4G01A

Ara7-gdp-ca2+/vps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
237
structure length
237
Chain Sequence
VKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein 9A
publication title Direct metal recognition by guanine nucleotide-exchange factor in the initial step of the exchange reaction
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 101
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4g01A01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g01A02
2EFHA 2OT3A 1TXUA 2EFCA 4G01A 4N3ZA 2EFEA 2EFDA
chains in the Genus database with same CATH superfamily
4C31B 4MBEC 3F6DA 19GSA 4I97A 1E7GA 2OADA 5ID7A 4N3ZA 3LSZA 4PHZC 5ECMB 2NNWA 3GUSA 5FUOA 1MIWA 2K0NA 4PO0A 1PKZA 2UZ8A 1SVOA 2DSAA 1BG1A 5F07A 1MUSA 1N25A 1PGTA 1XW5A 4IQAA 2CAIA 1PX7A 3NIVA 4KSMA 3BBYA 1AQVA 1S4BP 5LCZA 4MPGA 1O9XA 4G04A 5BMUA 4IW2A 4PI2C 1UORA 2WW0A 3BPJA 5HFKA 2WW2A 4JBBA 5IFOA 1C72A 5BMUB 5A4WA 4MPFA 2R4VA 1JLVA 1M9BA 3VPQA 3TDLA 4TQ1A 2VCTA 3KTLA 3FY7A 2F3MA 3LQ7A 8GSSA 3MDKA 4HGMB 2AJEA 4G0KA 5FHIA 3CRUA 1HNBA 2CA8A 1B8XA 4MP4A 3VK9A 5IIUA 4KX4A 3CSJA 2DYMA 5AN1A 11GSA 4ID0A 2IMKA 3SIUB 1N2AA 4N0UD 4ZC6A 2R6KA 2VCWA 4PXOA 2C4JA 2ON5A 2WVYA 4ZBQA 1SB0A 3LG6A 2WZSA 2GLRA 4G0IA 4ZBRA 5ELAA 4ECJA 3P90A 5DBYA 9GSSA 4GSSA 5DQSA 5J41A 2HSNA 4W66A 2OZBB 2C8UA 4ACSA 4USSA 2ROHA 3FWBC 3GQUA 1K0BA 5GZZB 1YJ6A 5A5HA 2YV7A 1M0UA 1VF1A 2GTUA 4EDYA 2JUHA 4IBPA 5G5EA 5A5HB 2BXFA 1H5WA 2CZ2A 5FWGA 4L9KA 1K0NA 4G01A 5D7GA 4ISDA 1XW6A 3RGBC 1M99A 2BXQA 2EFHA 3JRYA 1KXPD 3NVIA 1EV4A 3B9LA 2AAWA 4BVYA 4EDZA 2HSMA 3M0FA 2VKZG 5EL8A 4LUHA 5IJEA 4OTTA 5DALA 3CX9A 2VD0A 4F5UA 2HSMB 1Q4JA 1PD21 2X64A 3QAVA 3PLAA 1TW9A 2DBXA 5F06A 3FR6A 4K0GA 4EXJA 3WHSA 1MTCA 6GSXA 1TF0A 1V2AA 1PA3A 1EOHA 1IYIA 2BXMA 1M9AA 2PBJA 2C3TA 5FT3A 4AGSA 5GIOA 2VCZA 1E6BA 1PL2A 2WRTA 1E7IA 4GLTA 3IC8A 4FK5B 4IVFA 3ERFA 1I1IP 4MDCA 2QHBA 1K0MA 4HI7A 1IYHA 1Y6EA 2BXKA 1HK3A 4O92A 3A75A 2WVZA 3HMJG 5ECLB 3R2QA 1Y1UA 4YQVA 4IELA 2QMCA 1HK2A 2R3XA 1A0FA 2BXOA 3ISOA 2LQIA 1GSQA 1HNCA 5J4YA 5D9XA 1PX6A 2IL3A 1PL1A 1Z9HA 20GSA 5A34B 4HGKA 1OE7A 2ON7A 5ECQB 4PQIA 3HJOA 5HOZA 5D9TA 12GSA 3M8NA 3FYGA 2DBWA 1G6YA 4RI7A 2XW0A 1MUHA 1LJRA 5DQFA 3G7JA 5DJMA 1DUGA 4PUAA 2GSTA 3RBTA 4ZBBA 2O5VA 1LBKA 2O36A 5J4UA 2C3NA 3QR6A 6GSVA 3G7IA 4L8UA 2C3QA 2PVQA 4MF6A 4Q5QA 3F63A 3MHHB 2VCQA 4ZBDA 1YEWC 3KXOA 2I2ZA 3ZMLA 1F3BA 3L0HA 1K0DA 4N0VA 4Q5FA 1K3YA 5IIXA 2EFDA 3PGTA 1GSYA 3VLNA 4JZQA 6GSYA 1F2EA 3KM6A 3TOUA 5ECNB 1TXUA 4WA6B 3HKRA 5DAKB 1OE8A 2XVQA 3CWGA 5ECSA 3GURA 1HK4A 3ZFBA 4ECIA 4MF5A 3FR9A 5B7CA 4Q5NA 5ECIB 1TDIA 4GF0A 4OMVA 2CZ3A 4BKEA 4OFTA 4IKHA 4GSTA 3A73A 1EEMA 2E0XA 2A2SA 4RI6A 1B48A 2D2ZA 4JEDA 4NHWA 4AKHA 4WR5A 4G0LA 5AISA 4Q5RA 4PNFA 5ID9A 17GSA 3PPUA 1MIYA 5D9WA 1U88A 3Q19A 5GSTA 4KH7A 1OKTA 4YQMA 1MIVA 3SQJA 6GSSA 1GUKA 2LOQA 4PQHA 4ZUXV 4DM0A 2H1LA 5JCUA 2DC5A 4ZBKA 1GTBA 1GSSA 3M1GA 2EFCA 3N9JA 4LMVA 1AQXA 4TQ0A 2LQHA 2DYOA 1YQ1A 1E7BA 4QMKA 1GSEA 22GSA 2GSRA 3MAKA 1NT2B 3VQIA 1BX9A 1U3IA 2OA7A 1GNEA 4AKGA 4J2VA 1VF3A 4G03A 1VFIA 1GUHA 4F0CA 3ICXA 1AO6A 4IQ1A 3UAPA 3KJLA 1K0OA 1GNWA 2XVVA 6GSUA 4G10A 3Q74A 2V6KA 3EE2A 3IBHA 4ECCA 2BXDA 1KBNA 1GUMA 4NHZA 1EOGA 3CBUA 4KDYA 5ELGA 3VI5A 5ECRB 4HZ4A 4EC0A 3UIVA 1SVLA 3WD6A 4F0BA 3V09A 3KMNA 4PTSA 1E7HA 4K0NA 2UV8G 4OR0A 3AY8A 3I69A 3Q18A 3U6VA 2IMIA 2HRKA 2BXGA 4TOPA 2DBUA 4J2FA 4HOJA 3G9KD 3GA9L 2V36A 3GTUB 2HRKB 1BM0A 2WB9A 5G5FA 3IE3A 5J40A 2VUEA 2XVUA 2BXLA 4YQUA 2EFEA 3ERGA 3LYPA 1HA2A 5ECPB 5AIXA 1G7OA 4ZXGA 2GSSA 5D73A 3FWCC 2PERA 4AKIA 5AGYA 1HQOA 2OACA 1YY7A 1JNBA 3KIKA 2XVWA 4EE0A 4F5VA 2AHEA 4JK4A 5GHKA 1TU7A 3IK9A 5F8BA 2BXEA 3LU6A 3NVKA 4MK3A 5IIHA 1ML6A 4BY9C 5A34A 6GSWA 1FOUA 3RFRC 2I30A 3H3AA 1JLWA 5F05A 4S1YA 1FW1A 2XSIA 3HJMA 1HK1A 4Z9OA 1AW9A 1GSDA 4LMWA 1G6WA 1GSFA 5AIVA 3LYKA 1N5UA 4AKXB 3FR3A 4LB2A 2FNOA 1BF5A 4F5SA 3V03A 1VZSA 1BKEA 4FIPB 4G19A 2Z8KA 3V08A 2WDUA 1YKCA 4YAPA 1MM8A 3H37A 1LNSA 1YVLA 2F8FA 3UBLA 4F5TA 4E68A 1ZGNA 1J7EA 2WVXB 3PR8A 4O7HA 3ECPA 4E8EA 2CVDA 3UARA 5IQYA 2BXIA 5J4VA 4E8HA 3CHXC 5J5NA 4LB9A 3TGZA 2CAQA 2Z8JA 2PMTA 4GSNA 4NAXA 5ECHB 4LA0A 2HQTA 4PGTA 4L9QA 5EVOA 3M99C 4K71A 1GULA 2WW3A 5IJ5A 1GTIA 1K0AA 4ZB8A 4IJIA 2BXNA 3FNMA 3GSTA 4HJ2A 5DDLA 5DAKA 4FQUA 1E7AA 3LU8A 4KF9A 5JCWA 2OT3A 2J9HA 1H9ZA 4GG2A 3P8WA 3UBKA 1E7CA 2LJRA 5A5KA 1K0CA 2R5GA 4ZB9A 3CSIA 1BAYA 3QAGA 4PX1A 1E7FA 3LJRA 4PURA 7GSSA 1NHYA 5GSSA 3GX0A 2GUTA 2BXBA 4PI0C 2VO4A 5ECOB 2NQOA 1UA5A 2HRAA 4IS0A 5D9VA 3VI7A 4GDLB 3IK7A 3D0ZA 1KW2A 3GQXA 4YAVA 4ZBAA 1GTUA 1E7EA 5GIPA 5A1NA 1GNJA 1SVMA 4OTUA 1GWCA 4CHSA 3B9MA 3ZFLA 2GSQA 2LXTA 3KMOA 5A1NB 10GSA 1TU8A 4M70B 1XWKA 2C80A 3QAWA 3JQZA 1AQWA 4DHXB 2GDRA 2AB6A 4GTUA 3WYWA 3NMUA 2JL4A 1YDKA 5IJFA 2AGHB 2WS2A 4L8EA 3WHRA 2HNLA 1BJ5A 2PGTA 4IW9A 1GSUA 1J78A 4K2CA 3GSSA 5LD0A 2DG5A 5DCGA 2BXPA 2BX8A 1XWGA 3N5OA 4KDUA 2YV9A 1VF4A 1MA9A 4Z69A 2NTOA 1K3OA 1RK4A 5J47A 1K3LA 4ZCGA 1E78A 1EV9A 1VF2A 2BXAA 1USBA 1ZL9A 1MD3A 1LOTA 2A2RA 4OFNA 3DGQA 1JZRA 4YH2A 3GTUA 2HSNB 4KAEA 1AXDA 2VUFA 3F6FA 1BYEA 1MD4A 2KBZA 3CRTA 3DD3A 1GLQA 4OFMA 3I6AA 2N5FA 3TOTA 14GSA 2XMOA 4IW1A 2VD1A 3FRCA 2CKXA 3C8EA 4OT2A 3M3MA 4GDKB 2WJUA 3NVMA 4KGIA 1U87A 4MZWA 1OYJA 2VDBA 4BVYB 2QM6A 4EMXA 4DEJA 4PNGA 13GSA 5DALB 3KJYA 3LFLA 3VPTA 1PKWA 3VWXA 3O3TA 5GINA 4KE3A 2XW1A 1FHEA 4NAWB 1HNAA 4E99A 4W4UB 4HZ2A 4ZB7A 2VCVA 4L5LA 2VCXA 4GDXA 3R3EA 2E0YA 4BL7A 4L5OA 4WR4A 3VURA 4KDXA 4I9OA 2KWFA 1IJGA 4BL7B 3LU7A 1V40A 5KEJA 3SIVB 5A4VA 4IGJA 4LUFA 3O76A 4FXYP 5ECKB 2WVXA 3EINA 4ECBA 2YDFA 1BG5A 1HK5A 1GLPA 4D7XA 4GCIA 2BXHA 3LXZA 3MHSB 2YCDA 1GNIA 2LXSA 3TU3B 3ZMKA 2BXCA 18GSA 3LXTA 5F0GA 4N0FD 1PN9A 4G9HA 1GTAA 1B4PA 4GDFA 3W1SA 2Z8IA 4BVXA 5B5TA 4ZB6A 3GH6A 2FHEA 6GSTA 5DJLA 4F03A 5EY6A 3W8SA 3WHQA 4FJCB 3IR4A 3SWLA 1KDXA 4BVXB 3CSHA 4AI6A 1R5AA 4MF7A 2O3EA 1PMTA 3H1NA 4QQ7A 5A4UA 5BPKA 16GSA 2WW1A 3UVHA 1F3AA
chains in the Genus database with same CATH topology
4C31B 4MBEC 3F6DA 19GSA 4I97A 1E7GA 2OADA 5ID7A 4N3ZA 3LSZA 5ECMB 2NNWA 3GUSA 5FUOA 1MIWA 4PO0A 1PKZA 2UZ8A 1SVOA 2DSAA 1BG1A 5F07A 1N25A 1PGTA 1XW5A 4IQAA 2CAIA 1PX7A 3NIVA 4KSMA 3BBYA 1AQVA 5LCZA 4MPGA 1O9XA 4G04A 5BMUA 4IW2A 1UORA 5HFKA 4JBBA 5IFOA 1C72A 5BMUB 5A4WA 4MPFA 2R4VA 1JLVA 1M9BA 3VPQA 3TDLA 4TQ1A 2VCTA 3KTLA 3FY7A 2F3MA 3LQ7A 8GSSA 3MDKA 4HGMB 2AJEA 4G0KA 5FHIA 3CRUA 1HNBA 2CA8A 1B8XA 4MP4A 3VK9A 5IIUA 4KX4A 3CSJA 2DYMA 5AN1A 11GSA 4ID0A 2IMKA 3SIUB 1N2AA 4N0UD 4ZC6A 2R6KA 2VCWA 4PXOA 2C4JA 2ON5A 4ZBQA 3LG6A 2GLRA 4G0IA 4ZBRA 5ELAA 4ECJA 3P90A 5DBYA 9GSSA 4GSSA 5DQSA 5J41A 2HSNA 4W66A 2OZBB 2C8UA 4ACSA 4USSA 2ROHA 3FWBC 3GQUA 1K0BA 5GZZB 1YJ6A 5A5HA 2YV7A 1M0UA 1VF1A 2GTUA 4EDYA 2JUHA 4IBPA 5G5EA 5A5HB 2BXFA 1H5WA 2CZ2A 5FWGA 4L9KA 1K0NA 4G01A 5D7GA 4ISDA 1XW6A 1M99A 2BXQA 2EFHA 3JRYA 1KXPD 3NVIA 1EV4A 3B9LA 2AAWA 4BVYA 4EDZA 2HSMA 3M0FA 2VKZG 5EL8A 4LUHA 5IJEA 4OTTA 5DALA 3CX9A 2VD0A 4F5UA 2HSMB 1Q4JA 1PD21 2X64A 3QAVA 3PLAA 1TW9A 2DBXA 5F06A 3FR6A 4K0GA 4EXJA 3WHSA 1MTCA 6GSXA 1TF0A 1V2AA 1PA3A 1EOHA 1IYIA 2BXMA 1M9AA 2PBJA 2C3TA 5FT3A 4AGSA 5GIOA 2VCZA 1E6BA 1PL2A 2WRTA 1E7IA 4GLTA 3IC8A 4FK5B 4IVFA 3ERFA 4MDCA 2QHBA 1K0MA 4HI7A 1IYHA 1Y6EA 2BXKA 1HK3A 4O92A 3A75A 3HMJG 5ECLB 3R2QA 1Y1UA 4YQVA 4IELA 2QMCA 1HK2A 2R3XA 1A0FA 2BXOA 3ISOA 1GSQA 1HNCA 5J4YA 5D9XA 1PX6A 2IL3A 1PL1A 1Z9HA 20GSA 5A34B 4HGKA 1OE7A 2ON7A 5ECQB 4PQIA 3HJOA 5HOZA 5D9TA 12GSA 3M8NA 3FYGA 2DBWA 1G6YA 4RI7A 2XW0A 1LJRA 5DQFA 3G7JA 5DJMA 1DUGA 4PUAA 2GSTA 3RBTA 4ZBBA 2O5VA 1LBKA 5J4UA 2C3NA 3QR6A 6GSVA 3G7IA 4L8UA 2C3QA 2PVQA 4MF6A 4Q5QA 3F63A 3MHHB 2VCQA 4ZBDA 3KXOA 2I2ZA 3ZMLA 1F3BA 3L0HA 1K0DA 4N0VA 4Q5FA 1K3YA 5IIXA 2EFDA 3PGTA 1GSYA 3VLNA 4JZQA 6GSYA 1F2EA 3KM6A 3TOUA 5ECNB 1TXUA 4WA6B 3HKRA 5DAKB 1OE8A 2XVQA 3CWGA 5ECSA 3GURA 1HK4A 3ZFBA 4ECIA 4MF5A 3FR9A 5B7CA 4Q5NA 5ECIB 1TDIA 4GF0A 4OMVA 2CZ3A 4BKEA 4OFTA 4IKHA 4GSTA 3A73A 1EEMA 2E0XA 2A2SA 4RI6A 1B48A 2D2ZA 4JEDA 4NHWA 4AKHA 4WR5A 4G0LA 5AISA 4Q5RA 4PNFA 5ID9A 17GSA 3PPUA 1MIYA 5D9WA 1U88A 3Q19A 5GSTA 4KH7A 1OKTA 4YQMA 1MIVA 3SQJA 6GSSA 1GUKA 2LOQA 4PQHA 4ZUXV 5JCUA 2H1LA 2DC5A 4ZBKA 1GTBA 1GSSA 3M1GA 2EFCA 3N9JA 4LMVA 4TQ0A 1AQXA 1YQ1A 2DYOA 1E7BA 4QMKA 1GSEA 22GSA 2GSRA 3MAKA 1NT2B 3VQIA 1BX9A 1U3IA 2OA7A 1GNEA 4AKGA 4J2VA 1VF3A 4G03A 1VFIA 1GUHA 4F0CA 3ICXA 1AO6A 4IQ1A 3UAPA 3KJLA 1K0OA 1GNWA 2XVVA 6GSUA 4G10A 3Q74A 2V6KA 3EE2A 3IBHA 4ECCA 2BXDA 1KBNA 1GUMA 4NHZA 1EOGA 3CBUA 4KDYA 5ELGA 3VI5A 5ECRB 4HZ4A 4EC0A 3UIVA 1SVLA 3WD6A 4F0BA 3V09A 3KMNA 4PTSA 1E7HA 4K0NA 2UV8G 4OR0A 3AY8A 3I69A 3Q18A 3U6VA 2IMIA 2HRKA 2BXGA 4TOPA 2DBUA 4J2FA 4HOJA 3G9KD 3GA9L 2V36A 3GTUB 2HRKB 1BM0A 2WB9A 5G5FA 3IE3A 5J40A 2VUEA 2XVUA 2BXLA 4YQUA 2EFEA 3ERGA 3LYPA 1HA2A 5ECPB 5AIXA 1G7OA 4ZXGA 2GSSA 5D73A 3FWCC 2PERA 4AKIA 5AGYA 1HQOA 2OACA 1YY7A 1JNBA 3KIKA 2XVWA 4EE0A 4F5VA 2AHEA 4JK4A 5GHKA 1TU7A 3IK9A 5F8BA 2BXEA 3LU6A 3NVKA 4MK3A 5IIHA 1ML6A 4BY9C 5A34A 6GSWA 1FOUA 2I30A 3H3AA 1JLWA 5F05A 4S1YA 1FW1A 2XSIA 3HJMA 1HK1A 4Z9OA 1AW9A 1GSDA 4LMWA 1G6WA 1GSFA 5AIVA 3LYKA 1N5UA 4AKXB 3FR3A 4LB2A 2FNOA 1BF5A 4F5SA 3V03A 1VZSA 1BKEA 4FIPB 4G19A 2Z8KA 3V08A 2WDUA 1YKCA 4YAPA 3H37A 1LNSA 1YVLA 2F8FA 3UBLA 4F5TA 4E68A 1ZGNA 1J7EA 3PR8A 4O7HA 4E8EA 2CVDA 3UARA 5IQYA 2BXIA 5J4VA 4E8HA 5J5NA 4LB9A 3TGZA 2CAQA 2Z8JA 2PMTA 4GSNA 4NAXA 5ECHB 4LA0A 2HQTA 4PGTA 4L9QA 5EVOA 3M99C 4K71A 1GULA 5IJ5A 1GTIA 1K0AA 4ZB8A 4IJIA 2BXNA 3FNMA 3GSTA 4HJ2A 5DDLA 5DAKA 4FQUA 1E7AA 3LU8A 4KF9A 5JCWA 2OT3A 2J9HA 1H9ZA 4GG2A 3P8WA 3UBKA 1E7CA 2LJRA 5A5KA 1K0CA 2R5GA 4ZB9A 3CSIA 1BAYA 3QAGA 4PX1A 1E7FA 3LJRA 4PURA 7GSSA 1NHYA 5GSSA 3GX0A 2BXBA 2VO4A 5ECOB 2NQOA 1UA5A 2HRAA 4IS0A 5D9VA 3VI7A 4GDLB 3IK7A 3D0ZA 1KW2A 3GQXA 4YAVA 4ZBAA 1GTUA 1E7EA 5GIPA 5A1NA 1GNJA 1SVMA 4OTUA 1GWCA 4CHSA 3B9MA 3ZFLA 2GSQA 3KMOA 5A1NB 10GSA 1TU8A 4M70B 1XWKA 2C80A 3QAWA 3JQZA 1AQWA 4DHXB 2GDRA 2AB6A 4GTUA 3WYWA 3NMUA 2JL4A 1YDKA 5IJFA 2WS2A 4L8EA 3WHRA 2HNLA 1BJ5A 2PGTA 4IW9A 1GSUA 1J78A 4K2CA 3GSSA 5LD0A 2DG5A 5DCGA 2BXPA 2BX8A 1XWGA 3N5OA 4KDUA 2YV9A 1VF4A 1MA9A 4Z69A 2NTOA 1K3OA 1RK4A 5J47A 1K3LA 4ZCGA 1E78A 1EV9A 1VF2A 2BXAA 1USBA 1ZL9A 1MD3A 1LOTA 2A2RA 4OFNA 3DGQA 1JZRA 4YH2A 3GTUA 2HSNB 4KAEA 1AXDA 2VUFA 3F6FA 1BYEA 1MD4A 2KBZA 3CRTA 3DD3A 1GLQA 4OFMA 3I6AA 2N5FA 3TOTA 14GSA 2XMOA 4IW1A 2VD1A 3FRCA 2CKXA 3C8EA 4OT2A 3M3MA 4GDKB 2WJUA 3NVMA 4KGIA 1U87A 4MZWA 1OYJA 2VDBA 4BVYB 2QM6A 4EMXA 4DEJA 4PNGA 13GSA 5DALB 3KJYA 3LFLA 3VPTA 1PKWA 3VWXA 3O3TA 5GINA 4KE3A 2XW1A 1FHEA 4NAWB 1HNAA 4E99A 4W4UB 4HZ2A 4ZB7A 2VCVA 4L5LA 2VCXA 4GDXA 3R3EA 2E0YA 4BL7A 4L5OA 4WR4A 3VURA 4KDXA 1IJGA 4BL7B 3LU7A 1V40A 5KEJA 3SIVB 5A4VA 4IGJA 4LUFA 3O76A 5ECKB 3EINA 4ECBA 2YDFA 1BG5A 1HK5A 1GLPA 4GCIA 2BXHA 3LXZA 3MHSB 2YCDA 1GNIA 3TU3B 3ZMKA 2BXCA 18GSA 3LXTA 5F0GA 4N0FD 1PN9A 4G9HA 1GTAA 1B4PA 4GDFA 3W1SA 2Z8IA 4BVXA 5B5TA 4ZB6A 3GH6A 2FHEA 6GSTA 5DJLA 4F03A 5EY6A 3W8SA 3WHQA 4FJCB 3IR4A 3SWLA 4BVXB 3CSHA 4AI6A 1R5AA 4MF7A 1PMTA 3H1NA 4QQ7A 5A4UA 5BPKA 16GSA 3UVHA 1F3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFH A;  2OT3 A;  1TXU A;  2EFC A;  4G01 A;  4N3Z A;  2EFE A;  2EFD A; 
#chains in the Genus database with same CATH topology
 4C31 B;  4MBE C;  3F6D A;  19GS A;  4I97 A;  1E7G A;  2OAD A;  5ID7 A;  4N3Z A;  3LSZ A;  4PHZ C;  5ECM B;  2NNW A;  3GUS A;  5FUO A;  1MIW A;  2K0N A;  4PO0 A;  1PKZ A;  2UZ8 A;  1SVO A;  2DSA A;  1BG1 A;  5F07 A;  1MUS A;  1N25 A;  1PGT A;  1XW5 A;  4IQA A;  2CAI A;  1PX7 A;  3NIV A;  4KSM A;  3BBY A;  1AQV A;  1S4B P;  5LCZ A;  4MPG A;  1O9X A;  4G04 A;  5BMU A;  4IW2 A;  4PI2 C;  1UOR A;  2WW0 A;  3BPJ A;  5HFK A;  2WW2 A;  4JBB A;  5IFO A;  1C72 A;  5BMU B;  5A4W A;  4MPF A;  2R4V A;  1JLV A;  1M9B A;  3VPQ A;  3TDL A;  4TQ1 A;  2VCT A;  3KTL A;  3FY7 A;  2F3M A;  3LQ7 A;  8GSS A;  3MDK A;  4HGM B;  2AJE A;  4G0K A;  5FHI A;  3CRU A;  1HNB A;  2CA8 A;  1B8X A;  4MP4 A;  3VK9 A;  5IIU A;  4KX4 A;  3CSJ A;  2DYM A;  5AN1 A;  11GS A;  4ID0 A;  2IMK A;  3SIU B;  1N2A A;  4N0U D;  4ZC6 A;  2R6K A;  2VCW A;  4PXO A;  2C4J A;  2ON5 A;  2WVY A;  4ZBQ A;  1SB0 A;  3LG6 A;  2WZS A;  2GLR A;  4G0I A;  4ZBR A;  5ELA A;  4ECJ A;  3P90 A;  5DBY A;  9GSS A;  4GSS A;  5DQS A;  5J41 A;  2HSN A;  4W66 A;  2OZB B;  2C8U A;  4ACS A;  4USS A;  2ROH A;  3FWB C;  3GQU A;  1K0B A;  5GZZ B;  1YJ6 A;  5A5H A;  2YV7 A;  1M0U A;  1VF1 A;  2GTU A;  4EDY A;  2JUH A;  4IBP A;  5G5E A;  5A5H B;  2BXF A;  1H5W A;  2CZ2 A;  5FWG A;  4L9K A;  1K0N A;  4G01 A;  5D7G A;  4ISD A;  1XW6 A;  3RGB C;  1M99 A;  2BXQ A;  2EFH A;  3JRY A;  1KXP D;  3NVI A;  1EV4 A;  3B9L A;  2AAW A;  4BVY A;  4EDZ A;  2HSM A;  3M0F A;  2VKZ G;  5EL8 A;  4LUH A;  5IJE A;  4OTT A;  5DAL A;  3CX9 A;  2VD0 A;  4F5U A;  2HSM B;  1Q4J A;  1PD2 1;  2X64 A;  3QAV A;  3PLA A;  1TW9 A;  2DBX A;  5F06 A;  3FR6 A;  4K0G A;  4EXJ A;  3WHS A;  1MTC A;  6GSX A;  1TF0 A;  1V2A A;  1PA3 A;  1EOH A;  1IYI A;  2BXM A;  1M9A A;  2PBJ A;  2C3T A;  5FT3 A;  4AGS A;  5GIO A;  2VCZ A;  1E6B A;  1PL2 A;  2WRT A;  1E7I A;  4GLT A;  3IC8 A;  4FK5 B;  4IVF A;  3ERF A;  1I1I P;  4MDC A;  2QHB A;  1K0M A;  4HI7 A;  1IYH A;  1Y6E A;  2BXK A;  1HK3 A;  4O92 A;  3A75 A;  2WVZ A;  3HMJ G;  5ECL B;  3R2Q A;  1Y1U A;  4YQV A;  4IEL A;  2QMC A;  1HK2 A;  2R3X A;  1A0F A;  2BXO A;  3ISO A;  2LQI A;  1GSQ A;  1HNC A;  5J4Y A;  5D9X A;  1PX6 A;  2IL3 A;  1PL1 A;  1Z9H A;  20GS A;  5A34 B;  4HGK A;  1OE7 A;  2ON7 A;  5ECQ B;  4PQI A;  3HJO A;  5HOZ A;  5D9T A;  12GS A;  3M8N A;  3FYG A;  2DBW A;  1G6Y A;  4RI7 A;  2XW0 A;  1MUH A;  1LJR A;  5DQF A;  3G7J A;  5DJM A;  1DUG A;  4PUA A;  2GST A;  3RBT A;  4ZBB A;  2O5V A;  1LBK A;  2O36 A;  5J4U A;  2C3N A;  3QR6 A;  6GSV A;  3G7I A;  4L8U A;  2C3Q A;  2PVQ A;  4MF6 A;  4Q5Q A;  3F63 A;  3MHH B;  2VCQ A;  4ZBD A;  1YEW C;  3KXO A;  2I2Z A;  3ZML A;  1F3B A;  3L0H A;  1K0D A;  4N0V A;  4Q5F A;  1K3Y A;  5IIX A;  2EFD A;  3PGT A;  1GSY A;  3VLN A;  4JZQ A;  6GSY A;  1F2E A;  3KM6 A;  3TOU A;  5ECN B;  1TXU A;  4WA6 B;  3HKR A;  5DAK B;  1OE8 A;  2XVQ A;  3CWG A;  5ECS A;  3GUR A;  1HK4 A;  3ZFB A;  4ECI A;  4MF5 A;  3FR9 A;  5B7C A;  4Q5N A;  5ECI B;  1TDI A;  4GF0 A;  4OMV A;  2CZ3 A;  4BKE A;  4OFT A;  4IKH A;  4GST A;  3A73 A;  1EEM A;  2E0X A;  2A2S A;  4RI6 A;  1B48 A;  2D2Z A;  4JED A;  4NHW A;  4AKH A;  4WR5 A;  4G0L A;  5AIS A;  4Q5R A;  4PNF A;  5ID9 A;  17GS A;  3PPU A;  1MIY A;  5D9W A;  1U88 A;  3Q19 A;  5GST A;  4KH7 A;  1OKT A;  4YQM A;  1MIV A;  3SQJ A;  6GSS A;  1GUK A;  2LOQ A;  4PQH A;  4ZUX V;  4DM0 A;  2H1L A;  5JCU A;  2DC5 A;  4ZBK A;  1GTB A;  1GSS A;  3M1G A;  2EFC A;  3N9J A;  4LMV A;  1AQX A;  4TQ0 A;  2LQH A;  2DYO A;  1YQ1 A;  1E7B A;  4QMK A;  1GSE A;  22GS A;  2GSR A;  3MAK A;  1NT2 B;  3VQI A;  1BX9 A;  1U3I A;  2OA7 A;  1GNE A;  4AKG A;  4J2V A;  1VF3 A;  4G03 A;  1VFI A;  1GUH A;  4F0C A;  3ICX A;  1AO6 A;  4IQ1 A;  3UAP A;  3KJL A;  1K0O A;  1GNW A;  2XVV A;  6GSU A;  4G10 A;  3Q74 A;  2V6K A;  3EE2 A;  3IBH A;  4ECC A;  2BXD A;  1KBN A;  1GUM A;  4NHZ A;  1EOG A;  3CBU A;  4KDY A;  5ELG A;  3VI5 A;  5ECR B;  4HZ4 A;  4EC0 A;  3UIV A;  1SVL A;  3WD6 A;  4F0B A;  3V09 A;  3KMN A;  4PTS A;  1E7H A;  4K0N A;  2UV8 G;  4OR0 A;  3AY8 A;  3I69 A;  3Q18 A;  3U6V A;  2IMI A;  2HRK A;  2BXG A;  4TOP A;  2DBU A;  4J2F A;  4HOJ A;  3G9K D;  3GA9 L;  2V36 A;  3GTU B;  2HRK B;  1BM0 A;  2WB9 A;  5G5F A;  3IE3 A;  5J40 A;  2VUE A;  2XVU A;  2BXL A;  4YQU A;  2EFE A;  3ERG A;  3LYP A;  1HA2 A;  5ECP B;  5AIX A;  1G7O A;  4ZXG A;  2GSS A;  5D73 A;  3FWC C;  2PER A;  4AKI A;  5AGY A;  1HQO A;  2OAC A;  1YY7 A;  1JNB A;  3KIK A;  2XVW A;  4EE0 A;  4F5V A;  2AHE A;  4JK4 A;  5GHK A;  1TU7 A;  3IK9 A;  5F8B A;  2BXE A;  3LU6 A;  3NVK A;  4MK3 A;  5IIH A;  1ML6 A;  4BY9 C;  5A34 A;  6GSW A;  1FOU A;  3RFR C;  2I30 A;  3H3A A;  1JLW A;  5F05 A;  4S1Y A;  1FW1 A;  2XSI A;  3HJM A;  1HK1 A;  4Z9O A;  1AW9 A;  1GSD A;  4LMW A;  1G6W A;  1GSF A;  5AIV A;  3LYK A;  1N5U A;  4AKX B;  3FR3 A;  4LB2 A;  2FNO A;  1BF5 A;  4F5S A;  3V03 A;  1VZS A;  1BKE A;  4FIP B;  4G19 A;  2Z8K A;  3V08 A;  2WDU A;  1YKC A;  4YAP A;  1MM8 A;  3H37 A;  1LNS A;  1YVL A;  2F8F A;  3UBL A;  4F5T A;  4E68 A;  1ZGN A;  1J7E A;  2WVX B;  3PR8 A;  4O7H A;  3ECP A;  4E8E A;  2CVD A;  3UAR A;  5IQY A;  2BXI A;  5J4V A;  4E8H A;  3CHX C;  5J5N A;  4LB9 A;  3TGZ A;  2CAQ A;  2Z8J A;  2PMT A;  4GSN A;  4NAX A;  5ECH B;  4LA0 A;  2HQT A;  4PGT A;  4L9Q A;  5EVO A;  3M99 C;  4K71 A;  1GUL A;  2WW3 A;  5IJ5 A;  1GTI A;  1K0A A;  4ZB8 A;  4IJI A;  2BXN A;  3FNM A;  3GST A;  4HJ2 A;  5DDL A;  5DAK A;  4FQU A;  1E7A A;  3LU8 A;  4KF9 A;  5JCW A;  2OT3 A;  2J9H A;  1H9Z A;  4GG2 A;  3P8W A;  3UBK A;  1E7C A;  2LJR A;  5A5K A;  1K0C A;  2R5G A;  4ZB9 A;  3CSI A;  1BAY A;  3QAG A;  4PX1 A;  1E7F A;  3LJR A;  4PUR A;  7GSS A;  1NHY A;  5GSS A;  3GX0 A;  2GUT A;  2BXB A;  4PI0 C;  2VO4 A;  5ECO B;  2NQO A;  1UA5 A;  2HRA A;  4IS0 A;  5D9V A;  3VI7 A;  4GDL B;  3IK7 A;  3D0Z A;  1KW2 A;  3GQX A;  4YAV A;  4ZBA A;  1GTU A;  1E7E A;  5GIP A;  5A1N A;  1GNJ A;  1SVM A;  4OTU A;  1GWC A;  4CHS A;  3B9M A;  3ZFL A;  2GSQ A;  2LXT A;  3KMO A;  5A1N B;  10GS A;  1TU8 A;  4M70 B;  1XWK A;  2C80 A;  3QAW A;  3JQZ A;  1AQW A;  4DHX B;  2GDR A;  2AB6 A;  4GTU A;  3WYW A;  3NMU A;  2JL4 A;  1YDK A;  5IJF A;  2AGH B;  2WS2 A;  4L8E A;  3WHR A;  2HNL A;  1BJ5 A;  2PGT A;  4IW9 A;  1GSU A;  1J78 A;  4K2C A;  3GSS A;  5LD0 A;  2DG5 A;  5DCG A;  2BXP A;  2BX8 A;  1XWG A;  3N5O A;  4KDU A;  2YV9 A;  1VF4 A;  1MA9 A;  4Z69 A;  2NTO A;  1K3O A;  1RK4 A;  5J47 A;  1K3L A;  4ZCG A;  1E78 A;  1EV9 A;  1VF2 A;  2BXA A;  1USB A;  1ZL9 A;  1MD3 A;  1LOT A;  2A2R A;  4OFN A;  3DGQ A;  1JZR A;  4YH2 A;  3GTU A;  2HSN B;  4KAE A;  1AXD A;  2VUF A;  3F6F A;  1BYE A;  1MD4 A;  2KBZ A;  3CRT A;  3DD3 A;  1GLQ A;  4OFM A;  3I6A A;  2N5F A;  3TOT A;  14GS A;  2XMO A;  4IW1 A;  2VD1 A;  3FRC A;  2CKX A;  3C8E A;  4OT2 A;  3M3M A;  4GDK B;  2WJU A;  3NVM A;  4KGI A;  1U87 A;  4MZW A;  1OYJ A;  2VDB A;  4BVY B;  2QM6 A;  4EMX A;  4DEJ A;  4PNG A;  13GS A;  5DAL B;  3KJY A;  3LFL A;  3VPT A;  1PKW A;  3VWX A;  3O3T A;  5GIN A;  4KE3 A;  2XW1 A;  1FHE A;  4NAW B;  1HNA A;  4E99 A;  4W4U B;  4HZ2 A;  4ZB7 A;  2VCV A;  4L5L A;  2VCX A;  4GDX A;  3R3E A;  2E0Y A;  4BL7 A;  4L5O A;  4WR4 A;  3VUR A;  4KDX A;  4I9O A;  2KWF A;  1IJG A;  4BL7 B;  3LU7 A;  1V40 A;  5KEJ A;  3SIV B;  5A4V A;  4IGJ A;  4LUF A;  3O76 A;  4FXY P;  5ECK B;  2WVX A;  3EIN A;  4ECB A;  2YDF A;  1BG5 A;  1HK5 A;  1GLP A;  4D7X A;  4GCI A;  2BXH A;  3LXZ A;  3MHS B;  2YCD A;  1GNI A;  2LXS A;  3TU3 B;  3ZMK A;  2BXC A;  18GS A;  3LXT A;  5F0G A;  4N0F D;  1PN9 A;  4G9H A;  1GTA A;  1B4P A;  4GDF A;  3W1S A;  2Z8I A;  4BVX A;  5B5T A;  4ZB6 A;  3GH6 A;  2FHE A;  6GST A;  5DJL A;  4F03 A;  5EY6 A;  3W8S A;  3WHQ A;  4FJC B;  3IR4 A;  3SWL A;  1KDX A;  4BVX B;  3CSH A;  4AI6 A;  1R5A A;  4MF7 A;  2O3E A;  1PMT A;  3H1N A;  4QQ7 A;  5A4U A;  5BPK A;  16GS A;  2WW1 A;  3UVH A;  1F3A A; 
#chains in the Genus database with same CATH homology
 4C31 B;  4MBE C;  3F6D A;  19GS A;  4I97 A;  1E7G A;  2OAD A;  5ID7 A;  4N3Z A;  3LSZ A;  5ECM B;  2NNW A;  3GUS A;  5FUO A;  1MIW A;  4PO0 A;  1PKZ A;  2UZ8 A;  1SVO A;  2DSA A;  1BG1 A;  5F07 A;  1N25 A;  1PGT A;  1XW5 A;  4IQA A;  2CAI A;  1PX7 A;  3NIV A;  4KSM A;  3BBY A;  1AQV A;  5LCZ A;  4MPG A;  1O9X A;  4G04 A;  5BMU A;  4IW2 A;  1UOR A;  5HFK A;  4JBB A;  5IFO A;  1C72 A;  5BMU B;  5A4W A;  4MPF A;  2R4V A;  1JLV A;  1M9B A;  3VPQ A;  3TDL A;  4TQ1 A;  2VCT A;  3KTL A;  3FY7 A;  2F3M A;  3LQ7 A;  8GSS A;  3MDK A;  4HGM B;  2AJE A;  4G0K A;  5FHI A;  3CRU A;  1HNB A;  2CA8 A;  1B8X A;  4MP4 A;  3VK9 A;  5IIU A;  4KX4 A;  3CSJ A;  2DYM A;  5AN1 A;  11GS A;  4ID0 A;  2IMK A;  3SIU B;  1N2A A;  4N0U D;  4ZC6 A;  2R6K A;  2VCW A;  4PXO A;  2C4J A;  2ON5 A;  4ZBQ A;  3LG6 A;  2GLR A;  4G0I A;  4ZBR A;  5ELA A;  4ECJ A;  3P90 A;  5DBY A;  9GSS A;  4GSS A;  5DQS A;  5J41 A;  2HSN A;  4W66 A;  2OZB B;  2C8U A;  4ACS A;  4USS A;  2ROH A;  3FWB C;  3GQU A;  1K0B A;  5GZZ B;  1YJ6 A;  5A5H A;  2YV7 A;  1M0U A;  1VF1 A;  2GTU A;  4EDY A;  2JUH A;  4IBP A;  5G5E A;  5A5H B;  2BXF A;  1H5W A;  2CZ2 A;  5FWG A;  4L9K A;  1K0N A;  4G01 A;  5D7G A;  4ISD A;  1XW6 A;  1M99 A;  2BXQ A;  2EFH A;  3JRY A;  1KXP D;  3NVI A;  1EV4 A;  3B9L A;  2AAW A;  4BVY A;  4EDZ A;  2HSM A;  3M0F A;  2VKZ G;  5EL8 A;  4LUH A;  5IJE A;  4OTT A;  5DAL A;  3CX9 A;  2VD0 A;  4F5U A;  2HSM B;  1Q4J A;  1PD2 1;  2X64 A;  3QAV A;  3PLA A;  1TW9 A;  2DBX A;  5F06 A;  3FR6 A;  4K0G A;  4EXJ A;  3WHS A;  1MTC A;  6GSX A;  1TF0 A;  1V2A A;  1PA3 A;  1EOH A;  1IYI A;  2BXM A;  1M9A A;  2PBJ A;  2C3T A;  5FT3 A;  4AGS A;  5GIO A;  2VCZ A;  1E6B A;  1PL2 A;  2WRT A;  1E7I A;  4GLT A;  3IC8 A;  4FK5 B;  4IVF A;  3ERF A;  4MDC A;  2QHB A;  1K0M A;  4HI7 A;  1IYH A;  1Y6E A;  2BXK A;  1HK3 A;  4O92 A;  3A75 A;  3HMJ G;  5ECL B;  3R2Q A;  1Y1U A;  4YQV A;  4IEL A;  2QMC A;  1HK2 A;  2R3X A;  1A0F A;  2BXO A;  3ISO A;  1GSQ A;  1HNC A;  5J4Y A;  5D9X A;  1PX6 A;  2IL3 A;  1PL1 A;  1Z9H A;  20GS A;  5A34 B;  4HGK A;  1OE7 A;  2ON7 A;  5ECQ B;  4PQI A;  3HJO A;  5HOZ A;  5D9T A;  12GS A;  3M8N A;  3FYG A;  2DBW A;  1G6Y A;  4RI7 A;  2XW0 A;  1LJR A;  5DQF A;  3G7J A;  5DJM A;  1DUG A;  4PUA A;  2GST A;  3RBT A;  4ZBB A;  2O5V A;  1LBK A;  5J4U A;  2C3N A;  3QR6 A;  6GSV A;  3G7I A;  4L8U A;  2C3Q A;  2PVQ A;  4MF6 A;  4Q5Q A;  3F63 A;  3MHH B;  2VCQ A;  4ZBD A;  3KXO A;  2I2Z A;  3ZML A;  1F3B A;  3L0H A;  1K0D A;  4N0V A;  4Q5F A;  1K3Y A;  5IIX A;  2EFD A;  3PGT A;  1GSY A;  3VLN A;  4JZQ A;  6GSY A;  1F2E A;  3KM6 A;  3TOU A;  5ECN B;  1TXU A;  4WA6 B;  3HKR A;  5DAK B;  1OE8 A;  2XVQ A;  3CWG A;  5ECS A;  3GUR A;  1HK4 A;  3ZFB A;  4ECI A;  4MF5 A;  3FR9 A;  5B7C A;  4Q5N A;  5ECI B;  1TDI A;  4GF0 A;  4OMV A;  2CZ3 A;  4BKE A;  4OFT A;  4IKH A;  4GST A;  3A73 A;  1EEM A;  2E0X A;  2A2S A;  4RI6 A;  1B48 A;  2D2Z A;  4JED A;  4NHW A;  4AKH A;  4WR5 A;  4G0L A;  5AIS A;  4Q5R A;  4PNF A;  5ID9 A;  17GS A;  3PPU A;  1MIY A;  5D9W A;  1U88 A;  3Q19 A;  5GST A;  4KH7 A;  1OKT A;  4YQM A;  1MIV A;  3SQJ A;  6GSS A;  1GUK A;  2LOQ A;  4PQH A;  4ZUX V;  5JCU A;  2H1L A;  2DC5 A;  4ZBK A;  1GTB A;  1GSS A;  3M1G A;  2EFC A;  3N9J A;  4LMV A;  4TQ0 A;  1AQX A;  1YQ1 A;  2DYO A;  1E7B A;  4QMK A;  1GSE A;  22GS A;  2GSR A;  3MAK A;  1NT2 B;  3VQI A;  1BX9 A;  1U3I A;  2OA7 A;  1GNE A;  4AKG A;  4J2V A;  1VF3 A;  4G03 A;  1VFI A;  1GUH A;  4F0C A;  3ICX A;  1AO6 A;  4IQ1 A;  3UAP A;  3KJL A;  1K0O A;  1GNW A;  2XVV A;  6GSU A;  4G10 A;  3Q74 A;  2V6K A;  3EE2 A;  3IBH A;  4ECC A;  2BXD A;  1KBN A;  1GUM A;  4NHZ A;  1EOG A;  3CBU A;  4KDY A;  5ELG A;  3VI5 A;  5ECR B;  4HZ4 A;  4EC0 A;  3UIV A;  1SVL A;  3WD6 A;  4F0B A;  3V09 A;  3KMN A;  4PTS A;  1E7H A;  4K0N A;  2UV8 G;  4OR0 A;  3AY8 A;  3I69 A;  3Q18 A;  3U6V A;  2IMI A;  2HRK A;  2BXG A;  4TOP A;  2DBU A;  4J2F A;  4HOJ A;  3G9K D;  3GA9 L;  2V36 A;  3GTU B;  2HRK B;  1BM0 A;  2WB9 A;  5G5F A;  3IE3 A;  5J40 A;  2VUE A;  2XVU A;  2BXL A;  4YQU A;  2EFE A;  3ERG A;  3LYP A;  1HA2 A;  5ECP B;  5AIX A;  1G7O A;  4ZXG A;  2GSS A;  5D73 A;  3FWC C;  2PER A;  4AKI A;  5AGY A;  1HQO A;  2OAC A;  1YY7 A;  1JNB A;  3KIK A;  2XVW A;  4EE0 A;  4F5V A;  2AHE A;  4JK4 A;  5GHK A;  1TU7 A;  3IK9 A;  5F8B A;  2BXE A;  3LU6 A;  3NVK A;  4MK3 A;  5IIH A;  1ML6 A;  4BY9 C;  5A34 A;  6GSW A;  1FOU A;  2I30 A;  3H3A A;  1JLW A;  5F05 A;  4S1Y A;  1FW1 A;  2XSI A;  3HJM A;  1HK1 A;  4Z9O A;  1AW9 A;  1GSD A;  4LMW A;  1G6W A;  1GSF A;  5AIV A;  3LYK A;  1N5U A;  4AKX B;  3FR3 A;  4LB2 A;  2FNO A;  1BF5 A;  4F5S A;  3V03 A;  1VZS A;  1BKE A;  4FIP B;  4G19 A;  2Z8K A;  3V08 A;  2WDU A;  1YKC A;  4YAP A;  3H37 A;  1LNS A;  1YVL A;  2F8F A;  3UBL A;  4F5T A;  4E68 A;  1ZGN A;  1J7E A;  3PR8 A;  4O7H A;  4E8E A;  2CVD A;  3UAR A;  5IQY A;  2BXI A;  5J4V A;  4E8H A;  5J5N A;  4LB9 A;  3TGZ A;  2CAQ A;  2Z8J A;  2PMT A;  4GSN A;  4NAX A;  5ECH B;  4LA0 A;  2HQT A;  4PGT A;  4L9Q A;  5EVO A;  3M99 C;  4K71 A;  1GUL A;  5IJ5 A;  1GTI A;  1K0A A;  4ZB8 A;  4IJI A;  2BXN A;  3FNM A;  3GST A;  4HJ2 A;  5DDL A;  5DAK A;  4FQU A;  1E7A A;  3LU8 A;  4KF9 A;  5JCW A;  2OT3 A;  2J9H A;  1H9Z A;  4GG2 A;  3P8W A;  3UBK A;  1E7C A;  2LJR A;  5A5K A;  1K0C A;  2R5G A;  4ZB9 A;  3CSI A;  1BAY A;  3QAG A;  4PX1 A;  1E7F A;  3LJR A;  4PUR A;  7GSS A;  1NHY A;  5GSS A;  3GX0 A;  2BXB A;  2VO4 A;  5ECO B;  2NQO A;  1UA5 A;  2HRA A;  4IS0 A;  5D9V A;  3VI7 A;  4GDL B;  3IK7 A;  3D0Z A;  1KW2 A;  3GQX A;  4YAV A;  4ZBA A;  1GTU A;  1E7E A;  5GIP A;  5A1N A;  1GNJ A;  1SVM A;  4OTU A;  1GWC A;  4CHS A;  3B9M A;  3ZFL A;  2GSQ A;  3KMO A;  5A1N B;  10GS A;  1TU8 A;  4M70 B;  1XWK A;  2C80 A;  3QAW A;  3JQZ A;  1AQW A;  4DHX B;  2GDR A;  2AB6 A;  4GTU A;  3WYW A;  3NMU A;  2JL4 A;  1YDK A;  5IJF A;  2WS2 A;  4L8E A;  3WHR A;  2HNL A;  1BJ5 A;  2PGT A;  4IW9 A;  1GSU A;  1J78 A;  4K2C A;  3GSS A;  5LD0 A;  2DG5 A;  5DCG A;  2BXP A;  2BX8 A;  1XWG A;  3N5O A;  4KDU A;  2YV9 A;  1VF4 A;  1MA9 A;  4Z69 A;  2NTO A;  1K3O A;  1RK4 A;  5J47 A;  1K3L A;  4ZCG A;  1E78 A;  1EV9 A;  1VF2 A;  2BXA A;  1USB A;  1ZL9 A;  1MD3 A;  1LOT A;  2A2R A;  4OFN A;  3DGQ A;  1JZR A;  4YH2 A;  3GTU A;  2HSN B;  4KAE A;  1AXD A;  2VUF A;  3F6F A;  1BYE A;  1MD4 A;  2KBZ A;  3CRT A;  3DD3 A;  1GLQ A;  4OFM A;  3I6A A;  2N5F A;  3TOT A;  14GS A;  2XMO A;  4IW1 A;  2VD1 A;  3FRC A;  2CKX A;  3C8E A;  4OT2 A;  3M3M A;  4GDK B;  2WJU A;  3NVM A;  4KGI A;  1U87 A;  4MZW A;  1OYJ A;  2VDB A;  4BVY B;  2QM6 A;  4EMX A;  4DEJ A;  4PNG A;  13GS A;  5DAL B;  3KJY A;  3LFL A;  3VPT A;  1PKW A;  3VWX A;  3O3T A;  5GIN A;  4KE3 A;  2XW1 A;  1FHE A;  4NAW B;  1HNA A;  4E99 A;  4W4U B;  4HZ2 A;  4ZB7 A;  2VCV A;  4L5L A;  2VCX A;  4GDX A;  3R3E A;  2E0Y A;  4BL7 A;  4L5O A;  4WR4 A;  3VUR A;  4KDX A;  1IJG A;  4BL7 B;  3LU7 A;  1V40 A;  5KEJ A;  3SIV B;  5A4V A;  4IGJ A;  4LUF A;  3O76 A;  5ECK B;  3EIN A;  4ECB A;  2YDF A;  1BG5 A;  1HK5 A;  1GLP A;  4GCI A;  2BXH A;  3LXZ A;  3MHS B;  2YCD A;  1GNI A;  3TU3 B;  3ZMK A;  2BXC A;  18GS A;  3LXT A;  5F0G A;  4N0F D;  1PN9 A;  4G9H A;  1GTA A;  1B4P A;  4GDF A;  3W1S A;  2Z8I A;  4BVX A;  5B5T A;  4ZB6 A;  3GH6 A;  2FHE A;  6GST A;  5DJL A;  4F03 A;  5EY6 A;  3W8S A;  3WHQ A;  4FJC B;  3IR4 A;  3SWL A;  4BVX B;  3CSH A;  4AI6 A;  1R5A A;  4MF7 A;  1PMT A;  3H1N A;  4QQ7 A;  5A4U A;  5BPK A;  16GS A;  3UVH A;  1F3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...