2EFCA

Ara7-gdp/atvps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
246
structure length
246
Chain Sequence
MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 101
structure length 246
sequence length 246
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2efcA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2efcA02
1TXUA 2EFEA 2OT3A 4N3ZA 2EFCA 2EFHA 2EFDA 4G01A
chains in the Genus database with same CATH superfamily
11GSA 2O36A 2FHEA 2BXMA 3U6VA 3ICXA 1BX9A 5AISA 1SB0A 1U87A 4NHZA 1PD21 3B9LA 3IR4A 2DYOA 2IL3A 1GUKA 1I1IP 4LB2A 4YAPA 4NHWA 2R5GA 4WR4A 3H1NA 2LXSA 2Z8IA 4ZB6A 2VD0A 2WRTA 6GSVA 1HNAA 4ZBQA 3Q74A 1MA9A 4BVXA 1HK5A 3PR8A 1VF1A 3CSIA 2D2ZA 5FT3A 2BXGA 4PUAA 3P90A 4G0KA 4BY9C 3RFRC 5DQSA 6GSTA 5ECLB 5FWGA 2VCXA 3TDLA 2BXPA 4OT2A 4HGKA 4AKGA 4YQVA 1V40A 2O5VA 3JRYA 5AGYA 2AHEA 4G03A 4KF9A 3CRTA 3GTUA 5JCUA 1KDXA 5IIUA 1GTBA 4MPFA 3FR3A 4I97A 1PN9A 3MHHB 4O7HA 2I30A 2C8UA 4E8EA 6GSXA 3TOUA 3LU6A 4IVFA 4EDYA 10GSA 4GDFA 3IK7A 2BXIA 5GHKA 3V08A 3RGBC 5G5EA 1GNWA 1N25A 5DAKB 4ZBAA 1N2AA 4DEJA 1JLVA 1AQWA 4L9QA 1YJ6A 3MDKA 4MK3A 1AXDA 4L9KA 3ZFBA 1M9AA 4IS0A 1HNBA 5DJMA 3F6DA 3TU3B 2WW0A 3VI7A 2JUHA 5ID9A 2R3XA 3VURA 2YDFA 4MP4A 2BXNA 8GSSA 1BG1A 1GULA 4ZB7A 2XW0A 4ZXGA 2NNWA 2X64A 4OFMA 2YV9A 3P8WA 5FUOA 5A5KA 3IE3A 1BAYA 4ZC6A 2WVXA 1MUHA 1A0FA 4BVXB 4HZ2A 4ZCGA 5B7CA 4E8HA 2WJUA 5IIXA 3CX9A 2HSMA 4J2FA 4ACSA 1GLPA 1KBNA 2BXEA 3HJMA 4PGTA 1TF0A 2C80A 1H9ZA 3QAWA 1SVOA 3UBKA 4KDYA 4CHSA 1SVLA 2WB9A 3KM6A 4GSTA 1GWCA 1GUMA 4DHXB 3FWCC 2PGTA 5IFOA 1K0AA 4F0CA 1HQOA 4MZWA 1MIVA 3KIKA 4HGMB 1ZL9A 2E0XA 3O3TA 4N3ZA 3Q18A 1BJ5A 4LA0A 2HSNA 3IC8A 5DBYA 2BXLA 1BYEA 1TXUA 2CVDA 3VI5A 1OE7A 3QR6A 4KSMA 1JZRA 4RI6A 2VCWA 4Q5NA 2CKXA 4W66A 5EY6A 1OYJA 1E78A 4K0NA 4EXJA 4F5VA 2HQTA 2BXKA 4PNFA 16GSA 4GDXA 2XW1A 2GDRA 4YQMA 2BXFA 1GNIA 1TU8A 1C72A 3FR9A 4ID0A 2GUTA 1MIWA 2Z8JA 4M70B 4TQ1A 3V03A 3WHQA 2WVZA 4QQ7A 3FY7A 2KBZA 4IKHA 2EFEA 4Q5QA 1EV9A 5AIXA 3LU7A 2BXCA 6GSWA 2WVXB 3UARA 2BX8A 1Z9HA 4GSSA 1H5WA 2Z8KA 2HSMB 4GF0A 3PPUA 5A4WA 3NVIA 5J40A 2HRKA 1PKZA 1IJGA 4E68A 6GSYA 20GSA 2F8FA 1M9BA 2DYMA 1K0OA 1MIYA 4OR0A 3I6AA 1MD3A 4OTUA 5IJFA 3HKRA 3EINA 1YEWC 3LYKA 4WR5A 2VUFA 4PO0A 1PMTA 1XWKA 4ECIA 5A4VA 1GTUA 1PA3A 4HJ2A 3MHSB 4N0UD 5B5TA 4KE3A 1GSDA 4KDUA 5ID7A 1HA2A 4JBBA 4PX1A 1S4BP 1E7HA 5ECOB 3A73A 2HSNB 2AB6A 4G04A 2GSSA 4PQIA 1JLWA 3M99C 3GQUA 5BPKA 4F5TA 2WVYA 3GSSA 3KMNA 5DALA 5EVOA 5HFKA 3LXZA 3PGTA 3EE2A 4AKHA 1VFIA 4WA6B 4MDCA 4N0FD 4AKIA 3ERFA 3LU8A 2I2ZA 4F5UA 1KXPD 4ZB9A 1K0DA 2CZ3A 3LXTA 2IMKA 4ZBDA 4JK4A 2VCVA 4FJCB 1FHEA 5A5HA 2LQHA 2OACA 1ZGNA 1RK4A 3DD3A 1GTIA 7GSSA 5A1NA 3NVMA 3TOTA 3FNMA 1E7GA 2XSIA 2LXTA 5ECPB 1G6WA 4AKXB 1LOTA 1YKCA 1IYIA 2WW1A 2A2RA 3CRUA 5J4VA 1BF5A 5J4UA 1GSUA 2WS2A 1XWGA 2CAIA 1J7EA 2BXOA 2WZSA 4O92A 1ML6A 1GNEA 1HNCA 2HRKB 3IBHA 4G9HA 4HI7A 3CWGA 4FQUA 5ECSA 2DBWA 3G7IA 1EEMA 3QAGA 14GSA 5A4UA 2LJRA 4ZUXV 3SIVB 3ECPA 4LMVA 5LD0A 3NMUA 2AAWA 5J47A 1B48A 5F05A 1GSSA 1TDIA 4F5SA 4IW9A 5J4YA 3W8SA 1KW2A 2HRAA 3NVKA 4IELA 4HZ4A 2GTUA 5IIHA 5ECKB 4GTUA 5ECRB 2OZBB 2DBUA 4K71A 4Z69A 1NHYA 3VK9A 2YV7A 1AW9A 3N9JA 3UIVA 4ZB8A 4L5LA 2H1LA 4FIPB 5GIPA 2DBXA 3CHXC 3B9MA 4LB9A 5ELGA 1GNJA 19GSA 4JZQA 1E7CA 4NAWB 1BKEA 4YQUA 5D7GA 2C3TA 4YH2A 5JCWA 3GTUB 2F3MA 2J9HA 3F6FA 2V36A 2GSTA 3MAKA 5FHIA 4ECJA 3IK9A 1K3LA 1M99A 2VCQA 3JQZA 4TQ0A 5DDLA 3ZMKA 4I9OA 5ECIB 1GSQA 1Q4JA 5EL8A 1GTAA 5A1NB 1F3AA 2K0NA 4HOJA 2LQIA 1GSYA 3UAPA 2VO4A 1LNSA 1G6YA 4QMKA 3D0ZA 1HK4A 3WYWA 2VCZA 4GG2A 4LUFA 4MPGA 12GSA 1PX6A 3R3EA 2BXQA 2YCDA 4JEDA 4MF5A 1VF3A 4Q5FA 3GURA 4IBPA 4OFNA 4IGJA 5ELAA 3GQXA 4C31B 3G7JA 4PXOA 1E7IA 2R6KA 4ZBKA 2WW3A 1E7FA 2BXBA 5D9VA 5D9XA 5IJ5A 1OE8A 2ON7A 3H3AA 3CSHA 1LBKA 2LOQA 2NQOA 2PMTA 4D7XA 1Y1UA 4PURA 1K0NA 4S1YA 5AN1A 1EOGA 1K0MA 3RBTA 4EC0A 3C8EA 1FW1A 1GSFA 3R2QA 2VUEA 2BXAA 2DSAA 2QM6A 3UVHA 4MF7A 1GUHA 2UZ8A 22GSA 4ECCA 1UA5A 1GSEA 4F03A 3GH6A 3M3MA 2EFDA 3G9KD 1AQXA 2XVQA 4G01A 3GA9L 2WDUA 4EDZA 2OT3A 4LUHA 5DQFA 2VKZG 1NT2B 5ECQB 2N5FA 5A34A 5IQYA 1UORA 3WHSA 2OADA 4OMVA 2O3EA 3LSZA 1Y6EA 4PI0C 2BXHA 4ZBRA 4PTSA 3M8NA 3F63A 1B4PA 1K3YA 4GSNA 1HK2A 4GCIA 1TU7A 1E7AA 3BPJA 2WW2A 5GSSA 3W1SA 1YVLA 3Q19A 5ECNB 5AIVA 2XVWA 2BXDA 2ON5A 1BG5A 2C4JA 3H37A 3VQIA 3FYGA 4FXYP 2NTOA 3GX0A 3WHRA 3WD6A 5GZZB 3ZFLA 4IW2A 1U88A 4BVYA 2EFHA 2UV8G 1K0BA 1MTCA 9GSSA 3FWBC 4RI7A 5D73A 2VCTA 2XVVA 1K0CA 3BBYA 3HJOA 5DCGA 3KJYA 1MM8A 1YY7A 3VPQA 2C3QA 4OFTA 3LYPA 1R5AA 1BM0A 2CZ2A 2JL4A 1XW6A 3L0HA 1TW9A 1YQ1A 2IMIA 1VZSA 2GLRA 3VLNA 4BL7A 3VPTA 5LCZA 1N5UA 2FNOA 2V6KA 3LFLA 1USBA 4K2CA 4PI2C 3LJRA 4KAEA 18GSA 1F3BA 4KH7A 1HK1A 3V09A 2ROHA 2C3NA 5F07A 1G7OA 1PX7A 6GSSA 6GSUA 5BMUA 3SIUB 13GSA 2A2SA 4L5OA 4KX4A 5G5FA 2AGHB 1PKWA 4IQAA 2PVQA 5J5NA 5IJEA 5D9TA 5A34B 5DALB 4ECBA 5GSTA 1PL1A 1J78A 4GLTA 1V2AA 2QMCA 2QHBA 4IW1A 1IYHA 2DC5A 4Q5RA 4EE0A 5ECHB 2R4VA 4NAXA 4Z9OA 4G0LA 5KEJA 2EFCA 4YAVA 1VF4A 3PLAA 4L8EA 1GLQA 5GINA 1XW5A 1FOUA 3DGQA 3N5OA 4MF6A 3M1GA 4MBEC 5A5HB 4G0IA 2HNLA 4BVYB 4G19A 2GSRA 2PERA 4L8UA 4EMXA 3KMOA 4J2VA 3SQJA 1AO6A 4W4UB 1E7BA 3HMJG 4FK5B 5GIOA 4TOPA 4AI6A 4IJIA 3SWLA 4BKEA 2VD1A 3O76A 4DM0A 3FRCA 1F2EA 3GUSA 3UBLA 2DG5A 3KJLA 5HOZA 1SVMA 4K0GA 1LJRA 3VWXA 4F0BA 1AQVA 2GSQA 2PBJA 5ECMB 2XVUA 4PQHA 1E6BA 3NIVA 3ISOA 2XMOA 1B8XA 4N0VA 4LMWA 4OTTA 1EOHA 4BL7B 1O9XA 1VF2A 1U3IA 5F0GA 1YDKA 4AGSA 1HK3A 2VDBA 3ERGA 3A75A 3CSJA 3LG6A 4E99A 3AY8A 3I69A 3KXOA 3GSTA 4ZBBA 1K3OA 4USSA 4IQ1A 5J41A 4ISDA 1PGTA 2CA8A 17GSA 3KTLA 3M0FA 5BMUB 2OA7A 4PHZC 1E7EA 5F8BA 5D9WA 1EV4A 4GDLB 4KDXA 4GDKB 5DJLA 1DUGA 1MUSA 2AJEA 1MD4A 2CAQA 5DAKA 3CBUA 4PNGA 3FR6A 1OKTA 2E0YA 5F06A 1PL2A 2KWFA 1M0UA 4KGIA 1JNBA 3TGZA 4G10A 3LQ7A 3ZMLA 3QAVA
chains in the Genus database with same CATH topology
11GSA 2FHEA 2BXMA 3U6VA 3ICXA 1BX9A 5AISA 1U87A 4NHZA 1PD21 3B9LA 3IR4A 2DYOA 2IL3A 1GUKA 4LB2A 4YAPA 4NHWA 2R5GA 4WR4A 3H1NA 2Z8IA 4ZB6A 2VD0A 2WRTA 6GSVA 1HNAA 4ZBQA 3Q74A 1MA9A 4BVXA 1HK5A 3PR8A 1VF1A 3CSIA 2D2ZA 5FT3A 2BXGA 4PUAA 3P90A 4G0KA 4BY9C 6GSTA 5DQSA 5ECLB 5FWGA 2VCXA 3TDLA 2BXPA 4OT2A 4HGKA 4AKGA 4YQVA 1V40A 2O5VA 3JRYA 5AGYA 2AHEA 4G03A 4KF9A 3CRTA 3GTUA 5JCUA 5IIUA 1GTBA 4MPFA 3FR3A 4I97A 1PN9A 3MHHB 4O7HA 2I30A 2C8UA 4E8EA 6GSXA 3TOUA 3LU6A 4IVFA 4EDYA 10GSA 4GDFA 3IK7A 2BXIA 5GHKA 3V08A 5G5EA 1GNWA 1N25A 5DAKB 4ZBAA 1N2AA 4DEJA 1JLVA 1AQWA 4L9QA 1YJ6A 3MDKA 4MK3A 1AXDA 4L9KA 3ZFBA 1M9AA 4IS0A 1HNBA 5DJMA 3F6DA 3TU3B 3VI7A 2JUHA 5ID9A 2R3XA 3VURA 2YDFA 4MP4A 2BXNA 8GSSA 1BG1A 1GULA 4ZB7A 2XW0A 4ZXGA 2NNWA 2X64A 4OFMA 2YV9A 3P8WA 5FUOA 5A5KA 3IE3A 1BAYA 4ZC6A 1A0FA 4BVXB 4HZ2A 4ZCGA 5B7CA 4E8HA 2WJUA 5IIXA 3CX9A 2HSMA 4J2FA 4ACSA 1GLPA 1KBNA 2BXEA 3HJMA 4PGTA 1TF0A 2C80A 1H9ZA 3QAWA 1SVOA 3UBKA 4KDYA 4CHSA 1SVLA 2WB9A 3KM6A 4GSTA 1GWCA 1GUMA 4DHXB 3FWCC 2PGTA 5IFOA 1K0AA 4F0CA 1HQOA 4MZWA 1MIVA 3KIKA 4HGMB 1ZL9A 2E0XA 3O3TA 4N3ZA 3Q18A 1BJ5A 4LA0A 2HSNA 3IC8A 5DBYA 2BXLA 1BYEA 1TXUA 2CVDA 3VI5A 1OE7A 3QR6A 4KSMA 1JZRA 4RI6A 2VCWA 4Q5NA 2CKXA 4W66A 5EY6A 1OYJA 1E78A 4K0NA 4EXJA 4F5VA 2HQTA 2BXKA 4PNFA 16GSA 4GDXA 2XW1A 2GDRA 4YQMA 2BXFA 1GNIA 1TU8A 1C72A 3FR9A 4ID0A 1MIWA 2Z8JA 4M70B 4TQ1A 3V03A 3WHQA 4QQ7A 3FY7A 2KBZA 4IKHA 2EFEA 4Q5QA 1EV9A 5AIXA 3LU7A 2BXCA 6GSWA 3UARA 2BX8A 1Z9HA 4GSSA 1H5WA 2Z8KA 2HSMB 4GF0A 3PPUA 5A4WA 3NVIA 5J40A 2HRKA 1PKZA 1IJGA 4E68A 6GSYA 20GSA 2F8FA 1M9BA 2DYMA 1K0OA 1MIYA 4OR0A 3I6AA 1MD3A 4OTUA 5IJFA 3HKRA 3EINA 3LYKA 4WR5A 2VUFA 4PO0A 1PMTA 1XWKA 4ECIA 5A4VA 1GTUA 1PA3A 4HJ2A 3MHSB 4N0UD 5B5TA 4KE3A 1GSDA 4KDUA 5ID7A 1HA2A 4JBBA 4PX1A 1E7HA 5ECOB 3A73A 2HSNB 2AB6A 4G04A 2GSSA 4PQIA 1JLWA 3M99C 3GQUA 5BPKA 4F5TA 3GSSA 3KMNA 5DALA 5EVOA 5HFKA 3LXZA 3PGTA 3EE2A 4AKHA 1VFIA 4WA6B 4MDCA 4N0FD 4AKIA 3ERFA 3LU8A 2I2ZA 4F5UA 1KXPD 4ZB9A 1K0DA 2CZ3A 3LXTA 2IMKA 4ZBDA 4JK4A 2VCVA 4FJCB 1FHEA 5A5HA 2OACA 1ZGNA 1RK4A 3DD3A 1GTIA 7GSSA 5A1NA 3NVMA 3TOTA 3FNMA 1E7GA 2XSIA 5ECPB 1G6WA 4AKXB 1LOTA 1YKCA 1IYIA 2A2RA 3CRUA 5J4VA 1BF5A 5J4UA 1GSUA 2WS2A 1XWGA 2CAIA 1J7EA 2BXOA 4O92A 1ML6A 1GNEA 1HNCA 2HRKB 3IBHA 4G9HA 4HI7A 3CWGA 4FQUA 5ECSA 2DBWA 3G7IA 1EEMA 3QAGA 14GSA 5A4UA 2LJRA 4ZUXV 3SIVB 4LMVA 5LD0A 3NMUA 2AAWA 5J47A 1B48A 5F05A 1GSSA 1TDIA 4F5SA 4IW9A 5J4YA 3W8SA 1KW2A 2HRAA 3NVKA 4IELA 4HZ4A 2GTUA 5IIHA 5ECKB 4GTUA 5ECRB 2OZBB 2DBUA 4K71A 4Z69A 1NHYA 3VK9A 2YV7A 1AW9A 3N9JA 3UIVA 4ZB8A 4L5LA 2H1LA 4FIPB 5GIPA 2DBXA 3B9MA 4LB9A 5ELGA 1GNJA 19GSA 4JZQA 1E7CA 4NAWB 1BKEA 4YQUA 5D7GA 2C3TA 4YH2A 5JCWA 3GTUB 2F3MA 2J9HA 3F6FA 2V36A 2GSTA 3MAKA 5FHIA 4ECJA 3IK9A 1K3LA 1M99A 2VCQA 3JQZA 4TQ0A 5DDLA 3ZMKA 5ECIB 1GSQA 1Q4JA 5EL8A 1GTAA 5A1NB 1F3AA 4HOJA 1GSYA 3UAPA 2VO4A 1LNSA 1G6YA 4QMKA 3D0ZA 1HK4A 3WYWA 2VCZA 4GG2A 4LUFA 4MPGA 12GSA 1PX6A 3R3EA 2BXQA 2YCDA 4JEDA 4MF5A 1VF3A 4Q5FA 3GURA 4IBPA 4OFNA 4IGJA 5ELAA 3GQXA 4C31B 3G7JA 4PXOA 1E7IA 2R6KA 4ZBKA 1E7FA 2BXBA 5D9VA 5D9XA 5IJ5A 1OE8A 2ON7A 3H3AA 3CSHA 1LBKA 2LOQA 2NQOA 2PMTA 1Y1UA 4PURA 1K0NA 4S1YA 5AN1A 1EOGA 1K0MA 3RBTA 4EC0A 3C8EA 1FW1A 1GSFA 3R2QA 2VUEA 2BXAA 2DSAA 2QM6A 3UVHA 4MF7A 1GUHA 2UZ8A 22GSA 4ECCA 1UA5A 1GSEA 4F03A 3GH6A 3M3MA 2EFDA 3G9KD 1AQXA 2XVQA 4G01A 3GA9L 2WDUA 4EDZA 2OT3A 4LUHA 5DQFA 2VKZG 1NT2B 5ECQB 2N5FA 5A34A 5IQYA 1UORA 3WHSA 2OADA 4OMVA 3LSZA 1Y6EA 2BXHA 4ZBRA 4PTSA 3M8NA 3F63A 1B4PA 1K3YA 4GSNA 1HK2A 4GCIA 1TU7A 1E7AA 5GSSA 3W1SA 1YVLA 3Q19A 5ECNB 5AIVA 2XVWA 2BXDA 2ON5A 1BG5A 2C4JA 3H37A 3VQIA 3FYGA 2NTOA 3GX0A 3WHRA 3WD6A 5GZZB 3ZFLA 4IW2A 1U88A 4BVYA 2EFHA 2UV8G 1K0BA 1MTCA 9GSSA 3FWBC 4RI7A 5D73A 2VCTA 2XVVA 1K0CA 3BBYA 3HJOA 5DCGA 3KJYA 1YY7A 3VPQA 2C3QA 4OFTA 3LYPA 1R5AA 1BM0A 2CZ2A 2JL4A 1XW6A 3L0HA 1TW9A 1YQ1A 2IMIA 1VZSA 2GLRA 3VLNA 4BL7A 3VPTA 5LCZA 1N5UA 2FNOA 2V6KA 3LFLA 1USBA 4K2CA 3LJRA 4KAEA 18GSA 1F3BA 4KH7A 1HK1A 3V09A 2ROHA 2C3NA 5F07A 1G7OA 1PX7A 6GSSA 6GSUA 5BMUA 3SIUB 13GSA 2A2SA 4L5OA 4KX4A 5G5FA 1PKWA 4IQAA 2PVQA 5J5NA 5IJEA 5D9TA 5A34B 5DALB 4ECBA 5GSTA 1PL1A 1J78A 4GLTA 1V2AA 2QMCA 2QHBA 4IW1A 1IYHA 2DC5A 4Q5RA 4EE0A 5ECHB 2R4VA 4NAXA 4Z9OA 4G0LA 5KEJA 2EFCA 4YAVA 1VF4A 3PLAA 4L8EA 1GLQA 5GINA 1XW5A 1FOUA 3DGQA 3N5OA 4MF6A 3M1GA 4MBEC 5A5HB 4G0IA 2HNLA 4BVYB 4G19A 2GSRA 2PERA 4L8UA 4EMXA 3KMOA 4J2VA 3SQJA 1AO6A 4W4UB 1E7BA 3HMJG 4FK5B 5GIOA 4TOPA 4AI6A 4IJIA 3SWLA 4BKEA 2VD1A 3O76A 3FRCA 1F2EA 3GUSA 3UBLA 2DG5A 3KJLA 5HOZA 1SVMA 4K0GA 1LJRA 3VWXA 4F0BA 1AQVA 2GSQA 2PBJA 5ECMB 2XVUA 4PQHA 1E6BA 3NIVA 3ISOA 2XMOA 1B8XA 4N0VA 4LMWA 4OTTA 1EOHA 4BL7B 1O9XA 1VF2A 1U3IA 5F0GA 1YDKA 4AGSA 1HK3A 2VDBA 3ERGA 3A75A 3CSJA 3LG6A 4E99A 3AY8A 3I69A 3KXOA 3GSTA 4ZBBA 1K3OA 4USSA 4IQ1A 5J41A 4ISDA 1PGTA 2CA8A 17GSA 3KTLA 3M0FA 5BMUB 2OA7A 1E7EA 5F8BA 5D9WA 1EV4A 4GDLB 4KDXA 4GDKB 5DJLA 1DUGA 2CAQA 2AJEA 1MD4A 5DAKA 3CBUA 4PNGA 3FR6A 1OKTA 2E0YA 5F06A 1PL2A 1M0UA 4KGIA 1JNBA 3TGZA 4G10A 3LQ7A 3ZMLA 3QAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXU A;  2EFE A;  2OT3 A;  4N3Z A;  2EFC A;  2EFH A;  2EFD A;  4G01 A; 
#chains in the Genus database with same CATH topology
 11GS A;  2O36 A;  2FHE A;  2BXM A;  3U6V A;  3ICX A;  1BX9 A;  5AIS A;  1SB0 A;  1U87 A;  4NHZ A;  1PD2 1;  3B9L A;  3IR4 A;  2DYO A;  2IL3 A;  1GUK A;  1I1I P;  4LB2 A;  4YAP A;  4NHW A;  2R5G A;  4WR4 A;  3H1N A;  2LXS A;  2Z8I A;  4ZB6 A;  2VD0 A;  2WRT A;  6GSV A;  1HNA A;  4ZBQ A;  3Q74 A;  1MA9 A;  4BVX A;  1HK5 A;  3PR8 A;  1VF1 A;  3CSI A;  2D2Z A;  5FT3 A;  2BXG A;  4PUA A;  3P90 A;  4G0K A;  4BY9 C;  3RFR C;  5DQS A;  6GST A;  5ECL B;  5FWG A;  2VCX A;  3TDL A;  2BXP A;  4OT2 A;  4HGK A;  4AKG A;  4YQV A;  1V40 A;  2O5V A;  3JRY A;  5AGY A;  2AHE A;  4G03 A;  4KF9 A;  3CRT A;  3GTU A;  5JCU A;  1KDX A;  5IIU A;  1GTB A;  4MPF A;  3FR3 A;  4I97 A;  1PN9 A;  3MHH B;  4O7H A;  2I30 A;  2C8U A;  4E8E A;  6GSX A;  3TOU A;  3LU6 A;  4IVF A;  4EDY A;  10GS A;  4GDF A;  3IK7 A;  2BXI A;  5GHK A;  3V08 A;  3RGB C;  5G5E A;  1GNW A;  1N25 A;  5DAK B;  4ZBA A;  1N2A A;  4DEJ A;  1JLV A;  1AQW A;  4L9Q A;  1YJ6 A;  3MDK A;  4MK3 A;  1AXD A;  4L9K A;  3ZFB A;  1M9A A;  4IS0 A;  1HNB A;  5DJM A;  3F6D A;  3TU3 B;  2WW0 A;  3VI7 A;  2JUH A;  5ID9 A;  2R3X A;  3VUR A;  2YDF A;  4MP4 A;  2BXN A;  8GSS A;  1BG1 A;  1GUL A;  4ZB7 A;  2XW0 A;  4ZXG A;  2NNW A;  2X64 A;  4OFM A;  2YV9 A;  3P8W A;  5FUO A;  5A5K A;  3IE3 A;  1BAY A;  4ZC6 A;  2WVX A;  1MUH A;  1A0F A;  4BVX B;  4HZ2 A;  4ZCG A;  5B7C A;  4E8H A;  2WJU A;  5IIX A;  3CX9 A;  2HSM A;  4J2F A;  4ACS A;  1GLP A;  1KBN A;  2BXE A;  3HJM A;  4PGT A;  1TF0 A;  2C80 A;  1H9Z A;  3QAW A;  1SVO A;  3UBK A;  4KDY A;  4CHS A;  1SVL A;  2WB9 A;  3KM6 A;  4GST A;  1GWC A;  1GUM A;  4DHX B;  3FWC C;  2PGT A;  5IFO A;  1K0A A;  4F0C A;  1HQO A;  4MZW A;  1MIV A;  3KIK A;  4HGM B;  1ZL9 A;  2E0X A;  3O3T A;  4N3Z A;  3Q18 A;  1BJ5 A;  4LA0 A;  2HSN A;  3IC8 A;  5DBY A;  2BXL A;  1BYE A;  1TXU A;  2CVD A;  3VI5 A;  1OE7 A;  3QR6 A;  4KSM A;  1JZR A;  4RI6 A;  2VCW A;  4Q5N A;  2CKX A;  4W66 A;  5EY6 A;  1OYJ A;  1E78 A;  4K0N A;  4EXJ A;  4F5V A;  2HQT A;  2BXK A;  4PNF A;  16GS A;  4GDX A;  2XW1 A;  2GDR A;  4YQM A;  2BXF A;  1GNI A;  1TU8 A;  1C72 A;  3FR9 A;  4ID0 A;  2GUT A;  1MIW A;  2Z8J A;  4M70 B;  4TQ1 A;  3V03 A;  3WHQ A;  2WVZ A;  4QQ7 A;  3FY7 A;  2KBZ A;  4IKH A;  2EFE A;  4Q5Q A;  1EV9 A;  5AIX A;  3LU7 A;  2BXC A;  6GSW A;  2WVX B;  3UAR A;  2BX8 A;  1Z9H A;  4GSS A;  1H5W A;  2Z8K A;  2HSM B;  4GF0 A;  3PPU A;  5A4W A;  3NVI A;  5J40 A;  2HRK A;  1PKZ A;  1IJG A;  4E68 A;  6GSY A;  20GS A;  2F8F A;  1M9B A;  2DYM A;  1K0O A;  1MIY A;  4OR0 A;  3I6A A;  1MD3 A;  4OTU A;  5IJF A;  3HKR A;  3EIN A;  1YEW C;  3LYK A;  4WR5 A;  2VUF A;  4PO0 A;  1PMT A;  1XWK A;  4ECI A;  5A4V A;  1GTU A;  1PA3 A;  4HJ2 A;  3MHS B;  4N0U D;  5B5T A;  4KE3 A;  1GSD A;  4KDU A;  5ID7 A;  1HA2 A;  4JBB A;  4PX1 A;  1S4B P;  1E7H A;  5ECO B;  3A73 A;  2HSN B;  2AB6 A;  4G04 A;  2GSS A;  4PQI A;  1JLW A;  3M99 C;  3GQU A;  5BPK A;  4F5T A;  2WVY A;  3GSS A;  3KMN A;  5DAL A;  5EVO A;  5HFK A;  3LXZ A;  3PGT A;  3EE2 A;  4AKH A;  1VFI A;  4WA6 B;  4MDC A;  4N0F D;  4AKI A;  3ERF A;  3LU8 A;  2I2Z A;  4F5U A;  1KXP D;  4ZB9 A;  1K0D A;  2CZ3 A;  3LXT A;  2IMK A;  4ZBD A;  4JK4 A;  2VCV A;  4FJC B;  1FHE A;  5A5H A;  2LQH A;  2OAC A;  1ZGN A;  1RK4 A;  3DD3 A;  1GTI A;  7GSS A;  5A1N A;  3NVM A;  3TOT A;  3FNM A;  1E7G A;  2XSI A;  2LXT A;  5ECP B;  1G6W A;  4AKX B;  1LOT A;  1YKC A;  1IYI A;  2WW1 A;  2A2R A;  3CRU A;  5J4V A;  1BF5 A;  5J4U A;  1GSU A;  2WS2 A;  1XWG A;  2CAI A;  1J7E A;  2BXO A;  2WZS A;  4O92 A;  1ML6 A;  1GNE A;  1HNC A;  2HRK B;  3IBH A;  4G9H A;  4HI7 A;  3CWG A;  4FQU A;  5ECS A;  2DBW A;  3G7I A;  1EEM A;  3QAG A;  14GS A;  5A4U A;  2LJR A;  4ZUX V;  3SIV B;  3ECP A;  4LMV A;  5LD0 A;  3NMU A;  2AAW A;  5J47 A;  1B48 A;  5F05 A;  1GSS A;  1TDI A;  4F5S A;  4IW9 A;  5J4Y A;  3W8S A;  1KW2 A;  2HRA A;  3NVK A;  4IEL A;  4HZ4 A;  2GTU A;  5IIH A;  5ECK B;  4GTU A;  5ECR B;  2OZB B;  2DBU A;  4K71 A;  4Z69 A;  1NHY A;  3VK9 A;  2YV7 A;  1AW9 A;  3N9J A;  3UIV A;  4ZB8 A;  4L5L A;  2H1L A;  4FIP B;  5GIP A;  2DBX A;  3CHX C;  3B9M A;  4LB9 A;  5ELG A;  1GNJ A;  19GS A;  4JZQ A;  1E7C A;  4NAW B;  1BKE A;  4YQU A;  5D7G A;  2C3T A;  4YH2 A;  5JCW A;  3GTU B;  2F3M A;  2J9H A;  3F6F A;  2V36 A;  2GST A;  3MAK A;  5FHI A;  4ECJ A;  3IK9 A;  1K3L A;  1M99 A;  2VCQ A;  3JQZ A;  4TQ0 A;  5DDL A;  3ZMK A;  4I9O A;  5ECI B;  1GSQ A;  1Q4J A;  5EL8 A;  1GTA A;  5A1N B;  1F3A A;  2K0N A;  4HOJ A;  2LQI A;  1GSY A;  3UAP A;  2VO4 A;  1LNS A;  1G6Y A;  4QMK A;  3D0Z A;  1HK4 A;  3WYW A;  2VCZ A;  4GG2 A;  4LUF A;  4MPG A;  12GS A;  1PX6 A;  3R3E A;  2BXQ A;  2YCD A;  4JED A;  4MF5 A;  1VF3 A;  4Q5F A;  3GUR A;  4IBP A;  4OFN A;  4IGJ A;  5ELA A;  3GQX A;  4C31 B;  3G7J A;  4PXO A;  1E7I A;  2R6K A;  4ZBK A;  2WW3 A;  1E7F A;  2BXB A;  5D9V A;  5D9X A;  5IJ5 A;  1OE8 A;  2ON7 A;  3H3A A;  3CSH A;  1LBK A;  2LOQ A;  2NQO A;  2PMT A;  4D7X A;  1Y1U A;  4PUR A;  1K0N A;  4S1Y A;  5AN1 A;  1EOG A;  1K0M A;  3RBT A;  4EC0 A;  3C8E A;  1FW1 A;  1GSF A;  3R2Q A;  2VUE A;  2BXA A;  2DSA A;  2QM6 A;  3UVH A;  4MF7 A;  1GUH A;  2UZ8 A;  22GS A;  4ECC A;  1UA5 A;  1GSE A;  4F03 A;  3GH6 A;  3M3M A;  2EFD A;  3G9K D;  1AQX A;  2XVQ A;  4G01 A;  3GA9 L;  2WDU A;  4EDZ A;  2OT3 A;  4LUH A;  5DQF A;  2VKZ G;  1NT2 B;  5ECQ B;  2N5F A;  5A34 A;  5IQY A;  1UOR A;  3WHS A;  2OAD A;  4OMV A;  2O3E A;  3LSZ A;  1Y6E A;  4PI0 C;  2BXH A;  4ZBR A;  4PTS A;  3M8N A;  3F63 A;  1B4P A;  1K3Y A;  4GSN A;  1HK2 A;  4GCI A;  1TU7 A;  1E7A A;  3BPJ A;  2WW2 A;  5GSS A;  3W1S A;  1YVL A;  3Q19 A;  5ECN B;  5AIV A;  2XVW A;  2BXD A;  2ON5 A;  1BG5 A;  2C4J A;  3H37 A;  3VQI A;  3FYG A;  4FXY P;  2NTO A;  3GX0 A;  3WHR A;  3WD6 A;  5GZZ B;  3ZFL A;  4IW2 A;  1U88 A;  4BVY A;  2EFH A;  2UV8 G;  1K0B A;  1MTC A;  9GSS A;  3FWB C;  4RI7 A;  5D73 A;  2VCT A;  2XVV A;  1K0C A;  3BBY A;  3HJO A;  5DCG A;  3KJY A;  1MM8 A;  1YY7 A;  3VPQ A;  2C3Q A;  4OFT A;  3LYP A;  1R5A A;  1BM0 A;  2CZ2 A;  2JL4 A;  1XW6 A;  3L0H A;  1TW9 A;  1YQ1 A;  2IMI A;  1VZS A;  2GLR A;  3VLN A;  4BL7 A;  3VPT A;  5LCZ A;  1N5U A;  2FNO A;  2V6K A;  3LFL A;  1USB A;  4K2C A;  4PI2 C;  3LJR A;  4KAE A;  18GS A;  1F3B A;  4KH7 A;  1HK1 A;  3V09 A;  2ROH A;  2C3N A;  5F07 A;  1G7O A;  1PX7 A;  6GSS A;  6GSU A;  5BMU A;  3SIU B;  13GS A;  2A2S A;  4L5O A;  4KX4 A;  5G5F A;  2AGH B;  1PKW A;  4IQA A;  2PVQ A;  5J5N A;  5IJE A;  5D9T A;  5A34 B;  5DAL B;  4ECB A;  5GST A;  1PL1 A;  1J78 A;  4GLT A;  1V2A A;  2QMC A;  2QHB A;  4IW1 A;  1IYH A;  2DC5 A;  4Q5R A;  4EE0 A;  5ECH B;  2R4V A;  4NAX A;  4Z9O A;  4G0L A;  5KEJ A;  2EFC A;  4YAV A;  1VF4 A;  3PLA A;  4L8E A;  1GLQ A;  5GIN A;  1XW5 A;  1FOU A;  3DGQ A;  3N5O A;  4MF6 A;  3M1G A;  4MBE C;  5A5H B;  4G0I A;  2HNL A;  4BVY B;  4G19 A;  2GSR A;  2PER A;  4L8U A;  4EMX A;  3KMO A;  4J2V A;  3SQJ A;  1AO6 A;  4W4U B;  1E7B A;  3HMJ G;  4FK5 B;  5GIO A;  4TOP A;  4AI6 A;  4IJI A;  3SWL A;  4BKE A;  2VD1 A;  3O76 A;  4DM0 A;  3FRC A;  1F2E A;  3GUS A;  3UBL A;  2DG5 A;  3KJL A;  5HOZ A;  1SVM A;  4K0G A;  1LJR A;  3VWX A;  4F0B A;  1AQV A;  2GSQ A;  2PBJ A;  5ECM B;  2XVU A;  4PQH A;  1E6B A;  3NIV A;  3ISO A;  2XMO A;  1B8X A;  4N0V A;  4LMW A;  4OTT A;  1EOH A;  4BL7 B;  1O9X A;  1VF2 A;  1U3I A;  5F0G A;  1YDK A;  4AGS A;  1HK3 A;  2VDB A;  3ERG A;  3A75 A;  3CSJ A;  3LG6 A;  4E99 A;  3AY8 A;  3I69 A;  3KXO A;  3GST A;  4ZBB A;  1K3O A;  4USS A;  4IQ1 A;  5J41 A;  4ISD A;  1PGT A;  2CA8 A;  17GS A;  3KTL A;  3M0F A;  5BMU B;  2OA7 A;  4PHZ C;  1E7E A;  5F8B A;  5D9W A;  1EV4 A;  4GDL B;  4KDX A;  4GDK B;  5DJL A;  1DUG A;  1MUS A;  2AJE A;  1MD4 A;  2CAQ A;  5DAK A;  3CBU A;  4PNG A;  3FR6 A;  1OKT A;  2E0Y A;  5F06 A;  1PL2 A;  2KWF A;  1M0U A;  4KGI A;  1JNB A;  3TGZ A;  4G10 A;  3LQ7 A;  3ZML A;  3QAV A; 
#chains in the Genus database with same CATH homology
 11GS A;  2FHE A;  2BXM A;  3U6V A;  3ICX A;  1BX9 A;  5AIS A;  1U87 A;  4NHZ A;  1PD2 1;  3B9L A;  3IR4 A;  2DYO A;  2IL3 A;  1GUK A;  4LB2 A;  4YAP A;  4NHW A;  2R5G A;  4WR4 A;  3H1N A;  2Z8I A;  4ZB6 A;  2VD0 A;  2WRT A;  6GSV A;  1HNA A;  4ZBQ A;  3Q74 A;  1MA9 A;  4BVX A;  1HK5 A;  3PR8 A;  1VF1 A;  3CSI A;  2D2Z A;  5FT3 A;  2BXG A;  4PUA A;  3P90 A;  4G0K A;  4BY9 C;  6GST A;  5DQS A;  5ECL B;  5FWG A;  2VCX A;  3TDL A;  2BXP A;  4OT2 A;  4HGK A;  4AKG A;  4YQV A;  1V40 A;  2O5V A;  3JRY A;  5AGY A;  2AHE A;  4G03 A;  4KF9 A;  3CRT A;  3GTU A;  5JCU A;  5IIU A;  1GTB A;  4MPF A;  3FR3 A;  4I97 A;  1PN9 A;  3MHH B;  4O7H A;  2I30 A;  2C8U A;  4E8E A;  6GSX A;  3TOU A;  3LU6 A;  4IVF A;  4EDY A;  10GS A;  4GDF A;  3IK7 A;  2BXI A;  5GHK A;  3V08 A;  5G5E A;  1GNW A;  1N25 A;  5DAK B;  4ZBA A;  1N2A A;  4DEJ A;  1JLV A;  1AQW A;  4L9Q A;  1YJ6 A;  3MDK A;  4MK3 A;  1AXD A;  4L9K A;  3ZFB A;  1M9A A;  4IS0 A;  1HNB A;  5DJM A;  3F6D A;  3TU3 B;  3VI7 A;  2JUH A;  5ID9 A;  2R3X A;  3VUR A;  2YDF A;  4MP4 A;  2BXN A;  8GSS A;  1BG1 A;  1GUL A;  4ZB7 A;  2XW0 A;  4ZXG A;  2NNW A;  2X64 A;  4OFM A;  2YV9 A;  3P8W A;  5FUO A;  5A5K A;  3IE3 A;  1BAY A;  4ZC6 A;  1A0F A;  4BVX B;  4HZ2 A;  4ZCG A;  5B7C A;  4E8H A;  2WJU A;  5IIX A;  3CX9 A;  2HSM A;  4J2F A;  4ACS A;  1GLP A;  1KBN A;  2BXE A;  3HJM A;  4PGT A;  1TF0 A;  2C80 A;  1H9Z A;  3QAW A;  1SVO A;  3UBK A;  4KDY A;  4CHS A;  1SVL A;  2WB9 A;  3KM6 A;  4GST A;  1GWC A;  1GUM A;  4DHX B;  3FWC C;  2PGT A;  5IFO A;  1K0A A;  4F0C A;  1HQO A;  4MZW A;  1MIV A;  3KIK A;  4HGM B;  1ZL9 A;  2E0X A;  3O3T A;  4N3Z A;  3Q18 A;  1BJ5 A;  4LA0 A;  2HSN A;  3IC8 A;  5DBY A;  2BXL A;  1BYE A;  1TXU A;  2CVD A;  3VI5 A;  1OE7 A;  3QR6 A;  4KSM A;  1JZR A;  4RI6 A;  2VCW A;  4Q5N A;  2CKX A;  4W66 A;  5EY6 A;  1OYJ A;  1E78 A;  4K0N A;  4EXJ A;  4F5V A;  2HQT A;  2BXK A;  4PNF A;  16GS A;  4GDX A;  2XW1 A;  2GDR A;  4YQM A;  2BXF A;  1GNI A;  1TU8 A;  1C72 A;  3FR9 A;  4ID0 A;  1MIW A;  2Z8J A;  4M70 B;  4TQ1 A;  3V03 A;  3WHQ A;  4QQ7 A;  3FY7 A;  2KBZ A;  4IKH A;  2EFE A;  4Q5Q A;  1EV9 A;  5AIX A;  3LU7 A;  2BXC A;  6GSW A;  3UAR A;  2BX8 A;  1Z9H A;  4GSS A;  1H5W A;  2Z8K A;  2HSM B;  4GF0 A;  3PPU A;  5A4W A;  3NVI A;  5J40 A;  2HRK A;  1PKZ A;  1IJG A;  4E68 A;  6GSY A;  20GS A;  2F8F A;  1M9B A;  2DYM A;  1K0O A;  1MIY A;  4OR0 A;  3I6A A;  1MD3 A;  4OTU A;  5IJF A;  3HKR A;  3EIN A;  3LYK A;  4WR5 A;  2VUF A;  4PO0 A;  1PMT A;  1XWK A;  4ECI A;  5A4V A;  1GTU A;  1PA3 A;  4HJ2 A;  3MHS B;  4N0U D;  5B5T A;  4KE3 A;  1GSD A;  4KDU A;  5ID7 A;  1HA2 A;  4JBB A;  4PX1 A;  1E7H A;  5ECO B;  3A73 A;  2HSN B;  2AB6 A;  4G04 A;  2GSS A;  4PQI A;  1JLW A;  3M99 C;  3GQU A;  5BPK A;  4F5T A;  3GSS A;  3KMN A;  5DAL A;  5EVO A;  5HFK A;  3LXZ A;  3PGT A;  3EE2 A;  4AKH A;  1VFI A;  4WA6 B;  4MDC A;  4N0F D;  4AKI A;  3ERF A;  3LU8 A;  2I2Z A;  4F5U A;  1KXP D;  4ZB9 A;  1K0D A;  2CZ3 A;  3LXT A;  2IMK A;  4ZBD A;  4JK4 A;  2VCV A;  4FJC B;  1FHE A;  5A5H A;  2OAC A;  1ZGN A;  1RK4 A;  3DD3 A;  1GTI A;  7GSS A;  5A1N A;  3NVM A;  3TOT A;  3FNM A;  1E7G A;  2XSI A;  5ECP B;  1G6W A;  4AKX B;  1LOT A;  1YKC A;  1IYI A;  2A2R A;  3CRU A;  5J4V A;  1BF5 A;  5J4U A;  1GSU A;  2WS2 A;  1XWG A;  2CAI A;  1J7E A;  2BXO A;  4O92 A;  1ML6 A;  1GNE A;  1HNC A;  2HRK B;  3IBH A;  4G9H A;  4HI7 A;  3CWG A;  4FQU A;  5ECS A;  2DBW A;  3G7I A;  1EEM A;  3QAG A;  14GS A;  5A4U A;  2LJR A;  4ZUX V;  3SIV B;  4LMV A;  5LD0 A;  3NMU A;  2AAW A;  5J47 A;  1B48 A;  5F05 A;  1GSS A;  1TDI A;  4F5S A;  4IW9 A;  5J4Y A;  3W8S A;  1KW2 A;  2HRA A;  3NVK A;  4IEL A;  4HZ4 A;  2GTU A;  5IIH A;  5ECK B;  4GTU A;  5ECR B;  2OZB B;  2DBU A;  4K71 A;  4Z69 A;  1NHY A;  3VK9 A;  2YV7 A;  1AW9 A;  3N9J A;  3UIV A;  4ZB8 A;  4L5L A;  2H1L A;  4FIP B;  5GIP A;  2DBX A;  3B9M A;  4LB9 A;  5ELG A;  1GNJ A;  19GS A;  4JZQ A;  1E7C A;  4NAW B;  1BKE A;  4YQU A;  5D7G A;  2C3T A;  4YH2 A;  5JCW A;  3GTU B;  2F3M A;  2J9H A;  3F6F A;  2V36 A;  2GST A;  3MAK A;  5FHI A;  4ECJ A;  3IK9 A;  1K3L A;  1M99 A;  2VCQ A;  3JQZ A;  4TQ0 A;  5DDL A;  3ZMK A;  5ECI B;  1GSQ A;  1Q4J A;  5EL8 A;  1GTA A;  5A1N B;  1F3A A;  4HOJ A;  1GSY A;  3UAP A;  2VO4 A;  1LNS A;  1G6Y A;  4QMK A;  3D0Z A;  1HK4 A;  3WYW A;  2VCZ A;  4GG2 A;  4LUF A;  4MPG A;  12GS A;  1PX6 A;  3R3E A;  2BXQ A;  2YCD A;  4JED A;  4MF5 A;  1VF3 A;  4Q5F A;  3GUR A;  4IBP A;  4OFN A;  4IGJ A;  5ELA A;  3GQX A;  4C31 B;  3G7J A;  4PXO A;  1E7I A;  2R6K A;  4ZBK A;  1E7F A;  2BXB A;  5D9V A;  5D9X A;  5IJ5 A;  1OE8 A;  2ON7 A;  3H3A A;  3CSH A;  1LBK A;  2LOQ A;  2NQO A;  2PMT A;  1Y1U A;  4PUR A;  1K0N A;  4S1Y A;  5AN1 A;  1EOG A;  1K0M A;  3RBT A;  4EC0 A;  3C8E A;  1FW1 A;  1GSF A;  3R2Q A;  2VUE A;  2BXA A;  2DSA A;  2QM6 A;  3UVH A;  4MF7 A;  1GUH A;  2UZ8 A;  22GS A;  4ECC A;  1UA5 A;  1GSE A;  4F03 A;  3GH6 A;  3M3M A;  2EFD A;  3G9K D;  1AQX A;  2XVQ A;  4G01 A;  3GA9 L;  2WDU A;  4EDZ A;  2OT3 A;  4LUH A;  5DQF A;  2VKZ G;  1NT2 B;  5ECQ B;  2N5F A;  5A34 A;  5IQY A;  1UOR A;  3WHS A;  2OAD A;  4OMV A;  3LSZ A;  1Y6E A;  2BXH A;  4ZBR A;  4PTS A;  3M8N A;  3F63 A;  1B4P A;  1K3Y A;  4GSN A;  1HK2 A;  4GCI A;  1TU7 A;  1E7A A;  5GSS A;  3W1S A;  1YVL A;  3Q19 A;  5ECN B;  5AIV A;  2XVW A;  2BXD A;  2ON5 A;  1BG5 A;  2C4J A;  3H37 A;  3VQI A;  3FYG A;  2NTO A;  3GX0 A;  3WHR A;  3WD6 A;  5GZZ B;  3ZFL A;  4IW2 A;  1U88 A;  4BVY A;  2EFH A;  2UV8 G;  1K0B A;  1MTC A;  9GSS A;  3FWB C;  4RI7 A;  5D73 A;  2VCT A;  2XVV A;  1K0C A;  3BBY A;  3HJO A;  5DCG A;  3KJY A;  1YY7 A;  3VPQ A;  2C3Q A;  4OFT A;  3LYP A;  1R5A A;  1BM0 A;  2CZ2 A;  2JL4 A;  1XW6 A;  3L0H A;  1TW9 A;  1YQ1 A;  2IMI A;  1VZS A;  2GLR A;  3VLN A;  4BL7 A;  3VPT A;  5LCZ A;  1N5U A;  2FNO A;  2V6K A;  3LFL A;  1USB A;  4K2C A;  3LJR A;  4KAE A;  18GS A;  1F3B A;  4KH7 A;  1HK1 A;  3V09 A;  2ROH A;  2C3N A;  5F07 A;  1G7O A;  1PX7 A;  6GSS A;  6GSU A;  5BMU A;  3SIU B;  13GS A;  2A2S A;  4L5O A;  4KX4 A;  5G5F A;  1PKW A;  4IQA A;  2PVQ A;  5J5N A;  5IJE A;  5D9T A;  5A34 B;  5DAL B;  4ECB A;  5GST A;  1PL1 A;  1J78 A;  4GLT A;  1V2A A;  2QMC A;  2QHB A;  4IW1 A;  1IYH A;  2DC5 A;  4Q5R A;  4EE0 A;  5ECH B;  2R4V A;  4NAX A;  4Z9O A;  4G0L A;  5KEJ A;  2EFC A;  4YAV A;  1VF4 A;  3PLA A;  4L8E A;  1GLQ A;  5GIN A;  1XW5 A;  1FOU A;  3DGQ A;  3N5O A;  4MF6 A;  3M1G A;  4MBE C;  5A5H B;  4G0I A;  2HNL A;  4BVY B;  4G19 A;  2GSR A;  2PER A;  4L8U A;  4EMX A;  3KMO A;  4J2V A;  3SQJ A;  1AO6 A;  4W4U B;  1E7B A;  3HMJ G;  4FK5 B;  5GIO A;  4TOP A;  4AI6 A;  4IJI A;  3SWL A;  4BKE A;  2VD1 A;  3O76 A;  3FRC A;  1F2E A;  3GUS A;  3UBL A;  2DG5 A;  3KJL A;  5HOZ A;  1SVM A;  4K0G A;  1LJR A;  3VWX A;  4F0B A;  1AQV A;  2GSQ A;  2PBJ A;  5ECM B;  2XVU A;  4PQH A;  1E6B A;  3NIV A;  3ISO A;  2XMO A;  1B8X A;  4N0V A;  4LMW A;  4OTT A;  1EOH A;  4BL7 B;  1O9X A;  1VF2 A;  1U3I A;  5F0G A;  1YDK A;  4AGS A;  1HK3 A;  2VDB A;  3ERG A;  3A75 A;  3CSJ A;  3LG6 A;  4E99 A;  3AY8 A;  3I69 A;  3KXO A;  3GST A;  4ZBB A;  1K3O A;  4USS A;  4IQ1 A;  5J41 A;  4ISD A;  1PGT A;  2CA8 A;  17GS A;  3KTL A;  3M0F A;  5BMU B;  2OA7 A;  1E7E A;  5F8B A;  5D9W A;  1EV4 A;  4GDL B;  4KDX A;  4GDK B;  5DJL A;  1DUG A;  2CAQ A;  2AJE A;  1MD4 A;  5DAK A;  3CBU A;  4PNG A;  3FR6 A;  1OKT A;  2E0Y A;  5F06 A;  1PL2 A;  1M0U A;  4KGI A;  1JNB A;  3TGZ A;  4G10 A;  3LQ7 A;  3ZML A;  3QAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...