2AJEA

Solution structure of the arabidopsis thaliana telomeric repeat-binding protein dna binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
QRRIRRPFSVAEVEALVQAVEKLGTGRWRDVKLCAFEDADHRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWTQQQMQQLQQNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Arabidopsis thaliana telomeric repeat-binding protein DNA binding domain: a new fold with an additional C-terminal helix
pubmed doi rcsb
molecule keywords telomere repeat-binding protein
molecule tags Dna binding protein
source organism Arabidopsis thaliana
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.220 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2ajeA00
2QHBA 2ROHA 2JUHA 2CKXA 2AJEA
chains in the Genus database with same CATH superfamily
3G9KD 1E7IA 2QMCA 1MM8A 4ZBQA 3GQUA 4TQ0A 2NNWA 3V03A 2BXHA 1HK2A 2BXGA 3KIKA 5IJFA 2BXKA 2EFCA 4N0FD 2BXLA 4LB2A 2DBUA 2BX8A 2LXTA 2EFEA 4G03A 2E0XA 2V36A 5GIOA 4LUFA 2XW0A 2VUEA 5DBYA 2LXSA 3ECPA 4N3ZA 2XW1A 1KXPD 1BJ5A 1LNSA 2I2ZA 4G04A 4HGKA 5GHKA 3VQIA 3FNMA 2BXPA 3FWBC 1E7GA 4IW2A 3W1SA 1GNIA 2EFDA 4HGMB 5ID7A 3B9MA 4IW1A 5IIUA 3KJLA 2DG5A 5IIXA 1HK5A 4K2CA 5IIHA 1MIWA 2BXNA 2JUHA 4OTTA 4J2VA 1TXUA 3GQXA 4M70B 1BKEA 4K71A 4F5TA 4F5VA 4GDLB 5IFOA 2OZBB 3SIVB 1KW2A 4E99A 1E7EA 2XVVA 2BXIA 4FIPB 4Z69A 2E0YA 4DM0A 3FWCC 4S1YA 1N5UA 2DBXA 1E7AA 1HA2A 2QM6A 1AO6A 3V08A 5DQFA 2BXDA 2LQHA 2DYOA 3WHQA 4C31B 2GUTA 4L9KA 4GDXA 2AJEA 2BXFA 2KWFA 4OR0A 1MUSA 1MUHA 1E7FA 4MBEC 4LUHA 3SQJA 5IJEA 2OT3A 4D7XA 4F5UA 1SB0A 4OT2A 4G01A 2BXMA 2XVWA 1UORA 2Z8JA 1MA9A 3ICXA 3M99C 3H3AA 1JNBA 1NT2B 3JQZA 1O9XA 4GG2A 1H5WA 5D7GA 1J78A 4ZCGA 3GA9L 1E7CA 3LU8A 2QHBA 1TF0A 1FOUA 3UIVA 2CKXA 4FJCB 2KBZA 3NVMA 4NAWB 5BPKA 5GIPA 4JK4A 4LA0A 3JRYA 1E7HA 1VFIA 2ROHA 4N0UD 2BXOA 2NQOA 4Z9OA 4ZC6A 4PO0A 2XMOA 1MIYA 4W4UB 4GDKB 2LOQA 4OTUA 3TDLA 5ID9A 3A75A 1MIVA 2K0NA 2I30A 4L9QA 5GINA 1H9ZA 5B5TA 2DYMA 1HK4A 3V09A 1E78A 2BXQA 3BPJA 2BXBA 3A73A 3CX9A 4L8UA 4EMXA 3SIUB 3MHHB 3NVKA 2AGHB 2LQIA 4ZUXV 2VDBA 5HOZA 4BKEA 1KDXA 2Z8IA 1E7BA 3B9LA 5FUOA 1IJGA 2YDFA 4F5SA 1J7EA 1GNJA 4TQ1A 4WA6B 2VUFA 3WHRA 4DHXB 1HK3A 5IJ5A 4FK5B 3NMUA 2XSIA 1BM0A 3WHSA 4ZBKA 2BXCA 3H37A 4I9OA 2BXEA 3LU7A 2DBWA 3NVIA 1VZSA 3MHSB 4BY9C 1HK1A 2EFHA 2XVUA 2XVQA 4LB9A 2BXAA 3LU6A 4ZBRA 2Z8KA 3PLAA 1LOTA
chains in the Genus database with same CATH topology
3G9KD 1E7IA 2QMCA 4ZBQA 3GQUA 4TQ0A 2NNWA 3V03A 2BXHA 1HK2A 2BXGA 3KIKA 5IJFA 2BXKA 2EFCA 4N0FD 2BXLA 4LB2A 2DBUA 2BX8A 2EFEA 4G03A 2E0XA 2V36A 5GIOA 4LUFA 2XW0A 2VUEA 5DBYA 4N3ZA 2XW1A 1KXPD 1BJ5A 1LNSA 2I2ZA 4G04A 4HGKA 5GHKA 3VQIA 3FNMA 2BXPA 3FWBC 1E7GA 4IW2A 3W1SA 1GNIA 2EFDA 4HGMB 5ID7A 3B9MA 4IW1A 5IIUA 3KJLA 2DG5A 5IIXA 1HK5A 4K2CA 5IIHA 1MIWA 2BXNA 2JUHA 4OTTA 4J2VA 1TXUA 3GQXA 4M70B 1BKEA 4K71A 4F5TA 4F5VA 4GDLB 5IFOA 2OZBB 3SIVB 1KW2A 4E99A 1E7EA 2XVVA 2BXIA 4FIPB 4Z69A 2E0YA 3FWCC 4S1YA 1N5UA 2DBXA 1E7AA 1HA2A 2QM6A 1AO6A 3V08A 5DQFA 2BXDA 2DYOA 3WHQA 4C31B 4L9KA 4GDXA 2AJEA 2BXFA 4OR0A 1E7FA 4MBEC 4LUHA 3SQJA 5IJEA 2OT3A 4F5UA 4OT2A 4G01A 2BXMA 2XVWA 1UORA 2Z8JA 1MA9A 3ICXA 3M99C 3H3AA 1JNBA 1NT2B 3JQZA 1O9XA 4GG2A 1H5WA 5D7GA 1J78A 4ZCGA 3GA9L 1E7CA 3LU8A 2QHBA 1TF0A 1FOUA 3UIVA 2CKXA 4FJCB 2KBZA 3NVMA 4NAWB 5BPKA 5GIPA 4JK4A 4LA0A 3JRYA 1E7HA 1VFIA 2ROHA 4N0UD 2BXOA 2NQOA 4Z9OA 4ZC6A 4PO0A 2XMOA 1MIYA 4W4UB 4GDKB 2LOQA 4OTUA 3TDLA 5ID9A 3A75A 1MIVA 2I30A 4L9QA 5GINA 1H9ZA 5B5TA 2DYMA 1HK4A 3V09A 1E78A 2BXQA 3CX9A 2BXBA 3A73A 4L8UA 4EMXA 3SIUB 3MHHB 3NVKA 4ZUXV 2VDBA 5HOZA 4BKEA 2Z8IA 1E7BA 3B9LA 5FUOA 1IJGA 2YDFA 4F5SA 1J7EA 1GNJA 4TQ1A 4WA6B 2VUFA 3WHRA 4DHXB 1HK3A 5IJ5A 4FK5B 3NMUA 2XSIA 1BM0A 3WHSA 4ZBKA 2BXCA 3H37A 2BXEA 3LU7A 2DBWA 3NVIA 1VZSA 3MHSB 4BY9C 1HK1A 2EFHA 2XVUA 2XVQA 4LB9A 2BXAA 3LU6A 4ZBRA 2Z8KA 3PLAA 1LOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHB A;  2ROH A;  2JUH A;  2CKX A;  2AJE A; 
#chains in the Genus database with same CATH topology
 3G9K D;  1E7I A;  2QMC A;  1MM8 A;  4ZBQ A;  3GQU A;  4TQ0 A;  2NNW A;  3V03 A;  2BXH A;  1HK2 A;  2BXG A;  3KIK A;  5IJF A;  2BXK A;  2EFC A;  4N0F D;  2BXL A;  4LB2 A;  2DBU A;  2BX8 A;  2LXT A;  2EFE A;  4G03 A;  2E0X A;  2V36 A;  5GIO A;  4LUF A;  2XW0 A;  2VUE A;  5DBY A;  2LXS A;  3ECP A;  4N3Z A;  2XW1 A;  1KXP D;  1BJ5 A;  1LNS A;  2I2Z A;  4G04 A;  4HGK A;  5GHK A;  3VQI A;  3FNM A;  2BXP A;  3FWB C;  1E7G A;  4IW2 A;  3W1S A;  1GNI A;  2EFD A;  4HGM B;  5ID7 A;  3B9M A;  4IW1 A;  5IIU A;  3KJL A;  2DG5 A;  5IIX A;  1HK5 A;  4K2C A;  5IIH A;  1MIW A;  2BXN A;  2JUH A;  4OTT A;  4J2V A;  1TXU A;  3GQX A;  4M70 B;  1BKE A;  4K71 A;  4F5T A;  4F5V A;  4GDL B;  5IFO A;  2OZB B;  3SIV B;  1KW2 A;  4E99 A;  1E7E A;  2XVV A;  2BXI A;  4FIP B;  4Z69 A;  2E0Y A;  4DM0 A;  3FWC C;  4S1Y A;  1N5U A;  2DBX A;  1E7A A;  1HA2 A;  2QM6 A;  1AO6 A;  3V08 A;  5DQF A;  2BXD A;  2LQH A;  2DYO A;  3WHQ A;  4C31 B;  2GUT A;  4L9K A;  4GDX A;  2AJE A;  2BXF A;  2KWF A;  4OR0 A;  1MUS A;  1MUH A;  1E7F A;  4MBE C;  4LUH A;  3SQJ A;  5IJE A;  2OT3 A;  4D7X A;  4F5U A;  1SB0 A;  4OT2 A;  4G01 A;  2BXM A;  2XVW A;  1UOR A;  2Z8J A;  1MA9 A;  3ICX A;  3M99 C;  3H3A A;  1JNB A;  1NT2 B;  3JQZ A;  1O9X A;  4GG2 A;  1H5W A;  5D7G A;  1J78 A;  4ZCG A;  3GA9 L;  1E7C A;  3LU8 A;  2QHB A;  1TF0 A;  1FOU A;  3UIV A;  2CKX A;  4FJC B;  2KBZ A;  3NVM A;  4NAW B;  5BPK A;  5GIP A;  4JK4 A;  4LA0 A;  3JRY A;  1E7H A;  1VFI A;  2ROH A;  4N0U D;  2BXO A;  2NQO A;  4Z9O A;  4ZC6 A;  4PO0 A;  2XMO A;  1MIY A;  4W4U B;  4GDK B;  2LOQ A;  4OTU A;  3TDL A;  5ID9 A;  3A75 A;  1MIV A;  2K0N A;  2I30 A;  4L9Q A;  5GIN A;  1H9Z A;  5B5T A;  2DYM A;  1HK4 A;  3V09 A;  1E78 A;  2BXQ A;  3BPJ A;  2BXB A;  3A73 A;  3CX9 A;  4L8U A;  4EMX A;  3SIU B;  3MHH B;  3NVK A;  2AGH B;  2LQI A;  4ZUX V;  2VDB A;  5HOZ A;  4BKE A;  1KDX A;  2Z8I A;  1E7B A;  3B9L A;  5FUO A;  1IJG A;  2YDF A;  4F5S A;  1J7E A;  1GNJ A;  4TQ1 A;  4WA6 B;  2VUF A;  3WHR A;  4DHX B;  1HK3 A;  5IJ5 A;  4FK5 B;  3NMU A;  2XSI A;  1BM0 A;  3WHS A;  4ZBK A;  2BXC A;  3H37 A;  4I9O A;  2BXE A;  3LU7 A;  2DBW A;  3NVI A;  1VZS A;  3MHS B;  4BY9 C;  1HK1 A;  2EFH A;  2XVU A;  2XVQ A;  4LB9 A;  2BXA A;  3LU6 A;  4ZBR A;  2Z8K A;  3PLA A;  1LOT A; 
#chains in the Genus database with same CATH homology
 3G9K D;  1E7I A;  2QMC A;  4ZBQ A;  3GQU A;  4TQ0 A;  2NNW A;  3V03 A;  2BXH A;  1HK2 A;  2BXG A;  3KIK A;  5IJF A;  2BXK A;  2EFC A;  4N0F D;  2BXL A;  4LB2 A;  2DBU A;  2BX8 A;  2EFE A;  4G03 A;  2E0X A;  2V36 A;  5GIO A;  4LUF A;  2XW0 A;  2VUE A;  5DBY A;  4N3Z A;  2XW1 A;  1KXP D;  1BJ5 A;  1LNS A;  2I2Z A;  4G04 A;  4HGK A;  5GHK A;  3VQI A;  3FNM A;  2BXP A;  3FWB C;  1E7G A;  4IW2 A;  3W1S A;  1GNI A;  2EFD A;  4HGM B;  5ID7 A;  3B9M A;  4IW1 A;  5IIU A;  3KJL A;  2DG5 A;  5IIX A;  1HK5 A;  4K2C A;  5IIH A;  1MIW A;  2BXN A;  2JUH A;  4OTT A;  4J2V A;  1TXU A;  3GQX A;  4M70 B;  1BKE A;  4K71 A;  4F5T A;  4F5V A;  4GDL B;  5IFO A;  2OZB B;  3SIV B;  1KW2 A;  4E99 A;  1E7E A;  2XVV A;  2BXI A;  4FIP B;  4Z69 A;  2E0Y A;  3FWC C;  4S1Y A;  1N5U A;  2DBX A;  1E7A A;  1HA2 A;  2QM6 A;  1AO6 A;  3V08 A;  5DQF A;  2BXD A;  2DYO A;  3WHQ A;  4C31 B;  4L9K A;  4GDX A;  2AJE A;  2BXF A;  4OR0 A;  1E7F A;  4MBE C;  4LUH A;  3SQJ A;  5IJE A;  2OT3 A;  4F5U A;  4OT2 A;  4G01 A;  2BXM A;  2XVW A;  1UOR A;  2Z8J A;  1MA9 A;  3ICX A;  3M99 C;  3H3A A;  1JNB A;  1NT2 B;  3JQZ A;  1O9X A;  4GG2 A;  1H5W A;  5D7G A;  1J78 A;  4ZCG A;  3GA9 L;  1E7C A;  3LU8 A;  2QHB A;  1TF0 A;  1FOU A;  3UIV A;  2CKX A;  4FJC B;  2KBZ A;  3NVM A;  4NAW B;  5BPK A;  5GIP A;  4JK4 A;  4LA0 A;  3JRY A;  1E7H A;  1VFI A;  2ROH A;  4N0U D;  2BXO A;  2NQO A;  4Z9O A;  4ZC6 A;  4PO0 A;  2XMO A;  1MIY A;  4W4U B;  4GDK B;  2LOQ A;  4OTU A;  3TDL A;  5ID9 A;  3A75 A;  1MIV A;  2I30 A;  4L9Q A;  5GIN A;  1H9Z A;  5B5T A;  2DYM A;  1HK4 A;  3V09 A;  1E78 A;  2BXQ A;  3CX9 A;  2BXB A;  3A73 A;  4L8U A;  4EMX A;  3SIU B;  3MHH B;  3NVK A;  4ZUX V;  2VDB A;  5HOZ A;  4BKE A;  2Z8I A;  1E7B A;  3B9L A;  5FUO A;  1IJG A;  2YDF A;  4F5S A;  1J7E A;  1GNJ A;  4TQ1 A;  4WA6 B;  2VUF A;  3WHR A;  4DHX B;  1HK3 A;  5IJ5 A;  4FK5 B;  3NMU A;  2XSI A;  1BM0 A;  3WHS A;  4ZBK A;  2BXC A;  3H37 A;  2BXE A;  3LU7 A;  2DBW A;  3NVI A;  1VZS A;  3MHS B;  4BY9 C;  1HK1 A;  2EFH A;  2XVU A;  2XVQ A;  4LB9 A;  2BXA A;  3LU6 A;  4ZBR A;  2Z8K A;  3PLA A;  1LOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...