2LQHA

Nmr structure of foxo3a transactivation domains (cr2c-cr3) in complex with cbp kix domain (2b3l conformation)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREB-binding protein
publication title Structures of KIX domain of CBP in complex with two FOXO3a transactivation domains reveal promiscuity and plasticity in coactivator recruitment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 33
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02172 KIX KIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.20 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Coactivator CBP, KIX domain 2lqhA00
2GUTA 4D7XA 2K0NA 1SB0A 2AGHB 2KWFA 4I9OA 1KDXA 2LQHA 2LXSA 2LQIA 2LXTA
chains in the Genus database with same CATH superfamily
4EMXA 3SIVB 4K2CA 4IW2A 2KWFA 3H3AA 4NAWB 1J78A 1IJGA 1UORA 3MHHB 2Z8IA 4G01A 4GDLB 5ID9A 1E7CA 5GIPA 1H9ZA 4FJCB 3UIVA 4S1YA 2BXNA 1BKEA 4FK5B 2XVWA 2DBXA 2BXPA 2DYMA 3A73A 1N5UA 2I2ZA 1HA2A 2XSIA 4G03A 4TQ1A 5IJ5A 4FIPB 4C31B 2QM6A 4OT2A 3G9KD 2BXBA 4W4UB 1MM8A 2EFHA 3M99C 2BXHA 5IJEA 1O9XA 2LOQA 1MIVA 1TF0A 2I30A 3TDLA 5IJFA 2BXAA 1HK5A 4LUHA 1E78A 2BXGA 2OT3A 4D7XA 1SB0A 2AGHB 5D7GA 3V03A 5FUOA 2BXQA 5GIOA 2LQIA 3FWCC 5IIHA 2Z8JA 2GUTA 2VUFA 2BXOA 1AO6A 1MA9A 2BXEA 1BM0A 4BY9C 5DBYA 2DYOA 3V08A 3LU6A 2LXSA 4GG2A 3NVIA 2AJEA 1FOUA 4L8UA 2CKXA 3W1SA 1HK4A 2XW1A 3B9LA 3V09A 1VFIA 3BPJA 4N0FD 3PLAA 4Z9OA 1E7EA 3H37A 4ZCGA 4HGKA 4N3ZA 4PO0A 5BPKA 1HK1A 3WHRA 5HOZA 4Z69A 1TXUA 1J7EA 5IIXA 1E7HA 1JNBA 4BKEA 2NNWA 4L9QA 1E7FA 1MIWA 4ZUXV 3CX9A 2ROHA 3NVKA 2EFDA 4GDXA 1E7IA 1E7GA 2KBZA 2XW0A 4JK4A 3GQUA 4LB9A 5DQFA 2QHBA 1NT2B 2BX8A 2K0NA 3JRYA 4L9KA 2Z8KA 1KDXA 2LQHA 2EFEA 2DBUA 3WHQA 2YDFA 2BXMA 2EFCA 2DBWA 4LUFA 5ID7A 2E0XA 1GNJA 2BXLA 4HGMB 2VDBA 2BXKA 3FNMA 5IFOA 2BXFA 3GA9L 4OR0A 1MUHA 2BXCA 3NVMA 4ZBKA 1VZSA 4TQ0A 4LA0A 1KXPD 2XMOA 4ZC6A 1MUSA 2BXDA 5GINA 2BXIA 2JUHA 4DHXB 3VQIA 5B5TA 1GNIA 3B9MA 1E7AA 2XVUA 2XVVA 3LU7A 4ZBRA 2OZBB 4F5TA 2E0YA 4J2VA 1BJ5A 2VUEA 4N0UD 4ZBQA 3KIKA 4E99A 4OTUA 4LB2A 2XVQA 4F5SA 3SIUB 5GHKA 5IIUA 2LXTA 1E7BA 2DG5A 2QMCA 3JQZA 1LOTA 3WHSA 3FWBC 1HK3A 1LNSA 1KW2A 3MHSB 4I9OA 1HK2A 3GQXA 4GDKB 4G04A 4OTTA 2NQOA 3LU8A 4MBEC 4F5VA 3NMUA 3ECPA 3SQJA 4F5UA 3ICXA 4WA6B 4DM0A 1H5WA 4K71A 2V36A 3A75A 3KJLA 4IW1A 4M70B 1MIYA
chains in the Genus database with same CATH topology
2GUTA 4D7XA 2K0NA 1SB0A 2AGHB 2KWFA 4I9OA 1KDXA 2LQHA 2LXSA 2LQIA 2LXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUT A;  4D7X A;  2K0N A;  1SB0 A;  2AGH B;  2KWF A;  4I9O A;  1KDX A;  2LQH A;  2LXS A;  2LQI A;  2LXT A; 
#chains in the Genus database with same CATH topology
 4EMX A;  3SIV B;  4K2C A;  4IW2 A;  2KWF A;  3H3A A;  4NAW B;  1J78 A;  1IJG A;  1UOR A;  3MHH B;  2Z8I A;  4G01 A;  4GDL B;  5ID9 A;  1E7C A;  5GIP A;  1H9Z A;  4FJC B;  3UIV A;  4S1Y A;  2BXN A;  1BKE A;  4FK5 B;  2XVW A;  2DBX A;  2BXP A;  2DYM A;  3A73 A;  1N5U A;  2I2Z A;  1HA2 A;  2XSI A;  4G03 A;  4TQ1 A;  5IJ5 A;  4FIP B;  4C31 B;  2QM6 A;  4OT2 A;  3G9K D;  2BXB A;  4W4U B;  1MM8 A;  2EFH A;  3M99 C;  2BXH A;  5IJE A;  1O9X A;  2LOQ A;  1MIV A;  1TF0 A;  2I30 A;  3TDL A;  5IJF A;  2BXA A;  1HK5 A;  4LUH A;  1E78 A;  2BXG A;  2OT3 A;  4D7X A;  1SB0 A;  2AGH B;  5D7G A;  3V03 A;  5FUO A;  2BXQ A;  5GIO A;  2LQI A;  3FWC C;  5IIH A;  2Z8J A;  2GUT A;  2VUF A;  2BXO A;  1AO6 A;  1MA9 A;  2BXE A;  1BM0 A;  4BY9 C;  5DBY A;  2DYO A;  3V08 A;  3LU6 A;  2LXS A;  4GG2 A;  3NVI A;  2AJE A;  1FOU A;  4L8U A;  2CKX A;  3W1S A;  1HK4 A;  2XW1 A;  3B9L A;  3V09 A;  1VFI A;  3BPJ A;  4N0F D;  3PLA A;  4Z9O A;  1E7E A;  3H37 A;  4ZCG A;  4HGK A;  4N3Z A;  4PO0 A;  5BPK A;  1HK1 A;  3WHR A;  5HOZ A;  4Z69 A;  1TXU A;  1J7E A;  5IIX A;  1E7H A;  1JNB A;  4BKE A;  2NNW A;  4L9Q A;  1E7F A;  1MIW A;  4ZUX V;  3CX9 A;  2ROH A;  3NVK A;  2EFD A;  4GDX A;  1E7I A;  1E7G A;  2KBZ A;  2XW0 A;  4JK4 A;  3GQU A;  4LB9 A;  5DQF A;  2QHB A;  1NT2 B;  2BX8 A;  2K0N A;  3JRY A;  4L9K A;  2Z8K A;  1KDX A;  2LQH A;  2EFE A;  2DBU A;  3WHQ A;  2YDF A;  2BXM A;  2EFC A;  2DBW A;  4LUF A;  5ID7 A;  2E0X A;  1GNJ A;  2BXL A;  4HGM B;  2VDB A;  2BXK A;  3FNM A;  5IFO A;  2BXF A;  3GA9 L;  4OR0 A;  1MUH A;  2BXC A;  3NVM A;  4ZBK A;  1VZS A;  4TQ0 A;  4LA0 A;  1KXP D;  2XMO A;  4ZC6 A;  1MUS A;  2BXD A;  5GIN A;  2BXI A;  2JUH A;  4DHX B;  3VQI A;  5B5T A;  1GNI A;  3B9M A;  1E7A A;  2XVU A;  2XVV A;  3LU7 A;  4ZBR A;  2OZB B;  4F5T A;  2E0Y A;  4J2V A;  1BJ5 A;  2VUE A;  4N0U D;  4ZBQ A;  3KIK A;  4E99 A;  4OTU A;  4LB2 A;  2XVQ A;  4F5S A;  3SIU B;  5GHK A;  5IIU A;  2LXT A;  1E7B A;  2DG5 A;  2QMC A;  3JQZ A;  1LOT A;  3WHS A;  3FWB C;  1HK3 A;  1LNS A;  1KW2 A;  3MHS B;  4I9O A;  1HK2 A;  3GQX A;  4GDK B;  4G04 A;  4OTT A;  2NQO A;  3LU8 A;  4MBE C;  4F5V A;  3NMU A;  3ECP A;  3SQJ A;  4F5U A;  3ICX A;  4WA6 B;  4DM0 A;  1H5W A;  4K71 A;  2V36 A;  3A75 A;  3KJL A;  4IW1 A;  4M70 B;  1MIY A; 
#chains in the Genus database with same CATH homology
 2GUT A;  4D7X A;  2K0N A;  1SB0 A;  2AGH B;  2KWF A;  4I9O A;  1KDX A;  2LQH A;  2LXS A;  2LQI A;  2LXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...