2EFCA

Ara7-gdp/atvps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
246
structure length
246
Chain Sequence
b'MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 101
structure length 246
sequence length 246
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2efcA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2efcA02
4G01A 2EFCA 4N3ZA 2OT3A 2EFDA 2EFHA 1TXUA 2EFEA
chains in the Genus database with same CATH superfamily
1JLVA 5ECMB 10GSA 1K0DA 1ZGNA 3BPJA 1PGTA 1XWKA 1MM8A 4YQMA 5J4VA 4AKHA 1K3OA 3CHXC 5JCWA 5GZZB 1YVLA 3ZFBA 2LQIA 1S4BP 3UIVA 1SVOA 1VF1A 4K71A 4ZXGA 1GSUA 4ZBBA 3C8EA 2HRKB 4Q5RA 2FHEA 5J41A 1OKTA 2KWFA 2OA7A 3I6AA 2CAIA 1E7HA 2IMKA 1VFIA 3M0FA 5A34B 3IBHA 4ZUXV 3LU7A 4BKEA 4HOJA 2YV7A 1E7AA 1JLWA 4IBPA 4PURA 3VLNA 2CZ2A 1XW6A 3M3MA 4IKHA 4ZBQA 2I30A 4AGSA 1E7FA 2BXDA 1BYEA 4F0BA 2C3QA 3LU6A 1GLQA 2DBXA 3JRYA 4G03A 3RBTA 3ERFA 5D9TA 5J47A 3MHSB 4BVXB 2I2ZA 2HSNA 2LQHA 5GSSA 1AXDA 3KXOA 1AQVA 1YDKA 5ECKB 2WZSA 3B9LA 5D7GA 1GNWA 3VK9A 5GIOA 19GSA 3F6FA 5ELAA 3TDLA 3VPQA 4OTUA 2Z8KA 1PD21 3CRUA 5G5EA 4IJIA 3H1NA 3FWBC 1B8XA 2H1LA 1EV4A 3PPUA 5IQYA 5GINA 2C8UA 1SVMA 2R5GA 4RI7A 4I9OA 1TU7A 3PLAA 1HK3A 3GTUB 4ZB7A 4ECBA 5D9VA 4W66A 1K0NA 2WW0A 1YJ6A 4TQ1A 4YAVA 3ZMKA 4N0FD 1AQXA 5J4YA 4G04A 4PNGA 4EMXA 1MD4A 1N25A 4TOPA 4ZBKA 4C31B 1V2AA 2KBZA 1YY7A 3F63A 2J9HA 3Q19A 1GTBA 2OT3A 3QAGA 1M0UA 3CSHA 2R3XA 1K0BA 4ZB9A 1TF0A 5AISA 1JNBA 3O3TA 2BXQA 2DBWA 5GHKA 2AAWA 1V40A 3CSIA 1F2EA 4ECIA 5D9WA 4IGJA 4QMKA 2XVWA 5GSTA 2GTUA 5ECRB 2GSTA 4DM0A 3ICXA 4GDLB 2VCQA 3FR9A 1HK1A 3GSSA 1MA9A 3UARA 2DBUA 2V36A 8GSSA 4E99A 3HJOA 4WR5A 4I97A 2FNOA 3N9JA 5EY6A 1SVLA 1MIWA 3KMOA 5ECPB 2O3EA 2GLRA 3QAWA 3TU3B 5A1NB 4OT2A 3HKRA 4LUHA 3VQIA 2CVDA 3PGTA 4O92A 5DAKA 4CHSA 4E8HA 2EFDA 1K0OA 4E8EA 1K3LA 1N2AA 1PMTA 1BJ5A 1E6BA 1XWGA 2WS2A 5ECOB 5IIUA 4PUAA 1GLPA 2GDRA 4ISDA 3G7IA 1HA2A 4AI6A 2DYMA 3SIUB 3GUSA 3ISOA 1BM0A 5A5KA 2PMTA 5ECHB 2VCXA 4WA6B 2O36A 3DD3A 5ID7A 3NVMA 3I69A 1GNEA 11GSA 3V09A 1KW2A 3MHHB 2DSAA 3FR3A 4HZ4A 5D73A 1VZSA 4PI0C 3IK9A 4D7XA 6GSVA 2JUHA 3KJLA 4GSTA 2YCDA 2GSQA 1J7EA 3VURA 3H37A 3VI7A 2QMCA 1MTCA 5LD0A 1K3YA 2AJEA 4HGKA 2CKXA 3R2QA 2QHBA 4GTUA 1GSYA 5A5HB 5A4VA 3N5OA 3HJMA 4GSSA 4ZB6A 1DUGA 4PHZC 1USBA 4AKXB 4KF9A 2WDUA 3CWGA 3LFLA 3LU8A 4RI6A 1M9AA 3A73A 4KX4A 2NNWA 1GSDA 1LOTA 2HRAA 2GUTA 2OADA 3M99C 2EFCA 1AQWA 1GSSA 4WR4A 5DALB 4G10A 4K0NA 3RGBC 3TOUA 5GIPA 5AIXA 5DDLA 2GSRA 3U6VA 3UVHA 4NHZA 1H5WA 5HOZA 3QR6A 4KDUA 3DGQA 3KIKA 5DBYA 4F5VA 4G19A 2VUFA 2ROHA 4M70B 1B48A 2OZBB 2BXCA 2GSSA 4KDXA 3B9MA 5FHIA 4L9KA 1GWCA 1KBNA 1GTUA 3UBKA 4MF6A 4GDFA 4F5TA 2HRKA 3WHSA 4GLTA 5ECNB 3CX9A 5A34A 3CRTA 3MAKA 4MPFA 1PA3A 2D2ZA 3IE3A 2LOQA 3EE2A 1VF2A 4MF5A 1GULA 4J2FA 1XW5A 4DEJA 1NT2B 2HSMB 2HNLA 1RK4A 1VF4A 2VCWA 1GUMA 2E0XA 1K0CA 3FNMA 4LUFA 2XMOA 4LMWA 2R6KA 1U88A 5ID9A 3V03A 1AO6A 2HQTA 4BVXA 1GSQA 1ML6A 5FWGA 3EINA 4KSMA 4OMVA 3P90A 1GTIA 2K0NA 3O76A 4KE3A 4HGMB 5DQSA 2CAQA 2Z8JA 3BBYA 4ACSA 4FK5B 4ZCGA 2BXAA 4ZBDA 5DCGA 4GG2A 4OFNA 1HNAA 2WVYA 1GTAA 4USSA 4F5UA 1ZL9A 3GA9L 5FT3A 4JZQA 4NAXA 4FIPB 3FR6A 4W4UB 4Q5NA 4L8UA 3QAVA 1E7EA 3GTUA 2WVXB 2WW2A 4GCIA 5F0GA 5AN1A 4IQAA 2LJRA 1BF5A 4BL7B 2VCVA 5LCZA 3HMJG 1OE8A 1R5AA 6GSXA 5IJFA 2BXBA 3MDKA 2BXEA 17GSA 4PI2C 3RFRC 4KH7A 3LJRA 6GSSA 3KJYA 5KEJA 3LXTA 2AB6A 1IYIA 1B4PA 3G9KD 5FUOA 5IIXA 2VUEA 4MK3A 4DHXB 4AKGA 1M99A 1G7OA 4ZB8A 2PGTA 2F8FA 3P8WA 5ECLB 1J78A 1LJRA 3GX0A 2VD1A 2YDFA 2DC5A 4MF7A 3TOTA 4PO0A 1OYJA 2EFHA 4ZBRA 3FYGA 4LMVA 4IVFA 4ECCA 5F05A 3SQJA 3ZFLA 4O7HA 2BXHA 1H9ZA 4KAEA 4E68A 2DG5A 3SWLA 3F6DA 1PKZA 2WVZA 3IK7A 2YV9A 5AGYA 5JCUA 1Y1UA 3LXZA 1IJGA 3VWXA 4PNFA 1MUSA 1TDIA 3JQZA 4OFTA 3WD6A 1K0AA 1GNIA 1E7CA 4BVYB 5DJMA 5IIHA 4IW9A 1PKWA 1G6YA 1FW1A 1O9XA 1PX6A 1AW9A 5A1NA 1PX7A 5BMUB 4L9QA 2C3TA 1HK5A 5J5NA 3Q18A 1YKCA 3R3EA 4FQUA 3NIVA 2BX8A 2QM6A 1E7BA 3M8NA 3TGZA 3A75A 1NHYA 3LYPA 4GDKB 1HQOA 3L0HA 12GSA 2WJUA 1PL2A 13GSA 4IELA 1PL1A 4EC0A 4G0IA 2ON5A 1U3IA 2E0YA 1MIVA 4FJCB 4MPGA 3SIVB 3VI5A 4G0KA 2Z8IA 1HK4A 3H3AA 2C3NA 3V08A 1GNJA 5DQFA 2XSIA 1PN9A 1E7GA 4LB2A 4YAPA 16GSA 4YQUA 2PVQA 3W8SA 2AGHB 2BXGA 2VDBA 1MD3A 1F3BA 14GSA 2A2RA 4KDYA 5A5HA 6GSUA 3FRCA 4OFMA 2HSNB 5ECIB 9GSSA 4YH2A 1GUHA 6GSWA 2LXSA 1GUKA 3KTLA 1TXUA 2ON7A 1LNSA 4F03A 3GQXA 3IR4A 5J4UA 4L5OA 5IJEA 1MIYA 3WHRA 4PX1A 1N5UA 3KMNA 4N0UD 2CA8A 5DALA 4YQVA 2IL3A 1GSFA 1JZRA 2VO4A 3LSZA 2XVVA 1BKEA 4EDZA 3WYWA 3KM6A 3LYKA 2F3MA 3FY7A 3GQUA 1BG1A 4KGIA 4MP4A 4ID0A 22GSA 4MDCA 4EE0A 2VCTA 1YEWC 4EDYA 4G01A 3FWCC 2A2SA 3G7JA 4OR0A 2XW0A 5B7CA 2UZ8A 1G6WA 1BG5A 4TQ0A 3GSTA 2BXMA 2CZ3A 4NHWA 1TW9A 1OE7A 2V6KA 4K2CA 2AHEA 4HJ2A 5D9XA 3ERGA 2PBJA 2HSMA 4IS0A 2VCZA 1EV9A 1GSEA 3UBLA 4GSNA 2BXFA 1I1IP 2WW1A 4J2VA 2XVQA 1VF3A 2IMIA 4ECJA 2WB9A 4PGTA 4L5LA 2EFEA 1FOUA 1U87A 4HI7A 3PR8A 4NAWB 3NVIA 3CSJA 2XW1A 2NTOA 1SB0A 2R4VA 4QQ7A 2UV8G 5J40A 4GF0A 5ECSA 2JL4A 4Z9OA 1Y6EA 4PTSA 4S1YA 1BX9A 4EXJA 1IYHA 2BXNA 7GSSA 4ZBAA 4Z69A 5ELGA 5DJLA 4JBBA 4MZWA 5BPKA 1EEMA 5G5FA 4G9HA 1UA5A 2WVXA 2WW3A 3GH6A 4FXYP 6GSTA 5IFOA 2N5FA 3W1SA 3AY8A 4PQHA 2BXLA 5DAKB 5EL8A 1HK2A 20GSA 4BL7A 2NQOA 1KXPD 5ECQB 3M1GA 1LBKA 4OTTA 1A0FA 2PERA 4IQ1A 4IW2A 5B5TA 5AIVA 4F0CA 2OACA 2BXPA 4LB9A 4F5SA 4JEDA 2XVUA 4PQIA 2DYOA 4L8EA 1HNCA 6GSYA 4MBEC 4N3ZA 2WRTA 2VKZG 4PXOA 1KDXA 1K0MA 1MUHA 1FHEA 4N0VA 1TU8A 3LQ7A 5A4WA 4HZ2A 2X64A 5F07A 1UORA 1EOGA 2C4JA 3CBUA 3VPTA 2O5VA 1EOHA 2VD0A 3Q74A 1BAYA 4Q5QA 4Q5FA 2C80A 4K0GA 1E7IA 1M9BA 4ZC6A 3LG6A 4G0LA 4JK4A 1E78A 4BY9C 18GSA 2BXIA 3NMUA 1Q4JA 5F06A 3WHQA 2LXTA 3UAPA 1YQ1A 4GDXA 2BXKA 5A4UA 5F8BA 4BVYA 3ZMLA 3ECPA 1Z9HA 4LA0A 5HFKA 1C72A 4IW1A 3IC8A 4AKIA 5IJ5A 5EVOA 2BXOA 3NVKA 3GURA 5BMUA 1F3AA 3D0ZA 1HNBA
chains in the Genus database with same CATH topology
1JLVA 5ECMB 10GSA 1K0DA 1ZGNA 1PGTA 1XWKA 4YQMA 5J4VA 4AKHA 1K3OA 5JCWA 5GZZB 1YVLA 3ZFBA 3UIVA 1SVOA 1VF1A 4K71A 4ZXGA 1GSUA 4ZBBA 3C8EA 2HRKB 4Q5RA 2FHEA 5J41A 1OKTA 2OA7A 3I6AA 2CAIA 1E7HA 2IMKA 1VFIA 3M0FA 5A34B 3IBHA 4ZUXV 3LU7A 4BKEA 4HOJA 2YV7A 1E7AA 1JLWA 4IBPA 4PURA 3VLNA 2CZ2A 1XW6A 3M3MA 4IKHA 4ZBQA 2I30A 4AGSA 1E7FA 2BXDA 1BYEA 4F0BA 2C3QA 3LU6A 1GLQA 2DBXA 3JRYA 4G03A 3RBTA 3ERFA 5D9TA 5J47A 3MHSB 4BVXB 2I2ZA 2HSNA 5GSSA 1AXDA 3KXOA 1AQVA 1YDKA 5ECKB 3B9LA 5D7GA 1GNWA 3VK9A 5GIOA 19GSA 3F6FA 5ELAA 3TDLA 3VPQA 4OTUA 2Z8KA 1PD21 3CRUA 5G5EA 4IJIA 3H1NA 3FWBC 1B8XA 2H1LA 1EV4A 3PPUA 5IQYA 5GINA 2C8UA 1SVMA 2R5GA 4RI7A 1TU7A 3PLAA 1HK3A 3GTUB 4ZB7A 4ECBA 5D9VA 4W66A 1K0NA 1YJ6A 4TQ1A 4YAVA 3ZMKA 4N0FD 1AQXA 5J4YA 4G04A 4PNGA 4EMXA 1MD4A 1N25A 4TOPA 4ZBKA 4C31B 1V2AA 2KBZA 1YY7A 3F63A 2J9HA 3Q19A 1GTBA 2OT3A 3QAGA 1M0UA 3CSHA 2R3XA 1K0BA 4ZB9A 1TF0A 5AISA 1JNBA 3O3TA 2BXQA 2DBWA 5GHKA 2AAWA 1V40A 3CSIA 1F2EA 4ECIA 5D9WA 4IGJA 4QMKA 2XVWA 5GSTA 2GTUA 5ECRB 2GSTA 3ICXA 4GDLB 2VCQA 3FR9A 1HK1A 3GSSA 1MA9A 3UARA 2DBUA 2V36A 8GSSA 4E99A 3HJOA 4WR5A 4I97A 2FNOA 3N9JA 5EY6A 1SVLA 1MIWA 3KMOA 5ECPB 2GLRA 3QAWA 3TU3B 5A1NB 4OT2A 3HKRA 4LUHA 3VQIA 2CVDA 3PGTA 4O92A 5DAKA 4CHSA 4E8HA 2EFDA 1K0OA 4E8EA 1K3LA 1N2AA 1PMTA 1BJ5A 1E6BA 1XWGA 2WS2A 5ECOB 5IIUA 4PUAA 1GLPA 2GDRA 4ISDA 3G7IA 1HA2A 4AI6A 2DYMA 3SIUB 3GUSA 3ISOA 1BM0A 5A5KA 2PMTA 5ECHB 2VCXA 4WA6B 3DD3A 3I69A 5ID7A 3NVMA 11GSA 1GNEA 3V09A 1KW2A 3MHHB 2DSAA 3FR3A 4HZ4A 5D73A 1VZSA 3IK9A 6GSVA 2JUHA 3KJLA 4GSTA 2YCDA 2GSQA 1J7EA 3VURA 3H37A 3VI7A 2QMCA 1MTCA 5LD0A 1K3YA 2AJEA 4HGKA 2CKXA 3R2QA 2QHBA 4GTUA 1GSYA 5A5HB 5A4VA 3N5OA 3HJMA 4GSSA 4ZB6A 1DUGA 1USBA 4AKXB 4KF9A 2WDUA 3CWGA 3LFLA 3LU8A 4RI6A 1M9AA 3A73A 4KX4A 2NNWA 1GSDA 1LOTA 2HRAA 2OADA 3M99C 2EFCA 1AQWA 1GSSA 4WR4A 5DALB 4G10A 4K0NA 3TOUA 5GIPA 5AIXA 5DDLA 2GSRA 3U6VA 3UVHA 4NHZA 1H5WA 5HOZA 3QR6A 4KDUA 3DGQA 3KIKA 5DBYA 4F5VA 4G19A 2VUFA 2ROHA 4M70B 1B48A 2OZBB 2BXCA 2GSSA 4KDXA 3B9MA 5FHIA 4L9KA 1GWCA 1KBNA 1GTUA 3UBKA 4MF6A 4GDFA 4F5TA 2HRKA 3WHSA 4GLTA 5ECNB 3CX9A 5A34A 3CRTA 3MAKA 4MPFA 1PA3A 2D2ZA 3IE3A 2LOQA 3EE2A 1VF2A 4MF5A 1GULA 4J2FA 1XW5A 4DEJA 1NT2B 2HSMB 2HNLA 1RK4A 1VF4A 2VCWA 1GUMA 2E0XA 1K0CA 3FNMA 4LUFA 2XMOA 4LMWA 2R6KA 1U88A 5ID9A 3V03A 1AO6A 2HQTA 4BVXA 1GSQA 1ML6A 5FWGA 3EINA 4KSMA 4OMVA 3P90A 1GTIA 3O76A 4KE3A 4HGMB 5DQSA 2CAQA 2Z8JA 3BBYA 4ACSA 4FK5B 4ZCGA 2BXAA 4ZBDA 5DCGA 4GG2A 4OFNA 1HNAA 4USSA 1GTAA 4F5UA 1ZL9A 3GA9L 5FT3A 4JZQA 4NAXA 4FIPB 3FR6A 4W4UB 4Q5NA 4L8UA 3QAVA 1E7EA 3GTUA 4GCIA 5F0GA 5AN1A 4IQAA 2LJRA 1BF5A 4BL7B 2VCVA 5LCZA 3HMJG 1OE8A 1R5AA 6GSXA 5IJFA 2BXBA 3MDKA 2BXEA 17GSA 4KH7A 3LJRA 6GSSA 3KJYA 5KEJA 3LXTA 2AB6A 1IYIA 1B4PA 3G9KD 5FUOA 5IIXA 2VUEA 4MK3A 4DHXB 4AKGA 1M99A 1G7OA 4ZB8A 2PGTA 2F8FA 3P8WA 5ECLB 1J78A 1LJRA 3GX0A 2VD1A 2YDFA 2DC5A 4MF7A 3TOTA 4PO0A 1OYJA 2EFHA 4ZBRA 3FYGA 4LMVA 4IVFA 4ECCA 5F05A 3SQJA 3ZFLA 4O7HA 2BXHA 1H9ZA 4KAEA 4E68A 2DG5A 3SWLA 3F6DA 1PKZA 3IK7A 2YV9A 5AGYA 5JCUA 1Y1UA 3LXZA 1IJGA 3VWXA 4PNFA 1TDIA 3JQZA 4OFTA 3WD6A 1K0AA 1GNIA 1E7CA 4BVYB 5DJMA 5IIHA 4IW9A 1PKWA 1G6YA 1FW1A 1O9XA 1PX6A 1AW9A 5A1NA 1PX7A 5BMUB 4L9QA 2C3TA 1HK5A 5J5NA 3Q18A 1YKCA 3R3EA 4FQUA 3NIVA 2BX8A 2QM6A 1E7BA 3M8NA 3TGZA 3A75A 1NHYA 3LYPA 4GDKB 1HQOA 3L0HA 12GSA 2WJUA 1PL2A 13GSA 4IELA 1PL1A 4EC0A 4G0IA 2ON5A 1U3IA 2E0YA 1MIVA 4FJCB 4MPGA 3SIVB 3VI5A 4G0KA 2Z8IA 1HK4A 3H3AA 2C3NA 3V08A 1GNJA 5DQFA 2XSIA 1PN9A 1E7GA 4LB2A 4YAPA 16GSA 4YQUA 2PVQA 3W8SA 2VDBA 2BXGA 1MD3A 1F3BA 14GSA 2A2RA 4KDYA 5A5HA 6GSUA 3FRCA 4OFMA 2HSNB 5ECIB 9GSSA 4YH2A 1GUHA 6GSWA 1GUKA 3KTLA 1TXUA 2ON7A 1LNSA 4F03A 3GQXA 3IR4A 5J4UA 4L5OA 5IJEA 1MIYA 3WHRA 4PX1A 1N5UA 3KMNA 4N0UD 2CA8A 5DALA 4YQVA 2IL3A 1GSFA 1JZRA 2VO4A 3LSZA 2XVVA 1BKEA 4EDZA 3WYWA 3KM6A 3LYKA 2F3MA 3FY7A 3GQUA 1BG1A 4KGIA 4MP4A 4ID0A 22GSA 4MDCA 4EE0A 2VCTA 4EDYA 4G01A 3FWCC 2A2SA 3G7JA 4OR0A 2XW0A 5B7CA 2UZ8A 1G6WA 1BG5A 4TQ0A 3GSTA 2BXMA 2CZ3A 4NHWA 1TW9A 1OE7A 2V6KA 4K2CA 2AHEA 4HJ2A 5D9XA 3ERGA 2PBJA 2HSMA 4IS0A 2VCZA 1EV9A 1GSEA 3UBLA 4GSNA 2BXFA 4J2VA 2XVQA 1VF3A 2IMIA 4ECJA 2WB9A 4PGTA 4L5LA 2EFEA 1FOUA 1U87A 4HI7A 3PR8A 4NAWB 3NVIA 3CSJA 2XW1A 2NTOA 2R4VA 4QQ7A 5J40A 2UV8G 4GF0A 5ECSA 2JL4A 4Z9OA 1Y6EA 4PTSA 4S1YA 1BX9A 4EXJA 1IYHA 2BXNA 7GSSA 4ZBAA 4Z69A 5ELGA 5DJLA 4JBBA 4MZWA 5BPKA 1EEMA 5G5FA 4G9HA 1UA5A 3GH6A 6GSTA 5IFOA 2N5FA 3W1SA 3AY8A 4PQHA 2BXLA 5DAKB 5EL8A 1HK2A 20GSA 4BL7A 2NQOA 1KXPD 5ECQB 3M1GA 1LBKA 4OTTA 1A0FA 2PERA 4IQ1A 4IW2A 5B5TA 5AIVA 4F0CA 2OACA 2BXPA 4LB9A 4F5SA 4JEDA 2XVUA 4PQIA 2DYOA 4L8EA 1HNCA 6GSYA 4MBEC 4N3ZA 2WRTA 2VKZG 4PXOA 1K0MA 1FHEA 4N0VA 1TU8A 3LQ7A 5A4WA 4HZ2A 2X64A 5F07A 1UORA 1EOGA 2C4JA 3CBUA 3VPTA 2O5VA 1EOHA 2VD0A 3Q74A 1BAYA 4Q5QA 4Q5FA 2C80A 4K0GA 1E7IA 1M9BA 4ZC6A 3LG6A 4G0LA 4JK4A 1E78A 4BY9C 18GSA 2BXIA 3NMUA 1Q4JA 5F06A 3WHQA 3UAPA 1YQ1A 4GDXA 2BXKA 5A4UA 5F8BA 4BVYA 3ZMLA 1Z9HA 4LA0A 5HFKA 1C72A 4IW1A 3IC8A 4AKIA 5IJ5A 5EVOA 2BXOA 3NVKA 3GURA 5BMUA 1F3AA 3D0ZA 1HNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G01 A;  2EFC A;  4N3Z A;  2OT3 A;  2EFD A;  2EFH A;  1TXU A;  2EFE A; 
#chains in the Genus database with same CATH topology
 1JLV A;  5ECM B;  10GS A;  1K0D A;  1ZGN A;  3BPJ A;  1PGT A;  1XWK A;  1MM8 A;  4YQM A;  5J4V A;  4AKH A;  1K3O A;  3CHX C;  5JCW A;  5GZZ B;  1YVL A;  3ZFB A;  2LQI A;  1S4B P;  3UIV A;  1SVO A;  1VF1 A;  4K71 A;  4ZXG A;  1GSU A;  4ZBB A;  3C8E A;  2HRK B;  4Q5R A;  2FHE A;  5J41 A;  1OKT A;  2KWF A;  2OA7 A;  3I6A A;  2CAI A;  1E7H A;  2IMK A;  1VFI A;  3M0F A;  5A34 B;  3IBH A;  4ZUX V;  3LU7 A;  4BKE A;  4HOJ A;  2YV7 A;  1E7A A;  1JLW A;  4IBP A;  4PUR A;  3VLN A;  2CZ2 A;  1XW6 A;  3M3M A;  4IKH A;  4ZBQ A;  2I30 A;  4AGS A;  1E7F A;  2BXD A;  1BYE A;  4F0B A;  2C3Q A;  3LU6 A;  1GLQ A;  2DBX A;  3JRY A;  4G03 A;  3RBT A;  3ERF A;  5D9T A;  5J47 A;  3MHS B;  4BVX B;  2I2Z A;  2HSN A;  2LQH A;  5GSS A;  1AXD A;  3KXO A;  1AQV A;  1YDK A;  5ECK B;  2WZS A;  3B9L A;  5D7G A;  1GNW A;  3VK9 A;  5GIO A;  19GS A;  3F6F A;  5ELA A;  3TDL A;  3VPQ A;  4OTU A;  2Z8K A;  1PD2 1;  3CRU A;  5G5E A;  4IJI A;  3H1N A;  3FWB C;  1B8X A;  2H1L A;  1EV4 A;  3PPU A;  5IQY A;  5GIN A;  2C8U A;  1SVM A;  2R5G A;  4RI7 A;  4I9O A;  1TU7 A;  3PLA A;  1HK3 A;  3GTU B;  4ZB7 A;  4ECB A;  5D9V A;  4W66 A;  1K0N A;  2WW0 A;  1YJ6 A;  4TQ1 A;  4YAV A;  3ZMK A;  4N0F D;  1AQX A;  5J4Y A;  4G04 A;  4PNG A;  4EMX A;  1MD4 A;  1N25 A;  4TOP A;  4ZBK A;  4C31 B;  1V2A A;  2KBZ A;  1YY7 A;  3F63 A;  2J9H A;  3Q19 A;  1GTB A;  2OT3 A;  3QAG A;  1M0U A;  3CSH A;  2R3X A;  1K0B A;  4ZB9 A;  1TF0 A;  5AIS A;  1JNB A;  3O3T A;  2BXQ A;  2DBW A;  5GHK A;  2AAW A;  1V40 A;  3CSI A;  1F2E A;  4ECI A;  5D9W A;  4IGJ A;  4QMK A;  2XVW A;  5GST A;  2GTU A;  5ECR B;  2GST A;  4DM0 A;  3ICX A;  4GDL B;  2VCQ A;  3FR9 A;  1HK1 A;  3GSS A;  1MA9 A;  3UAR A;  2DBU A;  2V36 A;  8GSS A;  4E99 A;  3HJO A;  4WR5 A;  4I97 A;  2FNO A;  3N9J A;  5EY6 A;  1SVL A;  1MIW A;  3KMO A;  5ECP B;  2O3E A;  2GLR A;  3QAW A;  3TU3 B;  5A1N B;  4OT2 A;  3HKR A;  4LUH A;  3VQI A;  2CVD A;  3PGT A;  4O92 A;  5DAK A;  4CHS A;  4E8H A;  2EFD A;  1K0O A;  4E8E A;  1K3L A;  1N2A A;  1PMT A;  1BJ5 A;  1E6B A;  1XWG A;  2WS2 A;  5ECO B;  5IIU A;  4PUA A;  1GLP A;  2GDR A;  4ISD A;  3G7I A;  1HA2 A;  4AI6 A;  2DYM A;  3SIU B;  3GUS A;  3ISO A;  1BM0 A;  5A5K A;  2PMT A;  5ECH B;  2VCX A;  4WA6 B;  2O36 A;  3DD3 A;  5ID7 A;  3NVM A;  3I69 A;  1GNE A;  11GS A;  3V09 A;  1KW2 A;  3MHH B;  2DSA A;  3FR3 A;  4HZ4 A;  5D73 A;  1VZS A;  4PI0 C;  3IK9 A;  4D7X A;  6GSV A;  2JUH A;  3KJL A;  4GST A;  2YCD A;  2GSQ A;  1J7E A;  3VUR A;  3H37 A;  3VI7 A;  2QMC A;  1MTC A;  5LD0 A;  1K3Y A;  2AJE A;  4HGK A;  2CKX A;  3R2Q A;  2QHB A;  4GTU A;  1GSY A;  5A5H B;  5A4V A;  3N5O A;  3HJM A;  4GSS A;  4ZB6 A;  1DUG A;  4PHZ C;  1USB A;  4AKX B;  4KF9 A;  2WDU A;  3CWG A;  3LFL A;  3LU8 A;  4RI6 A;  1M9A A;  3A73 A;  4KX4 A;  2NNW A;  1GSD A;  1LOT A;  2HRA A;  2GUT A;  2OAD A;  3M99 C;  2EFC A;  1AQW A;  1GSS A;  4WR4 A;  5DAL B;  4G10 A;  4K0N A;  3RGB C;  3TOU A;  5GIP A;  5AIX A;  5DDL A;  2GSR A;  3U6V A;  3UVH A;  4NHZ A;  1H5W A;  5HOZ A;  3QR6 A;  4KDU A;  3DGQ A;  3KIK A;  5DBY A;  4F5V A;  4G19 A;  2VUF A;  2ROH A;  4M70 B;  1B48 A;  2OZB B;  2BXC A;  2GSS A;  4KDX A;  3B9M A;  5FHI A;  4L9K A;  1GWC A;  1KBN A;  1GTU A;  3UBK A;  4MF6 A;  4GDF A;  4F5T A;  2HRK A;  3WHS A;  4GLT A;  5ECN B;  3CX9 A;  5A34 A;  3CRT A;  3MAK A;  4MPF A;  1PA3 A;  2D2Z A;  3IE3 A;  2LOQ A;  3EE2 A;  1VF2 A;  4MF5 A;  1GUL A;  4J2F A;  1XW5 A;  4DEJ A;  1NT2 B;  2HSM B;  2HNL A;  1RK4 A;  1VF4 A;  2VCW A;  1GUM A;  2E0X A;  1K0C A;  3FNM A;  4LUF A;  2XMO A;  4LMW A;  2R6K A;  1U88 A;  5ID9 A;  3V03 A;  1AO6 A;  2HQT A;  4BVX A;  1GSQ A;  1ML6 A;  5FWG A;  3EIN A;  4KSM A;  4OMV A;  3P90 A;  1GTI A;  2K0N A;  3O76 A;  4KE3 A;  4HGM B;  5DQS A;  2CAQ A;  2Z8J A;  3BBY A;  4ACS A;  4FK5 B;  4ZCG A;  2BXA A;  4ZBD A;  5DCG A;  4GG2 A;  4OFN A;  1HNA A;  2WVY A;  1GTA A;  4USS A;  4F5U A;  1ZL9 A;  3GA9 L;  5FT3 A;  4JZQ A;  4NAX A;  4FIP B;  3FR6 A;  4W4U B;  4Q5N A;  4L8U A;  3QAV A;  1E7E A;  3GTU A;  2WVX B;  2WW2 A;  4GCI A;  5F0G A;  5AN1 A;  4IQA A;  2LJR A;  1BF5 A;  4BL7 B;  2VCV A;  5LCZ A;  3HMJ G;  1OE8 A;  1R5A A;  6GSX A;  5IJF A;  2BXB A;  3MDK A;  2BXE A;  17GS A;  4PI2 C;  3RFR C;  4KH7 A;  3LJR A;  6GSS A;  3KJY A;  5KEJ A;  3LXT A;  2AB6 A;  1IYI A;  1B4P A;  3G9K D;  5FUO A;  5IIX A;  2VUE A;  4MK3 A;  4DHX B;  4AKG A;  1M99 A;  1G7O A;  4ZB8 A;  2PGT A;  2F8F A;  3P8W A;  5ECL B;  1J78 A;  1LJR A;  3GX0 A;  2VD1 A;  2YDF A;  2DC5 A;  4MF7 A;  3TOT A;  4PO0 A;  1OYJ A;  2EFH A;  4ZBR A;  3FYG A;  4LMV A;  4IVF A;  4ECC A;  5F05 A;  3SQJ A;  3ZFL A;  4O7H A;  2BXH A;  1H9Z A;  4KAE A;  4E68 A;  2DG5 A;  3SWL A;  3F6D A;  1PKZ A;  2WVZ A;  3IK7 A;  2YV9 A;  5AGY A;  5JCU A;  1Y1U A;  3LXZ A;  1IJG A;  3VWX A;  4PNF A;  1MUS A;  1TDI A;  3JQZ A;  4OFT A;  3WD6 A;  1K0A A;  1GNI A;  1E7C A;  4BVY B;  5DJM A;  5IIH A;  4IW9 A;  1PKW A;  1G6Y A;  1FW1 A;  1O9X A;  1PX6 A;  1AW9 A;  5A1N A;  1PX7 A;  5BMU B;  4L9Q A;  2C3T A;  1HK5 A;  5J5N A;  3Q18 A;  1YKC A;  3R3E A;  4FQU A;  3NIV A;  2BX8 A;  2QM6 A;  1E7B A;  3M8N A;  3TGZ A;  3A75 A;  1NHY A;  3LYP A;  4GDK B;  1HQO A;  3L0H A;  12GS A;  2WJU A;  1PL2 A;  13GS A;  4IEL A;  1PL1 A;  4EC0 A;  4G0I A;  2ON5 A;  1U3I A;  2E0Y A;  1MIV A;  4FJC B;  4MPG A;  3SIV B;  3VI5 A;  4G0K A;  2Z8I A;  1HK4 A;  3H3A A;  2C3N A;  3V08 A;  1GNJ A;  5DQF A;  2XSI A;  1PN9 A;  1E7G A;  4LB2 A;  4YAP A;  16GS A;  4YQU A;  2PVQ A;  3W8S A;  2AGH B;  2BXG A;  2VDB A;  1MD3 A;  1F3B A;  14GS A;  2A2R A;  4KDY A;  5A5H A;  6GSU A;  3FRC A;  4OFM A;  2HSN B;  5ECI B;  9GSS A;  4YH2 A;  1GUH A;  6GSW A;  2LXS A;  1GUK A;  3KTL A;  1TXU A;  2ON7 A;  1LNS A;  4F03 A;  3GQX A;  3IR4 A;  5J4U A;  4L5O A;  5IJE A;  1MIY A;  3WHR A;  4PX1 A;  1N5U A;  3KMN A;  4N0U D;  2CA8 A;  5DAL A;  4YQV A;  2IL3 A;  1GSF A;  1JZR A;  2VO4 A;  3LSZ A;  2XVV A;  1BKE A;  4EDZ A;  3WYW A;  3KM6 A;  3LYK A;  2F3M A;  3FY7 A;  3GQU A;  1BG1 A;  4KGI A;  4MP4 A;  4ID0 A;  22GS A;  4MDC A;  4EE0 A;  2VCT A;  1YEW C;  4EDY A;  4G01 A;  3FWC C;  2A2S A;  3G7J A;  4OR0 A;  2XW0 A;  5B7C A;  2UZ8 A;  1G6W A;  1BG5 A;  4TQ0 A;  3GST A;  2BXM A;  2CZ3 A;  4NHW A;  1TW9 A;  1OE7 A;  2V6K A;  4K2C A;  2AHE A;  4HJ2 A;  5D9X A;  3ERG A;  2PBJ A;  2HSM A;  4IS0 A;  2VCZ A;  1EV9 A;  1GSE A;  3UBL A;  4GSN A;  2BXF A;  1I1I P;  2WW1 A;  4J2V A;  2XVQ A;  1VF3 A;  2IMI A;  4ECJ A;  2WB9 A;  4PGT A;  4L5L A;  2EFE A;  1FOU A;  1U87 A;  4HI7 A;  3PR8 A;  4NAW B;  3NVI A;  3CSJ A;  2XW1 A;  2NTO A;  1SB0 A;  2R4V A;  4QQ7 A;  2UV8 G;  5J40 A;  4GF0 A;  5ECS A;  2JL4 A;  4Z9O A;  1Y6E A;  4PTS A;  4S1Y A;  1BX9 A;  4EXJ A;  1IYH A;  2BXN A;  7GSS A;  4ZBA A;  4Z69 A;  5ELG A;  5DJL A;  4JBB A;  4MZW A;  5BPK A;  1EEM A;  5G5F A;  4G9H A;  1UA5 A;  2WVX A;  2WW3 A;  3GH6 A;  4FXY P;  6GST A;  5IFO A;  2N5F A;  3W1S A;  3AY8 A;  4PQH A;  2BXL A;  5DAK B;  5EL8 A;  1HK2 A;  20GS A;  4BL7 A;  2NQO A;  1KXP D;  5ECQ B;  3M1G A;  1LBK A;  4OTT A;  1A0F A;  2PER A;  4IQ1 A;  4IW2 A;  5B5T A;  5AIV A;  4F0C A;  2OAC A;  2BXP A;  4LB9 A;  4F5S A;  4JED A;  2XVU A;  4PQI A;  2DYO A;  4L8E A;  1HNC A;  6GSY A;  4MBE C;  4N3Z A;  2WRT A;  2VKZ G;  4PXO A;  1KDX A;  1K0M A;  1MUH A;  1FHE A;  4N0V A;  1TU8 A;  3LQ7 A;  5A4W A;  4HZ2 A;  2X64 A;  5F07 A;  1UOR A;  1EOG A;  2C4J A;  3CBU A;  3VPT A;  2O5V A;  1EOH A;  2VD0 A;  3Q74 A;  1BAY A;  4Q5Q A;  4Q5F A;  2C80 A;  4K0G A;  1E7I A;  1M9B A;  4ZC6 A;  3LG6 A;  4G0L A;  4JK4 A;  1E78 A;  4BY9 C;  18GS A;  2BXI A;  3NMU A;  1Q4J A;  5F06 A;  3WHQ A;  2LXT A;  3UAP A;  1YQ1 A;  4GDX A;  2BXK A;  5A4U A;  5F8B A;  4BVY A;  3ZML A;  3ECP A;  1Z9H A;  4LA0 A;  5HFK A;  1C72 A;  4IW1 A;  3IC8 A;  4AKI A;  5IJ5 A;  5EVO A;  2BXO A;  3NVK A;  3GUR A;  5BMU A;  1F3A A;  3D0Z A;  1HNB A; 
#chains in the Genus database with same CATH homology
 1JLV A;  5ECM B;  10GS A;  1K0D A;  1ZGN A;  1PGT A;  1XWK A;  4YQM A;  5J4V A;  4AKH A;  1K3O A;  5JCW A;  5GZZ B;  1YVL A;  3ZFB A;  3UIV A;  1SVO A;  1VF1 A;  4K71 A;  4ZXG A;  1GSU A;  4ZBB A;  3C8E A;  2HRK B;  4Q5R A;  2FHE A;  5J41 A;  1OKT A;  2OA7 A;  3I6A A;  2CAI A;  1E7H A;  2IMK A;  1VFI A;  3M0F A;  5A34 B;  3IBH A;  4ZUX V;  3LU7 A;  4BKE A;  4HOJ A;  2YV7 A;  1E7A A;  1JLW A;  4IBP A;  4PUR A;  3VLN A;  2CZ2 A;  1XW6 A;  3M3M A;  4IKH A;  4ZBQ A;  2I30 A;  4AGS A;  1E7F A;  2BXD A;  1BYE A;  4F0B A;  2C3Q A;  3LU6 A;  1GLQ A;  2DBX A;  3JRY A;  4G03 A;  3RBT A;  3ERF A;  5D9T A;  5J47 A;  3MHS B;  4BVX B;  2I2Z A;  2HSN A;  5GSS A;  1AXD A;  3KXO A;  1AQV A;  1YDK A;  5ECK B;  3B9L A;  5D7G A;  1GNW A;  3VK9 A;  5GIO A;  19GS A;  3F6F A;  5ELA A;  3TDL A;  3VPQ A;  4OTU A;  2Z8K A;  1PD2 1;  3CRU A;  5G5E A;  4IJI A;  3H1N A;  3FWB C;  1B8X A;  2H1L A;  1EV4 A;  3PPU A;  5IQY A;  5GIN A;  2C8U A;  1SVM A;  2R5G A;  4RI7 A;  1TU7 A;  3PLA A;  1HK3 A;  3GTU B;  4ZB7 A;  4ECB A;  5D9V A;  4W66 A;  1K0N A;  1YJ6 A;  4TQ1 A;  4YAV A;  3ZMK A;  4N0F D;  1AQX A;  5J4Y A;  4G04 A;  4PNG A;  4EMX A;  1MD4 A;  1N25 A;  4TOP A;  4ZBK A;  4C31 B;  1V2A A;  2KBZ A;  1YY7 A;  3F63 A;  2J9H A;  3Q19 A;  1GTB A;  2OT3 A;  3QAG A;  1M0U A;  3CSH A;  2R3X A;  1K0B A;  4ZB9 A;  1TF0 A;  5AIS A;  1JNB A;  3O3T A;  2BXQ A;  2DBW A;  5GHK A;  2AAW A;  1V40 A;  3CSI A;  1F2E A;  4ECI A;  5D9W A;  4IGJ A;  4QMK A;  2XVW A;  5GST A;  2GTU A;  5ECR B;  2GST A;  3ICX A;  4GDL B;  2VCQ A;  3FR9 A;  1HK1 A;  3GSS A;  1MA9 A;  3UAR A;  2DBU A;  2V36 A;  8GSS A;  4E99 A;  3HJO A;  4WR5 A;  4I97 A;  2FNO A;  3N9J A;  5EY6 A;  1SVL A;  1MIW A;  3KMO A;  5ECP B;  2GLR A;  3QAW A;  3TU3 B;  5A1N B;  4OT2 A;  3HKR A;  4LUH A;  3VQI A;  2CVD A;  3PGT A;  4O92 A;  5DAK A;  4CHS A;  4E8H A;  2EFD A;  1K0O A;  4E8E A;  1K3L A;  1N2A A;  1PMT A;  1BJ5 A;  1E6B A;  1XWG A;  2WS2 A;  5ECO B;  5IIU A;  4PUA A;  1GLP A;  2GDR A;  4ISD A;  3G7I A;  1HA2 A;  4AI6 A;  2DYM A;  3SIU B;  3GUS A;  3ISO A;  1BM0 A;  5A5K A;  2PMT A;  5ECH B;  2VCX A;  4WA6 B;  3DD3 A;  3I69 A;  5ID7 A;  3NVM A;  11GS A;  1GNE A;  3V09 A;  1KW2 A;  3MHH B;  2DSA A;  3FR3 A;  4HZ4 A;  5D73 A;  1VZS A;  3IK9 A;  6GSV A;  2JUH A;  3KJL A;  4GST A;  2YCD A;  2GSQ A;  1J7E A;  3VUR A;  3H37 A;  3VI7 A;  2QMC A;  1MTC A;  5LD0 A;  1K3Y A;  2AJE A;  4HGK A;  2CKX A;  3R2Q A;  2QHB A;  4GTU A;  1GSY A;  5A5H B;  5A4V A;  3N5O A;  3HJM A;  4GSS A;  4ZB6 A;  1DUG A;  1USB A;  4AKX B;  4KF9 A;  2WDU A;  3CWG A;  3LFL A;  3LU8 A;  4RI6 A;  1M9A A;  3A73 A;  4KX4 A;  2NNW A;  1GSD A;  1LOT A;  2HRA A;  2OAD A;  3M99 C;  2EFC A;  1AQW A;  1GSS A;  4WR4 A;  5DAL B;  4G10 A;  4K0N A;  3TOU A;  5GIP A;  5AIX A;  5DDL A;  2GSR A;  3U6V A;  3UVH A;  4NHZ A;  1H5W A;  5HOZ A;  3QR6 A;  4KDU A;  3DGQ A;  3KIK A;  5DBY A;  4F5V A;  4G19 A;  2VUF A;  2ROH A;  4M70 B;  1B48 A;  2OZB B;  2BXC A;  2GSS A;  4KDX A;  3B9M A;  5FHI A;  4L9K A;  1GWC A;  1KBN A;  1GTU A;  3UBK A;  4MF6 A;  4GDF A;  4F5T A;  2HRK A;  3WHS A;  4GLT A;  5ECN B;  3CX9 A;  5A34 A;  3CRT A;  3MAK A;  4MPF A;  1PA3 A;  2D2Z A;  3IE3 A;  2LOQ A;  3EE2 A;  1VF2 A;  4MF5 A;  1GUL A;  4J2F A;  1XW5 A;  4DEJ A;  1NT2 B;  2HSM B;  2HNL A;  1RK4 A;  1VF4 A;  2VCW A;  1GUM A;  2E0X A;  1K0C A;  3FNM A;  4LUF A;  2XMO A;  4LMW A;  2R6K A;  1U88 A;  5ID9 A;  3V03 A;  1AO6 A;  2HQT A;  4BVX A;  1GSQ A;  1ML6 A;  5FWG A;  3EIN A;  4KSM A;  4OMV A;  3P90 A;  1GTI A;  3O76 A;  4KE3 A;  4HGM B;  5DQS A;  2CAQ A;  2Z8J A;  3BBY A;  4ACS A;  4FK5 B;  4ZCG A;  2BXA A;  4ZBD A;  5DCG A;  4GG2 A;  4OFN A;  1HNA A;  4USS A;  1GTA A;  4F5U A;  1ZL9 A;  3GA9 L;  5FT3 A;  4JZQ A;  4NAX A;  4FIP B;  3FR6 A;  4W4U B;  4Q5N A;  4L8U A;  3QAV A;  1E7E A;  3GTU A;  4GCI A;  5F0G A;  5AN1 A;  4IQA A;  2LJR A;  1BF5 A;  4BL7 B;  2VCV A;  5LCZ A;  3HMJ G;  1OE8 A;  1R5A A;  6GSX A;  5IJF A;  2BXB A;  3MDK A;  2BXE A;  17GS A;  4KH7 A;  3LJR A;  6GSS A;  3KJY A;  5KEJ A;  3LXT A;  2AB6 A;  1IYI A;  1B4P A;  3G9K D;  5FUO A;  5IIX A;  2VUE A;  4MK3 A;  4DHX B;  4AKG A;  1M99 A;  1G7O A;  4ZB8 A;  2PGT A;  2F8F A;  3P8W A;  5ECL B;  1J78 A;  1LJR A;  3GX0 A;  2VD1 A;  2YDF A;  2DC5 A;  4MF7 A;  3TOT A;  4PO0 A;  1OYJ A;  2EFH A;  4ZBR A;  3FYG A;  4LMV A;  4IVF A;  4ECC A;  5F05 A;  3SQJ A;  3ZFL A;  4O7H A;  2BXH A;  1H9Z A;  4KAE A;  4E68 A;  2DG5 A;  3SWL A;  3F6D A;  1PKZ A;  3IK7 A;  2YV9 A;  5AGY A;  5JCU A;  1Y1U A;  3LXZ A;  1IJG A;  3VWX A;  4PNF A;  1TDI A;  3JQZ A;  4OFT A;  3WD6 A;  1K0A A;  1GNI A;  1E7C A;  4BVY B;  5DJM A;  5IIH A;  4IW9 A;  1PKW A;  1G6Y A;  1FW1 A;  1O9X A;  1PX6 A;  1AW9 A;  5A1N A;  1PX7 A;  5BMU B;  4L9Q A;  2C3T A;  1HK5 A;  5J5N A;  3Q18 A;  1YKC A;  3R3E A;  4FQU A;  3NIV A;  2BX8 A;  2QM6 A;  1E7B A;  3M8N A;  3TGZ A;  3A75 A;  1NHY A;  3LYP A;  4GDK B;  1HQO A;  3L0H A;  12GS A;  2WJU A;  1PL2 A;  13GS A;  4IEL A;  1PL1 A;  4EC0 A;  4G0I A;  2ON5 A;  1U3I A;  2E0Y A;  1MIV A;  4FJC B;  4MPG A;  3SIV B;  3VI5 A;  4G0K A;  2Z8I A;  1HK4 A;  3H3A A;  2C3N A;  3V08 A;  1GNJ A;  5DQF A;  2XSI A;  1PN9 A;  1E7G A;  4LB2 A;  4YAP A;  16GS A;  4YQU A;  2PVQ A;  3W8S A;  2VDB A;  2BXG A;  1MD3 A;  1F3B A;  14GS A;  2A2R A;  4KDY A;  5A5H A;  6GSU A;  3FRC A;  4OFM A;  2HSN B;  5ECI B;  9GSS A;  4YH2 A;  1GUH A;  6GSW A;  1GUK A;  3KTL A;  1TXU A;  2ON7 A;  1LNS A;  4F03 A;  3GQX A;  3IR4 A;  5J4U A;  4L5O A;  5IJE A;  1MIY A;  3WHR A;  4PX1 A;  1N5U A;  3KMN A;  4N0U D;  2CA8 A;  5DAL A;  4YQV A;  2IL3 A;  1GSF A;  1JZR A;  2VO4 A;  3LSZ A;  2XVV A;  1BKE A;  4EDZ A;  3WYW A;  3KM6 A;  3LYK A;  2F3M A;  3FY7 A;  3GQU A;  1BG1 A;  4KGI A;  4MP4 A;  4ID0 A;  22GS A;  4MDC A;  4EE0 A;  2VCT A;  4EDY A;  4G01 A;  3FWC C;  2A2S A;  3G7J A;  4OR0 A;  2XW0 A;  5B7C A;  2UZ8 A;  1G6W A;  1BG5 A;  4TQ0 A;  3GST A;  2BXM A;  2CZ3 A;  4NHW A;  1TW9 A;  1OE7 A;  2V6K A;  4K2C A;  2AHE A;  4HJ2 A;  5D9X A;  3ERG A;  2PBJ A;  2HSM A;  4IS0 A;  2VCZ A;  1EV9 A;  1GSE A;  3UBL A;  4GSN A;  2BXF A;  4J2V A;  2XVQ A;  1VF3 A;  2IMI A;  4ECJ A;  2WB9 A;  4PGT A;  4L5L A;  2EFE A;  1FOU A;  1U87 A;  4HI7 A;  3PR8 A;  4NAW B;  3NVI A;  3CSJ A;  2XW1 A;  2NTO A;  2R4V A;  4QQ7 A;  5J40 A;  2UV8 G;  4GF0 A;  5ECS A;  2JL4 A;  4Z9O A;  1Y6E A;  4PTS A;  4S1Y A;  1BX9 A;  4EXJ A;  1IYH A;  2BXN A;  7GSS A;  4ZBA A;  4Z69 A;  5ELG A;  5DJL A;  4JBB A;  4MZW A;  5BPK A;  1EEM A;  5G5F A;  4G9H A;  1UA5 A;  3GH6 A;  6GST A;  5IFO A;  2N5F A;  3W1S A;  3AY8 A;  4PQH A;  2BXL A;  5DAK B;  5EL8 A;  1HK2 A;  20GS A;  4BL7 A;  2NQO A;  1KXP D;  5ECQ B;  3M1G A;  1LBK A;  4OTT A;  1A0F A;  2PER A;  4IQ1 A;  4IW2 A;  5B5T A;  5AIV A;  4F0C A;  2OAC A;  2BXP A;  4LB9 A;  4F5S A;  4JED A;  2XVU A;  4PQI A;  2DYO A;  4L8E A;  1HNC A;  6GSY A;  4MBE C;  4N3Z A;  2WRT A;  2VKZ G;  4PXO A;  1K0M A;  1FHE A;  4N0V A;  1TU8 A;  3LQ7 A;  5A4W A;  4HZ2 A;  2X64 A;  5F07 A;  1UOR A;  1EOG A;  2C4J A;  3CBU A;  3VPT A;  2O5V A;  1EOH A;  2VD0 A;  3Q74 A;  1BAY A;  4Q5Q A;  4Q5F A;  2C80 A;  4K0G A;  1E7I A;  1M9B A;  4ZC6 A;  3LG6 A;  4G0L A;  4JK4 A;  1E78 A;  4BY9 C;  18GS A;  2BXI A;  3NMU A;  1Q4J A;  5F06 A;  3WHQ A;  3UAP A;  1YQ1 A;  4GDX A;  2BXK A;  5A4U A;  5F8B A;  4BVY A;  3ZML A;  1Z9H A;  4LA0 A;  5HFK A;  1C72 A;  4IW1 A;  3IC8 A;  4AKI A;  5IJ5 A;  5EVO A;  2BXO A;  3NVK A;  3GUR A;  5BMU A;  1F3A A;  3D0Z A;  1HNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...