2DYOA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-57) complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
286
structure length
269
Chain Sequence
HMNDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPLIWNKIKSFLSFDPEKYFWFEHNKTPIPWNYPVGVLFDCLAGKSAVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKEGDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy protein 5
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover/protein turnover
total genus 79
structure length 269
sequence length 286
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dyoA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dyoA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dyoA01
3VUXA 3LJ3A 3ZTDA 2REXA 1WX7A 4IM3A 2A4ZA 1LM8B 4DDGD 5KHQA 2BKFA 1OTRB 4KVGB 2N9PC 4RM8A 3EFUA 1WXSA 5E6PA 2LGXA 1KOTA 2LXCA 1V80A 3A1QB 3A4RA 5G55A 4KSKC 5DPRA 4KDIC 1LXDA 2MBOA 3PLUA 2R2QA 5D94A 2M1MA 2EMSA 4MSQB 3ZRCA 3JSVB 3AI5A 2MLBA 1OGWA 3QX1A 1WRDB 4FHJA 4WQOB 4ZYNA 4PS7A 2L05A 3AU4A 3QHTA 4GDLA 3WA0A 4AOFA 2JRHA 3A9JB 1EF1A 2V1YA 1TTNA 3PREA 4ZRKA 4BBNC 1OEYJ 4BKTA 4TQ0A 4FLHA 2O2VA 1UD7A 2DYBA 4GN1A 1YD8U 4GB9A 2JPHA 3IBEA 3VTWA 1U4AA 1R4MI 2BPSA 2JXXA 3A1QA 3N30A 1IP9A 4XZ4A 5HKHA 4IM2A 2AWTA 2BGFA 2I1KA 2DAFA 1K8RB 2C5LC 3L16A 3JSVA 2KX3A 2MW5A 3ZUNA 2HD5B 4DXAB 1TBEA 2HE7A 5D6JB 2DZMA 4ZRIA 1S1QB 1TGZB 1WGGA 1WZ0A 5C1ZA 4CYEA 3IG3A 2J0JA 3VDZA 3VUYA 3OJ3A 2N9EB 1GG3A 2NBWB 1D3ZA 3SU8X 3PT2B 1ZGUB 4FULA 4LJOB 1Y8RC 3UGBB 4CO7A 1L7YA 2K25A 2YVCA 3MHSD 2D2QA 1LQBA 1WXVA 4G11A 4JQWC 2K39A 2KVRA 2ZCBA 4RM9A 4W9GA 4FA6A 3D32A 4W9IA 3QIJA 2RR9A 4MJSB 2M4NA 4ZRJA 2GBKA 3PVLA 1G6JA 3L08A 3R7RA 4W9DA 3PGEA 4GDKB 4EFOA 2ZJDA 2K8BA 3TMPB 4TKNA 4II2B 1OQYA 3TBLD 2KO3A 2JY6A 5JHBA 3KYCD 3WANA 2RGFA 3WIMA 3DQVA 2LVPA 2ASQA 2KN5A 2AL3A 2CHXA 4B6WA 2LRWA 4BOZB 1XD3B 1WE7A 2NCNA 1P3QU 4EZJA 4NNJB 4FADA 2KMAA 1GC7A 2N1VA 5C23A 1C3TA 1Q5WB 1GNUA 4TQ1A 3JYUA 2KK8A 4FJVB 3ZNID 2KHWB 2PPHA 4HVBA 1R4NI 2N1WA 3KUZA 1V5TA 2IY0B 3PHWB 1E8YA 1WGHA 3H7PB 1V81A 4GDKA 2L00B 4E71A 4KZCA 2MRPA 2BYFA 1XT9B 3R66C 3V6CB 4W9FA 2GBJA 2HJ8A 1GUAB 4NQKE 4I6LB 2M0XA 3DBRI 2KNBA 1JRUA 2BYVE 2ZVNA 3KYDD 3V60A 4W9HA 4FN2A 3VAWA 2RSUA 1KJTA 2NPTB 1IYFA 1WGDA 2ZNVB 4HDQA 3QC8B 3S2AA 2G45B 3JVZX 3L54A 2IZVB 2KLCA 4BKGA 4ZDVA 4LDTB 2KC2A 2XK5A 1V6EA 2D3GA 2G4DB 4M8MA 2C7MB 3BY4B 3TCAA 2C7NB 2KMCA 3ALBA 2YLMA 3KW5B 5E6NA 3RYTA 4ANXA 1EF5A 2KTFA 2O6VB 3APFA 2J0KA 3WAMA 3HK0A 1WJUA 2DZJA 2UWQA 2JT4B 2XEWA 4MEMA 3ML9A 1SIFA 3OAWA 2L0FA 2NPTA 2R2OA 2M17A 4XX5A 3PPAA 4ICUA 4DHJB 4HK2A 2KTRB 1CMXB 3V61A 2FCSA 4J6IA 1ZW7A 2KFJA 3ZLZA 4EKUA 4MM3A 4JGHB 2DENB 3GOEA 3OJ4B 5IA7A 3TL5A 3HM3A 3ZIMA 2LZ6A 1YJ1A 2KJ6A 3DVGX 4DWFA 4B95A 3BINA 1P0RA 1UZXB 2MA9B 2O6VA 1H4RA 5AZGA 4IM0A 4A3PA 4GGQA 2RD0A 4URKA 2C9WB 1VCBA 2JRIB 2LVQA 4KIKB 3HM6X 5FR6A 2PJHA 1WI0A 1LFDA 2DZKA 4FHKA 4YL8A 2FCQA 1P1AA 4K7SA 3L17A 2WX1A 2V4LA 3QK0A 4X57B 3RULA 1IPGA 2AEHA 4GSWA 3KUCB 4TV3A 5CHWA 3B0AA 2MX2A 4LDTD 1WXMA 2N7EA 3VQIA 3HHMA 4E74A 2DZIA 1WM2A 2RPQA 3RD2A 4WWOA 2KQ7A 3L0WB 1WJNA 3A9JA 1KM7A 2FAZA 2O6VD 2W9NA 4KZ0A 5G2NA 2KLGA 5DCNA 5J2RA 5E6OA 2B3AA 1EO6A 2BYEA 2CS4A 2UYZB 4KIKA 4LCDE 1V86A 3VXWA 2LXAA 2LVOA 2VRRB 3QWZB 1FXTB 3VHTC 2GOWA 3M95A 1QZEA 4MGKE 1WMHB 1BT0A 4DHJD 1ISNA 2C60A 1S3SG 4F7ZA 3UQAA 3UQBA 2KD0A 2KDBA 4B9KA 1YX6B 2JF5A 3HIZA 4M0WB 4MH0E 4GMVA 3UF8A 5AZFA 4AJWA 3CMMB 3DOWA 3ZNHB 4F8CB 2KC1A 2KDEB 4W9LA 3B1LX 1UELA 3UIOB 4DK5A 4EUTA 5KHOA 3V62A 3APCA 3N32A 5TR5A 3C0RB 3W1YA 4WJPA 2K1FA 2LGDA 3M62B 5J18A 2OJRA 4BFRA 1NDDA 2QHOA 1YQBA 2ZPYA 3ZKJC 2PE6B 2ZVOA 4NQLB 1F9JA 2MBHA 1Z2MA 4NPNA 2IO3B 1WMHA 5AEKB 1H8CA 4ANWA 3IVFA 1Q0WB 3IHPC 4A20A 1E5WA 2DYOA 2K6DB 3QJZA 4FJZA 4IWPA 4W9KA 2LASA 4MJSA 2ZCCA 3SHQA 1WGRA 1WR6E 2MP2B 2JWZA 4WJNA 4WWNA 2JUOA 2KWCA 3X0WA 2KANA 1MG8A 5CX3A 4F1SA 1M94A 1YIWA 3NY5A 2D10A 4AJYB 1J8CA 2FCNA 3VTVA 3DBLI 1UBQA 4MDKE 3DVNU 3M63B 2XBBC 4NY0A 3CSFA 2J0MA 5D2MB 2KJRA 2KX0A 2GMIC 2KDFB 4JIOU 3MTNB 2ZNVC 4A3OA 2CU1A 4HXDA 3Q3JA 1UH6A 3A33B 3AXCA 3PSEB 4GU2A 3K9OB 4ICVA 3TJPA 4I6NB 2MQJA 1V49A 4MGIE 1AARA 4TUUA 2MBBB 3A9KB 3AU5A 2LUEA 5GMVA 3H1UA 3U30A 3X23A 3ZO5B 3B08A 1UBIA 4FJYA 3H7PA 3VH4B 3ZDTA 2NR2A 3DVGY 2WDTB 3W1SA 3N3KB 1WJ4A 3PRZA 2KJHB 1WE6A 3EECA 1WM3A 1L2NA 3RZWC 2NS5A 4IG7B 2FIFA 1WFYA 4N9F4 3CF6E 4JLCA 1P9DU 3JW0X 2DX5B 2IO0B 2KFKB 3O65B 4PS3A 4W9EA 3DBSA 1UGMA 4AWJA 4BBNF 2L8JA 3ZDMC 1E7UA 3WALA 4GDLB 2BF8B 2JZ3B 1I35A 4IUMB 1RRBA 2LD9A 4K7UA 2Z0DB 1RLFA 4NAWB 3H7SA 5DPSA 3A9KA 3DVNV 1WX8A 1V2YA 4HPMB 1WXAA 1J0GA 1RFAA 3L10B 2O2VB 4DBGA 1T0YA 3Q3FA 4G50A 1NI2A 3R3MA 4AP4C 4IC7B 2KDIA 2N4FA 2IO1B 4EZKA 1OEYA 3KVFB 2MWSB 1E8XA 2WWZA 1XQQA 1WGYA 2CKHB 3PLVA 1HE8A 1SE9A 4EZLA 3GZNI 1V9JA 3ZNGC 2A5UA 3QAQA 2KFKA 4OVVA 3NZUA 4W9JA 1C1YB 2L3ZA 2IBIB 1PQSA 1Z5SB 2FIDA 2MCNB 3SDLC 2KTRA 3QARA 2FCMA 5D7GA 2D11A 5IAAC 1RAXA 4GOCA 4WJQA 4MSMB 2ZEQA 1P98A 2KXJA 4NAWA 3P2BA 1EUVB 2J7QB 5L83A 3H6NA 4HCPB 2DYMA 3ML8A 3RZFA 3DDCB 3PRMB 2L76A 2EMTA 3QQ8B 5JH5C 3NOBA 4ANVA 1Q1OA 2NBUA 5BO4B 3TIXA 1GC6A 3ZTCA 2M8SA 5JHAA 2MSED 1TZ1A 3KH0A 3VFKA 3K9PB 4WAAA 3RCZA 2OOBB 4HCNB 2Y5BB 2JVCA 2G3QB 4EOYA 1WIAA 3VTUA 2D07B 4G0NB 4XC2A 5DPTA 2KQSA 4DHZE 4II3B 1E7VA 2K8HA 2KZRA 1E90A 2JZZA 4MGYE 2DHZA 1WF9A 3ZVVA 2N9XA 3DPDA 3NZSA 2EKEC 5CHVC 2K6QA 4HDOA 3EHVA 4HPLB 2I1JA 3U8ZA 1WR1A 4G3XB 1WZ3A 2NVUI 2GBMA 2PE9A 1E8WA 2PEAA 3H9DA 4IWOA 5L95C 4PS8A 2WX0A 2MBQA 3R7QA 2CR5A 2V3SA 4MELA 4BOSC 2AL6A 2IO2B 2CHZA 4MGZE 2ZPNA 3L13A 1YX5B 2BKRB 2FNJB 3PZDA 3QA8A 5LXIB 2AYOB 1KLVA 4NJ7A 2G4SA 4EEWA 3VH3B 4WJOA 3ZRFA 2KOXA 2KWVB 1WH3A 4K7WA 2L0TA 2MBEA 4DDID 3T9LA 2DAJA 4CHKA 4KDLB 3KUDB 4K1RB 3UIPB 3NS8A 4AUQC 3ECIA 4FBJB 3PRPB 4RMAA 3WAPA 2BWFA 4K81A 5EDSA 3ZNZB 1WX9A 3ONSA 4P7IA 1X1MA 4LJPB 2GBNA 3DBHI 3EC8A 4ASWC 4BKSA 3ENEA 3LDZE 2L7RA 3VVWB 2C7HA 2NBVB 5JZEB 4PYZA 4KSLC 2Z0EB 3PS6A 2N7DA 2Z59B 3W1SC 2WYQA 4I6PA 2LI5A 4KV2A 5LXHA 5CHFA 4WWPA 4HWIB 5CTRC 2XK5B 3A4SC 4DHZB 2LRUA 3DCGA 3ZW3A 1I42A 2KWUB 2LWPA 2IYDB 4E3CA 5DPWA 2IY1B 1WYWB 2ZZPB 1SGHA 2KKCA 1V5OA 2LGYA 3APDA 4OVUA 3PV1A 3U7DA 1A5RA 4GXBA 4BVUC 4IWQA 4HLEA 3WAOA 3V6EB 2MP2A 1J19A 5J17A 3IFWB 4GIVA 4M8NA 3I3TB 4ANUA 3AULA 3PTFC 3NHEB 3PHXB 1WJ6A 3QCAA 4BKSD 2FUHB 1GJZA 4HJKA 3RT3B 3T8MA 4JL9A 2CHWA 4IW0A 2K8CA 2HTHA 1NBFC 4W9CA 5LLIA 3UINB 4NJ6A 2GBRA 2LJ5A 3MJWA 3OLMD 3M3JA 3RUIB 3SD5A 1E8ZA 3CSTA 1VD2A 3VUWA 1WY8A 2BWES 5AZHA 4PYUA 1ZKHA
chains in the Genus database with same CATH superfamily
2PVGC 4DDGD 3A75A 5KHQA 1E0ZA 2BKFA 1HK1A 4N3ZA 3U2SC 4I9OA 5E6PA 3GE3C 1JWUD 4E99A 3FWBC 3A1QB 5G55A 1N63A 3TSSA 2MBOA 1ZUD2 5D94A 4S1YA 1SSNA 3AE1B 3EFCA 1HK2A 3AI5A 1OGWA 3DBHB 4PS7A 3QHTA 4GDLA 4EMXA 2JRHA 3A9JB 1TTNA 3PREA 2BXGA 5MPOA 1HTQA 1L0XB 2SEBD 4N59A 4YT0B 5IJ5A 2JPHA 1U4AA 2OJWA 4IM2A 1N61A 3SFEB 2KX3A 2HD5B 1C4AA 3BVZA 2DZMA 4ZRIA 1S1QB 5C1ZA 4CYEA 4C7ZA 1EWYC 2OT3A 1GG3A 2BBCA 3SU8X 1ZGUB 2WXMA 4CO7A 4LK0M 1L7YA 1WXVA 2KVRA 1JW9D 2ZCBA 3D32A 4W9IA 3QIJA 2MJEA 3VR9B 1K51A 1V1PB 4LNNA 1TS3A 4XE0A 1NVID 4USAA 2LHEA 4JWSC 4O1NA 1AW7A 5EE3A 4OT2A 1AO6A 4A8XC 1JWAD 2AL3A 4BOZB 2WNMA 1XD3B 4ARCA 4NNJB 3IAS1 2KMAA 2N1VA 1C3TA 1GNUA 3ZNID 4FJVB 2KK8A 4YSXB 2N1WA 2KWFA 1QKZA 4E71A 1L6UA 4KZCA 4F5UA 3R66C 4W9FA 4RCOA 2FUG1 2HJ8A 4S17A 3DBRI 2KNBA 2ZVNA 4GLSC 4W9HA 1IYFA 2NPTB 2WXLA 2K5PA 2ZNVB 3L54A 2W55A 3SR6A 1N6ZA 2Y5PA 2QM6A 2E0XA 2C7NB 3ALBA 3KW5B 3Q8FA 3RYTA 1FOUA 2MHJA 1ENFA 5IP4D 1C77A 4MEMA 3Q3OC 1MIVA 2R2OA 2K0PA 3FILB 4HGMB 4HJGE 1MHXA 4HK2A 1CMXB 1DOYA 4MH8A 4C00A 1ZW7A 4EKUA 5IO9A 2K0NA 4JGHB 1KF6B 2V3PA 4ZHPA 5IA7A 3M99C 2LZ6A 2R61A 4M02A 4ACFA 1J78A 3AEEB 3H37A 2Y3AA 1P0RA 4GGQA 3BIID 4LNOA 1R4NB 1IGDA 1WI0A 1LFDA 2DZKA 5AUKA 1P1AA 2V4LA 3NVKA 1C9FA 1UORA 3HHMA 3VQIA 2IGHA 4E74A 1WM2A 2BVCA 2RPQA 3TDLA 4WA6B 3A9JA 2O6VD 2W9NA 4KZ0A 2MJDA 5DCNA 5E6OA 1P7EA 1XEEA 3GQXA 2B3AA 4KIKA 2E0YA 1KXPD 3W5UB 2LVOA 4HKZE 2EELA 3CWIA 2GOWA 1QZEA 3W5VB 3AB5A 4JE3B 2KDBA 4B9KA 2JXTA 4YSZB 3AEDB 3HIZA 1T3QA 1AWDA 5AZFA 1ROEA 3DOWA 1SB0A 2KDEB 3V62A 3APCA 3N32A 5TR5A 4WJPA 2K1FA 4BFRA 2EKIA 1YQBA 1JQ4A 4JWUC 3MHZA 2MBHA 4NPNA 1H8CA 1E5WA 4FJZA 1CJEA 2BXQA 1WR6E 3BVMA 1KRHA 3RNEC 4XGAB 2KANA 1MG8A 1NYRA 3ZYYX 1C4CA 3ABVB 3BWUD 1YOVB 3VTVA 1XO3A 4MDKE 1ZDVA 4NY0A 2CU3A 4MT5A 2VDBA 2KDFB 3MTNB 1EU3A 4HXDA 5DQFA 1BUIC 2VH2A 2MQJA 1V49A 2MBBB 3AU5A 5D3IB 2LUEA 4US8A 4K71A 2NR2A 1XF5L 3DVGY 1T0SC 4FIPB 4K3CA 2INNE 1WE6A 1MI0A 3V03A 2GB1A 3RZWC 3GP7A 1FCCC 2NS5A 4N58A 4P16A 3T3OA 2ACZB 2PKOA 1TY0A 1YQ4B 2KDMA 1N60A 1VDVA 1E7UA 2BYTA 1I35A 2RDHA 1IBXB 4LB9A 1RLFA 3KQ4A 3SEBA 3DVNV 1WX8A 1WXAA 4K2CA 1J0GA 4F5VA 2ICIA 1MA9A 4G50A 3Q3FA 2L83A 1GNJA 4AP4C 2KDIA 2IO1B 5I4DA 2N9KA 2WWZA 2E6XA 2B76B 3ZNGC 2L32A 2BXNA 4W9JA 5IAAC 2JU6X 1QT9A 1NYQA 1RWSA 1UUPA 2ZEQA 3DBLB 4NAWA 3P2BA 2J7QB 2PTLA 2DYMA 3DDCB 4ANVA 3TIXA 3ZTCA 1GC6A 1M4VA 2GUTA 1TZ1A 1I4RA 3B2FA 4HCNB 1I4HA 2XNAC 2D07B 2KQSA 1E7VA 5EE1A 1OQRA 4RGMA 2WXPA 4RFBA 4KKJA 1FCLA 3AEBB 4HPLB 2I1JA 1WR1A 4G3XB 3NVMA 2NVUI 2MEKA 2PEAA 4IWOA 2BXEA 3FAHA 4PS8A 2MBQA 3OG5A 3R7QA 2BXHA 3WCQA 2RPVA 2IO2B 3TUOA 3ZGZA 2I2ZA 2XVQA 3L13A 3VRBB 1MJDA 2FNJB 5LXIB 2AYOB 4EEWA 3VH3B 3V3XA 2KOXA 1E7FA 2KWVB 1VZ8A 1I4GA 4CHKA 1N5WA 2KYWA 1MFWA 2WLBA 3GZNB 4AUQC 1NT2B 1WX9A 3ONSA 2GBNA 1QF6A 1WXQA 2L7RA 2TSSA 3NMUA 2Z59B 2INPE 5LXHA 4OTTA 3DHGC 2XK5B 3DCGA 1SE2A 5DPWA 2WXQA 2IY1B 2KKCA 2LGYA 4HLEA 1J19A 5ID9A 4BKEA 4M8NA 4OTUA 4ANUA 3MJ5A 3NHEB 3PHXB 3WHQA 4L23A 3T8MA 2CHWA 4RH6A 4IKGA 1C78A 2HTHA 4W9CA 5LLIA 4NJ6A 1YN4A 2LJ5A 3MJWA 3RUIB 3M3JA 3SD5A 3CSTA 1VD2A 4LNIA 3VUWA 4MM3B 5AZHA 3ZNZB 3LYYA 3LJ3A 3NG0A 2REXA 2A4ZA 2QCZA 1SJHD 3B2GA 4RM8A 4LNKA 1V80A 3A4RA 2BXMA 3CX9A 1LXDA 3PLUA 1FXAA 2BXPA 4FHJA 2KBZA 3QX1A 2N7JA 2BS2B 3VR8B 2L05A 1FO4A 4AOFA 2BXDA 2LOQA 1EF1A 2V1YA 3V09A 2J53A 1OEYJ 1DOXA 5HOZA 1BKEA 1SJED 4LB2A 4TQ0A 1UD7A 1KTKA 1XLQA 5IOIA 1R4MI 1F1HA 4XZ4A 4KKIA 2AWTA 4P1BC 2BGFA 1TKEA 1K8RB 2C5LC 3LU7A 3JSVA 3ZUNA 4DXAB 2HDEA 4JX1C 4RNAA 1TBEA 5D6JB 3UI3A 3RN9C 3U52E 1MUHA 3IG3A 3OJ3A 2N9EB 2Z8IA 3ZJUA 4FULA 3C19A 1YJJA 2K25A 2YVCA 4KGTA 4D7XA 4JQWC 1PFDA 3KWLA 4W9GA 2KAJA 2BXFA 1RFKA 5IKCM 2RR9A 1IUEA 4ZRJA 2GBKA 2QMTA 5EE0A 1MG4A 3EA6A 3AH7A 2Z8LA 3TMPB 4TKNA 1VLBA 1OQYA 2RGFA 3DQVA 2LVPA 2Q5WD 2LRWA 4FADA 5C23A 5H92C 1Q5WB 1NENB 1ZXIA 3PHWB 2EFEA 1V81A 2L00B 1J7AA 3V6CB 4NQKE 2JUHA 2M0XA 4LLGM 2BYVE 3BK1A 3V60A 3LU6A 1FNWA 4XDDA 4HDQA 4ARIA 1V8CA 2IZVB 4D2KA 1ZOYB 3Q8EA 4BKGA 4LDTB 2KC2A 2XK5A 2D3GA 4IW1A 2C7MB 1HZ5A 4ZYSA 4YTPB 2BTEA 2J0KA 3B9MA 1I4QA 2UWQA 5C2TB 2JT4B 3ML9A 2WXFA 1SIFA 2M17A 2L52A 1K50A 2JYEA 1NEKB 1E7EA 2FCSA 2CJNA 4J6IA 4MM3A 2DENB 4J3OD 3OJ4B 2QIEB 2QJLA 2HJ1A 1DYQA 1TYGB 3DVGX 3BINA 2MA9B 1PGXA 1VCBA 4Z69A 4P1CC 4KIKB 3ZXVA 2JYTA 2PJHA 3RMKC 4FHKA 2NQOA 4ZCGA 2WX1A 4X57B 1FEHA 1YMHE 4GSWA 1DOIA 3KIKA 3BYTB 1QILA 3ICXA 5BYSA 1VJKA 3I9V1 1GNIA 3RD2A 2KQ7A 1TKYA 3L0WB 1PUTA 3LB8C 2VZKB 4F5SA 1AYFA 2FBWB 3V05A 2KLGA 3JRYA 1JRPA 4ZBQA 2UYZB 4LCDE 4Z9OA 1DGJA 3VXWA 3TEWA 2VRRB 1FXTB 4G01A 2GI9A 3TEZA 4MGKE 1BT0A 1L5PA 2C60A 1LNSA 2DG5A 4K3BA 4F7ZA 4QAYA 2KD0A 2GLSA 2OHFA 3NJTA 2BXKA 4MH0E 3UF8A 4KGSA 2DBWA 4W9LA 1T0RC 4DK5A 1UWMA 2V4IB 3M62B 5J18A 2BB5A 3ZKJC 2PE6B 4G04A 2ZVOA 3RI7C 1TF0A 1Z2MA 4Q2JA 1FNUA 3NS1A 4ANWA 1Q0WB 1D6EC 2K6DB 4W9KA 2LASA 1QOFA 3SHQA 1WGRA 2MP2B 2JWZA 4M0WA 4WJNA 3P1MA 1M94A 2LHDA 5JXVA 1K53A 4AJYB 2FCNA 4OZCA 2XN9C 1KFYB 3M63B 3CSFA 5D2MB 5BYQA 1TY2A 3RFZB 3Q2AC 4JIOU 4A3OA 2CU1A 1UH6A 3A33B 3PSEB 1E9MA 4GU2A 3TJPA 2XW0A 4UDUC 3DHHC 3U7ZA 3VH4B 3O13A 1TKGA 2N0SB 5GIOA 1WJ4A 1IJGA 4B0MA 3EECA 1P7FA 4R3DA 4C4VB 1WFYA 4LNFA 2WXHA 1B9RA 3CF6E 4JLCA 1HK4A 3JW0X 2KACA 3DBSA 2L8JA 1T6BX 3FNMA 1B1ZA 3AEGB 3V08A 2WS3B 1YQ3B 1JWBD 1KW2A 4NAWB 3H7SA 4C80A 4HPMB 1V2YA 2K3UA 2KQ4X 3HVZA 3L10B 2O2VB 4DBGA 1VZ7A 1T0YA 1NI2A 2N4FA 1OEYA 3WHRA 1I4PA 1HE8A 4FJCB 2A5UA 1FPYA 1FXIA 1AN8A 4OVVA 4HPPA 3RNCC 2IBIB 1PQSA 3N20C 2DBXA 1F2RI 4OVZA 2FCMA 3L4PA 1FIQA 3N1ZC 2AX5A 3U4EG 1RAXA 4GOCA 4WJQA 2M0AA 2QDFA 3H6NA 1FMAD 1KDXA 4ZRPA 3ML8A 3PRMB 2L76A 2EMTA 3QQ8B 2WDRB 5JH5C 3NOBA 1Q1OA 5BO4B 1FRDA 2M8SA 3KH0A 3VFKA 3RCZA 2G3QB 1E7GA 2IJ0A 4RGTA 4II3B 2K8HA 2JZZA 4NAMA 2SAKA 2DHZA 2RDBC 1WF9A 4CQNA 3ZVVA 1HA5A 1VZSA 5CHVC 3AE9B 2GBMA 2PE9A 1E8WA 4IW2A 1E7PB 1MIYA 1L4DB 2WDQB 2ZW1A 2E3TA 2CHZA 1E7IA 2ZPNA 2LQHA 1KLVA 1LOTA 2G4SA 4WJOA 3ZRFA 2KVZA 1SEBD 2MBEA 2QHBA 4L1BA 3T9LA 3KUDB 3NS8A 4HGKA 4FBJB 1SIJA 1ZPSA 3PRPB 4YTNB 3WAPA 1WRIA 2IGDA 1CZPA 2BX8A 4JK4A 1YN3A 4WIPA 1X1MA 4LJPB 2DLBA 4ASWC 3VVWB 2C7HA 3FKYA 2Z0EB 1J7BA 3BK2A 2N7DA 3W1SC 3AM9A 2D5GA 2WYQA 4OHJA 5GHKA 5CHFA 4WWPA 1Q10A 3A4SC 2LGSA 3DHIC 1I42A 4E3CA 2ZZPB 1WYWB 4OVUA 3APDA 3PV1A 4GXBA 4BVUC 3WAOA 5GIPA 2CKXA 2MP2A 4GIVA 3PTFC 3QCAA 1WJ6A 4BKSD 2ROHA 3NVWA 1GJZA 4HJKA 1UGJA 2D3BA 2K8CA 3UIVA 2GBRA 4MACA 4WH4A 1E8ZA 4PYUA 1HK3A 5IIXA 3VUXA 3ZTDA 1VFIA 4IM3A 1LM8B 1JALA 3HVDA 1T5XD 3E9SA 3EFUA 3AECB 1KOTA 2LXCA 2EFHA 3MHSB 4JPSA 4KDIC 4C4VA 2M1MA 4MSQB 3JSVB 1FNVA 2H89B 4ZYNA 1TS2A 2L1AA 2WU5B 3MFGA 2BQQA 1N5XA 4ZRKA 4PO0A 4BBNC 2CJOA 2KWDA 4BKTA 3P4SB 4FLHA 3URYA 2O2VA 1ET6A 3J9CA 1IP9A 5HKHA 2I1KA 3L16A 5FR3A 1JWMD 2MW5A 2IPKD 2WXKA 3AMZA 2HE7A 3HRDD 1QQRA 3VUYA 1EM7A 4FXCA 3RNAC 2KT7A 3IXSA 1D3ZA 2K9XA 2XVVA 3SIUB 2X8XX 4REZA 1LQBA 4DQOC 1D5MC 4RM9A 4DHXB 5E6JA 1D4BA 4MJSB 2M4NA 2AQ2B 3L08A 3R7RA 4RGNA 4EFOA 3AE6B 2ZJDA 3KJLA 2M56B 1EWCA 1OQQA 2K8BA 3A73A 2LQIA 3TBLD 2KO3A 3KYCD 3WIMA 1ZP0B 2KN5A 2CHXA 2EFCA 4DXGA 1WE7A 2JSVX 5BMHA 1P3QU 4OW0A 4TQ1A 2KHWB 2PPHA 4HVBA 1R4MB 1N62A 1V5TA 4B0EA 1C79A 1E8YA 1WGHA 4GDKA 2BYFA 2GBJA 1C76A 1PDXA 4I6LB 1JRUA 2INCC 1KLGD 4FN2A 3VAWA 2RSUA 1KJTA 5IFOA 1WGDA 5C3JB 3NVYA 3JVZX 3SFDB 2KLCA 1HA2A 3ZJVA 2BXOA 2DNFA 5D3DA 1O9XA 1GOZA 1V6EA 4M00A 3TCAA 2YLMA 5E6NA 4ANXA 2KTFA 2BXBA 3WAMA 1WJUA 2XEWA 4ZBRA 2LXSA 3OAWA 2V9HA 4XX5A 4ICUA 1HZ6A 4DHJB 2M19A 1FFUA 3V61A 2LGIA 2UU7A 1ZKHA 3GS2A 1R7SA 1MUSA 3NVIA 2ON8A 3GOEA 2V3NA 3Q69A 4ZC6A 1YJ1A 4KGRA 4B95A 4NZLB 1UZXB 2O6VA 4WQMA 1H4RA 4L2YA 5AZGA 2WXIA 4IM0A 4A3PA 2RD0A 4URKA 2JRIB 1TT5B 3HM6X 4DXFA 4K7SA 4ITKA 5EE9A 2ZW0A 3TEYA 3QK0A 3KUCB 1UNSA 5CHWA 3B0AA 2MX2A 4LDTD 1QLBB 2N7EA 2JWUA 4OR0A 2DZIA 4A55A 5BMIA 1WWTA 1WJNA 3AV8A 2FAZA 3BPJA 1F77A 2JX5A 1EO6A 2CS4A 3CIRB 1V86A 2LXAA 1E7CA 3QWZB 3PZ8A 1HTOA 3VHTC 3MHHB 4EE2A 3AE2B 1ISNA 2NTTA 2XMOA 3UQAA 2PVOD 3NZ3A 3R8BA 3AE4B 1T0QC 5GINA 1JNBA 4C7YA 1YX6B 2JF5A 4M0WB 3R2IA 4C31B 4GMVA 2D3AA 4AJWA 4BZAA 3CMMB 3ZNHB 4F8CB 2PLPA 2KC1A 3B1LX 3UIOB 1CK1A 4EUTA 4WURA 3W1YA 2LGDA 2OJRA 2QHOA 2VUFA 2ZPYA 1BMLC 4GG2A 5HHDG 1Y56A 1F9JA 1F2RC 1WMHA 3IVFA 2DYOA 3QJZA 3H3AA 4MJSA 2ZCCA 2AGHB 1IGCA 2OZBB 3AEFB 4WWNA 3W9CB 2VZKD 2KWCA 1XCTL 4F1SA 1J8CA 2XBBC 4ZRQA 2GMIC 3P63A 2ZNVC 2EFDA 4L9KA 3H8HA 3Q3JA 1FM0D 1V97A 1GPXA 4B6WA 4TUUA 1AARA 3X23A 3B08A 1UBIA 4FJYA 3ZQ4A 3VRAB 2H88B 2WDTB 3W1SA 2WQYB 2KJHB 2BT6A 1VR9A 5B5TA 4IG7B 2DX5B 3EGRA 5TSSA 4F5TA 4BBNF 2XVUA 3ZDMC 3WALA 2BF8B 2JZ3B 1RRBA 2LD9A 2Z0DB 5DPSA 3A9KA 3MC9A 3G9KD 1BJ5A 1XCQL 1GB1A 1L4ZB 2BS3B 4EZKA 3ETRA 2MWSB 1E8XA 2I2YA 1XQQA 1TS4A 1WGYA 4EZLA 1SE9A 1ESFA 4RF1A 3QAQA 2KFKA 1C1YB 3RPFC 2MCNB 3DBRB 5D7GA 3Q8AA 1KH0A 2D11A 4AQ7A 4XDCA 1HK5A 3PZ7A 3Q14C 4HCPB 2WXNA 5JHAA 1SE4A 2Y5BB 1WIAA 3VTUA 4C56C 2X38A 5DPTA 4J2VA 1SB3C 2HTME 1WGKA 4ZHOA 1YNTE 4MGYE 2YDFA 3DPDA 3NZSA 3B9LA 4PT5A 2KMMA 2QEJC 4HDOA 3EHVA 3KLSX 4W4UB 2D3CA 1WZ3A 2NMQA 3H9DA 3FWCC 2WX0A 3R2TA 3PLAA 1MVKA 2AL6A 2W3RA 1YX5B 2BKRB 3PZDA 1QOGA 2IDYA 4NJ7A 2DWQA 3P4PB 4YWGG 3SQJA 1XLNA 2L0TA 4AS1A 2JQRB 4RMAA 4K81A 5EDSA 5LNK1 4KX6B 2AQ3B 4LA0A 3DBHI 3EC8A 3ENEA 5JZEB 2IGGA 4KSLC 3PS6A 1SBBB 4KV2A 2LI5A 2G1EA 1SE3A 3MC8A 4DHZB 4A9AA 2LRUA 2Z8KA 2N9LA 2KWUB 2LWPA 1FRRA 1SGHA 1TJEA 3SIVB 1N5UA 1A5RA 3NVVA 4IWQA 4M70B 3V6EB 1J7EA 3N1YC 5T8IA 1TIFA 2FUHB 3RT3B 4JL9A 1JROA 4ZBKA 3NUHB 2PMVA 3Q8CA 5H8YE 3AE7B 1K52A 3OLMD 4LTUA 1I4XA 2BWES 4XYCA 3I57A 1WX7A 2BB6A 1OTRB 4KVGB 2J52A 2N9PC 3GQUA 5DBYA 1V1OA 1WXSA 2LGXA 2LEKA 4KSKC 5DPRA 3IT6B 2R2QA 2EMSA 3ZRCA 2MLBA 4WQOB 2FE8A 1WRDB 3BZDB 1ACCA 2W82A 5HFYA 3AU4A 3WA0A 4N0FD 3RNGC 2BXAA 2QILA 4WWMA 4N0UD 4ZOHC 2WXGA 2DYBA 4GN1A 4BY9C 1CQVA 1YD8U 1ZDXA 2LJIA 3IBEA 2GRIA 4GB9A 2BPSA 2JXXA 3A1QA 3VTWA 3N30A 3MP9A 4N6EB 5IIUA 1C4PA 2DAFA 3P42A 1H9ZA 1TGZB 1WGGA 1WZ0A 2J42A 4L8UA 2J0JA 3VDZA 1D5XC 3PO0A 2NBWB 3PT2B 4LJOB 4OZAA 1Y8RC 3UGBB 3WHSA 4HKQA 3LU8A 1WSPA 3P4RB 2W3SA 3MHSD 2D2QA 4G11A 3TEXA 1LO5D 2K39A 3Q3MC 4XWWA 4MBEC 3RNFC 4FA6A 1RM6C 5IJFA 3PVLA 3HUIA 1G6JA 4W9DA 3PGEA 4GDKB 4GDXA 4II2B 2BXLA 2AQ1B 3FC4A 4IOIE 2JY6A 1PGBA 5JHBA 3WANA 2ASQA 2XSIA 1WYGA 2NCNA 2WHIA 3IAM1 3LXFA 5HG2A 4EZJA 4L9QA 5ID7A 1GC7A 3JYUA 4YSYB 1A70A 1EU4A 2WXRA 1BM0A 1R4NI 3KUZA 1V1PA 3ECPA 2IY0B 2WP9B 3NRZA 3H7PB 2MRPA 2I38A 1XT9B 3DWMA 1GUAB 1ET9A 1QOBA 3P4QB 2K22A 3KYDD 2BXCA 3Q6BA 3QC8B 3S2AA 4YXDB 2G45B 1XLPA 1YN5A 4ZDVA 4HROA 2G4DB 4M8MA 3BY4B 2V36A 2KMCA 1EF5A 2O6VB 3APFA 3DWGC 5G5HA 3HK0A 2DZJA 4US9A 1YJIA 2L0FA 5BPKA 2NPTA 2ONQA 3PPAA 2QMCA 2KTRB 4BAXA 3ZXRA 4WAFA 2KFJA 3ZLZA 4H2AA 2W54A 2JZPA 3TL5A 3HM3A 3ZIMA 2KJ6A 2LUMA 4DWFA 2PW9A 3EUB2 2C9WB 2PIAA 2LVQA 5FR6A 4DM0A 4YL8A 2FCQA 3L17A 3FILA 1KLUD 3ZJTA 3RULA 2G9HD 1IPGA 2OEDA 2AEHA 4TV3A 1UF0A 1WXMA 3Q3NC 4WWOA 5FK9C 4PK1A 1KM7A 1MHHE 5G2NA 5BYRA 2BXIA 5J2RA 1MIWA 1LGRA 1SXTA 5FKAC 1BXTA 2BYEA 4NJCA 4ZUXV 3M95A 4DHJD 1I7HA 1WMHB 2Y5CA 1S3SG 3UQBA 2NNWA 3AE3B 4G03A 2VH1A 2WGSA 3RNBC 1TXUA 1L0YB 2VUEA 1MPEA 3AE5B 1UELA 1VRAB 5KHOA 1D5ZC 3C0RB 5GXGB 4OZBA 1NDDA 1XXGA 3IT4B 4NQLB 2QC8A 2DBYA 5AEKB 2IO3B 4HRSA 3IHPC 5G5GA 4A20A 4IWPA 1HQRD 1E7BA 2JUOA 1E7HA 3X0WA 5CX3A 4LUHA 1F52A 3N9YC 1YIWA 3BYYB 3NY5A 2D10A 3DBLI 1UBQA 4YTMB 3I5JC 4P6VF 2J4XA 2WDVB 3DVNU 3AEAB 2BS4B 3GE8C 1PYWD 2J0MA 2KJRA 2KX0A 1TS5A 2RDGA 4RGOS 4FK5B 3AXCA 3K9OB 4ICVA 4I6NB 1J7CA 4MGIE 3AE8B 1E10A 3A9KB 5GMVA 3U30A 3H1UA 3ZO5B 5AUIA 3B9JA 3ZDTA 3H7PA 5IJEA 3N3KB 3C8YA 1QOAA 3PRZA 4RF0A 1L2NA 1UWXA 1WM3A 2FIFA 2INDC 4TMAB 4N9F4 1P9DU 2IO0B 2KFKB 3O65B 4PS3A 4W9EA 2Z8JA 1UGMA 4AWJA 1E6EB 4GDLB 4IUMB 1FD6A 4K7UA 1ZE3D 2WXJA 4HEA1 2YEPB 2LMCA 3E56A 1OFFA 1FFVA 1RFAA 1SF0A 3R3MA 4IC7B 3KVFB 3W2DA 3I63C 2CKHB 3PLVA 3GZNI 1V9JA 2MJ3A 5FUOA 5BMGA 2V0GA 3NZUA 2L3ZA 4A90A 2XW1A 1Z5SB 2FIDA 3SDLC 2KTRA 3QARA 1IBXA 2DBUA 4MSMB 1F0ZA 1P98A 2KXJA 1EUVB 5L83A 3GA9L 2QSDA 3RZFA 1E7AA 2NBUA 3Q8BA 4LUFA 3KWVA 2MSED 3K9PB 4WAAA 2OOBB 2JVCA 4EOYA 4G0NB 4XC2A 4DHZE 1E90A 2KZRA 3OWEB 1HXYD 2N9XA 2RMMA 2EKEC 2K6QA 1MM8A 4S0RA 1STEA 4M01A 3U8ZA 3T3NA 1VZ6A 1JCKB 4A6QA 5L95C 1L0VB 2CR5A 2V3SA 4MELA 4BOSC 4MGZE 2MH7A 3QA8A 1TZOA 1WH3A 1H5WA 3BVGA 4K7WA 4DDID 3N1XC 2LFIA 5IN7A 2DAJA 4KDLB 4K1RB 3UIPB 3ECIA 4TSSA 2XVWA 2AJEA 1GAQB 2BWFA 3JQZA 3GB1A 4P7IA 3NVZA 4BKSA 2WXOA 3LDZE 5HI1A 2NBVB 4PYZA 4IDIA 1PGAA 2I30A 2BW2A 2LXTA 4I6PA 1RYJA 4HWIB 5CTRC 1GB4A 1E78A 3ZW3A 2IYDB 1JWSD 4XWTA 1V5OA 3U7DA 5IIHA 2YEPF 2WU2B 1XLOA 1HEZE 1NI3A 3IFWB 5J17A 3I3TB 3AULA 2NTSA 3MC0B 1ZXHA 4IW0A 1NBFC 1L6VA 3UINB 1JMLA 1WY8A 2KN4A 3AN1A
chains in the Genus database with same CATH topology
2PVGC 4DDGD 3A75A 5KHQA 1E0ZA 2BKFA 1HK1A 4N3ZA 3U2SC 5E6PA 1JWUD 4E99A 3FWBC 3A1QB 5G55A 1N63A 3TSSA 2MBOA 1ZUD2 5D94A 4S1YA 1SSNA 3AE1B 1HK2A 3AI5A 1OGWA 4PS7A 3QHTA 4GDLA 4EMXA 2JRHA 3A9JB 1TTNA 3PREA 2BXGA 5MPOA 1L0XB 2SEBD 4N59A 4YT0B 5IJ5A 2JPHA 1U4AA 4IM2A 1N61A 3SFEB 2KX3A 2HD5B 1C4AA 3BVZA 2DZMA 4ZRIA 1S1QB 5C1ZA 4CYEA 4C7ZA 1EWYC 2OT3A 1GG3A 3SU8X 2BBCA 1ZGUB 4CO7A 2WXMA 4LK0M 1L7YA 1WXVA 2KVRA 1JW9D 2ZCBA 3D32A 4W9IA 3QIJA 2MJEA 3VR9B 1K51A 1V1PB 1TS3A 4XE0A 1NVID 4USAA 2LHEA 4JWSC 4O1NA 1AW7A 5EE3A 4OT2A 1AO6A 4A8XC 1JWAD 2AL3A 4BOZB 2WNMA 1XD3B 4ARCA 4NNJB 3IAS1 2KMAA 2N1VA 1C3TA 1GNUA 3ZNID 4FJVB 2KK8A 4YSXB 2N1WA 1QKZA 4E71A 1L6UA 4KZCA 4F5UA 3R66C 4W9FA 4RCOA 2HJ8A 2FUG1 3DBRI 2KNBA 2ZVNA 4GLSC 4W9HA 1IYFA 2NPTB 2WXLA 2K5PA 2ZNVB 3L54A 2W55A 3SR6A 2Y5PA 2QM6A 2E0XA 2C7NB 3ALBA 3KW5B 3Q8FA 3RYTA 1FOUA 1ENFA 1C77A 4MEMA 1MIVA 2R2OA 2K0PA 3FILB 4HGMB 4HJGE 1MHXA 4HK2A 1CMXB 1DOYA 4MH8A 1ZW7A 4EKUA 4JGHB 1KF6B 2V3PA 4ZHPA 5IA7A 3M99C 2LZ6A 2R61A 1J78A 3AEEB 3H37A 2Y3AA 1P0RA 4GGQA 3BIID 1IGDA 1WI0A 1LFDA 2DZKA 5AUKA 1P1AA 2V4LA 3NVKA 1C9FA 1UORA 3HHMA 3VQIA 2IGHA 4E74A 1WM2A 2RPQA 3TDLA 4WA6B 3A9JA 2O6VD 2W9NA 4KZ0A 2MJDA 5DCNA 5E6OA 1P7EA 2B3AA 3GQXA 1XEEA 4KIKA 2E0YA 1KXPD 3W5UB 2LVOA 4HKZE 2EELA 3CWIA 2GOWA 1QZEA 3W5VB 3AB5A 2KN4A 4JE3B 2KDBA 4B9KA 2JXTA 4YSZB 3AEDB 3HIZA 1T3QA 1AWDA 5AZFA 1ROEA 3DOWA 2KDEB 3V62A 3APCA 3N32A 5TR5A 4WJPA 2K1FA 4BFRA 2EKIA 1YQBA 1JQ4A 4JWUC 3MHZA 2MBHA 4NPNA 1H8CA 1E5WA 4FJZA 1CJEA 2BXQA 1WR6E 3BVMA 1KRHA 2KANA 1MG8A 1NYRA 3ZYYX 1C4CA 3ABVB 3BWUD 3VTVA 4MDKE 1XO3A 1ZDVA 4NY0A 2CU3A 4MT5A 2VDBA 2KDFB 3MTNB 1EU3A 4HXDA 5DQFA 1BUIC 2MQJA 1V49A 2MBBB 3AU5A 5D3IB 2LUEA 4US8A 4K71A 2NR2A 3DVGY 1XF5L 4FIPB 2INNE 1WE6A 1MI0A 3V03A 2GB1A 3RZWC 3GP7A 2NS5A 1FCCC 4N58A 4P16A 3T3OA 2ACZB 2PKOA 1TY0A 1YQ4B 2KDMA 1N60A 1VDVA 1E7UA 2BYTA 1I35A 2RDHA 1IBXB 4LB9A 1RLFA 3KQ4A 3SEBA 3DVNV 1WX8A 1WXAA 4K2CA 1J0GA 4F5VA 2ICIA 1MA9A 4G50A 3Q3FA 2L83A 1GNJA 4AP4C 2KDIA 2IO1B 5I4DA 2N9KA 2WWZA 2E6XA 2B76B 3ZNGC 2L32A 2BXNA 4W9JA 5IAAC 2JU6X 1QT9A 1NYQA 2ZEQA 1RWSA 1UUPA 4NAWA 3P2BA 2J7QB 2PTLA 2DYMA 3DDCB 4ANVA 3TIXA 3ZTCA 1GC6A 1M4VA 1TZ1A 1I4RA 4HCNB 3B2FA 1I4HA 2XNAC 2D07B 2KQSA 1E7VA 5EE1A 1OQRA 4RGMA 2WXPA 4RFBA 4KKJA 1FCLA 3AEBB 4HPLB 2I1JA 1WR1A 4G3XB 3NVMA 2NVUI 2MEKA 2PEAA 4IWOA 2BXEA 4PS8A 3FAHA 2MBQA 3R7QA 2BXHA 3WCQA 2RPVA 2IO2B 3TUOA 3ZGZA 2I2ZA 2XVQA 3L13A 3VRBB 2FNJB 5LXIB 2AYOB 4EEWA 3VH3B 3V3XA 2KOXA 1E7FA 2KWVB 1VZ8A 1I4GA 4CHKA 1N5WA 2WLBA 4AUQC 1NT2B 1WX9A 3ONSA 2GBNA 1QF6A 1WXQA 2L7RA 2TSSA 3NMUA 2Z59B 2INPE 5LXHA 4OTTA 2XK5B 3DCGA 1SE2A 5DPWA 2WXQA 2IY1B 2KKCA 2LGYA 4HLEA 1J19A 5ID9A 4BKEA 4M8NA 4OTUA 4ANUA 3MJ5A 3NHEB 3PHXB 3WHQA 4L23A 3T8MA 2CHWA 4RH6A 4IKGA 1C78A 2HTHA 4W9CA 5LLIA 4NJ6A 1YN4A 2LJ5A 3MJWA 3RUIB 3M3JA 3SD5A 3CSTA 1VD2A 3VUWA 4MM3B 5AZHA 3ZNZB 3LYYA 3LJ3A 2REXA 2A4ZA 1SJHD 3B2GA 4RM8A 1V80A 3A4RA 2BXMA 3CX9A 1LXDA 3PLUA 1FXAA 2BXPA 4FHJA 2KBZA 3QX1A 2N7JA 2BS2B 3VR8B 2L05A 1FO4A 4AOFA 2BXDA 2LOQA 1EF1A 2V1YA 3V09A 2J53A 1OEYJ 1DOXA 5HOZA 1BKEA 1SJED 4LB2A 4TQ0A 1UD7A 1KTKA 1XLQA 1R4MI 4XZ4A 4KKIA 2AWTA 2BGFA 1TKEA 1K8RB 2C5LC 3LU7A 3JSVA 3ZUNA 4DXAB 2HDEA 4JX1C 4RNAA 1TBEA 5D6JB 3UI3A 3U52E 3IG3A 3OJ3A 2N9EB 2Z8IA 3ZJUA 4FULA 1YJJA 2K25A 2YVCA 4KGTA 4JQWC 1PFDA 4W9GA 3KWLA 2KAJA 2BXFA 1RFKA 2RR9A 4ZRJA 1IUEA 2GBKA 2QMTA 5EE0A 3EA6A 3AH7A 2Z8LA 3TMPB 4TKNA 1VLBA 1OQYA 2RGFA 3DQVA 2LVPA 2Q5WD 2LRWA 4FADA 5C23A 5H92C 1Q5WB 1NENB 1ZXIA 3PHWB 2EFEA 1V81A 2L00B 1J7AA 3V6CB 4NQKE 2JUHA 2M0XA 4LLGM 2BYVE 3BK1A 3V60A 3LU6A 1FNWA 4XDDA 4HDQA 4ARIA 1V8CA 2IZVB 4D2KA 1ZOYB 3Q8EA 4BKGA 4LDTB 2KC2A 2XK5A 2D3GA 4IW1A 2C7MB 1HZ5A 4ZYSA 4YTPB 2BTEA 2J0KA 3B9MA 2UWQA 1I4QA 5C2TB 2JT4B 3ML9A 2WXFA 1SIFA 2M17A 2L52A 1K50A 2JYEA 1NEKB 1E7EA 2FCSA 4J6IA 2CJNA 4MM3A 2DENB 4J3OD 3OJ4B 2QIEB 2QJLA 1DYQA 1TYGB 3DVGX 3BINA 2MA9B 1PGXA 1VCBA 4Z69A 4KIKB 2PJHA 2JYTA 4FHKA 2NQOA 4ZCGA 2WX1A 4X57B 1FEHA 1YMHE 4GSWA 1DOIA 3KIKA 3BYTB 1QILA 3ICXA 5BYSA 1VJKA 3I9V1 1GNIA 3RD2A 2KQ7A 3L0WB 1TKYA 1PUTA 3LB8C 2VZKB 4F5SA 1AYFA 2FBWB 3V05A 2KLGA 3JRYA 1JRPA 4ZBQA 2UYZB 4LCDE 4Z9OA 1DGJA 3VXWA 3TEWA 2VRRB 1FXTB 4G01A 2GI9A 3TEZA 4MGKE 1BT0A 1L5PA 2C60A 1LNSA 2DG5A 4F7ZA 2KD0A 2OHFA 2BXKA 4MH0E 3UF8A 4KGSA 2DBWA 4W9LA 4DK5A 1UWMA 2V4IB 3M62B 5J18A 2BB5A 3ZKJC 2PE6B 4G04A 2ZVOA 1TF0A 1Z2MA 4Q2JA 4ANWA 1FNUA 3NS1A 1Q0WB 1D6EC 2K6DB 4W9KA 2LASA 3SHQA 1QOFA 1WGRA 2MP2B 2JWZA 4WJNA 4M0WA 3P1MA 1M94A 2LHDA 5JXVA 1K53A 4AJYB 2FCNA 4OZCA 2XN9C 1KFYB 3M63B 3CSFA 5D2MB 5BYQA 1TY2A 3RFZB 4JIOU 4A3OA 2CU1A 1UH6A 3A33B 3PSEB 4GU2A 1E9MA 3TJPA 2XW0A 4UDUC 3U7ZA 3VH4B 3O13A 1TKGA 2N0SB 5GIOA 1WJ4A 1IJGA 4B0MA 3EECA 1P7FA 4R3DA 1WFYA 2WXHA 1B9RA 3CF6E 4JLCA 1HK4A 3JW0X 2KACA 3DBSA 2L8JA 1T6BX 3FNMA 1B1ZA 3AEGB 3V08A 2WS3B 1YQ3B 1JWBD 1KW2A 4NAWB 3H7SA 4C80A 4HPMB 1V2YA 2K3UA 2KQ4X 3HVZA 3L10B 2O2VB 4DBGA 1VZ7A 1T0YA 1NI2A 2N4FA 1OEYA 3WHRA 1I4PA 1HE8A 4FJCB 2A5UA 1FXIA 4OVVA 1AN8A 2IBIB 1PQSA 2DBXA 1F2RI 4OVZA 2FCMA 3L4PA 1FIQA 2AX5A 3U4EG 1RAXA 4GOCA 4WJQA 2M0AA 3H6NA 1FMAD 4ZRPA 3ML8A 3PRMB 2L76A 2EMTA 3QQ8B 2WDRB 5JH5C 3NOBA 1Q1OA 5BO4B 1FRDA 2M8SA 3KH0A 3VFKA 3RCZA 2G3QB 1E7GA 2IJ0A 4RGTA 4II3B 2K8HA 2JZZA 4NAMA 2SAKA 2DHZA 1WF9A 4CQNA 3ZVVA 5CHVC 1VZSA 1HA5A 3AE9B 2GBMA 2PE9A 1E8WA 4IW2A 1E7PB 1MIYA 1L4DB 2WDQB 2ZW1A 2E3TA 2CHZA 1E7IA 2ZPNA 1KLVA 1LOTA 2G4SA 4WJOA 3ZRFA 1SEBD 2MBEA 2QHBA 3T9LA 4L1BA 3KUDB 3NS8A 4HGKA 4FBJB 1SIJA 3PRPB 3WAPA 1ZPSA 4YTNB 1WRIA 2IGDA 1CZPA 2BX8A 4JK4A 1YN3A 4WIPA 1X1MA 4LJPB 2DLBA 4ASWC 3VVWB 2C7HA 2Z0EB 1J7BA 3BK2A 2N7DA 3W1SC 3AM9A 2D5GA 2WYQA 4OHJA 5GHKA 5CHFA 4WWPA 1Q10A 3A4SC 1I42A 4E3CA 4OVUA 1WYWB 2ZZPB 3APDA 3PV1A 4GXBA 4BVUC 3WAOA 5GIPA 2CKXA 2MP2A 4GIVA 3PTFC 3QCAA 1WJ6A 4BKSD 2ROHA 3NVWA 1GJZA 4HJKA 1UGJA 2K8CA 3UIVA 2GBRA 4MACA 4WH4A 1E8ZA 4PYUA 1HK3A 5IIXA 3VUXA 3ZTDA 1VFIA 4IM3A 1LM8B 1JALA 3HVDA 1T5XD 3E9SA 3EFUA 3AECB 1KOTA 2LXCA 2EFHA 3MHSB 4JPSA 4KDIC 2M1MA 4MSQB 3JSVB 4ZYNA 1FNVA 2H89B 1TS2A 2L1AA 2WU5B 3MFGA 1N5XA 4ZRKA 4PO0A 4BBNC 2CJOA 2KWDA 4BKTA 3P4SB 4FLHA 3URYA 2O2VA 1ET6A 3J9CA 1IP9A 5HKHA 2I1KA 3L16A 5FR3A 2MW5A 1JWMD 2IPKD 2WXKA 3AMZA 2HE7A 3HRDD 1QQRA 3VUYA 1EM7A 4FXCA 1D3ZA 3IXSA 2K9XA 2XVVA 3SIUB 4REZA 1LQBA 4DQOC 1D5MC 4RM9A 4DHXB 5E6JA 1D4BA 4MJSB 2M4NA 2AQ2B 3L08A 3R7RA 4RGNA 4EFOA 3AE6B 2ZJDA 3KJLA 2M56B 1EWCA 2K8BA 1OQQA 3A73A 3TBLD 2KO3A 3KYCD 3WIMA 1ZP0B 2KN5A 2CHXA 2EFCA 4DXGA 1WE7A 2JSVX 5BMHA 1P3QU 4OW0A 4TQ1A 2KHWB 2PPHA 4HVBA 1N62A 1V5TA 4B0EA 1E8YA 1WGHA 1C79A 4GDKA 2BYFA 2GBJA 4I6LB 1C76A 1PDXA 1JRUA 1KLGD 4FN2A 3VAWA 2RSUA 1KJTA 5IFOA 1WGDA 5C3JB 3NVYA 3JVZX 3SFDB 2KLCA 1HA2A 3ZJVA 2BXOA 5D3DA 1O9XA 1V6EA 1GOZA 3TCAA 2YLMA 5E6NA 4ANXA 2KTFA 2BXBA 3WAMA 1WJUA 2XEWA 4ZBRA 3OAWA 4XX5A 4ICUA 1HZ6A 4DHJB 2M19A 1FFUA 3V61A 1ZKHA 2LGIA 3GS2A 1R7SA 3NVIA 2ON8A 3GOEA 2V3NA 3Q69A 4ZC6A 1YJ1A 4KGRA 4B95A 4NZLB 1UZXB 2O6VA 4WQMA 1H4RA 4L2YA 5AZGA 2WXIA 4IM0A 4A3PA 2RD0A 4URKA 2JRIB 3HM6X 4DXFA 4K7SA 4ITKA 5EE9A 2ZW0A 3TEYA 3QK0A 3KUCB 1UNSA 5CHWA 3B0AA 2MX2A 4LDTD 1QLBB 2N7EA 2JWUA 4OR0A 2DZIA 4A55A 5BMIA 1WWTA 1WJNA 3AV8A 2FAZA 1F77A 2CS4A 1EO6A 2JX5A 3CIRB 1V86A 2LXAA 1E7CA 3QWZB 3PZ8A 3VHTC 3MHHB 4EE2A 3AE2B 1ISNA 2NTTA 2XMOA 3UQAA 2PVOD 3NZ3A 3R8BA 3AE4B 5GINA 1JNBA 4C7YA 1YX6B 2JF5A 4M0WB 3R2IA 4C31B 4GMVA 4AJWA 3CMMB 3ZNHB 4F8CB 2PLPA 2KC1A 3B1LX 3UIOB 1CK1A 4EUTA 3W1YA 4WURA 2LGDA 2OJRA 2QHOA 2VUFA 2ZPYA 1BMLC 4GG2A 5HHDG 1Y56A 1F9JA 1F2RC 1WMHA 3IVFA 2DYOA 3QJZA 3H3AA 4MJSA 2ZCCA 1IGCA 2OZBB 3AEFB 4WWNA 3W9CB 2VZKD 2KWCA 1XCTL 4F1SA 1J8CA 2XBBC 4ZRQA 2GMIC 3P63A 2ZNVC 2EFDA 4L9KA 3H8HA 3Q3JA 1FM0D 1V97A 1GPXA 4B6WA 4TUUA 1AARA 3X23A 3B08A 1UBIA 4FJYA 3ZQ4A 3VRAB 2H88B 2WDTB 3W1SA 2WQYB 2KJHB 4IG7B 1VR9A 5B5TA 2BT6A 2DX5B 3EGRA 5TSSA 4F5TA 4BBNF 2XVUA 3ZDMC 3WALA 2BF8B 2JZ3B 1RRBA 2LD9A 2Z0DB 5DPSA 3A9KA 3G9KD 1BJ5A 1XCQL 1GB1A 1L4ZB 2BS3B 4EZKA 3ETRA 2MWSB 1E8XA 2I2YA 1XQQA 1TS4A 1WGYA 4EZLA 1SE9A 1ESFA 4RF1A 3QAQA 2KFKA 1C1YB 3RPFC 2MCNB 5D7GA 3Q8AA 1KH0A 2D11A 4AQ7A 4XDCA 1HK5A 3PZ7A 4HCPB 2WXNA 5JHAA 1SE4A 2Y5BB 1WIAA 3VTUA 4C56C 5DPTA 2X38A 4J2VA 1SB3C 2HTME 1WGKA 4ZHOA 1YNTE 4MGYE 2YDFA 3DPDA 3NZSA 3B9LA 4PT5A 2KMMA 2QEJC 4HDOA 3EHVA 3KLSX 4W4UB 1WZ3A 2NMQA 3H9DA 3FWCC 2WX0A 3R2TA 3PLAA 1MVKA 2AL6A 2W3RA 1YX5B 2BKRB 3PZDA 4NJ7A 1QOGA 2IDYA 2DWQA 3P4PB 4YWGG 3SQJA 1XLNA 2L0TA 4AS1A 2JQRB 4RMAA 4K81A 5EDSA 5LNK1 4KX6B 2AQ3B 4LA0A 3DBHI 3EC8A 3ENEA 5JZEB 4KSLC 2IGGA 3PS6A 1SBBB 4KV2A 2LI5A 2G1EA 1SE3A 4DHZB 4A9AA 2LRUA 2Z8KA 2N9LA 2KWUB 2LWPA 1FRRA 1SGHA 1TJEA 3SIVB 1N5UA 1A5RA 3NVVA 4IWQA 4M70B 3V6EB 1J7EA 5T8IA 2FUHB 3RT3B 4JL9A 1JROA 4ZBKA 3NUHB 2PMVA 3Q8CA 5H8YE 3AE7B 1K52A 3OLMD 4LTUA 1I4XA 2BWES 3I57A 1WX7A 2BB6A 1OTRB 4KVGB 2J52A 2N9PC 3GQUA 5DBYA 1V1OA 1WXSA 2LGXA 2LEKA 4KSKC 5DPRA 3IT6B 2R2QA 2EMSA 3ZRCA 2MLBA 4WQOB 2FE8A 1WRDB 3BZDB 1ACCA 2W82A 5HFYA 3AU4A 3WA0A 4N0FD 2BXAA 2QILA 4WWMA 4N0UD 4ZOHC 2WXGA 2DYBA 4GN1A 4BY9C 1YD8U 4GB9A 3IBEA 3VTWA 1CQVA 1ZDXA 2GRIA 2BPSA 2JXXA 3A1QA 2LJIA 3N30A 3MP9A 4N6EB 5IIUA 1C4PA 2DAFA 3P42A 1H9ZA 1TGZB 1WGGA 1WZ0A 2J42A 4L8UA 2J0JA 3VDZA 1D5XC 3PO0A 2NBWB 3PT2B 4LJOB 4OZAA 1Y8RC 3UGBB 3WHSA 4HKQA 3LU8A 1WSPA 3P4RB 3MHSD 2W3SA 2D2QA 4G11A 3TEXA 1LO5D 2K39A 4XWWA 4MBEC 4FA6A 1RM6C 5IJFA 3PVLA 3HUIA 1G6JA 4W9DA 3PGEA 4GDKB 4GDXA 4II2B 2BXLA 2AQ1B 3FC4A 4IOIE 2JY6A 5JHBA 1PGBA 3WANA 2ASQA 2XSIA 1WYGA 2NCNA 3IAM1 3LXFA 5HG2A 4EZJA 4L9QA 5ID7A 1GC7A 3JYUA 4YSYB 1A70A 1EU4A 2WXRA 1R4NI 1BM0A 3KUZA 1V1PA 2IY0B 2WP9B 3NRZA 3H7PB 2MRPA 2I38A 1XT9B 3DWMA 1GUAB 1ET9A 1QOBA 3P4QB 2K22A 3KYDD 2BXCA 3QC8B 3S2AA 4YXDB 2G45B 1XLPA 1YN5A 4ZDVA 4HROA 2G4DB 4M8MA 3BY4B 2V36A 2KMCA 1EF5A 2O6VB 3APFA 3DWGC 5G5HA 3HK0A 2DZJA 4US9A 1YJIA 2L0FA 5BPKA 2NPTA 2ONQA 3PPAA 2QMCA 2KTRB 4WAFA 2KFJA 3ZLZA 4H2AA 2W54A 3TL5A 2JZPA 3HM3A 3ZIMA 2KJ6A 4DWFA 2LUMA 2PW9A 3EUB2 2C9WB 2PIAA 2LVQA 5FR6A 4YL8A 2FCQA 3L17A 3FILA 1KLUD 3ZJTA 3RULA 2G9HD 1IPGA 2OEDA 2AEHA 4TV3A 1WXMA 4WWOA 5FK9C 1KM7A 1MHHE 5G2NA 5BYRA 2BXIA 5J2RA 1MIWA 1SXTA 5FKAC 1BXTA 2BYEA 4NJCA 4ZUXV 3M95A 4DHJD 1WMHB 1I7HA 2Y5CA 1S3SG 2NNWA 3AE3B 4G03A 1TXUA 1L0YB 2VUEA 1MPEA 3AE5B 1UELA 1VRAB 5KHOA 1D5ZC 3C0RB 5GXGB 4OZBA 1NDDA 1XXGA 3IT4B 4NQLB 2DBYA 5AEKB 2IO3B 4HRSA 3IHPC 5G5GA 4A20A 4IWPA 1HQRD 1E7BA 2JUOA 1E7HA 3X0WA 5CX3A 4LUHA 3N9YC 1YIWA 3BYYB 3NY5A 2D10A 3DBLI 1UBQA 4YTMB 4P6VF 2J4XA 3DVNU 2WDVB 3AEAB 2BS4B 1PYWD 2J0MA 2KJRA 2KX0A 1TS5A 2RDGA 4RGOS 4FK5B 3AXCA 3K9OB 4ICVA 4I6NB 1J7CA 4MGIE 3AE8B 1E10A 3A9KB 5GMVA 3U30A 3H1UA 3ZO5B 5AUIA 3ZDTA 3B9JA 3H7PA 5IJEA 3N3KB 3C8YA 3PRZA 1QOAA 4RF0A 1L2NA 1UWXA 1WM3A 2FIFA 4TMAB 4N9F4 1P9DU 2IO0B 2KFKB 3O65B 4PS3A 4W9EA 2Z8JA 1UGMA 4AWJA 1E6EB 4GDLB 4IUMB 1FD6A 4K7UA 1ZE3D 2WXJA 4HEA1 2YEPB 2LMCA 3E56A 1OFFA 1FFVA 1RFAA 1SF0A 3R3MA 4IC7B 3KVFB 3W2DA 2CKHB 3PLVA 3GZNI 1V9JA 2MJ3A 5FUOA 5BMGA 2V0GA 3NZUA 2L3ZA 4A90A 3SDLC 2XW1A 1Z5SB 2FIDA 2KTRA 3QARA 1IBXA 2DBUA 4MSMB 1F0ZA 1P98A 2KXJA 1EUVB 5L83A 3GA9L 2QSDA 3RZFA 1E7AA 2NBUA 3Q8BA 4LUFA 3KWVA 2MSED 3K9PB 4WAAA 2OOBB 2JVCA 4EOYA 4G0NB 4XC2A 4DHZE 1E90A 2KZRA 3OWEB 1HXYD 2N9XA 2RMMA 2EKEC 2K6QA 1STEA 3U8ZA 3T3NA 1VZ6A 1JCKB 4A6QA 5L95C 1L0VB 2CR5A 2V3SA 4MELA 4BOSC 4MGZE 2MH7A 3QA8A 1TZOA 1WH3A 1H5WA 4K7WA 4DDID 3BVGA 2LFIA 2DAJA 4KDLB 4K1RB 3UIPB 3ECIA 4TSSA 2XVWA 2AJEA 1GAQB 2BWFA 3JQZA 4P7IA 3GB1A 3NVZA 4BKSA 3LDZE 2WXOA 5HI1A 2NBVB 4PYZA 4IDIA 1PGAA 2I30A 2BW2A 4I6PA 1RYJA 4HWIB 5CTRC 1GB4A 1E78A 3ZW3A 2IYDB 1JWSD 4XWTA 1V5OA 3U7DA 5IIHA 2YEPF 2WU2B 1XLOA 1HEZE 5J17A 3IFWB 1NI3A 3I3TB 3AULA 2NTSA 3MC0B 1ZXHA 4IW0A 1NBFC 1L6VA 3UINB 1JMLA 1WY8A 3UQBA 3AN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUX A;  3LJ3 A;  3ZTD A;  2REX A;  1WX7 A;  4IM3 A;  2A4Z A;  1LM8 B;  4DDG D;  5KHQ A;  2BKF A;  1OTR B;  4KVG B;  2N9P C;  4RM8 A;  3EFU A;  1WXS A;  5E6P A;  2LGX A;  1KOT A;  2LXC A;  1V80 A;  3A1Q B;  3A4R A;  5G55 A;  4KSK C;  5DPR A;  4KDI C;  1LXD A;  2MBO A;  3PLU A;  2R2Q A;  5D94 A;  2M1M A;  2EMS A;  4MSQ B;  3ZRC A;  3JSV B;  3AI5 A;  2MLB A;  1OGW A;  3QX1 A;  1WRD B;  4FHJ A;  4WQO B;  4ZYN A;  4PS7 A;  2L05 A;  3AU4 A;  3QHT A;  4GDL A;  3WA0 A;  4AOF A;  2JRH A;  3A9J B;  1EF1 A;  2V1Y A;  1TTN A;  3PRE A;  4ZRK A;  4BBN C;  1OEY J;  4BKT A;  4TQ0 A;  4FLH A;  2O2V A;  1UD7 A;  2DYB A;  4GN1 A;  1YD8 U;  4GB9 A;  2JPH A;  3IBE A;  3VTW A;  1U4A A;  1R4M I;  2BPS A;  2JXX A;  3A1Q A;  3N30 A;  1IP9 A;  4XZ4 A;  5HKH A;  4IM2 A;  2AWT A;  2BGF A;  2I1K A;  2DAF A;  1K8R B;  2C5L C;  3L16 A;  3JSV A;  2KX3 A;  2MW5 A;  3ZUN A;  2HD5 B;  4DXA B;  1TBE A;  2HE7 A;  5D6J B;  2DZM A;  4ZRI A;  1S1Q B;  1TGZ B;  1WGG A;  1WZ0 A;  5C1Z A;  4CYE A;  3IG3 A;  2J0J A;  3VDZ A;  3VUY A;  3OJ3 A;  2N9E B;  1GG3 A;  2NBW B;  1D3Z A;  3SU8 X;  3PT2 B;  1ZGU B;  4FUL A;  4LJO B;  1Y8R C;  3UGB B;  4CO7 A;  1L7Y A;  2K25 A;  2YVC A;  3MHS D;  2D2Q A;  1LQB A;  1WXV A;  4G11 A;  4JQW C;  2K39 A;  2KVR A;  2ZCB A;  4RM9 A;  4W9G A;  4FA6 A;  3D32 A;  4W9I A;  3QIJ A;  2RR9 A;  4MJS B;  2M4N A;  4ZRJ A;  2GBK A;  3PVL A;  1G6J A;  3L08 A;  3R7R A;  4W9D A;  3PGE A;  4GDK B;  4EFO A;  2ZJD A;  2K8B A;  3TMP B;  4TKN A;  4II2 B;  1OQY A;  3TBL D;  2KO3 A;  2JY6 A;  5JHB A;  3KYC D;  3WAN A;  2RGF A;  3WIM A;  3DQV A;  2LVP A;  2ASQ A;  2KN5 A;  2AL3 A;  2CHX A;  4B6W A;  2LRW A;  4BOZ B;  1XD3 B;  1WE7 A;  2NCN A;  1P3Q U;  4EZJ A;  4NNJ B;  4FAD A;  2KMA A;  1GC7 A;  2N1V A;  5C23 A;  1C3T A;  1Q5W B;  1GNU A;  4TQ1 A;  3JYU A;  2KK8 A;  4FJV B;  3ZNI D;  2KHW B;  2PPH A;  4HVB A;  1R4N I;  2N1W A;  3KUZ A;  1V5T A;  2IY0 B;  3PHW B;  1E8Y A;  1WGH A;  3H7P B;  1V81 A;  4GDK A;  2L00 B;  4E71 A;  4KZC A;  2MRP A;  2BYF A;  1XT9 B;  3R66 C;  3V6C B;  4W9F A;  2GBJ A;  2HJ8 A;  1GUA B;  4NQK E;  4I6L B;  2M0X A;  3DBR I;  2KNB A;  1JRU A;  2BYV E;  2ZVN A;  3KYD D;  3V60 A;  4W9H A;  4FN2 A;  3VAW A;  2RSU A;  1KJT A;  2NPT B;  1IYF A;  1WGD A;  2ZNV B;  4HDQ A;  3QC8 B;  3S2A A;  2G45 B;  3JVZ X;  3L54 A;  2IZV B;  2KLC A;  4BKG A;  4ZDV A;  4LDT B;  2KC2 A;  2XK5 A;  1V6E A;  2D3G A;  2G4D B;  4M8M A;  2C7M B;  3BY4 B;  3TCA A;  2C7N B;  2KMC A;  3ALB A;  2YLM A;  3KW5 B;  5E6N A;  3RYT A;  4ANX A;  1EF5 A;  2KTF A;  2O6V B;  3APF A;  2J0K A;  3WAM A;  3HK0 A;  1WJU A;  2DZJ A;  2UWQ A;  2JT4 B;  2XEW A;  4MEM A;  3ML9 A;  1SIF A;  3OAW A;  2L0F A;  2NPT A;  2R2O A;  2M17 A;  4XX5 A;  3PPA A;  4ICU A;  4DHJ B;  4HK2 A;  2KTR B;  1CMX B;  3V61 A;  2FCS A;  4J6I A;  1ZW7 A;  2KFJ A;  3ZLZ A;  4EKU A;  4MM3 A;  4JGH B;  2DEN B;  3GOE A;  3OJ4 B;  5IA7 A;  3TL5 A;  3HM3 A;  3ZIM A;  2LZ6 A;  1YJ1 A;  2KJ6 A;  3DVG X;  4DWF A;  4B95 A;  3BIN A;  1P0R A;  1UZX B;  2MA9 B;  2O6V A;  1H4R A;  5AZG A;  4IM0 A;  4A3P A;  4GGQ A;  2RD0 A;  4URK A;  2C9W B;  1VCB A;  2JRI B;  2LVQ A;  4KIK B;  3HM6 X;  5FR6 A;  2PJH A;  1WI0 A;  1LFD A;  2DZK A;  4FHK A;  4YL8 A;  2FCQ A;  1P1A A;  4K7S A;  3L17 A;  2WX1 A;  2V4L A;  3QK0 A;  4X57 B;  3RUL A;  1IPG A;  2AEH A;  4GSW A;  3KUC B;  4TV3 A;  5CHW A;  3B0A A;  2MX2 A;  4LDT D;  1WXM A;  2N7E A;  3VQI A;  3HHM A;  4E74 A;  2DZI A;  1WM2 A;  2RPQ A;  3RD2 A;  4WWO A;  2KQ7 A;  3L0W B;  1WJN A;  3A9J A;  1KM7 A;  2FAZ A;  2O6V D;  2W9N A;  4KZ0 A;  5G2N A;  2KLG A;  5DCN A;  5J2R A;  5E6O A;  2B3A A;  1EO6 A;  2BYE A;  2CS4 A;  2UYZ B;  4KIK A;  4LCD E;  1V86 A;  3VXW A;  2LXA A;  2LVO A;  2VRR B;  3QWZ B;  1FXT B;  3VHT C;  2GOW A;  3M95 A;  1QZE A;  4MGK E;  1WMH B;  1BT0 A;  4DHJ D;  1ISN A;  2C60 A;  1S3S G;  4F7Z A;  3UQA A;  3UQB A;  2KD0 A;  2KDB A;  4B9K A;  1YX6 B;  2JF5 A;  3HIZ A;  4M0W B;  4MH0 E;  4GMV A;  3UF8 A;  5AZF A;  4AJW A;  3CMM B;  3DOW A;  3ZNH B;  4F8C B;  2KC1 A;  2KDE B;  4W9L A;  3B1L X;  1UEL A;  3UIO B;  4DK5 A;  4EUT A;  5KHO A;  3V62 A;  3APC A;  3N32 A;  5TR5 A;  3C0R B;  3W1Y A;  4WJP A;  2K1F A;  2LGD A;  3M62 B;  5J18 A;  2OJR A;  4BFR A;  1NDD A;  2QHO A;  1YQB A;  2ZPY A;  3ZKJ C;  2PE6 B;  2ZVO A;  4NQL B;  1F9J A;  2MBH A;  1Z2M A;  4NPN A;  2IO3 B;  1WMH A;  5AEK B;  1H8C A;  4ANW A;  3IVF A;  1Q0W B;  3IHP C;  4A20 A;  1E5W A;  2DYO A;  2K6D B;  3QJZ A;  4FJZ A;  4IWP A;  4W9K A;  2LAS A;  4MJS A;  2ZCC A;  3SHQ A;  1WGR A;  1WR6 E;  2MP2 B;  2JWZ A;  4WJN A;  4WWN A;  2JUO A;  2KWC A;  3X0W A;  2KAN A;  1MG8 A;  5CX3 A;  4F1S A;  1M94 A;  1YIW A;  3NY5 A;  2D10 A;  4AJY B;  1J8C A;  2FCN A;  3VTV A;  3DBL I;  1UBQ A;  4MDK E;  3DVN U;  3M63 B;  2XBB C;  4NY0 A;  3CSF A;  2J0M A;  5D2M B;  2KJR A;  2KX0 A;  2GMI C;  2KDF B;  4JIO U;  3MTN B;  2ZNV C;  4A3O A;  2CU1 A;  4HXD A;  3Q3J A;  1UH6 A;  3A33 B;  3AXC A;  3PSE B;  4GU2 A;  3K9O B;  4ICV A;  3TJP A;  4I6N B;  2MQJ A;  1V49 A;  4MGI E;  1AAR A;  4TUU A;  2MBB B;  3A9K B;  3AU5 A;  2LUE A;  5GMV A;  3H1U A;  3U30 A;  3X23 A;  3ZO5 B;  3B08 A;  1UBI A;  4FJY A;  3H7P A;  3VH4 B;  3ZDT A;  2NR2 A;  3DVG Y;  2WDT B;  3W1S A;  3N3K B;  1WJ4 A;  3PRZ A;  2KJH B;  1WE6 A;  3EEC A;  1WM3 A;  1L2N A;  3RZW C;  2NS5 A;  4IG7 B;  2FIF A;  1WFY A;  4N9F 4;  3CF6 E;  4JLC A;  1P9D U;  3JW0 X;  2DX5 B;  2IO0 B;  2KFK B;  3O65 B;  4PS3 A;  4W9E A;  3DBS A;  1UGM A;  4AWJ A;  4BBN F;  2L8J A;  3ZDM C;  1E7U A;  3WAL A;  4GDL B;  2BF8 B;  2JZ3 B;  1I35 A;  4IUM B;  1RRB A;  2LD9 A;  4K7U A;  2Z0D B;  1RLF A;  4NAW B;  3H7S A;  5DPS A;  3A9K A;  3DVN V;  1WX8 A;  1V2Y A;  4HPM B;  1WXA A;  1J0G A;  1RFA A;  3L10 B;  2O2V B;  4DBG A;  1T0Y A;  3Q3F A;  4G50 A;  1NI2 A;  3R3M A;  4AP4 C;  4IC7 B;  2KDI A;  2N4F A;  2IO1 B;  4EZK A;  1OEY A;  3KVF B;  2MWS B;  1E8X A;  2WWZ A;  1XQQ A;  1WGY A;  2CKH B;  3PLV A;  1HE8 A;  1SE9 A;  4EZL A;  3GZN I;  1V9J A;  3ZNG C;  2A5U A;  3QAQ A;  2KFK A;  4OVV A;  3NZU A;  4W9J A;  1C1Y B;  2L3Z A;  2IBI B;  1PQS A;  1Z5S B;  2FID A;  2MCN B;  3SDL C;  2KTR A;  3QAR A;  2FCM A;  5D7G A;  2D11 A;  5IAA C;  1RAX A;  4GOC A;  4WJQ A;  4MSM B;  2ZEQ A;  1P98 A;  2KXJ A;  4NAW A;  3P2B A;  1EUV B;  2J7Q B;  5L83 A;  3H6N A;  4HCP B;  2DYM A;  3ML8 A;  3RZF A;  3DDC B;  3PRM B;  2L76 A;  2EMT A;  3QQ8 B;  5JH5 C;  3NOB A;  4ANV A;  1Q1O A;  2NBU A;  5BO4 B;  3TIX A;  1GC6 A;  3ZTC A;  2M8S A;  5JHA A;  2MSE D;  1TZ1 A;  3KH0 A;  3VFK A;  3K9P B;  4WAA A;  3RCZ A;  2OOB B;  4HCN B;  2Y5B B;  2JVC A;  2G3Q B;  4EOY A;  1WIA A;  3VTU A;  2D07 B;  4G0N B;  4XC2 A;  5DPT A;  2KQS A;  4DHZ E;  4II3 B;  1E7V A;  2K8H A;  2KZR A;  1E90 A;  2JZZ A;  4MGY E;  2DHZ A;  1WF9 A;  3ZVV A;  2N9X A;  3DPD A;  3NZS A;  2EKE C;  5CHV C;  2K6Q A;  4HDO A;  3EHV A;  4HPL B;  2I1J A;  3U8Z A;  1WR1 A;  4G3X B;  1WZ3 A;  2NVU I;  2GBM A;  2PE9 A;  1E8W A;  2PEA A;  3H9D A;  4IWO A;  5L95 C;  4PS8 A;  2WX0 A;  2MBQ A;  3R7Q A;  2CR5 A;  2V3S A;  4MEL A;  4BOS C;  2AL6 A;  2IO2 B;  2CHZ A;  4MGZ E;  2ZPN A;  3L13 A;  1YX5 B;  2BKR B;  2FNJ B;  3PZD A;  3QA8 A;  5LXI B;  2AYO B;  1KLV A;  4NJ7 A;  2G4S A;  4EEW A;  3VH3 B;  4WJO A;  3ZRF A;  2KOX A;  2KWV B;  1WH3 A;  4K7W A;  2L0T A;  2MBE A;  4DDI D;  3T9L A;  2DAJ A;  4CHK A;  4KDL B;  3KUD B;  4K1R B;  3UIP B;  3NS8 A;  4AUQ C;  3ECI A;  4FBJ B;  3PRP B;  4RMA A;  3WAP A;  2BWF A;  4K81 A;  5EDS A;  3ZNZ B;  1WX9 A;  3ONS A;  4P7I A;  1X1M A;  4LJP B;  2GBN A;  3DBH I;  3EC8 A;  4ASW C;  4BKS A;  3ENE A;  3LDZ E;  2L7R A;  3VVW B;  2C7H A;  2NBV B;  5JZE B;  4PYZ A;  4KSL C;  2Z0E B;  3PS6 A;  2N7D A;  2Z59 B;  3W1S C;  2WYQ A;  4I6P A;  2LI5 A;  4KV2 A;  5LXH A;  5CHF A;  4WWP A;  4HWI B;  5CTR C;  2XK5 B;  3A4S C;  4DHZ B;  2LRU A;  3DCG A;  3ZW3 A;  1I42 A;  2KWU B;  2LWP A;  2IYD B;  4E3C A;  5DPW A;  2IY1 B;  1WYW B;  2ZZP B;  1SGH A;  2KKC A;  1V5O A;  2LGY A;  3APD A;  4OVU A;  3PV1 A;  3U7D A;  1A5R A;  4GXB A;  4BVU C;  4IWQ A;  4HLE A;  3WAO A;  3V6E B;  2MP2 A;  1J19 A;  5J17 A;  3IFW B;  4GIV A;  4M8N A;  3I3T B;  4ANU A;  3AUL A;  3PTF C;  3NHE B;  3PHX B;  1WJ6 A;  3QCA A;  4BKS D;  2FUH B;  1GJZ A;  4HJK A;  3RT3 B;  3T8M A;  4JL9 A;  2CHW A;  4IW0 A;  2K8C A;  2HTH A;  1NBF C;  4W9C A;  5LLI A;  3UIN B;  4NJ6 A;  2GBR A;  2LJ5 A;  3MJW A;  3OLM D;  3M3J A;  3RUI B;  3SD5 A;  1E8Z A;  3CST A;  1VD2 A;  3VUW A;  1WY8 A;  2BWE S;  5AZH A;  4PYU A;  1ZKH A; 
#chains in the Genus database with same CATH topology
 2PVG C;  4DDG D;  3A75 A;  5KHQ A;  1E0Z A;  2BKF A;  1HK1 A;  4N3Z A;  3U2S C;  4I9O A;  5E6P A;  3GE3 C;  1JWU D;  4E99 A;  3FWB C;  3A1Q B;  5G55 A;  1N63 A;  3TSS A;  2MBO A;  1ZUD 2;  5D94 A;  4S1Y A;  1SSN A;  3AE1 B;  3EFC A;  1HK2 A;  3AI5 A;  1OGW A;  3DBH B;  4PS7 A;  3QHT A;  4GDL A;  4EMX A;  2JRH A;  3A9J B;  1TTN A;  3PRE A;  2BXG A;  5MPO A;  1HTQ A;  1L0X B;  2SEB D;  4N59 A;  4YT0 B;  5IJ5 A;  2JPH A;  1U4A A;  2OJW A;  4IM2 A;  1N61 A;  3SFE B;  2KX3 A;  2HD5 B;  1C4A A;  3BVZ A;  2DZM A;  4ZRI A;  1S1Q B;  5C1Z A;  4CYE A;  4C7Z A;  1EWY C;  2OT3 A;  1GG3 A;  2BBC A;  3SU8 X;  1ZGU B;  2WXM A;  4CO7 A;  4LK0 M;  1L7Y A;  1WXV A;  2KVR A;  1JW9 D;  2ZCB A;  3D32 A;  4W9I A;  3QIJ A;  2MJE A;  3VR9 B;  1K51 A;  1V1P B;  4LNN A;  1TS3 A;  4XE0 A;  1NVI D;  4USA A;  2LHE A;  4JWS C;  4O1N A;  1AW7 A;  5EE3 A;  4OT2 A;  1AO6 A;  4A8X C;  1JWA D;  2AL3 A;  4BOZ B;  2WNM A;  1XD3 B;  4ARC A;  4NNJ B;  3IAS 1;  2KMA A;  2N1V A;  1C3T A;  1GNU A;  3ZNI D;  4FJV B;  2KK8 A;  4YSX B;  2N1W A;  2KWF A;  1QKZ A;  4E71 A;  1L6U A;  4KZC A;  4F5U A;  3R66 C;  4W9F A;  4RCO A;  2FUG 1;  2HJ8 A;  4S17 A;  3DBR I;  2KNB A;  2ZVN A;  4GLS C;  4W9H A;  1IYF A;  2NPT B;  2WXL A;  2K5P A;  2ZNV B;  3L54 A;  2W55 A;  3SR6 A;  1N6Z A;  2Y5P A;  2QM6 A;  2E0X A;  2C7N B;  3ALB A;  3KW5 B;  3Q8F A;  3RYT A;  1FOU A;  2MHJ A;  1ENF A;  5IP4 D;  1C77 A;  4MEM A;  3Q3O C;  1MIV A;  2R2O A;  2K0P A;  3FIL B;  4HGM B;  4HJG E;  1MHX A;  4HK2 A;  1CMX B;  1DOY A;  4MH8 A;  4C00 A;  1ZW7 A;  4EKU A;  5IO9 A;  2K0N A;  4JGH B;  1KF6 B;  2V3P A;  4ZHP A;  5IA7 A;  3M99 C;  2LZ6 A;  2R61 A;  4M02 A;  4ACF A;  1J78 A;  3AEE B;  3H37 A;  2Y3A A;  1P0R A;  4GGQ A;  3BII D;  4LNO A;  1R4N B;  1IGD A;  1WI0 A;  1LFD A;  2DZK A;  5AUK A;  1P1A A;  2V4L A;  3NVK A;  1C9F A;  1UOR A;  3HHM A;  3VQI A;  2IGH A;  4E74 A;  1WM2 A;  2BVC A;  2RPQ A;  3TDL A;  4WA6 B;  3A9J A;  2O6V D;  2W9N A;  4KZ0 A;  2MJD A;  5DCN A;  5E6O A;  1P7E A;  1XEE A;  3GQX A;  2B3A A;  4KIK A;  2E0Y A;  1KXP D;  3W5U B;  2LVO A;  4HKZ E;  2EEL A;  3CWI A;  2GOW A;  1QZE A;  3W5V B;  3AB5 A;  4JE3 B;  2KDB A;  4B9K A;  2JXT A;  4YSZ B;  3AED B;  3HIZ A;  1T3Q A;  1AWD A;  5AZF A;  1ROE A;  3DOW A;  1SB0 A;  2KDE B;  3V62 A;  3APC A;  3N32 A;  5TR5 A;  4WJP A;  2K1F A;  4BFR A;  2EKI A;  1YQB A;  1JQ4 A;  4JWU C;  3MHZ A;  2MBH A;  4NPN A;  1H8C A;  1E5W A;  4FJZ A;  1CJE A;  2BXQ A;  1WR6 E;  3BVM A;  1KRH A;  3RNE C;  4XGA B;  2KAN A;  1MG8 A;  1NYR A;  3ZYY X;  1C4C A;  3ABV B;  3BWU D;  1YOV B;  3VTV A;  1XO3 A;  4MDK E;  1ZDV A;  4NY0 A;  2CU3 A;  4MT5 A;  2VDB A;  2KDF B;  3MTN B;  1EU3 A;  4HXD A;  5DQF A;  1BUI C;  2VH2 A;  2MQJ A;  1V49 A;  2MBB B;  3AU5 A;  5D3I B;  2LUE A;  4US8 A;  4K71 A;  2NR2 A;  1XF5 L;  3DVG Y;  1T0S C;  4FIP B;  4K3C A;  2INN E;  1WE6 A;  1MI0 A;  3V03 A;  2GB1 A;  3RZW C;  3GP7 A;  1FCC C;  2NS5 A;  4N58 A;  4P16 A;  3T3O A;  2ACZ B;  2PKO A;  1TY0 A;  1YQ4 B;  2KDM A;  1N60 A;  1VDV A;  1E7U A;  2BYT A;  1I35 A;  2RDH A;  1IBX B;  4LB9 A;  1RLF A;  3KQ4 A;  3SEB A;  3DVN V;  1WX8 A;  1WXA A;  4K2C A;  1J0G A;  4F5V A;  2ICI A;  1MA9 A;  4G50 A;  3Q3F A;  2L83 A;  1GNJ A;  4AP4 C;  2KDI A;  2IO1 B;  5I4D A;  2N9K A;  2WWZ A;  2E6X A;  2B76 B;  3ZNG C;  2L32 A;  2BXN A;  4W9J A;  5IAA C;  2JU6 X;  1QT9 A;  1NYQ A;  1RWS A;  1UUP A;  2ZEQ A;  3DBL B;  4NAW A;  3P2B A;  2J7Q B;  2PTL A;  2DYM A;  3DDC B;  4ANV A;  3TIX A;  3ZTC A;  1GC6 A;  1M4V A;  2GUT A;  1TZ1 A;  1I4R A;  3B2F A;  4HCN B;  1I4H A;  2XNA C;  2D07 B;  2KQS A;  1E7V A;  5EE1 A;  1OQR A;  4RGM A;  2WXP A;  4RFB A;  4KKJ A;  1FCL A;  3AEB B;  4HPL B;  2I1J A;  1WR1 A;  4G3X B;  3NVM A;  2NVU I;  2MEK A;  2PEA A;  4IWO A;  2BXE A;  3FAH A;  4PS8 A;  2MBQ A;  3OG5 A;  3R7Q A;  2BXH A;  3WCQ A;  2RPV A;  2IO2 B;  3TUO A;  3ZGZ A;  2I2Z A;  2XVQ A;  3L13 A;  3VRB B;  1MJD A;  2FNJ B;  5LXI B;  2AYO B;  4EEW A;  3VH3 B;  3V3X A;  2KOX A;  1E7F A;  2KWV B;  1VZ8 A;  1I4G A;  4CHK A;  1N5W A;  2KYW A;  1MFW A;  2WLB A;  3GZN B;  4AUQ C;  1NT2 B;  1WX9 A;  3ONS A;  2GBN A;  1QF6 A;  1WXQ A;  2L7R A;  2TSS A;  3NMU A;  2Z59 B;  2INP E;  5LXH A;  4OTT A;  3DHG C;  2XK5 B;  3DCG A;  1SE2 A;  5DPW A;  2WXQ A;  2IY1 B;  2KKC A;  2LGY A;  4HLE A;  1J19 A;  5ID9 A;  4BKE A;  4M8N A;  4OTU A;  4ANU A;  3MJ5 A;  3NHE B;  3PHX B;  3WHQ A;  4L23 A;  3T8M A;  2CHW A;  4RH6 A;  4IKG A;  1C78 A;  2HTH A;  4W9C A;  5LLI A;  4NJ6 A;  1YN4 A;  2LJ5 A;  3MJW A;  3RUI B;  3M3J A;  3SD5 A;  3CST A;  1VD2 A;  4LNI A;  3VUW A;  4MM3 B;  5AZH A;  3ZNZ B;  3LYY A;  3LJ3 A;  3NG0 A;  2REX A;  2A4Z A;  2QCZ A;  1SJH D;  3B2G A;  4RM8 A;  4LNK A;  1V80 A;  3A4R A;  2BXM A;  3CX9 A;  1LXD A;  3PLU A;  1FXA A;  2BXP A;  4FHJ A;  2KBZ A;  3QX1 A;  2N7J A;  2BS2 B;  3VR8 B;  2L05 A;  1FO4 A;  4AOF A;  2BXD A;  2LOQ A;  1EF1 A;  2V1Y A;  3V09 A;  2J53 A;  1OEY J;  1DOX A;  5HOZ A;  1BKE A;  1SJE D;  4LB2 A;  4TQ0 A;  1UD7 A;  1KTK A;  1XLQ A;  5IOI A;  1R4M I;  1F1H A;  4XZ4 A;  4KKI A;  2AWT A;  4P1B C;  2BGF A;  1TKE A;  1K8R B;  2C5L C;  3LU7 A;  3JSV A;  3ZUN A;  4DXA B;  2HDE A;  4JX1 C;  4RNA A;  1TBE A;  5D6J B;  3UI3 A;  3RN9 C;  3U52 E;  1MUH A;  3IG3 A;  3OJ3 A;  2N9E B;  2Z8I A;  3ZJU A;  4FUL A;  3C19 A;  1YJJ A;  2K25 A;  2YVC A;  4KGT A;  4D7X A;  4JQW C;  1PFD A;  3KWL A;  4W9G A;  2KAJ A;  2BXF A;  1RFK A;  5IKC M;  2RR9 A;  1IUE A;  4ZRJ A;  2GBK A;  2QMT A;  5EE0 A;  1MG4 A;  3EA6 A;  3AH7 A;  2Z8L A;  3TMP B;  4TKN A;  1VLB A;  1OQY A;  2RGF A;  3DQV A;  2LVP A;  2Q5W D;  2LRW A;  4FAD A;  5C23 A;  5H92 C;  1Q5W B;  1NEN B;  1ZXI A;  3PHW B;  2EFE A;  1V81 A;  2L00 B;  1J7A A;  3V6C B;  4NQK E;  2JUH A;  2M0X A;  4LLG M;  2BYV E;  3BK1 A;  3V60 A;  3LU6 A;  1FNW A;  4XDD A;  4HDQ A;  4ARI A;  1V8C A;  2IZV B;  4D2K A;  1ZOY B;  3Q8E A;  4BKG A;  4LDT B;  2KC2 A;  2XK5 A;  2D3G A;  4IW1 A;  2C7M B;  1HZ5 A;  4ZYS A;  4YTP B;  2BTE A;  2J0K A;  3B9M A;  1I4Q A;  2UWQ A;  5C2T B;  2JT4 B;  3ML9 A;  2WXF A;  1SIF A;  2M17 A;  2L52 A;  1K50 A;  2JYE A;  1NEK B;  1E7E A;  2FCS A;  2CJN A;  4J6I A;  4MM3 A;  2DEN B;  4J3O D;  3OJ4 B;  2QIE B;  2QJL A;  2HJ1 A;  1DYQ A;  1TYG B;  3DVG X;  3BIN A;  2MA9 B;  1PGX A;  1VCB A;  4Z69 A;  4P1C C;  4KIK B;  3ZXV A;  2JYT A;  2PJH A;  3RMK C;  4FHK A;  2NQO A;  4ZCG A;  2WX1 A;  4X57 B;  1FEH A;  1YMH E;  4GSW A;  1DOI A;  3KIK A;  3BYT B;  1QIL A;  3ICX A;  5BYS A;  1VJK A;  3I9V 1;  1GNI A;  3RD2 A;  2KQ7 A;  1TKY A;  3L0W B;  1PUT A;  3LB8 C;  2VZK B;  4F5S A;  1AYF A;  2FBW B;  3V05 A;  2KLG A;  3JRY A;  1JRP A;  4ZBQ A;  2UYZ B;  4LCD E;  4Z9O A;  1DGJ A;  3VXW A;  3TEW A;  2VRR B;  1FXT B;  4G01 A;  2GI9 A;  3TEZ A;  4MGK E;  1BT0 A;  1L5P A;  2C60 A;  1LNS A;  2DG5 A;  4K3B A;  4F7Z A;  4QAY A;  2KD0 A;  2GLS A;  2OHF A;  3NJT A;  2BXK A;  4MH0 E;  3UF8 A;  4KGS A;  2DBW A;  4W9L A;  1T0R C;  4DK5 A;  1UWM A;  2V4I B;  3M62 B;  5J18 A;  2BB5 A;  3ZKJ C;  2PE6 B;  4G04 A;  2ZVO A;  3RI7 C;  1TF0 A;  1Z2M A;  4Q2J A;  1FNU A;  3NS1 A;  4ANW A;  1Q0W B;  1D6E C;  2K6D B;  4W9K A;  2LAS A;  1QOF A;  3SHQ A;  1WGR A;  2MP2 B;  2JWZ A;  4M0W A;  4WJN A;  3P1M A;  1M94 A;  2LHD A;  5JXV A;  1K53 A;  4AJY B;  2FCN A;  4OZC A;  2XN9 C;  1KFY B;  3M63 B;  3CSF A;  5D2M B;  5BYQ A;  1TY2 A;  3RFZ B;  3Q2A C;  4JIO U;  4A3O A;  2CU1 A;  1UH6 A;  3A33 B;  3PSE B;  1E9M A;  4GU2 A;  3TJP A;  2XW0 A;  4UDU C;  3DHH C;  3U7Z A;  3VH4 B;  3O13 A;  1TKG A;  2N0S B;  5GIO A;  1WJ4 A;  1IJG A;  4B0M A;  3EEC A;  1P7F A;  4R3D A;  4C4V B;  1WFY A;  4LNF A;  2WXH A;  1B9R A;  3CF6 E;  4JLC A;  1HK4 A;  3JW0 X;  2KAC A;  3DBS A;  2L8J A;  1T6B X;  3FNM A;  1B1Z A;  3AEG B;  3V08 A;  2WS3 B;  1YQ3 B;  1JWB D;  1KW2 A;  4NAW B;  3H7S A;  4C80 A;  4HPM B;  1V2Y A;  2K3U A;  2KQ4 X;  3HVZ A;  3L10 B;  2O2V B;  4DBG A;  1VZ7 A;  1T0Y A;  1NI2 A;  2N4F A;  1OEY A;  3WHR A;  1I4P A;  1HE8 A;  4FJC B;  2A5U A;  1FPY A;  1FXI A;  1AN8 A;  4OVV A;  4HPP A;  3RNC C;  2IBI B;  1PQS A;  3N20 C;  2DBX A;  1F2R I;  4OVZ A;  2FCM A;  3L4P A;  1FIQ A;  3N1Z C;  2AX5 A;  3U4E G;  1RAX A;  4GOC A;  4WJQ A;  2M0A A;  2QDF A;  3H6N A;  1FMA D;  1KDX A;  4ZRP A;  3ML8 A;  3PRM B;  2L76 A;  2EMT A;  3QQ8 B;  2WDR B;  5JH5 C;  3NOB A;  1Q1O A;  5BO4 B;  1FRD A;  2M8S A;  3KH0 A;  3VFK A;  3RCZ A;  2G3Q B;  1E7G A;  2IJ0 A;  4RGT A;  4II3 B;  2K8H A;  2JZZ A;  4NAM A;  2SAK A;  2DHZ A;  2RDB C;  1WF9 A;  4CQN A;  3ZVV A;  1HA5 A;  1VZS A;  5CHV C;  3AE9 B;  2GBM A;  2PE9 A;  1E8W A;  4IW2 A;  1E7P B;  1MIY A;  1L4D B;  2WDQ B;  2ZW1 A;  2E3T A;  2CHZ A;  1E7I A;  2ZPN A;  2LQH A;  1KLV A;  1LOT A;  2G4S A;  4WJO A;  3ZRF A;  2KVZ A;  1SEB D;  2MBE A;  2QHB A;  4L1B A;  3T9L A;  3KUD B;  3NS8 A;  4HGK A;  4FBJ B;  1SIJ A;  1ZPS A;  3PRP B;  4YTN B;  3WAP A;  1WRI A;  2IGD A;  1CZP A;  2BX8 A;  4JK4 A;  1YN3 A;  4WIP A;  1X1M A;  4LJP B;  2DLB A;  4ASW C;  3VVW B;  2C7H A;  3FKY A;  2Z0E B;  1J7B A;  3BK2 A;  2N7D A;  3W1S C;  3AM9 A;  2D5G A;  2WYQ A;  4OHJ A;  5GHK A;  5CHF A;  4WWP A;  1Q10 A;  3A4S C;  2LGS A;  3DHI C;  1I42 A;  4E3C A;  2ZZP B;  1WYW B;  4OVU A;  3APD A;  3PV1 A;  4GXB A;  4BVU C;  3WAO A;  5GIP A;  2CKX A;  2MP2 A;  4GIV A;  3PTF C;  3QCA A;  1WJ6 A;  4BKS D;  2ROH A;  3NVW A;  1GJZ A;  4HJK A;  1UGJ A;  2D3B A;  2K8C A;  3UIV A;  2GBR A;  4MAC A;  4WH4 A;  1E8Z A;  4PYU A;  1HK3 A;  5IIX A;  3VUX A;  3ZTD A;  1VFI A;  4IM3 A;  1LM8 B;  1JAL A;  3HVD A;  1T5X D;  3E9S A;  3EFU A;  3AEC B;  1KOT A;  2LXC A;  2EFH A;  3MHS B;  4JPS A;  4KDI C;  4C4V A;  2M1M A;  4MSQ B;  3JSV B;  1FNV A;  2H89 B;  4ZYN A;  1TS2 A;  2L1A A;  2WU5 B;  3MFG A;  2BQQ A;  1N5X A;  4ZRK A;  4PO0 A;  4BBN C;  2CJO A;  2KWD A;  4BKT A;  3P4S B;  4FLH A;  3URY A;  2O2V A;  1ET6 A;  3J9C A;  1IP9 A;  5HKH A;  2I1K A;  3L16 A;  5FR3 A;  1JWM D;  2MW5 A;  2IPK D;  2WXK A;  3AMZ A;  2HE7 A;  3HRD D;  1QQR A;  3VUY A;  1EM7 A;  4FXC A;  3RNA C;  2KT7 A;  3IXS A;  1D3Z A;  2K9X A;  2XVV A;  3SIU B;  2X8X X;  4REZ A;  1LQB A;  4DQO C;  1D5M C;  4RM9 A;  4DHX B;  5E6J A;  1D4B A;  4MJS B;  2M4N A;  2AQ2 B;  3L08 A;  3R7R A;  4RGN A;  4EFO A;  3AE6 B;  2ZJD A;  3KJL A;  2M56 B;  1EWC A;  1OQQ A;  2K8B A;  3A73 A;  2LQI A;  3TBL D;  2KO3 A;  3KYC D;  3WIM A;  1ZP0 B;  2KN5 A;  2CHX A;  2EFC A;  4DXG A;  1WE7 A;  2JSV X;  5BMH A;  1P3Q U;  4OW0 A;  4TQ1 A;  2KHW B;  2PPH A;  4HVB A;  1R4M B;  1N62 A;  1V5T A;  4B0E A;  1C79 A;  1E8Y A;  1WGH A;  4GDK A;  2BYF A;  2GBJ A;  1C76 A;  1PDX A;  4I6L B;  1JRU A;  2INC C;  1KLG D;  4FN2 A;  3VAW A;  2RSU A;  1KJT A;  5IFO A;  1WGD A;  5C3J B;  3NVY A;  3JVZ X;  3SFD B;  2KLC A;  1HA2 A;  3ZJV A;  2BXO A;  2DNF A;  5D3D A;  1O9X A;  1GOZ A;  1V6E A;  4M00 A;  3TCA A;  2YLM A;  5E6N A;  4ANX A;  2KTF A;  2BXB A;  3WAM A;  1WJU A;  2XEW A;  4ZBR A;  2LXS A;  3OAW A;  2V9H A;  4XX5 A;  4ICU A;  1HZ6 A;  4DHJ B;  2M19 A;  1FFU A;  3V61 A;  2LGI A;  2UU7 A;  1ZKH A;  3GS2 A;  1R7S A;  1MUS A;  3NVI A;  2ON8 A;  3GOE A;  2V3N A;  3Q69 A;  4ZC6 A;  1YJ1 A;  4KGR A;  4B95 A;  4NZL B;  1UZX B;  2O6V A;  4WQM A;  1H4R A;  4L2Y A;  5AZG A;  2WXI A;  4IM0 A;  4A3P A;  2RD0 A;  4URK A;  2JRI B;  1TT5 B;  3HM6 X;  4DXF A;  4K7S A;  4ITK A;  5EE9 A;  2ZW0 A;  3TEY A;  3QK0 A;  3KUC B;  1UNS A;  5CHW A;  3B0A A;  2MX2 A;  4LDT D;  1QLB B;  2N7E A;  2JWU A;  4OR0 A;  2DZI A;  4A55 A;  5BMI A;  1WWT A;  1WJN A;  3AV8 A;  2FAZ A;  3BPJ A;  1F77 A;  2JX5 A;  1EO6 A;  2CS4 A;  3CIR B;  1V86 A;  2LXA A;  1E7C A;  3QWZ B;  3PZ8 A;  1HTO A;  3VHT C;  3MHH B;  4EE2 A;  3AE2 B;  1ISN A;  2NTT A;  2XMO A;  3UQA A;  2PVO D;  3NZ3 A;  3R8B A;  3AE4 B;  1T0Q C;  5GIN A;  1JNB A;  4C7Y A;  1YX6 B;  2JF5 A;  4M0W B;  3R2I A;  4C31 B;  4GMV A;  2D3A A;  4AJW A;  4BZA A;  3CMM B;  3ZNH B;  4F8C B;  2PLP A;  2KC1 A;  3B1L X;  3UIO B;  1CK1 A;  4EUT A;  4WUR A;  3W1Y A;  2LGD A;  2OJR A;  2QHO A;  2VUF A;  2ZPY A;  1BML C;  4GG2 A;  5HHD G;  1Y56 A;  1F9J A;  1F2R C;  1WMH A;  3IVF A;  2DYO A;  3QJZ A;  3H3A A;  4MJS A;  2ZCC A;  2AGH B;  1IGC A;  2OZB B;  3AEF B;  4WWN A;  3W9C B;  2VZK D;  2KWC A;  1XCT L;  4F1S A;  1J8C A;  2XBB C;  4ZRQ A;  2GMI C;  3P63 A;  2ZNV C;  2EFD A;  4L9K A;  3H8H A;  3Q3J A;  1FM0 D;  1V97 A;  1GPX A;  4B6W A;  4TUU A;  1AAR A;  3X23 A;  3B08 A;  1UBI A;  4FJY A;  3ZQ4 A;  3VRA B;  2H88 B;  2WDT B;  3W1S A;  2WQY B;  2KJH B;  2BT6 A;  1VR9 A;  5B5T A;  4IG7 B;  2DX5 B;  3EGR A;  5TSS A;  4F5T A;  4BBN F;  2XVU A;  3ZDM C;  3WAL A;  2BF8 B;  2JZ3 B;  1RRB A;  2LD9 A;  2Z0D B;  5DPS A;  3A9K A;  3MC9 A;  3G9K D;  1BJ5 A;  1XCQ L;  1GB1 A;  1L4Z B;  2BS3 B;  4EZK A;  3ETR A;  2MWS B;  1E8X A;  2I2Y A;  1XQQ A;  1TS4 A;  1WGY A;  4EZL A;  1SE9 A;  1ESF A;  4RF1 A;  3QAQ A;  2KFK A;  1C1Y B;  3RPF C;  2MCN B;  3DBR B;  5D7G A;  3Q8A A;  1KH0 A;  2D11 A;  4AQ7 A;  4XDC A;  1HK5 A;  3PZ7 A;  3Q14 C;  4HCP B;  2WXN A;  5JHA A;  1SE4 A;  2Y5B B;  1WIA A;  3VTU A;  4C56 C;  2X38 A;  5DPT A;  4J2V A;  1SB3 C;  2HTM E;  1WGK A;  4ZHO A;  1YNT E;  4MGY E;  2YDF A;  3DPD A;  3NZS A;  3B9L A;  4PT5 A;  2KMM A;  2QEJ C;  4HDO A;  3EHV A;  3KLS X;  4W4U B;  2D3C A;  1WZ3 A;  2NMQ A;  3H9D A;  3FWC C;  2WX0 A;  3R2T A;  3PLA A;  1MVK A;  2AL6 A;  2W3R A;  1YX5 B;  2BKR B;  3PZD A;  1QOG A;  2IDY A;  4NJ7 A;  2DWQ A;  3P4P B;  4YWG G;  3SQJ A;  1XLN A;  2L0T A;  4AS1 A;  2JQR B;  4RMA A;  4K81 A;  5EDS A;  5LNK 1;  4KX6 B;  2AQ3 B;  4LA0 A;  3DBH I;  3EC8 A;  3ENE A;  5JZE B;  2IGG A;  4KSL C;  3PS6 A;  1SBB B;  4KV2 A;  2LI5 A;  2G1E A;  1SE3 A;  3MC8 A;  4DHZ B;  4A9A A;  2LRU A;  2Z8K A;  2N9L A;  2KWU B;  2LWP A;  1FRR A;  1SGH A;  1TJE A;  3SIV B;  1N5U A;  1A5R A;  3NVV A;  4IWQ A;  4M70 B;  3V6E B;  1J7E A;  3N1Y C;  5T8I A;  1TIF A;  2FUH B;  3RT3 B;  4JL9 A;  1JRO A;  4ZBK A;  3NUH B;  2PMV A;  3Q8C A;  5H8Y E;  3AE7 B;  1K52 A;  3OLM D;  4LTU A;  1I4X A;  2BWE S;  4XYC A;  3I57 A;  1WX7 A;  2BB6 A;  1OTR B;  4KVG B;  2J52 A;  2N9P C;  3GQU A;  5DBY A;  1V1O A;  1WXS A;  2LGX A;  2LEK A;  4KSK C;  5DPR A;  3IT6 B;  2R2Q A;  2EMS A;  3ZRC A;  2MLB A;  4WQO B;  2FE8 A;  1WRD B;  3BZD B;  1ACC A;  2W82 A;  5HFY A;  3AU4 A;  3WA0 A;  4N0F D;  3RNG C;  2BXA A;  2QIL A;  4WWM A;  4N0U D;  4ZOH C;  2WXG A;  2DYB A;  4GN1 A;  4BY9 C;  1CQV A;  1YD8 U;  1ZDX A;  2LJI A;  3IBE A;  2GRI A;  4GB9 A;  2BPS A;  2JXX A;  3A1Q A;  3VTW A;  3N30 A;  3MP9 A;  4N6E B;  5IIU A;  1C4P A;  2DAF A;  3P42 A;  1H9Z A;  1TGZ B;  1WGG A;  1WZ0 A;  2J42 A;  4L8U A;  2J0J A;  3VDZ A;  1D5X C;  3PO0 A;  2NBW B;  3PT2 B;  4LJO B;  4OZA A;  1Y8R C;  3UGB B;  3WHS A;  4HKQ A;  3LU8 A;  1WSP A;  3P4R B;  2W3S A;  3MHS D;  2D2Q A;  4G11 A;  3TEX A;  1LO5 D;  2K39 A;  3Q3M C;  4XWW A;  4MBE C;  3RNF C;  4FA6 A;  1RM6 C;  5IJF A;  3PVL A;  3HUI A;  1G6J A;  4W9D A;  3PGE A;  4GDK B;  4GDX A;  4II2 B;  2BXL A;  2AQ1 B;  3FC4 A;  4IOI E;  2JY6 A;  1PGB A;  5JHB A;  3WAN A;  2ASQ A;  2XSI A;  1WYG A;  2NCN A;  2WHI A;  3IAM 1;  3LXF A;  5HG2 A;  4EZJ A;  4L9Q A;  5ID7 A;  1GC7 A;  3JYU A;  4YSY B;  1A70 A;  1EU4 A;  2WXR A;  1BM0 A;  1R4N I;  3KUZ A;  1V1P A;  3ECP A;  2IY0 B;  2WP9 B;  3NRZ A;  3H7P B;  2MRP A;  2I38 A;  1XT9 B;  3DWM A;  1GUA B;  1ET9 A;  1QOB A;  3P4Q B;  2K22 A;  3KYD D;  2BXC A;  3Q6B A;  3QC8 B;  3S2A A;  4YXD B;  2G45 B;  1XLP A;  1YN5 A;  4ZDV A;  4HRO A;  2G4D B;  4M8M A;  3BY4 B;  2V36 A;  2KMC A;  1EF5 A;  2O6V B;  3APF A;  3DWG C;  5G5H A;  3HK0 A;  2DZJ A;  4US9 A;  1YJI A;  2L0F A;  5BPK A;  2NPT A;  2ONQ A;  3PPA A;  2QMC A;  2KTR B;  4BAX A;  3ZXR A;  4WAF A;  2KFJ A;  3ZLZ A;  4H2A A;  2W54 A;  2JZP A;  3TL5 A;  3HM3 A;  3ZIM A;  2KJ6 A;  2LUM A;  4DWF A;  2PW9 A;  3EUB 2;  2C9W B;  2PIA A;  2LVQ A;  5FR6 A;  4DM0 A;  4YL8 A;  2FCQ A;  3L17 A;  3FIL A;  1KLU D;  3ZJT A;  3RUL A;  2G9H D;  1IPG A;  2OED A;  2AEH A;  4TV3 A;  1UF0 A;  1WXM A;  3Q3N C;  4WWO A;  5FK9 C;  4PK1 A;  1KM7 A;  1MHH E;  5G2N A;  5BYR A;  2BXI A;  5J2R A;  1MIW A;  1LGR A;  1SXT A;  5FKA C;  1BXT A;  2BYE A;  4NJC A;  4ZUX V;  3M95 A;  4DHJ D;  1I7H A;  1WMH B;  2Y5C A;  1S3S G;  3UQB A;  2NNW A;  3AE3 B;  4G03 A;  2VH1 A;  2WGS A;  3RNB C;  1TXU A;  1L0Y B;  2VUE A;  1MPE A;  3AE5 B;  1UEL A;  1VRA B;  5KHO A;  1D5Z C;  3C0R B;  5GXG B;  4OZB A;  1NDD A;  1XXG A;  3IT4 B;  4NQL B;  2QC8 A;  2DBY A;  5AEK B;  2IO3 B;  4HRS A;  3IHP C;  5G5G A;  4A20 A;  4IWP A;  1HQR D;  1E7B A;  2JUO A;  1E7H A;  3X0W A;  5CX3 A;  4LUH A;  1F52 A;  3N9Y C;  1YIW A;  3BYY B;  3NY5 A;  2D10 A;  3DBL I;  1UBQ A;  4YTM B;  3I5J C;  4P6V F;  2J4X A;  2WDV B;  3DVN U;  3AEA B;  2BS4 B;  3GE8 C;  1PYW D;  2J0M A;  2KJR A;  2KX0 A;  1TS5 A;  2RDG A;  4RGO S;  4FK5 B;  3AXC A;  3K9O B;  4ICV A;  4I6N B;  1J7C A;  4MGI E;  3AE8 B;  1E10 A;  3A9K B;  5GMV A;  3U30 A;  3H1U A;  3ZO5 B;  5AUI A;  3B9J A;  3ZDT A;  3H7P A;  5IJE A;  3N3K B;  3C8Y A;  1QOA A;  3PRZ A;  4RF0 A;  1L2N A;  1UWX A;  1WM3 A;  2FIF A;  2IND C;  4TMA B;  4N9F 4;  1P9D U;  2IO0 B;  2KFK B;  3O65 B;  4PS3 A;  4W9E A;  2Z8J A;  1UGM A;  4AWJ A;  1E6E B;  4GDL B;  4IUM B;  1FD6 A;  4K7U A;  1ZE3 D;  2WXJ A;  4HEA 1;  2YEP B;  2LMC A;  3E56 A;  1OFF A;  1FFV A;  1RFA A;  1SF0 A;  3R3M A;  4IC7 B;  3KVF B;  3W2D A;  3I63 C;  2CKH B;  3PLV A;  3GZN I;  1V9J A;  2MJ3 A;  5FUO A;  5BMG A;  2V0G A;  3NZU A;  2L3Z A;  4A90 A;  2XW1 A;  1Z5S B;  2FID A;  3SDL C;  2KTR A;  3QAR A;  1IBX A;  2DBU A;  4MSM B;  1F0Z A;  1P98 A;  2KXJ A;  1EUV B;  5L83 A;  3GA9 L;  2QSD A;  3RZF A;  1E7A A;  2NBU A;  3Q8B A;  4LUF A;  3KWV A;  2MSE D;  3K9P B;  4WAA A;  2OOB B;  2JVC A;  4EOY A;  4G0N B;  4XC2 A;  4DHZ E;  1E90 A;  2KZR A;  3OWE B;  1HXY D;  2N9X A;  2RMM A;  2EKE C;  2K6Q A;  1MM8 A;  4S0R A;  1STE A;  4M01 A;  3U8Z A;  3T3N A;  1VZ6 A;  1JCK B;  4A6Q A;  5L95 C;  1L0V B;  2CR5 A;  2V3S A;  4MEL A;  4BOS C;  4MGZ E;  2MH7 A;  3QA8 A;  1TZO A;  1WH3 A;  1H5W A;  3BVG A;  4K7W A;  4DDI D;  3N1X C;  2LFI A;  5IN7 A;  2DAJ A;  4KDL B;  4K1R B;  3UIP B;  3ECI A;  4TSS A;  2XVW A;  2AJE A;  1GAQ B;  2BWF A;  3JQZ A;  3GB1 A;  4P7I A;  3NVZ A;  4BKS A;  2WXO A;  3LDZ E;  5HI1 A;  2NBV B;  4PYZ A;  4IDI A;  1PGA A;  2I30 A;  2BW2 A;  2LXT A;  4I6P A;  1RYJ A;  4HWI B;  5CTR C;  1GB4 A;  1E78 A;  3ZW3 A;  2IYD B;  1JWS D;  4XWT A;  1V5O A;  3U7D A;  5IIH A;  2YEP F;  2WU2 B;  1XLO A;  1HEZ E;  1NI3 A;  3IFW B;  5J17 A;  3I3T B;  3AUL A;  2NTS A;  3MC0 B;  1ZXH A;  4IW0 A;  1NBF C;  1L6V A;  3UIN B;  1JML A;  1WY8 A;  2KN4 A;  3AN1 A; 
#chains in the Genus database with same CATH homology
 2PVG C;  4DDG D;  3A75 A;  5KHQ A;  1E0Z A;  2BKF A;  1HK1 A;  4N3Z A;  3U2S C;  5E6P A;  1JWU D;  4E99 A;  3FWB C;  3A1Q B;  5G55 A;  1N63 A;  3TSS A;  2MBO A;  1ZUD 2;  5D94 A;  4S1Y A;  1SSN A;  3AE1 B;  1HK2 A;  3AI5 A;  1OGW A;  4PS7 A;  3QHT A;  4GDL A;  4EMX A;  2JRH A;  3A9J B;  1TTN A;  3PRE A;  2BXG A;  5MPO A;  1L0X B;  2SEB D;  4N59 A;  4YT0 B;  5IJ5 A;  2JPH A;  1U4A A;  4IM2 A;  1N61 A;  3SFE B;  2KX3 A;  2HD5 B;  1C4A A;  3BVZ A;  2DZM A;  4ZRI A;  1S1Q B;  5C1Z A;  4CYE A;  4C7Z A;  1EWY C;  2OT3 A;  1GG3 A;  3SU8 X;  2BBC A;  1ZGU B;  4CO7 A;  2WXM A;  4LK0 M;  1L7Y A;  1WXV A;  2KVR A;  1JW9 D;  2ZCB A;  3D32 A;  4W9I A;  3QIJ A;  2MJE A;  3VR9 B;  1K51 A;  1V1P B;  1TS3 A;  4XE0 A;  1NVI D;  4USA A;  2LHE A;  4JWS C;  4O1N A;  1AW7 A;  5EE3 A;  4OT2 A;  1AO6 A;  4A8X C;  1JWA D;  2AL3 A;  4BOZ B;  2WNM A;  1XD3 B;  4ARC A;  4NNJ B;  3IAS 1;  2KMA A;  2N1V A;  1C3T A;  1GNU A;  3ZNI D;  4FJV B;  2KK8 A;  4YSX B;  2N1W A;  1QKZ A;  4E71 A;  1L6U A;  4KZC A;  4F5U A;  3R66 C;  4W9F A;  4RCO A;  2HJ8 A;  2FUG 1;  3DBR I;  2KNB A;  2ZVN A;  4GLS C;  4W9H A;  1IYF A;  2NPT B;  2WXL A;  2K5P A;  2ZNV B;  3L54 A;  2W55 A;  3SR6 A;  2Y5P A;  2QM6 A;  2E0X A;  2C7N B;  3ALB A;  3KW5 B;  3Q8F A;  3RYT A;  1FOU A;  1ENF A;  1C77 A;  4MEM A;  1MIV A;  2R2O A;  2K0P A;  3FIL B;  4HGM B;  4HJG E;  1MHX A;  4HK2 A;  1CMX B;  1DOY A;  4MH8 A;  1ZW7 A;  4EKU A;  4JGH B;  1KF6 B;  2V3P A;  4ZHP A;  5IA7 A;  3M99 C;  2LZ6 A;  2R61 A;  1J78 A;  3AEE B;  3H37 A;  2Y3A A;  1P0R A;  4GGQ A;  3BII D;  1IGD A;  1WI0 A;  1LFD A;  2DZK A;  5AUK A;  1P1A A;  2V4L A;  3NVK A;  1C9F A;  1UOR A;  3HHM A;  3VQI A;  2IGH A;  4E74 A;  1WM2 A;  2RPQ A;  3TDL A;  4WA6 B;  3A9J A;  2O6V D;  2W9N A;  4KZ0 A;  2MJD A;  5DCN A;  5E6O A;  1P7E A;  2B3A A;  3GQX A;  1XEE A;  4KIK A;  2E0Y A;  1KXP D;  3W5U B;  2LVO A;  4HKZ E;  2EEL A;  3CWI A;  2GOW A;  1QZE A;  3W5V B;  3AB5 A;  2KN4 A;  4JE3 B;  2KDB A;  4B9K A;  2JXT A;  4YSZ B;  3AED B;  3HIZ A;  1T3Q A;  1AWD A;  5AZF A;  1ROE A;  3DOW A;  2KDE B;  3V62 A;  3APC A;  3N32 A;  5TR5 A;  4WJP A;  2K1F A;  4BFR A;  2EKI A;  1YQB A;  1JQ4 A;  4JWU C;  3MHZ A;  2MBH A;  4NPN A;  1H8C A;  1E5W A;  4FJZ A;  1CJE A;  2BXQ A;  1WR6 E;  3BVM A;  1KRH A;  2KAN A;  1MG8 A;  1NYR A;  3ZYY X;  1C4C A;  3ABV B;  3BWU D;  3VTV A;  4MDK E;  1XO3 A;  1ZDV A;  4NY0 A;  2CU3 A;  4MT5 A;  2VDB A;  2KDF B;  3MTN B;  1EU3 A;  4HXD A;  5DQF A;  1BUI C;  2MQJ A;  1V49 A;  2MBB B;  3AU5 A;  5D3I B;  2LUE A;  4US8 A;  4K71 A;  2NR2 A;  3DVG Y;  1XF5 L;  4FIP B;  2INN E;  1WE6 A;  1MI0 A;  3V03 A;  2GB1 A;  3RZW C;  3GP7 A;  2NS5 A;  1FCC C;  4N58 A;  4P16 A;  3T3O A;  2ACZ B;  2PKO A;  1TY0 A;  1YQ4 B;  2KDM A;  1N60 A;  1VDV A;  1E7U A;  2BYT A;  1I35 A;  2RDH A;  1IBX B;  4LB9 A;  1RLF A;  3KQ4 A;  3SEB A;  3DVN V;  1WX8 A;  1WXA A;  4K2C A;  1J0G A;  4F5V A;  2ICI A;  1MA9 A;  4G50 A;  3Q3F A;  2L83 A;  1GNJ A;  4AP4 C;  2KDI A;  2IO1 B;  5I4D A;  2N9K A;  2WWZ A;  2E6X A;  2B76 B;  3ZNG C;  2L32 A;  2BXN A;  4W9J A;  5IAA C;  2JU6 X;  1QT9 A;  1NYQ A;  2ZEQ A;  1RWS A;  1UUP A;  4NAW A;  3P2B A;  2J7Q B;  2PTL A;  2DYM A;  3DDC B;  4ANV A;  3TIX A;  3ZTC A;  1GC6 A;  1M4V A;  1TZ1 A;  1I4R A;  4HCN B;  3B2F A;  1I4H A;  2XNA C;  2D07 B;  2KQS A;  1E7V A;  5EE1 A;  1OQR A;  4RGM A;  2WXP A;  4RFB A;  4KKJ A;  1FCL A;  3AEB B;  4HPL B;  2I1J A;  1WR1 A;  4G3X B;  3NVM A;  2NVU I;  2MEK A;  2PEA A;  4IWO A;  2BXE A;  4PS8 A;  3FAH A;  2MBQ A;  3R7Q A;  2BXH A;  3WCQ A;  2RPV A;  2IO2 B;  3TUO A;  3ZGZ A;  2I2Z A;  2XVQ A;  3L13 A;  3VRB B;  2FNJ B;  5LXI B;  2AYO B;  4EEW A;  3VH3 B;  3V3X A;  2KOX A;  1E7F A;  2KWV B;  1VZ8 A;  1I4G A;  4CHK A;  1N5W A;  2WLB A;  4AUQ C;  1NT2 B;  1WX9 A;  3ONS A;  2GBN A;  1QF6 A;  1WXQ A;  2L7R A;  2TSS A;  3NMU A;  2Z59 B;  2INP E;  5LXH A;  4OTT A;  2XK5 B;  3DCG A;  1SE2 A;  5DPW A;  2WXQ A;  2IY1 B;  2KKC A;  2LGY A;  4HLE A;  1J19 A;  5ID9 A;  4BKE A;  4M8N A;  4OTU A;  4ANU A;  3MJ5 A;  3NHE B;  3PHX B;  3WHQ A;  4L23 A;  3T8M A;  2CHW A;  4RH6 A;  4IKG A;  1C78 A;  2HTH A;  4W9C A;  5LLI A;  4NJ6 A;  1YN4 A;  2LJ5 A;  3MJW A;  3RUI B;  3M3J A;  3SD5 A;  3CST A;  1VD2 A;  3VUW A;  4MM3 B;  5AZH A;  3ZNZ B;  3LYY A;  3LJ3 A;  2REX A;  2A4Z A;  1SJH D;  3B2G A;  4RM8 A;  1V80 A;  3A4R A;  2BXM A;  3CX9 A;  1LXD A;  3PLU A;  1FXA A;  2BXP A;  4FHJ A;  2KBZ A;  3QX1 A;  2N7J A;  2BS2 B;  3VR8 B;  2L05 A;  1FO4 A;  4AOF A;  2BXD A;  2LOQ A;  1EF1 A;  2V1Y A;  3V09 A;  2J53 A;  1OEY J;  1DOX A;  5HOZ A;  1BKE A;  1SJE D;  4LB2 A;  4TQ0 A;  1UD7 A;  1KTK A;  1XLQ A;  1R4M I;  4XZ4 A;  4KKI A;  2AWT A;  2BGF A;  1TKE A;  1K8R B;  2C5L C;  3LU7 A;  3JSV A;  3ZUN A;  4DXA B;  2HDE A;  4JX1 C;  4RNA A;  1TBE A;  5D6J B;  3UI3 A;  3U52 E;  3IG3 A;  3OJ3 A;  2N9E B;  2Z8I A;  3ZJU A;  4FUL A;  1YJJ A;  2K25 A;  2YVC A;  4KGT A;  4JQW C;  1PFD A;  4W9G A;  3KWL A;  2KAJ A;  2BXF A;  1RFK A;  2RR9 A;  4ZRJ A;  1IUE A;  2GBK A;  2QMT A;  5EE0 A;  3EA6 A;  3AH7 A;  2Z8L A;  3TMP B;  4TKN A;  1VLB A;  1OQY A;  2RGF A;  3DQV A;  2LVP A;  2Q5W D;  2LRW A;  4FAD A;  5C23 A;  5H92 C;  1Q5W B;  1NEN B;  1ZXI A;  3PHW B;  2EFE A;  1V81 A;  2L00 B;  1J7A A;  3V6C B;  4NQK E;  2JUH A;  2M0X A;  4LLG M;  2BYV E;  3BK1 A;  3V60 A;  3LU6 A;  1FNW A;  4XDD A;  4HDQ A;  4ARI A;  1V8C A;  2IZV B;  4D2K A;  1ZOY B;  3Q8E A;  4BKG A;  4LDT B;  2KC2 A;  2XK5 A;  2D3G A;  4IW1 A;  2C7M B;  1HZ5 A;  4ZYS A;  4YTP B;  2BTE A;  2J0K A;  3B9M A;  2UWQ A;  1I4Q A;  5C2T B;  2JT4 B;  3ML9 A;  2WXF A;  1SIF A;  2M17 A;  2L52 A;  1K50 A;  2JYE A;  1NEK B;  1E7E A;  2FCS A;  4J6I A;  2CJN A;  4MM3 A;  2DEN B;  4J3O D;  3OJ4 B;  2QIE B;  2QJL A;  1DYQ A;  1TYG B;  3DVG X;  3BIN A;  2MA9 B;  1PGX A;  1VCB A;  4Z69 A;  4KIK B;  2PJH A;  2JYT A;  4FHK A;  2NQO A;  4ZCG A;  2WX1 A;  4X57 B;  1FEH A;  1YMH E;  4GSW A;  1DOI A;  3KIK A;  3BYT B;  1QIL A;  3ICX A;  5BYS A;  1VJK A;  3I9V 1;  1GNI A;  3RD2 A;  2KQ7 A;  3L0W B;  1TKY A;  1PUT A;  3LB8 C;  2VZK B;  4F5S A;  1AYF A;  2FBW B;  3V05 A;  2KLG A;  3JRY A;  1JRP A;  4ZBQ A;  2UYZ B;  4LCD E;  4Z9O A;  1DGJ A;  3VXW A;  3TEW A;  2VRR B;  1FXT B;  4G01 A;  2GI9 A;  3TEZ A;  4MGK E;  1BT0 A;  1L5P A;  2C60 A;  1LNS A;  2DG5 A;  4F7Z A;  2KD0 A;  2OHF A;  2BXK A;  4MH0 E;  3UF8 A;  4KGS A;  2DBW A;  4W9L A;  4DK5 A;  1UWM A;  2V4I B;  3M62 B;  5J18 A;  2BB5 A;  3ZKJ C;  2PE6 B;  4G04 A;  2ZVO A;  1TF0 A;  1Z2M A;  4Q2J A;  4ANW A;  1FNU A;  3NS1 A;  1Q0W B;  1D6E C;  2K6D B;  4W9K A;  2LAS A;  3SHQ A;  1QOF A;  1WGR A;  2MP2 B;  2JWZ A;  4WJN A;  4M0W A;  3P1M A;  1M94 A;  2LHD A;  5JXV A;  1K53 A;  4AJY B;  2FCN A;  4OZC A;  2XN9 C;  1KFY B;  3M63 B;  3CSF A;  5D2M B;  5BYQ A;  1TY2 A;  3RFZ B;  4JIO U;  4A3O A;  2CU1 A;  1UH6 A;  3A33 B;  3PSE B;  4GU2 A;  1E9M A;  3TJP A;  2XW0 A;  4UDU C;  3U7Z A;  3VH4 B;  3O13 A;  1TKG A;  2N0S B;  5GIO A;  1WJ4 A;  1IJG A;  4B0M A;  3EEC A;  1P7F A;  4R3D A;  1WFY A;  2WXH A;  1B9R A;  3CF6 E;  4JLC A;  1HK4 A;  3JW0 X;  2KAC A;  3DBS A;  2L8J A;  1T6B X;  3FNM A;  1B1Z A;  3AEG B;  3V08 A;  2WS3 B;  1YQ3 B;  1JWB D;  1KW2 A;  4NAW B;  3H7S A;  4C80 A;  4HPM B;  1V2Y A;  2K3U A;  2KQ4 X;  3HVZ A;  3L10 B;  2O2V B;  4DBG A;  1VZ7 A;  1T0Y A;  1NI2 A;  2N4F A;  1OEY A;  3WHR A;  1I4P A;  1HE8 A;  4FJC B;  2A5U A;  1FXI A;  4OVV A;  1AN8 A;  2IBI B;  1PQS A;  2DBX A;  1F2R I;  4OVZ A;  2FCM A;  3L4P A;  1FIQ A;  2AX5 A;  3U4E G;  1RAX A;  4GOC A;  4WJQ A;  2M0A A;  3H6N A;  1FMA D;  4ZRP A;  3ML8 A;  3PRM B;  2L76 A;  2EMT A;  3QQ8 B;  2WDR B;  5JH5 C;  3NOB A;  1Q1O A;  5BO4 B;  1FRD A;  2M8S A;  3KH0 A;  3VFK A;  3RCZ A;  2G3Q B;  1E7G A;  2IJ0 A;  4RGT A;  4II3 B;  2K8H A;  2JZZ A;  4NAM A;  2SAK A;  2DHZ A;  1WF9 A;  4CQN A;  3ZVV A;  5CHV C;  1VZS A;  1HA5 A;  3AE9 B;  2GBM A;  2PE9 A;  1E8W A;  4IW2 A;  1E7P B;  1MIY A;  1L4D B;  2WDQ B;  2ZW1 A;  2E3T A;  2CHZ A;  1E7I A;  2ZPN A;  1KLV A;  1LOT A;  2G4S A;  4WJO A;  3ZRF A;  1SEB D;  2MBE A;  2QHB A;  3T9L A;  4L1B A;  3KUD B;  3NS8 A;  4HGK A;  4FBJ B;  1SIJ A;  3PRP B;  3WAP A;  1ZPS A;  4YTN B;  1WRI A;  2IGD A;  1CZP A;  2BX8 A;  4JK4 A;  1YN3 A;  4WIP A;  1X1M A;  4LJP B;  2DLB A;  4ASW C;  3VVW B;  2C7H A;  2Z0E B;  1J7B A;  3BK2 A;  2N7D A;  3W1S C;  3AM9 A;  2D5G A;  2WYQ A;  4OHJ A;  5GHK A;  5CHF A;  4WWP A;  1Q10 A;  3A4S C;  1I42 A;  4E3C A;  4OVU A;  1WYW B;  2ZZP B;  3APD A;  3PV1 A;  4GXB A;  4BVU C;  3WAO A;  5GIP A;  2CKX A;  2MP2 A;  4GIV A;  3PTF C;  3QCA A;  1WJ6 A;  4BKS D;  2ROH A;  3NVW A;  1GJZ A;  4HJK A;  1UGJ A;  2K8C A;  3UIV A;  2GBR A;  4MAC A;  4WH4 A;  1E8Z A;  4PYU A;  1HK3 A;  5IIX A;  3VUX A;  3ZTD A;  1VFI A;  4IM3 A;  1LM8 B;  1JAL A;  3HVD A;  1T5X D;  3E9S A;  3EFU A;  3AEC B;  1KOT A;  2LXC A;  2EFH A;  3MHS B;  4JPS A;  4KDI C;  2M1M A;  4MSQ B;  3JSV B;  4ZYN A;  1FNV A;  2H89 B;  1TS2 A;  2L1A A;  2WU5 B;  3MFG A;  1N5X A;  4ZRK A;  4PO0 A;  4BBN C;  2CJO A;  2KWD A;  4BKT A;  3P4S B;  4FLH A;  3URY A;  2O2V A;  1ET6 A;  3J9C A;  1IP9 A;  5HKH A;  2I1K A;  3L16 A;  5FR3 A;  2MW5 A;  1JWM D;  2IPK D;  2WXK A;  3AMZ A;  2HE7 A;  3HRD D;  1QQR A;  3VUY A;  1EM7 A;  4FXC A;  1D3Z A;  3IXS A;  2K9X A;  2XVV A;  3SIU B;  4REZ A;  1LQB A;  4DQO C;  1D5M C;  4RM9 A;  4DHX B;  5E6J A;  1D4B A;  4MJS B;  2M4N A;  2AQ2 B;  3L08 A;  3R7R A;  4RGN A;  4EFO A;  3AE6 B;  2ZJD A;  3KJL A;  2M56 B;  1EWC A;  2K8B A;  1OQQ A;  3A73 A;  3TBL D;  2KO3 A;  3KYC D;  3WIM A;  1ZP0 B;  2KN5 A;  2CHX A;  2EFC A;  4DXG A;  1WE7 A;  2JSV X;  5BMH A;  1P3Q U;  4OW0 A;  4TQ1 A;  2KHW B;  2PPH A;  4HVB A;  1N62 A;  1V5T A;  4B0E A;  1E8Y A;  1WGH A;  1C79 A;  4GDK A;  2BYF A;  2GBJ A;  4I6L B;  1C76 A;  1PDX A;  1JRU A;  1KLG D;  4FN2 A;  3VAW A;  2RSU A;  1KJT A;  5IFO A;  1WGD A;  5C3J B;  3NVY A;  3JVZ X;  3SFD B;  2KLC A;  1HA2 A;  3ZJV A;  2BXO A;  5D3D A;  1O9X A;  1V6E A;  1GOZ A;  3TCA A;  2YLM A;  5E6N A;  4ANX A;  2KTF A;  2BXB A;  3WAM A;  1WJU A;  2XEW A;  4ZBR A;  3OAW A;  4XX5 A;  4ICU A;  1HZ6 A;  4DHJ B;  2M19 A;  1FFU A;  3V61 A;  1ZKH A;  2LGI A;  3GS2 A;  1R7S A;  3NVI A;  2ON8 A;  3GOE A;  2V3N A;  3Q69 A;  4ZC6 A;  1YJ1 A;  4KGR A;  4B95 A;  4NZL B;  1UZX B;  2O6V A;  4WQM A;  1H4R A;  4L2Y A;  5AZG A;  2WXI A;  4IM0 A;  4A3P A;  2RD0 A;  4URK A;  2JRI B;  3HM6 X;  4DXF A;  4K7S A;  4ITK A;  5EE9 A;  2ZW0 A;  3TEY A;  3QK0 A;  3KUC B;  1UNS A;  5CHW A;  3B0A A;  2MX2 A;  4LDT D;  1QLB B;  2N7E A;  2JWU A;  4OR0 A;  2DZI A;  4A55 A;  5BMI A;  1WWT A;  1WJN A;  3AV8 A;  2FAZ A;  1F77 A;  2CS4 A;  1EO6 A;  2JX5 A;  3CIR B;  1V86 A;  2LXA A;  1E7C A;  3QWZ B;  3PZ8 A;  3VHT C;  3MHH B;  4EE2 A;  3AE2 B;  1ISN A;  2NTT A;  2XMO A;  3UQA A;  2PVO D;  3NZ3 A;  3R8B A;  3AE4 B;  5GIN A;  1JNB A;  4C7Y A;  1YX6 B;  2JF5 A;  4M0W B;  3R2I A;  4C31 B;  4GMV A;  4AJW A;  3CMM B;  3ZNH B;  4F8C B;  2PLP A;  2KC1 A;  3B1L X;  3UIO B;  1CK1 A;  4EUT A;  3W1Y A;  4WUR A;  2LGD A;  2OJR A;  2QHO A;  2VUF A;  2ZPY A;  1BML C;  4GG2 A;  5HHD G;  1Y56 A;  1F9J A;  1F2R C;  1WMH A;  3IVF A;  2DYO A;  3QJZ A;  3H3A A;  4MJS A;  2ZCC A;  1IGC A;  2OZB B;  3AEF B;  4WWN A;  3W9C B;  2VZK D;  2KWC A;  1XCT L;  4F1S A;  1J8C A;  2XBB C;  4ZRQ A;  2GMI C;  3P63 A;  2ZNV C;  2EFD A;  4L9K A;  3H8H A;  3Q3J A;  1FM0 D;  1V97 A;  1GPX A;  4B6W A;  4TUU A;  1AAR A;  3X23 A;  3B08 A;  1UBI A;  4FJY A;  3ZQ4 A;  3VRA B;  2H88 B;  2WDT B;  3W1S A;  2WQY B;  2KJH B;  4IG7 B;  1VR9 A;  5B5T A;  2BT6 A;  2DX5 B;  3EGR A;  5TSS A;  4F5T A;  4BBN F;  2XVU A;  3ZDM C;  3WAL A;  2BF8 B;  2JZ3 B;  1RRB A;  2LD9 A;  2Z0D B;  5DPS A;  3A9K A;  3G9K D;  1BJ5 A;  1XCQ L;  1GB1 A;  1L4Z B;  2BS3 B;  4EZK A;  3ETR A;  2MWS B;  1E8X A;  2I2Y A;  1XQQ A;  1TS4 A;  1WGY A;  4EZL A;  1SE9 A;  1ESF A;  4RF1 A;  3QAQ A;  2KFK A;  1C1Y B;  3RPF C;  2MCN B;  5D7G A;  3Q8A A;  1KH0 A;  2D11 A;  4AQ7 A;  4XDC A;  1HK5 A;  3PZ7 A;  4HCP B;  2WXN A;  5JHA A;  1SE4 A;  2Y5B B;  1WIA A;  3VTU A;  4C56 C;  5DPT A;  2X38 A;  4J2V A;  1SB3 C;  2HTM E;  1WGK A;  4ZHO A;  1YNT E;  4MGY E;  2YDF A;  3DPD A;  3NZS A;  3B9L A;  4PT5 A;  2KMM A;  2QEJ C;  4HDO A;  3EHV A;  3KLS X;  4W4U B;  1WZ3 A;  2NMQ A;  3H9D A;  3FWC C;  2WX0 A;  3R2T A;  3PLA A;  1MVK A;  2AL6 A;  2W3R A;  1YX5 B;  2BKR B;  3PZD A;  4NJ7 A;  1QOG A;  2IDY A;  2DWQ A;  3P4P B;  4YWG G;  3SQJ A;  1XLN A;  2L0T A;  4AS1 A;  2JQR B;  4RMA A;  4K81 A;  5EDS A;  5LNK 1;  4KX6 B;  2AQ3 B;  4LA0 A;  3DBH I;  3EC8 A;  3ENE A;  5JZE B;  4KSL C;  2IGG A;  3PS6 A;  1SBB B;  4KV2 A;  2LI5 A;  2G1E A;  1SE3 A;  4DHZ B;  4A9A A;  2LRU A;  2Z8K A;  2N9L A;  2KWU B;  2LWP A;  1FRR A;  1SGH A;  1TJE A;  3SIV B;  1N5U A;  1A5R A;  3NVV A;  4IWQ A;  4M70 B;  3V6E B;  1J7E A;  5T8I A;  2FUH B;  3RT3 B;  4JL9 A;  1JRO A;  4ZBK A;  3NUH B;  2PMV A;  3Q8C A;  5H8Y E;  3AE7 B;  1K52 A;  3OLM D;  4LTU A;  1I4X A;  2BWE S;  3I57 A;  1WX7 A;  2BB6 A;  1OTR B;  4KVG B;  2J52 A;  2N9P C;  3GQU A;  5DBY A;  1V1O A;  1WXS A;  2LGX A;  2LEK A;  4KSK C;  5DPR A;  3IT6 B;  2R2Q A;  2EMS A;  3ZRC A;  2MLB A;  4WQO B;  2FE8 A;  1WRD B;  3BZD B;  1ACC A;  2W82 A;  5HFY A;  3AU4 A;  3WA0 A;  4N0F D;  2BXA A;  2QIL A;  4WWM A;  4N0U D;  4ZOH C;  2WXG A;  2DYB A;  4GN1 A;  4BY9 C;  1YD8 U;  4GB9 A;  3IBE A;  3VTW A;  1CQV A;  1ZDX A;  2GRI A;  2BPS A;  2JXX A;  3A1Q A;  2LJI A;  3N30 A;  3MP9 A;  4N6E B;  5IIU A;  1C4P A;  2DAF A;  3P42 A;  1H9Z A;  1TGZ B;  1WGG A;  1WZ0 A;  2J42 A;  4L8U A;  2J0J A;  3VDZ A;  1D5X C;  3PO0 A;  2NBW B;  3PT2 B;  4LJO B;  4OZA A;  1Y8R C;  3UGB B;  3WHS A;  4HKQ A;  3LU8 A;  1WSP A;  3P4R B;  3MHS D;  2W3S A;  2D2Q A;  4G11 A;  3TEX A;  1LO5 D;  2K39 A;  4XWW A;  4MBE C;  4FA6 A;  1RM6 C;  5IJF A;  3PVL A;  3HUI A;  1G6J A;  4W9D A;  3PGE A;  4GDK B;  4GDX A;  4II2 B;  2BXL A;  2AQ1 B;  3FC4 A;  4IOI E;  2JY6 A;  5JHB A;  1PGB A;  3WAN A;  2ASQ A;  2XSI A;  1WYG A;  2NCN A;  3IAM 1;  3LXF A;  5HG2 A;  4EZJ A;  4L9Q A;  5ID7 A;  1GC7 A;  3JYU A;  4YSY B;  1A70 A;  1EU4 A;  2WXR A;  1R4N I;  1BM0 A;  3KUZ A;  1V1P A;  2IY0 B;  2WP9 B;  3NRZ A;  3H7P B;  2MRP A;  2I38 A;  1XT9 B;  3DWM A;  1GUA B;  1ET9 A;  1QOB A;  3P4Q B;  2K22 A;  3KYD D;  2BXC A;  3QC8 B;  3S2A A;  4YXD B;  2G45 B;  1XLP A;  1YN5 A;  4ZDV A;  4HRO A;  2G4D B;  4M8M A;  3BY4 B;  2V36 A;  2KMC A;  1EF5 A;  2O6V B;  3APF A;  3DWG C;  5G5H A;  3HK0 A;  2DZJ A;  4US9 A;  1YJI A;  2L0F A;  5BPK A;  2NPT A;  2ONQ A;  3PPA A;  2QMC A;  2KTR B;  4WAF A;  2KFJ A;  3ZLZ A;  4H2A A;  2W54 A;  3TL5 A;  2JZP A;  3HM3 A;  3ZIM A;  2KJ6 A;  4DWF A;  2LUM A;  2PW9 A;  3EUB 2;  2C9W B;  2PIA A;  2LVQ A;  5FR6 A;  4YL8 A;  2FCQ A;  3L17 A;  3FIL A;  1KLU D;  3ZJT A;  3RUL A;  2G9H D;  1IPG A;  2OED A;  2AEH A;  4TV3 A;  1WXM A;  4WWO A;  5FK9 C;  1KM7 A;  1MHH E;  5G2N A;  5BYR A;  2BXI A;  5J2R A;  1MIW A;  1SXT A;  5FKA C;  1BXT A;  2BYE A;  4NJC A;  4ZUX V;  3M95 A;  4DHJ D;  1WMH B;  1I7H A;  2Y5C A;  1S3S G;  2NNW A;  3AE3 B;  4G03 A;  1TXU A;  1L0Y B;  2VUE A;  1MPE A;  3AE5 B;  1UEL A;  1VRA B;  5KHO A;  1D5Z C;  3C0R B;  5GXG B;  4OZB A;  1NDD A;  1XXG A;  3IT4 B;  4NQL B;  2DBY A;  5AEK B;  2IO3 B;  4HRS A;  3IHP C;  5G5G A;  4A20 A;  4IWP A;  1HQR D;  1E7B A;  2JUO A;  1E7H A;  3X0W A;  5CX3 A;  4LUH A;  3N9Y C;  1YIW A;  3BYY B;  3NY5 A;  2D10 A;  3DBL I;  1UBQ A;  4YTM B;  4P6V F;  2J4X A;  3DVN U;  2WDV B;  3AEA B;  2BS4 B;  1PYW D;  2J0M A;  2KJR A;  2KX0 A;  1TS5 A;  2RDG A;  4RGO S;  4FK5 B;  3AXC A;  3K9O B;  4ICV A;  4I6N B;  1J7C A;  4MGI E;  3AE8 B;  1E10 A;  3A9K B;  5GMV A;  3U30 A;  3H1U A;  3ZO5 B;  5AUI A;  3ZDT A;  3B9J A;  3H7P A;  5IJE A;  3N3K B;  3C8Y A;  3PRZ A;  1QOA A;  4RF0 A;  1L2N A;  1UWX A;  1WM3 A;  2FIF A;  4TMA B;  4N9F 4;  1P9D U;  2IO0 B;  2KFK B;  3O65 B;  4PS3 A;  4W9E A;  2Z8J A;  1UGM A;  4AWJ A;  1E6E B;  4GDL B;  4IUM B;  1FD6 A;  4K7U A;  1ZE3 D;  2WXJ A;  4HEA 1;  2YEP B;  2LMC A;  3E56 A;  1OFF A;  1FFV A;  1RFA A;  1SF0 A;  3R3M A;  4IC7 B;  3KVF B;  3W2D A;  2CKH B;  3PLV A;  3GZN I;  1V9J A;  2MJ3 A;  5FUO A;  5BMG A;  2V0G A;  3NZU A;  2L3Z A;  4A90 A;  3SDL C;  2XW1 A;  1Z5S B;  2FID A;  2KTR A;  3QAR A;  1IBX A;  2DBU A;  4MSM B;  1F0Z A;  1P98 A;  2KXJ A;  1EUV B;  5L83 A;  3GA9 L;  2QSD A;  3RZF A;  1E7A A;  2NBU A;  3Q8B A;  4LUF A;  3KWV A;  2MSE D;  3K9P B;  4WAA A;  2OOB B;  2JVC A;  4EOY A;  4G0N B;  4XC2 A;  4DHZ E;  1E90 A;  2KZR A;  3OWE B;  1HXY D;  2N9X A;  2RMM A;  2EKE C;  2K6Q A;  1STE A;  3U8Z A;  3T3N A;  1VZ6 A;  1JCK B;  4A6Q A;  5L95 C;  1L0V B;  2CR5 A;  2V3S A;  4MEL A;  4BOS C;  4MGZ E;  2MH7 A;  3QA8 A;  1TZO A;  1WH3 A;  1H5W A;  4K7W A;  4DDI D;  3BVG A;  2LFI A;  2DAJ A;  4KDL B;  4K1R B;  3UIP B;  3ECI A;  4TSS A;  2XVW A;  2AJE A;  1GAQ B;  2BWF A;  3JQZ A;  4P7I A;  3GB1 A;  3NVZ A;  4BKS A;  3LDZ E;  2WXO A;  5HI1 A;  2NBV B;  4PYZ A;  4IDI A;  1PGA A;  2I30 A;  2BW2 A;  4I6P A;  1RYJ A;  4HWI B;  5CTR C;  1GB4 A;  1E78 A;  3ZW3 A;  2IYD B;  1JWS D;  4XWT A;  1V5O A;  3U7D A;  5IIH A;  2YEP F;  2WU2 B;  1XLO A;  1HEZ E;  5J17 A;  3IFW B;  1NI3 A;  3I3T B;  3AUL A;  2NTS A;  3MC0 B;  1ZXH A;  4IW0 A;  1NBF C;  1L6V A;  3UIN B;  1JML A;  1WY8 A;  3UQB A;  3AN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...