1JNBA

Connector protein from bacteriophage phi29
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
275
structure length
257
Chain Sequence
SINEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNYRDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFLGIKDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPPER COLLAR PROTEIN
publication title Structure determination of the head-tail connector of bacteriophage phi29.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 57
structure length 257
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05352 Phage_connector Phage Connector (GP10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.30 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1jnbA01
2.40.500.10 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) 1jnbA02
3.30.1350.20 Alpha Beta 2-Layer Sandwich Crambin Bacteriophage PHI-29 conector. Domain 3 1jnbA03
1IJGA 1FOUA 1JNBA 1H5WA
chains in the Genus database with same CATH superfamily
2BXMA 3AK3A 2P4KA 4ZCGA 4JZ2A 4PO0A 1N0NA 3AK2A 4LUFA 2QKCA 4K2CA 3LU6A 2DYOA 2I2ZA 2VDBA 4L9QA 1XILA 3B9LA 4F5VA 4NAWB 5IJFA 2BXHA 5ID7A 1E7CA 1JXXA 5DQFA 4E4EA 2LXTA 3VQIA 1AR4A 1EN4A 3LU7A 1EJGA 2BXNA 1XREA 3FNMA 1WB8A 3G9KD 1JMNA 1CNRA 2OT3A 2PLHA 3BFRA 2KWFA 2CKXA 1J7EA 1JXTA 2CDYA 1GN3A 4FIPB 1IXBA 4FK5B 3MDSA 2ADQB 4TQ1A 1E78A 2BXQA 1BM0A 3NVMA 4IW1A 1HA2A 2EFEA 3KIKA 3C3TA 2XW1A 1O9XA 2XSIA 1CCNA 2CE4A 3LSUA 4FJCB 3SZSA 1VEWA 3PLAA 1AR5A 2OZBB 1GNIA 3RN4A 3JQZA 2V36A 1N0JA 1XUQA 1LNSA 1HK5A 4ZBQA 1E7HA 5GINA 2Z8KA 2BXAA 4G01A 5IIHA 2FD7A 2QHBA 4GDKB 1IDSA 2BXOA 2AJEA 2JUHA 1IX9A 5AG2A 3V08A 1AO6A 4F5UA 5IIXA 3MHSB 1SB0A 1PL4A 2XMOA 2GDSA 1HK3A 1MIVA 4C31B 1QNMA 1YVAA 1MA1A 4N0FD 1ZUQA 3GQUA 3LU8A 4MBEC 1NBLA 1E7EA 3ICXA 1EM1A 2DBWA 1E7BA 4FFKA 2VUFA 4EMXA 4ZBKA 2EYCA 1TXUA 2XVUA 1BT8A 2BXKA 2BXGA 4E99A 3TJTA 1D5NA 3DC5A 1WB7A 2QKAA 3M99C 2EYAA 1FOUA 2NQOA 4GDXA 5IFOA 1VZSA 2EFDA 2LQHA 3QVNA 2DYMA 1BJ5A 1LOTA 2BXEA 4I9OA 1LUWA 1H5WA 4GDLB 4W4UB 5HOZA 3ECPA 3V03A 2RCVA 1NT2B 3V09A 3C8PA 3UIVA 3NVIA 5ID9A 3K9SA 4OR0A 2LXSA 1B06A 5IJEA 4JYYA 4M70B 1E7FA 2ROHA 3EVKA 4GUNA 2KBZA 1JXWA 3FWBC 1KXPD 4LUHA 1E7GA 1UORA 4F6EA 2E0YA 1KW2A 1JR9A 1MNGA 2EYDA 4HGKA 1MA9A 2NNWA 1BSMA 3SIUB 4OT2A 1EN6A 4BY9C 1IJGA 5BPKA 2BXPA 2LOQA 3NVKA 2AW9A 2BX8A 4YIOA 4OTUA 4ZBRA 4JK4A 5GIOA 2DG5A 1MM8A 3NMUA 4WA6B 1YV8A 1TF0A 2E0XA 1VARA 1AVMA 1E7IA 1P7GA 2QMCA 2VUEA 2EFCA 1HK2A 3B9MA 5GIPA 1KDXA 1EN5A 4LA0A 2XVWA 1ZTEA 1AP5A 2XVVA 1OKHA 3CX9A 4OTTA 1VFIA 1XDCA 3BPJA 5D7GA 4L9KA 4F5TA 1AB1A 1GN2A 2I30A 1BKEA 1HK1A 1ORLA 3U7TA 1JA8A 4BR6A 4X9QA 1MIWA 2EYBA 3OT7A 1SZXA 1I0HA 1GN4A 1LUVA 2EFHA 1MSDA 1AP6A 1MUSA 3KDRA 1HK4A 4L8UA 4FC1A 2BXBA 4N0UD 2QM6A 4DHXB 1CXRA 3AK1A 3SQJA 2BXCA 1E7AA 5B5TA 5IIUA 4IW2A 3CEIA 4LB9A 3KKYA 5DBYA 1Y67A 3JRYA 5GHKA 2BXDA 3GA9L 4N3ZA 1J78A 1GNJA 3WHQA 1MMMA 4YIPA 3C3SA 2Z8IA 4D7XA 2YDFA 2FD9A 4C7UA 3H3AA 1ED0A 2V9BA 3A73A 5IJ5A 2BXIA 2K0NA 2BXLA 4BKEA 2DBUA 3DC6A 3KJLA 1ZSPA 1N5UA 4ZC6A 1BS3A 2LQIA 1WUWA 1JXYA 3FWCC 1MIYA 3SIVB 2ADPA 3WHRA 1CBNA 1JMPA 2Z8JA 3W1SA 4F5SA 4J2VA 1JNBA 1BHPA 4S1YA 5A9GA 4GG2A 4G03A 3WHSA 5FUOA 2XW0A 4K71A 3UE7B 3NIRA 1CRNA 3TDLA 1MUHA 3MHHB 2DBXA 4JZGA 2BXFA 1CCMA 4ZUXV 4Z69A 1H9ZA 1KKCA 4TQ0A 1I08A 4G04A 2GUTA 2XVQA 2AGHB 4DM0A 1GN6A 1ZLZA 1JXUA 3H37A 4Z9OA 1PM9A 3A75A 3GQXA 4HGMB 4LB2A
chains in the Genus database with same CATH topology
1E7GA 1UORA 5DBYA 2E0YA 1KW2A 2BXMA 3JRYA 5GHKA 2BXOA 2AJEA 2JUHA 4HGKA 2BXDA 1MA9A 3GA9L 4N3ZA 2NNWA 3SIUB 4OT2A 4ZCGA 1J78A 4BY9C 1IJGA 1GNJA 4PO0A 3V08A 1AO6A 3WHQA 2BXPA 4LUFA 2LOQA 5BPKA 3NVKA 2BX8A 4K2CA 4F5UA 3LU6A 5IIXA 2DYOA 2I2ZA 3MHSB 2VDBA 2Z8IA 4L9QA 2XMOA 3B9LA 4OTUA 2YDFA 4ZBRA 4F5VA 4NAWB 5IJFA 1HK3A 4JK4A 5GIOA 2DG5A 1MIVA 2BXHA 3H3AA 5ID7A 1E7CA 3NMUA 4C31B 4WA6B 5DQFA 4N0FD 3VQIA 1TF0A 2E0XA 3GQUA 3A73A 3LU8A 4MBEC 5IJ5A 3LU7A 2BXNA 2BXLA 1E7IA 2DBUA 3FNMA 1E7EA 3ICXA 4BKEA 2QMCA 3KJLA 2VUEA 2DBWA 3G9KD 1N5UA 1E7BA 2EFCA 4ZC6A 2VUFA 4EMXA 4ZBKA 1HK2A 1TXUA 2OT3A 2XVUA 3B9MA 2BXKA 3FWCC 5GIPA 2BXGA 1MIYA 2CKXA 4E99A 3SIVB 4LA0A 3WHRA 2XVWA 1J7EA 2XVVA 2Z8JA 3CX9A 3W1SA 4F5SA 4OTTA 1VFIA 4FIPB 4J2VA 3M99C 4FK5B 4TQ1A 1JNBA 5D7GA 4L9KA 4F5TA 1E78A 1FOUA 2NQOA 4HGMB 4S1YA 4GG2A 2BXQA 1BM0A 4G03A 3NVMA 4GDXA 5IFOA 1VZSA 2I30A 3WHSA 4IW1A 2XW0A 4K71A 2EFDA 5FUOA 1BKEA 2DYMA 1HA2A 2EFEA 1HK1A 1BJ5A 3KIKA 1LOTA 2BXEA 2XW1A 1O9XA 3TDLA 1H5WA 2XSIA 4GDLB 4W4UB 3MHHB 5HOZA 3V03A 2DBXA 4FJCB 1MIWA 2BXFA 1NT2B 3V09A 3PLAA 4ZUXV 2EFHA 4Z69A 2OZBB 1H9ZA 3UIVA 1GNIA 4TQ0A 3NVIA 5ID9A 3JQZA 2V36A 4G04A 1LNSA 4OR0A 1HK5A 1HK4A 4L8UA 2XVQA 2BXBA 4ZBQA 1E7HA 5GINA 4N0UD 2Z8KA 2QM6A 4DHXB 5IJEA 4M70B 1E7FA 2ROHA 3SQJA 2BXCA 1E7AA 2BXAA 2KBZA 5B5TA 3FWBC 4G01A 4IW2A 5IIUA 3H37A 4LB9A 1KXPD 4Z9OA 4GDKB 4LUHA 5IIHA 3A75A 3GQXA 2QHBA 2BXIA 4LB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJG A;  1FOU A;  1JNB A;  1H5W A; 
#chains in the Genus database with same CATH topology
 2BXM A;  3AK3 A;  2P4K A;  4ZCG A;  4JZ2 A;  4PO0 A;  1N0N A;  3AK2 A;  4LUF A;  2QKC A;  4K2C A;  3LU6 A;  2DYO A;  2I2Z A;  2VDB A;  4L9Q A;  1XIL A;  3B9L A;  4F5V A;  4NAW B;  5IJF A;  2BXH A;  5ID7 A;  1E7C A;  1JXX A;  5DQF A;  4E4E A;  2LXT A;  3VQI A;  1AR4 A;  1EN4 A;  3LU7 A;  1EJG A;  2BXN A;  1XRE A;  3FNM A;  1WB8 A;  3G9K D;  1JMN A;  1CNR A;  2OT3 A;  2PLH A;  3BFR A;  2KWF A;  2CKX A;  1J7E A;  1JXT A;  2CDY A;  1GN3 A;  4FIP B;  1IXB A;  4FK5 B;  3MDS A;  2ADQ B;  4TQ1 A;  1E78 A;  2BXQ A;  1BM0 A;  3NVM A;  4IW1 A;  1HA2 A;  2EFE A;  3KIK A;  3C3T A;  2XW1 A;  1O9X A;  2XSI A;  1CCN A;  2CE4 A;  3LSU A;  4FJC B;  3SZS A;  1VEW A;  3PLA A;  1AR5 A;  2OZB B;  1GNI A;  3RN4 A;  3JQZ A;  2V36 A;  1N0J A;  1XUQ A;  1LNS A;  1HK5 A;  4ZBQ A;  1E7H A;  5GIN A;  2Z8K A;  2BXA A;  4G01 A;  5IIH A;  2FD7 A;  2QHB A;  4GDK B;  1IDS A;  2BXO A;  2AJE A;  2JUH A;  1IX9 A;  5AG2 A;  3V08 A;  1AO6 A;  4F5U A;  5IIX A;  3MHS B;  1SB0 A;  1PL4 A;  2XMO A;  2GDS A;  1HK3 A;  1MIV A;  4C31 B;  1QNM A;  1YVA A;  1MA1 A;  4N0F D;  1ZUQ A;  3GQU A;  3LU8 A;  4MBE C;  1NBL A;  1E7E A;  3ICX A;  1EM1 A;  2DBW A;  1E7B A;  4FFK A;  2VUF A;  4EMX A;  4ZBK A;  2EYC A;  1TXU A;  2XVU A;  1BT8 A;  2BXK A;  2BXG A;  4E99 A;  3TJT A;  1D5N A;  3DC5 A;  1WB7 A;  2QKA A;  3M99 C;  2EYA A;  1FOU A;  2NQO A;  4GDX A;  5IFO A;  1VZS A;  2EFD A;  2LQH A;  3QVN A;  2DYM A;  1BJ5 A;  1LOT A;  2BXE A;  4I9O A;  1LUW A;  1H5W A;  4GDL B;  4W4U B;  5HOZ A;  3ECP A;  3V03 A;  2RCV A;  1NT2 B;  3V09 A;  3C8P A;  3UIV A;  3NVI A;  5ID9 A;  3K9S A;  4OR0 A;  2LXS A;  1B06 A;  5IJE A;  4JYY A;  4M70 B;  1E7F A;  2ROH A;  3EVK A;  4GUN A;  2KBZ A;  1JXW A;  3FWB C;  1KXP D;  4LUH A;  1E7G A;  1UOR A;  4F6E A;  2E0Y A;  1KW2 A;  1JR9 A;  1MNG A;  2EYD A;  4HGK A;  1MA9 A;  2NNW A;  1BSM A;  3SIU B;  4OT2 A;  1EN6 A;  4BY9 C;  1IJG A;  5BPK A;  2BXP A;  2LOQ A;  3NVK A;  2AW9 A;  2BX8 A;  4YIO A;  4OTU A;  4ZBR A;  4JK4 A;  5GIO A;  2DG5 A;  1MM8 A;  3NMU A;  4WA6 B;  1YV8 A;  1TF0 A;  2E0X A;  1VAR A;  1AVM A;  1E7I A;  1P7G A;  2QMC A;  2VUE A;  2EFC A;  1HK2 A;  3B9M A;  5GIP A;  1KDX A;  1EN5 A;  4LA0 A;  2XVW A;  1ZTE A;  1AP5 A;  2XVV A;  1OKH A;  3CX9 A;  4OTT A;  1VFI A;  1XDC A;  3BPJ A;  5D7G A;  4L9K A;  4F5T A;  1AB1 A;  1GN2 A;  2I30 A;  1BKE A;  1HK1 A;  1ORL A;  3U7T A;  1JA8 A;  4BR6 A;  4X9Q A;  1MIW A;  2EYB A;  3OT7 A;  1SZX A;  1I0H A;  1GN4 A;  1LUV A;  2EFH A;  1MSD A;  1AP6 A;  1MUS A;  3KDR A;  1HK4 A;  4L8U A;  4FC1 A;  2BXB A;  4N0U D;  2QM6 A;  4DHX B;  1CXR A;  3AK1 A;  3SQJ A;  2BXC A;  1E7A A;  5B5T A;  5IIU A;  4IW2 A;  3CEI A;  4LB9 A;  3KKY A;  5DBY A;  1Y67 A;  3JRY A;  5GHK A;  2BXD A;  3GA9 L;  4N3Z A;  1J78 A;  1GNJ A;  3WHQ A;  1MMM A;  4YIP A;  3C3S A;  2Z8I A;  4D7X A;  2YDF A;  2FD9 A;  4C7U A;  3H3A A;  1ED0 A;  2V9B A;  3A73 A;  5IJ5 A;  2BXI A;  2K0N A;  2BXL A;  4BKE A;  2DBU A;  3DC6 A;  3KJL A;  1ZSP A;  1N5U A;  4ZC6 A;  1BS3 A;  2LQI A;  1WUW A;  1JXY A;  3FWC C;  1MIY A;  3SIV B;  2ADP A;  3WHR A;  1CBN A;  1JMP A;  2Z8J A;  3W1S A;  4F5S A;  4J2V A;  1JNB A;  1BHP A;  4S1Y A;  5A9G A;  4GG2 A;  4G03 A;  3WHS A;  5FUO A;  2XW0 A;  4K71 A;  3UE7 B;  3NIR A;  1CRN A;  3TDL A;  1MUH A;  3MHH B;  2DBX A;  4JZG A;  2BXF A;  1CCM A;  4ZUX V;  4Z69 A;  1H9Z A;  1KKC A;  4TQ0 A;  1I08 A;  4G04 A;  2GUT A;  2XVQ A;  2AGH B;  4DM0 A;  1GN6 A;  1ZLZ A;  1JXU A;  3H37 A;  4Z9O A;  1PM9 A;  3A75 A;  3GQX A;  4HGM B;  4LB2 A; 
#chains in the Genus database with same CATH homology
 1E7G A;  1UOR A;  5DBY A;  2E0Y A;  1KW2 A;  2BXM A;  3JRY A;  5GHK A;  2BXO A;  2AJE A;  2JUH A;  4HGK A;  2BXD A;  1MA9 A;  3GA9 L;  4N3Z A;  2NNW A;  3SIU B;  4OT2 A;  4ZCG A;  1J78 A;  4BY9 C;  1IJG A;  1GNJ A;  4PO0 A;  3V08 A;  1AO6 A;  3WHQ A;  2BXP A;  4LUF A;  2LOQ A;  5BPK A;  3NVK A;  2BX8 A;  4K2C A;  4F5U A;  3LU6 A;  5IIX A;  2DYO A;  2I2Z A;  3MHS B;  2VDB A;  2Z8I A;  4L9Q A;  2XMO A;  3B9L A;  4OTU A;  2YDF A;  4ZBR A;  4F5V A;  4NAW B;  5IJF A;  1HK3 A;  4JK4 A;  5GIO A;  2DG5 A;  1MIV A;  2BXH A;  3H3A A;  5ID7 A;  1E7C A;  3NMU A;  4C31 B;  4WA6 B;  5DQF A;  4N0F D;  3VQI A;  1TF0 A;  2E0X A;  3GQU A;  3A73 A;  3LU8 A;  4MBE C;  5IJ5 A;  3LU7 A;  2BXN A;  2BXL A;  1E7I A;  2DBU A;  3FNM A;  1E7E A;  3ICX A;  4BKE A;  2QMC A;  3KJL A;  2VUE A;  2DBW A;  3G9K D;  1N5U A;  1E7B A;  2EFC A;  4ZC6 A;  2VUF A;  4EMX A;  4ZBK A;  1HK2 A;  1TXU A;  2OT3 A;  2XVU A;  3B9M A;  2BXK A;  3FWC C;  5GIP A;  2BXG A;  1MIY A;  2CKX A;  4E99 A;  3SIV B;  4LA0 A;  3WHR A;  2XVW A;  1J7E A;  2XVV A;  2Z8J A;  3CX9 A;  3W1S A;  4F5S A;  4OTT A;  1VFI A;  4FIP B;  4J2V A;  3M99 C;  4FK5 B;  4TQ1 A;  1JNB A;  5D7G A;  4L9K A;  4F5T A;  1E78 A;  1FOU A;  2NQO A;  4HGM B;  4S1Y A;  4GG2 A;  2BXQ A;  1BM0 A;  4G03 A;  3NVM A;  4GDX A;  5IFO A;  1VZS A;  2I30 A;  3WHS A;  4IW1 A;  2XW0 A;  4K71 A;  2EFD A;  5FUO A;  1BKE A;  2DYM A;  1HA2 A;  2EFE A;  1HK1 A;  1BJ5 A;  3KIK A;  1LOT A;  2BXE A;  2XW1 A;  1O9X A;  3TDL A;  1H5W A;  2XSI A;  4GDL B;  4W4U B;  3MHH B;  5HOZ A;  3V03 A;  2DBX A;  4FJC B;  1MIW A;  2BXF A;  1NT2 B;  3V09 A;  3PLA A;  4ZUX V;  2EFH A;  4Z69 A;  2OZB B;  1H9Z A;  3UIV A;  1GNI A;  4TQ0 A;  3NVI A;  5ID9 A;  3JQZ A;  2V36 A;  4G04 A;  1LNS A;  4OR0 A;  1HK5 A;  1HK4 A;  4L8U A;  2XVQ A;  2BXB A;  4ZBQ A;  1E7H A;  5GIN A;  4N0U D;  2Z8K A;  2QM6 A;  4DHX B;  5IJE A;  4M70 B;  1E7F A;  2ROH A;  3SQJ A;  2BXC A;  1E7A A;  2BXA A;  2KBZ A;  5B5T A;  3FWB C;  4G01 A;  4IW2 A;  5IIU A;  3H37 A;  4LB9 A;  1KXP D;  4Z9O A;  4GDK B;  4LUH A;  5IIH A;  3A75 A;  3GQX A;  2QHB A;  2BXI A;  4LB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...