2DYOA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-57) complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
286
structure length
269
Chain Sequence
HMNDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPLIWNKIKSFLSFDPEKYFWFEHNKTPIPWNYPVGVLFDCLAGKSAVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKEGDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy protein 5
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover/protein turnover
total genus 79
structure length 269
sequence length 286
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dyoA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dyoA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dyoA01
1SE9A 4AJWA 4FJYA 3TCAA 2JWZA 2A4ZA 4FULA 3QJZA 3K9OB 4BOSC 4FADA 4M8MA 4PS8A 4HPMB 4RMAA 3V6EB 1NI2A 4GU2A 1V5TA 1UD7A 4MELA 2LGXA 1EF5A 4II2B 4JLCA 1S1QB 2BYFA 2FCQA 2NR2A 4DHZE 1OEYA 1GJZA 2AYOB 5CHWA 3O65B 4W9LA 3VTWA 3DDCB 3ZNHB 3QWZB 1TBEA 2YLMA 3ZNID 5LXIB 3KYCD 3TL5A 3N30A 1P1AA 2BWFA 5E6PA 4KIKA 2FCMA 4FN2A 3UIPB 2ZVOA 3ZRCA 2K8BA 4ZRJA 2DAJA 2DENB 2L05A 3WA0A 3I3TB 2C7HA 2KZRA 1NDDA 1E7VA 3QK0A 4W9CA 2KMCA 2M0XA 2XBBC 3HIZA 2MCNB 3AI5A 4W9HA 3ZDTA 1WMHA 4WAAA 4GDLA 1P9DU 2HD5B 2KTRA 3PGEA 3DBLI 1A5RA 4FHKA 1KLVA 2BF8B 3RUIB 3QC8B 4BFRA 4LJPB 1UELA 2GBKA 2JUOA 3GOEA 4DDGD 2L3ZA 1WE6A 3EECA 1NBFC 3ENEA 5LXHA 2M8SA 3AXCA 3EHVA 4KZCA 4AWJA 3VQIA 1V81A 2G45B 2FUHB 1WJ4A 2DYBA 2KJ6A 2WYQA 3SHQA 1EO6A 1U4AA 2KTRB 2KDIA 2KLGA 3R3MA 3L54A 2DHZA 3VAWA 1WXVA 3ML8A 4HDOA 4M8NA 3KH0A 4ICUA 4I6LB 2D2QA 4GMVA 2KQSA 4WJQA 2KX3A 3IFWB 5L83A 2EMSA 1WGDA 3CF6E 1WY8A 3OJ4B 2M1MA 4K7SA 4MGKE 5TR5A 2ZPNA 4G3XB 4WJOA 4W9GA 3VUWA 2KWCA 3QIJA 3MHSD 2LUEA 4IM0A 2L0TA 3WALA 1E8XA 2IZVB 3HK0A 4LDTB 2OOBB 4ZDVA 3PLUA 2ZVNA 4FHJA 4E71A 3UQBA 2D3GA 2MWSB 2FCSA 3RCZA 3VUXA 4AJYB 2D10A 3PT2B 2KFJA 2DAFA 3VHTC 2N7DA 2GOWA 2R2OA 2BPSA 2N4FA 1F9JA 2C9WB 3AULA 4DHJB 3M3JA 4KDIC 5DPTA 2K6DB 3PHXB 1L2NA 4KDLB 3APDA 4WJNA 5E6OA 4WQOB 2GMIC 3SDLC 2J0MA 3W1SC 1LM8B 2BGFA 4IG7B 3VVWB 2ZZPB 2O2VA 2KVRA 2GBJA 3V6CB 3D32A 3R7RA 1MG8A 2LD9A 3R7QA 4EZKA 3N3KB 2ZEQA 2FIFA 4W9DA 4DHZB 2JVCA 2KANA 1GNUA 2V4LA 3H7PA 4HXDA 1WZ3A 1XT9B 2RR9A 1V49A 2OJRA 4CO7A 2N1VA 4IC7B 4IWPA 2K1FA 2MX2A 4A20A 3RZWC 4NQKE 2KC1A 4WJPA 2KDEB 3U8ZA 4EUTA 5FR6A 2IY0B 2O2VB 5DPWA 1Y8RC 2Z59B 2FNJB 3CSTA 2EKEC 3EC8A 2CHXA 4RM8A 2Y5BB 3Q3JA 5LLIA 3UIOB 2JF5A 4HPLB 1E5WA 1UGMA 2C7NB 2L00B 3PZDA 3H7PB 3PRZA 3VUYA 2NBUA 3PREA 2CU1A 2MSED 3KYDD 4KVGB 4RM9A 4DDID 1ZGUB 2JZ3B 2AL3A 2KD0A 4GGQA 3T9LA 3L13A 2J0KA 4ANWA 3HHMA 3DCGA 3PTFC 4JIOU 4GDKA 2KDBA 4ZYNA 3BY4B 4IUMB 1WX7A 2N9XA 2GBMA 4BKTA 4WWNA 4DK5A 2BKRB 1GC6A 2WX0A 2MBHA 1RRBA 3ZO5B 1G6JA 3PV1A 4NAWA 3SD5A 3CMMB 4FA6A 1AARA 4NJ6A 5J2RA 2C5LC 5KHOA 1H4RA 4HJKA 2DYMA 3X0WA 3WAPA 1M94A 3UINB 5L95C 4OVUA 3U7DA 3CSFA 4A3OA 1X1MA 3QCAA 4N9F4 2IO1B 1R4MI 5C23A 1ZKHA 5AEKB 2PEAA 3ZUNA 2XK5A 4KZ0A 4NAWB 1ZW7A 3DOWA 1WR1A 1E8ZA 1YJ1A 3ALBA 3OJ3A 4HWIB 3S2AA 3A1QA 3NZSA 2NBVB 3KVFB 5AZGA 1J19A 1WF9A 2I1KA 3ZVVA 4PS3A 3JVZX 4I6PA 2BKFA 2PJHA 2JPHA 1EF1A 2MBQA 2KNBA 4KIKB 4HCNB 2C60A 3UQAA 1HE8A 4J6IA 2VRRB 3WAMA 3KUCB 1WGYA 1WI0A 2LZ6A 2PE9A 3BINA 4DBGA 1V80A 1YD8U 2M4NA 3DPDA 3SU8X 5AZHA 3KUDB 1R4NI 4GSWA 4MM3A 1V5OA 1WMHB 1WE7A 3RZFA 4GDLB 3IBEA 2JY6A 2CKHB 1E8WA 3H9DA 4XX5A 4TQ1A 2CS4A 4G50A 3L17A 3ZNGC 2N1WA 1YX5B 3WANA 2MA9B 1WXMA 1YIWA 5JH5C 1C3TA 2KK8A 3IVFA 1JRUA 4TV3A 2YVCA 1WZ0A 3PRPB 5E6NA 2EMTA 2LJ5A 1KJTA 4JQWC 2FCNA 2LASA 4GOCA 1WJ6A 2DZIA 4LDTD 2KQ7A 3PRMB 3X23A 3KUZA 4ANXA 3L16A 3U30A 2CHWA 2CHZA 2KJRA 3RYTA 3ONSA 1XD3B 2KWUB 2I1JA 3H1UA 2LRUA 3RT3B 3HM6X 4DHJD 1RFAA 3K9PB 2LVPA 2M17A 3B0AA 4G0NB 1P98A 2KX0A 2MQJA 2R2QA 2K39A 3H6NA 2NCNA 4GB9A 4MEMA 4MSQB 4ANVA 1YQBA 1IP9A 1WFYA 3B08A 2WDTB 3GZNI 2MBBB 1KM7A 2JRHA 1E7UA 4K7WA 4IW0A 4K81A 4II3B 5G55A 4BOZB 2QHOA 4IWOA 2DZJA 1VD2A 1YX6B 2UWQA 1SIFA 1OEYJ 2ZNVB 4KV2A 1ISNA 3AU5A 2K6QA 4DWFA 2IO2B 3IHPC 3MJWA 4LJOB 1P0RA 2BYVE 3ZIMA 4EZLA 3V62A 5D2MB 2N9EB 1KOTA 2PPHA 4EZJA 4JL9A 2BWES 4MGZE 4HLEA 4K7UA 2RD0A 1WYWB 1LXDA 1WJNA 3Q3FA 4F7ZA 4KSKC 2O6VA 4GIVA 4AP4C 2J7QB 3TMPB 3VH3B 3DBHI 1EUVB 4XZ4A 5CTRC 2IY1B 3TIXA 3DBSA 2NS5A 5D7GA 1V2YA 1J0GA 1GG3A 1LQBA 3APCA 3PLVA 3DBRI 3DVGY 3JW0X 4MSMB 5D6JB 2O6VB 3AU4A 2KOXA 3A9KA 3M62B 2KDFB 3VDZA 2LI5A 3UGBB 1CMXB 4MH0E 2LXCA 4BKSA 1TZ1A 4NQLB 4IWQA 4NNJB 5C1ZA 2ZNVC 2ZPYA 1Q5WB 1WR6E 4I6NB 4M0WB 5BO4B 2ASQA 2ZCCA 2KC2A 4EOYA 3QA8A 2DX5B 4MDKE 4K1RB 1FXTB 2G4DB 3ZTCA 4GDKB 2L7RA 4FLHA 4F8CB 4BBNF 3EFUA 4W9IA 1WM3A 2MLBA 2V3SA 2C7MB 3DVNU 3L10B 5JHAA 1WM2A 5JZEB 3RULA 2FIDA 2V1YA 2IYDB 3ZW3A 4CHKA 1BT0A 2KWVB 4WWPA 3VXWA 3QX1A 2D07B 2LVQA 2RPQA 1GUAB 4NPNA 2IBIB 5DPSA 4MJSA 3ML9A 4IM2A 2HJ8A 2KN5A 2Z0EB 3A33B 3ZDMC 5IA7A 3M95A 3B1LX 2UYZB 2XEWA 1T0YA 2HTHA 2LGYA 4WWOA 3ZNZB 4MGIE 3VH4B 1PQSA 2XK5B 3APFA 2J0JA 3DQVA 2WX1A 4BBNC 3TJPA 3A1QB 1WXAA 1C1YB 1P3QU 3PHWB 4E74A 1WH3A 2BYEA 1S3SG 3NS8A 1RLFA 1WGGA 2DZKA 4MJSB 4PS7A 4TKNA 3TBLD 1Z2MA 3A4RA 3R66C 4PYUA 4HDQA 3VTUA 1WRDB 3RD2A 2RSUA 3QAQA 2MW5A 3JSVA 3W1YA 5CX3A 2N9PC 3N32A 3DVGX 2A5UA 3NZUA 4GN1A 2GBRA 2IO0B 2K25A 3LDZE 1UZXB 5AZFA 2ZCBA 4XC2A 2DYOA 2CR5A 1TTNA 3NOBA 2HE7A 2KLCA 4ASWC 5DCNA 2KXJA 1UBIA 2AEHA 1VCBA 4ZRIA 2N7EA 2LVOA 3W1SA 2L76A 2KO3A 3JSVB 5CHFA 3QQ8B 4X57B 3NHEB 2L0FA 3KW5B 1K8RB 1UH6A 3QARA 1QZEA 1WGRA 2JXXA 4W9JA 3IG3A 3QHTA 2MBEA 2JRIB 3VFKA 4CYEA 3ZKJC 2K8HA 1XQQA 1Q0WB 1L7YA 2K8CA 4NJ7A 1WX8A 2KTFA 4YL8A 5DPRA 3ZLZA 1D3ZA 2KKCA 4HVBA 5GMVA 4EKUA 2MP2A 1WIAA 2L8JA 3ZRFA 3A9JA 1V86A 1UBQA 3MTNB 3P2BA 4A3PA 2GBNA 3OAWA 2FAZA 1IPGA 2NPTA 1WX9A 4DXAB 3VTVA 5D94A 2KHWB 4HK2A 1V6EA 2G4SA 1TGZB 2LGDA 1OTRB 3UF8A 3V61A 4B95A 5J18A 2MP2B 4BVUC 2REXA 1WXSA 3A9JB 2D11A 2LRWA 4G11A 4FBJB 3NY5A 3T8MA 2PE6B 2RGFA 2DZMA 2MBOA 2NPTB 5CHVC 4W9EA 1SGHA 1WJUA 3WIMA 2G3QB 3ECIA 1OQYA 4LCDE 4GXBA 1H8CA 4P7IA 2KFKA 4MGYE 4TQ0A 2NVUI 3A4SC 4EEWA 5J17A 4HCPB 2JT4B 4E3CA 2Z0DB 3L08A 3PSEB 2KJHB 4PYZA 1GC7A 2KMAA 3PS6A 5IAAC 4AOFA 1RAXA 1IYFA 1V9JA 1I42A 3ZTDA 3JYUA 2O6VD 4ANUA 2IO3B 1E90A 3PVLA 4B9KA 2WWZA 4ZRKA 4URKA 5HKHA 2KFKB 2LXAA 1LFDA 2AWTA 2JZZA 1OGWA 3H7SA 4IM3A 1E8YA 4TUUA 1Z5SB 4ICVA 2B3AA 3DVNV 4B6WA 1Q1OA 1WGHA 3L0WB 4EFOA 4KSLC 4NY0A 3C0RB 4FJVB 4JGHB 3HM3A 4OVVA 4FJZA 1J8CA 3OLMD 2ZJDA 4BKSD 3WAOA 4AUQC 2W9NA 3LJ3A 3PPAA 5JHBA 1I35A 5EDSA 5KHQA 5G2NA 3A9KB 4BKGA 2AL6A 4F1SA 3M63B 4W9KA 2MRPA 3V60A 4W9FA 2NBWB 2LWPA
chains in the Genus database with same CATH superfamily
2PKOA 4K3CA 3TCAA 4A6QA 1JNBA 5BMGA 4M8MA 4PS8A 4HPMB 4MELA 1YOVB 1EF5A 4JLCA 2FCQA 3MHHB 3VTWA 2I30A 1QOBA 1E7AA 4WWMA 3TL5A 3N30A 1MUSA 4KKJA 2KBZA 4FN2A 5IIXA 2WQYB 2ZVOA 1HA2A 2K8BA 3RI7C 3TEWA 2DAJA 2DENB 1NEKB 3WA0A 3I3TB 4OZCA 1E7FA 2KZRA 1VZ8A 1NDDA 1NENB 1E7VA 3QK0A 4W9CA 2KMCA 1VZ6A 3AI5A 1ET9A 1H9ZA 2K22A 1UWMA 2KTRA 3MHZA 1A5RA 3BIID 5TSSA 3PO0A 3RUIB 3IAM1 2GBKA 2JUOA 2CKXA 3JQZA 2L3ZA 1MHXA 2M8SA 3AXCA 3EHVA 4LNKA 2G45B 1ZPSA 2KJ6A 2PTLA 2WYQA 4GDXA 2E3TA 2KLGA 3GB1A 1E7GA 4HDOA 2KMMA 3FKYA 4MBEC 4C00A 3UIVA 1WGDA 2QSDA 3CF6E 1KH0A 2M1MA 2VH2A 4G3XB 3BVMA 4W9GA 2E6XA 3VUWA 2LMCA 2LUEA 1LO5D 5IJEA 2I38A 3HK0A 4LDTB 1C4PA 4ZDVA 2XVUA 1FPYA 2MWSB 1BXTA 3P42A 3VHTC 1RFKA 2N7DA 2N4FA 1F9JA 4DHJB 2K6DB 3AEDB 3IT6B 4ITKA 4WJNA 3SDLC 4S17A 2ZZPB 3R2IA 2KWDA 3V6CB 1MG8A 3R7QA 1EU3A 1OFFA 2KT7A 2ZEQA 1D5XC 4C56C 1TJEA 4HXDA 3B9MA 2RR9A 1FXIA 2N1VA 4IC7B 3A73A 3V08A 2MX2A 2INDC 4IWPA 4NQKE 2BS4B 2KDEB 4RM8A 1V1PA 1E5WA 2C7NB 3V3XA 3PZDA 3H7PB 3PRZA 4KVGB 4IKGA 1K50A 2AL3A 2J0KA 3N1XC 3DCGA 3PTFC 4JIOU 3BY4B 1ZOYB 4WWNA 2BKRB 1GC6A 2EFEA 2MBHA 2WDVB 3VR8B 3SD5A 3CMMB 5J2RA 1AARA 1L6VA 1H4RA 3X0WA 3WAPA 4OZBA 3DBRB 4OVUA 4Z69A 4WA6B 4N9F4 1FOUA 1NT2B 1O9XA 5C23A 2K5PA 4TSSA 3Q3NC 1ZW7A 4M01A 1GPXA 1MIWA 2LFIA 5FR3A 3ALBA 1DOXA 3NZSA 2OJWA 3I5JC 2I1KA 1DOYA 3JVZX 2BKFA 3W5UB 4M00A 2MBQA 2KNBA 1L5PA 1CZPA 3BINA 1YD8U 2MJ3A 3ZYYX 4BZAA 4GSWA 2SEBD 3AEFB 4NZLB 3RZFA 2CS4A 2N1WA 1YX5B 4HRSA 1HQRD 2ROHA 1HA5A 3IVFA 2BXQA 5E6NA 2EMTA 2LJ5A 3AE9B 4JQWC 1V1OA 2MJEA 3NVZA 2TSSA 5I4DA 2WS3B 2CHZA 4A55A 2XNAC 3HM6X 3K9PB 2LVPA 3B0AA 2M17A 5BYRA 2OZBB 3H6NA 1E0ZA 1MPEA 4MEMA 3MJ5A 4MSQB 2Y3AA 4ANVA 1WFYA 1FCCC 3LU8A 1UNSA 4BOZB 4J2VA 1KW2A 2DZJA 4XGAB 4B0EA 1E7CA 2UWQA 5IO9A 2K6QA 2IO2B 3ZIMA 1P0RA 2BYVE 2GLSA 4MT5A 3BYTB 2RDGA 1C79A 4JL9A 2BWES 4K7UA 4ACFA 4KSKC 4ZUXV 1WXQA 3RN9C 3DBHI 1EUVB 3Q3MC 4HGKA 4XZ4A 2IY1B 2NS5A 5D7GA 4JK4A 1V2YA 4BAXA 4AS1A 1GG3A 2FE8A 2PMVA 1EU4A 2KYWA 3APCA 3JW0X 5D6JB 3SQJA 3NVMA 1VRAB 2LXCA 1CQVA 4BKSA 4H2AA 3ZQ4A 2XVVA 4I6NB 2ASQA 2ZCCA 4N58A 3N1ZC 4MDKE 2JXTA 4L2YA 2XW1A 3EFUA 3AECB 2MLBA 3DVNU 1T0QC 2L52A 3MC9A 5JZEB 3RULA 2FIDA 2IYDB 1QT9A 2KWVB 4WWPA 4ARIA 3U2SC 2IBIB 1YJJA 2KN5A 3A33B 2XEWA 1T0YA 3BWUD 4MGIE 2XK5B 3APFA 3NJTA 3PHWB 1WGGA 3TBLD 3VTUA 2KVZA 2WXIA 1WRDB 4C7YA 2MW5A 1ET6A 4RF0A 3N32A 2YDFA 4GN1A 2K25A 4O1NA 2WP9B 3LU7A 2DYOA 1UF0A 1H5WA 2BQQA 2IDYA 4YSZB 4ASWC 2KXJA 1UBIA 2PW9A 2KO3A 1BM0A 1J7BA 3NHEB 2L0FA 1JMLA 3QARA 1WGRA 2JXXA 1YQ3B 3QHTA 2MBEA 4ZCGA 2WXRA 1MIYA 1MHHE 2MJDA 2WXLA 2WXKA 4NJ7A 2BX8A 3ZLZA 1KRHA 2UU7A 2W3RA 1XLNA 3I57A 2MP2A 3A9JA 4LB9A 4M02A 4D2KA 2HDEA 1WX9A 2KHWB 1CK1A 4B95A 1OTRB 3UF8A 1SE4A 1C76A 2WLBA 3P1MA 3T8MA 3C8YA 4XYCA 2AJEA 2MBOA 4LCDE 2VUEA 2INPE 1B1ZA 2Z0DB 3L08A 1GC7A 4YTNB 5D3DA 5FUOA 2IO3B 4B9KA 4D7XA 1Q10A 2WWZA 3Q2AC 1TY2A 3TMPB 3M99C 1OGWA 4IM3A 4TUUA 1Z5SB 1KDXA 3DVNV 1EM7A 3L0WB 3Q8FA 3J9CA 4JGHB 3HM3A 1MG4A 4OVVA 4L23A 3OLMD 4PK1A 2ZJDA 4AUQC 3LJ3A 5EDSA 3A9KB 4BKGA 2AL6A 4F1SA 2NQOA 2D3CA 2MRPA 2BXFA 1J7AA 1QILA 1LOTA 4FK5B 1AWDA 2BB5A 4AJWA 3V6EB 2M0AA 1V5TA 2LHDA 3NVVA 2W82A 2BS2B 1K51A 1UD7A 3AE6B 1FCLA 2LGXA 2Q5WD 3GP7A 4II2B 2I2YA 2NR2A 4DHZE 4LK0M 2BXNA 3DDCB 1QOFA 3QWZB 2JX5A 5DQFA 1L6UA 4LLGM 1QQRA 4LB2A 3ZGZA 1R4MB 4N0UD 4P6VF 2M0XA 2XBBC 3ZDTA 4P1CC 4FXCA 1PGXA 2HD5B 3H37A 1HTOA 3DBLI 3DWMA 4BFRA 1GB1A 3AEBB 5H8YE 2BXPA 1BUIC 1NBFC 1WE6A 5LXHA 1MUHA 4KZCA 3VQIA 1E6EB 3E56A 2WXOA 3R3MA 2KDIA 3L54A 2DHZA 4KKIA 1FXAA 4ICUA 2QHBA 1I4HA 1OQRA 3IFWB 2EMSA 1AYFA 5EE9A 5TR5A 3QIJA 3FAHA 3ZJTA 3WALA 2BVCA 2IZVB 3KLSX 4US9A 3UQBA 2D3GA 1SE2A 4C4VB 2D10A 2V36A 2KFJA 4JWSC 2XVWA 2GOWA 1KLUD 2R2OA 3M3JA 2Y5PA 3PHXB 1L2NA 4KDLB 1NVID 2V0GA 4QAYA 2J0MA 3W1SC 4IG7B 2IGGA 2FIFA 2QJLA 4W9DA 1GNUA 2KANA 2CJOA 3GZNB 2IGHA 2H88B 4A20A 4EUTA 2IY0B 2O2VB 1Y8RC 3FWBC 3EC8A 1FIQA 5LLIA 3UIOB 1QOAA 2JF5A 2K9XA 2NBUA 1KLGD 3PREA 2NTTA 2JZ3B 2KD0A 3T9LA 4ANWA 1B9RA 2KDBA 2K0PA 1HK5A 3AN1A 4DK5A 5G5GA 2WX0A 1RRBA 1HEZE 1LNSA 4WURA 1WGKA 2NNWA 1KXPD 4FA6A 5KHOA 3UINB 4A3OA 2BYTA 2Z8JA 3Q6BA 2WDRB 1C4CA 3JRYA 2XK5A 4NAWB 5FKAC 3DOWA 1I4PA 1YJ1A 4HWIB 3S2AA 1FFVA 5AZGA 1J19A 1VJKA 3ZXRA 2JYTA 3ZVVA 4OTUA 3OWEB 4PS3A 4I6PA 4TMAB 2PJHA 3FILA 3Q69A 1EF1A 4HROA 4KIKB 4NJCA 4HCNB 3UQAA 3MC0B 4F5TA 1ROEA 3CWIA 4C7ZA 4DBGA 1E7PB 2QM6A 1FNVA 3TSSA 1R4NI 3UI3A 4YT0B 1WMHB 4GDLB 3IBEA 1E8WA 3H9DA 1HK3A 4G50A 1ACCA 3R8BA 1JRUA 3Q3OC 5LNK1 3GE8C 2BXEA 3Q8CA 4MM3B 5D3IB 5H92C 4GOCA 5IJ5A 4LDTD 3PRMB 2B76B 4ANXA 2ZW1A 3L16A 3U30A 2GB1A 3RFZB 4CQNA 2JYEA 1JALA 3ONSA 1XD3B 2KWUB 3EFCA 2XSIA 4DHJD 2HTME 2DBUA 4ARCA 2MQJA 2I2ZA 2K39A 4A8XC 3Q8AA 1JWUD 3BK1A 2WDTB 2LQIA 1QF6A 1E7UA 5G55A 1ZE3D 1YX6B 3MC8A 1OEYJ 4KV2A 3AU5A 4LJOB 5IJFA 5D2MB 1TZOA 1KOTA 2PPHA 4MGZE 3BYYB 1WYWB 1LXDA 4GIVA 2J7QB 4LUFA 3VH3B 4MACA 4L8UA 4F5SA 1SEBD 1MVKA 1LQBA 3G9KD 1GNIA 2O6VB 3AU4A 1N60A 2IGDA 3A9KA 3VDZA 4PT5A 2LI5A 1WRIA 4XE0A 4YSYB 1TZ1A 2MHJA 4IWQA 2ZNVC 3IAS1 4M0WB 1DOIA 5BO4B 4EOYA 2LUMA 2DLBA 4K1RB 1FXTB 2WXHA 4GDKB 4BBNF 3V05A 2V3SA 5JHAA 2C7MB 4L1BA 1WM2A 2NTSA 3ZW3A 1MJDA 2R61A 1WWTA 1K52A 4RCOA 1HK2A 4MJSA 2RDBC 2ZW0A 3ML9A 4IM2A 2Z0EB 3AB5A 3M95A 3B1LX 2HTHA 4WWOA 3ZNZB 3P63A 4ZBKA 4USAA 3DQVA 3N9YC 2WX1A 1IJGA 3TJPA 3A1QB 3DHGC 4E74A 4TKNA 1RLFA 1UWXA 1SIJA 4BY9C 2WHIA 1Z2MA 3R66C 4K2CA 5E6JA 3RD2A 1GAQB 1LGRA 3JSVA 1GB4A 3W1YA 3AH7A 2JQRB 2N9PC 4IW2A 5CX3A 3WCQA 1HZ5A 1WSPA 2GBRA 4LNFA 3B2FA 5AZFA 1QKZA 2ZCBA 2INNE 2CR5A 3NOBA 1JWMD 3KIKA 1L4DB 1VCBA 1WYGA 4ZRIA 2N7EA 2L76A 5HI1A 5CHFA 2L32A 3QQ8B 4X57B 3KW5B 3MP9A 1K8RB 5HOZA 3VFKA 1T0RC 4CYEA 3ZKJC 2EFHA 3KWVA 1I4QA 2KTFA 1D3ZA 4HJGE 2J53A 1AN8A 3TEYA 1SSNA 1WIAA 2E0YA 2QCZA 3ZRFA 4A3PA 4HEA1 1NYRA 3OAWA 1YJIA 1IPGA 2NPTA 4DXAB 5G5HA 1ESFA 2J42A 4HK2A 3RNGC 1P7EA 2KACA 3MHSB 2G4SA 1TGZB 5J18A 4BVUC 2INCC 4G11A 4FBJB 3HRDD 3FWCC 3IXSA 2DZMA 5CHVC 2BXKA 1SGHA 1WJUA 1SB0A 3ECIA 1OQYA 2KFKA 4MGYE 5J17A 2RDHA 2QDFA 3A4SC 2JT4B 1TKYA 2VH1A 4J3OD 5IAAC 3URYA 5EE0A 1P7FA 1V9JA 1I42A 3ABVB 2OEDA 3NMUA 3JYUA 1IGDA 3LU6A 1IBXB 2QMTA 2N9LA 1LFDA 1FNUA 2AWTA 3V09A 2WXQA 3H7SA 3B9LA 1JWSD 3LXFA 1WGHA 4EFOA 1TS2A 2KAJA 4FJVB 2XVQA 2V3PA 3NZ3A 4FJZA 1JCKB 1J8CA 5JXVA 3EGRA 4C31B 1T5XD 3WAOA 5JHBA 1I35A 5KHQA 1QLBB 3M63B 4W9KA 2WDQB 3I9V1 3W5VB 1XEEA 2LWPA 2RMMA 2A4ZA 5DBYA 2ONQA 3AE7B 3QJZA 3K9OB 4FADA 4HKZE 3CIRB 4RMAA 2BXHA 1C9FA 4GU2A 5GHKA 2EKIA 3AE3B 1GJZA 1OEYA 2AYOB 5CHWA 3ZNHB 2LXTA 5LXIB 2G9HD 2GUTA 3AE4B 1P1AA 5E6PA 2QIEB 4KIKA 1DGJA 3AE1B 3UIPB 1HK1A 2DBXA 4ZRJA 2AGHB 4YWGG 2BXAA 2MCNB 1DYQA 1I4GA 4EMXA 4HGMB 1WMHA 4WAAA 1TKGA 4GDLA 4ZRQA 3PGEA 2RPVA 4FHKA 2BF8B 3GOEA 2CJNA 3EECA 1TT5B 4RH6A 2WXJA 3P4SB 4AWJA 2FUHB 3SHQA 2KTRB 1BKEA 2PIAA 4K3BA 3ML8A 1E7HA 4OTTA 3KH0A 4I6LB 2D2QA 3O13A 4XDDA 4G01A 4WJQA 2KX3A 5BYQA 5L83A 3OJ4B 4K7SA 2ZPNA 2QC8A 4WJOA 1SF0A 1JWAD 3L4PA 1FO4A 4IM0A 3U52E 2V9HA 4FHJA 4E71A 1ZUD2 3RCZA 4AJYB 4HPPA 2WXFA 3RPFC 2LJIA 2N7JA 2DAFA 4K71A 1N5XA 2C9WB 3AULA 2VZKD 4KDIC 4OZAA 5HG2A 1VDVA 3APDA 2GMIC 1LM8B 2BGFA 3VVWB 2FBWB 1RYJA 1NI3A 2GBJA 4MH8A 3D32A 3R7RA 2PVGC 4EZKA 4XWTA 4LNOA 2JVCA 3H7PA 4DHZB 1L0XB 1XT9B 4CO7A 1HTQA 2K1FA 3RZWC 2KC1A 4WJPA 3U8ZA 1TYGB 5DPWA 3CSTA 4OR0A 2CHXA 3KQ4A 2Y5BB 4HPLB 4UDUC 3VUYA 2MSED 3KYDD 4RM9A 3T3NA 2W55A 3L13A 2K3UA 3DHHC 4GDKA 1HXYD 1WX7A 2GBMA 4LUHA 2LHEA 3DBHB 3RNFC 3ZO5B 1G6JA 3PV1A 1FRDA 5T8IA 2DYMA 2BW2A 4JWUC 4WQMA 2BXOA 3RNBC 1M94A 2HJ1A 3U7DA 2ACZB 1X1MA 4OT2A 3QCAA 1J78A 2CU3A 1J7CA 2BS3B 1PUTA 2K0NA 3OJ3A 3PLAA 3A1QA 2KQ4X 2NBVB 3KVFB 4LNIA 2WXMA 1N63A 2MEKA 4XDCA 4KGTA 3U7ZA 1MFWA 4ZHOA 2VRRB 1V8CA 1WGYA 2LZ6A 1I4XA 2IPKD 3U4EG 3AE5B 3TEXA 1HZ6A 1AW7A 2LGIA 3WANA 2LEKA 2MA9B 2GI9A 1T6BX 1YIWA 1C3TA 2KK8A 2N9KA 3EA6A 3N20C 4TV3A 1WZ0A 2OHFA 1KJTA 2FCNA 2LASA 3MFGA 2LXSA 3HUIA 2KQ7A 3WHSA 3KUZA 4M70B 4DQOC 3N1YC 2CHWA 2KJRA 1E7IA 5GIPA 1ZXIA 4ZC6A 3H1UA 2LRUA 4YTPB 3RT3B 4NAMA 2XMOA 2W3SA 3OG5A 1P98A 2R2QA 3BPJA 1STEA 4RF1A 2NCNA 4GB9A 1IP9A 1L4ZB 1F0ZA 5HHDG 3B08A 1VLBA 2MBBB 1XCTL 5IFOA 4K81A 2AQ2B 2JU6X 4IW0A 3SEBA 1VD2A 5ID7A 1TF0A 1XO3A 3EUB2 1C78A 4DWFA 3NVYA 3B2GA 4EZLA 5IOIA 3SIUB 1IBXA 2RD0A 1F1HA 4F7ZA 4ZOHC 5MPOA 3A75A 4N0FD 4S0RA 3DBSA 2DG5A 1J0GA 3Q8EA 2WXPA 1YQ4B 3PLVA 3DBRI 2LOQA 3DVGY 2BTEA 3VRAB 4OVZA 3M62B 1SB3C 4MH0E 5C1ZA 2ZPYA 1SXTA 1CJEA 1Q5WB 2KC2A 3QA8A 2DX5B 4AQ7A 4WAFA 5BPKA 3ZTCA 2L7RA 5IKCM 1AO6A 4W9IA 3L10B 4R3DA 2FUG1 3AM9A 1KTKA 3TDLA 4RGNA 3VXWA 3QX1A 2D07B 2RPQA 4NPNA 2Z8KA 1PGAA 5DPSA 4DXGA 3SFEB 1F77A 2VDBA 1R7SA 2HJ8A 2WU5B 5IA7A 1YMHE 1PQSA 1C1YB 3NS8A 1FNWA 2WXGA 2V3NA 2BT6A 2RSUA 3QAQA 2DBYA 2D5GA 3DVGX 2A5UA 3NZUA 2IO0B 3LDZE 1UZXB 3SFDB 1XCQL 2AEHA 2Y5CA 4I9OA 2MH7A 1UH6A 1QZEA 4LA0A 3IG3A 2K8HA 1XQQA 3DBLB 1Q0WB 1SBBB 1L7YA 4FJCB 1FEHA 3P4QB 5C2TB 1WX8A 4Q2JA 4N59A 1TS5A 2WXNA 4EKUA 2L8JA 1ZDXA 5EE3A 3P2BA 1JROA 1EWCA 1D5MC 4G03A 3KWLA 5IIHA 5FK9C 1V6EA 3SIVB 2MP2B 1XF5L 3A9JB 4F5VA 3NY5A 1PFDA 4IOIE 4W9EA 3WIMA 1H8CA 2G3QB 4GXBA 4XWWA 4P7IA 2NVUI 2J52A 2N0SB 4PYZA 3PSEB 5B5TA 2KJHB 4AOFA 2KMAA 3PS6A 1RAXA 4REZA 2ICIA 2O6VD 1JW9D 1L0YB 3ICXA 2LQHA 4ZBQA 3CX9A 5AUIA 1E8YA 4ICVA 2B3AA 2EFDA 2PLPA 1Q1OA 2BBCA 4A90A 2WGSA 2H89B 3C0RB 3DHIC 4A9AA 1HK4A 4W4UB 2D3AA 1M4VA 3V60A 4W9FA 3RNEC 1GOZA 3WHRA 5IP4D 1K53A 1SE9A 4FJYA 2JWZA 4BKEA 4FULA 4BOSC 4YSXB 1YNTE 2DNFA 1NI2A 4ZHPA 3VRBB 4RGMA 1N5UA 1S1QB 2BYFA 3PZ7A 3ECPA 3O65B 4W9LA 1E78A 2BXIA 1TBEA 2YLMA 3ZNID 4YTMB 3KYCD 5GXGB 1F2RC 2BWFA 2FCMA 1QOGA 3ZRCA 1TS4A 2W54A 3RNCC 2L05A 1FMAD 2C7HA 3C19A 4C80A 3HIZA 4W9HA 4YXDB 1PYWD 5C3JB 2L1AA 1P9DU 1KLVA 1XLOA 2D3BA 3QC8B 4LJPB 1UELA 2DBWA 4DDGD 4JPSA 2PVOD 3ENEA 2JZPA 1E9MA 1RM6C 1V81A 3RNAC 1WJ4A 3WHQA 2DYBA 3E9SA 1EO6A 1U4AA 2AQ1B 4LTUA 3VAWA 1WXVA 4M8NA 1E7EA 2AX5A 2SAKA 1R4NB 4GMVA 2KQSA 4C4VA 2IJ0A 2NMQA 1WY8A 3H3AA 4MGKE 2KWCA 3MHSD 2L0TA 5BMHA 1E8XA 2OOBB 3PLUA 2ZVNA 2FCSA 3VUXA 3GQUA 3TUOA 4OW0A 3PT2B 2BPSA 4N6EB 5DPTA 1UUPA 1OQQA 3Q14C 5E6OA 4WQOB 1BMLC 4G04A 2E0XA 2O2VA 2KVRA 1F2RI 5HFYA 2LD9A 4IDIA 3N3KB 1YN4A 2V4LA 1WZ3A 1V49A 2OJRA 5FR6A 2G1EA 1Y56A 2Z59B 2FNJB 3HVZA 2EKEC 5GINA 1I7HA 3Q3JA 2X38A 3T3OA 4HKQA 1UGMA 2L00B 3NVWA 2CU1A 4DDID 1ZGUB 4GGQA 3HHMA 2J4XA 3GA9L 1RWSA 4ZYNA 4IUMB 2N9XA 4BKTA 4LNNA 4P16A 5BMIA 3SR6A 4NAWA 3W9CB 4NJ6A 2C5LC 3PZ8A 4HJKA 4RNAA 1MM8A 5L95C 2QEJC 3BVGA 4DXFA 3CSFA 2JUHA 2IO1B 1A70A 1R4MI 5ID9A 2OT3A 1ZKHA 2YEPB 5AEKB 5BYSA 2PEAA 3ZUNA 1E10A 4KZ0A 3AE8B 1WR1A 1N5WA 1E8ZA 2EELA 3ETRA 1WF9A 4IW1A 3R2TA 3VR9B 1JQ4A 3ZXVA 2YEPF 1VZ7A 3AV8A 2JPHA 4DHXB 2C60A 1HE8A 2GRIA 1UORA 4J6IA 3WAMA 3KUCB 1TS3A 4L9QA 1WI0A 2PE9A 1V80A 1IGCA 1MIVA 2M4NA 1SJED 1N62A 2VUFA 3DPDA 5AZHA 3KUDB 3SU8X 4WIPA 3V03A 4DM0A 3FILB 4MM3A 4ZRPA 1V5OA 2XW0A 1WE7A 2BXBA 4B0MA 1FD6A 2JY6A 2CKHB 1MA9A 4XX5A 4TQ1A 3L17A 3ZNGC 1WXMA 5JH5C 1I4RA 1D5ZC 2YVCA 3P4PB 3PRPB 3AEGB 1D6EC 1WJ6A 2DZIA 3X23A 3DWGC 2BXGA 4KGRA 3RYTA 2I1JA 4GLSC 3AEAB 3H8HA 1RFAA 1ZXHA 2BXCA 4G0NB 2KX0A 1YQBA 3TEZA 1ZDVA 1ENFA 3GZNI 1KM7A 3NS1A 2JRHA 1V97A 4K7WA 4II3B 1FFUA 2QHOA 3AE2B 4IWOA 1VFIA 1VR9A 2BXDA 1SIFA 2ZNVB 1VZSA 1ISNA 2X8XX 2ON8A 5IIUA 3IHPC 3MJWA 2QMCA 1FRRA 3V62A 2N9EB 4EZJA 4HLEA 2AQ3B 3ZJVA 1WJNA 3Q3FA 4RFBA 2O6VA 4AP4C 2VZKB 3ZJUA 5CTRC 3TIXA 3FNMA 4FIPB 4WH4A 4M0WA 4RGTA 2M19A 3GE3C 4MSMB 2EFCA 2M56B 2KOXA 2KDFB 3LYYA 4L9KA 3UGBB 1V1PB 1CMXB 3AEEB 4NQLB 4NNJB 1MI0A 1WR6E 3NVKA 2KN4A 4S1YA 3W2DA 2JSVX 1TY0A 2G4DB 4JE3B 4FLHA 4F8CB 1C77A 5GIOA 5IN7A 1WM3A 1C4AA 3NVIA 2V1YA 4CHKA 1BT0A 1GNJA 2LVQA 1GUAB 3FC4A 1E7BA 3GS2A 3ZDMC 4PO0A 2UYZB 1PGBA 2LGYA 4KGSA 3VH4B 4EE2A 1N61A 2J0JA 4BBNC 4KX6B 1KF6B 1WXAA 3HVDA 3P4RB 1P3QU 1WH3A 2BYEA 1S3SG 2DZKA 4MJSB 4PS7A 1SE3A 3A4RA 4PYUA 4HDQA 2L83A 4ZBRA 3B9JA 4E99A 4F5UA 1T3QA 4XC2A 3IT4B 2LGSA 1TTNA 2HE7A 1XLPA 1YN3A 2KLCA 5DCNA 1L0VB 2BXMA 3KJLA 2LVOA 2XN9C 3W1SA 3JSVB 2KWFA 1KFYB 1UGJA 4US8A 4GG2A 5EE1A 1D4BA 2Z8IA 2Z8LA 3RMKC 3AMZA 1JWBD 3Q8BA 4W9JA 3NUHB 3NRZA 2JRIB 3LB8C 3NG0A 1FM0D 2K8CA 4YL8A 5DPRA 2KKCA 4HVBA 3BZDB 5GMVA 1TIFA 5AUKA 1TKEA 1V86A 1UBQA 3MTNB 4Z9OA 2GBNA 2BB6A 2FAZA 1XXGA 3VTVA 5D94A 4P1BC 2LGDA 3V61A 3GQXA 2REXA 1WXSA 2KDMA 2D11A 2LRWA 2QILA 1EWYC 2PE6B 2RGFA 2NPTB 3BK2A 2JWUA 4JX1C 1ZP0B 4TQ0A 4EEWA 4HCPB 1F52A 4E3CA 1IYFA 3I63C 2DWQA 3ZTDA 4RGOS 2BXLA 4ANUA 1E90A 3PVLA 3BVZA 4ZRKA 4URKA 1N6ZA 5HKHA 2KFKB 2LXAA 2V4IB 2JZZA 1NYQA 2WNMA 4B6WA 1IUEA 4KSLC 4NY0A 1T0SC 1YN5A 1J7EA 1SJHD 4BKSD 2W9NA 3PPAA 1JRPA 5G2NA 4ZYSA 1PDXA 2WU2B 1BJ5A 1XLQA 4N3ZA 4OHJA 2NBWB 1TXUA
chains in the Genus database with same CATH topology
2PKOA 3TCAA 4A6QA 1JNBA 5BMGA 4M8MA 4PS8A 4HPMB 4MELA 1EF5A 4JLCA 2FCQA 3MHHB 3VTWA 2I30A 1QOBA 1E7AA 4WWMA 3TL5A 3N30A 4KKJA 2KBZA 4FN2A 5IIXA 2WQYB 2ZVOA 1HA2A 2K8BA 3TEWA 2DAJA 2DENB 1NEKB 3WA0A 3I3TB 4OZCA 1E7FA 2KZRA 1VZ8A 1NDDA 1NENB 1E7VA 3QK0A 4W9CA 2KMCA 1VZ6A 3AI5A 1ET9A 1H9ZA 2K22A 1UWMA 2KTRA 3MHZA 1A5RA 3BIID 5TSSA 3RUIB 3PO0A 3IAM1 2GBKA 2JUOA 2CKXA 3JQZA 2L3ZA 2M8SA 3AXCA 1MHXA 3EHVA 2G45B 1ZPSA 2KJ6A 2WYQA 2PTLA 4GDXA 2E3TA 2KLGA 3GB1A 1E7GA 4HDOA 2KMMA 4MBEC 3UIVA 1WGDA 3CF6E 2QSDA 1KH0A 2M1MA 4G3XB 4W9GA 3BVMA 2E6XA 3VUWA 2LMCA 2LUEA 1LO5D 5IJEA 3HK0A 4LDTB 2I38A 4ZDVA 1C4PA 2XVUA 2MWSB 1BXTA 3P42A 3VHTC 2N7DA 1RFKA 2N4FA 1F9JA 4DHJB 2K6DB 3AEDB 3IT6B 4ITKA 4WJNA 3SDLC 2ZZPB 3R2IA 2KWDA 3V6CB 1MG8A 3R7QA 1EU3A 1OFFA 2ZEQA 1D5XC 4C56C 4HXDA 1TJEA 3B9MA 2RR9A 1FXIA 2N1VA 4IC7B 3A73A 3V08A 2MX2A 4IWPA 4NQKE 2KDEB 2BS4B 4RM8A 1V1PA 1E5WA 2C7NB 3V3XA 3PZDA 3H7PB 3PRZA 4KVGB 4IKGA 1K50A 2AL3A 2J0KA 3DCGA 3PTFC 4JIOU 3BY4B 1ZOYB 4WWNA 2BKRB 1GC6A 2EFEA 2MBHA 2WDVB 3VR8B 3SD5A 3CMMB 5J2RA 1AARA 1L6VA 1H4RA 3X0WA 3WAPA 4OZBA 4OVUA 4Z69A 4WA6B 4N9F4 1FOUA 1NT2B 1O9XA 5C23A 2K5PA 4TSSA 1ZW7A 1GPXA 1MIWA 2LFIA 5FR3A 3ALBA 1DOXA 3NZSA 2I1KA 1DOYA 3JVZX 2BKFA 3W5UB 2MBQA 2KNBA 1L5PA 1CZPA 3BINA 1YD8U 2MJ3A 3ZYYX 4GSWA 2SEBD 3AEFB 4NZLB 3RZFA 2CS4A 2N1WA 1YX5B 4HRSA 1HQRD 2ROHA 3IVFA 1HA5A 2BXQA 5E6NA 2EMTA 2LJ5A 3AE9B 4JQWC 1V1OA 2MJEA 3NVZA 2TSSA 5I4DA 2WS3B 2CHZA 4A55A 2XNAC 3HM6X 3K9PB 2LVPA 2M17A 3B0AA 5BYRA 2OZBB 3H6NA 1E0ZA 1MPEA 4MEMA 4MSQB 4ANVA 2Y3AA 3MJ5A 1WFYA 1FCCC 3LU8A 1UNSA 4BOZB 4J2VA 1KW2A 2DZJA 4B0EA 1E7CA 2UWQA 2K6QA 2IO2B 3ZIMA 1P0RA 2BYVE 4MT5A 3BYTB 2RDGA 1C79A 4JL9A 2BWES 4K7UA 4KSKC 4ZUXV 1WXQA 3DBHI 1EUVB 4HGKA 4XZ4A 2IY1B 2NS5A 5D7GA 4JK4A 1V2YA 4AS1A 1GG3A 2FE8A 2PMVA 1EU4A 3APCA 3JW0X 5D6JB 3SQJA 3NVMA 1VRAB 2LXCA 1CQVA 4BKSA 4H2AA 3ZQ4A 2XVVA 4I6NB 2ASQA 2ZCCA 4N58A 4MDKE 2JXTA 4L2YA 2XW1A 3EFUA 3AECB 2MLBA 3DVNU 5JZEB 2L52A 3RULA 2FIDA 2IYDB 1QT9A 2KWVB 4WWPA 4ARIA 3U2SC 2IBIB 1YJJA 2KN5A 3A33B 2XEWA 1T0YA 3BWUD 4MGIE 2XK5B 3APFA 3PHWB 1WGGA 3TBLD 3VTUA 2WXIA 1WRDB 4C7YA 2MW5A 1ET6A 4RF0A 3N32A 2YDFA 4GN1A 2K25A 4O1NA 2WP9B 3LU7A 2DYOA 1H5WA 2IDYA 4YSZB 4ASWC 2KXJA 1UBIA 2PW9A 2KO3A 1BM0A 1J7BA 3NHEB 2L0FA 1JMLA 3QARA 1WGRA 2JXXA 1YQ3B 3QHTA 2MBEA 4ZCGA 2WXRA 1MIYA 1MHHE 2MJDA 4NJ7A 2WXLA 2WXKA 2BX8A 3ZLZA 1KRHA 2W3RA 1XLNA 3I57A 2MP2A 3A9JA 4LB9A 4D2KA 2HDEA 1WX9A 2KHWB 1CK1A 4B95A 1OTRB 3UF8A 1SE4A 1C76A 2WLBA 3T8MA 3P1MA 3C8YA 2AJEA 2MBOA 4LCDE 2VUEA 2INPE 1B1ZA 2Z0DB 3L08A 1GC7A 4YTNB 5D3DA 5FUOA 2IO3B 4B9KA 1Q10A 2WWZA 1TY2A 3TMPB 3M99C 1OGWA 4IM3A 4TUUA 1Z5SB 3DVNV 1EM7A 3L0WB 3Q8FA 3J9CA 4JGHB 3HM3A 4OVVA 4L23A 3OLMD 2ZJDA 4AUQC 3LJ3A 5EDSA 3A9KB 4BKGA 2AL6A 4F1SA 2NQOA 2MRPA 2BXFA 1J7AA 1QILA 1LOTA 4FK5B 1AWDA 2BB5A 4AJWA 3V6EB 2M0AA 1V5TA 2LHDA 3NVVA 2W82A 2BS2B 1UD7A 1K51A 3AE6B 1FCLA 2LGXA 2Q5WD 3GP7A 4II2B 2I2YA 2NR2A 4DHZE 4LK0M 2BXNA 3DDCB 1QOFA 3QWZB 2JX5A 5DQFA 1L6UA 4LLGM 1QQRA 4LB2A 3ZGZA 4N0UD 4P6VF 2M0XA 2XBBC 3ZDTA 4FXCA 1PGXA 2HD5B 3H37A 3DBLI 3DWMA 4BFRA 1GB1A 3AEBB 5H8YE 2BXPA 1WE6A 1NBFC 1BUIC 5LXHA 4KZCA 3VQIA 1E6EB 2WXOA 3E56A 3R3MA 2KDIA 3L54A 2DHZA 4KKIA 4ICUA 1FXAA 2QHBA 1I4HA 1OQRA 3IFWB 2EMSA 1AYFA 5TR5A 5EE9A 3QIJA 3FAHA 3ZJTA 3WALA 2IZVB 3UQBA 3KLSX 4US9A 2D3GA 1SE2A 2D10A 2V36A 2KFJA 4JWSC 2XVWA 2GOWA 2R2OA 1KLUD 3M3JA 2Y5PA 3PHXB 1L2NA 4KDLB 1NVID 2V0GA 2J0MA 3W1SC 4IG7B 2IGGA 2FIFA 2QJLA 4W9DA 1GNUA 2KANA 2CJOA 2IGHA 2H88B 4A20A 4EUTA 2IY0B 2O2VB 1Y8RC 3FWBC 3EC8A 1FIQA 5LLIA 3UIOB 1QOAA 2JF5A 2K9XA 2NBUA 3PREA 1KLGD 2NTTA 2JZ3B 2KD0A 3T9LA 4ANWA 1B9RA 2KDBA 2K0PA 1HK5A 3AN1A 4DK5A 5G5GA 2WX0A 1RRBA 1HEZE 1LNSA 4WURA 1WGKA 2NNWA 1KXPD 4FA6A 5KHOA 3UINB 4A3OA 2BYTA 2Z8JA 2WDRB 1C4CA 3JRYA 2XK5A 4NAWB 5FKAC 3DOWA 1I4PA 1YJ1A 4HWIB 3S2AA 5AZGA 1FFVA 1J19A 1VJKA 2JYTA 3ZVVA 4OTUA 4PS3A 3OWEB 4I6PA 4TMAB 2PJHA 3FILA 3Q69A 1EF1A 4HROA 4KIKB 4NJCA 4HCNB 3UQAA 3MC0B 4F5TA 1ROEA 3CWIA 4C7ZA 4DBGA 1E7PB 2QM6A 1FNVA 3TSSA 1R4NI 3UI3A 4YT0B 1WMHB 4GDLB 3IBEA 1E8WA 3H9DA 1HK3A 4G50A 1ACCA 3R8BA 1JRUA 5LNK1 2BXEA 3Q8CA 4MM3B 5D3IB 5H92C 4GOCA 5IJ5A 4LDTD 3PRMB 2B76B 4ANXA 2ZW1A 3L16A 3U30A 2GB1A 3RFZB 4CQNA 2JYEA 1JALA 3ONSA 1XD3B 2KWUB 2XSIA 4DHJD 2HTME 2DBUA 4ARCA 2MQJA 2I2ZA 2K39A 4A8XC 3Q8AA 1JWUD 3BK1A 2WDTB 1QF6A 1E7UA 5G55A 1ZE3D 1YX6B 1OEYJ 4KV2A 3AU5A 4LJOB 5IJFA 5D2MB 1TZOA 1KOTA 2PPHA 4MGZE 3BYYB 1WYWB 1LXDA 4GIVA 2J7QB 4LUFA 3VH3B 4MACA 4L8UA 4F5SA 1SEBD 1MVKA 1LQBA 3G9KD 1GNIA 2O6VB 3AU4A 1N60A 2IGDA 3A9KA 3VDZA 4PT5A 2LI5A 1WRIA 4XE0A 4YSYB 1TZ1A 4IWQA 2ZNVC 3IAS1 4M0WB 5BO4B 1DOIA 4EOYA 2LUMA 2DLBA 4K1RB 1FXTB 2WXHA 4GDKB 4BBNF 3V05A 2V3SA 5JHAA 2C7MB 4L1BA 1WM2A 2NTSA 3ZW3A 2R61A 1WWTA 1K52A 4RCOA 1HK2A 4MJSA 3ML9A 2ZW0A 4IM2A 2Z0EB 3AB5A 3M95A 3B1LX 2HTHA 4WWOA 3ZNZB 3P63A 4ZBKA 4USAA 3DQVA 3N9YC 2WX1A 1IJGA 3TJPA 3A1QB 4E74A 4TKNA 1RLFA 1UWXA 1SIJA 4BY9C 1Z2MA 3R66C 4K2CA 5E6JA 3RD2A 3JSVA 1GAQB 1GB4A 3W1YA 3AH7A 5CX3A 2N9PC 4IW2A 2JQRB 3WCQA 1HZ5A 2GBRA 1WSPA 5AZFA 3B2FA 1QKZA 2ZCBA 2INNE 2CR5A 3NOBA 1JWMD 3KIKA 1L4DB 1VCBA 4ZRIA 1WYGA 2N7EA 2L76A 5HI1A 5CHFA 3QQ8B 2L32A 4X57B 3KW5B 3MP9A 1K8RB 5HOZA 3VFKA 4CYEA 3ZKJC 2EFHA 3KWVA 1I4QA 2KTFA 1D3ZA 4HJGE 2J53A 1AN8A 3TEYA 1SSNA 1WIAA 2E0YA 3ZRFA 4A3PA 4HEA1 3OAWA 1NYRA 1YJIA 1IPGA 2NPTA 4DXAB 5G5HA 4HK2A 1ESFA 2J42A 1P7EA 2KACA 3MHSB 2G4SA 1TGZB 5J18A 4BVUC 4G11A 4FBJB 3HRDD 3FWCC 3IXSA 2DZMA 5CHVC 2BXKA 1SGHA 1WJUA 3ECIA 1OQYA 2KFKA 4MGYE 5J17A 3A4SC 2RDHA 2JT4B 1TKYA 4J3OD 5IAAC 3URYA 5EE0A 1P7FA 1V9JA 1I42A 3ABVB 2OEDA 3NMUA 3JYUA 1IGDA 3LU6A 1IBXB 1LFDA 2AWTA 1FNUA 2N9LA 3H7SA 3V09A 2QMTA 2WXQA 3B9LA 1JWSD 3LXFA 1WGHA 4EFOA 1TS2A 2KAJA 4FJVB 2XVQA 2V3PA 3NZ3A 4FJZA 1J8CA 1JCKB 5JXVA 3EGRA 4C31B 3WAOA 5JHBA 1I35A 1T5XD 5KHQA 1QLBB 3M63B 4W9KA 2WDQB 3I9V1 3W5VB 1XEEA 2LWPA 2RMMA 2A4ZA 5DBYA 2ONQA 3AE7B 3QJZA 3K9OB 4FADA 4HKZE 3CIRB 4RMAA 2BXHA 1C9FA 4GU2A 5GHKA 2EKIA 3AE3B 1GJZA 1OEYA 2AYOB 5CHWA 3ZNHB 5LXIB 2G9HD 3AE4B 1P1AA 5E6PA 4KIKA 2QIEB 1DGJA 3AE1B 3UIPB 1HK1A 2DBXA 4ZRJA 4YWGG 2BXAA 2MCNB 1DYQA 1I4GA 4EMXA 4HGMB 1WMHA 4WAAA 4GDLA 1TKGA 4ZRQA 3PGEA 2RPVA 4FHKA 2BF8B 3GOEA 2CJNA 3EECA 4RH6A 2WXJA 3P4SB 4AWJA 2FUHB 3SHQA 2KTRB 1BKEA 2PIAA 3ML8A 1E7HA 4OTTA 3KH0A 4I6LB 2D2QA 3O13A 4XDDA 4G01A 4WJQA 2KX3A 5BYQA 5L83A 3OJ4B 4K7SA 2ZPNA 4WJOA 1SF0A 1JWAD 3L4PA 1FO4A 4IM0A 3U52E 4FHJA 4E71A 1ZUD2 3RCZA 4AJYB 2WXFA 3RPFC 2LJIA 2N7JA 2DAFA 4K71A 1N5XA 2C9WB 3AULA 2VZKD 4KDIC 4OZAA 5HG2A 1VDVA 3APDA 2GMIC 1LM8B 2BGFA 3VVWB 2GBJA 1RYJA 1NI3A 2FBWB 4MH8A 3D32A 3R7RA 2PVGC 4EZKA 4XWTA 4DHZB 2JVCA 3H7PA 1L0XB 1XT9B 4CO7A 2K1FA 3RZWC 2KC1A 4WJPA 3U8ZA 5DPWA 1TYGB 3CSTA 4OR0A 2CHXA 3KQ4A 2Y5BB 4HPLB 4UDUC 3VUYA 2MSED 3KYDD 4RM9A 3T3NA 3L13A 2W55A 2K3UA 4GDKA 1HXYD 1WX7A 2GBMA 4LUHA 2LHEA 3ZO5B 1G6JA 3PV1A 1FRDA 5T8IA 2DYMA 2BW2A 4JWUC 4WQMA 2BXOA 1M94A 3U7DA 2ACZB 1X1MA 4OT2A 3QCAA 1J78A 2CU3A 1J7CA 2BS3B 1PUTA 3OJ3A 3PLAA 3A1QA 2NBVB 3KVFB 2KQ4X 2WXMA 1N63A 2MEKA 4XDCA 4KGTA 3U7ZA 4ZHOA 2VRRB 1V8CA 1WGYA 2LZ6A 1I4XA 2IPKD 3U4EG 3AE5B 3TEXA 1HZ6A 1AW7A 2LGIA 3WANA 2LEKA 2MA9B 2GI9A 1YIWA 1T6BX 1C3TA 2KK8A 2N9KA 3EA6A 4TV3A 1WZ0A 2OHFA 1KJTA 2FCNA 2LASA 3MFGA 3HUIA 2KQ7A 3WHSA 3KUZA 4M70B 4DQOC 2CHWA 2KJRA 1E7IA 5GIPA 1ZXIA 4ZC6A 3H1UA 2LRUA 4YTPB 3RT3B 4NAMA 2XMOA 2W3SA 1P98A 2R2QA 1STEA 4RF1A 2NCNA 4GB9A 1IP9A 1L4ZB 1F0ZA 5HHDG 3B08A 1VLBA 2MBBB 1XCTL 5IFOA 4K81A 4IW0A 2AQ2B 2JU6X 3SEBA 1VD2A 5ID7A 1TF0A 1XO3A 3EUB2 1C78A 4DWFA 3NVYA 3B2GA 4EZLA 3SIUB 1IBXA 2RD0A 4F7ZA 4ZOHC 5MPOA 3A75A 4N0FD 3DBSA 2DG5A 1J0GA 3Q8EA 2WXPA 1YQ4B 3PLVA 3DBRI 2LOQA 3DVGY 2BTEA 3VRAB 4OVZA 3M62B 1SB3C 4MH0E 5C1ZA 2ZPYA 1SXTA 1CJEA 1Q5WB 2KC2A 3QA8A 2DX5B 4AQ7A 4WAFA 5BPKA 3ZTCA 2L7RA 1AO6A 4W9IA 3L10B 4R3DA 2FUG1 3AM9A 1KTKA 3TDLA 4RGNA 3VXWA 3QX1A 2D07B 2RPQA 4NPNA 2Z8KA 1PGAA 5DPSA 4DXGA 3SFEB 1F77A 2VDBA 2HJ8A 1R7SA 2WU5B 5IA7A 1YMHE 1PQSA 1C1YB 3NS8A 1FNWA 2WXGA 2V3NA 2BT6A 2RSUA 3QAQA 2DBYA 2D5GA 3DVGX 2A5UA 3NZUA 2IO0B 3LDZE 1UZXB 3SFDB 1XCQL 2AEHA 2Y5CA 2MH7A 1UH6A 1QZEA 4LA0A 3IG3A 2K8HA 1XQQA 1Q0WB 1SBBB 1L7YA 4FJCB 1FEHA 3P4QB 5C2TB 1WX8A 4Q2JA 4N59A 1TS5A 4EKUA 2WXNA 2L8JA 1ZDXA 5EE3A 3P2BA 1JROA 1D5MC 1EWCA 4G03A 3KWLA 5IIHA 5FK9C 1V6EA 3SIVB 2MP2B 1XF5L 3A9JB 4F5VA 3NY5A 1PFDA 4IOIE 4W9EA 3WIMA 1H8CA 2G3QB 4GXBA 4XWWA 4P7IA 2NVUI 2J52A 2N0SB 4PYZA 4AOFA 5B5TA 2KJHB 3PSEB 2KMAA 3PS6A 1RAXA 4REZA 2ICIA 2O6VD 1JW9D 1L0YB 3ICXA 4ZBQA 3CX9A 5AUIA 1E8YA 4ICVA 2B3AA 2EFDA 2PLPA 1Q1OA 2BBCA 4A90A 2H89B 3C0RB 4A9AA 1HK4A 4W4UB 1M4VA 3V60A 4W9FA 1GOZA 3WHRA 1SE9A 1K53A 4FJYA 2JWZA 4BKEA 4FULA 4BOSC 4YSXB 1YNTE 1NI2A 4ZHPA 3VRBB 4RGMA 1N5UA 1S1QB 2BYFA 3PZ7A 3O65B 4W9LA 1E78A 2BXIA 1TBEA 2YLMA 3ZNID 4YTMB 3KYCD 5GXGB 1F2RC 2BWFA 2FCMA 1QOGA 3ZRCA 1TS4A 2W54A 2L05A 1FMAD 2C7HA 4C80A 3HIZA 4W9HA 4YXDB 1PYWD 5C3JB 2L1AA 1P9DU 1KLVA 1XLOA 3QC8B 4LJPB 1UELA 2DBWA 4DDGD 4JPSA 2PVOD 3ENEA 2JZPA 1E9MA 1RM6C 1V81A 1WJ4A 3WHQA 2DYBA 3E9SA 1EO6A 1U4AA 2AQ1B 4LTUA 3VAWA 1WXVA 4M8NA 1E7EA 2AX5A 2SAKA 4GMVA 2KQSA 2IJ0A 2NMQA 1WY8A 3H3AA 4MGKE 2KWCA 3MHSD 2L0TA 5BMHA 1E8XA 2OOBB 3PLUA 2ZVNA 2FCSA 3VUXA 3GQUA 3TUOA 4OW0A 3PT2B 2BPSA 4N6EB 5DPTA 1UUPA 1OQQA 5E6OA 4WQOB 1BMLC 4G04A 2E0XA 2O2VA 2KVRA 1F2RI 5HFYA 2LD9A 4IDIA 3N3KB 1YN4A 2V4LA 1WZ3A 1V49A 2OJRA 5FR6A 2G1EA 1Y56A 2Z59B 2FNJB 3HVZA 2EKEC 5GINA 1I7HA 3Q3JA 2X38A 3T3OA 4HKQA 1UGMA 2L00B 3NVWA 2CU1A 4DDID 1ZGUB 4GGQA 3HHMA 2J4XA 3GA9L 1RWSA 4ZYNA 4IUMB 2N9XA 4BKTA 4P16A 5BMIA 3SR6A 4NAWA 3W9CB 4NJ6A 2C5LC 3PZ8A 4HJKA 5L95C 4RNAA 2QEJC 3BVGA 4DXFA 3CSFA 2JUHA 2IO1B 1R4MI 1A70A 5ID9A 2OT3A 1ZKHA 2YEPB 5AEKB 5BYSA 2PEAA 3ZUNA 1E10A 4KZ0A 3AE8B 1WR1A 1N5WA 1E8ZA 2EELA 3ETRA 1WF9A 4IW1A 3R2TA 3VR9B 1JQ4A 2YEPF 1VZ7A 3AV8A 2JPHA 4DHXB 2C60A 1HE8A 2GRIA 1UORA 4J6IA 3WAMA 3KUCB 1TS3A 4L9QA 1WI0A 2PE9A 1V80A 1IGCA 1MIVA 2M4NA 3DPDA 1N62A 2VUFA 3SU8X 5AZHA 3KUDB 1SJED 4WIPA 3V03A 3FILB 4MM3A 4ZRPA 1V5OA 2XW0A 1WE7A 2BXBA 4B0MA 1FD6A 2JY6A 2CKHB 1MA9A 4XX5A 4TQ1A 3L17A 3ZNGC 1WXMA 5JH5C 1I4RA 1D5ZC 2YVCA 3P4PB 3PRPB 3AEGB 1D6EC 1WJ6A 2DZIA 3X23A 3DWGC 2BXGA 3RYTA 4KGRA 2I1JA 4GLSC 3AEAB 3H8HA 1RFAA 1ZXHA 2BXCA 4G0NB 2KX0A 1YQBA 3TEZA 1ZDVA 1ENFA 3GZNI 1KM7A 3NS1A 2JRHA 4K7WA 1V97A 4II3B 2QHOA 4IWOA 1FFUA 3AE2B 1VFIA 1VR9A 2BXDA 1SIFA 2ZNVB 1VZSA 1ISNA 2ON8A 5IIUA 3IHPC 3MJWA 2QMCA 1FRRA 3V62A 2N9EB 4EZJA 4HLEA 2AQ3B 3ZJVA 1WJNA 3Q3FA 4RFBA 2O6VA 4AP4C 2VZKB 3ZJUA 5CTRC 3TIXA 3FNMA 4FIPB 4WH4A 4M0WA 4RGTA 2M19A 4MSMB 2EFCA 2M56B 2KOXA 2KDFB 3LYYA 4L9KA 3UGBB 1V1PB 1CMXB 3AEEB 4NQLB 4NNJB 1MI0A 1WR6E 3NVKA 2KN4A 4S1YA 3W2DA 2JSVX 1TY0A 2G4DB 4JE3B 4FLHA 4F8CB 1C77A 5GIOA 1WM3A 1C4AA 3NVIA 2V1YA 4CHKA 1BT0A 1GNJA 2LVQA 1GUAB 3FC4A 1E7BA 3GS2A 3ZDMC 4PO0A 2UYZB 1PGBA 2LGYA 4KGSA 3VH4B 4EE2A 1N61A 2J0JA 4BBNC 4KX6B 1KF6B 1WXAA 3HVDA 3P4RB 1P3QU 1WH3A 2BYEA 1S3SG 2DZKA 4MJSB 4PS7A 1SE3A 3A4RA 4PYUA 4HDQA 2L83A 4ZBRA 3B9JA 4E99A 4F5UA 1T3QA 4XC2A 3IT4B 1TTNA 2HE7A 2KLCA 1XLPA 1YN3A 5DCNA 1L0VB 2BXMA 3KJLA 2LVOA 2XN9C 3W1SA 3JSVB 1KFYB 1UGJA 4US8A 4GG2A 5EE1A 1D4BA 2Z8IA 2Z8LA 3AMZA 1JWBD 3Q8BA 4W9JA 3NUHB 3NRZA 2JRIB 3LB8C 2K8CA 1FM0D 4YL8A 5DPRA 2KKCA 4HVBA 3BZDB 5GMVA 5AUKA 1TKEA 1V86A 1UBQA 3MTNB 4Z9OA 2GBNA 2FAZA 2BB6A 1XXGA 3VTVA 5D94A 2LGDA 3V61A 3GQXA 2REXA 1WXSA 2KDMA 2D11A 2LRWA 2QILA 1EWYC 2PE6B 2RGFA 2NPTB 3BK2A 2JWUA 4JX1C 1ZP0B 4TQ0A 4EEWA 4HCPB 4E3CA 1IYFA 2DWQA 3ZTDA 4RGOS 2BXLA 4ANUA 1E90A 3PVLA 3BVZA 4ZRKA 4URKA 5HKHA 2KFKB 2LXAA 2V4IB 2JZZA 1NYQA 2WNMA 4B6WA 1IUEA 4KSLC 4NY0A 1YN5A 1J7EA 1SJHD 4BKSD 2W9NA 3PPAA 1JRPA 5G2NA 4ZYSA 1PDXA 2WU2B 1BJ5A 1XLQA 4N3ZA 4OHJA 2NBWB 1TXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE9 A;  4AJW A;  4FJY A;  3TCA A;  2JWZ A;  2A4Z A;  4FUL A;  3QJZ A;  3K9O B;  4BOS C;  4FAD A;  4M8M A;  4PS8 A;  4HPM B;  4RMA A;  3V6E B;  1NI2 A;  4GU2 A;  1V5T A;  1UD7 A;  4MEL A;  2LGX A;  1EF5 A;  4II2 B;  4JLC A;  1S1Q B;  2BYF A;  2FCQ A;  2NR2 A;  4DHZ E;  1OEY A;  1GJZ A;  2AYO B;  5CHW A;  3O65 B;  4W9L A;  3VTW A;  3DDC B;  3ZNH B;  3QWZ B;  1TBE A;  2YLM A;  3ZNI D;  5LXI B;  3KYC D;  3TL5 A;  3N30 A;  1P1A A;  2BWF A;  5E6P A;  4KIK A;  2FCM A;  4FN2 A;  3UIP B;  2ZVO A;  3ZRC A;  2K8B A;  4ZRJ A;  2DAJ A;  2DEN B;  2L05 A;  3WA0 A;  3I3T B;  2C7H A;  2KZR A;  1NDD A;  1E7V A;  3QK0 A;  4W9C A;  2KMC A;  2M0X A;  2XBB C;  3HIZ A;  2MCN B;  3AI5 A;  4W9H A;  3ZDT A;  1WMH A;  4WAA A;  4GDL A;  1P9D U;  2HD5 B;  2KTR A;  3PGE A;  3DBL I;  1A5R A;  4FHK A;  1KLV A;  2BF8 B;  3RUI B;  3QC8 B;  4BFR A;  4LJP B;  1UEL A;  2GBK A;  2JUO A;  3GOE A;  4DDG D;  2L3Z A;  1WE6 A;  3EEC A;  1NBF C;  3ENE A;  5LXH A;  2M8S A;  3AXC A;  3EHV A;  4KZC A;  4AWJ A;  3VQI A;  1V81 A;  2G45 B;  2FUH B;  1WJ4 A;  2DYB A;  2KJ6 A;  2WYQ A;  3SHQ A;  1EO6 A;  1U4A A;  2KTR B;  2KDI A;  2KLG A;  3R3M A;  3L54 A;  2DHZ A;  3VAW A;  1WXV A;  3ML8 A;  4HDO A;  4M8N A;  3KH0 A;  4ICU A;  4I6L B;  2D2Q A;  4GMV A;  2KQS A;  4WJQ A;  2KX3 A;  3IFW B;  5L83 A;  2EMS A;  1WGD A;  3CF6 E;  1WY8 A;  3OJ4 B;  2M1M A;  4K7S A;  4MGK E;  5TR5 A;  2ZPN A;  4G3X B;  4WJO A;  4W9G A;  3VUW A;  2KWC A;  3QIJ A;  3MHS D;  2LUE A;  4IM0 A;  2L0T A;  3WAL A;  1E8X A;  2IZV B;  3HK0 A;  4LDT B;  2OOB B;  4ZDV A;  3PLU A;  2ZVN A;  4FHJ A;  4E71 A;  3UQB A;  2D3G A;  2MWS B;  2FCS A;  3RCZ A;  3VUX A;  4AJY B;  2D10 A;  3PT2 B;  2KFJ A;  2DAF A;  3VHT C;  2N7D A;  2GOW A;  2R2O A;  2BPS A;  2N4F A;  1F9J A;  2C9W B;  3AUL A;  4DHJ B;  3M3J A;  4KDI C;  5DPT A;  2K6D B;  3PHX B;  1L2N A;  4KDL B;  3APD A;  4WJN A;  5E6O A;  4WQO B;  2GMI C;  3SDL C;  2J0M A;  3W1S C;  1LM8 B;  2BGF A;  4IG7 B;  3VVW B;  2ZZP B;  2O2V A;  2KVR A;  2GBJ A;  3V6C B;  3D32 A;  3R7R A;  1MG8 A;  2LD9 A;  3R7Q A;  4EZK A;  3N3K B;  2ZEQ A;  2FIF A;  4W9D A;  4DHZ B;  2JVC A;  2KAN A;  1GNU A;  2V4L A;  3H7P A;  4HXD A;  1WZ3 A;  1XT9 B;  2RR9 A;  1V49 A;  2OJR A;  4CO7 A;  2N1V A;  4IC7 B;  4IWP A;  2K1F A;  2MX2 A;  4A20 A;  3RZW C;  4NQK E;  2KC1 A;  4WJP A;  2KDE B;  3U8Z A;  4EUT A;  5FR6 A;  2IY0 B;  2O2V B;  5DPW A;  1Y8R C;  2Z59 B;  2FNJ B;  3CST A;  2EKE C;  3EC8 A;  2CHX A;  4RM8 A;  2Y5B B;  3Q3J A;  5LLI A;  3UIO B;  2JF5 A;  4HPL B;  1E5W A;  1UGM A;  2C7N B;  2L00 B;  3PZD A;  3H7P B;  3PRZ A;  3VUY A;  2NBU A;  3PRE A;  2CU1 A;  2MSE D;  3KYD D;  4KVG B;  4RM9 A;  4DDI D;  1ZGU B;  2JZ3 B;  2AL3 A;  2KD0 A;  4GGQ A;  3T9L A;  3L13 A;  2J0K A;  4ANW A;  3HHM A;  3DCG A;  3PTF C;  4JIO U;  4GDK A;  2KDB A;  4ZYN A;  3BY4 B;  4IUM B;  1WX7 A;  2N9X A;  2GBM A;  4BKT A;  4WWN A;  4DK5 A;  2BKR B;  1GC6 A;  2WX0 A;  2MBH A;  1RRB A;  3ZO5 B;  1G6J A;  3PV1 A;  4NAW A;  3SD5 A;  3CMM B;  4FA6 A;  1AAR A;  4NJ6 A;  5J2R A;  2C5L C;  5KHO A;  1H4R A;  4HJK A;  2DYM A;  3X0W A;  3WAP A;  1M94 A;  3UIN B;  5L95 C;  4OVU A;  3U7D A;  3CSF A;  4A3O A;  1X1M A;  3QCA A;  4N9F 4;  2IO1 B;  1R4M I;  5C23 A;  1ZKH A;  5AEK B;  2PEA A;  3ZUN A;  2XK5 A;  4KZ0 A;  4NAW B;  1ZW7 A;  3DOW A;  1WR1 A;  1E8Z A;  1YJ1 A;  3ALB A;  3OJ3 A;  4HWI B;  3S2A A;  3A1Q A;  3NZS A;  2NBV B;  3KVF B;  5AZG A;  1J19 A;  1WF9 A;  2I1K A;  3ZVV A;  4PS3 A;  3JVZ X;  4I6P A;  2BKF A;  2PJH A;  2JPH A;  1EF1 A;  2MBQ A;  2KNB A;  4KIK B;  4HCN B;  2C60 A;  3UQA A;  1HE8 A;  4J6I A;  2VRR B;  3WAM A;  3KUC B;  1WGY A;  1WI0 A;  2LZ6 A;  2PE9 A;  3BIN A;  4DBG A;  1V80 A;  1YD8 U;  2M4N A;  3DPD A;  3SU8 X;  5AZH A;  3KUD B;  1R4N I;  4GSW A;  4MM3 A;  1V5O A;  1WMH B;  1WE7 A;  3RZF A;  4GDL B;  3IBE A;  2JY6 A;  2CKH B;  1E8W A;  3H9D A;  4XX5 A;  4TQ1 A;  2CS4 A;  4G50 A;  3L17 A;  3ZNG C;  2N1W A;  1YX5 B;  3WAN A;  2MA9 B;  1WXM A;  1YIW A;  5JH5 C;  1C3T A;  2KK8 A;  3IVF A;  1JRU A;  4TV3 A;  2YVC A;  1WZ0 A;  3PRP B;  5E6N A;  2EMT A;  2LJ5 A;  1KJT A;  4JQW C;  2FCN A;  2LAS A;  4GOC A;  1WJ6 A;  2DZI A;  4LDT D;  2KQ7 A;  3PRM B;  3X23 A;  3KUZ A;  4ANX A;  3L16 A;  3U30 A;  2CHW A;  2CHZ A;  2KJR A;  3RYT A;  3ONS A;  1XD3 B;  2KWU B;  2I1J A;  3H1U A;  2LRU A;  3RT3 B;  3HM6 X;  4DHJ D;  1RFA A;  3K9P B;  2LVP A;  2M17 A;  3B0A A;  4G0N B;  1P98 A;  2KX0 A;  2MQJ A;  2R2Q A;  2K39 A;  3H6N A;  2NCN A;  4GB9 A;  4MEM A;  4MSQ B;  4ANV A;  1YQB A;  1IP9 A;  1WFY A;  3B08 A;  2WDT B;  3GZN I;  2MBB B;  1KM7 A;  2JRH A;  1E7U A;  4K7W A;  4IW0 A;  4K81 A;  4II3 B;  5G55 A;  4BOZ B;  2QHO A;  4IWO A;  2DZJ A;  1VD2 A;  1YX6 B;  2UWQ A;  1SIF A;  1OEY J;  2ZNV B;  4KV2 A;  1ISN A;  3AU5 A;  2K6Q A;  4DWF A;  2IO2 B;  3IHP C;  3MJW A;  4LJO B;  1P0R A;  2BYV E;  3ZIM A;  4EZL A;  3V62 A;  5D2M B;  2N9E B;  1KOT A;  2PPH A;  4EZJ A;  4JL9 A;  2BWE S;  4MGZ E;  4HLE A;  4K7U A;  2RD0 A;  1WYW B;  1LXD A;  1WJN A;  3Q3F A;  4F7Z A;  4KSK C;  2O6V A;  4GIV A;  4AP4 C;  2J7Q B;  3TMP B;  3VH3 B;  3DBH I;  1EUV B;  4XZ4 A;  5CTR C;  2IY1 B;  3TIX A;  3DBS A;  2NS5 A;  5D7G A;  1V2Y A;  1J0G A;  1GG3 A;  1LQB A;  3APC A;  3PLV A;  3DBR I;  3DVG Y;  3JW0 X;  4MSM B;  5D6J B;  2O6V B;  3AU4 A;  2KOX A;  3A9K A;  3M62 B;  2KDF B;  3VDZ A;  2LI5 A;  3UGB B;  1CMX B;  4MH0 E;  2LXC A;  4BKS A;  1TZ1 A;  4NQL B;  4IWQ A;  4NNJ B;  5C1Z A;  2ZNV C;  2ZPY A;  1Q5W B;  1WR6 E;  4I6N B;  4M0W B;  5BO4 B;  2ASQ A;  2ZCC A;  2KC2 A;  4EOY A;  3QA8 A;  2DX5 B;  4MDK E;  4K1R B;  1FXT B;  2G4D B;  3ZTC A;  4GDK B;  2L7R A;  4FLH A;  4F8C B;  4BBN F;  3EFU A;  4W9I A;  1WM3 A;  2MLB A;  2V3S A;  2C7M B;  3DVN U;  3L10 B;  5JHA A;  1WM2 A;  5JZE B;  3RUL A;  2FID A;  2V1Y A;  2IYD B;  3ZW3 A;  4CHK A;  1BT0 A;  2KWV B;  4WWP A;  3VXW A;  3QX1 A;  2D07 B;  2LVQ A;  2RPQ A;  1GUA B;  4NPN A;  2IBI B;  5DPS A;  4MJS A;  3ML9 A;  4IM2 A;  2HJ8 A;  2KN5 A;  2Z0E B;  3A33 B;  3ZDM C;  5IA7 A;  3M95 A;  3B1L X;  2UYZ B;  2XEW A;  1T0Y A;  2HTH A;  2LGY A;  4WWO A;  3ZNZ B;  4MGI E;  3VH4 B;  1PQS A;  2XK5 B;  3APF A;  2J0J A;  3DQV A;  2WX1 A;  4BBN C;  3TJP A;  3A1Q B;  1WXA A;  1C1Y B;  1P3Q U;  3PHW B;  4E74 A;  1WH3 A;  2BYE A;  1S3S G;  3NS8 A;  1RLF A;  1WGG A;  2DZK A;  4MJS B;  4PS7 A;  4TKN A;  3TBL D;  1Z2M A;  3A4R A;  3R66 C;  4PYU A;  4HDQ A;  3VTU A;  1WRD B;  3RD2 A;  2RSU A;  3QAQ A;  2MW5 A;  3JSV A;  3W1Y A;  5CX3 A;  2N9P C;  3N32 A;  3DVG X;  2A5U A;  3NZU A;  4GN1 A;  2GBR A;  2IO0 B;  2K25 A;  3LDZ E;  1UZX B;  5AZF A;  2ZCB A;  4XC2 A;  2DYO A;  2CR5 A;  1TTN A;  3NOB A;  2HE7 A;  2KLC A;  4ASW C;  5DCN A;  2KXJ A;  1UBI A;  2AEH A;  1VCB A;  4ZRI A;  2N7E A;  2LVO A;  3W1S A;  2L76 A;  2KO3 A;  3JSV B;  5CHF A;  3QQ8 B;  4X57 B;  3NHE B;  2L0F A;  3KW5 B;  1K8R B;  1UH6 A;  3QAR A;  1QZE A;  1WGR A;  2JXX A;  4W9J A;  3IG3 A;  3QHT A;  2MBE A;  2JRI B;  3VFK A;  4CYE A;  3ZKJ C;  2K8H A;  1XQQ A;  1Q0W B;  1L7Y A;  2K8C A;  4NJ7 A;  1WX8 A;  2KTF A;  4YL8 A;  5DPR A;  3ZLZ A;  1D3Z A;  2KKC A;  4HVB A;  5GMV A;  4EKU A;  2MP2 A;  1WIA A;  2L8J A;  3ZRF A;  3A9J A;  1V86 A;  1UBQ A;  3MTN B;  3P2B A;  4A3P A;  2GBN A;  3OAW A;  2FAZ A;  1IPG A;  2NPT A;  1WX9 A;  4DXA B;  3VTV A;  5D94 A;  2KHW B;  4HK2 A;  1V6E A;  2G4S A;  1TGZ B;  2LGD A;  1OTR B;  3UF8 A;  3V61 A;  4B95 A;  5J18 A;  2MP2 B;  4BVU C;  2REX A;  1WXS A;  3A9J B;  2D11 A;  2LRW A;  4G11 A;  4FBJ B;  3NY5 A;  3T8M A;  2PE6 B;  2RGF A;  2DZM A;  2MBO A;  2NPT B;  5CHV C;  4W9E A;  1SGH A;  1WJU A;  3WIM A;  2G3Q B;  3ECI A;  1OQY A;  4LCD E;  4GXB A;  1H8C A;  4P7I A;  2KFK A;  4MGY E;  4TQ0 A;  2NVU I;  3A4S C;  4EEW A;  5J17 A;  4HCP B;  2JT4 B;  4E3C A;  2Z0D B;  3L08 A;  3PSE B;  2KJH B;  4PYZ A;  1GC7 A;  2KMA A;  3PS6 A;  5IAA C;  4AOF A;  1RAX A;  1IYF A;  1V9J A;  1I42 A;  3ZTD A;  3JYU A;  2O6V D;  4ANU A;  2IO3 B;  1E90 A;  3PVL A;  4B9K A;  2WWZ A;  4ZRK A;  4URK A;  5HKH A;  2KFK B;  2LXA A;  1LFD A;  2AWT A;  2JZZ A;  1OGW A;  3H7S A;  4IM3 A;  1E8Y A;  4TUU A;  1Z5S B;  4ICV A;  2B3A A;  3DVN V;  4B6W A;  1Q1O A;  1WGH A;  3L0W B;  4EFO A;  4KSL C;  4NY0 A;  3C0R B;  4FJV B;  4JGH B;  3HM3 A;  4OVV A;  4FJZ A;  1J8C A;  3OLM D;  2ZJD A;  4BKS D;  3WAO A;  4AUQ C;  2W9N A;  3LJ3 A;  3PPA A;  5JHB A;  1I35 A;  5EDS A;  5KHQ A;  5G2N A;  3A9K B;  4BKG A;  2AL6 A;  4F1S A;  3M63 B;  4W9K A;  2MRP A;  3V60 A;  4W9F A;  2NBW B;  2LWP A; 
#chains in the Genus database with same CATH topology
 2PKO A;  4K3C A;  3TCA A;  4A6Q A;  1JNB A;  5BMG A;  4M8M A;  4PS8 A;  4HPM B;  4MEL A;  1YOV B;  1EF5 A;  4JLC A;  2FCQ A;  3MHH B;  3VTW A;  2I30 A;  1QOB A;  1E7A A;  4WWM A;  3TL5 A;  3N30 A;  1MUS A;  4KKJ A;  2KBZ A;  4FN2 A;  5IIX A;  2WQY B;  2ZVO A;  1HA2 A;  2K8B A;  3RI7 C;  3TEW A;  2DAJ A;  2DEN B;  1NEK B;  3WA0 A;  3I3T B;  4OZC A;  1E7F A;  2KZR A;  1VZ8 A;  1NDD A;  1NEN B;  1E7V A;  3QK0 A;  4W9C A;  2KMC A;  1VZ6 A;  3AI5 A;  1ET9 A;  1H9Z A;  2K22 A;  1UWM A;  2KTR A;  3MHZ A;  1A5R A;  3BII D;  5TSS A;  3PO0 A;  3RUI B;  3IAM 1;  2GBK A;  2JUO A;  2CKX A;  3JQZ A;  2L3Z A;  1MHX A;  2M8S A;  3AXC A;  3EHV A;  4LNK A;  2G45 B;  1ZPS A;  2KJ6 A;  2PTL A;  2WYQ A;  4GDX A;  2E3T A;  2KLG A;  3GB1 A;  1E7G A;  4HDO A;  2KMM A;  3FKY A;  4MBE C;  4C00 A;  3UIV A;  1WGD A;  2QSD A;  3CF6 E;  1KH0 A;  2M1M A;  2VH2 A;  4G3X B;  3BVM A;  4W9G A;  2E6X A;  3VUW A;  2LMC A;  2LUE A;  1LO5 D;  5IJE A;  2I38 A;  3HK0 A;  4LDT B;  1C4P A;  4ZDV A;  2XVU A;  1FPY A;  2MWS B;  1BXT A;  3P42 A;  3VHT C;  1RFK A;  2N7D A;  2N4F A;  1F9J A;  4DHJ B;  2K6D B;  3AED B;  3IT6 B;  4ITK A;  4WJN A;  3SDL C;  4S17 A;  2ZZP B;  3R2I A;  2KWD A;  3V6C B;  1MG8 A;  3R7Q A;  1EU3 A;  1OFF A;  2KT7 A;  2ZEQ A;  1D5X C;  4C56 C;  1TJE A;  4HXD A;  3B9M A;  2RR9 A;  1FXI A;  2N1V A;  4IC7 B;  3A73 A;  3V08 A;  2MX2 A;  2IND C;  4IWP A;  4NQK E;  2BS4 B;  2KDE B;  4RM8 A;  1V1P A;  1E5W A;  2C7N B;  3V3X A;  3PZD A;  3H7P B;  3PRZ A;  4KVG B;  4IKG A;  1K50 A;  2AL3 A;  2J0K A;  3N1X C;  3DCG A;  3PTF C;  4JIO U;  3BY4 B;  1ZOY B;  4WWN A;  2BKR B;  1GC6 A;  2EFE A;  2MBH A;  2WDV B;  3VR8 B;  3SD5 A;  3CMM B;  5J2R A;  1AAR A;  1L6V A;  1H4R A;  3X0W A;  3WAP A;  4OZB A;  3DBR B;  4OVU A;  4Z69 A;  4WA6 B;  4N9F 4;  1FOU A;  1NT2 B;  1O9X A;  5C23 A;  2K5P A;  4TSS A;  3Q3N C;  1ZW7 A;  4M01 A;  1GPX A;  1MIW A;  2LFI A;  5FR3 A;  3ALB A;  1DOX A;  3NZS A;  2OJW A;  3I5J C;  2I1K A;  1DOY A;  3JVZ X;  2BKF A;  3W5U B;  4M00 A;  2MBQ A;  2KNB A;  1L5P A;  1CZP A;  3BIN A;  1YD8 U;  2MJ3 A;  3ZYY X;  4BZA A;  4GSW A;  2SEB D;  3AEF B;  4NZL B;  3RZF A;  2CS4 A;  2N1W A;  1YX5 B;  4HRS A;  1HQR D;  2ROH A;  1HA5 A;  3IVF A;  2BXQ A;  5E6N A;  2EMT A;  2LJ5 A;  3AE9 B;  4JQW C;  1V1O A;  2MJE A;  3NVZ A;  2TSS A;  5I4D A;  2WS3 B;  2CHZ A;  4A55 A;  2XNA C;  3HM6 X;  3K9P B;  2LVP A;  3B0A A;  2M17 A;  5BYR A;  2OZB B;  3H6N A;  1E0Z A;  1MPE A;  4MEM A;  3MJ5 A;  4MSQ B;  2Y3A A;  4ANV A;  1WFY A;  1FCC C;  3LU8 A;  1UNS A;  4BOZ B;  4J2V A;  1KW2 A;  2DZJ A;  4XGA B;  4B0E A;  1E7C A;  2UWQ A;  5IO9 A;  2K6Q A;  2IO2 B;  3ZIM A;  1P0R A;  2BYV E;  2GLS A;  4MT5 A;  3BYT B;  2RDG A;  1C79 A;  4JL9 A;  2BWE S;  4K7U A;  4ACF A;  4KSK C;  4ZUX V;  1WXQ A;  3RN9 C;  3DBH I;  1EUV B;  3Q3M C;  4HGK A;  4XZ4 A;  2IY1 B;  2NS5 A;  5D7G A;  4JK4 A;  1V2Y A;  4BAX A;  4AS1 A;  1GG3 A;  2FE8 A;  2PMV A;  1EU4 A;  2KYW A;  3APC A;  3JW0 X;  5D6J B;  3SQJ A;  3NVM A;  1VRA B;  2LXC A;  1CQV A;  4BKS A;  4H2A A;  3ZQ4 A;  2XVV A;  4I6N B;  2ASQ A;  2ZCC A;  4N58 A;  3N1Z C;  4MDK E;  2JXT A;  4L2Y A;  2XW1 A;  3EFU A;  3AEC B;  2MLB A;  3DVN U;  1T0Q C;  2L52 A;  3MC9 A;  5JZE B;  3RUL A;  2FID A;  2IYD B;  1QT9 A;  2KWV B;  4WWP A;  4ARI A;  3U2S C;  2IBI B;  1YJJ A;  2KN5 A;  3A33 B;  2XEW A;  1T0Y A;  3BWU D;  4MGI E;  2XK5 B;  3APF A;  3NJT A;  3PHW B;  1WGG A;  3TBL D;  3VTU A;  2KVZ A;  2WXI A;  1WRD B;  4C7Y A;  2MW5 A;  1ET6 A;  4RF0 A;  3N32 A;  2YDF A;  4GN1 A;  2K25 A;  4O1N A;  2WP9 B;  3LU7 A;  2DYO A;  1UF0 A;  1H5W A;  2BQQ A;  2IDY A;  4YSZ B;  4ASW C;  2KXJ A;  1UBI A;  2PW9 A;  2KO3 A;  1BM0 A;  1J7B A;  3NHE B;  2L0F A;  1JML A;  3QAR A;  1WGR A;  2JXX A;  1YQ3 B;  3QHT A;  2MBE A;  4ZCG A;  2WXR A;  1MIY A;  1MHH E;  2MJD A;  2WXL A;  2WXK A;  4NJ7 A;  2BX8 A;  3ZLZ A;  1KRH A;  2UU7 A;  2W3R A;  1XLN A;  3I57 A;  2MP2 A;  3A9J A;  4LB9 A;  4M02 A;  4D2K A;  2HDE A;  1WX9 A;  2KHW B;  1CK1 A;  4B95 A;  1OTR B;  3UF8 A;  1SE4 A;  1C76 A;  2WLB A;  3P1M A;  3T8M A;  3C8Y A;  4XYC A;  2AJE A;  2MBO A;  4LCD E;  2VUE A;  2INP E;  1B1Z A;  2Z0D B;  3L08 A;  1GC7 A;  4YTN B;  5D3D A;  5FUO A;  2IO3 B;  4B9K A;  4D7X A;  1Q10 A;  2WWZ A;  3Q2A C;  1TY2 A;  3TMP B;  3M99 C;  1OGW A;  4IM3 A;  4TUU A;  1Z5S B;  1KDX A;  3DVN V;  1EM7 A;  3L0W B;  3Q8F A;  3J9C A;  4JGH B;  3HM3 A;  1MG4 A;  4OVV A;  4L23 A;  3OLM D;  4PK1 A;  2ZJD A;  4AUQ C;  3LJ3 A;  5EDS A;  3A9K B;  4BKG A;  2AL6 A;  4F1S A;  2NQO A;  2D3C A;  2MRP A;  2BXF A;  1J7A A;  1QIL A;  1LOT A;  4FK5 B;  1AWD A;  2BB5 A;  4AJW A;  3V6E B;  2M0A A;  1V5T A;  2LHD A;  3NVV A;  2W82 A;  2BS2 B;  1K51 A;  1UD7 A;  3AE6 B;  1FCL A;  2LGX A;  2Q5W D;  3GP7 A;  4II2 B;  2I2Y A;  2NR2 A;  4DHZ E;  4LK0 M;  2BXN A;  3DDC B;  1QOF A;  3QWZ B;  2JX5 A;  5DQF A;  1L6U A;  4LLG M;  1QQR A;  4LB2 A;  3ZGZ A;  1R4M B;  4N0U D;  4P6V F;  2M0X A;  2XBB C;  3ZDT A;  4P1C C;  4FXC A;  1PGX A;  2HD5 B;  3H37 A;  1HTO A;  3DBL I;  3DWM A;  4BFR A;  1GB1 A;  3AEB B;  5H8Y E;  2BXP A;  1BUI C;  1NBF C;  1WE6 A;  5LXH A;  1MUH A;  4KZC A;  3VQI A;  1E6E B;  3E56 A;  2WXO A;  3R3M A;  2KDI A;  3L54 A;  2DHZ A;  4KKI A;  1FXA A;  4ICU A;  2QHB A;  1I4H A;  1OQR A;  3IFW B;  2EMS A;  1AYF A;  5EE9 A;  5TR5 A;  3QIJ A;  3FAH A;  3ZJT A;  3WAL A;  2BVC A;  2IZV B;  3KLS X;  4US9 A;  3UQB A;  2D3G A;  1SE2 A;  4C4V B;  2D10 A;  2V36 A;  2KFJ A;  4JWS C;  2XVW A;  2GOW A;  1KLU D;  2R2O A;  3M3J A;  2Y5P A;  3PHX B;  1L2N A;  4KDL B;  1NVI D;  2V0G A;  4QAY A;  2J0M A;  3W1S C;  4IG7 B;  2IGG A;  2FIF A;  2QJL A;  4W9D A;  1GNU A;  2KAN A;  2CJO A;  3GZN B;  2IGH A;  2H88 B;  4A20 A;  4EUT A;  2IY0 B;  2O2V B;  1Y8R C;  3FWB C;  3EC8 A;  1FIQ A;  5LLI A;  3UIO B;  1QOA A;  2JF5 A;  2K9X A;  2NBU A;  1KLG D;  3PRE A;  2NTT A;  2JZ3 B;  2KD0 A;  3T9L A;  4ANW A;  1B9R A;  2KDB A;  2K0P A;  1HK5 A;  3AN1 A;  4DK5 A;  5G5G A;  2WX0 A;  1RRB A;  1HEZ E;  1LNS A;  4WUR A;  1WGK A;  2NNW A;  1KXP D;  4FA6 A;  5KHO A;  3UIN B;  4A3O A;  2BYT A;  2Z8J A;  3Q6B A;  2WDR B;  1C4C A;  3JRY A;  2XK5 A;  4NAW B;  5FKA C;  3DOW A;  1I4P A;  1YJ1 A;  4HWI B;  3S2A A;  1FFV A;  5AZG A;  1J19 A;  1VJK A;  3ZXR A;  2JYT A;  3ZVV A;  4OTU A;  3OWE B;  4PS3 A;  4I6P A;  4TMA B;  2PJH A;  3FIL A;  3Q69 A;  1EF1 A;  4HRO A;  4KIK B;  4NJC A;  4HCN B;  3UQA A;  3MC0 B;  4F5T A;  1ROE A;  3CWI A;  4C7Z A;  4DBG A;  1E7P B;  2QM6 A;  1FNV A;  3TSS A;  1R4N I;  3UI3 A;  4YT0 B;  1WMH B;  4GDL B;  3IBE A;  1E8W A;  3H9D A;  1HK3 A;  4G50 A;  1ACC A;  3R8B A;  1JRU A;  3Q3O C;  5LNK 1;  3GE8 C;  2BXE A;  3Q8C A;  4MM3 B;  5D3I B;  5H92 C;  4GOC A;  5IJ5 A;  4LDT D;  3PRM B;  2B76 B;  4ANX A;  2ZW1 A;  3L16 A;  3U30 A;  2GB1 A;  3RFZ B;  4CQN A;  2JYE A;  1JAL A;  3ONS A;  1XD3 B;  2KWU B;  3EFC A;  2XSI A;  4DHJ D;  2HTM E;  2DBU A;  4ARC A;  2MQJ A;  2I2Z A;  2K39 A;  4A8X C;  3Q8A A;  1JWU D;  3BK1 A;  2WDT B;  2LQI A;  1QF6 A;  1E7U A;  5G55 A;  1ZE3 D;  1YX6 B;  3MC8 A;  1OEY J;  4KV2 A;  3AU5 A;  4LJO B;  5IJF A;  5D2M B;  1TZO A;  1KOT A;  2PPH A;  4MGZ E;  3BYY B;  1WYW B;  1LXD A;  4GIV A;  2J7Q B;  4LUF A;  3VH3 B;  4MAC A;  4L8U A;  4F5S A;  1SEB D;  1MVK A;  1LQB A;  3G9K D;  1GNI A;  2O6V B;  3AU4 A;  1N60 A;  2IGD A;  3A9K A;  3VDZ A;  4PT5 A;  2LI5 A;  1WRI A;  4XE0 A;  4YSY B;  1TZ1 A;  2MHJ A;  4IWQ A;  2ZNV C;  3IAS 1;  4M0W B;  1DOI A;  5BO4 B;  4EOY A;  2LUM A;  2DLB A;  4K1R B;  1FXT B;  2WXH A;  4GDK B;  4BBN F;  3V05 A;  2V3S A;  5JHA A;  2C7M B;  4L1B A;  1WM2 A;  2NTS A;  3ZW3 A;  1MJD A;  2R61 A;  1WWT A;  1K52 A;  4RCO A;  1HK2 A;  4MJS A;  2RDB C;  2ZW0 A;  3ML9 A;  4IM2 A;  2Z0E B;  3AB5 A;  3M95 A;  3B1L X;  2HTH A;  4WWO A;  3ZNZ B;  3P63 A;  4ZBK A;  4USA A;  3DQV A;  3N9Y C;  2WX1 A;  1IJG A;  3TJP A;  3A1Q B;  3DHG C;  4E74 A;  4TKN A;  1RLF A;  1UWX A;  1SIJ A;  4BY9 C;  2WHI A;  1Z2M A;  3R66 C;  4K2C A;  5E6J A;  3RD2 A;  1GAQ B;  1LGR A;  3JSV A;  1GB4 A;  3W1Y A;  3AH7 A;  2JQR B;  2N9P C;  4IW2 A;  5CX3 A;  3WCQ A;  1HZ5 A;  1WSP A;  2GBR A;  4LNF A;  3B2F A;  5AZF A;  1QKZ A;  2ZCB A;  2INN E;  2CR5 A;  3NOB A;  1JWM D;  3KIK A;  1L4D B;  1VCB A;  1WYG A;  4ZRI A;  2N7E A;  2L76 A;  5HI1 A;  5CHF A;  2L32 A;  3QQ8 B;  4X57 B;  3KW5 B;  3MP9 A;  1K8R B;  5HOZ A;  3VFK A;  1T0R C;  4CYE A;  3ZKJ C;  2EFH A;  3KWV A;  1I4Q A;  2KTF A;  1D3Z A;  4HJG E;  2J53 A;  1AN8 A;  3TEY A;  1SSN A;  1WIA A;  2E0Y A;  2QCZ A;  3ZRF A;  4A3P A;  4HEA 1;  1NYR A;  3OAW A;  1YJI A;  1IPG A;  2NPT A;  4DXA B;  5G5H A;  1ESF A;  2J42 A;  4HK2 A;  3RNG C;  1P7E A;  2KAC A;  3MHS B;  2G4S A;  1TGZ B;  5J18 A;  4BVU C;  2INC C;  4G11 A;  4FBJ B;  3HRD D;  3FWC C;  3IXS A;  2DZM A;  5CHV C;  2BXK A;  1SGH A;  1WJU A;  1SB0 A;  3ECI A;  1OQY A;  2KFK A;  4MGY E;  5J17 A;  2RDH A;  2QDF A;  3A4S C;  2JT4 B;  1TKY A;  2VH1 A;  4J3O D;  5IAA C;  3URY A;  5EE0 A;  1P7F A;  1V9J A;  1I42 A;  3ABV B;  2OED A;  3NMU A;  3JYU A;  1IGD A;  3LU6 A;  1IBX B;  2QMT A;  2N9L A;  1LFD A;  1FNU A;  2AWT A;  3V09 A;  2WXQ A;  3H7S A;  3B9L A;  1JWS D;  3LXF A;  1WGH A;  4EFO A;  1TS2 A;  2KAJ A;  4FJV B;  2XVQ A;  2V3P A;  3NZ3 A;  4FJZ A;  1JCK B;  1J8C A;  5JXV A;  3EGR A;  4C31 B;  1T5X D;  3WAO A;  5JHB A;  1I35 A;  5KHQ A;  1QLB B;  3M63 B;  4W9K A;  2WDQ B;  3I9V 1;  3W5V B;  1XEE A;  2LWP A;  2RMM A;  2A4Z A;  5DBY A;  2ONQ A;  3AE7 B;  3QJZ A;  3K9O B;  4FAD A;  4HKZ E;  3CIR B;  4RMA A;  2BXH A;  1C9F A;  4GU2 A;  5GHK A;  2EKI A;  3AE3 B;  1GJZ A;  1OEY A;  2AYO B;  5CHW A;  3ZNH B;  2LXT A;  5LXI B;  2G9H D;  2GUT A;  3AE4 B;  1P1A A;  5E6P A;  2QIE B;  4KIK A;  1DGJ A;  3AE1 B;  3UIP B;  1HK1 A;  2DBX A;  4ZRJ A;  2AGH B;  4YWG G;  2BXA A;  2MCN B;  1DYQ A;  1I4G A;  4EMX A;  4HGM B;  1WMH A;  4WAA A;  1TKG A;  4GDL A;  4ZRQ A;  3PGE A;  2RPV A;  4FHK A;  2BF8 B;  3GOE A;  2CJN A;  3EEC A;  1TT5 B;  4RH6 A;  2WXJ A;  3P4S B;  4AWJ A;  2FUH B;  3SHQ A;  2KTR B;  1BKE A;  2PIA A;  4K3B A;  3ML8 A;  1E7H A;  4OTT A;  3KH0 A;  4I6L B;  2D2Q A;  3O13 A;  4XDD A;  4G01 A;  4WJQ A;  2KX3 A;  5BYQ A;  5L83 A;  3OJ4 B;  4K7S A;  2ZPN A;  2QC8 A;  4WJO A;  1SF0 A;  1JWA D;  3L4P A;  1FO4 A;  4IM0 A;  3U52 E;  2V9H A;  4FHJ A;  4E71 A;  1ZUD 2;  3RCZ A;  4AJY B;  4HPP A;  2WXF A;  3RPF C;  2LJI A;  2N7J A;  2DAF A;  4K71 A;  1N5X A;  2C9W B;  3AUL A;  2VZK D;  4KDI C;  4OZA A;  5HG2 A;  1VDV A;  3APD A;  2GMI C;  1LM8 B;  2BGF A;  3VVW B;  2FBW B;  1RYJ A;  1NI3 A;  2GBJ A;  4MH8 A;  3D32 A;  3R7R A;  2PVG C;  4EZK A;  4XWT A;  4LNO A;  2JVC A;  3H7P A;  4DHZ B;  1L0X B;  1XT9 B;  4CO7 A;  1HTQ A;  2K1F A;  3RZW C;  2KC1 A;  4WJP A;  3U8Z A;  1TYG B;  5DPW A;  3CST A;  4OR0 A;  2CHX A;  3KQ4 A;  2Y5B B;  4HPL B;  4UDU C;  3VUY A;  2MSE D;  3KYD D;  4RM9 A;  3T3N A;  2W55 A;  3L13 A;  2K3U A;  3DHH C;  4GDK A;  1HXY D;  1WX7 A;  2GBM A;  4LUH A;  2LHE A;  3DBH B;  3RNF C;  3ZO5 B;  1G6J A;  3PV1 A;  1FRD A;  5T8I A;  2DYM A;  2BW2 A;  4JWU C;  4WQM A;  2BXO A;  3RNB C;  1M94 A;  2HJ1 A;  3U7D A;  2ACZ B;  1X1M A;  4OT2 A;  3QCA A;  1J78 A;  2CU3 A;  1J7C A;  2BS3 B;  1PUT A;  2K0N A;  3OJ3 A;  3PLA A;  3A1Q A;  2KQ4 X;  2NBV B;  3KVF B;  4LNI A;  2WXM A;  1N63 A;  2MEK A;  4XDC A;  4KGT A;  3U7Z A;  1MFW A;  4ZHO A;  2VRR B;  1V8C A;  1WGY A;  2LZ6 A;  1I4X A;  2IPK D;  3U4E G;  3AE5 B;  3TEX A;  1HZ6 A;  1AW7 A;  2LGI A;  3WAN A;  2LEK A;  2MA9 B;  2GI9 A;  1T6B X;  1YIW A;  1C3T A;  2KK8 A;  2N9K A;  3EA6 A;  3N20 C;  4TV3 A;  1WZ0 A;  2OHF A;  1KJT A;  2FCN A;  2LAS A;  3MFG A;  2LXS A;  3HUI A;  2KQ7 A;  3WHS A;  3KUZ A;  4M70 B;  4DQO C;  3N1Y C;  2CHW A;  2KJR A;  1E7I A;  5GIP A;  1ZXI A;  4ZC6 A;  3H1U A;  2LRU A;  4YTP B;  3RT3 B;  4NAM A;  2XMO A;  2W3S A;  3OG5 A;  1P98 A;  2R2Q A;  3BPJ A;  1STE A;  4RF1 A;  2NCN A;  4GB9 A;  1IP9 A;  1L4Z B;  1F0Z A;  5HHD G;  3B08 A;  1VLB A;  2MBB B;  1XCT L;  5IFO A;  4K81 A;  2AQ2 B;  2JU6 X;  4IW0 A;  3SEB A;  1VD2 A;  5ID7 A;  1TF0 A;  1XO3 A;  3EUB 2;  1C78 A;  4DWF A;  3NVY A;  3B2G A;  4EZL A;  5IOI A;  3SIU B;  1IBX A;  2RD0 A;  1F1H A;  4F7Z A;  4ZOH C;  5MPO A;  3A75 A;  4N0F D;  4S0R A;  3DBS A;  2DG5 A;  1J0G A;  3Q8E A;  2WXP A;  1YQ4 B;  3PLV A;  3DBR I;  2LOQ A;  3DVG Y;  2BTE A;  3VRA B;  4OVZ A;  3M62 B;  1SB3 C;  4MH0 E;  5C1Z A;  2ZPY A;  1SXT A;  1CJE A;  1Q5W B;  2KC2 A;  3QA8 A;  2DX5 B;  4AQ7 A;  4WAF A;  5BPK A;  3ZTC A;  2L7R A;  5IKC M;  1AO6 A;  4W9I A;  3L10 B;  4R3D A;  2FUG 1;  3AM9 A;  1KTK A;  3TDL A;  4RGN A;  3VXW A;  3QX1 A;  2D07 B;  2RPQ A;  4NPN A;  2Z8K A;  1PGA A;  5DPS A;  4DXG A;  3SFE B;  1F77 A;  2VDB A;  1R7S A;  2HJ8 A;  2WU5 B;  5IA7 A;  1YMH E;  1PQS A;  1C1Y B;  3NS8 A;  1FNW A;  2WXG A;  2V3N A;  2BT6 A;  2RSU A;  3QAQ A;  2DBY A;  2D5G A;  3DVG X;  2A5U A;  3NZU A;  2IO0 B;  3LDZ E;  1UZX B;  3SFD B;  1XCQ L;  2AEH A;  2Y5C A;  4I9O A;  2MH7 A;  1UH6 A;  1QZE A;  4LA0 A;  3IG3 A;  2K8H A;  1XQQ A;  3DBL B;  1Q0W B;  1SBB B;  1L7Y A;  4FJC B;  1FEH A;  3P4Q B;  5C2T B;  1WX8 A;  4Q2J A;  4N59 A;  1TS5 A;  2WXN A;  4EKU A;  2L8J A;  1ZDX A;  5EE3 A;  3P2B A;  1JRO A;  1EWC A;  1D5M C;  4G03 A;  3KWL A;  5IIH A;  5FK9 C;  1V6E A;  3SIV B;  2MP2 B;  1XF5 L;  3A9J B;  4F5V A;  3NY5 A;  1PFD A;  4IOI E;  4W9E A;  3WIM A;  1H8C A;  2G3Q B;  4GXB A;  4XWW A;  4P7I A;  2NVU I;  2J52 A;  2N0S B;  4PYZ A;  3PSE B;  5B5T A;  2KJH B;  4AOF A;  2KMA A;  3PS6 A;  1RAX A;  4REZ A;  2ICI A;  2O6V D;  1JW9 D;  1L0Y B;  3ICX A;  2LQH A;  4ZBQ A;  3CX9 A;  5AUI A;  1E8Y A;  4ICV A;  2B3A A;  2EFD A;  2PLP A;  1Q1O A;  2BBC A;  4A90 A;  2WGS A;  2H89 B;  3C0R B;  3DHI C;  4A9A A;  1HK4 A;  4W4U B;  2D3A A;  1M4V A;  3V60 A;  4W9F A;  3RNE C;  1GOZ A;  3WHR A;  5IP4 D;  1K53 A;  1SE9 A;  4FJY A;  2JWZ A;  4BKE A;  4FUL A;  4BOS C;  4YSX B;  1YNT E;  2DNF A;  1NI2 A;  4ZHP A;  3VRB B;  4RGM A;  1N5U A;  1S1Q B;  2BYF A;  3PZ7 A;  3ECP A;  3O65 B;  4W9L A;  1E78 A;  2BXI A;  1TBE A;  2YLM A;  3ZNI D;  4YTM B;  3KYC D;  5GXG B;  1F2R C;  2BWF A;  2FCM A;  1QOG A;  3ZRC A;  1TS4 A;  2W54 A;  3RNC C;  2L05 A;  1FMA D;  2C7H A;  3C19 A;  4C80 A;  3HIZ A;  4W9H A;  4YXD B;  1PYW D;  5C3J B;  2L1A A;  1P9D U;  1KLV A;  1XLO A;  2D3B A;  3QC8 B;  4LJP B;  1UEL A;  2DBW A;  4DDG D;  4JPS A;  2PVO D;  3ENE A;  2JZP A;  1E9M A;  1RM6 C;  1V81 A;  3RNA C;  1WJ4 A;  3WHQ A;  2DYB A;  3E9S A;  1EO6 A;  1U4A A;  2AQ1 B;  4LTU A;  3VAW A;  1WXV A;  4M8N A;  1E7E A;  2AX5 A;  2SAK A;  1R4N B;  4GMV A;  2KQS A;  4C4V A;  2IJ0 A;  2NMQ A;  1WY8 A;  3H3A A;  4MGK E;  2KWC A;  3MHS D;  2L0T A;  5BMH A;  1E8X A;  2OOB B;  3PLU A;  2ZVN A;  2FCS A;  3VUX A;  3GQU A;  3TUO A;  4OW0 A;  3PT2 B;  2BPS A;  4N6E B;  5DPT A;  1UUP A;  1OQQ A;  3Q14 C;  5E6O A;  4WQO B;  1BML C;  4G04 A;  2E0X A;  2O2V A;  2KVR A;  1F2R I;  5HFY A;  2LD9 A;  4IDI A;  3N3K B;  1YN4 A;  2V4L A;  1WZ3 A;  1V49 A;  2OJR A;  5FR6 A;  2G1E A;  1Y56 A;  2Z59 B;  2FNJ B;  3HVZ A;  2EKE C;  5GIN A;  1I7H A;  3Q3J A;  2X38 A;  3T3O A;  4HKQ A;  1UGM A;  2L00 B;  3NVW A;  2CU1 A;  4DDI D;  1ZGU B;  4GGQ A;  3HHM A;  2J4X A;  3GA9 L;  1RWS A;  4ZYN A;  4IUM B;  2N9X A;  4BKT A;  4LNN A;  4P16 A;  5BMI A;  3SR6 A;  4NAW A;  3W9C B;  4NJ6 A;  2C5L C;  3PZ8 A;  4HJK A;  4RNA A;  1MM8 A;  5L95 C;  2QEJ C;  3BVG A;  4DXF A;  3CSF A;  2JUH A;  2IO1 B;  1A70 A;  1R4M I;  5ID9 A;  2OT3 A;  1ZKH A;  2YEP B;  5AEK B;  5BYS A;  2PEA A;  3ZUN A;  1E10 A;  4KZ0 A;  3AE8 B;  1WR1 A;  1N5W A;  1E8Z A;  2EEL A;  3ETR A;  1WF9 A;  4IW1 A;  3R2T A;  3VR9 B;  1JQ4 A;  3ZXV A;  2YEP F;  1VZ7 A;  3AV8 A;  2JPH A;  4DHX B;  2C60 A;  1HE8 A;  2GRI A;  1UOR A;  4J6I A;  3WAM A;  3KUC B;  1TS3 A;  4L9Q A;  1WI0 A;  2PE9 A;  1V80 A;  1IGC A;  1MIV A;  2M4N A;  1SJE D;  1N62 A;  2VUF A;  3DPD A;  5AZH A;  3KUD B;  3SU8 X;  4WIP A;  3V03 A;  4DM0 A;  3FIL B;  4MM3 A;  4ZRP A;  1V5O A;  2XW0 A;  1WE7 A;  2BXB A;  4B0M A;  1FD6 A;  2JY6 A;  2CKH B;  1MA9 A;  4XX5 A;  4TQ1 A;  3L17 A;  3ZNG C;  1WXM A;  5JH5 C;  1I4R A;  1D5Z C;  2YVC A;  3P4P B;  3PRP B;  3AEG B;  1D6E C;  1WJ6 A;  2DZI A;  3X23 A;  3DWG C;  2BXG A;  4KGR A;  3RYT A;  2I1J A;  4GLS C;  3AEA B;  3H8H A;  1RFA A;  1ZXH A;  2BXC A;  4G0N B;  2KX0 A;  1YQB A;  3TEZ A;  1ZDV A;  1ENF A;  3GZN I;  1KM7 A;  3NS1 A;  2JRH A;  1V97 A;  4K7W A;  4II3 B;  1FFU A;  2QHO A;  3AE2 B;  4IWO A;  1VFI A;  1VR9 A;  2BXD A;  1SIF A;  2ZNV B;  1VZS A;  1ISN A;  2X8X X;  2ON8 A;  5IIU A;  3IHP C;  3MJW A;  2QMC A;  1FRR A;  3V62 A;  2N9E B;  4EZJ A;  4HLE A;  2AQ3 B;  3ZJV A;  1WJN A;  3Q3F A;  4RFB A;  2O6V A;  4AP4 C;  2VZK B;  3ZJU A;  5CTR C;  3TIX A;  3FNM A;  4FIP B;  4WH4 A;  4M0W A;  4RGT A;  2M19 A;  3GE3 C;  4MSM B;  2EFC A;  2M56 B;  2KOX A;  2KDF B;  3LYY A;  4L9K A;  3UGB B;  1V1P B;  1CMX B;  3AEE B;  4NQL B;  4NNJ B;  1MI0 A;  1WR6 E;  3NVK A;  2KN4 A;  4S1Y A;  3W2D A;  2JSV X;  1TY0 A;  2G4D B;  4JE3 B;  4FLH A;  4F8C B;  1C77 A;  5GIO A;  5IN7 A;  1WM3 A;  1C4A A;  3NVI A;  2V1Y A;  4CHK A;  1BT0 A;  1GNJ A;  2LVQ A;  1GUA B;  3FC4 A;  1E7B A;  3GS2 A;  3ZDM C;  4PO0 A;  2UYZ B;  1PGB A;  2LGY A;  4KGS A;  3VH4 B;  4EE2 A;  1N61 A;  2J0J A;  4BBN C;  4KX6 B;  1KF6 B;  1WXA A;  3HVD A;  3P4R B;  1P3Q U;  1WH3 A;  2BYE A;  1S3S G;  2DZK A;  4MJS B;  4PS7 A;  1SE3 A;  3A4R A;  4PYU A;  4HDQ A;  2L83 A;  4ZBR A;  3B9J A;  4E99 A;  4F5U A;  1T3Q A;  4XC2 A;  3IT4 B;  2LGS A;  1TTN A;  2HE7 A;  1XLP A;  1YN3 A;  2KLC A;  5DCN A;  1L0V B;  2BXM A;  3KJL A;  2LVO A;  2XN9 C;  3W1S A;  3JSV B;  2KWF A;  1KFY B;  1UGJ A;  4US8 A;  4GG2 A;  5EE1 A;  1D4B A;  2Z8I A;  2Z8L A;  3RMK C;  3AMZ A;  1JWB D;  3Q8B A;  4W9J A;  3NUH B;  3NRZ A;  2JRI B;  3LB8 C;  3NG0 A;  1FM0 D;  2K8C A;  4YL8 A;  5DPR A;  2KKC A;  4HVB A;  3BZD B;  5GMV A;  1TIF A;  5AUK A;  1TKE A;  1V86 A;  1UBQ A;  3MTN B;  4Z9O A;  2GBN A;  2BB6 A;  2FAZ A;  1XXG A;  3VTV A;  5D94 A;  4P1B C;  2LGD A;  3V61 A;  3GQX A;  2REX A;  1WXS A;  2KDM A;  2D11 A;  2LRW A;  2QIL A;  1EWY C;  2PE6 B;  2RGF A;  2NPT B;  3BK2 A;  2JWU A;  4JX1 C;  1ZP0 B;  4TQ0 A;  4EEW A;  4HCP B;  1F52 A;  4E3C A;  1IYF A;  3I63 C;  2DWQ A;  3ZTD A;  4RGO S;  2BXL A;  4ANU A;  1E90 A;  3PVL A;  3BVZ A;  4ZRK A;  4URK A;  1N6Z A;  5HKH A;  2KFK B;  2LXA A;  2V4I B;  2JZZ A;  1NYQ A;  2WNM A;  4B6W A;  1IUE A;  4KSL C;  4NY0 A;  1T0S C;  1YN5 A;  1J7E A;  1SJH D;  4BKS D;  2W9N A;  3PPA A;  1JRP A;  5G2N A;  4ZYS A;  1PDX A;  2WU2 B;  1BJ5 A;  1XLQ A;  4N3Z A;  4OHJ A;  2NBW B;  1TXU A; 
#chains in the Genus database with same CATH homology
 2PKO A;  3TCA A;  4A6Q A;  1JNB A;  5BMG A;  4M8M A;  4PS8 A;  4HPM B;  4MEL A;  1EF5 A;  4JLC A;  2FCQ A;  3MHH B;  3VTW A;  2I30 A;  1QOB A;  1E7A A;  4WWM A;  3TL5 A;  3N30 A;  4KKJ A;  2KBZ A;  4FN2 A;  5IIX A;  2WQY B;  2ZVO A;  1HA2 A;  2K8B A;  3TEW A;  2DAJ A;  2DEN B;  1NEK B;  3WA0 A;  3I3T B;  4OZC A;  1E7F A;  2KZR A;  1VZ8 A;  1NDD A;  1NEN B;  1E7V A;  3QK0 A;  4W9C A;  2KMC A;  1VZ6 A;  3AI5 A;  1ET9 A;  1H9Z A;  2K22 A;  1UWM A;  2KTR A;  3MHZ A;  1A5R A;  3BII D;  5TSS A;  3RUI B;  3PO0 A;  3IAM 1;  2GBK A;  2JUO A;  2CKX A;  3JQZ A;  2L3Z A;  2M8S A;  3AXC A;  1MHX A;  3EHV A;  2G45 B;  1ZPS A;  2KJ6 A;  2WYQ A;  2PTL A;  4GDX A;  2E3T A;  2KLG A;  3GB1 A;  1E7G A;  4HDO A;  2KMM A;  4MBE C;  3UIV A;  1WGD A;  3CF6 E;  2QSD A;  1KH0 A;  2M1M A;  4G3X B;  4W9G A;  3BVM A;  2E6X A;  3VUW A;  2LMC A;  2LUE A;  1LO5 D;  5IJE A;  3HK0 A;  4LDT B;  2I38 A;  4ZDV A;  1C4P A;  2XVU A;  2MWS B;  1BXT A;  3P42 A;  3VHT C;  2N7D A;  1RFK A;  2N4F A;  1F9J A;  4DHJ B;  2K6D B;  3AED B;  3IT6 B;  4ITK A;  4WJN A;  3SDL C;  2ZZP B;  3R2I A;  2KWD A;  3V6C B;  1MG8 A;  3R7Q A;  1EU3 A;  1OFF A;  2ZEQ A;  1D5X C;  4C56 C;  4HXD A;  1TJE A;  3B9M A;  2RR9 A;  1FXI A;  2N1V A;  4IC7 B;  3A73 A;  3V08 A;  2MX2 A;  4IWP A;  4NQK E;  2KDE B;  2BS4 B;  4RM8 A;  1V1P A;  1E5W A;  2C7N B;  3V3X A;  3PZD A;  3H7P B;  3PRZ A;  4KVG B;  4IKG A;  1K50 A;  2AL3 A;  2J0K A;  3DCG A;  3PTF C;  4JIO U;  3BY4 B;  1ZOY B;  4WWN A;  2BKR B;  1GC6 A;  2EFE A;  2MBH A;  2WDV B;  3VR8 B;  3SD5 A;  3CMM B;  5J2R A;  1AAR A;  1L6V A;  1H4R A;  3X0W A;  3WAP A;  4OZB A;  4OVU A;  4Z69 A;  4WA6 B;  4N9F 4;  1FOU A;  1NT2 B;  1O9X A;  5C23 A;  2K5P A;  4TSS A;  1ZW7 A;  1GPX A;  1MIW A;  2LFI A;  5FR3 A;  3ALB A;  1DOX A;  3NZS A;  2I1K A;  1DOY A;  3JVZ X;  2BKF A;  3W5U B;  2MBQ A;  2KNB A;  1L5P A;  1CZP A;  3BIN A;  1YD8 U;  2MJ3 A;  3ZYY X;  4GSW A;  2SEB D;  3AEF B;  4NZL B;  3RZF A;  2CS4 A;  2N1W A;  1YX5 B;  4HRS A;  1HQR D;  2ROH A;  3IVF A;  1HA5 A;  2BXQ A;  5E6N A;  2EMT A;  2LJ5 A;  3AE9 B;  4JQW C;  1V1O A;  2MJE A;  3NVZ A;  2TSS A;  5I4D A;  2WS3 B;  2CHZ A;  4A55 A;  2XNA C;  3HM6 X;  3K9P B;  2LVP A;  2M17 A;  3B0A A;  5BYR A;  2OZB B;  3H6N A;  1E0Z A;  1MPE A;  4MEM A;  4MSQ B;  4ANV A;  2Y3A A;  3MJ5 A;  1WFY A;  1FCC C;  3LU8 A;  1UNS A;  4BOZ B;  4J2V A;  1KW2 A;  2DZJ A;  4B0E A;  1E7C A;  2UWQ A;  2K6Q A;  2IO2 B;  3ZIM A;  1P0R A;  2BYV E;  4MT5 A;  3BYT B;  2RDG A;  1C79 A;  4JL9 A;  2BWE S;  4K7U A;  4KSK C;  4ZUX V;  1WXQ A;  3DBH I;  1EUV B;  4HGK A;  4XZ4 A;  2IY1 B;  2NS5 A;  5D7G A;  4JK4 A;  1V2Y A;  4AS1 A;  1GG3 A;  2FE8 A;  2PMV A;  1EU4 A;  3APC A;  3JW0 X;  5D6J B;  3SQJ A;  3NVM A;  1VRA B;  2LXC A;  1CQV A;  4BKS A;  4H2A A;  3ZQ4 A;  2XVV A;  4I6N B;  2ASQ A;  2ZCC A;  4N58 A;  4MDK E;  2JXT A;  4L2Y A;  2XW1 A;  3EFU A;  3AEC B;  2MLB A;  3DVN U;  5JZE B;  2L52 A;  3RUL A;  2FID A;  2IYD B;  1QT9 A;  2KWV B;  4WWP A;  4ARI A;  3U2S C;  2IBI B;  1YJJ A;  2KN5 A;  3A33 B;  2XEW A;  1T0Y A;  3BWU D;  4MGI E;  2XK5 B;  3APF A;  3PHW B;  1WGG A;  3TBL D;  3VTU A;  2WXI A;  1WRD B;  4C7Y A;  2MW5 A;  1ET6 A;  4RF0 A;  3N32 A;  2YDF A;  4GN1 A;  2K25 A;  4O1N A;  2WP9 B;  3LU7 A;  2DYO A;  1H5W A;  2IDY A;  4YSZ B;  4ASW C;  2KXJ A;  1UBI A;  2PW9 A;  2KO3 A;  1BM0 A;  1J7B A;  3NHE B;  2L0F A;  1JML A;  3QAR A;  1WGR A;  2JXX A;  1YQ3 B;  3QHT A;  2MBE A;  4ZCG A;  2WXR A;  1MIY A;  1MHH E;  2MJD A;  4NJ7 A;  2WXL A;  2WXK A;  2BX8 A;  3ZLZ A;  1KRH A;  2W3R A;  1XLN A;  3I57 A;  2MP2 A;  3A9J A;  4LB9 A;  4D2K A;  2HDE A;  1WX9 A;  2KHW B;  1CK1 A;  4B95 A;  1OTR B;  3UF8 A;  1SE4 A;  1C76 A;  2WLB A;  3T8M A;  3P1M A;  3C8Y A;  2AJE A;  2MBO A;  4LCD E;  2VUE A;  2INP E;  1B1Z A;  2Z0D B;  3L08 A;  1GC7 A;  4YTN B;  5D3D A;  5FUO A;  2IO3 B;  4B9K A;  1Q10 A;  2WWZ A;  1TY2 A;  3TMP B;  3M99 C;  1OGW A;  4IM3 A;  4TUU A;  1Z5S B;  3DVN V;  1EM7 A;  3L0W B;  3Q8F A;  3J9C A;  4JGH B;  3HM3 A;  4OVV A;  4L23 A;  3OLM D;  2ZJD A;  4AUQ C;  3LJ3 A;  5EDS A;  3A9K B;  4BKG A;  2AL6 A;  4F1S A;  2NQO A;  2MRP A;  2BXF A;  1J7A A;  1QIL A;  1LOT A;  4FK5 B;  1AWD A;  2BB5 A;  4AJW A;  3V6E B;  2M0A A;  1V5T A;  2LHD A;  3NVV A;  2W82 A;  2BS2 B;  1UD7 A;  1K51 A;  3AE6 B;  1FCL A;  2LGX A;  2Q5W D;  3GP7 A;  4II2 B;  2I2Y A;  2NR2 A;  4DHZ E;  4LK0 M;  2BXN A;  3DDC B;  1QOF A;  3QWZ B;  2JX5 A;  5DQF A;  1L6U A;  4LLG M;  1QQR A;  4LB2 A;  3ZGZ A;  4N0U D;  4P6V F;  2M0X A;  2XBB C;  3ZDT A;  4FXC A;  1PGX A;  2HD5 B;  3H37 A;  3DBL I;  3DWM A;  4BFR A;  1GB1 A;  3AEB B;  5H8Y E;  2BXP A;  1WE6 A;  1NBF C;  1BUI C;  5LXH A;  4KZC A;  3VQI A;  1E6E B;  2WXO A;  3E56 A;  3R3M A;  2KDI A;  3L54 A;  2DHZ A;  4KKI A;  4ICU A;  1FXA A;  2QHB A;  1I4H A;  1OQR A;  3IFW B;  2EMS A;  1AYF A;  5TR5 A;  5EE9 A;  3QIJ A;  3FAH A;  3ZJT A;  3WAL A;  2IZV B;  3UQB A;  3KLS X;  4US9 A;  2D3G A;  1SE2 A;  2D10 A;  2V36 A;  2KFJ A;  4JWS C;  2XVW A;  2GOW A;  2R2O A;  1KLU D;  3M3J A;  2Y5P A;  3PHX B;  1L2N A;  4KDL B;  1NVI D;  2V0G A;  2J0M A;  3W1S C;  4IG7 B;  2IGG A;  2FIF A;  2QJL A;  4W9D A;  1GNU A;  2KAN A;  2CJO A;  2IGH A;  2H88 B;  4A20 A;  4EUT A;  2IY0 B;  2O2V B;  1Y8R C;  3FWB C;  3EC8 A;  1FIQ A;  5LLI A;  3UIO B;  1QOA A;  2JF5 A;  2K9X A;  2NBU A;  3PRE A;  1KLG D;  2NTT A;  2JZ3 B;  2KD0 A;  3T9L A;  4ANW A;  1B9R A;  2KDB A;  2K0P A;  1HK5 A;  3AN1 A;  4DK5 A;  5G5G A;  2WX0 A;  1RRB A;  1HEZ E;  1LNS A;  4WUR A;  1WGK A;  2NNW A;  1KXP D;  4FA6 A;  5KHO A;  3UIN B;  4A3O A;  2BYT A;  2Z8J A;  2WDR B;  1C4C A;  3JRY A;  2XK5 A;  4NAW B;  5FKA C;  3DOW A;  1I4P A;  1YJ1 A;  4HWI B;  3S2A A;  5AZG A;  1FFV A;  1J19 A;  1VJK A;  2JYT A;  3ZVV A;  4OTU A;  4PS3 A;  3OWE B;  4I6P A;  4TMA B;  2PJH A;  3FIL A;  3Q69 A;  1EF1 A;  4HRO A;  4KIK B;  4NJC A;  4HCN B;  3UQA A;  3MC0 B;  4F5T A;  1ROE A;  3CWI A;  4C7Z A;  4DBG A;  1E7P B;  2QM6 A;  1FNV A;  3TSS A;  1R4N I;  3UI3 A;  4YT0 B;  1WMH B;  4GDL B;  3IBE A;  1E8W A;  3H9D A;  1HK3 A;  4G50 A;  1ACC A;  3R8B A;  1JRU A;  5LNK 1;  2BXE A;  3Q8C A;  4MM3 B;  5D3I B;  5H92 C;  4GOC A;  5IJ5 A;  4LDT D;  3PRM B;  2B76 B;  4ANX A;  2ZW1 A;  3L16 A;  3U30 A;  2GB1 A;  3RFZ B;  4CQN A;  2JYE A;  1JAL A;  3ONS A;  1XD3 B;  2KWU B;  2XSI A;  4DHJ D;  2HTM E;  2DBU A;  4ARC A;  2MQJ A;  2I2Z A;  2K39 A;  4A8X C;  3Q8A A;  1JWU D;  3BK1 A;  2WDT B;  1QF6 A;  1E7U A;  5G55 A;  1ZE3 D;  1YX6 B;  1OEY J;  4KV2 A;  3AU5 A;  4LJO B;  5IJF A;  5D2M B;  1TZO A;  1KOT A;  2PPH A;  4MGZ E;  3BYY B;  1WYW B;  1LXD A;  4GIV A;  2J7Q B;  4LUF A;  3VH3 B;  4MAC A;  4L8U A;  4F5S A;  1SEB D;  1MVK A;  1LQB A;  3G9K D;  1GNI A;  2O6V B;  3AU4 A;  1N60 A;  2IGD A;  3A9K A;  3VDZ A;  4PT5 A;  2LI5 A;  1WRI A;  4XE0 A;  4YSY B;  1TZ1 A;  4IWQ A;  2ZNV C;  3IAS 1;  4M0W B;  5BO4 B;  1DOI A;  4EOY A;  2LUM A;  2DLB A;  4K1R B;  1FXT B;  2WXH A;  4GDK B;  4BBN F;  3V05 A;  2V3S A;  5JHA A;  2C7M B;  4L1B A;  1WM2 A;  2NTS A;  3ZW3 A;  2R61 A;  1WWT A;  1K52 A;  4RCO A;  1HK2 A;  4MJS A;  3ML9 A;  2ZW0 A;  4IM2 A;  2Z0E B;  3AB5 A;  3M95 A;  3B1L X;  2HTH A;  4WWO A;  3ZNZ B;  3P63 A;  4ZBK A;  4USA A;  3DQV A;  3N9Y C;  2WX1 A;  1IJG A;  3TJP A;  3A1Q B;  4E74 A;  4TKN A;  1RLF A;  1UWX A;  1SIJ A;  4BY9 C;  1Z2M A;  3R66 C;  4K2C A;  5E6J A;  3RD2 A;  3JSV A;  1GAQ B;  1GB4 A;  3W1Y A;  3AH7 A;  5CX3 A;  2N9P C;  4IW2 A;  2JQR B;  3WCQ A;  1HZ5 A;  2GBR A;  1WSP A;  5AZF A;  3B2F A;  1QKZ A;  2ZCB A;  2INN E;  2CR5 A;  3NOB A;  1JWM D;  3KIK A;  1L4D B;  1VCB A;  4ZRI A;  1WYG A;  2N7E A;  2L76 A;  5HI1 A;  5CHF A;  3QQ8 B;  2L32 A;  4X57 B;  3KW5 B;  3MP9 A;  1K8R B;  5HOZ A;  3VFK A;  4CYE A;  3ZKJ C;  2EFH A;  3KWV A;  1I4Q A;  2KTF A;  1D3Z A;  4HJG E;  2J53 A;  1AN8 A;  3TEY A;  1SSN A;  1WIA A;  2E0Y A;  3ZRF A;  4A3P A;  4HEA 1;  3OAW A;  1NYR A;  1YJI A;  1IPG A;  2NPT A;  4DXA B;  5G5H A;  4HK2 A;  1ESF A;  2J42 A;  1P7E A;  2KAC A;  3MHS B;  2G4S A;  1TGZ B;  5J18 A;  4BVU C;  4G11 A;  4FBJ B;  3HRD D;  3FWC C;  3IXS A;  2DZM A;  5CHV C;  2BXK A;  1SGH A;  1WJU A;  3ECI A;  1OQY A;  2KFK A;  4MGY E;  5J17 A;  3A4S C;  2RDH A;  2JT4 B;  1TKY A;  4J3O D;  5IAA C;  3URY A;  5EE0 A;  1P7F A;  1V9J A;  1I42 A;  3ABV B;  2OED A;  3NMU A;  3JYU A;  1IGD A;  3LU6 A;  1IBX B;  1LFD A;  2AWT A;  1FNU A;  2N9L A;  3H7S A;  3V09 A;  2QMT A;  2WXQ A;  3B9L A;  1JWS D;  3LXF A;  1WGH A;  4EFO A;  1TS2 A;  2KAJ A;  4FJV B;  2XVQ A;  2V3P A;  3NZ3 A;  4FJZ A;  1J8C A;  1JCK B;  5JXV A;  3EGR A;  4C31 B;  3WAO A;  5JHB A;  1I35 A;  1T5X D;  5KHQ A;  1QLB B;  3M63 B;  4W9K A;  2WDQ B;  3I9V 1;  3W5V B;  1XEE A;  2LWP A;  2RMM A;  2A4Z A;  5DBY A;  2ONQ A;  3AE7 B;  3QJZ A;  3K9O B;  4FAD A;  4HKZ E;  3CIR B;  4RMA A;  2BXH A;  1C9F A;  4GU2 A;  5GHK A;  2EKI A;  3AE3 B;  1GJZ A;  1OEY A;  2AYO B;  5CHW A;  3ZNH B;  5LXI B;  2G9H D;  3AE4 B;  1P1A A;  5E6P A;  4KIK A;  2QIE B;  1DGJ A;  3AE1 B;  3UIP B;  1HK1 A;  2DBX A;  4ZRJ A;  4YWG G;  2BXA A;  2MCN B;  1DYQ A;  1I4G A;  4EMX A;  4HGM B;  1WMH A;  4WAA A;  4GDL A;  1TKG A;  4ZRQ A;  3PGE A;  2RPV A;  4FHK A;  2BF8 B;  3GOE A;  2CJN A;  3EEC A;  4RH6 A;  2WXJ A;  3P4S B;  4AWJ A;  2FUH B;  3SHQ A;  2KTR B;  1BKE A;  2PIA A;  3ML8 A;  1E7H A;  4OTT A;  3KH0 A;  4I6L B;  2D2Q A;  3O13 A;  4XDD A;  4G01 A;  4WJQ A;  2KX3 A;  5BYQ A;  5L83 A;  3OJ4 B;  4K7S A;  2ZPN A;  4WJO A;  1SF0 A;  1JWA D;  3L4P A;  1FO4 A;  4IM0 A;  3U52 E;  4FHJ A;  4E71 A;  1ZUD 2;  3RCZ A;  4AJY B;  2WXF A;  3RPF C;  2LJI A;  2N7J A;  2DAF A;  4K71 A;  1N5X A;  2C9W B;  3AUL A;  2VZK D;  4KDI C;  4OZA A;  5HG2 A;  1VDV A;  3APD A;  2GMI C;  1LM8 B;  2BGF A;  3VVW B;  2GBJ A;  1RYJ A;  1NI3 A;  2FBW B;  4MH8 A;  3D32 A;  3R7R A;  2PVG C;  4EZK A;  4XWT A;  4DHZ B;  2JVC A;  3H7P A;  1L0X B;  1XT9 B;  4CO7 A;  2K1F A;  3RZW C;  2KC1 A;  4WJP A;  3U8Z A;  5DPW A;  1TYG B;  3CST A;  4OR0 A;  2CHX A;  3KQ4 A;  2Y5B B;  4HPL B;  4UDU C;  3VUY A;  2MSE D;  3KYD D;  4RM9 A;  3T3N A;  3L13 A;  2W55 A;  2K3U A;  4GDK A;  1HXY D;  1WX7 A;  2GBM A;  4LUH A;  2LHE A;  3ZO5 B;  1G6J A;  3PV1 A;  1FRD A;  5T8I A;  2DYM A;  2BW2 A;  4JWU C;  4WQM A;  2BXO A;  1M94 A;  3U7D A;  2ACZ B;  1X1M A;  4OT2 A;  3QCA A;  1J78 A;  2CU3 A;  1J7C A;  2BS3 B;  1PUT A;  3OJ3 A;  3PLA A;  3A1Q A;  2NBV B;  3KVF B;  2KQ4 X;  2WXM A;  1N63 A;  2MEK A;  4XDC A;  4KGT A;  3U7Z A;  4ZHO A;  2VRR B;  1V8C A;  1WGY A;  2LZ6 A;  1I4X A;  2IPK D;  3U4E G;  3AE5 B;  3TEX A;  1HZ6 A;  1AW7 A;  2LGI A;  3WAN A;  2LEK A;  2MA9 B;  2GI9 A;  1YIW A;  1T6B X;  1C3T A;  2KK8 A;  2N9K A;  3EA6 A;  4TV3 A;  1WZ0 A;  2OHF A;  1KJT A;  2FCN A;  2LAS A;  3MFG A;  3HUI A;  2KQ7 A;  3WHS A;  3KUZ A;  4M70 B;  4DQO C;  2CHW A;  2KJR A;  1E7I A;  5GIP A;  1ZXI A;  4ZC6 A;  3H1U A;  2LRU A;  4YTP B;  3RT3 B;  4NAM A;  2XMO A;  2W3S A;  1P98 A;  2R2Q A;  1STE A;  4RF1 A;  2NCN A;  4GB9 A;  1IP9 A;  1L4Z B;  1F0Z A;  5HHD G;  3B08 A;  1VLB A;  2MBB B;  1XCT L;  5IFO A;  4K81 A;  4IW0 A;  2AQ2 B;  2JU6 X;  3SEB A;  1VD2 A;  5ID7 A;  1TF0 A;  1XO3 A;  3EUB 2;  1C78 A;  4DWF A;  3NVY A;  3B2G A;  4EZL A;  3SIU B;  1IBX A;  2RD0 A;  4F7Z A;  4ZOH C;  5MPO A;  3A75 A;  4N0F D;  3DBS A;  2DG5 A;  1J0G A;  3Q8E A;  2WXP A;  1YQ4 B;  3PLV A;  3DBR I;  2LOQ A;  3DVG Y;  2BTE A;  3VRA B;  4OVZ A;  3M62 B;  1SB3 C;  4MH0 E;  5C1Z A;  2ZPY A;  1SXT A;  1CJE A;  1Q5W B;  2KC2 A;  3QA8 A;  2DX5 B;  4AQ7 A;  4WAF A;  5BPK A;  3ZTC A;  2L7R A;  1AO6 A;  4W9I A;  3L10 B;  4R3D A;  2FUG 1;  3AM9 A;  1KTK A;  3TDL A;  4RGN A;  3VXW A;  3QX1 A;  2D07 B;  2RPQ A;  4NPN A;  2Z8K A;  1PGA A;  5DPS A;  4DXG A;  3SFE B;  1F77 A;  2VDB A;  2HJ8 A;  1R7S A;  2WU5 B;  5IA7 A;  1YMH E;  1PQS A;  1C1Y B;  3NS8 A;  1FNW A;  2WXG A;  2V3N A;  2BT6 A;  2RSU A;  3QAQ A;  2DBY A;  2D5G A;  3DVG X;  2A5U A;  3NZU A;  2IO0 B;  3LDZ E;  1UZX B;  3SFD B;  1XCQ L;  2AEH A;  2Y5C A;  2MH7 A;  1UH6 A;  1QZE A;  4LA0 A;  3IG3 A;  2K8H A;  1XQQ A;  1Q0W B;  1SBB B;  1L7Y A;  4FJC B;  1FEH A;  3P4Q B;  5C2T B;  1WX8 A;  4Q2J A;  4N59 A;  1TS5 A;  4EKU A;  2WXN A;  2L8J A;  1ZDX A;  5EE3 A;  3P2B A;  1JRO A;  1D5M C;  1EWC A;  4G03 A;  3KWL A;  5IIH A;  5FK9 C;  1V6E A;  3SIV B;  2MP2 B;  1XF5 L;  3A9J B;  4F5V A;  3NY5 A;  1PFD A;  4IOI E;  4W9E A;  3WIM A;  1H8C A;  2G3Q B;  4GXB A;  4XWW A;  4P7I A;  2NVU I;  2J52 A;  2N0S B;  4PYZ A;  4AOF A;  5B5T A;  2KJH B;  3PSE B;  2KMA A;  3PS6 A;  1RAX A;  4REZ A;  2ICI A;  2O6V D;  1JW9 D;  1L0Y B;  3ICX A;  4ZBQ A;  3CX9 A;  5AUI A;  1E8Y A;  4ICV A;  2B3A A;  2EFD A;  2PLP A;  1Q1O A;  2BBC A;  4A90 A;  2H89 B;  3C0R B;  4A9A A;  1HK4 A;  4W4U B;  1M4V A;  3V60 A;  4W9F A;  1GOZ A;  3WHR A;  1SE9 A;  1K53 A;  4FJY A;  2JWZ A;  4BKE A;  4FUL A;  4BOS C;  4YSX B;  1YNT E;  1NI2 A;  4ZHP A;  3VRB B;  4RGM A;  1N5U A;  1S1Q B;  2BYF A;  3PZ7 A;  3O65 B;  4W9L A;  1E78 A;  2BXI A;  1TBE A;  2YLM A;  3ZNI D;  4YTM B;  3KYC D;  5GXG B;  1F2R C;  2BWF A;  2FCM A;  1QOG A;  3ZRC A;  1TS4 A;  2W54 A;  2L05 A;  1FMA D;  2C7H A;  4C80 A;  3HIZ A;  4W9H A;  4YXD B;  1PYW D;  5C3J B;  2L1A A;  1P9D U;  1KLV A;  1XLO A;  3QC8 B;  4LJP B;  1UEL A;  2DBW A;  4DDG D;  4JPS A;  2PVO D;  3ENE A;  2JZP A;  1E9M A;  1RM6 C;  1V81 A;  1WJ4 A;  3WHQ A;  2DYB A;  3E9S A;  1EO6 A;  1U4A A;  2AQ1 B;  4LTU A;  3VAW A;  1WXV A;  4M8N A;  1E7E A;  2AX5 A;  2SAK A;  4GMV A;  2KQS A;  2IJ0 A;  2NMQ A;  1WY8 A;  3H3A A;  4MGK E;  2KWC A;  3MHS D;  2L0T A;  5BMH A;  1E8X A;  2OOB B;  3PLU A;  2ZVN A;  2FCS A;  3VUX A;  3GQU A;  3TUO A;  4OW0 A;  3PT2 B;  2BPS A;  4N6E B;  5DPT A;  1UUP A;  1OQQ A;  5E6O A;  4WQO B;  1BML C;  4G04 A;  2E0X A;  2O2V A;  2KVR A;  1F2R I;  5HFY A;  2LD9 A;  4IDI A;  3N3K B;  1YN4 A;  2V4L A;  1WZ3 A;  1V49 A;  2OJR A;  5FR6 A;  2G1E A;  1Y56 A;  2Z59 B;  2FNJ B;  3HVZ A;  2EKE C;  5GIN A;  1I7H A;  3Q3J A;  2X38 A;  3T3O A;  4HKQ A;  1UGM A;  2L00 B;  3NVW A;  2CU1 A;  4DDI D;  1ZGU B;  4GGQ A;  3HHM A;  2J4X A;  3GA9 L;  1RWS A;  4ZYN A;  4IUM B;  2N9X A;  4BKT A;  4P16 A;  5BMI A;  3SR6 A;  4NAW A;  3W9C B;  4NJ6 A;  2C5L C;  3PZ8 A;  4HJK A;  5L95 C;  4RNA A;  2QEJ C;  3BVG A;  4DXF A;  3CSF A;  2JUH A;  2IO1 B;  1R4M I;  1A70 A;  5ID9 A;  2OT3 A;  1ZKH A;  2YEP B;  5AEK B;  5BYS A;  2PEA A;  3ZUN A;  1E10 A;  4KZ0 A;  3AE8 B;  1WR1 A;  1N5W A;  1E8Z A;  2EEL A;  3ETR A;  1WF9 A;  4IW1 A;  3R2T A;  3VR9 B;  1JQ4 A;  2YEP F;  1VZ7 A;  3AV8 A;  2JPH A;  4DHX B;  2C60 A;  1HE8 A;  2GRI A;  1UOR A;  4J6I A;  3WAM A;  3KUC B;  1TS3 A;  4L9Q A;  1WI0 A;  2PE9 A;  1V80 A;  1IGC A;  1MIV A;  2M4N A;  3DPD A;  1N62 A;  2VUF A;  3SU8 X;  5AZH A;  3KUD B;  1SJE D;  4WIP A;  3V03 A;  3FIL B;  4MM3 A;  4ZRP A;  1V5O A;  2XW0 A;  1WE7 A;  2BXB A;  4B0M A;  1FD6 A;  2JY6 A;  2CKH B;  1MA9 A;  4XX5 A;  4TQ1 A;  3L17 A;  3ZNG C;  1WXM A;  5JH5 C;  1I4R A;  1D5Z C;  2YVC A;  3P4P B;  3PRP B;  3AEG B;  1D6E C;  1WJ6 A;  2DZI A;  3X23 A;  3DWG C;  2BXG A;  3RYT A;  4KGR A;  2I1J A;  4GLS C;  3AEA B;  3H8H A;  1RFA A;  1ZXH A;  2BXC A;  4G0N B;  2KX0 A;  1YQB A;  3TEZ A;  1ZDV A;  1ENF A;  3GZN I;  1KM7 A;  3NS1 A;  2JRH A;  4K7W A;  1V97 A;  4II3 B;  2QHO A;  4IWO A;  1FFU A;  3AE2 B;  1VFI A;  1VR9 A;  2BXD A;  1SIF A;  2ZNV B;  1VZS A;  1ISN A;  2ON8 A;  5IIU A;  3IHP C;  3MJW A;  2QMC A;  1FRR A;  3V62 A;  2N9E B;  4EZJ A;  4HLE A;  2AQ3 B;  3ZJV A;  1WJN A;  3Q3F A;  4RFB A;  2O6V A;  4AP4 C;  2VZK B;  3ZJU A;  5CTR C;  3TIX A;  3FNM A;  4FIP B;  4WH4 A;  4M0W A;  4RGT A;  2M19 A;  4MSM B;  2EFC A;  2M56 B;  2KOX A;  2KDF B;  3LYY A;  4L9K A;  3UGB B;  1V1P B;  1CMX B;  3AEE B;  4NQL B;  4NNJ B;  1MI0 A;  1WR6 E;  3NVK A;  2KN4 A;  4S1Y A;  3W2D A;  2JSV X;  1TY0 A;  2G4D B;  4JE3 B;  4FLH A;  4F8C B;  1C77 A;  5GIO A;  1WM3 A;  1C4A A;  3NVI A;  2V1Y A;  4CHK A;  1BT0 A;  1GNJ A;  2LVQ A;  1GUA B;  3FC4 A;  1E7B A;  3GS2 A;  3ZDM C;  4PO0 A;  2UYZ B;  1PGB A;  2LGY A;  4KGS A;  3VH4 B;  4EE2 A;  1N61 A;  2J0J A;  4BBN C;  4KX6 B;  1KF6 B;  1WXA A;  3HVD A;  3P4R B;  1P3Q U;  1WH3 A;  2BYE A;  1S3S G;  2DZK A;  4MJS B;  4PS7 A;  1SE3 A;  3A4R A;  4PYU A;  4HDQ A;  2L83 A;  4ZBR A;  3B9J A;  4E99 A;  4F5U A;  1T3Q A;  4XC2 A;  3IT4 B;  1TTN A;  2HE7 A;  2KLC A;  1XLP A;  1YN3 A;  5DCN A;  1L0V B;  2BXM A;  3KJL A;  2LVO A;  2XN9 C;  3W1S A;  3JSV B;  1KFY B;  1UGJ A;  4US8 A;  4GG2 A;  5EE1 A;  1D4B A;  2Z8I A;  2Z8L A;  3AMZ A;  1JWB D;  3Q8B A;  4W9J A;  3NUH B;  3NRZ A;  2JRI B;  3LB8 C;  2K8C A;  1FM0 D;  4YL8 A;  5DPR A;  2KKC A;  4HVB A;  3BZD B;  5GMV A;  5AUK A;  1TKE A;  1V86 A;  1UBQ A;  3MTN B;  4Z9O A;  2GBN A;  2FAZ A;  2BB6 A;  1XXG A;  3VTV A;  5D94 A;  2LGD A;  3V61 A;  3GQX A;  2REX A;  1WXS A;  2KDM A;  2D11 A;  2LRW A;  2QIL A;  1EWY C;  2PE6 B;  2RGF A;  2NPT B;  3BK2 A;  2JWU A;  4JX1 C;  1ZP0 B;  4TQ0 A;  4EEW A;  4HCP B;  4E3C A;  1IYF A;  2DWQ A;  3ZTD A;  4RGO S;  2BXL A;  4ANU A;  1E90 A;  3PVL A;  3BVZ A;  4ZRK A;  4URK A;  5HKH A;  2KFK B;  2LXA A;  2V4I B;  2JZZ A;  1NYQ A;  2WNM A;  4B6W A;  1IUE A;  4KSL C;  4NY0 A;  1YN5 A;  1J7E A;  1SJH D;  4BKS D;  2W9N A;  3PPA A;  1JRP A;  5G2N A;  4ZYS A;  1PDX A;  2WU2 B;  1BJ5 A;  1XLQ A;  4N3Z A;  4OHJ A;  2NBW B;  1TXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...