2AJEA

Solution structure of the arabidopsis thaliana telomeric repeat-binding protein dna binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
QRRIRRPFSVAEVEALVQAVEKLGTGRWRDVKLCAFEDADHRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWTQQQMQQLQQNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords telomere repeat-binding protein
publication title Solution structure of the Arabidopsis thaliana telomeric repeat-binding protein DNA binding domain: a new fold with an additional C-terminal helix
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.220 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2ajeA00
2AJEA 2QHBA 2ROHA 2CKXA 2JUHA
chains in the Genus database with same CATH superfamily
1HK1A 1E7IA 2YDFA 2OT3A 4S1YA 5IFOA 2I30A 4LB9A 2BXIA 3SIUB 1BM0A 2EFHA 1N5UA 5B5TA 4L9KA 1MUHA 5DBYA 1KW2A 2Z8JA 2LQIA 2K0NA 4LB2A 4I9OA 4ZC6A 5IIXA 1MM8A 4ZUXV 5FUOA 3FWCC 2DBXA 2V36A 3CX9A 4W4UB 4K71A 2XVVA 4NAWB 2DYOA 5GIPA 2LQHA 4GDLB 1E7AA 4ZBKA 4L9QA 4LUHA 4ZCGA 1AO6A 5GIOA 1NT2B 5IJEA 1IJGA 2VUFA 4WA6B 2BXQA 3G9KD 3GA9L 1HA2A 3MHHB 5IIUA 4F5UA 3NVIA 1BKEA 4F5VA 2NQOA 3VQIA 4OTUA 4N3ZA 1E7GA 3ECPA 2LXTA 4M70B 4LA0A 3V08A 2BXPA 3LU6A 4FK5B 5ID9A 2XVUA 1HK5A 2KBZA 4IW2A 1H5WA 4FIPB 2DBWA 3NMUA 4L8UA 2KWFA 3GQXA 4N0FD 4DM0A 2BXMA 2ROHA 2XW0A 3BPJA 2EFDA 4GG2A 2XMOA 2XW1A 3V03A 1KXPD 2EFCA 1E7CA 3WHRA 2GUTA 3JQZA 4C31B 2EFEA 2NNWA 4N0UD 1MIVA 4TQ1A 1VFIA 4JK4A 1HK2A 3V09A 2VUEA 3MHSB 1FOUA 3M99C 4HGKA 4D7XA 1O9XA 1E78A 2QM6A 2BXLA 2BXOA 1MIWA 4TQ0A 1GNJA 4G03A 2BXHA 4FJCB 2BXDA 5HOZA 3LU8A 2XSIA 1UORA 1E7FA 1MA9A 1TF0A 2DG5A 3GQUA 1GNIA 5D7GA 4BKEA 4Z69A 2E0XA 3H3AA 3JRYA 3KJLA 4BY9C 4Z9OA 1JNBA 1H9ZA 3B9MA 4G04A 1J78A 2Z8IA 5GINA 1HK4A 4OR0A 2I2ZA 1E7EA 1VZSA 2BXFA 4GDXA 3NVMA 4HGMB 2JUHA 1SB0A 3PLAA 4MBEC 2BXNA 3H37A 5GHKA 2QHBA 2LOQA 2LXSA 1LNSA 4IW1A 1E7BA 4EMXA 5DQFA 3A75A 3TDLA 1MIYA 2XVWA 2QMCA 3W1SA 3NVKA 2BXEA 3ICXA 1TXUA 3A73A 4J2VA 5ID7A 2AJEA 2DBUA 3SIVB 3FWBC 1MUSA 2BX8A 3WHSA 4DHXB 2XVQA 4OT2A 3SQJA 4E99A 1LOTA 4F5TA 5IIHA 1E7HA 5IJFA 4PO0A 3B9LA 2BXBA 4GDKB 2E0YA 4K2CA 4LUFA 5IJ5A 1KDXA 3WHQA 4ZBQA 3KIKA 2BXGA 1J7EA 2AGHB 4G01A 2CKXA 3LU7A 2BXKA 1HK3A 2DYMA 4ZBRA 4F5SA 2OZBB 5BPKA 2Z8KA 4OTTA 3FNMA 2BXCA 3UIVA 1BJ5A 2VDBA 2BXAA
chains in the Genus database with same CATH topology
1HK1A 1E7IA 2YDFA 2OT3A 4S1YA 5IFOA 2I30A 4LB9A 2BXIA 3SIUB 1BM0A 2EFHA 1N5UA 5B5TA 4L9KA 5DBYA 1KW2A 2Z8JA 4LB2A 4ZC6A 5IIXA 4ZUXV 5FUOA 3FWCC 2DBXA 2V36A 3CX9A 4W4UB 4K71A 2XVVA 4NAWB 2DYOA 5GIPA 4GDLB 1E7AA 4ZBKA 4L9QA 4LUHA 4ZCGA 1AO6A 5GIOA 1NT2B 5IJEA 1IJGA 2VUFA 4WA6B 2BXQA 3G9KD 3GA9L 1HA2A 3MHHB 5IIUA 4F5UA 3NVIA 1BKEA 4F5VA 2NQOA 3VQIA 4OTUA 4N3ZA 1E7GA 4M70B 4LA0A 3V08A 2BXPA 3LU6A 4FK5B 5ID9A 2XVUA 1HK5A 2KBZA 4IW2A 1H5WA 4FIPB 2DBWA 3NMUA 4L8UA 3GQXA 4N0FD 2BXMA 2ROHA 2XW0A 2EFDA 4GG2A 2XMOA 2XW1A 3V03A 1KXPD 2EFCA 1E7CA 3WHRA 4C31B 3JQZA 2EFEA 2NNWA 4N0UD 1MIVA 4TQ1A 1VFIA 4JK4A 1HK2A 3V09A 2VUEA 3MHSB 1FOUA 3M99C 4HGKA 1O9XA 1E78A 2QM6A 2BXLA 2BXOA 1MIWA 4TQ0A 1GNJA 4G03A 2BXHA 4FJCB 2BXDA 5HOZA 3LU8A 2XSIA 1UORA 1E7FA 1MA9A 1TF0A 2DG5A 3GQUA 1GNIA 5D7GA 4BKEA 4Z69A 2E0XA 3H3AA 3JRYA 3KJLA 4BY9C 4Z9OA 1JNBA 1H9ZA 3B9MA 4G04A 1J78A 2Z8IA 5GINA 1HK4A 4OR0A 2I2ZA 1E7EA 1VZSA 2BXFA 4GDXA 3NVMA 4HGMB 2JUHA 3PLAA 4MBEC 2BXNA 3H37A 5GHKA 2QHBA 2LOQA 1LNSA 4IW1A 1E7BA 4EMXA 5DQFA 3A75A 3TDLA 1MIYA 2XVWA 2QMCA 3W1SA 3NVKA 2BXEA 3ICXA 1TXUA 3A73A 4J2VA 5ID7A 2AJEA 2DBUA 3SIVB 3FWBC 2BX8A 3WHSA 4DHXB 2XVQA 4OT2A 3SQJA 4E99A 1LOTA 4F5TA 5IIHA 1E7HA 5IJFA 4PO0A 3B9LA 2BXBA 4GDKB 2E0YA 4K2CA 4LUFA 5IJ5A 3WHQA 4ZBQA 3KIKA 2BXGA 1J7EA 4G01A 2CKXA 3LU7A 2BXKA 1HK3A 2DYMA 4ZBRA 4F5SA 2OZBB 5BPKA 2Z8KA 4OTTA 3FNMA 2BXCA 3UIVA 1BJ5A 2VDBA 2BXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJE A;  2QHB A;  2ROH A;  2CKX A;  2JUH A; 
#chains in the Genus database with same CATH topology
 1HK1 A;  1E7I A;  2YDF A;  2OT3 A;  4S1Y A;  5IFO A;  2I30 A;  4LB9 A;  2BXI A;  3SIU B;  1BM0 A;  2EFH A;  1N5U A;  5B5T A;  4L9K A;  1MUH A;  5DBY A;  1KW2 A;  2Z8J A;  2LQI A;  2K0N A;  4LB2 A;  4I9O A;  4ZC6 A;  5IIX A;  1MM8 A;  4ZUX V;  5FUO A;  3FWC C;  2DBX A;  2V36 A;  3CX9 A;  4W4U B;  4K71 A;  2XVV A;  4NAW B;  2DYO A;  5GIP A;  2LQH A;  4GDL B;  1E7A A;  4ZBK A;  4L9Q A;  4LUH A;  4ZCG A;  1AO6 A;  5GIO A;  1NT2 B;  5IJE A;  1IJG A;  2VUF A;  4WA6 B;  2BXQ A;  3G9K D;  3GA9 L;  1HA2 A;  3MHH B;  5IIU A;  4F5U A;  3NVI A;  1BKE A;  4F5V A;  2NQO A;  3VQI A;  4OTU A;  4N3Z A;  1E7G A;  3ECP A;  2LXT A;  4M70 B;  4LA0 A;  3V08 A;  2BXP A;  3LU6 A;  4FK5 B;  5ID9 A;  2XVU A;  1HK5 A;  2KBZ A;  4IW2 A;  1H5W A;  4FIP B;  2DBW A;  3NMU A;  4L8U A;  2KWF A;  3GQX A;  4N0F D;  4DM0 A;  2BXM A;  2ROH A;  2XW0 A;  3BPJ A;  2EFD A;  4GG2 A;  2XMO A;  2XW1 A;  3V03 A;  1KXP D;  2EFC A;  1E7C A;  3WHR A;  2GUT A;  3JQZ A;  4C31 B;  2EFE A;  2NNW A;  4N0U D;  1MIV A;  4TQ1 A;  1VFI A;  4JK4 A;  1HK2 A;  3V09 A;  2VUE A;  3MHS B;  1FOU A;  3M99 C;  4HGK A;  4D7X A;  1O9X A;  1E78 A;  2QM6 A;  2BXL A;  2BXO A;  1MIW A;  4TQ0 A;  1GNJ A;  4G03 A;  2BXH A;  4FJC B;  2BXD A;  5HOZ A;  3LU8 A;  2XSI A;  1UOR A;  1E7F A;  1MA9 A;  1TF0 A;  2DG5 A;  3GQU A;  1GNI A;  5D7G A;  4BKE A;  4Z69 A;  2E0X A;  3H3A A;  3JRY A;  3KJL A;  4BY9 C;  4Z9O A;  1JNB A;  1H9Z A;  3B9M A;  4G04 A;  1J78 A;  2Z8I A;  5GIN A;  1HK4 A;  4OR0 A;  2I2Z A;  1E7E A;  1VZS A;  2BXF A;  4GDX A;  3NVM A;  4HGM B;  2JUH A;  1SB0 A;  3PLA A;  4MBE C;  2BXN A;  3H37 A;  5GHK A;  2QHB A;  2LOQ A;  2LXS A;  1LNS A;  4IW1 A;  1E7B A;  4EMX A;  5DQF A;  3A75 A;  3TDL A;  1MIY A;  2XVW A;  2QMC A;  3W1S A;  3NVK A;  2BXE A;  3ICX A;  1TXU A;  3A73 A;  4J2V A;  5ID7 A;  2AJE A;  2DBU A;  3SIV B;  3FWB C;  1MUS A;  2BX8 A;  3WHS A;  4DHX B;  2XVQ A;  4OT2 A;  3SQJ A;  4E99 A;  1LOT A;  4F5T A;  5IIH A;  1E7H A;  5IJF A;  4PO0 A;  3B9L A;  2BXB A;  4GDK B;  2E0Y A;  4K2C A;  4LUF A;  5IJ5 A;  1KDX A;  3WHQ A;  4ZBQ A;  3KIK A;  2BXG A;  1J7E A;  2AGH B;  4G01 A;  2CKX A;  3LU7 A;  2BXK A;  1HK3 A;  2DYM A;  4ZBR A;  4F5S A;  2OZB B;  5BPK A;  2Z8K A;  4OTT A;  3FNM A;  2BXC A;  3UIV A;  1BJ5 A;  2VDB A;  2BXA A; 
#chains in the Genus database with same CATH homology
 1HK1 A;  1E7I A;  2YDF A;  2OT3 A;  4S1Y A;  5IFO A;  2I30 A;  4LB9 A;  2BXI A;  3SIU B;  1BM0 A;  2EFH A;  1N5U A;  5B5T A;  4L9K A;  5DBY A;  1KW2 A;  2Z8J A;  4LB2 A;  4ZC6 A;  5IIX A;  4ZUX V;  5FUO A;  3FWC C;  2DBX A;  2V36 A;  3CX9 A;  4W4U B;  4K71 A;  2XVV A;  4NAW B;  2DYO A;  5GIP A;  4GDL B;  1E7A A;  4ZBK A;  4L9Q A;  4LUH A;  4ZCG A;  1AO6 A;  5GIO A;  1NT2 B;  5IJE A;  1IJG A;  2VUF A;  4WA6 B;  2BXQ A;  3G9K D;  3GA9 L;  1HA2 A;  3MHH B;  5IIU A;  4F5U A;  3NVI A;  1BKE A;  4F5V A;  2NQO A;  3VQI A;  4OTU A;  4N3Z A;  1E7G A;  4M70 B;  4LA0 A;  3V08 A;  2BXP A;  3LU6 A;  4FK5 B;  5ID9 A;  2XVU A;  1HK5 A;  2KBZ A;  4IW2 A;  1H5W A;  4FIP B;  2DBW A;  3NMU A;  4L8U A;  3GQX A;  4N0F D;  2BXM A;  2ROH A;  2XW0 A;  2EFD A;  4GG2 A;  2XMO A;  2XW1 A;  3V03 A;  1KXP D;  2EFC A;  1E7C A;  3WHR A;  4C31 B;  3JQZ A;  2EFE A;  2NNW A;  4N0U D;  1MIV A;  4TQ1 A;  1VFI A;  4JK4 A;  1HK2 A;  3V09 A;  2VUE A;  3MHS B;  1FOU A;  3M99 C;  4HGK A;  1O9X A;  1E78 A;  2QM6 A;  2BXL A;  2BXO A;  1MIW A;  4TQ0 A;  1GNJ A;  4G03 A;  2BXH A;  4FJC B;  2BXD A;  5HOZ A;  3LU8 A;  2XSI A;  1UOR A;  1E7F A;  1MA9 A;  1TF0 A;  2DG5 A;  3GQU A;  1GNI A;  5D7G A;  4BKE A;  4Z69 A;  2E0X A;  3H3A A;  3JRY A;  3KJL A;  4BY9 C;  4Z9O A;  1JNB A;  1H9Z A;  3B9M A;  4G04 A;  1J78 A;  2Z8I A;  5GIN A;  1HK4 A;  4OR0 A;  2I2Z A;  1E7E A;  1VZS A;  2BXF A;  4GDX A;  3NVM A;  4HGM B;  2JUH A;  3PLA A;  4MBE C;  2BXN A;  3H37 A;  5GHK A;  2QHB A;  2LOQ A;  1LNS A;  4IW1 A;  1E7B A;  4EMX A;  5DQF A;  3A75 A;  3TDL A;  1MIY A;  2XVW A;  2QMC A;  3W1S A;  3NVK A;  2BXE A;  3ICX A;  1TXU A;  3A73 A;  4J2V A;  5ID7 A;  2AJE A;  2DBU A;  3SIV B;  3FWB C;  2BX8 A;  3WHS A;  4DHX B;  2XVQ A;  4OT2 A;  3SQJ A;  4E99 A;  1LOT A;  4F5T A;  5IIH A;  1E7H A;  5IJF A;  4PO0 A;  3B9L A;  2BXB A;  4GDK B;  2E0Y A;  4K2C A;  4LUF A;  5IJ5 A;  3WHQ A;  4ZBQ A;  3KIK A;  2BXG A;  1J7E A;  4G01 A;  2CKX A;  3LU7 A;  2BXK A;  1HK3 A;  2DYM A;  4ZBR A;  4F5S A;  2OZB B;  5BPK A;  2Z8K A;  4OTT A;  3FNM A;  2BXC A;  3UIV A;  1BJ5 A;  2VDB A;  2BXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...