4G01A

Ara7-gdp-ca2+/vps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
237
structure length
237
Chain Sequence
VKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Vacuolar protein sorting-associated protein 9A
publication title Direct metal recognition by guanine nucleotide-exchange factor in the initial step of the exchange reaction
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 101
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4g01A01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g01A02
2OT3A 2EFHA 2EFDA 4G01A 2EFCA 4N3ZA 2EFEA 1TXUA
chains in the Genus database with same CATH superfamily
2CAQA 5J41A 2DBXA 1B48A 1GUMA 4PUAA 2PERA 5DJLA 3CSIA 3B9MA 2WVXB 3AY8A 3SIVB 3UVHA 3CHXC 3LU8A 3V09A 4EC0A 4YQUA 3WYWA 2QHBA 4Q5NA 3LFLA 2NNWA 5A34B 4GSSA 3G9KD 1PN9A 3EE2A 1K0NA 4ACSA 3LYKA 1DUGA 1MUHA 5AIVA 2H1LA 3B9LA 3GQUA 1ML6A 4G03A 5JCWA 2AJEA 3CSJA 4OFTA 3FR9A 5ECSA 1H5WA 4F5TA 1GUKA 4N0UD 1Y1UA 3V08A 4OTTA 2CZ2A 3UBKA 2HSMA 5B5TA 3NVKA 1FW1A 4ZB7A 1F2EA 1KDXA 5ECNB 3O3TA 5J5NA 1M9BA 4TQ0A 5IIUA 4G0KA 4EMXA 3LJRA 4MPFA 2BXCA 3R3EA 1HA2A 1PL2A 1K3YA 12GSA 1LNSA 4AGSA 4G9HA 1E7CA 2HSNA 4E8HA 4LMWA 4FIPB 2HRKB 3NIVA 1J7EA 3SWLA 3F6FA 2XVWA 2VDBA 3UARA 2C80A 1FHEA 3H37A 2AHEA 3WHRA 1PA3A 4F0BA 1KXPD 1OYJA 2HNLA 1MD4A 4WR5A 2F3MA 4KDXA 2WB9A 1TU7A 2WRTA 2QM6A 5F8BA 4FJCB 3M0FA 5GZZB 4C31B 5ECPB 2Z8IA 5IIXA 5LD0A 4K2CA 2FNOA 1N25A 1VZSA 7GSSA 4NHWA 1OE7A 4ZBKA 2F8FA 2AGHB 4DHXB 1HK1A 1GSFA 3D0ZA 3F63A 3N5OA 1TXUA 2LQHA 1OE8A 5ELAA 3FNMA 3PR8A 4GDLB 3GUSA 3PLAA 1BAYA 4ZBBA 1U87A 5J40A 9GSSA 2K0NA 2WZSA 2R5GA 4BL7B 1AXDA 2ROHA 4O7HA 5F07A 3ZMLA 4EE0A 1HQOA 2OZBB 3U6VA 5D9XA 4G10A 4S1YA 3WHSA 18GSA 3NVMA 5DAKB 1F3BA 4ISDA 5IQYA 2DBWA 1JLVA 3GSTA 1MD3A 1YVLA 2NTOA 4L8EA 3FY7A 4CHSA 4GDFA 2BXFA 1XW6A 5J4VA 4PO0A 1E7HA 1SVMA 1BG1A 1TDIA 3BPJA 3HKRA 5FT3A 5J47A 4EDZA 1M99A 3CX9A 1GUHA 3N9JA 3GURA 1RK4A 2XW1A 4MZWA 3TDLA 3FYGA 3MHSB 5A1NA 1HK4A 3UAPA 5G5EA 1PKWA 2CZ3A 4OTUA 2C3TA 3ISOA 4FXYP 1MUSA 3LXTA 3VPTA 4F5SA 1AQXA 3LU6A 2VKZG 2O36A 2HSMB 6GSTA 2O5VA 1HNCA 3H3AA 2WW2A 1Q4JA 4PGTA 5FWGA 4KH7A 5G5FA 3MAKA 5A5HA 4E99A 5D73A 4IQ1A 2GSQA 4J2FA 2BXIA 4LA0A 19GSA 6GSVA 1E7BA 4FK5B 5DAKA 2GTUA 4IW1A 2V36A 13GSA 4Z9OA 2VCQA 2VCVA 2WVZA 2XSIA 3RGBC 1GNIA 5IIHA 3NMUA 3TOUA 5D9WA 5AISA 4F0CA 2N5FA 2OACA 3ZFBA 4DEJA 5AGYA 1M9AA 2JUHA 1AQVA 4KE3A 2WW3A 1E7EA 2O3EA 1K3OA 2BXDA 4LB9A 3P90A 2D2ZA 2GSSA 1K3LA 4IW2A 1JZRA 4ZC6A 1GSYA 1N2AA 3A73A 1Z9HA 4FQUA 4GSTA 3TGZA 3FWBC 2VCWA 3QAWA 4ECJA 3MDKA 4AKXB 4PI2C 1B4PA 3VK9A 4D7XA 3LYPA 2BXHA 5DCGA 4G19A 1BKEA 2IMKA 1M0UA 4MDCA 1E7FA 4PTSA 4OFMA 4KX4A 4NAXA 3RFRC 4OT2A 5EY6A 4MPGA 4QMKA 3RBTA 2A2SA 3G7IA 3FWCC 5JCUA 1V2AA 1K0OA 1LBKA 4HI7A 3IE3A 5J4UA 5KEJA 2VUFA 4ZB9A 1PKZA 4N3ZA 2EFEA 4GDXA 4HGMB 1U88A 2HQTA 1MIYA 4GLTA 3JQZA 3ICXA 1EV4A 5ECKB 5DALB 5IJ5A 2V6KA 1HNBA 2PMTA 3KIKA 4ZCGA 4Z69A 2LQIA 1IYHA 1BG5A 3UIVA 4USSA 4GG2A 5HFKA 1E78A 1EOGA 4F5VA 20GSA 4EXJA 5ECOB 4MF6A 4L9QA 5GIOA 1PGTA 3IC8A 5A1NB 4YH2A 2PBJA 6GSSA 3HMJG 5ECHB 3V03A 1VF4A 4K0GA 4W66A 2DC5A 3W8SA 1XWKA 5F05A 2LXTA 4ZBDA 2C3QA 4O92A 4KF9A 1TF0A 1S4BP 3QAVA 2HRAA 2IMIA 1USBA 3GA9L 5A5HB 3VQIA 2CA8A 2VD1A 4ZUXV 1BX9A 4JZQA 4QQ7A 4HGKA 1XW5A 1NT2B 4BY9C 3FRCA 4I97A 5EVOA 2KBZA 3A75A 5J4YA 1LOTA 4KGIA 3Q74A 5ECMB 1TU8A 1O9XA 5DDLA 2R3XA 4MF5A 1K0CA 5A4WA 3DD3A 2I2ZA 3GTUA 10GSA 1GSSA 3LSZA 5DALA 4PNGA 2WJUA 2XVVA 5AN1A 4LUFA 1EV9A 4NHZA 3CRTA 5ECQB 2VCTA 2BXLA 4JK4A 1E7IA 2I30A 1VF2A 5F0GA 1G7OA 1AO6A 1GSUA 3FR6A 4G01A 1SVLA 3P8WA 2OADA 4PNFA 1VF3A 2YDFA 5AIXA 5FHIA 5A5KA 5ELGA 3SIUB 4GDKB 3C8EA 3TOTA 4ZBQA 1PMTA 2C4JA 2DG5A 4GTUA 2VUEA 2AAWA 4I9OA 4JBBA 1EOHA 1MTCA 2CVDA 2JL4A 3GX0A 1BJ5A 4OFNA 1VFIA 1N5UA 2LXSA 2XVQA 1GWCA 1HK3A 2GSRA 4GSNA 2OT3A 2IL3A 3KTLA 4ZB6A 1UORA 1U3IA 5D7GA 3G7JA 4PX1A 4TQ1A 6GSXA 4GCIA 3CWGA 4F5UA 4EDYA 5A4UA 4PQIA 2BXMA 4F03A 4ZXGA 4MBEC 4K0NA 4N0FD 2ON7A 1GNJA 4AI6A 4IW9A 1GTIA 3KXOA 4IGJA 3PPUA 1BM0A 4IELA 4YAPA 5DBYA 1YEWC 2OA7A 4PXOA 3M99C 1GLPA 4ZB8A 2BXOA 4BVXA 2GLRA 2WDUA 6GSYA 2GDRA 1R5AA 2E0XA 1SB0A 2BXAA 4WA6B 5GIPA 2VCZA 4L5LA 2BXBA 1MIVA 1GTUA 3SQJA 2X64A 1K0AA 3ZMKA 16GSA 1A0FA 1KBNA 4BVYA 4PQHA 4AKHA 1FOUA 5BPKA 1PX7A 2EFHA 3DGQA 4MK3A 5DQSA 3Q18A 3NVIA 2R6KA 1V40A 6GSUA 1HK2A 3FR3A 2UZ8A 4G0IA 4J2VA 1YKCA 4IKHA 1Y6EA 1AQWA 3JRYA 1UA5A 3ZFLA 4Q5FA 1OKTA 4PHZC 4ECIA 5GHKA 4BKEA 5IJEA 5EL8A 4ZBRA 3GTUB 5GINA 2BXGA 1JLWA 2Z8KA 1AW9A 4L5OA 4WR4A 5F06A 1E6BA 3IK7A 5HOZA 5ID7A 2PGTA 4YQMA 1I1IP 3F6DA 2DBUA 2YV7A 4ZBAA 3IR4A 4OMVA 5GSSA 1XWGA 4E68A 3KJYA 6GSWA 1GSDA 5BMUA 1PL1A 1YY7A 1BF5A 5ECLB 2XMOA 4IBPA 4N0VA 1LJRA 1ZGNA 4AKIA 1C72A 3CSHA 2WVXA 2LOQA 2GUTA 5ID9A 3ECPA 4M70B 2ON5A 2J9HA 4HJ2A 3HJMA 3KM6A 3LU7A 5LCZA 3VI7A 5A34A 3CRUA 1BYEA 3H1NA 4KSMA 3QR6A 4YAVA 3VWXA 2Z8JA 5IJFA 3I6AA 5DJMA 2A2RA 4NAWB 4W4UB 4MP4A 4PI0C 4PURA 4IVFA 4LUHA 1PX6A 4K71A 1G6WA 4RI6A 4YQVA 1GNEA 4L8UA 5IFOA 2WVYA 3R2QA 4MF7A 4Q5RA 4IQAA 2UV8G 2NQOA 11GSA 1E7AA 2AB6A 3BBYA 1EEMA 2VCXA 4LB2A 3HJOA 2PVQA 5B7CA 2BX8A 4BVXB 1SVOA 3KJLA 1MM8A 1YQ1A 4G0LA 2DYMA 1HK5A 3ERFA 3O76A 4HOJA 1ZL9A 3PGTA 4IS0A 4G04A 4RI7A 3LQ7A 4AKGA 2BXNA 1MA9A 2EFCA 1G6YA 1H9ZA 3GH6A 4L9KA 2HRKA 1B8XA 3QAGA 4ECCA 5D9VA 1GSQA 4Q5QA 3GSSA 1VF1A 22GSA 2FHEA 2YV9A 4LMVA 3I69A 3IBHA 3M8NA 4E8EA 4ECBA 1GLQA 3UBLA 3IK9A 5D9TA 3KMNA 1GULA 1K0BA 4KAEA 5ECIB 3TU3B 4BVYB 1KW2A 2BXEA 2WW0A 1YDKA 2GSTA 1MIWA 1F3AA 2XVUA 1GNWA 8GSSA 5GSTA 3WD6A 5A4VA 2XW0A 2CKXA 2DYOA 1K0MA 4IJIA 1JNBA 1PD21 2LJRA 3CBUA 4OR0A 3MHHB 3ERGA 1GTAA 2BXPA 1HNAA 1J78A 3LG6A 3LXZA 4GF0A 3VPQA 3VLNA 3M3MA 2VO4A 1IJGA 2WW1A 4JEDA 3Q19A 4KDUA 4TOPA 4HZ2A 1K0DA 1E7GA 1GTBA 5FUOA 2KWFA 2WS2A 5ECRB 3VI5A 1NHYA 2R4VA 3L0HA 2QMCA 3KMOA 2C8UA 1IYIA 14GSA 2EFDA 2BXKA 2DSAA 2YCDA 3WHQA 3EINA 4ID0A 2BXQA 17GSA 4DM0A 4BL7A 5DQFA 1TW9A 1YJ6A 3VURA 5BMUB 1GSEA 3M1GA 2HSNB 2VD0A 2E0YA 3W1SA 4HZ4A 4KDYA 2CAIA 2C3NA 3GQXA
chains in the Genus database with same CATH topology
2CAQA 5J41A 2DBXA 1B48A 1GUMA 4PUAA 2PERA 5DJLA 3CSIA 3B9MA 3AY8A 3SIVB 3UVHA 3LU8A 3V09A 4EC0A 4YQUA 3WYWA 2QHBA 4Q5NA 3LFLA 2NNWA 5A34B 4GSSA 3G9KD 1PN9A 3EE2A 1K0NA 4ACSA 3LYKA 1DUGA 5AIVA 2H1LA 3B9LA 3GQUA 1ML6A 4G03A 5JCWA 2AJEA 3CSJA 4OFTA 3FR9A 5ECSA 1H5WA 4F5TA 1GUKA 4N0UD 1Y1UA 3V08A 4OTTA 2CZ2A 3UBKA 2HSMA 5B5TA 3NVKA 1FW1A 4ZB7A 1F2EA 5ECNB 3O3TA 5J5NA 1M9BA 4TQ0A 5IIUA 4G0KA 4EMXA 3LJRA 4MPFA 2BXCA 3R3EA 1HA2A 1PL2A 1K3YA 12GSA 1LNSA 4AGSA 4G9HA 1E7CA 2HSNA 4E8HA 4LMWA 4FIPB 2HRKB 3NIVA 1J7EA 3SWLA 3F6FA 2XVWA 2VDBA 3UARA 2C80A 1FHEA 3H37A 2AHEA 3WHRA 1PA3A 4F0BA 1KXPD 1OYJA 2HNLA 1MD4A 4WR5A 2F3MA 4KDXA 2WB9A 1TU7A 2WRTA 2QM6A 5F8BA 4FJCB 3M0FA 5GZZB 4C31B 5ECPB 2Z8IA 5IIXA 5LD0A 4K2CA 2FNOA 1N25A 1VZSA 7GSSA 4NHWA 1OE7A 4ZBKA 2F8FA 4DHXB 1GSFA 1HK1A 3D0ZA 3F63A 3N5OA 1TXUA 1OE8A 5ELAA 3FNMA 3PR8A 4GDLB 3GUSA 3PLAA 1BAYA 4ZBBA 1U87A 5J40A 9GSSA 2R5GA 4BL7B 1AXDA 2ROHA 4O7HA 5F07A 3ZMLA 4EE0A 1HQOA 2OZBB 3U6VA 5D9XA 4G10A 4S1YA 3WHSA 18GSA 3NVMA 5DAKB 1F3BA 4ISDA 5IQYA 2DBWA 1JLVA 3GSTA 1MD3A 1YVLA 2NTOA 4L8EA 3FY7A 4CHSA 4GDFA 2BXFA 1XW6A 5J4VA 4PO0A 1E7HA 1SVMA 1BG1A 1TDIA 3HKRA 5FT3A 5J47A 4EDZA 1M99A 3CX9A 1GUHA 3N9JA 3GURA 1RK4A 2XW1A 4MZWA 3TDLA 3FYGA 3MHSB 5A1NA 1HK4A 3UAPA 5G5EA 1PKWA 2CZ3A 4OTUA 2C3TA 3ISOA 3LXTA 3VPTA 4F5SA 1AQXA 3LU6A 2VKZG 2HSMB 6GSTA 2O5VA 1HNCA 3H3AA 1Q4JA 4PGTA 5FWGA 4KH7A 5G5FA 3MAKA 5A5HA 4E99A 5D73A 4IQ1A 2GSQA 4J2FA 2BXIA 4LA0A 19GSA 6GSVA 1E7BA 4FK5B 5DAKA 2GTUA 4IW1A 2V36A 13GSA 4Z9OA 2VCQA 2VCVA 2XSIA 1GNIA 5IIHA 3NMUA 3TOUA 5D9WA 5AISA 4F0CA 2N5FA 2OACA 3ZFBA 4DEJA 5AGYA 1M9AA 2JUHA 1AQVA 4KE3A 1E7EA 1K3OA 2BXDA 4LB9A 3P90A 2D2ZA 2GSSA 1K3LA 4IW2A 1JZRA 4ZC6A 1GSYA 1N2AA 3A73A 1Z9HA 4FQUA 4GSTA 3TGZA 3FWBC 2VCWA 3QAWA 4ECJA 3MDKA 4AKXB 1B4PA 3VK9A 3LYPA 5DCGA 2BXHA 4G19A 1BKEA 2IMKA 1M0UA 4MDCA 1E7FA 4PTSA 4OFMA 4KX4A 4NAXA 4OT2A 5EY6A 4MPGA 4QMKA 3RBTA 2A2SA 3G7IA 3FWCC 5JCUA 1V2AA 1K0OA 1LBKA 4HI7A 3IE3A 5J4UA 5KEJA 2VUFA 4ZB9A 1PKZA 4N3ZA 2EFEA 4GDXA 4HGMB 1U88A 2HQTA 1MIYA 4GLTA 3JQZA 3ICXA 1EV4A 5ECKB 5DALB 5IJ5A 2V6KA 1HNBA 2PMTA 3KIKA 4ZCGA 4Z69A 1IYHA 1BG5A 3UIVA 4USSA 4GG2A 5HFKA 1E78A 1EOGA 4F5VA 20GSA 4EXJA 5ECOB 4MF6A 4L9QA 5GIOA 1PGTA 3IC8A 5A1NB 4YH2A 2PBJA 6GSSA 3HMJG 5ECHB 3V03A 1VF4A 4K0GA 4W66A 2DC5A 3W8SA 1XWKA 5F05A 4ZBDA 2C3QA 4O92A 4KF9A 1TF0A 3QAVA 2HRAA 2IMIA 1USBA 3GA9L 5A5HB 3VQIA 2CA8A 2VD1A 4ZUXV 1BX9A 4JZQA 4QQ7A 4HGKA 1XW5A 1NT2B 4BY9C 3FRCA 4I97A 5EVOA 2KBZA 3A75A 5J4YA 1LOTA 4KGIA 3Q74A 5ECMB 1TU8A 1O9XA 5DDLA 2R3XA 4MF5A 1K0CA 5A4WA 3DD3A 2I2ZA 3GTUA 10GSA 1GSSA 3LSZA 5DALA 4PNGA 2WJUA 2XVVA 5AN1A 4LUFA 1EV9A 4NHZA 3CRTA 5ECQB 2VCTA 2BXLA 4JK4A 1E7IA 2I30A 1VF2A 5F0GA 1G7OA 1AO6A 1GSUA 3FR6A 4G01A 1SVLA 3P8WA 2OADA 4PNFA 1VF3A 2YDFA 5AIXA 5FHIA 5A5KA 5ELGA 3SIUB 4GDKB 3C8EA 3TOTA 4ZBQA 1PMTA 2C4JA 2DG5A 4GTUA 2VUEA 2AAWA 4JBBA 1EOHA 1MTCA 2CVDA 2JL4A 3GX0A 1BJ5A 4OFNA 1VFIA 1N5UA 2XVQA 4GSNA 1GWCA 1HK3A 2GSRA 2OT3A 2IL3A 3KTLA 4ZB6A 1UORA 1U3IA 5D7GA 3G7JA 4PX1A 4TQ1A 6GSXA 4GCIA 3CWGA 4F5UA 4EDYA 5A4UA 4PQIA 2BXMA 4F03A 4ZXGA 4MBEC 4K0NA 4N0FD 2ON7A 1GNJA 4AI6A 4IW9A 1GTIA 3KXOA 4IGJA 3PPUA 1BM0A 4IELA 4YAPA 5DBYA 2OA7A 4PXOA 3M99C 1GLPA 4ZB8A 2BXOA 4BVXA 2GLRA 2WDUA 6GSYA 2GDRA 1R5AA 2E0XA 2BXAA 4WA6B 5GIPA 2VCZA 4L5LA 2BXBA 1MIVA 1GTUA 3SQJA 2X64A 1K0AA 3ZMKA 16GSA 1A0FA 1KBNA 4BVYA 4PQHA 4AKHA 1FOUA 5BPKA 1PX7A 2EFHA 3DGQA 4MK3A 5DQSA 3Q18A 3NVIA 2R6KA 1V40A 6GSUA 1HK2A 3FR3A 2UZ8A 4G0IA 4J2VA 1YKCA 4IKHA 1Y6EA 1AQWA 3JRYA 1UA5A 3ZFLA 4Q5FA 1OKTA 4ECIA 5GHKA 4BKEA 5IJEA 5EL8A 4ZBRA 3GTUB 5GINA 2BXGA 1JLWA 2Z8KA 1AW9A 4L5OA 4WR4A 5F06A 1E6BA 3IK7A 5HOZA 5ID7A 2PGTA 4YQMA 3F6DA 2DBUA 2YV7A 4ZBAA 3IR4A 4OMVA 5GSSA 1XWGA 4E68A 3KJYA 6GSWA 1GSDA 5BMUA 1PL1A 1YY7A 1BF5A 5ECLB 2XMOA 4IBPA 4N0VA 1LJRA 1ZGNA 4AKIA 1C72A 3CSHA 2LOQA 5ID9A 2ON5A 4M70B 2J9HA 4HJ2A 3HJMA 3KM6A 3LU7A 5LCZA 3VI7A 5A34A 3CRUA 1BYEA 3H1NA 4KSMA 3QR6A 4YAVA 3VWXA 2Z8JA 5IJFA 3I6AA 5DJMA 2A2RA 4NAWB 4W4UB 4MP4A 4PURA 4IVFA 4LUHA 1PX6A 4K71A 1G6WA 4RI6A 4YQVA 1GNEA 4L8UA 5IFOA 3R2QA 4MF7A 4Q5RA 4IQAA 2UV8G 2NQOA 11GSA 1E7AA 2AB6A 3BBYA 1EEMA 2VCXA 4LB2A 3HJOA 2PVQA 5B7CA 2BX8A 4BVXB 1SVOA 3KJLA 1YQ1A 4G0LA 2DYMA 1HK5A 3ERFA 3O76A 4HOJA 1ZL9A 3PGTA 4IS0A 4G04A 4RI7A 3LQ7A 4AKGA 2BXNA 1MA9A 2EFCA 1G6YA 1H9ZA 3GH6A 4L9KA 2HRKA 1B8XA 3QAGA 4ECCA 5D9VA 1GSQA 4Q5QA 3GSSA 1VF1A 22GSA 2FHEA 2YV9A 4LMVA 3I69A 3IBHA 3M8NA 4E8EA 4ECBA 1GLQA 3UBLA 3IK9A 5D9TA 3KMNA 1GULA 1K0BA 4KAEA 5ECIB 3TU3B 4BVYB 1KW2A 2BXEA 1YDKA 2GSTA 1MIWA 1F3AA 2XVUA 1GNWA 8GSSA 5GSTA 3WD6A 5A4VA 2XW0A 2CKXA 2DYOA 1K0MA 4IJIA 1JNBA 1PD21 2LJRA 3CBUA 4OR0A 3MHHB 3ERGA 1GTAA 2BXPA 1HNAA 1J78A 3LG6A 3LXZA 4GF0A 3VPQA 3VLNA 3M3MA 2VO4A 1IJGA 4JEDA 3Q19A 4KDUA 4TOPA 4HZ2A 1K0DA 1E7GA 1GTBA 5FUOA 3VI5A 2WS2A 5ECRB 1NHYA 2R4VA 3L0HA 2QMCA 3KMOA 2C8UA 1IYIA 14GSA 2EFDA 2BXKA 2DSAA 2YCDA 3WHQA 3EINA 4ID0A 2BXQA 17GSA 4BL7A 5DQFA 1TW9A 1YJ6A 3VURA 5BMUB 1GSEA 3M1GA 2HSNB 2VD0A 2E0YA 3W1SA 4HZ4A 4KDYA 2CAIA 2C3NA 3GQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT3 A;  2EFH A;  2EFD A;  4G01 A;  2EFC A;  4N3Z A;  2EFE A;  1TXU A; 
#chains in the Genus database with same CATH topology
 2CAQ A;  5J41 A;  2DBX A;  1B48 A;  1GUM A;  4PUA A;  2PER A;  5DJL A;  3CSI A;  3B9M A;  2WVX B;  3AY8 A;  3SIV B;  3UVH A;  3CHX C;  3LU8 A;  3V09 A;  4EC0 A;  4YQU A;  3WYW A;  2QHB A;  4Q5N A;  3LFL A;  2NNW A;  5A34 B;  4GSS A;  3G9K D;  1PN9 A;  3EE2 A;  1K0N A;  4ACS A;  3LYK A;  1DUG A;  1MUH A;  5AIV A;  2H1L A;  3B9L A;  3GQU A;  1ML6 A;  4G03 A;  5JCW A;  2AJE A;  3CSJ A;  4OFT A;  3FR9 A;  5ECS A;  1H5W A;  4F5T A;  1GUK A;  4N0U D;  1Y1U A;  3V08 A;  4OTT A;  2CZ2 A;  3UBK A;  2HSM A;  5B5T A;  3NVK A;  1FW1 A;  4ZB7 A;  1F2E A;  1KDX A;  5ECN B;  3O3T A;  5J5N A;  1M9B A;  4TQ0 A;  5IIU A;  4G0K A;  4EMX A;  3LJR A;  4MPF A;  2BXC A;  3R3E A;  1HA2 A;  1PL2 A;  1K3Y A;  12GS A;  1LNS A;  4AGS A;  4G9H A;  1E7C A;  2HSN A;  4E8H A;  4LMW A;  4FIP B;  2HRK B;  3NIV A;  1J7E A;  3SWL A;  3F6F A;  2XVW A;  2VDB A;  3UAR A;  2C80 A;  1FHE A;  3H37 A;  2AHE A;  3WHR A;  1PA3 A;  4F0B A;  1KXP D;  1OYJ A;  2HNL A;  1MD4 A;  4WR5 A;  2F3M A;  4KDX A;  2WB9 A;  1TU7 A;  2WRT A;  2QM6 A;  5F8B A;  4FJC B;  3M0F A;  5GZZ B;  4C31 B;  5ECP B;  2Z8I A;  5IIX A;  5LD0 A;  4K2C A;  2FNO A;  1N25 A;  1VZS A;  7GSS A;  4NHW A;  1OE7 A;  4ZBK A;  2F8F A;  2AGH B;  4DHX B;  1HK1 A;  1GSF A;  3D0Z A;  3F63 A;  3N5O A;  1TXU A;  2LQH A;  1OE8 A;  5ELA A;  3FNM A;  3PR8 A;  4GDL B;  3GUS A;  3PLA A;  1BAY A;  4ZBB A;  1U87 A;  5J40 A;  9GSS A;  2K0N A;  2WZS A;  2R5G A;  4BL7 B;  1AXD A;  2ROH A;  4O7H A;  5F07 A;  3ZML A;  4EE0 A;  1HQO A;  2OZB B;  3U6V A;  5D9X A;  4G10 A;  4S1Y A;  3WHS A;  18GS A;  3NVM A;  5DAK B;  1F3B A;  4ISD A;  5IQY A;  2DBW A;  1JLV A;  3GST A;  1MD3 A;  1YVL A;  2NTO A;  4L8E A;  3FY7 A;  4CHS A;  4GDF A;  2BXF A;  1XW6 A;  5J4V A;  4PO0 A;  1E7H A;  1SVM A;  1BG1 A;  1TDI A;  3BPJ A;  3HKR A;  5FT3 A;  5J47 A;  4EDZ A;  1M99 A;  3CX9 A;  1GUH A;  3N9J A;  3GUR A;  1RK4 A;  2XW1 A;  4MZW A;  3TDL A;  3FYG A;  3MHS B;  5A1N A;  1HK4 A;  3UAP A;  5G5E A;  1PKW A;  2CZ3 A;  4OTU A;  2C3T A;  3ISO A;  4FXY P;  1MUS A;  3LXT A;  3VPT A;  4F5S A;  1AQX A;  3LU6 A;  2VKZ G;  2O36 A;  2HSM B;  6GST A;  2O5V A;  1HNC A;  3H3A A;  2WW2 A;  1Q4J A;  4PGT A;  5FWG A;  4KH7 A;  5G5F A;  3MAK A;  5A5H A;  4E99 A;  5D73 A;  4IQ1 A;  2GSQ A;  4J2F A;  2BXI A;  4LA0 A;  19GS A;  6GSV A;  1E7B A;  4FK5 B;  5DAK A;  2GTU A;  4IW1 A;  2V36 A;  13GS A;  4Z9O A;  2VCQ A;  2VCV A;  2WVZ A;  2XSI A;  3RGB C;  1GNI A;  5IIH A;  3NMU A;  3TOU A;  5D9W A;  5AIS A;  4F0C A;  2N5F A;  2OAC A;  3ZFB A;  4DEJ A;  5AGY A;  1M9A A;  2JUH A;  1AQV A;  4KE3 A;  2WW3 A;  1E7E A;  2O3E A;  1K3O A;  2BXD A;  4LB9 A;  3P90 A;  2D2Z A;  2GSS A;  1K3L A;  4IW2 A;  1JZR A;  4ZC6 A;  1GSY A;  1N2A A;  3A73 A;  1Z9H A;  4FQU A;  4GST A;  3TGZ A;  3FWB C;  2VCW A;  3QAW A;  4ECJ A;  3MDK A;  4AKX B;  4PI2 C;  1B4P A;  3VK9 A;  4D7X A;  3LYP A;  2BXH A;  5DCG A;  4G19 A;  1BKE A;  2IMK A;  1M0U A;  4MDC A;  1E7F A;  4PTS A;  4OFM A;  4KX4 A;  4NAX A;  3RFR C;  4OT2 A;  5EY6 A;  4MPG A;  4QMK A;  3RBT A;  2A2S A;  3G7I A;  3FWC C;  5JCU A;  1V2A A;  1K0O A;  1LBK A;  4HI7 A;  3IE3 A;  5J4U A;  5KEJ A;  2VUF A;  4ZB9 A;  1PKZ A;  4N3Z A;  2EFE A;  4GDX A;  4HGM B;  1U88 A;  2HQT A;  1MIY A;  4GLT A;  3JQZ A;  3ICX A;  1EV4 A;  5ECK B;  5DAL B;  5IJ5 A;  2V6K A;  1HNB A;  2PMT A;  3KIK A;  4ZCG A;  4Z69 A;  2LQI A;  1IYH A;  1BG5 A;  3UIV A;  4USS A;  4GG2 A;  5HFK A;  1E78 A;  1EOG A;  4F5V A;  20GS A;  4EXJ A;  5ECO B;  4MF6 A;  4L9Q A;  5GIO A;  1PGT A;  3IC8 A;  5A1N B;  4YH2 A;  2PBJ A;  6GSS A;  3HMJ G;  5ECH B;  3V03 A;  1VF4 A;  4K0G A;  4W66 A;  2DC5 A;  3W8S A;  1XWK A;  5F05 A;  2LXT A;  4ZBD A;  2C3Q A;  4O92 A;  4KF9 A;  1TF0 A;  1S4B P;  3QAV A;  2HRA A;  2IMI A;  1USB A;  3GA9 L;  5A5H B;  3VQI A;  2CA8 A;  2VD1 A;  4ZUX V;  1BX9 A;  4JZQ A;  4QQ7 A;  4HGK A;  1XW5 A;  1NT2 B;  4BY9 C;  3FRC A;  4I97 A;  5EVO A;  2KBZ A;  3A75 A;  5J4Y A;  1LOT A;  4KGI A;  3Q74 A;  5ECM B;  1TU8 A;  1O9X A;  5DDL A;  2R3X A;  4MF5 A;  1K0C A;  5A4W A;  3DD3 A;  2I2Z A;  3GTU A;  10GS A;  1GSS A;  3LSZ A;  5DAL A;  4PNG A;  2WJU A;  2XVV A;  5AN1 A;  4LUF A;  1EV9 A;  4NHZ A;  3CRT A;  5ECQ B;  2VCT A;  2BXL A;  4JK4 A;  1E7I A;  2I30 A;  1VF2 A;  5F0G A;  1G7O A;  1AO6 A;  1GSU A;  3FR6 A;  4G01 A;  1SVL A;  3P8W A;  2OAD A;  4PNF A;  1VF3 A;  2YDF A;  5AIX A;  5FHI A;  5A5K A;  5ELG A;  3SIU B;  4GDK B;  3C8E A;  3TOT A;  4ZBQ A;  1PMT A;  2C4J A;  2DG5 A;  4GTU A;  2VUE A;  2AAW A;  4I9O A;  4JBB A;  1EOH A;  1MTC A;  2CVD A;  2JL4 A;  3GX0 A;  1BJ5 A;  4OFN A;  1VFI A;  1N5U A;  2LXS A;  2XVQ A;  1GWC A;  1HK3 A;  2GSR A;  4GSN A;  2OT3 A;  2IL3 A;  3KTL A;  4ZB6 A;  1UOR A;  1U3I A;  5D7G A;  3G7J A;  4PX1 A;  4TQ1 A;  6GSX A;  4GCI A;  3CWG A;  4F5U A;  4EDY A;  5A4U A;  4PQI A;  2BXM A;  4F03 A;  4ZXG A;  4MBE C;  4K0N A;  4N0F D;  2ON7 A;  1GNJ A;  4AI6 A;  4IW9 A;  1GTI A;  3KXO A;  4IGJ A;  3PPU A;  1BM0 A;  4IEL A;  4YAP A;  5DBY A;  1YEW C;  2OA7 A;  4PXO A;  3M99 C;  1GLP A;  4ZB8 A;  2BXO A;  4BVX A;  2GLR A;  2WDU A;  6GSY A;  2GDR A;  1R5A A;  2E0X A;  1SB0 A;  2BXA A;  4WA6 B;  5GIP A;  2VCZ A;  4L5L A;  2BXB A;  1MIV A;  1GTU A;  3SQJ A;  2X64 A;  1K0A A;  3ZMK A;  16GS A;  1A0F A;  1KBN A;  4BVY A;  4PQH A;  4AKH A;  1FOU A;  5BPK A;  1PX7 A;  2EFH A;  3DGQ A;  4MK3 A;  5DQS A;  3Q18 A;  3NVI A;  2R6K A;  1V40 A;  6GSU A;  1HK2 A;  3FR3 A;  2UZ8 A;  4G0I A;  4J2V A;  1YKC A;  4IKH A;  1Y6E A;  1AQW A;  3JRY A;  1UA5 A;  3ZFL A;  4Q5F A;  1OKT A;  4PHZ C;  4ECI A;  5GHK A;  4BKE A;  5IJE A;  5EL8 A;  4ZBR A;  3GTU B;  5GIN A;  2BXG A;  1JLW A;  2Z8K A;  1AW9 A;  4L5O A;  4WR4 A;  5F06 A;  1E6B A;  3IK7 A;  5HOZ A;  5ID7 A;  2PGT A;  4YQM A;  1I1I P;  3F6D A;  2DBU A;  2YV7 A;  4ZBA A;  3IR4 A;  4OMV A;  5GSS A;  1XWG A;  4E68 A;  3KJY A;  6GSW A;  1GSD A;  5BMU A;  1PL1 A;  1YY7 A;  1BF5 A;  5ECL B;  2XMO A;  4IBP A;  4N0V A;  1LJR A;  1ZGN A;  4AKI A;  1C72 A;  3CSH A;  2WVX A;  2LOQ A;  2GUT A;  5ID9 A;  3ECP A;  4M70 B;  2ON5 A;  2J9H A;  4HJ2 A;  3HJM A;  3KM6 A;  3LU7 A;  5LCZ A;  3VI7 A;  5A34 A;  3CRU A;  1BYE A;  3H1N A;  4KSM A;  3QR6 A;  4YAV A;  3VWX A;  2Z8J A;  5IJF A;  3I6A A;  5DJM A;  2A2R A;  4NAW B;  4W4U B;  4MP4 A;  4PI0 C;  4PUR A;  4IVF A;  4LUH A;  1PX6 A;  4K71 A;  1G6W A;  4RI6 A;  4YQV A;  1GNE A;  4L8U A;  5IFO A;  2WVY A;  3R2Q A;  4MF7 A;  4Q5R A;  4IQA A;  2UV8 G;  2NQO A;  11GS A;  1E7A A;  2AB6 A;  3BBY A;  1EEM A;  2VCX A;  4LB2 A;  3HJO A;  2PVQ A;  5B7C A;  2BX8 A;  4BVX B;  1SVO A;  3KJL A;  1MM8 A;  1YQ1 A;  4G0L A;  2DYM A;  1HK5 A;  3ERF A;  3O76 A;  4HOJ A;  1ZL9 A;  3PGT A;  4IS0 A;  4G04 A;  4RI7 A;  3LQ7 A;  4AKG A;  2BXN A;  1MA9 A;  2EFC A;  1G6Y A;  1H9Z A;  3GH6 A;  4L9K A;  2HRK A;  1B8X A;  3QAG A;  4ECC A;  5D9V A;  1GSQ A;  4Q5Q A;  3GSS A;  1VF1 A;  22GS A;  2FHE A;  2YV9 A;  4LMV A;  3I69 A;  3IBH A;  3M8N A;  4E8E A;  4ECB A;  1GLQ A;  3UBL A;  3IK9 A;  5D9T A;  3KMN A;  1GUL A;  1K0B A;  4KAE A;  5ECI B;  3TU3 B;  4BVY B;  1KW2 A;  2BXE A;  2WW0 A;  1YDK A;  2GST A;  1MIW A;  1F3A A;  2XVU A;  1GNW A;  8GSS A;  5GST A;  3WD6 A;  5A4V A;  2XW0 A;  2CKX A;  2DYO A;  1K0M A;  4IJI A;  1JNB A;  1PD2 1;  2LJR A;  3CBU A;  4OR0 A;  3MHH B;  3ERG A;  1GTA A;  2BXP A;  1HNA A;  1J78 A;  3LG6 A;  3LXZ A;  4GF0 A;  3VPQ A;  3VLN A;  3M3M A;  2VO4 A;  1IJG A;  2WW1 A;  4JED A;  3Q19 A;  4KDU A;  4TOP A;  4HZ2 A;  1K0D A;  1E7G A;  1GTB A;  5FUO A;  2KWF A;  2WS2 A;  5ECR B;  3VI5 A;  1NHY A;  2R4V A;  3L0H A;  2QMC A;  3KMO A;  2C8U A;  1IYI A;  14GS A;  2EFD A;  2BXK A;  2DSA A;  2YCD A;  3WHQ A;  3EIN A;  4ID0 A;  2BXQ A;  17GS A;  4DM0 A;  4BL7 A;  5DQF A;  1TW9 A;  1YJ6 A;  3VUR A;  5BMU B;  1GSE A;  3M1G A;  2HSN B;  2VD0 A;  2E0Y A;  3W1S A;  4HZ4 A;  4KDY A;  2CAI A;  2C3N A;  3GQX A; 
#chains in the Genus database with same CATH homology
 2CAQ A;  5J41 A;  2DBX A;  1B48 A;  1GUM A;  4PUA A;  2PER A;  5DJL A;  3CSI A;  3B9M A;  3AY8 A;  3SIV B;  3UVH A;  3LU8 A;  3V09 A;  4EC0 A;  4YQU A;  3WYW A;  2QHB A;  4Q5N A;  3LFL A;  2NNW A;  5A34 B;  4GSS A;  3G9K D;  1PN9 A;  3EE2 A;  1K0N A;  4ACS A;  3LYK A;  1DUG A;  5AIV A;  2H1L A;  3B9L A;  3GQU A;  1ML6 A;  4G03 A;  5JCW A;  2AJE A;  3CSJ A;  4OFT A;  3FR9 A;  5ECS A;  1H5W A;  4F5T A;  1GUK A;  4N0U D;  1Y1U A;  3V08 A;  4OTT A;  2CZ2 A;  3UBK A;  2HSM A;  5B5T A;  3NVK A;  1FW1 A;  4ZB7 A;  1F2E A;  5ECN B;  3O3T A;  5J5N A;  1M9B A;  4TQ0 A;  5IIU A;  4G0K A;  4EMX A;  3LJR A;  4MPF A;  2BXC A;  3R3E A;  1HA2 A;  1PL2 A;  1K3Y A;  12GS A;  1LNS A;  4AGS A;  4G9H A;  1E7C A;  2HSN A;  4E8H A;  4LMW A;  4FIP B;  2HRK B;  3NIV A;  1J7E A;  3SWL A;  3F6F A;  2XVW A;  2VDB A;  3UAR A;  2C80 A;  1FHE A;  3H37 A;  2AHE A;  3WHR A;  1PA3 A;  4F0B A;  1KXP D;  1OYJ A;  2HNL A;  1MD4 A;  4WR5 A;  2F3M A;  4KDX A;  2WB9 A;  1TU7 A;  2WRT A;  2QM6 A;  5F8B A;  4FJC B;  3M0F A;  5GZZ B;  4C31 B;  5ECP B;  2Z8I A;  5IIX A;  5LD0 A;  4K2C A;  2FNO A;  1N25 A;  1VZS A;  7GSS A;  4NHW A;  1OE7 A;  4ZBK A;  2F8F A;  4DHX B;  1GSF A;  1HK1 A;  3D0Z A;  3F63 A;  3N5O A;  1TXU A;  1OE8 A;  5ELA A;  3FNM A;  3PR8 A;  4GDL B;  3GUS A;  3PLA A;  1BAY A;  4ZBB A;  1U87 A;  5J40 A;  9GSS A;  2R5G A;  4BL7 B;  1AXD A;  2ROH A;  4O7H A;  5F07 A;  3ZML A;  4EE0 A;  1HQO A;  2OZB B;  3U6V A;  5D9X A;  4G10 A;  4S1Y A;  3WHS A;  18GS A;  3NVM A;  5DAK B;  1F3B A;  4ISD A;  5IQY A;  2DBW A;  1JLV A;  3GST A;  1MD3 A;  1YVL A;  2NTO A;  4L8E A;  3FY7 A;  4CHS A;  4GDF A;  2BXF A;  1XW6 A;  5J4V A;  4PO0 A;  1E7H A;  1SVM A;  1BG1 A;  1TDI A;  3HKR A;  5FT3 A;  5J47 A;  4EDZ A;  1M99 A;  3CX9 A;  1GUH A;  3N9J A;  3GUR A;  1RK4 A;  2XW1 A;  4MZW A;  3TDL A;  3FYG A;  3MHS B;  5A1N A;  1HK4 A;  3UAP A;  5G5E A;  1PKW A;  2CZ3 A;  4OTU A;  2C3T A;  3ISO A;  3LXT A;  3VPT A;  4F5S A;  1AQX A;  3LU6 A;  2VKZ G;  2HSM B;  6GST A;  2O5V A;  1HNC A;  3H3A A;  1Q4J A;  4PGT A;  5FWG A;  4KH7 A;  5G5F A;  3MAK A;  5A5H A;  4E99 A;  5D73 A;  4IQ1 A;  2GSQ A;  4J2F A;  2BXI A;  4LA0 A;  19GS A;  6GSV A;  1E7B A;  4FK5 B;  5DAK A;  2GTU A;  4IW1 A;  2V36 A;  13GS A;  4Z9O A;  2VCQ A;  2VCV A;  2XSI A;  1GNI A;  5IIH A;  3NMU A;  3TOU A;  5D9W A;  5AIS A;  4F0C A;  2N5F A;  2OAC A;  3ZFB A;  4DEJ A;  5AGY A;  1M9A A;  2JUH A;  1AQV A;  4KE3 A;  1E7E A;  1K3O A;  2BXD A;  4LB9 A;  3P90 A;  2D2Z A;  2GSS A;  1K3L A;  4IW2 A;  1JZR A;  4ZC6 A;  1GSY A;  1N2A A;  3A73 A;  1Z9H A;  4FQU A;  4GST A;  3TGZ A;  3FWB C;  2VCW A;  3QAW A;  4ECJ A;  3MDK A;  4AKX B;  1B4P A;  3VK9 A;  3LYP A;  5DCG A;  2BXH A;  4G19 A;  1BKE A;  2IMK A;  1M0U A;  4MDC A;  1E7F A;  4PTS A;  4OFM A;  4KX4 A;  4NAX A;  4OT2 A;  5EY6 A;  4MPG A;  4QMK A;  3RBT A;  2A2S A;  3G7I A;  3FWC C;  5JCU A;  1V2A A;  1K0O A;  1LBK A;  4HI7 A;  3IE3 A;  5J4U A;  5KEJ A;  2VUF A;  4ZB9 A;  1PKZ A;  4N3Z A;  2EFE A;  4GDX A;  4HGM B;  1U88 A;  2HQT A;  1MIY A;  4GLT A;  3JQZ A;  3ICX A;  1EV4 A;  5ECK B;  5DAL B;  5IJ5 A;  2V6K A;  1HNB A;  2PMT A;  3KIK A;  4ZCG A;  4Z69 A;  1IYH A;  1BG5 A;  3UIV A;  4USS A;  4GG2 A;  5HFK A;  1E78 A;  1EOG A;  4F5V A;  20GS A;  4EXJ A;  5ECO B;  4MF6 A;  4L9Q A;  5GIO A;  1PGT A;  3IC8 A;  5A1N B;  4YH2 A;  2PBJ A;  6GSS A;  3HMJ G;  5ECH B;  3V03 A;  1VF4 A;  4K0G A;  4W66 A;  2DC5 A;  3W8S A;  1XWK A;  5F05 A;  4ZBD A;  2C3Q A;  4O92 A;  4KF9 A;  1TF0 A;  3QAV A;  2HRA A;  2IMI A;  1USB A;  3GA9 L;  5A5H B;  3VQI A;  2CA8 A;  2VD1 A;  4ZUX V;  1BX9 A;  4JZQ A;  4QQ7 A;  4HGK A;  1XW5 A;  1NT2 B;  4BY9 C;  3FRC A;  4I97 A;  5EVO A;  2KBZ A;  3A75 A;  5J4Y A;  1LOT A;  4KGI A;  3Q74 A;  5ECM B;  1TU8 A;  1O9X A;  5DDL A;  2R3X A;  4MF5 A;  1K0C A;  5A4W A;  3DD3 A;  2I2Z A;  3GTU A;  10GS A;  1GSS A;  3LSZ A;  5DAL A;  4PNG A;  2WJU A;  2XVV A;  5AN1 A;  4LUF A;  1EV9 A;  4NHZ A;  3CRT A;  5ECQ B;  2VCT A;  2BXL A;  4JK4 A;  1E7I A;  2I30 A;  1VF2 A;  5F0G A;  1G7O A;  1AO6 A;  1GSU A;  3FR6 A;  4G01 A;  1SVL A;  3P8W A;  2OAD A;  4PNF A;  1VF3 A;  2YDF A;  5AIX A;  5FHI A;  5A5K A;  5ELG A;  3SIU B;  4GDK B;  3C8E A;  3TOT A;  4ZBQ A;  1PMT A;  2C4J A;  2DG5 A;  4GTU A;  2VUE A;  2AAW A;  4JBB A;  1EOH A;  1MTC A;  2CVD A;  2JL4 A;  3GX0 A;  1BJ5 A;  4OFN A;  1VFI A;  1N5U A;  2XVQ A;  4GSN A;  1GWC A;  1HK3 A;  2GSR A;  2OT3 A;  2IL3 A;  3KTL A;  4ZB6 A;  1UOR A;  1U3I A;  5D7G A;  3G7J A;  4PX1 A;  4TQ1 A;  6GSX A;  4GCI A;  3CWG A;  4F5U A;  4EDY A;  5A4U A;  4PQI A;  2BXM A;  4F03 A;  4ZXG A;  4MBE C;  4K0N A;  4N0F D;  2ON7 A;  1GNJ A;  4AI6 A;  4IW9 A;  1GTI A;  3KXO A;  4IGJ A;  3PPU A;  1BM0 A;  4IEL A;  4YAP A;  5DBY A;  2OA7 A;  4PXO A;  3M99 C;  1GLP A;  4ZB8 A;  2BXO A;  4BVX A;  2GLR A;  2WDU A;  6GSY A;  2GDR A;  1R5A A;  2E0X A;  2BXA A;  4WA6 B;  5GIP A;  2VCZ A;  4L5L A;  2BXB A;  1MIV A;  1GTU A;  3SQJ A;  2X64 A;  1K0A A;  3ZMK A;  16GS A;  1A0F A;  1KBN A;  4BVY A;  4PQH A;  4AKH A;  1FOU A;  5BPK A;  1PX7 A;  2EFH A;  3DGQ A;  4MK3 A;  5DQS A;  3Q18 A;  3NVI A;  2R6K A;  1V40 A;  6GSU A;  1HK2 A;  3FR3 A;  2UZ8 A;  4G0I A;  4J2V A;  1YKC A;  4IKH A;  1Y6E A;  1AQW A;  3JRY A;  1UA5 A;  3ZFL A;  4Q5F A;  1OKT A;  4ECI A;  5GHK A;  4BKE A;  5IJE A;  5EL8 A;  4ZBR A;  3GTU B;  5GIN A;  2BXG A;  1JLW A;  2Z8K A;  1AW9 A;  4L5O A;  4WR4 A;  5F06 A;  1E6B A;  3IK7 A;  5HOZ A;  5ID7 A;  2PGT A;  4YQM A;  3F6D A;  2DBU A;  2YV7 A;  4ZBA A;  3IR4 A;  4OMV A;  5GSS A;  1XWG A;  4E68 A;  3KJY A;  6GSW A;  1GSD A;  5BMU A;  1PL1 A;  1YY7 A;  1BF5 A;  5ECL B;  2XMO A;  4IBP A;  4N0V A;  1LJR A;  1ZGN A;  4AKI A;  1C72 A;  3CSH A;  2LOQ A;  5ID9 A;  2ON5 A;  4M70 B;  2J9H A;  4HJ2 A;  3HJM A;  3KM6 A;  3LU7 A;  5LCZ A;  3VI7 A;  5A34 A;  3CRU A;  1BYE A;  3H1N A;  4KSM A;  3QR6 A;  4YAV A;  3VWX A;  2Z8J A;  5IJF A;  3I6A A;  5DJM A;  2A2R A;  4NAW B;  4W4U B;  4MP4 A;  4PUR A;  4IVF A;  4LUH A;  1PX6 A;  4K71 A;  1G6W A;  4RI6 A;  4YQV A;  1GNE A;  4L8U A;  5IFO A;  3R2Q A;  4MF7 A;  4Q5R A;  4IQA A;  2UV8 G;  2NQO A;  11GS A;  1E7A A;  2AB6 A;  3BBY A;  1EEM A;  2VCX A;  4LB2 A;  3HJO A;  2PVQ A;  5B7C A;  2BX8 A;  4BVX B;  1SVO A;  3KJL A;  1YQ1 A;  4G0L A;  2DYM A;  1HK5 A;  3ERF A;  3O76 A;  4HOJ A;  1ZL9 A;  3PGT A;  4IS0 A;  4G04 A;  4RI7 A;  3LQ7 A;  4AKG A;  2BXN A;  1MA9 A;  2EFC A;  1G6Y A;  1H9Z A;  3GH6 A;  4L9K A;  2HRK A;  1B8X A;  3QAG A;  4ECC A;  5D9V A;  1GSQ A;  4Q5Q A;  3GSS A;  1VF1 A;  22GS A;  2FHE A;  2YV9 A;  4LMV A;  3I69 A;  3IBH A;  3M8N A;  4E8E A;  4ECB A;  1GLQ A;  3UBL A;  3IK9 A;  5D9T A;  3KMN A;  1GUL A;  1K0B A;  4KAE A;  5ECI B;  3TU3 B;  4BVY B;  1KW2 A;  2BXE A;  1YDK A;  2GST A;  1MIW A;  1F3A A;  2XVU A;  1GNW A;  8GSS A;  5GST A;  3WD6 A;  5A4V A;  2XW0 A;  2CKX A;  2DYO A;  1K0M A;  4IJI A;  1JNB A;  1PD2 1;  2LJR A;  3CBU A;  4OR0 A;  3MHH B;  3ERG A;  1GTA A;  2BXP A;  1HNA A;  1J78 A;  3LG6 A;  3LXZ A;  4GF0 A;  3VPQ A;  3VLN A;  3M3M A;  2VO4 A;  1IJG A;  4JED A;  3Q19 A;  4KDU A;  4TOP A;  4HZ2 A;  1K0D A;  1E7G A;  1GTB A;  5FUO A;  3VI5 A;  2WS2 A;  5ECR B;  1NHY A;  2R4V A;  3L0H A;  2QMC A;  3KMO A;  2C8U A;  1IYI A;  14GS A;  2EFD A;  2BXK A;  2DSA A;  2YCD A;  3WHQ A;  3EIN A;  4ID0 A;  2BXQ A;  17GS A;  4BL7 A;  5DQF A;  1TW9 A;  1YJ6 A;  3VUR A;  5BMU B;  1GSE A;  3M1G A;  2HSN B;  2VD0 A;  2E0Y A;  3W1S A;  4HZ4 A;  4KDY A;  2CAI A;  2C3N A;  3GQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...