2EFCA

Ara7-gdp/atvps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
246
structure length
246
Chain Sequence
MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 101
structure length 246
sequence length 246
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2efcA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2efcA02
2EFEA 4G01A 2OT3A 2EFCA 1TXUA 4N3ZA 2EFDA 2EFHA
chains in the Genus database with same CATH superfamily
1E78A 2A2RA 4PGTA 4PI0C 6GSUA 2VKZG 2VO4A 2Z8IA 5DALB 1PX7A 3CRTA 2WW2A 3G7JA 5AIVA 14GSA 3GSTA 1Q4JA 2XVVA 3TU3B 4RI7A 2GSQA 2KBZA 4O92A 5J4UA 4DHXB 4GDLB 4EDYA 1BG1A 1V2AA 2WS2A 2BXAA 5EVOA 6GSTA 5F8BA 1E7EA 1VF1A 4F03A 3WHSA 2PGTA 4TQ0A 4ACSA 3GUSA 1R5AA 1B4PA 4GLTA 1Y6EA 16GSA 3V09A 2VUEA 6GSYA 4ZB6A 3NMUA 1GSYA 1VF2A 3W1SA 3HJMA 2O3EA 4Q5FA 1UORA 3L0HA 3MDKA 5ID9A 1AO6A 2WDUA 2J9HA 4BVXA 1FOUA 3F63A 5ECIB 4LUFA 2X64A 1F3AA 2C3NA 4GSNA 1ZGNA 5DJMA 1E7FA 4K0GA 1LNSA 4HGKA 1JNBA 1NT2B 1M99A 1JLWA 3UBLA 4IJIA 3KJYA 2QHBA 5A4WA 1H9ZA 3PR8A 5D9WA 4JK4A 1HNCA 4BY9C 1HQOA 4Q5RA 4CHSA 1TXUA 3DGQA 3GH6A 3SIVB 2YV7A 3IBHA 2HSNB 3G9KD 1F3BA 1OYJA 3PPUA 4KSMA 2VCZA 4PO0A 4K71A 1PMTA 2E0YA 4PHZC 2ROHA 5FHIA 3IK9A 5D7GA 3FR3A 3A73A 3LXZA 4I9OA 1B48A 4YAPA 4GSTA 4MDCA 1Z9HA 3R2QA 2OACA 5IQYA 4WR5A 4S1YA 4BVYB 2OT3A 4K0NA 1BKEA 2DYOA 4KF9A 5D9TA 10GSA 4HZ4A 3CRUA 1KDXA 1O9XA 1EV9A 3B9MA 5BMUA 1GNEA 1E7HA 1C72A 1PN9A 4MK3A 4OT2A 4TOPA 3VI7A 3UAPA 4C31B 5HOZA 1IYIA 1MIYA 1K0DA 2LXSA 4QQ7A 5F07A 2QMCA 2CA8A 2XVUA 5AN1A 4AKHA 5IJFA 4F5TA 1K3YA 3RFRC 1PKZA 5BPKA 3KIKA 5AIXA 2WJUA 3LU6A 1ML6A 3LYPA 1IJGA 3UARA 11GSA 1K0AA 3PGTA 5ECRB 1HK4A 4W4UB 3H1NA 1MIVA 4OTUA 5FT3A 5EL8A 2BX8A 3LYKA 3NIVA 3GURA 4FXYP 3GA9L 4PTSA 4BL7A 4L9KA 2AHEA 4G03A 1AXDA 4WR4A 4W66A 1YKCA 4NAXA 5B5TA 5IFOA 1GSFA 1VF4A 1K0NA 1AQXA 1TW9A 5J5NA 2GSRA 4F5UA 1S4BP 4ID0A 19GSA 1MD3A 1SVOA 3W8SA 1N25A 4Z9OA 3QAWA 4KGIA 2CVDA 1YEWC 4YAVA 5AISA 2BXIA 1EEMA 5J40A 3VQIA 4F5VA 4ECJA 18GSA 4G9HA 4MZWA 3VWXA 4ZB9A 2UZ8A 5DBYA 1SB0A 4LB2A 1G6YA 4IVFA 5ELGA 4NAWB 4PI2C 3LJRA 2HNLA 5FWGA 1K0MA 3TDLA 4ZBBA 4LA0A 2HRKB 4G19A 4E99A 1VFIA 3CSJA 4YH2A 4ZXGA 4L5OA 9GSSA 4L9QA 4FQUA 4BVXB 1U3IA 4AI6A 1U88A 4JZQA 4PX1A 1BM0A 2Z8JA 3KTLA 1AQWA 3FY7A 3VI5A 3VK9A 1TF0A 4FIPB 1E7IA 4IW1A 1V40A 3RGBC 2GDRA 4AKIA 2VUFA 5A5HA 5A1NA 1EOHA 2AJEA 2UV8G 13GSA 3C8EA 3HMJG 12GSA 3HJOA 3VLNA 4N0UD 4L8EA 3GQXA 2NNWA 2OA7A 1GULA 5A34A 2PBJA 3M8NA 4ECIA 1DUGA 3GTUA 3KJLA 5DQSA 3UBKA 1PGTA 4EE0A 4YQVA 3ERFA 2OZBB 4ZBDA 2XVWA 4LUHA 4ZUXV 1FW1A 2WW0A 3NVMA 4F5SA 3LU7A 3CSIA 1GSDA 5ECKB 1AQVA 2JL4A 4GTUA 4M70B 2BXLA 4NHZA 5KEJA 3CHXC 1MM8A 2DG5A 2VCWA 5DAKA 6GSSA 1BYEA 3GX0A 2V6KA 3GSSA 4ECCA 1GTUA 1YDKA 3VPTA 3H37A 1ZL9A 1E7AA 3FRCA 2XVQA 1KXPD 2F3MA 4MF7A 3FWBC 5DQFA 5EY6A 2DBWA 4KX4A 3SQJA 2BXHA 3BPJA 4MPFA 3IK7A 4Z69A 1GWCA 1MD4A 2EFEA 1TU7A 3A75A 4IW9A 4HOJA 3DD3A 5GIPA 2YDFA 1PD21 1GNWA 6GSXA 2C3QA 4PNFA 3KMNA 2EFDA 1J7EA 3QAGA 3FNMA 3RBTA 2OADA 1N5UA 5DCGA 2BXOA 4BL7B 3Q19A 1UA5A 4BKEA 5F05A 1K0OA 2AAWA 4KAEA 1MA9A 1TDIA 1OE7A 3M3MA 2LOQA 4ZCGA 2CAIA 2VD1A 1A0FA 4GDXA 3JQZA 2IMKA 2R5GA 3NVKA 2EFHA 2VCQA 2LQIA 3SIUB 2PVQA 4PXOA 2HSMA 3BBYA 1NHYA 1E7GA 4G10A 4LMVA 4D7XA 1EOGA 2F8FA 1XWKA 4GG2A 2PMTA 3I6AA 5A4VA 5LCZA 3EINA 2WVXA 2VCVA 3QAVA 4PQHA 4ECBA 2NQOA 3LXTA 5LD0A 3FR6A 1MUHA 1I1IP 2I2ZA 3QR6A 1K3LA 1BX9A 5ECQB 4EDZA 5ECNB 4MBEC 4KDYA 1MTCA 5GHKA 4IGJA 2VCXA 2GLRA 5ID7A 3CSHA 5D9VA 5GIOA 2VDBA 3LU8A 1AW9A 1F2EA 1K0CA 4E68A 2HSNA 2BXMA 1GSQA 4F0CA 8GSSA 2A2SA 2WVZA 4HI7A 2EFCA 3V03A 4PNGA 3FWCC 1TU8A 5GZZB 1BF5A 5G5EA 4J2FA 3ISOA 4BVYA 1YJ6A 1B8XA 2DYMA 5D9XA 2XW0A 1LBKA 3ECPA 3O76A 5A5HB 2LQHA 5A1NB 3NVIA 3WYWA 1SVMA 3UVHA 2V36A 4ZBAA 5J4VA 1GUKA 3HKRA 3R3EA 1GUMA 3ZFBA 4J2VA 3MAKA 1PKWA 3ZFLA 4KE3A 2BXFA 5G5FA 2FNOA 4MF6A 4YQUA 4HJ2A 5ECLB 4YQMA 22GSA 4AGSA 2BXEA 1MIWA 2GUTA 3N5OA 4G04A 4PUAA 3VURA 4EMXA 4LB9A 1HNAA 5IIXA 1JZRA 2AGHB 2WB9A 2C3TA 3IC8A 4KDUA 4TQ1A 4K2CA 3I69A 2WW1A 4DM0A 4Q5NA 1LOTA 4FJCB 2WVYA 3IE3A 2KWFA 4IBPA 3MHSB 2NTOA 1GNIA 4ZC6A 3IR4A 1YY7A 1HK1A 3SWLA 3EE2A 2PERA 3KXOA 5IIHA 3M1GA 5J41A 3FR9A 2BXBA 2HQTA 4OFMA 2BXGA 1USBA 5B7CA 2VD0A 1XW6A 4KH7A 5FUOA 2R6KA 2D2ZA 4GSSA 2C4JA 2CZ3A 3TOUA 1IYHA 2ON5A 4WA6B 4IKHA 4O7HA 17GSA 1PA3A 4I97A 5D73A 2BXPA 1G6WA 1BAYA 2GSSA 3H3AA 5IJEA 1GTAA 2AB6A 2C8UA 2WZSA 3D0ZA 3ZMKA 4DEJA 1E7CA 3WHRA 2FHEA 5BMUB 1K3OA 2BXQA 6GSVA 2I30A 3F6FA 5DDLA 2HRKA 2K0NA 2DBXA 4G0KA 1KBNA 3ZMLA 2JUHA 1XWGA 1PX6A 2HSMB 4MPGA 20GSA 1OE8A 4L8UA 1GSEA 6GSWA 5DALA 3LQ7A 5F0GA 2E0XA 4N0VA 1K0BA 4OFTA 2WVXB 3G7IA 2O36A 2Z8KA 2DSAA 4GDKB 1M0UA 3P90A 4E8HA 2GSTA 1GTIA 2ON7A 2IL3A 3AY8A 4N0FD 5JCUA 3PLAA 1PL1A 3TOTA 4ZB8A 1SVLA 2CKXA 1EV4A 4OR0A 3ICXA 1U87A 1M9BA 1M9AA 4OFNA 1LJRA 4IW2A 4E8EA 5A5KA 1H5WA 1J78A 3FYGA 2IMIA 4G0IA 1Y1UA 4AKGA 2DBUA 1YVLA 4ZBKA 3CX9A 1GLQA 1PL2A 4G0LA 1BG5A 3M99C 5ELAA 4F0BA 7GSSA 1G7OA 3P8WA 4KDXA 3WD6A 2BXNA 3M0FA 2YV9A 3JRYA 3KMOA 2BXDA 2GTUA 5GSTA 4OTTA 1BJ5A 1GUHA 5ECHB 3UIVA 5ECMB 2CZ2A 5J4YA 1GNJA 4LMWA 4JBBA 3Q74A 5IIUA 4L5LA 4IQAA 3F6DA 1FHEA 1OKTA 1YQ1A 2R3XA 2C80A 4ZB7A 3VPQA 4GDFA 1HK2A 2VCTA 4AKXB 2R4VA 3LFLA 1HK3A 4NHWA 4HGMB 4EC0A 4N3ZA 3GQUA 4ZBRA 3TGZA 2DC5A 3O3TA 2YCDA 3V08A 5DJLA 1HA2A 4ISDA 2XSIA 3KM6A 4Q5QA 3WHQA 3U6VA 2QM6A 1GSUA 4FK5B 1HK5A 4RI6A 2H1LA 4HZ2A 5ECOB 4ZBQA 1GSSA 2WRTA 5A4UA 1MUSA 5J47A 3LG6A 1RK4A 4G01A 5GINA 2N5FA 5ECSA 5AGYA 4QMKA 2XW1A 1KW2A 4OMVA 1N2AA 5HFKA 5GSSA 5JCWA 3N9JA 4GF0A 5A34B 4PURA 1JLVA 3B9LA 5ECPB 2LXTA 3GTUB 2BXCA 2CAQA 1VF3A 3MHHB 3LSZA 1GTBA 4MF5A 4IQ1A 2XMOA 3CWGA 4EXJA 1E6BA 2HRAA 1HNBA 2LJRA 3Q18A 3ERGA 4IELA 5DAKB 5IJ5A 4GCIA 1GLPA 3CBUA 2BXKA 2WW3A 1VZSA 4JEDA 4USSA 1E7BA 5F06A 1XW5A 4MP4A 4PQIA 2O5VA 4IS0A
chains in the Genus database with same CATH topology
1E78A 2A2RA 4PGTA 6GSUA 2VKZG 2VO4A 2Z8IA 5DALB 1PX7A 3CRTA 3G7JA 5AIVA 14GSA 3GSTA 1Q4JA 2XVVA 3TU3B 4RI7A 2GSQA 2KBZA 4O92A 5J4UA 4DHXB 4GDLB 4EDYA 1BG1A 1V2AA 2WS2A 2BXAA 5EVOA 6GSTA 5F8BA 1E7EA 1VF1A 4F03A 3WHSA 2PGTA 4TQ0A 4ACSA 3GUSA 1R5AA 1B4PA 4GLTA 1Y6EA 16GSA 3V09A 2VUEA 6GSYA 4ZB6A 3NMUA 1GSYA 1VF2A 3W1SA 3HJMA 4Q5FA 1UORA 3L0HA 3MDKA 5ID9A 1AO6A 2WDUA 2J9HA 4BVXA 1FOUA 3F63A 5ECIB 4LUFA 2X64A 1F3AA 2C3NA 4GSNA 1ZGNA 5DJMA 1E7FA 4K0GA 1LNSA 4HGKA 1JNBA 1NT2B 1M99A 1JLWA 3UBLA 4IJIA 3KJYA 2QHBA 5A4WA 1H9ZA 3PR8A 5D9WA 4JK4A 1HNCA 4BY9C 1HQOA 4Q5RA 4CHSA 1TXUA 3DGQA 3GH6A 3SIVB 2YV7A 3IBHA 2HSNB 3G9KD 1F3BA 1OYJA 3PPUA 4KSMA 2VCZA 4PO0A 4K71A 1PMTA 2E0YA 2ROHA 5FHIA 3IK9A 5D7GA 3FR3A 3A73A 3LXZA 1B48A 4YAPA 4GSTA 4MDCA 1Z9HA 3R2QA 2OACA 5IQYA 4WR5A 4S1YA 4BVYB 2OT3A 4K0NA 1BKEA 2DYOA 4KF9A 5D9TA 10GSA 4HZ4A 3CRUA 1O9XA 1EV9A 3B9MA 5BMUA 1GNEA 1E7HA 1C72A 1PN9A 4MK3A 4OT2A 4TOPA 3VI7A 3UAPA 4C31B 5HOZA 1IYIA 1MIYA 1K0DA 4QQ7A 5F07A 2QMCA 2CA8A 2XVUA 5AN1A 4AKHA 5IJFA 4F5TA 1K3YA 1PKZA 5BPKA 3KIKA 5AIXA 2WJUA 3LU6A 1ML6A 3LYPA 1IJGA 3UARA 11GSA 1K0AA 3PGTA 5ECRB 1HK4A 4W4UB 3H1NA 1MIVA 4OTUA 5FT3A 5EL8A 2BX8A 3LYKA 3NIVA 3GURA 4PTSA 3GA9L 4BL7A 4L9KA 2AHEA 4G03A 1AXDA 4WR4A 4W66A 1YKCA 4NAXA 5B5TA 5IFOA 1GSFA 1VF4A 1K0NA 1AQXA 1TW9A 5J5NA 2GSRA 4F5UA 4ID0A 19GSA 1MD3A 1SVOA 3W8SA 1N25A 4Z9OA 3QAWA 4KGIA 2CVDA 4YAVA 5AISA 2BXIA 1EEMA 5J40A 3VQIA 4F5VA 4ECJA 18GSA 4G9HA 4MZWA 3VWXA 4ZB9A 2UZ8A 5DBYA 1G6YA 4LB2A 4IVFA 5ELGA 4NAWB 3LJRA 2HNLA 5FWGA 1K0MA 3TDLA 4ZBBA 4LA0A 2HRKB 4G19A 4E99A 1VFIA 3CSJA 4YH2A 4ZXGA 4L5OA 9GSSA 4L9QA 4FQUA 4BVXB 1U3IA 4AI6A 1U88A 4JZQA 4PX1A 1BM0A 2Z8JA 3KTLA 1AQWA 3FY7A 3VI5A 3VK9A 1TF0A 4FIPB 1E7IA 4IW1A 1V40A 2GDRA 4AKIA 2VUFA 5A5HA 5A1NA 1EOHA 2AJEA 2UV8G 13GSA 3C8EA 3HMJG 12GSA 3HJOA 3VLNA 4N0UD 4L8EA 3GQXA 2NNWA 2OA7A 1GULA 5A34A 2PBJA 3M8NA 4ECIA 1DUGA 3GTUA 3KJLA 5DQSA 3UBKA 1PGTA 4EE0A 4YQVA 3ERFA 2OZBB 4ZBDA 2XVWA 4LUHA 4ZUXV 1FW1A 3NVMA 4F5SA 3LU7A 3CSIA 1GSDA 5ECKB 1AQVA 2JL4A 4GTUA 4M70B 2BXLA 4NHZA 5KEJA 2DG5A 2VCWA 5DAKA 6GSSA 1BYEA 3GX0A 2V6KA 3GSSA 4ECCA 1GTUA 1YDKA 3VPTA 3H37A 1ZL9A 1E7AA 3FRCA 2XVQA 1KXPD 2F3MA 4MF7A 3FWBC 5DQFA 5EY6A 2DBWA 4KX4A 3SQJA 2BXHA 4MPFA 3IK7A 4Z69A 1GWCA 1MD4A 2EFEA 1TU7A 3A75A 4IW9A 4HOJA 3DD3A 5GIPA 2YDFA 1PD21 1GNWA 6GSXA 2C3QA 4PNFA 3KMNA 2EFDA 1J7EA 3QAGA 3FNMA 3RBTA 2OADA 1N5UA 5DCGA 2BXOA 4BL7B 3Q19A 1UA5A 4BKEA 5F05A 1K0OA 2AAWA 4KAEA 1MA9A 1TDIA 1OE7A 3M3MA 2LOQA 4ZCGA 2CAIA 2VD1A 1A0FA 4GDXA 3JQZA 2IMKA 2R5GA 3NVKA 2EFHA 2VCQA 3SIUB 4PXOA 2PVQA 2HSMA 3BBYA 1NHYA 1E7GA 4G10A 4LMVA 1EOGA 2F8FA 1XWKA 4GG2A 2PMTA 3I6AA 5A4VA 5LCZA 3EINA 3QAVA 2VCVA 4PQHA 4ECBA 2NQOA 3LXTA 5LD0A 3FR6A 2I2ZA 3QR6A 1K3LA 1BX9A 5ECQB 4EDZA 5ECNB 4MBEC 4KDYA 1MTCA 5GHKA 4IGJA 2VCXA 2GLRA 5ID7A 3CSHA 5D9VA 5GIOA 2VDBA 3LU8A 1K0CA 1AW9A 1F2EA 4E68A 2HSNA 2BXMA 1GSQA 4F0CA 8GSSA 2A2SA 4HI7A 2EFCA 3V03A 4PNGA 3FWCC 1TU8A 5GZZB 1BF5A 5G5EA 4J2FA 3ISOA 4BVYA 1YJ6A 1B8XA 2DYMA 5D9XA 2XW0A 1LBKA 3O76A 5A5HB 5A1NB 3NVIA 3WYWA 1SVMA 3UVHA 2V36A 4ZBAA 5J4VA 1GUKA 3HKRA 3R3EA 1GUMA 3ZFBA 4J2VA 3MAKA 1PKWA 3ZFLA 4KE3A 2BXFA 5G5FA 2FNOA 4MF6A 4YQUA 4HJ2A 5ECLB 4YQMA 22GSA 4AGSA 2BXEA 1MIWA 3N5OA 4G04A 4PUAA 3VURA 4EMXA 4LB9A 1HNAA 5IIXA 1JZRA 2WB9A 3IC8A 2C3TA 4KDUA 4TQ1A 4K2CA 3I69A 4Q5NA 1LOTA 4FJCB 3IE3A 4IBPA 3MHSB 2NTOA 1GNIA 4ZC6A 3IR4A 1YY7A 1HK1A 3SWLA 3EE2A 2PERA 3KXOA 5IIHA 3M1GA 5J41A 3FR9A 2BXBA 2HQTA 4OFMA 2BXGA 1USBA 5B7CA 2VD0A 1XW6A 4KH7A 5FUOA 2R6KA 2D2ZA 4GSSA 2C4JA 2CZ3A 3TOUA 1IYHA 2ON5A 4WA6B 4IKHA 4O7HA 17GSA 1PA3A 4I97A 5D73A 2BXPA 1G6WA 1BAYA 2GSSA 3H3AA 5IJEA 1GTAA 2AB6A 2C8UA 3D0ZA 3ZMKA 4DEJA 1E7CA 3WHRA 2FHEA 5BMUB 1K3OA 2BXQA 6GSVA 2I30A 3F6FA 5DDLA 2HRKA 2DBXA 4G0KA 1KBNA 3ZMLA 2JUHA 1XWGA 1PX6A 2HSMB 4MPGA 20GSA 1OE8A 4L8UA 1GSEA 6GSWA 5DALA 3LQ7A 5F0GA 2E0XA 4N0VA 1K0BA 4OFTA 3G7IA 2Z8KA 2DSAA 4GDKB 1M0UA 3P90A 4E8HA 2GSTA 1GTIA 2ON7A 2IL3A 3AY8A 4N0FD 5JCUA 3PLAA 1PL1A 3TOTA 4ZB8A 1SVLA 2CKXA 1EV4A 4OR0A 3ICXA 1U87A 1M9BA 1M9AA 4OFNA 1LJRA 4IW2A 4E8EA 5A5KA 1H5WA 1J78A 3FYGA 2IMIA 4G0IA 1Y1UA 4AKGA 2DBUA 1YVLA 4ZBKA 3CX9A 1GLQA 1PL2A 4G0LA 1BG5A 3M99C 5ELAA 4F0BA 7GSSA 1G7OA 3P8WA 4KDXA 3WD6A 2BXNA 3M0FA 2YV9A 3JRYA 3KMOA 2BXDA 2GTUA 5GSTA 4OTTA 1BJ5A 1GUHA 5ECHB 3UIVA 5ECMB 2CZ2A 5J4YA 1GNJA 4LMWA 4JBBA 3Q74A 5IIUA 4L5LA 4IQAA 3F6DA 1FHEA 1OKTA 1YQ1A 2R3XA 2C80A 4ZB7A 3VPQA 4GDFA 1HK2A 2VCTA 4AKXB 2R4VA 3LFLA 1HK3A 4NHWA 4HGMB 4EC0A 4N3ZA 3GQUA 4ZBRA 3TGZA 2DC5A 3O3TA 2YCDA 3V08A 5DJLA 1HA2A 4ISDA 2XSIA 3KM6A 4Q5QA 3WHQA 3U6VA 2QM6A 1GSUA 4FK5B 1HK5A 4RI6A 2H1LA 4HZ2A 5ECOB 4ZBQA 1GSSA 2WRTA 5A4UA 5J47A 3LG6A 1RK4A 4G01A 5GINA 2N5FA 5ECSA 5AGYA 4QMKA 2XW1A 1KW2A 4OMVA 1N2AA 5HFKA 5GSSA 5JCWA 3N9JA 4GF0A 5A34B 4PURA 1JLVA 3B9LA 5ECPB 3GTUB 2BXCA 2CAQA 1VF3A 3MHHB 3LSZA 1GTBA 4MF5A 4IQ1A 2XMOA 3CWGA 4EXJA 1E6BA 2HRAA 1HNBA 2LJRA 3Q18A 3ERGA 4IELA 5DAKB 5IJ5A 4GCIA 1GLPA 3CBUA 2BXKA 1VZSA 4JEDA 4USSA 1E7BA 5F06A 1XW5A 4MP4A 4PQIA 2O5VA 4IS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFE A;  4G01 A;  2OT3 A;  2EFC A;  1TXU A;  4N3Z A;  2EFD A;  2EFH A; 
#chains in the Genus database with same CATH topology
 1E78 A;  2A2R A;  4PGT A;  4PI0 C;  6GSU A;  2VKZ G;  2VO4 A;  2Z8I A;  5DAL B;  1PX7 A;  3CRT A;  2WW2 A;  3G7J A;  5AIV A;  14GS A;  3GST A;  1Q4J A;  2XVV A;  3TU3 B;  4RI7 A;  2GSQ A;  2KBZ A;  4O92 A;  5J4U A;  4DHX B;  4GDL B;  4EDY A;  1BG1 A;  1V2A A;  2WS2 A;  2BXA A;  5EVO A;  6GST A;  5F8B A;  1E7E A;  1VF1 A;  4F03 A;  3WHS A;  2PGT A;  4TQ0 A;  4ACS A;  3GUS A;  1R5A A;  1B4P A;  4GLT A;  1Y6E A;  16GS A;  3V09 A;  2VUE A;  6GSY A;  4ZB6 A;  3NMU A;  1GSY A;  1VF2 A;  3W1S A;  3HJM A;  2O3E A;  4Q5F A;  1UOR A;  3L0H A;  3MDK A;  5ID9 A;  1AO6 A;  2WDU A;  2J9H A;  4BVX A;  1FOU A;  3F63 A;  5ECI B;  4LUF A;  2X64 A;  1F3A A;  2C3N A;  4GSN A;  1ZGN A;  5DJM A;  1E7F A;  4K0G A;  1LNS A;  4HGK A;  1JNB A;  1NT2 B;  1M99 A;  1JLW A;  3UBL A;  4IJI A;  3KJY A;  2QHB A;  5A4W A;  1H9Z A;  3PR8 A;  5D9W A;  4JK4 A;  1HNC A;  4BY9 C;  1HQO A;  4Q5R A;  4CHS A;  1TXU A;  3DGQ A;  3GH6 A;  3SIV B;  2YV7 A;  3IBH A;  2HSN B;  3G9K D;  1F3B A;  1OYJ A;  3PPU A;  4KSM A;  2VCZ A;  4PO0 A;  4K71 A;  1PMT A;  2E0Y A;  4PHZ C;  2ROH A;  5FHI A;  3IK9 A;  5D7G A;  3FR3 A;  3A73 A;  3LXZ A;  4I9O A;  1B48 A;  4YAP A;  4GST A;  4MDC A;  1Z9H A;  3R2Q A;  2OAC A;  5IQY A;  4WR5 A;  4S1Y A;  4BVY B;  2OT3 A;  4K0N A;  1BKE A;  2DYO A;  4KF9 A;  5D9T A;  10GS A;  4HZ4 A;  3CRU A;  1KDX A;  1O9X A;  1EV9 A;  3B9M A;  5BMU A;  1GNE A;  1E7H A;  1C72 A;  1PN9 A;  4MK3 A;  4OT2 A;  4TOP A;  3VI7 A;  3UAP A;  4C31 B;  5HOZ A;  1IYI A;  1MIY A;  1K0D A;  2LXS A;  4QQ7 A;  5F07 A;  2QMC A;  2CA8 A;  2XVU A;  5AN1 A;  4AKH A;  5IJF A;  4F5T A;  1K3Y A;  3RFR C;  1PKZ A;  5BPK A;  3KIK A;  5AIX A;  2WJU A;  3LU6 A;  1ML6 A;  3LYP A;  1IJG A;  3UAR A;  11GS A;  1K0A A;  3PGT A;  5ECR B;  1HK4 A;  4W4U B;  3H1N A;  1MIV A;  4OTU A;  5FT3 A;  5EL8 A;  2BX8 A;  3LYK A;  3NIV A;  3GUR A;  4FXY P;  3GA9 L;  4PTS A;  4BL7 A;  4L9K A;  2AHE A;  4G03 A;  1AXD A;  4WR4 A;  4W66 A;  1YKC A;  4NAX A;  5B5T A;  5IFO A;  1GSF A;  1VF4 A;  1K0N A;  1AQX A;  1TW9 A;  5J5N A;  2GSR A;  4F5U A;  1S4B P;  4ID0 A;  19GS A;  1MD3 A;  1SVO A;  3W8S A;  1N25 A;  4Z9O A;  3QAW A;  4KGI A;  2CVD A;  1YEW C;  4YAV A;  5AIS A;  2BXI A;  1EEM A;  5J40 A;  3VQI A;  4F5V A;  4ECJ A;  18GS A;  4G9H A;  4MZW A;  3VWX A;  4ZB9 A;  2UZ8 A;  5DBY A;  1SB0 A;  4LB2 A;  1G6Y A;  4IVF A;  5ELG A;  4NAW B;  4PI2 C;  3LJR A;  2HNL A;  5FWG A;  1K0M A;  3TDL A;  4ZBB A;  4LA0 A;  2HRK B;  4G19 A;  4E99 A;  1VFI A;  3CSJ A;  4YH2 A;  4ZXG A;  4L5O A;  9GSS A;  4L9Q A;  4FQU A;  4BVX B;  1U3I A;  4AI6 A;  1U88 A;  4JZQ A;  4PX1 A;  1BM0 A;  2Z8J A;  3KTL A;  1AQW A;  3FY7 A;  3VI5 A;  3VK9 A;  1TF0 A;  4FIP B;  1E7I A;  4IW1 A;  1V40 A;  3RGB C;  2GDR A;  4AKI A;  2VUF A;  5A5H A;  5A1N A;  1EOH A;  2AJE A;  2UV8 G;  13GS A;  3C8E A;  3HMJ G;  12GS A;  3HJO A;  3VLN A;  4N0U D;  4L8E A;  3GQX A;  2NNW A;  2OA7 A;  1GUL A;  5A34 A;  2PBJ A;  3M8N A;  4ECI A;  1DUG A;  3GTU A;  3KJL A;  5DQS A;  3UBK A;  1PGT A;  4EE0 A;  4YQV A;  3ERF A;  2OZB B;  4ZBD A;  2XVW A;  4LUH A;  4ZUX V;  1FW1 A;  2WW0 A;  3NVM A;  4F5S A;  3LU7 A;  3CSI A;  1GSD A;  5ECK B;  1AQV A;  2JL4 A;  4GTU A;  4M70 B;  2BXL A;  4NHZ A;  5KEJ A;  3CHX C;  1MM8 A;  2DG5 A;  2VCW A;  5DAK A;  6GSS A;  1BYE A;  3GX0 A;  2V6K A;  3GSS A;  4ECC A;  1GTU A;  1YDK A;  3VPT A;  3H37 A;  1ZL9 A;  1E7A A;  3FRC A;  2XVQ A;  1KXP D;  2F3M A;  4MF7 A;  3FWB C;  5DQF A;  5EY6 A;  2DBW A;  4KX4 A;  3SQJ A;  2BXH A;  3BPJ A;  4MPF A;  3IK7 A;  4Z69 A;  1GWC A;  1MD4 A;  2EFE A;  1TU7 A;  3A75 A;  4IW9 A;  4HOJ A;  3DD3 A;  5GIP A;  2YDF A;  1PD2 1;  1GNW A;  6GSX A;  2C3Q A;  4PNF A;  3KMN A;  2EFD A;  1J7E A;  3QAG A;  3FNM A;  3RBT A;  2OAD A;  1N5U A;  5DCG A;  2BXO A;  4BL7 B;  3Q19 A;  1UA5 A;  4BKE A;  5F05 A;  1K0O A;  2AAW A;  4KAE A;  1MA9 A;  1TDI A;  1OE7 A;  3M3M A;  2LOQ A;  4ZCG A;  2CAI A;  2VD1 A;  1A0F A;  4GDX A;  3JQZ A;  2IMK A;  2R5G A;  3NVK A;  2EFH A;  2VCQ A;  2LQI A;  3SIU B;  2PVQ A;  4PXO A;  2HSM A;  3BBY A;  1NHY A;  1E7G A;  4G10 A;  4LMV A;  4D7X A;  1EOG A;  2F8F A;  1XWK A;  4GG2 A;  2PMT A;  3I6A A;  5A4V A;  5LCZ A;  3EIN A;  2WVX A;  2VCV A;  3QAV A;  4PQH A;  4ECB A;  2NQO A;  3LXT A;  5LD0 A;  3FR6 A;  1MUH A;  1I1I P;  2I2Z A;  3QR6 A;  1K3L A;  1BX9 A;  5ECQ B;  4EDZ A;  5ECN B;  4MBE C;  4KDY A;  1MTC A;  5GHK A;  4IGJ A;  2VCX A;  2GLR A;  5ID7 A;  3CSH A;  5D9V A;  5GIO A;  2VDB A;  3LU8 A;  1AW9 A;  1F2E A;  1K0C A;  4E68 A;  2HSN A;  2BXM A;  1GSQ A;  4F0C A;  8GSS A;  2A2S A;  2WVZ A;  4HI7 A;  2EFC A;  3V03 A;  4PNG A;  3FWC C;  1TU8 A;  5GZZ B;  1BF5 A;  5G5E A;  4J2F A;  3ISO A;  4BVY A;  1YJ6 A;  1B8X A;  2DYM A;  5D9X A;  2XW0 A;  1LBK A;  3ECP A;  3O76 A;  5A5H B;  2LQH A;  5A1N B;  3NVI A;  3WYW A;  1SVM A;  3UVH A;  2V36 A;  4ZBA A;  5J4V A;  1GUK A;  3HKR A;  3R3E A;  1GUM A;  3ZFB A;  4J2V A;  3MAK A;  1PKW A;  3ZFL A;  4KE3 A;  2BXF A;  5G5F A;  2FNO A;  4MF6 A;  4YQU A;  4HJ2 A;  5ECL B;  4YQM A;  22GS A;  4AGS A;  2BXE A;  1MIW A;  2GUT A;  3N5O A;  4G04 A;  4PUA A;  3VUR A;  4EMX A;  4LB9 A;  1HNA A;  5IIX A;  1JZR A;  2AGH B;  2WB9 A;  2C3T A;  3IC8 A;  4KDU A;  4TQ1 A;  4K2C A;  3I69 A;  2WW1 A;  4DM0 A;  4Q5N A;  1LOT A;  4FJC B;  2WVY A;  3IE3 A;  2KWF A;  4IBP A;  3MHS B;  2NTO A;  1GNI A;  4ZC6 A;  3IR4 A;  1YY7 A;  1HK1 A;  3SWL A;  3EE2 A;  2PER A;  3KXO A;  5IIH A;  3M1G A;  5J41 A;  3FR9 A;  2BXB A;  2HQT A;  4OFM A;  2BXG A;  1USB A;  5B7C A;  2VD0 A;  1XW6 A;  4KH7 A;  5FUO A;  2R6K A;  2D2Z A;  4GSS A;  2C4J A;  2CZ3 A;  3TOU A;  1IYH A;  2ON5 A;  4WA6 B;  4IKH A;  4O7H A;  17GS A;  1PA3 A;  4I97 A;  5D73 A;  2BXP A;  1G6W A;  1BAY A;  2GSS A;  3H3A A;  5IJE A;  1GTA A;  2AB6 A;  2C8U A;  2WZS A;  3D0Z A;  3ZMK A;  4DEJ A;  1E7C A;  3WHR A;  2FHE A;  5BMU B;  1K3O A;  2BXQ A;  6GSV A;  2I30 A;  3F6F A;  5DDL A;  2HRK A;  2K0N A;  2DBX A;  4G0K A;  1KBN A;  3ZML A;  2JUH A;  1XWG A;  1PX6 A;  2HSM B;  4MPG A;  20GS A;  1OE8 A;  4L8U A;  1GSE A;  6GSW A;  5DAL A;  3LQ7 A;  5F0G A;  2E0X A;  4N0V A;  1K0B A;  4OFT A;  2WVX B;  3G7I A;  2O36 A;  2Z8K A;  2DSA A;  4GDK B;  1M0U A;  3P90 A;  4E8H A;  2GST A;  1GTI A;  2ON7 A;  2IL3 A;  3AY8 A;  4N0F D;  5JCU A;  3PLA A;  1PL1 A;  3TOT A;  4ZB8 A;  1SVL A;  2CKX A;  1EV4 A;  4OR0 A;  3ICX A;  1U87 A;  1M9B A;  1M9A A;  4OFN A;  1LJR A;  4IW2 A;  4E8E A;  5A5K A;  1H5W A;  1J78 A;  3FYG A;  2IMI A;  4G0I A;  1Y1U A;  4AKG A;  2DBU A;  1YVL A;  4ZBK A;  3CX9 A;  1GLQ A;  1PL2 A;  4G0L A;  1BG5 A;  3M99 C;  5ELA A;  4F0B A;  7GSS A;  1G7O A;  3P8W A;  4KDX A;  3WD6 A;  2BXN A;  3M0F A;  2YV9 A;  3JRY A;  3KMO A;  2BXD A;  2GTU A;  5GST A;  4OTT A;  1BJ5 A;  1GUH A;  5ECH B;  3UIV A;  5ECM B;  2CZ2 A;  5J4Y A;  1GNJ A;  4LMW A;  4JBB A;  3Q74 A;  5IIU A;  4L5L A;  4IQA A;  3F6D A;  1FHE A;  1OKT A;  1YQ1 A;  2R3X A;  2C80 A;  4ZB7 A;  3VPQ A;  4GDF A;  1HK2 A;  2VCT A;  4AKX B;  2R4V A;  3LFL A;  1HK3 A;  4NHW A;  4HGM B;  4EC0 A;  4N3Z A;  3GQU A;  4ZBR A;  3TGZ A;  2DC5 A;  3O3T A;  2YCD A;  3V08 A;  5DJL A;  1HA2 A;  4ISD A;  2XSI A;  3KM6 A;  4Q5Q A;  3WHQ A;  3U6V A;  2QM6 A;  1GSU A;  4FK5 B;  1HK5 A;  4RI6 A;  2H1L A;  4HZ2 A;  5ECO B;  4ZBQ A;  1GSS A;  2WRT A;  5A4U A;  1MUS A;  5J47 A;  3LG6 A;  1RK4 A;  4G01 A;  5GIN A;  2N5F A;  5ECS A;  5AGY A;  4QMK A;  2XW1 A;  1KW2 A;  4OMV A;  1N2A A;  5HFK A;  5GSS A;  5JCW A;  3N9J A;  4GF0 A;  5A34 B;  4PUR A;  1JLV A;  3B9L A;  5ECP B;  2LXT A;  3GTU B;  2BXC A;  2CAQ A;  1VF3 A;  3MHH B;  3LSZ A;  1GTB A;  4MF5 A;  4IQ1 A;  2XMO A;  3CWG A;  4EXJ A;  1E6B A;  2HRA A;  1HNB A;  2LJR A;  3Q18 A;  3ERG A;  4IEL A;  5DAK B;  5IJ5 A;  4GCI A;  1GLP A;  3CBU A;  2BXK A;  2WW3 A;  1VZS A;  4JED A;  4USS A;  1E7B A;  5F06 A;  1XW5 A;  4MP4 A;  4PQI A;  2O5V A;  4IS0 A; 
#chains in the Genus database with same CATH homology
 1E78 A;  2A2R A;  4PGT A;  6GSU A;  2VKZ G;  2VO4 A;  2Z8I A;  5DAL B;  1PX7 A;  3CRT A;  3G7J A;  5AIV A;  14GS A;  3GST A;  1Q4J A;  2XVV A;  3TU3 B;  4RI7 A;  2GSQ A;  2KBZ A;  4O92 A;  5J4U A;  4DHX B;  4GDL B;  4EDY A;  1BG1 A;  1V2A A;  2WS2 A;  2BXA A;  5EVO A;  6GST A;  5F8B A;  1E7E A;  1VF1 A;  4F03 A;  3WHS A;  2PGT A;  4TQ0 A;  4ACS A;  3GUS A;  1R5A A;  1B4P A;  4GLT A;  1Y6E A;  16GS A;  3V09 A;  2VUE A;  6GSY A;  4ZB6 A;  3NMU A;  1GSY A;  1VF2 A;  3W1S A;  3HJM A;  4Q5F A;  1UOR A;  3L0H A;  3MDK A;  5ID9 A;  1AO6 A;  2WDU A;  2J9H A;  4BVX A;  1FOU A;  3F63 A;  5ECI B;  4LUF A;  2X64 A;  1F3A A;  2C3N A;  4GSN A;  1ZGN A;  5DJM A;  1E7F A;  4K0G A;  1LNS A;  4HGK A;  1JNB A;  1NT2 B;  1M99 A;  1JLW A;  3UBL A;  4IJI A;  3KJY A;  2QHB A;  5A4W A;  1H9Z A;  3PR8 A;  5D9W A;  4JK4 A;  1HNC A;  4BY9 C;  1HQO A;  4Q5R A;  4CHS A;  1TXU A;  3DGQ A;  3GH6 A;  3SIV B;  2YV7 A;  3IBH A;  2HSN B;  3G9K D;  1F3B A;  1OYJ A;  3PPU A;  4KSM A;  2VCZ A;  4PO0 A;  4K71 A;  1PMT A;  2E0Y A;  2ROH A;  5FHI A;  3IK9 A;  5D7G A;  3FR3 A;  3A73 A;  3LXZ A;  1B48 A;  4YAP A;  4GST A;  4MDC A;  1Z9H A;  3R2Q A;  2OAC A;  5IQY A;  4WR5 A;  4S1Y A;  4BVY B;  2OT3 A;  4K0N A;  1BKE A;  2DYO A;  4KF9 A;  5D9T A;  10GS A;  4HZ4 A;  3CRU A;  1O9X A;  1EV9 A;  3B9M A;  5BMU A;  1GNE A;  1E7H A;  1C72 A;  1PN9 A;  4MK3 A;  4OT2 A;  4TOP A;  3VI7 A;  3UAP A;  4C31 B;  5HOZ A;  1IYI A;  1MIY A;  1K0D A;  4QQ7 A;  5F07 A;  2QMC A;  2CA8 A;  2XVU A;  5AN1 A;  4AKH A;  5IJF A;  4F5T A;  1K3Y A;  1PKZ A;  5BPK A;  3KIK A;  5AIX A;  2WJU A;  3LU6 A;  1ML6 A;  3LYP A;  1IJG A;  3UAR A;  11GS A;  1K0A A;  3PGT A;  5ECR B;  1HK4 A;  4W4U B;  3H1N A;  1MIV A;  4OTU A;  5FT3 A;  5EL8 A;  2BX8 A;  3LYK A;  3NIV A;  3GUR A;  4PTS A;  3GA9 L;  4BL7 A;  4L9K A;  2AHE A;  4G03 A;  1AXD A;  4WR4 A;  4W66 A;  1YKC A;  4NAX A;  5B5T A;  5IFO A;  1GSF A;  1VF4 A;  1K0N A;  1AQX A;  1TW9 A;  5J5N A;  2GSR A;  4F5U A;  4ID0 A;  19GS A;  1MD3 A;  1SVO A;  3W8S A;  1N25 A;  4Z9O A;  3QAW A;  4KGI A;  2CVD A;  4YAV A;  5AIS A;  2BXI A;  1EEM A;  5J40 A;  3VQI A;  4F5V A;  4ECJ A;  18GS A;  4G9H A;  4MZW A;  3VWX A;  4ZB9 A;  2UZ8 A;  5DBY A;  1G6Y A;  4LB2 A;  4IVF A;  5ELG A;  4NAW B;  3LJR A;  2HNL A;  5FWG A;  1K0M A;  3TDL A;  4ZBB A;  4LA0 A;  2HRK B;  4G19 A;  4E99 A;  1VFI A;  3CSJ A;  4YH2 A;  4ZXG A;  4L5O A;  9GSS A;  4L9Q A;  4FQU A;  4BVX B;  1U3I A;  4AI6 A;  1U88 A;  4JZQ A;  4PX1 A;  1BM0 A;  2Z8J A;  3KTL A;  1AQW A;  3FY7 A;  3VI5 A;  3VK9 A;  1TF0 A;  4FIP B;  1E7I A;  4IW1 A;  1V40 A;  2GDR A;  4AKI A;  2VUF A;  5A5H A;  5A1N A;  1EOH A;  2AJE A;  2UV8 G;  13GS A;  3C8E A;  3HMJ G;  12GS A;  3HJO A;  3VLN A;  4N0U D;  4L8E A;  3GQX A;  2NNW A;  2OA7 A;  1GUL A;  5A34 A;  2PBJ A;  3M8N A;  4ECI A;  1DUG A;  3GTU A;  3KJL A;  5DQS A;  3UBK A;  1PGT A;  4EE0 A;  4YQV A;  3ERF A;  2OZB B;  4ZBD A;  2XVW A;  4LUH A;  4ZUX V;  1FW1 A;  3NVM A;  4F5S A;  3LU7 A;  3CSI A;  1GSD A;  5ECK B;  1AQV A;  2JL4 A;  4GTU A;  4M70 B;  2BXL A;  4NHZ A;  5KEJ A;  2DG5 A;  2VCW A;  5DAK A;  6GSS A;  1BYE A;  3GX0 A;  2V6K A;  3GSS A;  4ECC A;  1GTU A;  1YDK A;  3VPT A;  3H37 A;  1ZL9 A;  1E7A A;  3FRC A;  2XVQ A;  1KXP D;  2F3M A;  4MF7 A;  3FWB C;  5DQF A;  5EY6 A;  2DBW A;  4KX4 A;  3SQJ A;  2BXH A;  4MPF A;  3IK7 A;  4Z69 A;  1GWC A;  1MD4 A;  2EFE A;  1TU7 A;  3A75 A;  4IW9 A;  4HOJ A;  3DD3 A;  5GIP A;  2YDF A;  1PD2 1;  1GNW A;  6GSX A;  2C3Q A;  4PNF A;  3KMN A;  2EFD A;  1J7E A;  3QAG A;  3FNM A;  3RBT A;  2OAD A;  1N5U A;  5DCG A;  2BXO A;  4BL7 B;  3Q19 A;  1UA5 A;  4BKE A;  5F05 A;  1K0O A;  2AAW A;  4KAE A;  1MA9 A;  1TDI A;  1OE7 A;  3M3M A;  2LOQ A;  4ZCG A;  2CAI A;  2VD1 A;  1A0F A;  4GDX A;  3JQZ A;  2IMK A;  2R5G A;  3NVK A;  2EFH A;  2VCQ A;  3SIU B;  4PXO A;  2PVQ A;  2HSM A;  3BBY A;  1NHY A;  1E7G A;  4G10 A;  4LMV A;  1EOG A;  2F8F A;  1XWK A;  4GG2 A;  2PMT A;  3I6A A;  5A4V A;  5LCZ A;  3EIN A;  3QAV A;  2VCV A;  4PQH A;  4ECB A;  2NQO A;  3LXT A;  5LD0 A;  3FR6 A;  2I2Z A;  3QR6 A;  1K3L A;  1BX9 A;  5ECQ B;  4EDZ A;  5ECN B;  4MBE C;  4KDY A;  1MTC A;  5GHK A;  4IGJ A;  2VCX A;  2GLR A;  5ID7 A;  3CSH A;  5D9V A;  5GIO A;  2VDB A;  3LU8 A;  1K0C A;  1AW9 A;  1F2E A;  4E68 A;  2HSN A;  2BXM A;  1GSQ A;  4F0C A;  8GSS A;  2A2S A;  4HI7 A;  2EFC A;  3V03 A;  4PNG A;  3FWC C;  1TU8 A;  5GZZ B;  1BF5 A;  5G5E A;  4J2F A;  3ISO A;  4BVY A;  1YJ6 A;  1B8X A;  2DYM A;  5D9X A;  2XW0 A;  1LBK A;  3O76 A;  5A5H B;  5A1N B;  3NVI A;  3WYW A;  1SVM A;  3UVH A;  2V36 A;  4ZBA A;  5J4V A;  1GUK A;  3HKR A;  3R3E A;  1GUM A;  3ZFB A;  4J2V A;  3MAK A;  1PKW A;  3ZFL A;  4KE3 A;  2BXF A;  5G5F A;  2FNO A;  4MF6 A;  4YQU A;  4HJ2 A;  5ECL B;  4YQM A;  22GS A;  4AGS A;  2BXE A;  1MIW A;  3N5O A;  4G04 A;  4PUA A;  3VUR A;  4EMX A;  4LB9 A;  1HNA A;  5IIX A;  1JZR A;  2WB9 A;  3IC8 A;  2C3T A;  4KDU A;  4TQ1 A;  4K2C A;  3I69 A;  4Q5N A;  1LOT A;  4FJC B;  3IE3 A;  4IBP A;  3MHS B;  2NTO A;  1GNI A;  4ZC6 A;  3IR4 A;  1YY7 A;  1HK1 A;  3SWL A;  3EE2 A;  2PER A;  3KXO A;  5IIH A;  3M1G A;  5J41 A;  3FR9 A;  2BXB A;  2HQT A;  4OFM A;  2BXG A;  1USB A;  5B7C A;  2VD0 A;  1XW6 A;  4KH7 A;  5FUO A;  2R6K A;  2D2Z A;  4GSS A;  2C4J A;  2CZ3 A;  3TOU A;  1IYH A;  2ON5 A;  4WA6 B;  4IKH A;  4O7H A;  17GS A;  1PA3 A;  4I97 A;  5D73 A;  2BXP A;  1G6W A;  1BAY A;  2GSS A;  3H3A A;  5IJE A;  1GTA A;  2AB6 A;  2C8U A;  3D0Z A;  3ZMK A;  4DEJ A;  1E7C A;  3WHR A;  2FHE A;  5BMU B;  1K3O A;  2BXQ A;  6GSV A;  2I30 A;  3F6F A;  5DDL A;  2HRK A;  2DBX A;  4G0K A;  1KBN A;  3ZML A;  2JUH A;  1XWG A;  1PX6 A;  2HSM B;  4MPG A;  20GS A;  1OE8 A;  4L8U A;  1GSE A;  6GSW A;  5DAL A;  3LQ7 A;  5F0G A;  2E0X A;  4N0V A;  1K0B A;  4OFT A;  3G7I A;  2Z8K A;  2DSA A;  4GDK B;  1M0U A;  3P90 A;  4E8H A;  2GST A;  1GTI A;  2ON7 A;  2IL3 A;  3AY8 A;  4N0F D;  5JCU A;  3PLA A;  1PL1 A;  3TOT A;  4ZB8 A;  1SVL A;  2CKX A;  1EV4 A;  4OR0 A;  3ICX A;  1U87 A;  1M9B A;  1M9A A;  4OFN A;  1LJR A;  4IW2 A;  4E8E A;  5A5K A;  1H5W A;  1J78 A;  3FYG A;  2IMI A;  4G0I A;  1Y1U A;  4AKG A;  2DBU A;  1YVL A;  4ZBK A;  3CX9 A;  1GLQ A;  1PL2 A;  4G0L A;  1BG5 A;  3M99 C;  5ELA A;  4F0B A;  7GSS A;  1G7O A;  3P8W A;  4KDX A;  3WD6 A;  2BXN A;  3M0F A;  2YV9 A;  3JRY A;  3KMO A;  2BXD A;  2GTU A;  5GST A;  4OTT A;  1BJ5 A;  1GUH A;  5ECH B;  3UIV A;  5ECM B;  2CZ2 A;  5J4Y A;  1GNJ A;  4LMW A;  4JBB A;  3Q74 A;  5IIU A;  4L5L A;  4IQA A;  3F6D A;  1FHE A;  1OKT A;  1YQ1 A;  2R3X A;  2C80 A;  4ZB7 A;  3VPQ A;  4GDF A;  1HK2 A;  2VCT A;  4AKX B;  2R4V A;  3LFL A;  1HK3 A;  4NHW A;  4HGM B;  4EC0 A;  4N3Z A;  3GQU A;  4ZBR A;  3TGZ A;  2DC5 A;  3O3T A;  2YCD A;  3V08 A;  5DJL A;  1HA2 A;  4ISD A;  2XSI A;  3KM6 A;  4Q5Q A;  3WHQ A;  3U6V A;  2QM6 A;  1GSU A;  4FK5 B;  1HK5 A;  4RI6 A;  2H1L A;  4HZ2 A;  5ECO B;  4ZBQ A;  1GSS A;  2WRT A;  5A4U A;  5J47 A;  3LG6 A;  1RK4 A;  4G01 A;  5GIN A;  2N5F A;  5ECS A;  5AGY A;  4QMK A;  2XW1 A;  1KW2 A;  4OMV A;  1N2A A;  5HFK A;  5GSS A;  5JCW A;  3N9J A;  4GF0 A;  5A34 B;  4PUR A;  1JLV A;  3B9L A;  5ECP B;  3GTU B;  2BXC A;  2CAQ A;  1VF3 A;  3MHH B;  3LSZ A;  1GTB A;  4MF5 A;  4IQ1 A;  2XMO A;  3CWG A;  4EXJ A;  1E6B A;  2HRA A;  1HNB A;  2LJR A;  3Q18 A;  3ERG A;  4IEL A;  5DAK B;  5IJ5 A;  4GCI A;  1GLP A;  3CBU A;  2BXK A;  1VZS A;  4JED A;  4USS A;  1E7B A;  5F06 A;  1XW5 A;  4MP4 A;  4PQI A;  2O5V A;  4IS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...