1IJGA

Structure of the bacteriophage phi29 head-tail connector protein
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
257
Chain Sequence
SINEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNYRDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFLGIKDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords UPPER COLLAR PROTEIN
publication title Structure determination of the head-tail connector of bacteriophage phi29.
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 77
structure length 257
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05352 Phage_connector Phage Connector (GP10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.30 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1ijgA01
2.40.500.10 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) 1ijgA02
3.30.1350.20 Alpha Beta 2-Layer Sandwich Crambin Bacteriophage PHI-29 conector. Domain 3 1ijgA03
1FOUA 1H5WA 1IJGA 1JNBA
chains in the Genus database with same CATH superfamily
5ID7A 2I30A 4TQ0A 2Z8IA 3KDRA 2QHBA 4BKEA 1GN4A 1ORLA 2BXFA 1MIWA 1E78A 2K0NA 1O9XA 2AGHB 1PM9A 3DC6A 3V09A 1WB8A 2DYOA 1GNJA 4L9KA 1KW2A 5DQFA 3OT7A 1AR4A 4F5UA 4JK4A 1E7AA 3V08A 1JR9A 4TQ1A 5D7GA 3WHQA 2BXIA 2CE4A 1E7EA 1PL4A 4MBEC 1VFIA 1BT8A 3SZSA 1J78A 4K2CA 1BKEA 3JRYA 3TDLA 4E99A 3SQJA 2EFHA 4OR0A 2VUFA 3UE7B 4C31B 4IW1A 1IJGA 2XMOA 1EN5A 4N0FD 1E7GA 1XILA 3PLAA 2XVWA 2KBZA 1P7GA 2VDBA 2EFDA 1BHPA 5IIUA 2BXQA 3DC5A 1LUVA 1AVMA 1XREA 1BM0A 2Z8JA 1LNSA 4L9QA 3BFRA 4WA6B 1J7EA 2XW1A 2LQHA 2V9BA 2BXAA 4ZCGA 1WUWA 2BXKA 4EMXA 1ZSPA 2BXLA 1E7CA 5GINA 2BXPA 1JXYA 4IW2A 2BXCA 5IJEA 4FC1A 3CX9A 3NVMA 3CEIA 3KKYA 2BXBA 1GN2A 4FIPB 5IIHA 3FNMA 3KJLA 1E7BA 4LA0A 3M99C 3MDSA 3V03A 2AJEA 4FJCB 5ID9A 1VARA 4JZ2A 2CDYA 1AP6A 4ZUXV 2JUHA 4GG2A 4ZBKA 4BY9C 3K9SA 3FWBC 3ECPA 3U7TA 4DHXB 4Z69A 2GDSA 1D5NA 1QNMA 2OZBB 5HOZA 3RN4A 1MSDA 1GNIA 2XVUA 3GQUA 5IJ5A 1OKHA 1IDSA 1N5UA 4G03A 2E0YA 4LUHA 3SIVB 3EVKA 1KDXA 3C8PA 3FWCC 3SIUB 4ZBRA 1EM1A 4BR6A 3JQZA 2E0XA 5AG2A 5BPKA 5GIPA 1MUSA 2VUEA 1BJ5A 3C3SA 4JYYA 1MIYA 1UORA 2LOQA 4GDXA 3ICXA 1CXRA 5IIXA 1B06A 1ED0A 1MMMA 4F6EA 2EFEA 1Y67A 3B9MA 4OTUA 3MHSB 2DG5A 2V36A 4DM0A 5B5TA 4X9QA 1JXXA 3LU6A 2ADPA 4C7UA 2QM6A 4ZBQA 3H37A 4NAWB 2LXTA 2NNWA 1EJGA 1MNGA 1HK5A 3BPJA 2ROHA 4GUNA 5GHKA 1MM8A 1EN4A 1JXTA 2BXDA 1JXWA 2EYBA 1BS3A 5A9GA 1AB1A 1VZSA 4FK5B 1I0HA 2BXOA 1LUWA 1HK1A 5GIOA 2EYDA 2XVQA 2BXGA 1AR5A 1ZTEA 4PO0A 1AO6A 2AW9A 1N0JA 4N3ZA 2DBUA 3LSUA 2BXMA 4HGMB 4Z9OA 2CKXA 1CNRA 1JMPA 4F5VA 2OT3A 4LB2A 4N0UD 1BSMA 1KXPD 3LU7A 1IXBA 3AK2A 3W1SA 3KIKA 1WB7A 1H5WA 1SB0A 3A73A 1MIVA 1I08A 1XDCA 1JXUA 2QKAA 1H9ZA 1VEWA 3B9LA 1HK4A 2YDFA 4JZGA 3TJTA 1SZXA 1GN3A 2GUTA 4FFKA 1CCMA 2DYMA 4HGKA 1E7FA 1E7HA 2I2ZA 3AK3A 3GQXA 3H3AA 3NMUA 1CCNA 4GDKB 1CRNA 3QVNA 4D7XA 5DBYA 2BX8A 2BXEA 4LUFA 4YIPA 4F5SA 4GDLB 2KWFA 2FD7A 1NT2B 1JMNA 5IFOA 5FUOA 4J2VA 4K71A 2QKCA 4G04A 3GA9L 3NIRA 3MHHB 1AP5A 2LQIA 2EYAA 1MA9A 3UIVA 4W4UB 1YV8A 1TXUA 1NBLA 3A75A 3NVIA 4YIOA 1JA8A 4E4EA 1N0NA 1MUHA 4LB9A 3C3TA 3G9KD 4L8UA 2FD9A 2BXNA 2NQOA 4G01A 1ZUQA 2EFCA 2PLHA 2XVVA 4OTTA 2ADQB 1IX9A 4OT2A 4M70B 3WHRA 1YVAA 4I9OA 2BXHA 2DBWA 2RCVA 1HK3A 2QMCA 2XSIA 2DBXA 2Z8KA 4ZC6A 4F5TA 3AK1A 1LOTA 1HK2A 3LU8A 5IJFA 1HA2A 2XW0A 1MA1A 1GN6A 2LXSA 2EYCA 4S1YA 2P4KA 3WHSA 1CBNA 1ZLZA 1KKCA 1FOUA 1TF0A 3NVKA 1EN6A 1E7IA 3VQIA 1JNBA 1XUQA
chains in the Genus database with same CATH topology
5ID7A 4OTUA 3MHSB 2I30A 4EMXA 2DG5A 4TQ0A 2V36A 2Z8IA 2BXLA 2QHBA 4BKEA 5B5TA 5DBYA 2BX8A 3LU6A 1E7CA 2BXFA 2BXEA 5GINA 2BXPA 4LUFA 2QM6A 1MIWA 4IW2A 4ZBQA 4F5SA 4GDLB 2BXCA 3H37A 4NAWB 5IJEA 3CX9A 1E78A 2NNWA 3NVMA 2BXBA 1NT2B 1O9XA 5IFOA 5FUOA 4J2VA 4K71A 4G04A 4FIPB 1HK5A 5IIHA 3V09A 3FNMA 3GA9L 3KJLA 1E7BA 4LA0A 2ROHA 3M99C 5GHKA 3MHHB 2DYOA 1GNJA 3V03A 2BXDA 2AJEA 4L9KA 1KW2A 5DQFA 4FJCB 5ID9A 1MA9A 3UIVA 1VZSA 4W4UB 4FK5B 4F5UA 1TXUA 4JK4A 1E7AA 4ZUXV 3V08A 2BXOA 1HK1A 2JUHA 4TQ1A 5GIOA 3A75A 3NVIA 4GG2A 5D7GA 3WHQA 4ZBKA 4BY9C 2BXIA 2XVQA 3FWBC 1E7EA 2BXGA 4LB9A 4DHXB 3G9KD 4MBEC 1VFIA 4Z69A 1J78A 4K2CA 1BKEA 4L8UA 2BXNA 4PO0A 2OZBB 1AO6A 2NQOA 3JRYA 4G01A 4N3ZA 2DBUA 5HOZA 2BXMA 3TDLA 4HGMB 2EFCA 4Z9OA 2XVVA 1GNIA 2CKXA 2XVUA 4E99A 3GQUA 4OTTA 5IJ5A 3SQJA 4F5VA 4OT2A 2OT3A 4LB2A 4M70B 3SIUB 4N0UD 1KXPD 2EFHA 1N5UA 4OR0A 4G03A 2VUFA 3LU7A 3WHRA 2E0YA 4LUHA 3SIVB 2BXHA 2DBWA 1HK3A 4C31B 2QMCA 2XSIA 4IW1A 2DBXA 2Z8KA 1IJGA 2XMOA 3FWCC 4N0FD 4ZC6A 4F5TA 1E7GA 1LOTA 3W1SA 1HK2A 3KIKA 3LU8A 3PLAA 4ZBRA 1H5WA 5IJFA 2XVWA 2KBZA 2VDBA 1HA2A 2EFDA 3A73A 3JQZA 1MIVA 2E0XA 2BXQA 5IIUA 2XW0A 5BPKA 4S1YA 1H9ZA 5GIPA 2VUEA 1BM0A 3B9LA 1BJ5A 1HK4A 2Z8JA 1LNSA 2YDFA 4L9QA 4WA6B 3WHSA 1MIYA 1UORA 1J7EA 1FOUA 1TF0A 2LOQA 2XW1A 3ICXA 4GDXA 3NVKA 2DYMA 4HGKA 1E7FA 1E7HA 2I2ZA 1E7IA 5IIXA 3VQIA 2BXAA 3GQXA 2EFEA 4ZCGA 3H3AA 1JNBA 3NMUA 4GDKB 2BXKA 3B9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOU A;  1H5W A;  1IJG A;  1JNB A; 
#chains in the Genus database with same CATH topology
 5ID7 A;  2I30 A;  4TQ0 A;  2Z8I A;  3KDR A;  2QHB A;  4BKE A;  1GN4 A;  1ORL A;  2BXF A;  1MIW A;  1E78 A;  2K0N A;  1O9X A;  2AGH B;  1PM9 A;  3DC6 A;  3V09 A;  1WB8 A;  2DYO A;  1GNJ A;  4L9K A;  1KW2 A;  5DQF A;  3OT7 A;  1AR4 A;  4F5U A;  4JK4 A;  1E7A A;  3V08 A;  1JR9 A;  4TQ1 A;  5D7G A;  3WHQ A;  2BXI A;  2CE4 A;  1E7E A;  1PL4 A;  4MBE C;  1VFI A;  1BT8 A;  3SZS A;  1J78 A;  4K2C A;  1BKE A;  3JRY A;  3TDL A;  4E99 A;  3SQJ A;  2EFH A;  4OR0 A;  2VUF A;  3UE7 B;  4C31 B;  4IW1 A;  1IJG A;  2XMO A;  1EN5 A;  4N0F D;  1E7G A;  1XIL A;  3PLA A;  2XVW A;  2KBZ A;  1P7G A;  2VDB A;  2EFD A;  1BHP A;  5IIU A;  2BXQ A;  3DC5 A;  1LUV A;  1AVM A;  1XRE A;  1BM0 A;  2Z8J A;  1LNS A;  4L9Q A;  3BFR A;  4WA6 B;  1J7E A;  2XW1 A;  2LQH A;  2V9B A;  2BXA A;  4ZCG A;  1WUW A;  2BXK A;  4EMX A;  1ZSP A;  2BXL A;  1E7C A;  5GIN A;  2BXP A;  1JXY A;  4IW2 A;  2BXC A;  5IJE A;  4FC1 A;  3CX9 A;  3NVM A;  3CEI A;  3KKY A;  2BXB A;  1GN2 A;  4FIP B;  5IIH A;  3FNM A;  3KJL A;  1E7B A;  4LA0 A;  3M99 C;  3MDS A;  3V03 A;  2AJE A;  4FJC B;  5ID9 A;  1VAR A;  4JZ2 A;  2CDY A;  1AP6 A;  4ZUX V;  2JUH A;  4GG2 A;  4ZBK A;  4BY9 C;  3K9S A;  3FWB C;  3ECP A;  3U7T A;  4DHX B;  4Z69 A;  2GDS A;  1D5N A;  1QNM A;  2OZB B;  5HOZ A;  3RN4 A;  1MSD A;  1GNI A;  2XVU A;  3GQU A;  5IJ5 A;  1OKH A;  1IDS A;  1N5U A;  4G03 A;  2E0Y A;  4LUH A;  3SIV B;  3EVK A;  1KDX A;  3C8P A;  3FWC C;  3SIU B;  4ZBR A;  1EM1 A;  4BR6 A;  3JQZ A;  2E0X A;  5AG2 A;  5BPK A;  5GIP A;  1MUS A;  2VUE A;  1BJ5 A;  3C3S A;  4JYY A;  1MIY A;  1UOR A;  2LOQ A;  4GDX A;  3ICX A;  1CXR A;  5IIX A;  1B06 A;  1ED0 A;  1MMM A;  4F6E A;  2EFE A;  1Y67 A;  3B9M A;  4OTU A;  3MHS B;  2DG5 A;  2V36 A;  4DM0 A;  5B5T A;  4X9Q A;  1JXX A;  3LU6 A;  2ADP A;  4C7U A;  2QM6 A;  4ZBQ A;  3H37 A;  4NAW B;  2LXT A;  2NNW A;  1EJG A;  1MNG A;  1HK5 A;  3BPJ A;  2ROH A;  4GUN A;  5GHK A;  1MM8 A;  1EN4 A;  1JXT A;  2BXD A;  1JXW A;  2EYB A;  1BS3 A;  5A9G A;  1AB1 A;  1VZS A;  4FK5 B;  1I0H A;  2BXO A;  1LUW A;  1HK1 A;  5GIO A;  2EYD A;  2XVQ A;  2BXG A;  1AR5 A;  1ZTE A;  4PO0 A;  1AO6 A;  2AW9 A;  1N0J A;  4N3Z A;  2DBU A;  3LSU A;  2BXM A;  4HGM B;  4Z9O A;  2CKX A;  1CNR A;  1JMP A;  4F5V A;  2OT3 A;  4LB2 A;  4N0U D;  1BSM A;  1KXP D;  3LU7 A;  1IXB A;  3AK2 A;  3W1S A;  3KIK A;  1WB7 A;  1H5W A;  1SB0 A;  3A73 A;  1MIV A;  1I08 A;  1XDC A;  1JXU A;  2QKA A;  1H9Z A;  1VEW A;  3B9L A;  1HK4 A;  2YDF A;  4JZG A;  3TJT A;  1SZX A;  1GN3 A;  2GUT A;  4FFK A;  1CCM A;  2DYM A;  4HGK A;  1E7F A;  1E7H A;  2I2Z A;  3AK3 A;  3GQX A;  3H3A A;  3NMU A;  1CCN A;  4GDK B;  1CRN A;  3QVN A;  4D7X A;  5DBY A;  2BX8 A;  2BXE A;  4LUF A;  4YIP A;  4F5S A;  4GDL B;  2KWF A;  2FD7 A;  1NT2 B;  1JMN A;  5IFO A;  5FUO A;  4J2V A;  4K71 A;  2QKC A;  4G04 A;  3GA9 L;  3NIR A;  3MHH B;  1AP5 A;  2LQI A;  2EYA A;  1MA9 A;  3UIV A;  4W4U B;  1YV8 A;  1TXU A;  1NBL A;  3A75 A;  3NVI A;  4YIO A;  1JA8 A;  4E4E A;  1N0N A;  1MUH A;  4LB9 A;  3C3T A;  3G9K D;  4L8U A;  2FD9 A;  2BXN A;  2NQO A;  4G01 A;  1ZUQ A;  2EFC A;  2PLH A;  2XVV A;  4OTT A;  2ADQ B;  1IX9 A;  4OT2 A;  4M70 B;  3WHR A;  1YVA A;  4I9O A;  2BXH A;  2DBW A;  2RCV A;  1HK3 A;  2QMC A;  2XSI A;  2DBX A;  2Z8K A;  4ZC6 A;  4F5T A;  3AK1 A;  1LOT A;  1HK2 A;  3LU8 A;  5IJF A;  1HA2 A;  2XW0 A;  1MA1 A;  1GN6 A;  2LXS A;  2EYC A;  4S1Y A;  2P4K A;  3WHS A;  1CBN A;  1ZLZ A;  1KKC A;  1FOU A;  1TF0 A;  3NVK A;  1EN6 A;  1E7I A;  3VQI A;  1JNB A;  1XUQ A; 
#chains in the Genus database with same CATH homology
 5ID7 A;  4OTU A;  3MHS B;  2I30 A;  4EMX A;  2DG5 A;  4TQ0 A;  2V36 A;  2Z8I A;  2BXL A;  2QHB A;  4BKE A;  5B5T A;  5DBY A;  2BX8 A;  3LU6 A;  1E7C A;  2BXF A;  2BXE A;  5GIN A;  2BXP A;  4LUF A;  2QM6 A;  1MIW A;  4IW2 A;  4ZBQ A;  4F5S A;  4GDL B;  2BXC A;  3H37 A;  4NAW B;  5IJE A;  3CX9 A;  1E78 A;  2NNW A;  3NVM A;  2BXB A;  1NT2 B;  1O9X A;  5IFO A;  5FUO A;  4J2V A;  4K71 A;  4G04 A;  4FIP B;  1HK5 A;  5IIH A;  3V09 A;  3FNM A;  3GA9 L;  3KJL A;  1E7B A;  4LA0 A;  2ROH A;  3M99 C;  5GHK A;  3MHH B;  2DYO A;  1GNJ A;  3V03 A;  2BXD A;  2AJE A;  4L9K A;  1KW2 A;  5DQF A;  4FJC B;  5ID9 A;  1MA9 A;  3UIV A;  1VZS A;  4W4U B;  4FK5 B;  4F5U A;  1TXU A;  4JK4 A;  1E7A A;  4ZUX V;  3V08 A;  2BXO A;  1HK1 A;  2JUH A;  4TQ1 A;  5GIO A;  3A75 A;  3NVI A;  4GG2 A;  5D7G A;  3WHQ A;  4ZBK A;  4BY9 C;  2BXI A;  2XVQ A;  3FWB C;  1E7E A;  2BXG A;  4LB9 A;  4DHX B;  3G9K D;  4MBE C;  1VFI A;  4Z69 A;  1J78 A;  4K2C A;  1BKE A;  4L8U A;  2BXN A;  4PO0 A;  2OZB B;  1AO6 A;  2NQO A;  3JRY A;  4G01 A;  4N3Z A;  2DBU A;  5HOZ A;  2BXM A;  3TDL A;  4HGM B;  2EFC A;  4Z9O A;  2XVV A;  1GNI A;  2CKX A;  2XVU A;  4E99 A;  3GQU A;  4OTT A;  5IJ5 A;  3SQJ A;  4F5V A;  4OT2 A;  2OT3 A;  4LB2 A;  4M70 B;  3SIU B;  4N0U D;  1KXP D;  2EFH A;  1N5U A;  4OR0 A;  4G03 A;  2VUF A;  3LU7 A;  3WHR A;  2E0Y A;  4LUH A;  3SIV B;  2BXH A;  2DBW A;  1HK3 A;  4C31 B;  2QMC A;  2XSI A;  4IW1 A;  2DBX A;  2Z8K A;  1IJG A;  2XMO A;  3FWC C;  4N0F D;  4ZC6 A;  4F5T A;  1E7G A;  1LOT A;  3W1S A;  1HK2 A;  3KIK A;  3LU8 A;  3PLA A;  4ZBR A;  1H5W A;  5IJF A;  2XVW A;  2KBZ A;  2VDB A;  1HA2 A;  2EFD A;  3A73 A;  3JQZ A;  1MIV A;  2E0X A;  2BXQ A;  5IIU A;  2XW0 A;  5BPK A;  4S1Y A;  1H9Z A;  5GIP A;  2VUE A;  1BM0 A;  3B9L A;  1BJ5 A;  1HK4 A;  2Z8J A;  1LNS A;  2YDF A;  4L9Q A;  4WA6 B;  3WHS A;  1MIY A;  1UOR A;  1J7E A;  1FOU A;  1TF0 A;  2LOQ A;  2XW1 A;  3ICX A;  4GDX A;  3NVK A;  2DYM A;  4HGK A;  1E7F A;  1E7H A;  2I2Z A;  1E7I A;  5IIX A;  3VQI A;  2BXA A;  3GQX A;  2EFE A;  4ZCG A;  3H3A A;  1JNB A;  3NMU A;  4GDK B;  2BXK A;  3B9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...