4W4UB

Structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase
publication title Uncovering the role of Sgf73 in maintaining SAGA deubiquitinating module structure and activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 37
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4w4uB00
3FWBC 4C31B 3FWCC 4W4UB 4WA6B 3MHHB 4FK5B 4DHXB 4ZUXV 3M99C 4MBEC 4FJCB 3KJLA 3KIKA 4FIPB 3MHSB
chains in the Genus database with same CATH superfamily
3H3AA 3V09A 2E0XA 4HGMB 1HK5A 2OZBB 3M99C 1JNBA 2XVVA 4FIPB 4JK4A 5IFOA 5B5TA 3BPJA 3B9MA 3SQJA 4TQ1A 2XMOA 2BXKA 1TXUA 4ZBQA 4G04A 3NVIA 1E7FA 1E78A 2BXLA 4ZCGA 2OT3A 4M70B 4J2VA 5ID9A 3SIVB 4I9OA 1MA9A 2E0YA 3A73A 5HOZA 4FK5B 2LQHA 4F5UA 1HA2A 2Z8KA 4ZBRA 1O9XA 1E7GA 1J7EA 4IW1A 5FUOA 2NNWA 4IW2A 1NT2B 2I2ZA 1HK4A 4K2CA 4N0UD 5IIXA 2BXOA 5GIOA 2DYMA 3G9KD 4N3ZA 1HK2A 1LOTA 2EFCA 1H5WA 4TQ0A 4Z69A 5DQFA 3SIUB 4DM0A 2BXAA 2DG5A 4LB2A 4BY9C 2QM6A 3UIVA 4ZUXV 1MIYA 3GA9L 2XVWA 4BKEA 1KDXA 4LA0A 1E7HA 2DYOA 3V03A 3ECPA 4LUFA 1MIWA 4K71A 1HK1A 1E7EA 1KXPD 3LU7A 2KBZA 3WHRA 2ROHA 2BXCA 2BXMA 2DBXA 3VQIA 3FWBC 2QMCA 1H9ZA 3FWCC 2DBWA 3LU6A 4S1YA 3H37A 4OTTA 5IJFA 4GG2A 2BXEA 1GNIA 5IJ5A 4OTUA 4D7XA 1MUSA 3GQXA 4MBEC 4FJCB 3PLAA 1SB0A 1J78A 3NMUA 1IJGA 2K0NA 2BXFA 2V36A 4C31B 2BXPA 4W4UB 2LXTA 3WHQA 1AO6A 2BXIA 3FNMA 1E7IA 4LB9A 1MIVA 2BXGA 3KJLA 5IJEA 2BXDA 3MHSB 2AJEA 2XVQA 1E7AA 2EFDA 2LXSA 2VUFA 3A75A 2EFEA 3JRYA 2LQIA 3NVMA 4NAWB 4GDXA 1N5UA 2VDBA 2BXHA 4L9KA 4F5TA 1MUHA 2BX8A 3ICXA 4LUHA 2LOQA 1BKEA 4OR0A 4WA6B 3CX9A 2BXBA 5BPKA 2Z8IA 3V08A 5GIPA 1FOUA 4N0FD 4GDLB 4G01A 5DBYA 1UORA 3MHHB 4F5VA 3NVKA 1LNSA 2GUTA 4L8UA 4OT2A 5IIHA 2I30A 2DBUA 3KIKA 4Z9OA 1KW2A 2XW0A 2EFHA 3W1SA 2QHBA 1TF0A 4ZC6A 1HK3A 2BXQA 4F5SA 4HGKA 4PO0A 2YDFA 2XVUA 4G03A 4GDKB 2AGHB 2KWFA 3GQUA 2BXNA 2CKXA 4DHXB 2NQOA 2VUEA 5GINA 3B9LA 4ZBKA 5IIUA 1E7BA 3JQZA 5D7GA 4EMXA 4L9QA 1GNJA 2XSIA 2JUHA 3LU8A 1E7CA 5ID7A 1MM8A 3WHSA 4E99A 1BM0A 5GHKA 3TDLA 2Z8JA 1VZSA 1BJ5A 1VFIA 2XW1A
chains in the Genus database with same CATH topology
3H3AA 3V09A 2E0XA 4HGMB 1HK5A 2OZBB 3M99C 1JNBA 2XVVA 4FIPB 4JK4A 5IFOA 5B5TA 3B9MA 3SQJA 4TQ1A 2XMOA 2BXKA 1TXUA 4ZBQA 4G04A 3NVIA 1E7FA 1E78A 2BXLA 4ZCGA 2OT3A 4M70B 4J2VA 5ID9A 3SIVB 1MA9A 2E0YA 3A73A 5HOZA 4FK5B 4F5UA 1HA2A 2Z8KA 4ZBRA 1O9XA 1E7GA 1J7EA 4IW1A 5FUOA 2NNWA 4IW2A 1NT2B 2I2ZA 1HK4A 4K2CA 4N0UD 5IIXA 2BXOA 5GIOA 2DYMA 3G9KD 4N3ZA 1HK2A 1LOTA 2EFCA 1H5WA 4TQ0A 4Z69A 5DQFA 3SIUB 2BXAA 2DG5A 4LB2A 4BY9C 2QM6A 3UIVA 4ZUXV 1MIYA 3GA9L 2XVWA 4BKEA 4LA0A 1E7HA 2DYOA 3V03A 4LUFA 1MIWA 4K71A 1HK1A 1E7EA 1KXPD 3LU7A 2KBZA 3WHRA 2ROHA 2BXCA 2BXMA 2DBXA 3VQIA 3FWBC 2QMCA 1H9ZA 3FWCC 2DBWA 3LU6A 4S1YA 3H37A 4OTTA 5IJFA 4GG2A 2BXEA 1GNIA 5IJ5A 4OTUA 3GQXA 4MBEC 4FJCB 3PLAA 1J78A 3NMUA 1IJGA 2V36A 2BXFA 4C31B 2BXPA 4W4UB 3WHQA 1AO6A 2BXIA 3FNMA 1E7IA 4LB9A 1MIVA 2BXGA 3KJLA 5IJEA 2BXDA 3MHSB 2AJEA 2XVQA 1E7AA 2EFDA 2VUFA 3JRYA 3A75A 2EFEA 3NVMA 4NAWB 4ZBKA 4GDXA 1N5UA 2VDBA 2BXHA 4L9KA 4F5TA 2BX8A 3ICXA 4LUHA 2LOQA 1BKEA 4OR0A 4WA6B 3CX9A 2BXBA 5BPKA 2Z8IA 3V08A 5GIPA 1FOUA 4N0FD 4GDLB 4G01A 5DBYA 1UORA 3MHHB 4F5VA 3NVKA 1LNSA 4L8UA 4OT2A 5IIHA 2I30A 2DBUA 3KIKA 4Z9OA 1KW2A 2XW0A 2EFHA 3W1SA 2QHBA 1TF0A 4ZC6A 1HK3A 2BXQA 4F5SA 4HGKA 4PO0A 2YDFA 2XVUA 4G03A 4GDKB 3GQUA 2BXNA 2CKXA 4DHXB 2NQOA 2VUEA 5GINA 3B9LA 5IIUA 1E7BA 3JQZA 5D7GA 4EMXA 4L9QA 1GNJA 2XSIA 2JUHA 3LU8A 1E7CA 5ID7A 3WHSA 4E99A 1BM0A 5GHKA 3TDLA 2Z8JA 1VZSA 1BJ5A 1VFIA 2XW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWB C;  4C31 B;  3FWC C;  4W4U B;  4WA6 B;  3MHH B;  4FK5 B;  4DHX B;  4ZUX V;  3M99 C;  4MBE C;  4FJC B;  3KJL A;  3KIK A;  4FIP B;  3MHS B; 
#chains in the Genus database with same CATH topology
 3H3A A;  3V09 A;  2E0X A;  4HGM B;  1HK5 A;  2OZB B;  3M99 C;  1JNB A;  2XVV A;  4FIP B;  4JK4 A;  5IFO A;  5B5T A;  3BPJ A;  3B9M A;  3SQJ A;  4TQ1 A;  2XMO A;  2BXK A;  1TXU A;  4ZBQ A;  4G04 A;  3NVI A;  1E7F A;  1E78 A;  2BXL A;  4ZCG A;  2OT3 A;  4M70 B;  4J2V A;  5ID9 A;  3SIV B;  4I9O A;  1MA9 A;  2E0Y A;  3A73 A;  5HOZ A;  4FK5 B;  2LQH A;  4F5U A;  1HA2 A;  2Z8K A;  4ZBR A;  1O9X A;  1E7G A;  1J7E A;  4IW1 A;  5FUO A;  2NNW A;  4IW2 A;  1NT2 B;  2I2Z A;  1HK4 A;  4K2C A;  4N0U D;  5IIX A;  2BXO A;  5GIO A;  2DYM A;  3G9K D;  4N3Z A;  1HK2 A;  1LOT A;  2EFC A;  1H5W A;  4TQ0 A;  4Z69 A;  5DQF A;  3SIU B;  4DM0 A;  2BXA A;  2DG5 A;  4LB2 A;  4BY9 C;  2QM6 A;  3UIV A;  4ZUX V;  1MIY A;  3GA9 L;  2XVW A;  4BKE A;  1KDX A;  4LA0 A;  1E7H A;  2DYO A;  3V03 A;  3ECP A;  4LUF A;  1MIW A;  4K71 A;  1HK1 A;  1E7E A;  1KXP D;  3LU7 A;  2KBZ A;  3WHR A;  2ROH A;  2BXC A;  2BXM A;  2DBX A;  3VQI A;  3FWB C;  2QMC A;  1H9Z A;  3FWC C;  2DBW A;  3LU6 A;  4S1Y A;  3H37 A;  4OTT A;  5IJF A;  4GG2 A;  2BXE A;  1GNI A;  5IJ5 A;  4OTU A;  4D7X A;  1MUS A;  3GQX A;  4MBE C;  4FJC B;  3PLA A;  1SB0 A;  1J78 A;  3NMU A;  1IJG A;  2K0N A;  2BXF A;  2V36 A;  4C31 B;  2BXP A;  4W4U B;  2LXT A;  3WHQ A;  1AO6 A;  2BXI A;  3FNM A;  1E7I A;  4LB9 A;  1MIV A;  2BXG A;  3KJL A;  5IJE A;  2BXD A;  3MHS B;  2AJE A;  2XVQ A;  1E7A A;  2EFD A;  2LXS A;  2VUF A;  3A75 A;  2EFE A;  3JRY A;  2LQI A;  3NVM A;  4NAW B;  4GDX A;  1N5U A;  2VDB A;  2BXH A;  4L9K A;  4F5T A;  1MUH A;  2BX8 A;  3ICX A;  4LUH A;  2LOQ A;  1BKE A;  4OR0 A;  4WA6 B;  3CX9 A;  2BXB A;  5BPK A;  2Z8I A;  3V08 A;  5GIP A;  1FOU A;  4N0F D;  4GDL B;  4G01 A;  5DBY A;  1UOR A;  3MHH B;  4F5V A;  3NVK A;  1LNS A;  2GUT A;  4L8U A;  4OT2 A;  5IIH A;  2I30 A;  2DBU A;  3KIK A;  4Z9O A;  1KW2 A;  2XW0 A;  2EFH A;  3W1S A;  2QHB A;  1TF0 A;  4ZC6 A;  1HK3 A;  2BXQ A;  4F5S A;  4HGK A;  4PO0 A;  2YDF A;  2XVU A;  4G03 A;  4GDK B;  2AGH B;  2KWF A;  3GQU A;  2BXN A;  2CKX A;  4DHX B;  2NQO A;  2VUE A;  5GIN A;  3B9L A;  4ZBK A;  5IIU A;  1E7B A;  3JQZ A;  5D7G A;  4EMX A;  4L9Q A;  1GNJ A;  2XSI A;  2JUH A;  3LU8 A;  1E7C A;  5ID7 A;  1MM8 A;  3WHS A;  4E99 A;  1BM0 A;  5GHK A;  3TDL A;  2Z8J A;  1VZS A;  1BJ5 A;  1VFI A;  2XW1 A; 
#chains in the Genus database with same CATH homology
 3H3A A;  3V09 A;  2E0X A;  4HGM B;  1HK5 A;  2OZB B;  3M99 C;  1JNB A;  2XVV A;  4FIP B;  4JK4 A;  5IFO A;  5B5T A;  3B9M A;  3SQJ A;  4TQ1 A;  2XMO A;  2BXK A;  1TXU A;  4ZBQ A;  4G04 A;  3NVI A;  1E7F A;  1E78 A;  2BXL A;  4ZCG A;  2OT3 A;  4M70 B;  4J2V A;  5ID9 A;  3SIV B;  1MA9 A;  2E0Y A;  3A73 A;  5HOZ A;  4FK5 B;  4F5U A;  1HA2 A;  2Z8K A;  4ZBR A;  1O9X A;  1E7G A;  1J7E A;  4IW1 A;  5FUO A;  2NNW A;  4IW2 A;  1NT2 B;  2I2Z A;  1HK4 A;  4K2C A;  4N0U D;  5IIX A;  2BXO A;  5GIO A;  2DYM A;  3G9K D;  4N3Z A;  1HK2 A;  1LOT A;  2EFC A;  1H5W A;  4TQ0 A;  4Z69 A;  5DQF A;  3SIU B;  2BXA A;  2DG5 A;  4LB2 A;  4BY9 C;  2QM6 A;  3UIV A;  4ZUX V;  1MIY A;  3GA9 L;  2XVW A;  4BKE A;  4LA0 A;  1E7H A;  2DYO A;  3V03 A;  4LUF A;  1MIW A;  4K71 A;  1HK1 A;  1E7E A;  1KXP D;  3LU7 A;  2KBZ A;  3WHR A;  2ROH A;  2BXC A;  2BXM A;  2DBX A;  3VQI A;  3FWB C;  2QMC A;  1H9Z A;  3FWC C;  2DBW A;  3LU6 A;  4S1Y A;  3H37 A;  4OTT A;  5IJF A;  4GG2 A;  2BXE A;  1GNI A;  5IJ5 A;  4OTU A;  3GQX A;  4MBE C;  4FJC B;  3PLA A;  1J78 A;  3NMU A;  1IJG A;  2V36 A;  2BXF A;  4C31 B;  2BXP A;  4W4U B;  3WHQ A;  1AO6 A;  2BXI A;  3FNM A;  1E7I A;  4LB9 A;  1MIV A;  2BXG A;  3KJL A;  5IJE A;  2BXD A;  3MHS B;  2AJE A;  2XVQ A;  1E7A A;  2EFD A;  2VUF A;  3JRY A;  3A75 A;  2EFE A;  3NVM A;  4NAW B;  4ZBK A;  4GDX A;  1N5U A;  2VDB A;  2BXH A;  4L9K A;  4F5T A;  2BX8 A;  3ICX A;  4LUH A;  2LOQ A;  1BKE A;  4OR0 A;  4WA6 B;  3CX9 A;  2BXB A;  5BPK A;  2Z8I A;  3V08 A;  5GIP A;  1FOU A;  4N0F D;  4GDL B;  4G01 A;  5DBY A;  1UOR A;  3MHH B;  4F5V A;  3NVK A;  1LNS A;  4L8U A;  4OT2 A;  5IIH A;  2I30 A;  2DBU A;  3KIK A;  4Z9O A;  1KW2 A;  2XW0 A;  2EFH A;  3W1S A;  2QHB A;  1TF0 A;  4ZC6 A;  1HK3 A;  2BXQ A;  4F5S A;  4HGK A;  4PO0 A;  2YDF A;  2XVU A;  4G03 A;  4GDK B;  3GQU A;  2BXN A;  2CKX A;  4DHX B;  2NQO A;  2VUE A;  5GIN A;  3B9L A;  5IIU A;  1E7B A;  3JQZ A;  5D7G A;  4EMX A;  4L9Q A;  1GNJ A;  2XSI A;  2JUH A;  3LU8 A;  1E7C A;  5ID7 A;  3WHS A;  4E99 A;  1BM0 A;  5GHK A;  3TDL A;  2Z8J A;  1VZS A;  1BJ5 A;  1VFI A;  2XW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...