3WHRA

Crystal structure of gamma-glutamyltranspeptidase from bacillus subtilis (crystal soaked for 3min. in acivicin soln. )
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
359
structure length
359
Chain Sequence
EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-glutamyltranspeptidase large chain
publication title Structure of Bacillus subtilis gamma-glutamyl-transpeptidase in complex with acivicin: diversity of the binding mode of a classical and electrophilic active-site-directed glutamate analogue
doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase, transferase
total genus 108
structure length 359
sequence length 359
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3whrA02
2Z8IA 4OTTA 3A75A 2DBWA 3FNMA 2Z8JA 3WHQA 5BPKA 2NQOA 2DBUA 4ZCGA 4ZC6A 4ZBKA 4Z9OA 5B5TA 4GG2A 3WHRA 3WHSA 2E0YA 2E0XA 2QM6A 2Z8KA 2DG5A 4OTUA 2QMCA 2DBXA 2V36A 4GDXA
chains in the Genus database with same CATH superfamily
2BXGA 2BXKA 2CKXA 3GQXA 1VZSA 2BXBA 3FWBC 1LNSA 1MUSA 5IJEA 1J7EA 4OT2A 4FJCB 4ZUXV 1J78A 4PO0A 4ZCGA 5GINA 4ZC6A 4OR0A 3SIUB 2BXPA 4E99A 1HA2A 2VUEA 4G04A 1E7BA 5HOZA 2XVUA 3SQJA 2XSIA 3FWCC 3W1SA 3WHRA 4BY9C 1HK3A 1E7IA 2BXFA 1KW2A 3A73A 1IJGA 4I9OA 4FK5B 3NVIA 5GIPA 2XW1A 2NNWA 1MIYA 2YDFA 1E7FA 4LB2A 2BXAA 2QMCA 3GA9L 3UIVA 1FOUA 2AGHB 2BXNA 4F5VA 5IFOA 4LUHA 2DYMA 3V03A 3SIVB 1E7EA 2Z8IA 1UORA 2BXIA 2EFDA 3H37A 4BKEA 2VUFA 1HK2A 2BXEA 2XVQA 3ICXA 1E7HA 2EFHA 2Z8JA 5IIUA 1MM8A 1E7CA 5BPKA 3M99C 3MHHB 4W4UB 1NT2B 2KWFA 1N5UA 4FIPB 5IIHA 3V09A 3LU6A 2XVVA 4L9KA 2KBZA 4LUFA 4TQ1A 2LXSA 4S1YA 1AO6A 2XVWA 1E78A 1BM0A 3WHSA 2E0YA 4C31B 5D7GA 2OT3A 5GIOA 2JUHA 1HK5A 2K0NA 4OTUA 3NVKA 1H5WA 1BKEA 2EFEA 4LB9A 2DBXA 1JNBA 2V36A 1LOTA 2XW0A 5IJ5A 4NAWB 1H9ZA 5IJFA 2OZBB 4GDLB 4J2VA 4M70B 5ID9A 4N0UD 4IW2A 3WHQA 3KIKA 5IIXA 1KXPD 4HGKA 4Z69A 3BPJA 4F5UA 4GDKB 3VQIA 4G01A 3JQZA 2BXOA 3G9KD 5GHKA 3NMUA 2BXDA 4K71A 4F5TA 4DHXB 4LA0A 4ZBKA 4WA6B 5B5TA 2I30A 1O9XA 1VFIA 1GNJA 2Z8KA 1HK4A 2DG5A 1BJ5A 1MA9A 2LQIA 3MHSB 1MIWA 4DM0A 1TXUA 1MUHA 2GUTA 3GQUA 2BX8A 3NVMA 4ZBRA 4G03A 4GDXA 3KJLA 3TDLA 2QHBA 4OTTA 4L8UA 3CX9A 2I2ZA 3A75A 2DBWA 3ECPA 1GNIA 2LQHA 2VDBA 1SB0A 2BXMA 2BXQA 3FNMA 4JK4A 5DBYA 2LOQA 3B9MA 2BXHA 2NQOA 3H3AA 2DBUA 4F5SA 3V08A 4K2CA 4ZBQA 4HGMB 2BXCA 4TQ0A 2XMOA 3PLAA 1KDXA 4IW1A 4N3ZA 4Z9OA 4GG2A 5FUOA 4D7XA 3LU7A 2E0XA 2QM6A 2AJEA 1MIVA 2EFCA 4MBEC 3B9LA 3JRYA 2ROHA 1E7GA 5ID7A 4L9QA 3LU8A 2DYOA 4N0FD 1E7AA 5DQFA 2BXLA 2LXTA 4EMXA 1TF0A 1HK1A
chains in the Genus database with same CATH topology
2BXGA 2BXKA 2CKXA 3GQXA 1VZSA 2BXBA 3FWBC 1LNSA 5IJEA 1J7EA 4OT2A 4FJCB 4ZUXV 1J78A 4PO0A 4ZCGA 5GINA 4ZC6A 4OR0A 3SIUB 2BXPA 4E99A 1HA2A 2VUEA 4G04A 1E7BA 5HOZA 2XVUA 3SQJA 2XSIA 3FWCC 3W1SA 3WHRA 4BY9C 1HK3A 1E7IA 2BXFA 1KW2A 3A73A 1IJGA 4FK5B 3NVIA 5GIPA 2XW1A 2NNWA 1MIYA 2YDFA 1E7FA 4LB2A 2BXAA 2QMCA 3GA9L 3UIVA 1FOUA 2BXNA 4F5VA 5IFOA 4LUHA 2DYMA 3V03A 3SIVB 1E7EA 2Z8IA 1UORA 2BXIA 2EFDA 3H37A 4BKEA 2VUFA 1HK2A 2BXEA 2XVQA 3ICXA 1E7HA 2EFHA 2Z8JA 5IIUA 1E7CA 5BPKA 3M99C 3MHHB 4W4UB 1NT2B 1N5UA 4FIPB 5IIHA 3V09A 3LU6A 2XVVA 4L9KA 2KBZA 4LUFA 4TQ1A 4S1YA 1AO6A 2XVWA 1E78A 1BM0A 3WHSA 2E0YA 4C31B 5D7GA 2OT3A 5GIOA 2JUHA 1HK5A 4OTUA 3NVKA 1H5WA 1BKEA 2EFEA 4LB9A 2DBXA 1JNBA 2V36A 1LOTA 2XW0A 5IJ5A 4NAWB 1H9ZA 5IJFA 2OZBB 4GDLB 4J2VA 4M70B 5ID9A 4N0UD 4IW2A 3WHQA 3KIKA 5IIXA 1KXPD 4Z69A 4F5UA 4GDKB 3VQIA 4G01A 3JQZA 2BXOA 3G9KD 5GHKA 3NMUA 2BXDA 4K71A 4F5TA 4DHXB 4LA0A 4ZBKA 4WA6B 5B5TA 2I30A 1O9XA 1VFIA 1GNJA 2Z8KA 1HK4A 2DG5A 1BJ5A 1MA9A 3MHSB 1MIWA 1TXUA 3GQUA 3NVMA 2BX8A 4ZBRA 4G03A 4GDXA 3KJLA 3TDLA 2QHBA 4OTTA 4L8UA 3CX9A 2I2ZA 3A75A 2DBWA 1GNIA 2VDBA 5DBYA 2BXMA 2BXQA 3FNMA 4JK4A 2LOQA 3B9MA 2BXHA 2NQOA 3H3AA 2DBUA 4F5SA 3V08A 4K2CA 4ZBQA 4HGMB 2BXCA 4TQ0A 2XMOA 3PLAA 4IW1A 4N3ZA 4Z9OA 4GG2A 5FUOA 3LU7A 2E0XA 2QM6A 2AJEA 1MIVA 2EFCA 4MBEC 3B9LA 3JRYA 2ROHA 1E7GA 5ID7A 4L9QA 3LU8A 2DYOA 4N0FD 1E7AA 5DQFA 2BXLA 4HGKA 4EMXA 1TF0A 1HK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8I A;  4OTT A;  3A75 A;  2DBW A;  3FNM A;  2Z8J A;  3WHQ A;  5BPK A;  2NQO A;  2DBU A;  4ZCG A;  4ZC6 A;  4ZBK A;  4Z9O A;  5B5T A;  4GG2 A;  3WHR A;  3WHS A;  2E0Y A;  2E0X A;  2QM6 A;  2Z8K A;  2DG5 A;  4OTU A;  2QMC A;  2DBX A;  2V36 A;  4GDX A; 
#chains in the Genus database with same CATH topology
 2BXG A;  2BXK A;  2CKX A;  3GQX A;  1VZS A;  2BXB A;  3FWB C;  1LNS A;  1MUS A;  5IJE A;  1J7E A;  4OT2 A;  4FJC B;  4ZUX V;  1J78 A;  4PO0 A;  4ZCG A;  5GIN A;  4ZC6 A;  4OR0 A;  3SIU B;  2BXP A;  4E99 A;  1HA2 A;  2VUE A;  4G04 A;  1E7B A;  5HOZ A;  2XVU A;  3SQJ A;  2XSI A;  3FWC C;  3W1S A;  3WHR A;  4BY9 C;  1HK3 A;  1E7I A;  2BXF A;  1KW2 A;  3A73 A;  1IJG A;  4I9O A;  4FK5 B;  3NVI A;  5GIP A;  2XW1 A;  2NNW A;  1MIY A;  2YDF A;  1E7F A;  4LB2 A;  2BXA A;  2QMC A;  3GA9 L;  3UIV A;  1FOU A;  2AGH B;  2BXN A;  4F5V A;  5IFO A;  4LUH A;  2DYM A;  3V03 A;  3SIV B;  1E7E A;  2Z8I A;  1UOR A;  2BXI A;  2EFD A;  3H37 A;  4BKE A;  2VUF A;  1HK2 A;  2BXE A;  2XVQ A;  3ICX A;  1E7H A;  2EFH A;  2Z8J A;  5IIU A;  1MM8 A;  1E7C A;  5BPK A;  3M99 C;  3MHH B;  4W4U B;  1NT2 B;  2KWF A;  1N5U A;  4FIP B;  5IIH A;  3V09 A;  3LU6 A;  2XVV A;  4L9K A;  2KBZ A;  4LUF A;  4TQ1 A;  2LXS A;  4S1Y A;  1AO6 A;  2XVW A;  1E78 A;  1BM0 A;  3WHS A;  2E0Y A;  4C31 B;  5D7G A;  2OT3 A;  5GIO A;  2JUH A;  1HK5 A;  2K0N A;  4OTU A;  3NVK A;  1H5W A;  1BKE A;  2EFE A;  4LB9 A;  2DBX A;  1JNB A;  2V36 A;  1LOT A;  2XW0 A;  5IJ5 A;  4NAW B;  1H9Z A;  5IJF A;  2OZB B;  4GDL B;  4J2V A;  4M70 B;  5ID9 A;  4N0U D;  4IW2 A;  3WHQ A;  3KIK A;  5IIX A;  1KXP D;  4HGK A;  4Z69 A;  3BPJ A;  4F5U A;  4GDK B;  3VQI A;  4G01 A;  3JQZ A;  2BXO A;  3G9K D;  5GHK A;  3NMU A;  2BXD A;  4K71 A;  4F5T A;  4DHX B;  4LA0 A;  4ZBK A;  4WA6 B;  5B5T A;  2I30 A;  1O9X A;  1VFI A;  1GNJ A;  2Z8K A;  1HK4 A;  2DG5 A;  1BJ5 A;  1MA9 A;  2LQI A;  3MHS B;  1MIW A;  4DM0 A;  1TXU A;  1MUH A;  2GUT A;  3GQU A;  2BX8 A;  3NVM A;  4ZBR A;  4G03 A;  4GDX A;  3KJL A;  3TDL A;  2QHB A;  4OTT A;  4L8U A;  3CX9 A;  2I2Z A;  3A75 A;  2DBW A;  3ECP A;  1GNI A;  2LQH A;  2VDB A;  1SB0 A;  2BXM A;  2BXQ A;  3FNM A;  4JK4 A;  5DBY A;  2LOQ A;  3B9M A;  2BXH A;  2NQO A;  3H3A A;  2DBU A;  4F5S A;  3V08 A;  4K2C A;  4ZBQ A;  4HGM B;  2BXC A;  4TQ0 A;  2XMO A;  3PLA A;  1KDX A;  4IW1 A;  4N3Z A;  4Z9O A;  4GG2 A;  5FUO A;  4D7X A;  3LU7 A;  2E0X A;  2QM6 A;  2AJE A;  1MIV A;  2EFC A;  4MBE C;  3B9L A;  3JRY A;  2ROH A;  1E7G A;  5ID7 A;  4L9Q A;  3LU8 A;  2DYO A;  4N0F D;  1E7A A;  5DQF A;  2BXL A;  2LXT A;  4EMX A;  1TF0 A;  1HK1 A; 
#chains in the Genus database with same CATH homology
 2BXG A;  2BXK A;  2CKX A;  3GQX A;  1VZS A;  2BXB A;  3FWB C;  1LNS A;  5IJE A;  1J7E A;  4OT2 A;  4FJC B;  4ZUX V;  1J78 A;  4PO0 A;  4ZCG A;  5GIN A;  4ZC6 A;  4OR0 A;  3SIU B;  2BXP A;  4E99 A;  1HA2 A;  2VUE A;  4G04 A;  1E7B A;  5HOZ A;  2XVU A;  3SQJ A;  2XSI A;  3FWC C;  3W1S A;  3WHR A;  4BY9 C;  1HK3 A;  1E7I A;  2BXF A;  1KW2 A;  3A73 A;  1IJG A;  4FK5 B;  3NVI A;  5GIP A;  2XW1 A;  2NNW A;  1MIY A;  2YDF A;  1E7F A;  4LB2 A;  2BXA A;  2QMC A;  3GA9 L;  3UIV A;  1FOU A;  2BXN A;  4F5V A;  5IFO A;  4LUH A;  2DYM A;  3V03 A;  3SIV B;  1E7E A;  2Z8I A;  1UOR A;  2BXI A;  2EFD A;  3H37 A;  4BKE A;  2VUF A;  1HK2 A;  2BXE A;  2XVQ A;  3ICX A;  1E7H A;  2EFH A;  2Z8J A;  5IIU A;  1E7C A;  5BPK A;  3M99 C;  3MHH B;  4W4U B;  1NT2 B;  1N5U A;  4FIP B;  5IIH A;  3V09 A;  3LU6 A;  2XVV A;  4L9K A;  2KBZ A;  4LUF A;  4TQ1 A;  4S1Y A;  1AO6 A;  2XVW A;  1E78 A;  1BM0 A;  3WHS A;  2E0Y A;  4C31 B;  5D7G A;  2OT3 A;  5GIO A;  2JUH A;  1HK5 A;  4OTU A;  3NVK A;  1H5W A;  1BKE A;  2EFE A;  4LB9 A;  2DBX A;  1JNB A;  2V36 A;  1LOT A;  2XW0 A;  5IJ5 A;  4NAW B;  1H9Z A;  5IJF A;  2OZB B;  4GDL B;  4J2V A;  4M70 B;  5ID9 A;  4N0U D;  4IW2 A;  3WHQ A;  3KIK A;  5IIX A;  1KXP D;  4Z69 A;  4F5U A;  4GDK B;  3VQI A;  4G01 A;  3JQZ A;  2BXO A;  3G9K D;  5GHK A;  3NMU A;  2BXD A;  4K71 A;  4F5T A;  4DHX B;  4LA0 A;  4ZBK A;  4WA6 B;  5B5T A;  2I30 A;  1O9X A;  1VFI A;  1GNJ A;  2Z8K A;  1HK4 A;  2DG5 A;  1BJ5 A;  1MA9 A;  3MHS B;  1MIW A;  1TXU A;  3GQU A;  3NVM A;  2BX8 A;  4ZBR A;  4G03 A;  4GDX A;  3KJL A;  3TDL A;  2QHB A;  4OTT A;  4L8U A;  3CX9 A;  2I2Z A;  3A75 A;  2DBW A;  1GNI A;  2VDB A;  5DBY A;  2BXM A;  2BXQ A;  3FNM A;  4JK4 A;  2LOQ A;  3B9M A;  2BXH A;  2NQO A;  3H3A A;  2DBU A;  4F5S A;  3V08 A;  4K2C A;  4ZBQ A;  4HGM B;  2BXC A;  4TQ0 A;  2XMO A;  3PLA A;  4IW1 A;  4N3Z A;  4Z9O A;  4GG2 A;  5FUO A;  3LU7 A;  2E0X A;  2QM6 A;  2AJE A;  1MIV A;  2EFC A;  4MBE C;  3B9L A;  3JRY A;  2ROH A;  1E7G A;  5ID7 A;  4L9Q A;  3LU8 A;  2DYO A;  4N0F D;  1E7A A;  5DQF A;  2BXL A;  4HGK A;  4EMX A;  1TF0 A;  1HK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...