4G01A

Ara7-gdp-ca2+/vps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
237
structure length
237
Chain Sequence
b'VKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein 9A
publication title Direct metal recognition by guanine nucleotide-exchange factor in the initial step of the exchange reaction
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 101
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4g01A01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g01A02
1TXUA 2EFHA 2EFDA 4N3ZA 2EFEA 4G01A 2OT3A 2EFCA
chains in the Genus database with same CATH superfamily
4BL7A 4HGMB 1PX7A 4LUFA 3QR6A 5AGYA 2CAIA 1MTCA 5ECSA 1HQOA 2BXCA 3UBLA 2YV7A 3M0FA 2GTUA 3ZFLA 5ECOB 1GWCA 4FK5B 1GLPA 4YAPA 4ISDA 3ISOA 4JZQA 4JBBA 1ML6A 2BXPA 4YH2A 4GDFA 5J40A 5DQSA 1J7EA 1KBNA 1ZL9A 2HNLA 2R6KA 5ECQB 3AY8A 5DBYA 2C80A 22GSA 4IKHA 2E0XA 13GSA 2XVUA 2GUTA 1MIWA 4L9QA 1K0BA 5FWGA 1HK2A 2BXEA 2DBWA 1K0MA 1HNAA 2XW0A 3EINA 5FHIA 1EEMA 4E8EA 4PHZC 1HNCA 4ZXGA 3VI7A 5BPKA 5D9WA 1EOGA 1NHYA 4EXJA 1A0FA 5ECIB 4OMVA 3B9MA 2OADA 2CZ2A 2I2ZA 2VUEA 2BXFA 3FR6A 4F5TA 4JEDA 3U6VA 2BXAA 2O5VA 1YVLA 2NQOA 3MDKA 1BJ5A 4G0IA 4DEJA 2WS2A 1VF4A 2AAWA 4MZWA 5EL8A 3GTUB 2IMIA 4K0NA 4DM0A 5GIOA 2J9HA 2K0NA 3JQZA 2OZBB 2N5FA 4AI6A 4MK3A 3CSHA 1FOUA 2BXGA 1GNIA 1OYJA 1TU8A 5DDLA 4AKIA 4LMVA 3KXOA 1BF5A 1AXDA 3G7IA 4F5SA 1K0NA 3DD3A 4PGTA 3ZFBA 6GSTA 2FHEA 5F07A 3SWLA 2EFHA 3GQUA 4TQ0A 3IR4A 3KJYA 4N0UD 4F0BA 2VKZG 4EDZA 3GTUA 3H1NA 1K0AA 5J4VA 4Q5QA 1E7CA 5IIUA 5D9VA 3FYGA 1UA5A 10GSA 4PQIA 1GNWA 4IBPA 2JUHA 4J2FA 1SVLA 5A4VA 3FNMA 3A75A 2XVQA 2LXSA 5IJ5A 3LJRA 4JK4A 1SVOA 3HJOA 4IW1A 6GSVA 4KDYA 6GSUA 4BVXB 4L9KA 3I6AA 4MPFA 2CAQA 4AKXB 4G0KA 5F06A 1GNEA 1KW2A 2O36A 5J4UA 4IGJA 4ZBBA 5A1NB 3NVMA 3HJMA 2VDBA 3Q74A 5DALB 5AN1A 3NMUA 3UAPA 1SB0A 4S1YA 1BX9A 1YEWC 1E7GA 4MBEC 1B4PA 4IQ1A 3CX9A 4EMXA 1K0CA 1YQ1A 2HRKA 3HKRA 4BVXA 3GSTA 4YQVA 3F63A 2GLRA 5DCGA 2AHEA 3QAWA 4PI0C 1BYEA 2EFDA 1XWGA 2DBUA 4BVYB 5A1NA 1ZGNA 5DALA 3V09A 1MD3A 2DG5A 2BXLA 3WD6A 3LSZA 2F8FA 3LYKA 2LJRA 4KAEA 3SIVB 1F2EA 1N5UA 4GCIA 4MF7A 2YDFA 1UORA 4FQUA 4GLTA 5DAKB 1MD4A 1EOHA 2VCZA 3GUSA 4PURA 3MHSB 1HA2A 1HK4A 2ON7A 5ECMB 5EVOA 3TOTA 5J47A 2GSSA 1GUMA 4G03A 3G9KD 4BVYA 2BXDA 4G01A 14GSA 2XVWA 5B7CA 4DHXB 3PR8A 4ECBA 4BY9C 4ZB8A 2XW1A 3WHSA 1HK3A 1XW6A 2EFEA 4Z69A 1MM8A 4QMKA 5A4UA 2JL4A 12GSA 3UVHA 4Z9OA 5DAKA 3B9LA 1V2AA 2DYOA 2VCXA 2E0YA 4KH7A 5A4WA 2CA8A 1AQWA 4MPGA 4HZ4A 5ECPB 5JCWA 1MA9A 1KXPD 2IL3A 3DGQA 3I69A 2VCWA 1GTIA 3IBHA 5ECNB 4ECJA 1C72A 1BAYA 1JZRA 3H37A 1N2AA 1PD21 4KF9A 4KDUA 5LCZA 4ZC6A 1PN9A 1TU7A 3TDLA 2LQIA 3CSIA 1B48A 2DSAA 5A5KA 1TDIA 2R3XA 3KTLA 2O3EA 1JLWA 3F6DA 1F3BA 1GTUA 4K71A 1VFIA 4OT2A 4GTUA 3KMOA 2BXOA 2C3TA 4GDKB 3V03A 3SQJA 3WHRA 4PXOA 4KDXA 3ECPA 1VF2A 4PO0A 16GSA 5ELGA 4C31B 4ECIA 1GSDA 3LQ7A 1HK1A 5DJLA 2BXNA 3P8WA 4KE3A 4F5UA 4N0VA 1AW9A 3FWCC 4GSSA 4J2VA 2WRTA 4ZB9A 4WR5A 4ACSA 5D7GA 4ZBKA 1GTAA 3GSSA 4PQHA 2ON5A 1Y1UA 5B5TA 2VCQA 3VPTA 2Z8IA 4L5OA 4AGSA 9GSSA 3LU6A 4NHWA 3QAGA 3MHHB 5A34B 4AKGA 2C3QA 5IJEA 5GHKA 20GSA 2WZSA 4K0GA 1AQVA 1FW1A 5ECHB 3GA9L 2KBZA 1GSUA 4Q5NA 4M70B 5IIXA 1RK4A 2HRAA 4OTTA 5GZZB 1GSFA 1I1IP 1HNBA 1U3IA 5J41A 18GSA 1S4BP 2LQHA 4ZB7A 3LU7A 1BG1A 5HFKA 4USSA 2OACA 4W66A 4MF6A 1MUSA 3R2QA 5F0GA 1XWKA 3PPUA 5A34A 1GSSA 1GTBA 4OFNA 5GINA 1XW5A 1LNSA 2PERA 4HZ2A 4NAWB 5F8BA 3ZMKA 4ZBRA 3CSJA 1BM0A 5DQFA 1GUHA 4IJIA 2GSRA 3IC8A 4PNFA 3GH6A 3QAVA 5ECKB 4F0CA 3Q18A 3M1GA 3LYPA 1O9XA 1GSQA 3D0ZA 3O76A 5ELAA 1TXUA 1B8XA 2F3MA 4AKHA 4NAXA 2H1LA 3V08A 4MDCA 1IYHA 2C4JA 5KEJA 1LOTA 3ZMLA 2BX8A 5ID9A 2R5GA 3KJLA 4IELA 3TGZA 5GIPA 5ID7A 1V40A 1VF3A 4ZB6A 4LUHA 3RFRC 4G10A 3VURA 4G04A 2KWFA 6GSXA 4IVFA 1K0DA 3LU8A 4Q5RA 4Q5FA 4L8EA 3FWBC 1E6BA 1R5AA 1MIVA 4N0FD 4FXYP 1G6WA 1IJGA 2XSIA 1GSYA 5BMUB 4KSMA 3UIVA 4IS0A 1GULA 1E7FA 4E99A 3LXZA 3JRYA 4L8UA 3CRTA 4WR4A 3TOUA 1K3LA 1PKWA 4G19A 3M99C 1K3OA 17GSA 4I97A 1TF0A 1E7HA 4LA0A 1EV9A 2AB6A 5G5EA 4PTSA 1YJ6A 4I9OA 3BBYA 4G0LA 4ID0A 8GSSA 2BXHA 4N3ZA 1M9BA 2OA7A 2UV8G 1GLQA 3TU3B 4LB9A 4K2CA 2I30A 2PMTA 4IQAA 5J5NA 1H9ZA 2GSTA 2PVQA 2WVYA 7GSSA 4LB2A 2C8UA 2YCDA 5LD0A 1EV4A 3IK9A 5AISA 1IYIA 4HGKA 2DC5A 1JLVA 1F3AA 1Z9HA 2HSNB 4HOJA 4MF5A 4KX4A 5GSTA 1HK5A 4FJCB 4FIPB 3GX0A 3PLAA 2WVXB 1YKCA 19GSA 4L5LA 1YDKA 4ECCA 3VWXA 2VCTA 3RGBC 3LFLA 2QM6A 2HSMB 2A2RA 1N25A 4RI7A 1MUHA 2X64A 2VD0A 4PX1A 3RBTA 2BXKA 3VK9A 2C3NA 2V36A 1M9AA 3CWGA 4GSNA 3VLNA 4HJ2A 1VF1A 2WB9A 2HSNA 3IK7A 2AGHB 1PMTA 1PL2A 2WVXA 5EY6A 2OT3A 3HMJG 4YAVA 3LXTA 3O3TA 5GSSA 2HSMA 1PL1A 4ZCGA 4LMWA 1Q4JA 2QHBA 4IW2A 1FHEA 2EFCA 2IMKA 1G7OA 4W4UB 1GNJA 1NT2B 4ZBDA 1E78A 3MAKA 2PGTA 4WA6B 2VD1A 2NNWA 4F5VA 3NVKA 4KGIA 5AIXA 2DBXA 2WVZA 4ZBAA 3N5OA 4F03A 3IE3A 2XMOA 3M3MA 4EE0A 2R4VA 1E7IA 2WDUA 2A2SA 2WJUA 1J78A 2VUFA 5J4YA 2LXTA 3GQXA 1VZSA 2FNOA 2CKXA 5A5HB 5ECRB 4G9HA 3W1SA 1KDXA 3P90A 4EDYA 4O92A 3C8EA 3Q19A 5JCUA 1U88A 5D9XA 2WW2A 4PI2C 2VCVA 2Z8JA 3WYWA 3SIUB 4RI6A 1PX6A 3F6FA 1MIYA 5FUOA 4OR0A 1GUKA 5DJMA 3WHQA 1SVMA 5AIVA 1AO6A 3LG6A 2DYMA 1PKZA 2NTOA 2YV9A 2PBJA 5A5HA 2GDRA 1YY7A 3FR9A 3FRCA 3FR3A 4HI7A 4E8HA 5FT3A 1G6YA 3FY7A 4OFTA 4MP4A 4YQMA 3VQIA 4GSTA 2WW0A 4PUAA 2WW3A 1PA3A 2BXIA 1BG5A 3NIVA 1E7BA 5IJFA 5G5FA 1BKEA 2HRKB 5D73A 11GSA 3VPQA 1E7AA 3CBUA 4YQUA 1TW9A 6GSWA 1M99A 4D7XA 4PNGA 3KM6A 4NHZA 2VO4A 4GG2A 3KMNA 3M8NA 4EC0A 3CHXC 3GURA 4GF0A 3N9JA 4TOPA 1LBKA 1OE8A 2CZ3A 3L0HA 5IFOA 3ERGA 4QQ7A 2BXBA 5ECLB 1Y6EA 2BXMA 3PGTA 4ZBQA 3A73A 4IW9A 4OTUA 3KIKA 3NVIA 1LJRA 3UARA 3G7JA 3H3AA 1OKTA 2QMCA 4GDLB 5F05A 1JNBA 1H5WA 3ERFA 3VI5A 1M0UA 3W8SA 1PGTA 1GSEA 1U87A 4OFMA 2HQTA 4TQ1A 1OE7A 2BXQA 4CHSA 5BMUA 2ROHA 2UZ8A 5IIHA 4BL7B 3BPJA 2D2ZA 3UBKA 5IQYA 3EE2A 4O7HA 5D9TA 2V6KA 1DUGA 4E68A 6GSSA 2LOQA 1E7EA 3CRUA 5HOZA 1AQXA 6GSYA 4GDXA 2AJEA 4BKEA 1K0OA 2GSQA 4ZUXV 1K3YA 2XVVA 1USBA 2WW1A 3R3EA 3ICXA 2Z8KA 2CVDA
chains in the Genus database with same CATH topology
4BL7A 4HGMB 1PX7A 4LUFA 3QR6A 5AGYA 2CAIA 1MTCA 5ECSA 1HQOA 2BXCA 3UBLA 2YV7A 3M0FA 2GTUA 3ZFLA 5ECOB 1GWCA 4FK5B 1GLPA 4YAPA 4ISDA 3ISOA 4JZQA 4JBBA 1ML6A 2BXPA 4YH2A 4GDFA 5J40A 5DQSA 1J7EA 1KBNA 1ZL9A 2HNLA 2R6KA 5ECQB 3AY8A 5DBYA 2C80A 22GSA 4IKHA 2E0XA 13GSA 2XVUA 1MIWA 4L9QA 1K0BA 5FWGA 1HK2A 2BXEA 2DBWA 1K0MA 1HNAA 2XW0A 3EINA 5FHIA 1EEMA 4E8EA 1HNCA 4ZXGA 3VI7A 5BPKA 5D9WA 1EOGA 1NHYA 4EXJA 1A0FA 5ECIB 4OMVA 3B9MA 2OADA 2CZ2A 2I2ZA 2VUEA 2BXFA 3FR6A 4F5TA 4JEDA 3U6VA 2BXAA 2O5VA 1YVLA 2NQOA 3MDKA 1BJ5A 4G0IA 4DEJA 2WS2A 1VF4A 2AAWA 4MZWA 5EL8A 3GTUB 2IMIA 4K0NA 5GIOA 2J9HA 3JQZA 2OZBB 2N5FA 4AI6A 4MK3A 3CSHA 1FOUA 2BXGA 1GNIA 1OYJA 1TU8A 5DDLA 4AKIA 4LMVA 3KXOA 1BF5A 1AXDA 3G7IA 4F5SA 1K0NA 3DD3A 4PGTA 3ZFBA 6GSTA 2FHEA 5F07A 3SWLA 2EFHA 3GQUA 4TQ0A 3IR4A 3KJYA 4N0UD 4F0BA 2VKZG 4EDZA 3GTUA 3H1NA 1K0AA 5J4VA 4Q5QA 1E7CA 5IIUA 5D9VA 3FYGA 1UA5A 10GSA 4PQIA 1GNWA 4IBPA 2JUHA 4J2FA 1SVLA 5A4VA 3FNMA 3A75A 2XVQA 5IJ5A 3LJRA 4JK4A 1SVOA 3HJOA 4IW1A 6GSVA 4KDYA 6GSUA 4BVXB 4L9KA 3I6AA 4MPFA 2CAQA 4AKXB 4G0KA 5F06A 1GNEA 1KW2A 5J4UA 4IGJA 4ZBBA 5A1NB 3NVMA 3HJMA 2VDBA 3Q74A 5DALB 5AN1A 3NMUA 3UAPA 4S1YA 1BX9A 1E7GA 4MBEC 1B4PA 4IQ1A 3CX9A 4EMXA 1K0CA 1YQ1A 2HRKA 3HKRA 4BVXA 3GSTA 4YQVA 3F63A 2GLRA 5DCGA 2AHEA 3QAWA 1BYEA 2EFDA 1XWGA 2DBUA 4BVYB 5A1NA 1ZGNA 5DALA 3V09A 1MD3A 2DG5A 2BXLA 3WD6A 3LSZA 2F8FA 3LYKA 2LJRA 4KAEA 3SIVB 1F2EA 1N5UA 4GCIA 4MF7A 2YDFA 1UORA 4FQUA 4GLTA 5DAKB 1MD4A 1EOHA 2VCZA 3GUSA 4PURA 3MHSB 1HA2A 1HK4A 2ON7A 5ECMB 5EVOA 3TOTA 5J47A 2GSSA 1GUMA 4G03A 3G9KD 4BVYA 2BXDA 4G01A 14GSA 2XVWA 5B7CA 4DHXB 3PR8A 4ECBA 4BY9C 4ZB8A 2XW1A 3WHSA 1HK3A 1XW6A 2EFEA 4Z69A 5A4UA 4QMKA 2JL4A 12GSA 3UVHA 4Z9OA 5DAKA 3B9LA 1V2AA 2DYOA 2VCXA 2E0YA 4KH7A 5A4WA 2CA8A 1AQWA 4MPGA 4HZ4A 5ECPB 5JCWA 1MA9A 1KXPD 2IL3A 3DGQA 3I69A 2VCWA 1GTIA 3IBHA 5ECNB 4ECJA 1C72A 1BAYA 1JZRA 3H37A 1N2AA 1PD21 4KF9A 4KDUA 5LCZA 4ZC6A 1PN9A 1TU7A 3TDLA 3CSIA 1B48A 2DSAA 5A5KA 1TDIA 2R3XA 3KTLA 1JLWA 3F6DA 1F3BA 1GTUA 4K71A 1VFIA 4OT2A 4GTUA 3KMOA 2BXOA 2C3TA 4GDKB 3V03A 3SQJA 3WHRA 4PXOA 4KDXA 1VF2A 4PO0A 16GSA 5ELGA 4C31B 4ECIA 1GSDA 3LQ7A 1HK1A 5DJLA 2BXNA 3P8WA 4KE3A 4F5UA 4N0VA 1AW9A 3FWCC 4GSSA 4J2VA 2WRTA 4ZB9A 4WR5A 4ACSA 5D7GA 4ZBKA 1GTAA 3GSSA 4PQHA 2ON5A 1Y1UA 5B5TA 2VCQA 3VPTA 2Z8IA 4L5OA 4AGSA 9GSSA 3LU6A 4NHWA 3QAGA 3MHHB 5A34B 4AKGA 2C3QA 5IJEA 5GHKA 20GSA 4K0GA 1AQVA 1FW1A 5ECHB 3GA9L 2KBZA 1GSUA 4Q5NA 4M70B 5IIXA 1RK4A 2HRAA 4OTTA 5GZZB 1GSFA 5J41A 1HNBA 1U3IA 18GSA 1BG1A 4ZB7A 3LU7A 5HFKA 4USSA 2OACA 4W66A 4MF6A 5F0GA 3R2QA 1XWKA 3PPUA 5A34A 1GSSA 1GTBA 4OFNA 5GINA 1XW5A 1LNSA 2PERA 4HZ2A 4NAWB 5F8BA 3ZMKA 4ZBRA 3CSJA 1BM0A 5DQFA 1GUHA 4IJIA 2GSRA 3IC8A 4PNFA 3GH6A 3QAVA 5ECKB 4F0CA 3Q18A 3M1GA 3LYPA 1O9XA 1GSQA 3D0ZA 3O76A 5ELAA 1TXUA 1B8XA 2F3MA 4AKHA 4NAXA 2H1LA 3V08A 4MDCA 1IYHA 2C4JA 5KEJA 1LOTA 3ZMLA 2BX8A 5ID9A 2R5GA 3KJLA 4IELA 3TGZA 5GIPA 5ID7A 1V40A 1VF3A 4ZB6A 4LUHA 4G10A 3VURA 4G04A 6GSXA 4IVFA 1K0DA 3LU8A 4Q5RA 4Q5FA 4L8EA 3FWBC 1E6BA 1R5AA 1MIVA 4N0FD 1G6WA 1IJGA 2XSIA 1GSYA 5BMUB 4KSMA 3UIVA 4IS0A 1GULA 1E7FA 4E99A 3LXZA 3JRYA 4L8UA 3CRTA 4WR4A 3TOUA 1K3LA 1PKWA 4G19A 3M99C 1K3OA 17GSA 4I97A 1TF0A 1E7HA 4LA0A 1EV9A 2AB6A 5G5EA 4PTSA 1YJ6A 3BBYA 4G0LA 4ID0A 8GSSA 2BXHA 4N3ZA 1M9BA 2OA7A 2UV8G 1GLQA 3TU3B 4LB9A 4K2CA 2I30A 2PMTA 4IQAA 5J5NA 1H9ZA 2GSTA 2PVQA 7GSSA 4LB2A 2C8UA 2YCDA 5LD0A 1EV4A 3IK9A 5AISA 1IYIA 4HGKA 2DC5A 1JLVA 1F3AA 1Z9HA 2HSNB 4HOJA 4MF5A 4KX4A 5GSTA 1HK5A 4FJCB 4FIPB 3GX0A 3PLAA 1YKCA 19GSA 4L5LA 1YDKA 4ECCA 3VWXA 2VCTA 3LFLA 2QM6A 2HSMB 2A2RA 1N25A 4RI7A 2X64A 2VD0A 4PX1A 3RBTA 2BXKA 3VK9A 2C3NA 2V36A 1M9AA 3CWGA 4GSNA 3VLNA 4HJ2A 1VF1A 2WB9A 2HSNA 3IK7A 1PMTA 1PL2A 5EY6A 2OT3A 3HMJG 4YAVA 3LXTA 3O3TA 5GSSA 2HSMA 1PL1A 4ZCGA 4LMWA 1Q4JA 2QHBA 4IW2A 1FHEA 2EFCA 2IMKA 1G7OA 4W4UB 1GNJA 1NT2B 4ZBDA 1E78A 3MAKA 2PGTA 4WA6B 2VD1A 2NNWA 4F5VA 3NVKA 4KGIA 5AIXA 2DBXA 4ZBAA 4F03A 3N5OA 3IE3A 2XMOA 3M3MA 4EE0A 2R4VA 1E7IA 2WDUA 2A2SA 2WJUA 1J78A 2VUFA 5J4YA 3GQXA 1VZSA 2FNOA 2CKXA 5A5HB 5ECRB 4G9HA 3W1SA 3P90A 4EDYA 4O92A 3C8EA 3Q19A 5JCUA 1U88A 5D9XA 2VCVA 2Z8JA 3WYWA 3SIUB 4RI6A 1PX6A 3F6FA 1MIYA 5FUOA 4OR0A 1GUKA 5DJMA 3WHQA 1SVMA 5AIVA 1AO6A 3LG6A 2DYMA 1PKZA 2NTOA 2YV9A 2PBJA 5A5HA 2GDRA 1YY7A 3FR9A 3FRCA 3FR3A 4HI7A 4E8HA 5FT3A 1G6YA 3FY7A 4OFTA 4MP4A 4YQMA 3VQIA 4GSTA 4PUAA 1PA3A 2BXIA 1BG5A 3NIVA 1E7BA 5IJFA 5G5FA 1BKEA 2HRKB 5D73A 11GSA 3VPQA 1E7AA 3CBUA 4YQUA 1TW9A 6GSWA 1M99A 4PNGA 3KM6A 4NHZA 2VO4A 4GG2A 3KMNA 3M8NA 4EC0A 3GURA 4GF0A 3N9JA 4TOPA 1LBKA 1OE8A 2CZ3A 3L0HA 5IFOA 3ERGA 4QQ7A 2BXBA 5ECLB 1Y6EA 2BXMA 3PGTA 4ZBQA 3A73A 4IW9A 4OTUA 1LJRA 3KIKA 3NVIA 3UARA 3G7JA 3H3AA 1OKTA 2QMCA 4GDLB 5F05A 1JNBA 1H5WA 3ERFA 3VI5A 1M0UA 3W8SA 1PGTA 1GSEA 1U87A 4OFMA 2HQTA 4TQ1A 1OE7A 2BXQA 4CHSA 5BMUA 2ROHA 2UZ8A 5IIHA 4BL7B 3UBKA 2D2ZA 5IQYA 3EE2A 4O7HA 5D9TA 2V6KA 1DUGA 4E68A 6GSSA 2LOQA 1E7EA 3CRUA 5HOZA 1AQXA 6GSYA 4GDXA 2AJEA 4BKEA 1K0OA 2GSQA 4ZUXV 1K3YA 2XVVA 1USBA 3R3EA 3ICXA 2Z8KA 2CVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXU A;  2EFH A;  2EFD A;  4N3Z A;  2EFE A;  4G01 A;  2OT3 A;  2EFC A; 
#chains in the Genus database with same CATH topology
 4BL7 A;  4HGM B;  1PX7 A;  4LUF A;  3QR6 A;  5AGY A;  2CAI A;  1MTC A;  5ECS A;  1HQO A;  2BXC A;  3UBL A;  2YV7 A;  3M0F A;  2GTU A;  3ZFL A;  5ECO B;  1GWC A;  4FK5 B;  1GLP A;  4YAP A;  4ISD A;  3ISO A;  4JZQ A;  4JBB A;  1ML6 A;  2BXP A;  4YH2 A;  4GDF A;  5J40 A;  5DQS A;  1J7E A;  1KBN A;  1ZL9 A;  2HNL A;  2R6K A;  5ECQ B;  3AY8 A;  5DBY A;  2C80 A;  22GS A;  4IKH A;  2E0X A;  13GS A;  2XVU A;  2GUT A;  1MIW A;  4L9Q A;  1K0B A;  5FWG A;  1HK2 A;  2BXE A;  2DBW A;  1K0M A;  1HNA A;  2XW0 A;  3EIN A;  5FHI A;  1EEM A;  4E8E A;  4PHZ C;  1HNC A;  4ZXG A;  3VI7 A;  5BPK A;  5D9W A;  1EOG A;  1NHY A;  4EXJ A;  1A0F A;  5ECI B;  4OMV A;  3B9M A;  2OAD A;  2CZ2 A;  2I2Z A;  2VUE A;  2BXF A;  3FR6 A;  4F5T A;  4JED A;  3U6V A;  2BXA A;  2O5V A;  1YVL A;  2NQO A;  3MDK A;  1BJ5 A;  4G0I A;  4DEJ A;  2WS2 A;  1VF4 A;  2AAW A;  4MZW A;  5EL8 A;  3GTU B;  2IMI A;  4K0N A;  4DM0 A;  5GIO A;  2J9H A;  2K0N A;  3JQZ A;  2OZB B;  2N5F A;  4AI6 A;  4MK3 A;  3CSH A;  1FOU A;  2BXG A;  1GNI A;  1OYJ A;  1TU8 A;  5DDL A;  4AKI A;  4LMV A;  3KXO A;  1BF5 A;  1AXD A;  3G7I A;  4F5S A;  1K0N A;  3DD3 A;  4PGT A;  3ZFB A;  6GST A;  2FHE A;  5F07 A;  3SWL A;  2EFH A;  3GQU A;  4TQ0 A;  3IR4 A;  3KJY A;  4N0U D;  4F0B A;  2VKZ G;  4EDZ A;  3GTU A;  3H1N A;  1K0A A;  5J4V A;  4Q5Q A;  1E7C A;  5IIU A;  5D9V A;  3FYG A;  1UA5 A;  10GS A;  4PQI A;  1GNW A;  4IBP A;  2JUH A;  4J2F A;  1SVL A;  5A4V A;  3FNM A;  3A75 A;  2XVQ A;  2LXS A;  5IJ5 A;  3LJR A;  4JK4 A;  1SVO A;  3HJO A;  4IW1 A;  6GSV A;  4KDY A;  6GSU A;  4BVX B;  4L9K A;  3I6A A;  4MPF A;  2CAQ A;  4AKX B;  4G0K A;  5F06 A;  1GNE A;  1KW2 A;  2O36 A;  5J4U A;  4IGJ A;  4ZBB A;  5A1N B;  3NVM A;  3HJM A;  2VDB A;  3Q74 A;  5DAL B;  5AN1 A;  3NMU A;  3UAP A;  1SB0 A;  4S1Y A;  1BX9 A;  1YEW C;  1E7G A;  4MBE C;  1B4P A;  4IQ1 A;  3CX9 A;  4EMX A;  1K0C A;  1YQ1 A;  2HRK A;  3HKR A;  4BVX A;  3GST A;  4YQV A;  3F63 A;  2GLR A;  5DCG A;  2AHE A;  3QAW A;  4PI0 C;  1BYE A;  2EFD A;  1XWG A;  2DBU A;  4BVY B;  5A1N A;  1ZGN A;  5DAL A;  3V09 A;  1MD3 A;  2DG5 A;  2BXL A;  3WD6 A;  3LSZ A;  2F8F A;  3LYK A;  2LJR A;  4KAE A;  3SIV B;  1F2E A;  1N5U A;  4GCI A;  4MF7 A;  2YDF A;  1UOR A;  4FQU A;  4GLT A;  5DAK B;  1MD4 A;  1EOH A;  2VCZ A;  3GUS A;  4PUR A;  3MHS B;  1HA2 A;  1HK4 A;  2ON7 A;  5ECM B;  5EVO A;  3TOT A;  5J47 A;  2GSS A;  1GUM A;  4G03 A;  3G9K D;  4BVY A;  2BXD A;  4G01 A;  14GS A;  2XVW A;  5B7C A;  4DHX B;  3PR8 A;  4ECB A;  4BY9 C;  4ZB8 A;  2XW1 A;  3WHS A;  1HK3 A;  1XW6 A;  2EFE A;  4Z69 A;  1MM8 A;  4QMK A;  5A4U A;  2JL4 A;  12GS A;  3UVH A;  4Z9O A;  5DAK A;  3B9L A;  1V2A A;  2DYO A;  2VCX A;  2E0Y A;  4KH7 A;  5A4W A;  2CA8 A;  1AQW A;  4MPG A;  4HZ4 A;  5ECP B;  5JCW A;  1MA9 A;  1KXP D;  2IL3 A;  3DGQ A;  3I69 A;  2VCW A;  1GTI A;  3IBH A;  5ECN B;  4ECJ A;  1C72 A;  1BAY A;  1JZR A;  3H37 A;  1N2A A;  1PD2 1;  4KF9 A;  4KDU A;  5LCZ A;  4ZC6 A;  1PN9 A;  1TU7 A;  3TDL A;  2LQI A;  3CSI A;  1B48 A;  2DSA A;  5A5K A;  1TDI A;  2R3X A;  3KTL A;  2O3E A;  1JLW A;  3F6D A;  1F3B A;  1GTU A;  4K71 A;  1VFI A;  4OT2 A;  4GTU A;  3KMO A;  2BXO A;  2C3T A;  4GDK B;  3V03 A;  3SQJ A;  3WHR A;  4PXO A;  4KDX A;  3ECP A;  1VF2 A;  4PO0 A;  16GS A;  5ELG A;  4C31 B;  4ECI A;  1GSD A;  3LQ7 A;  1HK1 A;  5DJL A;  2BXN A;  3P8W A;  4KE3 A;  4F5U A;  4N0V A;  1AW9 A;  3FWC C;  4GSS A;  4J2V A;  2WRT A;  4ZB9 A;  4WR5 A;  4ACS A;  5D7G A;  4ZBK A;  1GTA A;  3GSS A;  4PQH A;  2ON5 A;  1Y1U A;  5B5T A;  2VCQ A;  3VPT A;  2Z8I A;  4L5O A;  4AGS A;  9GSS A;  3LU6 A;  4NHW A;  3QAG A;  3MHH B;  5A34 B;  4AKG A;  2C3Q A;  5IJE A;  5GHK A;  20GS A;  2WZS A;  4K0G A;  1AQV A;  1FW1 A;  5ECH B;  3GA9 L;  2KBZ A;  1GSU A;  4Q5N A;  4M70 B;  5IIX A;  1RK4 A;  2HRA A;  4OTT A;  5GZZ B;  1GSF A;  1I1I P;  1HNB A;  1U3I A;  5J41 A;  18GS A;  1S4B P;  2LQH A;  4ZB7 A;  3LU7 A;  1BG1 A;  5HFK A;  4USS A;  2OAC A;  4W66 A;  4MF6 A;  1MUS A;  3R2Q A;  5F0G A;  1XWK A;  3PPU A;  5A34 A;  1GSS A;  1GTB A;  4OFN A;  5GIN A;  1XW5 A;  1LNS A;  2PER A;  4HZ2 A;  4NAW B;  5F8B A;  3ZMK A;  4ZBR A;  3CSJ A;  1BM0 A;  5DQF A;  1GUH A;  4IJI A;  2GSR A;  3IC8 A;  4PNF A;  3GH6 A;  3QAV A;  5ECK B;  4F0C A;  3Q18 A;  3M1G A;  3LYP A;  1O9X A;  1GSQ A;  3D0Z A;  3O76 A;  5ELA A;  1TXU A;  1B8X A;  2F3M A;  4AKH A;  4NAX A;  2H1L A;  3V08 A;  4MDC A;  1IYH A;  2C4J A;  5KEJ A;  1LOT A;  3ZML A;  2BX8 A;  5ID9 A;  2R5G A;  3KJL A;  4IEL A;  3TGZ A;  5GIP A;  5ID7 A;  1V40 A;  1VF3 A;  4ZB6 A;  4LUH A;  3RFR C;  4G10 A;  3VUR A;  4G04 A;  2KWF A;  6GSX A;  4IVF A;  1K0D A;  3LU8 A;  4Q5R A;  4Q5F A;  4L8E A;  3FWB C;  1E6B A;  1R5A A;  1MIV A;  4N0F D;  4FXY P;  1G6W A;  1IJG A;  2XSI A;  1GSY A;  5BMU B;  4KSM A;  3UIV A;  4IS0 A;  1GUL A;  1E7F A;  4E99 A;  3LXZ A;  3JRY A;  4L8U A;  3CRT A;  4WR4 A;  3TOU A;  1K3L A;  1PKW A;  4G19 A;  3M99 C;  1K3O A;  17GS A;  4I97 A;  1TF0 A;  1E7H A;  4LA0 A;  1EV9 A;  2AB6 A;  5G5E A;  4PTS A;  1YJ6 A;  4I9O A;  3BBY A;  4G0L A;  4ID0 A;  8GSS A;  2BXH A;  4N3Z A;  1M9B A;  2OA7 A;  2UV8 G;  1GLQ A;  3TU3 B;  4LB9 A;  4K2C A;  2I30 A;  2PMT A;  4IQA A;  5J5N A;  1H9Z A;  2GST A;  2PVQ A;  2WVY A;  7GSS A;  4LB2 A;  2C8U A;  2YCD A;  5LD0 A;  1EV4 A;  3IK9 A;  5AIS A;  1IYI A;  4HGK A;  2DC5 A;  1JLV A;  1F3A A;  1Z9H A;  2HSN B;  4HOJ A;  4MF5 A;  4KX4 A;  5GST A;  1HK5 A;  4FJC B;  4FIP B;  3GX0 A;  3PLA A;  2WVX B;  1YKC A;  19GS A;  4L5L A;  1YDK A;  4ECC A;  3VWX A;  2VCT A;  3RGB C;  3LFL A;  2QM6 A;  2HSM B;  2A2R A;  1N25 A;  4RI7 A;  1MUH A;  2X64 A;  2VD0 A;  4PX1 A;  3RBT A;  2BXK A;  3VK9 A;  2C3N A;  2V36 A;  1M9A A;  3CWG A;  4GSN A;  3VLN A;  4HJ2 A;  1VF1 A;  2WB9 A;  2HSN A;  3IK7 A;  2AGH B;  1PMT A;  1PL2 A;  2WVX A;  5EY6 A;  2OT3 A;  3HMJ G;  4YAV A;  3LXT A;  3O3T A;  5GSS A;  2HSM A;  1PL1 A;  4ZCG A;  4LMW A;  1Q4J A;  2QHB A;  4IW2 A;  1FHE A;  2EFC A;  2IMK A;  1G7O A;  4W4U B;  1GNJ A;  1NT2 B;  4ZBD A;  1E78 A;  3MAK A;  2PGT A;  4WA6 B;  2VD1 A;  2NNW A;  4F5V A;  3NVK A;  4KGI A;  5AIX A;  2DBX A;  2WVZ A;  4ZBA A;  3N5O A;  4F03 A;  3IE3 A;  2XMO A;  3M3M A;  4EE0 A;  2R4V A;  1E7I A;  2WDU A;  2A2S A;  2WJU A;  1J78 A;  2VUF A;  5J4Y A;  2LXT A;  3GQX A;  1VZS A;  2FNO A;  2CKX A;  5A5H B;  5ECR B;  4G9H A;  3W1S A;  1KDX A;  3P90 A;  4EDY A;  4O92 A;  3C8E A;  3Q19 A;  5JCU A;  1U88 A;  5D9X A;  2WW2 A;  4PI2 C;  2VCV A;  2Z8J A;  3WYW A;  3SIU B;  4RI6 A;  1PX6 A;  3F6F A;  1MIY A;  5FUO A;  4OR0 A;  1GUK A;  5DJM A;  3WHQ A;  1SVM A;  5AIV A;  1AO6 A;  3LG6 A;  2DYM A;  1PKZ A;  2NTO A;  2YV9 A;  2PBJ A;  5A5H A;  2GDR A;  1YY7 A;  3FR9 A;  3FRC A;  3FR3 A;  4HI7 A;  4E8H A;  5FT3 A;  1G6Y A;  3FY7 A;  4OFT A;  4MP4 A;  4YQM A;  3VQI A;  4GST A;  2WW0 A;  4PUA A;  2WW3 A;  1PA3 A;  2BXI A;  1BG5 A;  3NIV A;  1E7B A;  5IJF A;  5G5F A;  1BKE A;  2HRK B;  5D73 A;  11GS A;  3VPQ A;  1E7A A;  3CBU A;  4YQU A;  1TW9 A;  6GSW A;  1M99 A;  4D7X A;  4PNG A;  3KM6 A;  4NHZ A;  2VO4 A;  4GG2 A;  3KMN A;  3M8N A;  4EC0 A;  3CHX C;  3GUR A;  4GF0 A;  3N9J A;  4TOP A;  1LBK A;  1OE8 A;  2CZ3 A;  3L0H A;  5IFO A;  3ERG A;  4QQ7 A;  2BXB A;  5ECL B;  1Y6E A;  2BXM A;  3PGT A;  4ZBQ A;  3A73 A;  4IW9 A;  4OTU A;  3KIK A;  3NVI A;  1LJR A;  3UAR A;  3G7J A;  3H3A A;  1OKT A;  2QMC A;  4GDL B;  5F05 A;  1JNB A;  1H5W A;  3ERF A;  3VI5 A;  1M0U A;  3W8S A;  1PGT A;  1GSE A;  1U87 A;  4OFM A;  2HQT A;  4TQ1 A;  1OE7 A;  2BXQ A;  4CHS A;  5BMU A;  2ROH A;  2UZ8 A;  5IIH A;  4BL7 B;  3BPJ A;  2D2Z A;  3UBK A;  5IQY A;  3EE2 A;  4O7H A;  5D9T A;  2V6K A;  1DUG A;  4E68 A;  6GSS A;  2LOQ A;  1E7E A;  3CRU A;  5HOZ A;  1AQX A;  6GSY A;  4GDX A;  2AJE A;  4BKE A;  1K0O A;  2GSQ A;  4ZUX V;  1K3Y A;  2XVV A;  1USB A;  2WW1 A;  3R3E A;  3ICX A;  2Z8K A;  2CVD A; 
#chains in the Genus database with same CATH homology
 4BL7 A;  4HGM B;  1PX7 A;  4LUF A;  3QR6 A;  5AGY A;  2CAI A;  1MTC A;  5ECS A;  1HQO A;  2BXC A;  3UBL A;  2YV7 A;  3M0F A;  2GTU A;  3ZFL A;  5ECO B;  1GWC A;  4FK5 B;  1GLP A;  4YAP A;  4ISD A;  3ISO A;  4JZQ A;  4JBB A;  1ML6 A;  2BXP A;  4YH2 A;  4GDF A;  5J40 A;  5DQS A;  1J7E A;  1KBN A;  1ZL9 A;  2HNL A;  2R6K A;  5ECQ B;  3AY8 A;  5DBY A;  2C80 A;  22GS A;  4IKH A;  2E0X A;  13GS A;  2XVU A;  1MIW A;  4L9Q A;  1K0B A;  5FWG A;  1HK2 A;  2BXE A;  2DBW A;  1K0M A;  1HNA A;  2XW0 A;  3EIN A;  5FHI A;  1EEM A;  4E8E A;  1HNC A;  4ZXG A;  3VI7 A;  5BPK A;  5D9W A;  1EOG A;  1NHY A;  4EXJ A;  1A0F A;  5ECI B;  4OMV A;  3B9M A;  2OAD A;  2CZ2 A;  2I2Z A;  2VUE A;  2BXF A;  3FR6 A;  4F5T A;  4JED A;  3U6V A;  2BXA A;  2O5V A;  1YVL A;  2NQO A;  3MDK A;  1BJ5 A;  4G0I A;  4DEJ A;  2WS2 A;  1VF4 A;  2AAW A;  4MZW A;  5EL8 A;  3GTU B;  2IMI A;  4K0N A;  5GIO A;  2J9H A;  3JQZ A;  2OZB B;  2N5F A;  4AI6 A;  4MK3 A;  3CSH A;  1FOU A;  2BXG A;  1GNI A;  1OYJ A;  1TU8 A;  5DDL A;  4AKI A;  4LMV A;  3KXO A;  1BF5 A;  1AXD A;  3G7I A;  4F5S A;  1K0N A;  3DD3 A;  4PGT A;  3ZFB A;  6GST A;  2FHE A;  5F07 A;  3SWL A;  2EFH A;  3GQU A;  4TQ0 A;  3IR4 A;  3KJY A;  4N0U D;  4F0B A;  2VKZ G;  4EDZ A;  3GTU A;  3H1N A;  1K0A A;  5J4V A;  4Q5Q A;  1E7C A;  5IIU A;  5D9V A;  3FYG A;  1UA5 A;  10GS A;  4PQI A;  1GNW A;  4IBP A;  2JUH A;  4J2F A;  1SVL A;  5A4V A;  3FNM A;  3A75 A;  2XVQ A;  5IJ5 A;  3LJR A;  4JK4 A;  1SVO A;  3HJO A;  4IW1 A;  6GSV A;  4KDY A;  6GSU A;  4BVX B;  4L9K A;  3I6A A;  4MPF A;  2CAQ A;  4AKX B;  4G0K A;  5F06 A;  1GNE A;  1KW2 A;  5J4U A;  4IGJ A;  4ZBB A;  5A1N B;  3NVM A;  3HJM A;  2VDB A;  3Q74 A;  5DAL B;  5AN1 A;  3NMU A;  3UAP A;  4S1Y A;  1BX9 A;  1E7G A;  4MBE C;  1B4P A;  4IQ1 A;  3CX9 A;  4EMX A;  1K0C A;  1YQ1 A;  2HRK A;  3HKR A;  4BVX A;  3GST A;  4YQV A;  3F63 A;  2GLR A;  5DCG A;  2AHE A;  3QAW A;  1BYE A;  2EFD A;  1XWG A;  2DBU A;  4BVY B;  5A1N A;  1ZGN A;  5DAL A;  3V09 A;  1MD3 A;  2DG5 A;  2BXL A;  3WD6 A;  3LSZ A;  2F8F A;  3LYK A;  2LJR A;  4KAE A;  3SIV B;  1F2E A;  1N5U A;  4GCI A;  4MF7 A;  2YDF A;  1UOR A;  4FQU A;  4GLT A;  5DAK B;  1MD4 A;  1EOH A;  2VCZ A;  3GUS A;  4PUR A;  3MHS B;  1HA2 A;  1HK4 A;  2ON7 A;  5ECM B;  5EVO A;  3TOT A;  5J47 A;  2GSS A;  1GUM A;  4G03 A;  3G9K D;  4BVY A;  2BXD A;  4G01 A;  14GS A;  2XVW A;  5B7C A;  4DHX B;  3PR8 A;  4ECB A;  4BY9 C;  4ZB8 A;  2XW1 A;  3WHS A;  1HK3 A;  1XW6 A;  2EFE A;  4Z69 A;  5A4U A;  4QMK A;  2JL4 A;  12GS A;  3UVH A;  4Z9O A;  5DAK A;  3B9L A;  1V2A A;  2DYO A;  2VCX A;  2E0Y A;  4KH7 A;  5A4W A;  2CA8 A;  1AQW A;  4MPG A;  4HZ4 A;  5ECP B;  5JCW A;  1MA9 A;  1KXP D;  2IL3 A;  3DGQ A;  3I69 A;  2VCW A;  1GTI A;  3IBH A;  5ECN B;  4ECJ A;  1C72 A;  1BAY A;  1JZR A;  3H37 A;  1N2A A;  1PD2 1;  4KF9 A;  4KDU A;  5LCZ A;  4ZC6 A;  1PN9 A;  1TU7 A;  3TDL A;  3CSI A;  1B48 A;  2DSA A;  5A5K A;  1TDI A;  2R3X A;  3KTL A;  1JLW A;  3F6D A;  1F3B A;  1GTU A;  4K71 A;  1VFI A;  4OT2 A;  4GTU A;  3KMO A;  2BXO A;  2C3T A;  4GDK B;  3V03 A;  3SQJ A;  3WHR A;  4PXO A;  4KDX A;  1VF2 A;  4PO0 A;  16GS A;  5ELG A;  4C31 B;  4ECI A;  1GSD A;  3LQ7 A;  1HK1 A;  5DJL A;  2BXN A;  3P8W A;  4KE3 A;  4F5U A;  4N0V A;  1AW9 A;  3FWC C;  4GSS A;  4J2V A;  2WRT A;  4ZB9 A;  4WR5 A;  4ACS A;  5D7G A;  4ZBK A;  1GTA A;  3GSS A;  4PQH A;  2ON5 A;  1Y1U A;  5B5T A;  2VCQ A;  3VPT A;  2Z8I A;  4L5O A;  4AGS A;  9GSS A;  3LU6 A;  4NHW A;  3QAG A;  3MHH B;  5A34 B;  4AKG A;  2C3Q A;  5IJE A;  5GHK A;  20GS A;  4K0G A;  1AQV A;  1FW1 A;  5ECH B;  3GA9 L;  2KBZ A;  1GSU A;  4Q5N A;  4M70 B;  5IIX A;  1RK4 A;  2HRA A;  4OTT A;  5GZZ B;  1GSF A;  5J41 A;  1HNB A;  1U3I A;  18GS A;  1BG1 A;  4ZB7 A;  3LU7 A;  5HFK A;  4USS A;  2OAC A;  4W66 A;  4MF6 A;  5F0G A;  3R2Q A;  1XWK A;  3PPU A;  5A34 A;  1GSS A;  1GTB A;  4OFN A;  5GIN A;  1XW5 A;  1LNS A;  2PER A;  4HZ2 A;  4NAW B;  5F8B A;  3ZMK A;  4ZBR A;  3CSJ A;  1BM0 A;  5DQF A;  1GUH A;  4IJI A;  2GSR A;  3IC8 A;  4PNF A;  3GH6 A;  3QAV A;  5ECK B;  4F0C A;  3Q18 A;  3M1G A;  3LYP A;  1O9X A;  1GSQ A;  3D0Z A;  3O76 A;  5ELA A;  1TXU A;  1B8X A;  2F3M A;  4AKH A;  4NAX A;  2H1L A;  3V08 A;  4MDC A;  1IYH A;  2C4J A;  5KEJ A;  1LOT A;  3ZML A;  2BX8 A;  5ID9 A;  2R5G A;  3KJL A;  4IEL A;  3TGZ A;  5GIP A;  5ID7 A;  1V40 A;  1VF3 A;  4ZB6 A;  4LUH A;  4G10 A;  3VUR A;  4G04 A;  6GSX A;  4IVF A;  1K0D A;  3LU8 A;  4Q5R A;  4Q5F A;  4L8E A;  3FWB C;  1E6B A;  1R5A A;  1MIV A;  4N0F D;  1G6W A;  1IJG A;  2XSI A;  1GSY A;  5BMU B;  4KSM A;  3UIV A;  4IS0 A;  1GUL A;  1E7F A;  4E99 A;  3LXZ A;  3JRY A;  4L8U A;  3CRT A;  4WR4 A;  3TOU A;  1K3L A;  1PKW A;  4G19 A;  3M99 C;  1K3O A;  17GS A;  4I97 A;  1TF0 A;  1E7H A;  4LA0 A;  1EV9 A;  2AB6 A;  5G5E A;  4PTS A;  1YJ6 A;  3BBY A;  4G0L A;  4ID0 A;  8GSS A;  2BXH A;  4N3Z A;  1M9B A;  2OA7 A;  2UV8 G;  1GLQ A;  3TU3 B;  4LB9 A;  4K2C A;  2I30 A;  2PMT A;  4IQA A;  5J5N A;  1H9Z A;  2GST A;  2PVQ A;  7GSS A;  4LB2 A;  2C8U A;  2YCD A;  5LD0 A;  1EV4 A;  3IK9 A;  5AIS A;  1IYI A;  4HGK A;  2DC5 A;  1JLV A;  1F3A A;  1Z9H A;  2HSN B;  4HOJ A;  4MF5 A;  4KX4 A;  5GST A;  1HK5 A;  4FJC B;  4FIP B;  3GX0 A;  3PLA A;  1YKC A;  19GS A;  4L5L A;  1YDK A;  4ECC A;  3VWX A;  2VCT A;  3LFL A;  2QM6 A;  2HSM B;  2A2R A;  1N25 A;  4RI7 A;  2X64 A;  2VD0 A;  4PX1 A;  3RBT A;  2BXK A;  3VK9 A;  2C3N A;  2V36 A;  1M9A A;  3CWG A;  4GSN A;  3VLN A;  4HJ2 A;  1VF1 A;  2WB9 A;  2HSN A;  3IK7 A;  1PMT A;  1PL2 A;  5EY6 A;  2OT3 A;  3HMJ G;  4YAV A;  3LXT A;  3O3T A;  5GSS A;  2HSM A;  1PL1 A;  4ZCG A;  4LMW A;  1Q4J A;  2QHB A;  4IW2 A;  1FHE A;  2EFC A;  2IMK A;  1G7O A;  4W4U B;  1GNJ A;  1NT2 B;  4ZBD A;  1E78 A;  3MAK A;  2PGT A;  4WA6 B;  2VD1 A;  2NNW A;  4F5V A;  3NVK A;  4KGI A;  5AIX A;  2DBX A;  4ZBA A;  4F03 A;  3N5O A;  3IE3 A;  2XMO A;  3M3M A;  4EE0 A;  2R4V A;  1E7I A;  2WDU A;  2A2S A;  2WJU A;  1J78 A;  2VUF A;  5J4Y A;  3GQX A;  1VZS A;  2FNO A;  2CKX A;  5A5H B;  5ECR B;  4G9H A;  3W1S A;  3P90 A;  4EDY A;  4O92 A;  3C8E A;  3Q19 A;  5JCU A;  1U88 A;  5D9X A;  2VCV A;  2Z8J A;  3WYW A;  3SIU B;  4RI6 A;  1PX6 A;  3F6F A;  1MIY A;  5FUO A;  4OR0 A;  1GUK A;  5DJM A;  3WHQ A;  1SVM A;  5AIV A;  1AO6 A;  3LG6 A;  2DYM A;  1PKZ A;  2NTO A;  2YV9 A;  2PBJ A;  5A5H A;  2GDR A;  1YY7 A;  3FR9 A;  3FRC A;  3FR3 A;  4HI7 A;  4E8H A;  5FT3 A;  1G6Y A;  3FY7 A;  4OFT A;  4MP4 A;  4YQM A;  3VQI A;  4GST A;  4PUA A;  1PA3 A;  2BXI A;  1BG5 A;  3NIV A;  1E7B A;  5IJF A;  5G5F A;  1BKE A;  2HRK B;  5D73 A;  11GS A;  3VPQ A;  1E7A A;  3CBU A;  4YQU A;  1TW9 A;  6GSW A;  1M99 A;  4PNG A;  3KM6 A;  4NHZ A;  2VO4 A;  4GG2 A;  3KMN A;  3M8N A;  4EC0 A;  3GUR A;  4GF0 A;  3N9J A;  4TOP A;  1LBK A;  1OE8 A;  2CZ3 A;  3L0H A;  5IFO A;  3ERG A;  4QQ7 A;  2BXB A;  5ECL B;  1Y6E A;  2BXM A;  3PGT A;  4ZBQ A;  3A73 A;  4IW9 A;  4OTU A;  1LJR A;  3KIK A;  3NVI A;  3UAR A;  3G7J A;  3H3A A;  1OKT A;  2QMC A;  4GDL B;  5F05 A;  1JNB A;  1H5W A;  3ERF A;  3VI5 A;  1M0U A;  3W8S A;  1PGT A;  1GSE A;  1U87 A;  4OFM A;  2HQT A;  4TQ1 A;  1OE7 A;  2BXQ A;  4CHS A;  5BMU A;  2ROH A;  2UZ8 A;  5IIH A;  4BL7 B;  3UBK A;  2D2Z A;  5IQY A;  3EE2 A;  4O7H A;  5D9T A;  2V6K A;  1DUG A;  4E68 A;  6GSS A;  2LOQ A;  1E7E A;  3CRU A;  5HOZ A;  1AQX A;  6GSY A;  4GDX A;  2AJE A;  4BKE A;  1K0O A;  2GSQ A;  4ZUX V;  1K3Y A;  2XVV A;  1USB A;  3R3E A;  3ICX A;  2Z8K A;  2CVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...