IJ5A 4K2CA 3WHRA 2BXFA 1HK3A 3FNMA 1J7EA 2FD7A 2QM6A 3AK2A 1YVAA 1TF0A 5D7GA 3LU7A 3NVMA 2QKCA 2NNWA 4Z9OA 3MHHB 1E7AA 4OR0A 1AR4A 1JXUA 2BXPA 1JXTA 4L8UA 1XDCA 2XVWA 3JQZA 4L9KA 1HK5A 5GIPA 2ADQB 2VDBA 4F5TA 2VUFA 1LNSA 4FC1A 1AP5A 3A75A 2DYOA 4BKEA 1MUSA 3W1SA 4TQ0A 4G03A 5ID7A 2BXKA 2BXOA 3TDLA 1KDXA 3AK3A 4K71A 4DHXB 1I0HA 2JUHA 2QMCA 4PO0A 3WHSA 1AP6A 2EFDA 1E7IA 1KW2A 1H9ZA 3SZSA 1B06A 3UE7B 3QVNA 1BJ5A 1JA8A 1JXWA 1P7GA 3SIVB 2OT3A 2E0YA 1GNIA 3LU6A 1XILA 4N3ZA 3M99C 2BXIA 4F5SA 2I30A 2KWFA 2EFHA 2CE4A 1E7HA 1MNGA 3DC5A 1CCMA 2XW1A 4E4EA 1KKCA 3NMUA 2XSIA 4BY9C 1D5NA 4JZGA 2Z8KA 2E0XA 1GN2A 2V36A 4FIPB 3ECPA 2AGHB 2FD9A 3GA9L 1HA2A 2CDYA 3ICXA 4F5VA 4N0UD 1VFIA 1GN4A 4DM0A 4TQ1A 5IIXA 2QKAA 4S1YA 1GN6A 4LB2A 1WB8A 4ZBQA 1J78A 1KXPD 1PL4A 4FK5B 3KDRA 1LUVA 1HK1A 4M70B 3U7TA 1VEWA
chains in the Genus database with same CATH topology
2DBUA 4G03A 3V09A 1VZSA 1BM0A 3B9MA 5ID7A 3MHSB 2BXKA 2DYMA 2BXOA 2DBXA 4EMXA 3TDLA 4LB9A 1HK4A 1LOTA 4F5UA 4K71A 1H5WA 4DHXB 1E7EA 2JUHA 3V08A 2BXDA 4ZUXV 2XVUA 3CX9A 2AJEA 5HOZA 2I2ZA 2QMCA 2VUEA 4OTTA 5GHKA 4WA6B 2XMOA 4PO0A 3WHSA 2CKXA 1IJGA 4GDXA 2NQOA 1MA9A 2BXMA 2EFDA 4GG2A 1AO6A 5IIHA 1E7IA 1KW2A 1H9ZA 4HGMB 1N5UA 1MIYA 1HK2A 1E7BA 3A73A 1BKEA 5DBYA 4W4UB 4ZC6A 2OZBB 4HGKA 1BJ5A 4MBEC 5DQFA 4GDLB 4JK4A 3KJLA 5GIOA 3SIVB 2OT3A 4E99A 3GQXA 2E0YA 2BXNA 5IFOA 4ZCGA 1GNIA 1E7FA 5ID9A 1JNBA 1UORA 3LU6A 4N0FD 4OTUA 4IW2A 2Z8IA 5IJFA 4N3ZA 3NVKA 5GINA 4ZBKA 2XVQA 3M99C 2BXIA 4F5SA 1E7GA 2I30A 2EFHA 1E7CA 1E7HA 3SQJA 1E78A 3FWBC 5IJEA 5IJ5A 4GDKB 4G04A 2XW1A 3H37A 4FJCB 3NMUA 4G01A 2XSIA 4K2CA 3WHRA 4BY9C 2BXFA 5IIUA 1HK3A 2Z8KA 1J7EA 2E0XA 3FNMA 4Z69A 1FOUA 3PLAA 2EFCA 2YDFA 3B9LA 4NAWB 2V36A 4FIPB 2DBWA 1MIWA 2QM6A 2LOQA 5FUOA 1TF0A 2BX8A 4L9QA 5D7GA 2BXGA 2Z8JA 4LUFA 1MIVA 2XVVA 1HA2A 3GA9L 3LU7A 3NVMA 1O9XA 3H3AA 2NNWA 3LU8A 3MHHB 4Z9OA 4IW1A 4LUHA 2DG5A 3ICXA 2QHBA 3SIUB 1NT2B 4C31B 1E7AA 2XW0A 3KIKA 3V03A 4OR0A 4OT2A 3UIVA 4F5VA 3JRYA 1VFIA 4N0UD 2BXCA 1TXUA 2BXPA 4TQ1A 4L8UA 1GNJA 2BXBA 2BXLA 5IIXA 4ZBRA 2XVWA 4S1YA 4LB2A 3JQZA 4L9KA 1HK5A 3WHQA 4J2VA 5GIPA 3G9KD 3FWCC 2ROHA 2VDBA 4ZBQA 4F5TA 1J78A 3NVIA 1KXPD 2VUFA 2BXQA 4FK5B 5BPKA 5B5TA 2BXEA 3VQIA 1LNSA 2BXAA 3A75A 2BXHA 1HK1A 2EFEA 4M70B 4LA0A 2DYOA 3GQUA 4BKEA 2KBZA 3W1SA 4TQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOU A;  1H5W A;  1IJG A;  1JNB A; 
#chains in the Genus database with same CATH topology
 3V09 A;  1VZS A;  1OKH A;  4F5U A;  2BXD A;  3CX9 A;  2GDS A;  2XMO A;  1ED0 A;  2BXM A;  1IDS A;  2EYA A;  4JYY A;  4HGM B;  1N5U A;  1E7B A;  4W4U B;  4ZC6 A;  4MBE C;  4GDL B;  3EVK A;  1QNM A;  1WUW A;  2BXN A;  4IW2 A;  1CBN A;  1SZX A;  1N0N A;  1EJG A;  2XVQ A;  3OT7 A;  1E7C A;  1CRN A;  1LUW A;  1NBL A;  2LXS A;  4G01 A;  2GUT A;  3PLA A;  2EFC A;  3B9L A;  4NAW B;  1PM9 A;  2LOQ A;  2BX8 A;  4L9Q A;  2Z8J A;  4LUF A;  1MIV A;  1MA1 A;  1O9X A;  3H3A A;  3KKY A;  4IW1 A;  2DG5 A;  3SIU B;  4C31 B;  2XW0 A;  3V03 A;  2BXC A;  3LSU A;  1EN6 A;  1GNJ A;  2BXB A;  2BXL A;  1MMM A;  4ZBR A;  1IXB A;  2V9B A;  3WHQ A;  4J2V A;  1N0J A;  3DC6 A;  2EYC A;  5BPK A;  1SB0 A;  2BXE A;  1YV8 A;  2BXA A;  4FFK A;  1EM1 A;  1XUQ A;  2EFE A;  4YIO A;  3TJT A;  2KBZ A;  3NVK A;  1EN4 A;  3MHS B;  2DYM A;  1JR9 A;  1EN5 A;  4LB9 A;  1HK4 A;  1XRE A;  1MM8 A;  4GUN A;  1E7E A;  3V08 A;  1ZUQ A;  4ZUX V;  3C3S A;  5HOZ A;  2AJE A;  4OTT A;  2LQH A;  4I9O A;  2CKX A;  4C7U A;  2NQO A;  1MA9 A;  1BHP A;  1AO6 A;  5IIH A;  1MIY A;  1CNR A;  5A9G A;  1BKE A;  5DBY A;  2OZB B;  1Y67 A;  3KJL A;  3GQX A;  5IFO A;  2EYD A;  3RN4 A;  1E7F A;  1UOR A;  4N0F D;  2Z8I A;  5IJF A;  3C3T A;  2EYB A;  1I08 A;  3SQJ A;  5IJE A;  4GDK B;  2ADP A;  4G04 A;  3H37 A;  4FJC B;  3BFR A;  2LQI A;  5IIU A;  4Z69 A;  1FOU A;  2YDF A;  2DBW A;  1MIW A;  5FUO A;  1VAR A;  2BXG A;  2XVV A;  4BR6 A;  1CCN A;  1IX9 A;  3LU8 A;  2K0N A;  4LUH A;  5AG2 A;  2QHB A;  1JMP A;  1NT2 B;  3KIK A;  4OT2 A;  3UIV A;  3JRY A;  2LXT A;  3NIR A;  1TXU A;  1AB1 A;  1BS3 A;  1MSD A;  1ORL A;  1JXX A;  1GN3 A;  3G9K D;  3FWC C;  2ROH A;  1ZTE A;  3NVI A;  1WB7 A;  2BXQ A;  5B5T A;  3VQI A;  1MUH A;  1JMN A;  2P4K A;  4F6E A;  2BXH A;  4LA0 A;  3GQU A;  2AW9 A;  1ZSP A;  2DBU A;  4JZ2 A;  3B9M A;  1BM0 A;  2DBX A;  2RCV A;  4EMX A;  1LOT A;  1AR5 A;  1H5W A;  1CXR A;  3MDS A;  2XVU A;  2I2Z A;  2VUE A;  5GHK A;  4WA6 B;  1AVM A;  1IJG A;  4GDX A;  1BT8 A;  4D7X A;  4GG2 A;  3CEI A;  1HK2 A;  3A73 A;  4YIP A;  4HGK A;  5DQF A;  3BPJ A;  4JK4 A;  5GIO A;  4X9Q A;  3C8P A;  4E99 A;  1JXY A;  4ZCG A;  3K9S A;  5ID9 A;  1JNB A;  4OTU A;  3AK1 A;  5GIN A;  4ZBK A;  2PLH A;  1E7G A;  1BSM A;  1E78 A;  3FWB C;  1ZLZ A;  5IJ5 A;  4K2C A;  3WHR A;  2BXF A;  1HK3 A;  3FNM A;  1J7E A;  2FD7 A;  2QM6 A;  3AK2 A;  1YVA A;  1TF0 A;  5D7G A;  3LU7 A;  3NVM A;  2QKC A;  2NNW A;  4Z9O A;  3MHH B;  1E7A A;  4OR0 A;  1AR4 A;  1JXU A;  2BXP A;  1JXT A;  4L8U A;  1XDC A;  2XVW A;  3JQZ A;  4L9K A;  1HK5 A;  5GIP A;  2ADQ B;  2VDB A;  4F5T A;  2VUF A;  1LNS A;  4FC1 A;  1AP5 A;  3A75 A;  2DYO A;  4BKE A;  1MUS A;  3W1S A;  4TQ0 A;  4G03 A;  5ID7 A;  2BXK A;  2BXO A;  3TDL A;  1KDX A;  3AK3 A;  4K71 A;  4DHX B;  1I0H A;  2JUH A;  2QMC A;  4PO0 A;  3WHS A;  1AP6 A;  2EFD A;  1E7I A;  1KW2 A;  1H9Z A;  3SZS A;  1B06 A;  3UE7 B;  3QVN A;  1BJ5 A;  1JA8 A;  1JXW A;  1P7G A;  3SIV B;  2OT3 A;  2E0Y A;  1GNI A;  3LU6 A;  1XIL A;  4N3Z A;  3M99 C;  2BXI A;  4F5S A;  2I30 A;  2KWF A;  2EFH A;  2CE4 A;  1E7H A;  1MNG A;  3DC5 A;  1CCM A;  2XW1 A;  4E4E A;  1KKC A;  3NMU A;  2XSI A;  4BY9 C;  1D5N A;  4JZG A;  2Z8K A;  2E0X A;  1GN2 A;  2V36 A;  4FIP B;  3ECP A;  2AGH B;  2FD9 A;  3GA9 L;  1HA2 A;  2CDY A;  3ICX A;  4F5V A;  4N0U D;  1VFI A;  1GN4 A;  4DM0 A;  4TQ1 A;  5IIX A;  2QKA A;  4S1Y A;  1GN6 A;  4LB2 A;  1WB8 A;  4ZBQ A;  1J78 A;  1KXP D;  1PL4 A;  4FK5 B;  3KDR A;  1LUV A;  1HK1 A;  4M70 B;  3U7T A;  1VEW A; 
#chains in the Genus database with same CATH homology
 2DBU A;  4G03 A;  3V09 A;  1VZS A;  1BM0 A;  3B9M A;  5ID7 A;  3MHS B;  2BXK A;  2DYM A;  2BXO A;  2DBX A;  4EMX A;  3TDL A;  4LB9 A;  1HK4 A;  1LOT A;  4F5U A;  4K71 A;  1H5W A;  4DHX B;  1E7E A;  2JUH A;  3V08 A;  2BXD A;  4ZUX V;  2XVU A;  3CX9 A;  2AJE A;  5HOZ A;  2I2Z A;  2QMC A;  2VUE A;  4OTT A;  5GHK A;  4WA6 B;  2XMO A;  4PO0 A;  3WHS A;  2CKX A;  1IJG A;  4GDX A;  2NQO A;  1MA9 A;  2BXM A;  2EFD A;  4GG2 A;  1AO6 A;  5IIH A;  1E7I A;  1KW2 A;  1H9Z A;  4HGM B;  1N5U A;  1MIY A;  1HK2 A;  1E7B A;  3A73 A;  1BKE A;  5DBY A;  4W4U B;  4ZC6 A;  2OZB B;  4HGK A;  1BJ5 A;  4MBE C;  5DQF A;  4GDL B;  4JK4 A;  3KJL A;  5GIO A;  3SIV B;  2OT3 A;  4E99 A;  3GQX A;  2E0Y A;  2BXN A;  5IFO A;  4ZCG A;  1GNI A;  1E7F A;  5ID9 A;  1JNB A;  1UOR A;  3LU6 A;  4N0F D;  4OTU A;  4IW2 A;  2Z8I A;  5IJF A;  4N3Z A;  3NVK A;  5GIN A;  4ZBK A;  2XVQ A;  3M99 C;  2BXI A;  4F5S A;  1E7G A;  2I30 A;  2EFH A;  1E7C A;  1E7H A;  3SQJ A;  1E78 A;  3FWB C;  5IJE A;  5IJ5 A;  4GDK B;  4G04 A;  2XW1 A;  3H37 A;  4FJC B;  3NMU A;  4G01 A;  2XSI A;  4K2C A;  3WHR A;  4BY9 C;  2BXF A;  5IIU A;  1HK3 A;  2Z8K A;  1J7E A;  2E0X A;  3FNM A;  4Z69 A;  1FOU A;  3PLA A;  2EFC A;  2YDF A;  3B9L A;  4NAW B;  2V36 A;  4FIP B;  2DBW A;  1MIW A;  2QM6 A;  2LOQ A;  5FUO A;  1TF0 A;  2BX8 A;  4L9Q A;  5D7G A;  2BXG A;  2Z8J A;  4LUF A;  1MIV A;  2XVV A;  1HA2 A;  3GA9 L;  3LU7 A;  3NVM A;  1O9X A;  3H3A A;  2NNW A;  3LU8 A;  3MHH B;  4Z9O A;  4IW1 A;  4LUH A;  2DG5 A;  3ICX A;  2QHB A;  3SIU B;  1NT2 B;  4C31 B;  1E7A A;  2XW0 A;  3KIK A;  3V03 A;  4OR0 A;  4OT2 A;  3UIV A;  4F5V A;  3JRY A;  1VFI A;  4N0U D;  2BXC A;  1TXU A;  2BXP A;  4TQ1 A;  4L8U A;  1GNJ A;  2BXB A;  2BXL A;  5IIX A;  4ZBR A;  2XVW A;  4S1Y A;  4LB2 A;  3JQZ A;  4L9K A;  1HK5 A;  3WHQ A;  4J2V A;  5GIP A;  3G9K D;  3FWC C;  2ROH A;  2VDB A;  4ZBQ A;  4F5T A;  1J78 A;  3NVI A;  1KXP D;  2VUF A;  2BXQ A;  4FK5 B;  5BPK A;  5B5T A;  2BXE A;  3VQI A;  1LNS A;  2BXA A;  3A75 A;  2BXH A;  1HK1 A;  2EFE A;  4M70 B;  4LA0 A;  2DYO A;  3GQU A;  4BKE A;  2KBZ A;  3W1S A;  4TQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...