3KIKA

Sgf11:sus1 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
MDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SUS1
publication title Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 38
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3kikA00
3FWCC 4FK5B 3M99C 3MHHB 4FJCB 4W4UB 4FIPB 4WA6B 4DHXB 3KIKA 4MBEC 4ZUXV 3KJLA 4C31B 3FWBC 3MHSB
chains in the Genus database with same CATH superfamily
4F5TA 2BXBA 1E7CA 3JQZA 1HK5A 1MIYA 2DYMA 2OT3A 4N0FD 2LOQA 4WA6B 3UIVA 4LB9A 5IJ5A 2KBZA 2ROHA 2EFCA 4ZBQA 4GDKB 4F5SA 2BX8A 5GIOA 2XW1A 3H37A 4FIPB 4K71A 3KIKA 5IFOA 2EFEA 1JNBA 1O9XA 4GDLB 2NNWA 2EFDA 5HOZA 1AO6A 1E7GA 1MUSA 2KWFA 1GNJA 4Z9OA 4MBEC 5FUOA 1MIWA 1E78A 5IIXA 2DG5A 5D7GA 1E7EA 1MA9A 3V08A 1E7HA 1E7IA 2DBUA 4BY9C 3GA9L 4C31B 2Z8IA 2BXLA 1HK1A 4FJCB 4ZC6A 1KW2A 3M99C 4LUFA 1NT2B 3G9KD 4LA0A 3ECPA 2QM6A 5IJEA 1J78A 1MIVA 1HA2A 3H3AA 2DYOA 1HK2A 2BXKA 2BXFA 4L9QA 4E99A 3ICXA 2BXAA 2LXSA 4FK5B 2BXGA 3WHSA 1HK3A 1TF0A 2JUHA 2VUFA 5ID9A 2QMCA 2GUTA 4M70B 1BKEA 1MM8A 4K2CA 2K0NA 3SIUB 4G01A 3MHHB 5GINA 4OTTA 4NAWB 1H5WA 1E7AA 2XVUA 4PO0A 1TXUA 4DHXB 1VZSA 2BXOA 1LNSA 1J7EA 1HK4A 2VUEA 2BXHA 2E0YA 2AJEA 3FWBC 2LQHA 3MHSB 4IW1A 4EMXA 3V09A 2AGHB 2EFHA 4D7XA 3WHRA 4W4UB 1N5UA 4J2VA 4F5VA 4JK4A 4BKEA 2BXEA 1GNIA 5DBYA 3SQJA 1KDXA 2Z8JA 2BXQA 2YDFA 5BPKA 3B9LA 2XVQA 4ZUXV 3A75A 2Z8KA 2OZBB 3NVIA 4TQ1A 4HGKA 3LU7A 4OT2A 4N0UD 4G03A 3VQIA 5GIPA 2BXCA 2BXIA 4F5UA 4Z69A 2XMOA 4S1YA 4N3ZA 3A73A 1E7BA 4DM0A 1FOUA 2CKXA 3V03A 4ZCGA 1KXPD 1MUHA 5B5TA 3FWCC 3WHQA 2QHBA 2NQOA 1UORA 3B9MA 3GQUA 1IJGA 2DBWA 2I30A 2LXTA 5GHKA 2V36A 3NVKA 3FNMA 3W1SA 4LB2A 1H9ZA 4IW2A 3PLAA 1E7FA 1LOTA 4I9OA 5IIHA 4OTUA 2BXDA 4ZBKA 1BM0A 3BPJA 2VDBA 1SB0A 2I2ZA 3KJLA 4OR0A 2E0XA 2BXNA 5DQFA 1VFIA 2LQIA 2XVWA 3LU6A 3TDLA 3NMUA 3SIVB 2DBXA 2XW0A 4GDXA 3LU8A 4GG2A 4ZBRA 2XSIA 3NVMA 5IJFA 3CX9A 3GQXA 2BXPA 4HGMB 4G04A 1BJ5A 4L8UA 2BXMA 4TQ0A 2XVVA 5ID7A 4L9KA 5IIUA 3JRYA 4LUHA
chains in the Genus database with same CATH topology
4F5TA 2BXBA 1E7CA 3JQZA 1HK5A 1MIYA 2DYMA 2OT3A 4N0FD 2LOQA 4WA6B 3UIVA 4LB9A 5IJ5A 2KBZA 2ROHA 2EFCA 4ZBQA 4GDKB 4F5SA 2BX8A 5GIOA 2XW1A 3H37A 4FIPB 4K71A 3KIKA 5IFOA 2EFEA 1JNBA 1O9XA 4GDLB 2NNWA 2EFDA 5HOZA 1AO6A 1E7GA 1GNJA 4Z9OA 4MBEC 5FUOA 1MIWA 1E78A 5IIXA 2DG5A 5D7GA 1E7EA 1MA9A 3V08A 1E7HA 1E7IA 2DBUA 4BY9C 3GA9L 4C31B 2Z8IA 2BXLA 1HK1A 4FJCB 4ZC6A 1KW2A 3M99C 4LUFA 1NT2B 3G9KD 4LA0A 2QM6A 5IJEA 1J78A 1MIVA 1HA2A 3H3AA 2DYOA 1HK2A 2BXKA 2BXFA 4L9QA 4E99A 3ICXA 2BXAA 4FK5B 2BXGA 3WHSA 1HK3A 1TF0A 2JUHA 2VUFA 5ID9A 2QMCA 4M70B 1BKEA 4K2CA 3SIUB 4G01A 3MHHB 5GINA 4OTTA 4NAWB 1H5WA 1E7AA 2XVUA 4PO0A 1TXUA 4DHXB 1VZSA 2BXOA 1LNSA 1J7EA 1HK4A 2VUEA 2BXHA 2E0YA 2AJEA 3FWBC 3MHSB 4IW1A 4EMXA 3V09A 2EFHA 3WHRA 4W4UB 1N5UA 4J2VA 4F5VA 4JK4A 4BKEA 2BXEA 1GNIA 5DBYA 3SQJA 2Z8JA 2BXQA 2YDFA 5BPKA 3B9LA 2XVQA 4ZUXV 3A75A 2Z8KA 2OZBB 3NVIA 4TQ1A 4HGKA 3LU7A 4OT2A 4N0UD 4G03A 3VQIA 5GIPA 2BXCA 2BXIA 4F5UA 4Z69A 2XMOA 4S1YA 4N3ZA 3A73A 1E7BA 1FOUA 2CKXA 3V03A 4ZCGA 1KXPD 5B5TA 3FWCC 3WHQA 2QHBA 2NQOA 1UORA 3B9MA 3GQUA 1IJGA 2DBWA 2I30A 2V36A 3NVKA 3FNMA 3W1SA 4LB2A 1H9ZA 4IW2A 3PLAA 1E7FA 1LOTA 5IIHA 4OTUA 2BXDA 4ZBKA 1BM0A 2VDBA 3KJLA 2I2ZA 4OR0A 5GHKA 2E0XA 2BXNA 5DQFA 1VFIA 2XVWA 3TDLA 3LU6A 3NMUA 3SIVB 2DBXA 2XW0A 4GDXA 3LU8A 4GG2A 4ZBRA 2XSIA 3NVMA 5IJFA 3CX9A 3GQXA 2BXPA 4HGMB 4G04A 1BJ5A 4L8UA 2BXMA 4TQ0A 2XVVA 5ID7A 4L9KA 5IIUA 3JRYA 4LUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWC C;  4FK5 B;  3M99 C;  3MHH B;  4FJC B;  4W4U B;  4FIP B;  4WA6 B;  4DHX B;  3KIK A;  4MBE C;  4ZUX V;  3KJL A;  4C31 B;  3FWB C;  3MHS B; 
#chains in the Genus database with same CATH topology
 4F5T A;  2BXB A;  1E7C A;  3JQZ A;  1HK5 A;  1MIY A;  2DYM A;  2OT3 A;  4N0F D;  2LOQ A;  4WA6 B;  3UIV A;  4LB9 A;  5IJ5 A;  2KBZ A;  2ROH A;  2EFC A;  4ZBQ A;  4GDK B;  4F5S A;  2BX8 A;  5GIO A;  2XW1 A;  3H37 A;  4FIP B;  4K71 A;  3KIK A;  5IFO A;  2EFE A;  1JNB A;  1O9X A;  4GDL B;  2NNW A;  2EFD A;  5HOZ A;  1AO6 A;  1E7G A;  1MUS A;  2KWF A;  1GNJ A;  4Z9O A;  4MBE C;  5FUO A;  1MIW A;  1E78 A;  5IIX A;  2DG5 A;  5D7G A;  1E7E A;  1MA9 A;  3V08 A;  1E7H A;  1E7I A;  2DBU A;  4BY9 C;  3GA9 L;  4C31 B;  2Z8I A;  2BXL A;  1HK1 A;  4FJC B;  4ZC6 A;  1KW2 A;  3M99 C;  4LUF A;  1NT2 B;  3G9K D;  4LA0 A;  3ECP A;  2QM6 A;  5IJE A;  1J78 A;  1MIV A;  1HA2 A;  3H3A A;  2DYO A;  1HK2 A;  2BXK A;  2BXF A;  4L9Q A;  4E99 A;  3ICX A;  2BXA A;  2LXS A;  4FK5 B;  2BXG A;  3WHS A;  1HK3 A;  1TF0 A;  2JUH A;  2VUF A;  5ID9 A;  2QMC A;  2GUT A;  4M70 B;  1BKE A;  1MM8 A;  4K2C A;  2K0N A;  3SIU B;  4G01 A;  3MHH B;  5GIN A;  4OTT A;  4NAW B;  1H5W A;  1E7A A;  2XVU A;  4PO0 A;  1TXU A;  4DHX B;  1VZS A;  2BXO A;  1LNS A;  1J7E A;  1HK4 A;  2VUE A;  2BXH A;  2E0Y A;  2AJE A;  3FWB C;  2LQH A;  3MHS B;  4IW1 A;  4EMX A;  3V09 A;  2AGH B;  2EFH A;  4D7X A;  3WHR A;  4W4U B;  1N5U A;  4J2V A;  4F5V A;  4JK4 A;  4BKE A;  2BXE A;  1GNI A;  5DBY A;  3SQJ A;  1KDX A;  2Z8J A;  2BXQ A;  2YDF A;  5BPK A;  3B9L A;  2XVQ A;  4ZUX V;  3A75 A;  2Z8K A;  2OZB B;  3NVI A;  4TQ1 A;  4HGK A;  3LU7 A;  4OT2 A;  4N0U D;  4G03 A;  3VQI A;  5GIP A;  2BXC A;  2BXI A;  4F5U A;  4Z69 A;  2XMO A;  4S1Y A;  4N3Z A;  3A73 A;  1E7B A;  4DM0 A;  1FOU A;  2CKX A;  3V03 A;  4ZCG A;  1KXP D;  1MUH A;  5B5T A;  3FWC C;  3WHQ A;  2QHB A;  2NQO A;  1UOR A;  3B9M A;  3GQU A;  1IJG A;  2DBW A;  2I30 A;  2LXT A;  5GHK A;  2V36 A;  3NVK A;  3FNM A;  3W1S A;  4LB2 A;  1H9Z A;  4IW2 A;  3PLA A;  1E7F A;  1LOT A;  4I9O A;  5IIH A;  4OTU A;  2BXD A;  4ZBK A;  1BM0 A;  3BPJ A;  2VDB A;  1SB0 A;  2I2Z A;  3KJL A;  4OR0 A;  2E0X A;  2BXN A;  5DQF A;  1VFI A;  2LQI A;  2XVW A;  3LU6 A;  3TDL A;  3NMU A;  3SIV B;  2DBX A;  2XW0 A;  4GDX A;  3LU8 A;  4GG2 A;  4ZBR A;  2XSI A;  3NVM A;  5IJF A;  3CX9 A;  3GQX A;  2BXP A;  4HGM B;  4G04 A;  1BJ5 A;  4L8U A;  2BXM A;  4TQ0 A;  2XVV A;  5ID7 A;  4L9K A;  5IIU A;  3JRY A;  4LUH A; 
#chains in the Genus database with same CATH homology
 4F5T A;  2BXB A;  1E7C A;  3JQZ A;  1HK5 A;  1MIY A;  2DYM A;  2OT3 A;  4N0F D;  2LOQ A;  4WA6 B;  3UIV A;  4LB9 A;  5IJ5 A;  2KBZ A;  2ROH A;  2EFC A;  4ZBQ A;  4GDK B;  4F5S A;  2BX8 A;  5GIO A;  2XW1 A;  3H37 A;  4FIP B;  4K71 A;  3KIK A;  5IFO A;  2EFE A;  1JNB A;  1O9X A;  4GDL B;  2NNW A;  2EFD A;  5HOZ A;  1AO6 A;  1E7G A;  1GNJ A;  4Z9O A;  4MBE C;  5FUO A;  1MIW A;  1E78 A;  5IIX A;  2DG5 A;  5D7G A;  1E7E A;  1MA9 A;  3V08 A;  1E7H A;  1E7I A;  2DBU A;  4BY9 C;  3GA9 L;  4C31 B;  2Z8I A;  2BXL A;  1HK1 A;  4FJC B;  4ZC6 A;  1KW2 A;  3M99 C;  4LUF A;  1NT2 B;  3G9K D;  4LA0 A;  2QM6 A;  5IJE A;  1J78 A;  1MIV A;  1HA2 A;  3H3A A;  2DYO A;  1HK2 A;  2BXK A;  2BXF A;  4L9Q A;  4E99 A;  3ICX A;  2BXA A;  4FK5 B;  2BXG A;  3WHS A;  1HK3 A;  1TF0 A;  2JUH A;  2VUF A;  5ID9 A;  2QMC A;  4M70 B;  1BKE A;  4K2C A;  3SIU B;  4G01 A;  3MHH B;  5GIN A;  4OTT A;  4NAW B;  1H5W A;  1E7A A;  2XVU A;  4PO0 A;  1TXU A;  4DHX B;  1VZS A;  2BXO A;  1LNS A;  1J7E A;  1HK4 A;  2VUE A;  2BXH A;  2E0Y A;  2AJE A;  3FWB C;  3MHS B;  4IW1 A;  4EMX A;  3V09 A;  2EFH A;  3WHR A;  4W4U B;  1N5U A;  4J2V A;  4F5V A;  4JK4 A;  4BKE A;  2BXE A;  1GNI A;  5DBY A;  3SQJ A;  2Z8J A;  2BXQ A;  2YDF A;  5BPK A;  3B9L A;  2XVQ A;  4ZUX V;  3A75 A;  2Z8K A;  2OZB B;  3NVI A;  4TQ1 A;  4HGK A;  3LU7 A;  4OT2 A;  4N0U D;  4G03 A;  3VQI A;  5GIP A;  2BXC A;  2BXI A;  4F5U A;  4Z69 A;  2XMO A;  4S1Y A;  4N3Z A;  3A73 A;  1E7B A;  1FOU A;  2CKX A;  3V03 A;  4ZCG A;  1KXP D;  5B5T A;  3FWC C;  3WHQ A;  2QHB A;  2NQO A;  1UOR A;  3B9M A;  3GQU A;  1IJG A;  2DBW A;  2I30 A;  2V36 A;  3NVK A;  3FNM A;  3W1S A;  4LB2 A;  1H9Z A;  4IW2 A;  3PLA A;  1E7F A;  1LOT A;  5IIH A;  4OTU A;  2BXD A;  4ZBK A;  1BM0 A;  2VDB A;  3KJL A;  2I2Z A;  4OR0 A;  5GHK A;  2E0X A;  2BXN A;  5DQF A;  1VFI A;  2XVW A;  3TDL A;  3LU6 A;  3NMU A;  3SIV B;  2DBX A;  2XW0 A;  4GDX A;  3LU8 A;  4GG2 A;  4ZBR A;  2XSI A;  3NVM A;  5IJF A;  3CX9 A;  3GQX A;  2BXP A;  4HGM B;  4G04 A;  1BJ5 A;  4L8U A;  2BXM A;  4TQ0 A;  2XVV A;  5ID7 A;  4L9K A;  5IIU A;  3JRY A;  4LUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...