2DYOA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-57) complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
286
structure length
269
Chain Sequence
HMNDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPLIWNKIKSFLSFDPEKYFWFEHNKTPIPWNYPVGVLFDCLAGKSAVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKEGDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover/protein turnover
molecule keywords Autophagy protein 5
total genus 79
structure length 269
sequence length 286
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dyoA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dyoA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dyoA01
2I1JA 4FN2A 3W1SA 2KQ7A 2ZNVC 5DPTA 2BYVE 2KLGA 3NY5A 2IY1B 3S2AA 2FCSA 4ANXA 4BBNC 4ZRKA 3RUIB 2IYDB 3QAQA 2C7MB 3DBSA 1E8WA 1ZW7A 3D32A 1E7UA 2WX0A 2A5UA 2L0TA 1WY8A 4FHJA 5AZFA 4K1RB 2K8CA 4A3PA 2K1FA 4F8CB 2V4LA 4WAAA 4OVVA 5E6OA 2KKCA 2ZCCA 3PSEB 3Q3JA 2JT4B 3IVFA 3NS8A 5D6JB 2NPTB 2J0MA 2KQSA 4BBNF 2RD0A 3QX1A 4DHJB 2LRWA 3L0WB 3HM3A 4DDID 2I1KA 2LGDA 1E8YA 2DENB 4GOCA 2AL6A 2L00B 3ZIMA 4HDQA 4FHKA 1ZKHA 2O6VD 4W9HA 4IWOA 3IHPC 2KN5A 4JLCA 4II2B 4RM9A 3X0WA 3VAWA 2D3GA 1A5RA 2N7DA 3EC8A 3HM6X 3PHWB 3ZRCA 1G6JA 2K25A 3ZKJC 1RFAA 3I3TB 1WX8A 2N7EA 2LVQA 1V6EA 3A4RA 1AARA 4ICUA 4KIKB 4ANUA 3M63B 3DVGX 1YD8U 3JVZX 3O65B 4BOZB 3DOWA 4MH0E 3AI5A 4IC7B 2MRPA 1C1YB 3CF6E 3WALA 5LXHA 2N1WA 4LCDE 4NNJB 2KDBA 4TQ0A 1Q5WB 4XZ4A 2C9WB 5CX3A 4LJPB 3ECIA 1K8RB 3L16A 3N32A 3N3KB 4WJOA 3PLUA 4G3XB 1I42A 1TGZB 2M0XA 3NHEB 3EFUA 3VTWA 1WX7A 2N9EB 2JRHA 2FNJB 4GDKA 3U7DA 3RD2A 5JHBA 3QIJA 4W9CA 3ZUNA 3L10B 3R66C 3VH4B 4II3B 2J0KA 3IBEA 4FULA 3WANA 1WGHA 2MP2A 2K6QA 3V6CB 2KVRA 2CKHB 2FUHB 2KMCA 1Q0WB 3M95A 3ML9A 3B08A 2GBNA 4DBGA 3VUXA 4HJKA 3ZO5B 1V49A 2XBBC 4G50A 3H7PA 2A4ZA 4IWQA 3L54A 4MJSA 4XX5A 3MHSD 2JWZA 3CSTA 3ZNZB 3QWZB 3ZTDA 3MJWA 1WYWB 2R2QA 3A9KA 1D3ZA 1GG3A 1WH3A 2JPHA 2QHOA 3PRMB 3A1QB 3GZNI 2JVCA 1TTNA 4FLHA 4GN1A 4M8NA 1GJZA 2GBKA 2EMTA 4ZDVA 2PPHA 5C1ZA 5CHFA 3K9PB 3R7RA 2K39A 4K81A 2KO3A 3EECA 4MGYE 2O6VA 4ASWC 2LVOA 3DVNU 2M1MA 2KFKA 2RPQA 4RMAA 1H4RA 1YX5B 4MM3A 2OJRA 2NCNA 1WR1A 3UQBA 4YL8A 5DPSA 4FJZA 2L0FA 3ZRFA 2N1VA 3TIXA 2KDFB 3JSVA 3QQ8B 4NAWB 1UELA 4B9KA 4GXBA 1WM2A 4K7SA 2NBWB 3DCGA 4KIKA 5JZEB 2MBBB 1MG8A 2IO0B 2LI5A 2JZZA 2DZIA 4N9F4 1Y8RC 3TL5A 1V5TA 3ONSA 1X1MA 2C7NB 2XK5B 3H9DA 3UF8A 3PV1A 4EZJA 2YLMA 2KX3A 2DAFA 1WXSA 3TJPA 1OEYA 1SIFA 3PT2B 2KJ6A 4GDLA 2J7QB 4WWPA 2Y5BB 2DYOA 3DBRI 3ZNHB 4KZCA 3MTNB 1P98A 2LGYA 3T8MA 2IO1B 5G2NA 2C60A 3HHMA 1KM7A 3VTVA 4ANVA 3UGBB 1H8CA 1TZ1A 1WXVA 2R2OA 4HWIB 1GC6A 5LXIB 5EDSA 4KSLC 3R3MA 3WA0A 3UIOB 1KOTA 3IFWB 1WGDA 2FCQA 4EUTA 4NY0A 3PRPB 2MLBA 1L7YA 3SHQA 2PE6B 1UH6A 3JSVB 2KZRA 4JGHB 1HE8A 5JH5C 2LASA 3WIMA 1SE9A 2M4NA 2D07B 3AULA 1BT0A 2CS4A 1WM3A 4WJQA 3KUDB 3DVGY 1WMHB 4WWNA 2BYFA 2FIFA 3RULA 4W9LA 3M3JA 4B6WA 1VCBA 3OJ3A 4G11A 2IO3B 4PS3A 2KTFA 2YVCA 1KJTA 1WMHA 2UYZB 5DCNA 2KLCA 3RT3B 1IP9A 3NOBA 5AZGA 3JW0X 4KDIC 3OJ4B 1IPGA 3AU4A 3WAMA 4FADA 1E7VA 2AL3A 2WWZA 2WX1A 3QK0A 4ZRJA 2MA9B 2GOWA 2ZPNA 2KC1A 2KK8A 5G55A 3SD5A 2KTRA 4E71A 4URKA 1F9JA 2ZJDA 3DQVA 4F1SA 2Z0EB 3OLMD 1V80A 5J18A 1C3TA 2L76A 2EKEC 2RR9A 1UBQA 3L08A 2CHWA 3V61A 4OVUA 2D2QA 1WGGA 1YX6B 2K8HA 2KFJA 3PRZA 4TV3A 5BO4B 3A9JB 4AWJA 3PGEA 2DHZA 4DHZB 3AU5A 4G0NB 4DWFA 3A1QA 5JHAA 4HVBA 1E5WA 3ZNID 4W9GA 2NBVB 1EF5A 4MJSB 2LWPA 1XQQA 4BKSD 4TQ1A 1E8XA 1LQBA 1XD3B 2ZVNA 3C0RB 3QJZA 3KVFB 1WE7A 5D2MB 3KYDD 2GMIC 1XT9B 2AEHA 2N9PC 1SGHA 5E6NA 3ZW3A 4EKUA 2L05A 2KX0A 4DK5A 4ZYNA 2MP2B 4LDTB 4WJNA 1WGYA 4EZKA 5L95C 2JZ3B 2V1YA 1WZ0A 4FBJB 1JRUA 2UWQA 1CMXB 4EEWA 1RLFA 5E6PA 1WGRA 2EMSA 2DAJA 2MX2A 5HKHA 2N9XA 4IW0A 4MDKE 4TUUA 5GMVA 5TR5A 3WAPA 2C5LC 3B1LX 3RYTA 2BYEA 3PS6A 2BWES 2OOBB 3P2BA 3LJ3A 2HE7A 4NJ7A 4ANWA 2L8JA 4BFRA 4HCPB 2WDTB 3W1SC 4AJYB 3HK0A 3VDZA 4GDLB 1WJUA 2ZZPB 5CTRC 1EF1A 2CR5A 5KHQA 3X23A 1UGMA 1V5OA 1GUAB 1R4NI 3RZFA 2VRRB 2B3AA 4BKGA 4XC2A 3VUWA 3ZTCA 2KC2A 2BKRB 4MGKE 3VUYA 2PEAA 1Z2MA 2PE9A 4WJPA 3L17A 2ZCBA 4HDOA 4E3CA 4DXAB 1UBIA 1YQBA 3HIZA 3CSFA 1WXAA 3T9LA 5FR6A 3A4SC 4AUQC 3QC8B 5L83A 1OGWA 5KHOA 3H1UA 4IM0A 2KTRB 1V86A 2KHWB 4I6NB 3DBHI 4MSMB 3PZDA 3RCZA 3KH0A 4F7ZA 4GGQA 2LD9A 2KJRA 4MGZE 3SU8X 2IBIB 2AWTA 2KNBA 3VH3B 3VTUA 1WFYA 1OQYA 1RAXA 4HXDA 2JY6A 2NBUA 4W9EA 3TMPB 5LLIA 1NBFC 2MBQA 3V60A 3A9JA 4GU2A 3ZVVA 4BOSC 2JF5A 1EUVB 2KJHB 1LXDA 4MSQB 4AJWA 1Q1OA 3KUZA 3UINB 1IYFA 3R7QA 3JYUA 3BINA 3VHTC 3APFA 2DYMA 1WR6E 4KVGB 3GOEA 3DVNV 3KW5B 1M94A 1KLVA 2G4DB 4PS7A 1E8ZA 3EHVA 2K8BA 2MSED 4X57B 1V81A 4NQLB 2BGFA 3OAWA 1WX9A 3L13A 2DX5B 4PYZA 1NI2A 4TKNA 2REXA 3WAOA 2LXAA 3BY4B 2HJ8A 1E90A 2C7HA 2KANA 4K7WA 5J2RA 5C23A 4BKSA 4DHJD 5D94A 2BWFA 2L3ZA 3N30A 4AOFA 1GC7A 4FA6A 1QZEA 2G4SA 4J6IA 4M8MA 1J19A 1VD2A 3A9KB 2DZJA 3PREA 2FAZA 4E74A 4GIVA 1UD7A 4MEMA 2ASQA 3A33B 1TBEA 2G3QB 2ZVOA 3CMMB 3DBLI 4JIOU 4K7UA 1V2YA 3H7PB 4HPMB 3ZDMC 2L7RA 1I35A 2GBMA 2NPTA 3APCA 4RM8A 1LM8B 3V62A 4IM3A 5D7GA 2NS5A 3KYCD 5DPWA 4W9IA 4CYEA 3V6EB 2JUOA 2D11A 4JL9A 2MBEA 3DDCB 3DPDA 2LXCA 4IUMB 4AP4C 1WJ6A 4GSWA 4WWOA 1EO6A 1WIAA 2IZVB 2MWSB 2FCMA 1J8CA 1L2NA 2HD5B 2O2VB 3H7SA 4WQOB 5CHVC 5IA7A 3SDLC 1Z5SB 3VQIA 2M17A 3PHXB 2K6DB 3UIPB 1YJ1A 2LRUA 2MW5A 3RZWC 3K9OB 2BKFA 2KMAA 2J0JA 2JRIB 2CHXA 2O2VA 4EOYA 2KXJA 4IWPA 1WI0A 2XK5A 4HPLB 2FCNA 3IG3A 4LDTD 4NAWA 2MBOA 4BKTA 1GNUA 2LVPA 2NVUI 2MCNB 3VVWB 1J0GA 3H6NA 4W9KA 4EFOA 1T0YA 3PVLA 1WE6A 4HLEA 1WRDB 4KSKC 2PJHA 2WYQA 1P3QU 2Z59B 2GBRA 2BF8B 1S1QB 2XEWA 4P7IA 2AYOB 3W1YA 2O6VB 3M62B 4W9DA 1WZ3A 1V9JA 3TCAA 3U8ZA 4BVUC 3LDZE 3ENEA 4FJVB 2LJ5A 4JQWC 4IG7B 3VXWA 3B0AA 2GBJA 4ICVA 2V3SA 2N4FA 4PYUA 5CHWA 1LFDA 1UZXB 2DZKA 3TBLD 2M8SA 1OEYJ 3ALBA 2KDEB 1PQSA 4MELA 3VFKA 1U4AA 2KWUB 5AEKB 3QARA 2W9NA 1NDDA 2MBHA 4NQKE 3PPAA 1S3SG 2G45B 3ML8A 4ZRIA 2KD0A 5AZHA 2Z0DB 1ISNA 2JXXA 5DPRA 2DYBA 1P1AA 2NR2A 1RRBA 1YIWA 4I6LB 4A3OA 2CHZA 2KWCA 2LZ6A 3APDA 3QCAA 4LJOB 2FIDA 1WXMA 2KDIA 4KV2A 1WJNA 1WJ4A 4NPNA 3KUCB 4W9JA 4I6PA 3ZNGC 2HTHA 4A20A 4MGIE 4PS8A 4B95A 2IO2B 3QHTA 4CHKA 3PTFC 2IY0B 4GMVA 4NJ6A 4DHZE 2DZMA 2KWVB 2MQJA 3ZLZA 2CU1A 4FJYA 3NZUA 1P9DU 2ZEQA 2LGXA 4HCNB 3QA8A 1ZGUB 3Q3FA 2RGFA 2LUEA 3PLVA 5IAAC 1FXTB 2KOXA 5J17A 2ZPYA 3UQAA 4IM2A 3U30A 4M0WB 1WF9A 4GB9A 4HK2A 4EZLA 3NZSA 1R4MI 3ZDTA 2D10A 4KDLB 4DDGD 1P0RA 4CO7A 2ZNVB 3AXCA 1OTRB 4W9FA 2RSUA 2KFKB 4KZ0A 2BPSA 4GDKB
chains in the Genus database with same CATH superfamily
4RGTA 5IP4D 2KQ7A 5DPTA 2KLGA 3NY5A 4A90A 1WYGA 2FCSA 2IYDB 3DBRB 2WXRA 4KKJA 1E8WA 3D32A 3IT4B 1BXTA 1R7SA 1QOFA 4FHJA 5AZFA 4K1RB 4A3PA 2WNMA 2YEPB 4F8CB 1LOTA 5E6OA 4OVVA 5TSSA 2JT4B 2W54A 3QX1A 2LXSA 2OHFA 3IXSA 4DDID 3EA6A 1MI0A 1KDXA 1E8YA 2DNFA 1MJDA 1SJED 2LGDA 4GOCA 4C4VB 4ARIA 1JALA 1SB3C 4HDQA 5GINA 2O6VD 2KN5A 3AEDB 4II2B 4RM9A 1I4QA 4RCOA 3IAM1 3HM6X 3SFEB 3ZKJC 3I3TB 3B9LA 2N7EA 1MUHA 1L4ZB 1JWAD 3O65B 4BOZB 3AI5A 4IC7B 3H3AA 3CF6E 2PMVA 1I4RA 2INDC 2LGIA 2VUEA 4NNJB 3FWBC 5GIPA 1RM6C 4YSYB 1ET6A 1H5WA 3ECIA 1K8RB 3L16A 1HTOA 3N3KB 4WJOA 3PLUA 3B9JA 1I42A 3NHEB 2M0XA 2DBWA 2BTEA 1QKZA 1FD6A 5JHBA 3QIJA 1AYFA 1N62A 2J0KA 4RFBA 3WANA 1WGHA 2K6QA 2PLPA 2Q5WD 3NG0A 1GNIA 2KACA 4DBGA 1V49A 2BT6A 3KWLA 1VLBA 2JSVX 3QWZB 3GE3C 2JPHA 3PRMB 2TSSA 2K22A 3RFZB 4M8NA 4FLHA 1GJZA 4ZDVA 1TKEA 3K9PB 2O6VA 4ASWC 3DVNU 2M1MA 2KFKA 2RPQA 1H4RA 4XE0A 2OJRA 3UQBA 4FJZA 2L0FA 2N1VA 2KDFB 2RDHA 1JWUD 4L23A 4KIKA 2NQOA 4XDCA 2IO0B 1TY0A 3TL5A 5FUOA 2LHEA 3ONSA 2C7NB 2YLMA 2X8XX 3TJPA 3PT2B 1FNUA 3Q3MC 3W5UB 1I4PA 3ZNHB 3GB1A 3T8MA 4F5UA 3GS2A 3I5JC 1KM7A 3UGBB 2Y5CA 4MH8A 1TZ1A 1WXVA 5D3DA 1DOXA 3ZXRA 3ETRA 5LXIB 4KSLC 3SEBA 2WXHA 1WGDA 1JCKB 4NY0A 4M02A 1GAQB 2PE6B 2KZRA 4LB2A 1XLQA 1A70A 2LASA 2K0NA 1SE9A 5BMHA 3AULA 1N63A 3AH7A 4ZHPA 1FM0D 3KUDB 3DVGY 2QSDA 4WWNA 1LGRA 3N9YC 5HFYA 1VCBA 3OJ3A 1VZ7A 2KTFA 4PS3A 1SJHD 1FEHA 1KH0A 5AZGA 4KDIC 4HEA1 4FADA 2RDBC 1TS5A 2AL3A 1GNJA 2WWZA 1I7HA 1F77A 1D5XC 2ZPNA 4URKA 2JXTA 4RGNA 1F9JA 1WXQA 1UGJA 3OLMD 2PIAA 2KWDA 2QIEB 5J18A 5DBYA 1C3TA 4B0MA 2L76A 2EKEC 1ZDXA 2KBZA 5B5TA 4HKZE 1HK1A 1WSPA 3LXFA 1ZPSA 4DWFA 1WWTA 2K0PA 1E78A 2KAJA 2NMQA 4O1NA 5BYQA 3ZNID 4W9GA 2LWPA 1AW7A 4BKSD 2LMCA 3PZ7A 2ZVNA 2ZW0A 1P7EA 3VRAB 2E6XA 4B0EA 4FK5B 1E7PB 2KX0A 2MP2B 4WJNA 2JZ3B 1WZ0A 1XCTL 4FBJB 1CMXB 4J3OD 4IW0A 4TUUA 3PS6A 4BFRA 2VUFA 2WDTB 3W1SC 3T3OA 1IJGA 3MC8A 3X23A 1UGMA 1V5OA 4K3BA 2GUTA 2PEAA 1Z2MA 4BKEA 2EFCA 4HDOA 3G9KD 1UBIA 3CSFA 3T9LA 5L83A 1FIQA 1OGWA 2KTRB 1V86A 4MSMB 1YOVB 3KH0A 2KJRA 2WXKA 3SU8X 1TYGB 1WFYA 2NBUA 5LLIA 2MBQA 4ZCGA 1F1HA 3A9JA 3P4PB 4GU2A 4KX6B 1EUVB 2KJHB 2N9LA 4AJWA 1E7IA 3R7QA 3JYUA 1TS2A 3Q3NC 4KVGB 1B1ZA 3DVNV 1KLVA 4PS7A 1GPXA 2MSED 4X57B 4L1BA 4OTUA 2BXIA 1L0XB 2MEKA 1CQVA 1HZ5A 2INPE 2V4IB 4HJGE 2C7HA 2KANA 4AOFA 4FA6A 1E7EA 3AE5B 1D4BA 2AX5A 4OZCA 4RGMA 4MEMA 3DBLI 1EWYC 4OHJA 3VR8B 3APCA 4USAA 1DOIA 2D11A 2MBEA 4IUMB 4HPPA 2BXGA 1WJ6A 4WWOA 3UI3A 1EO6A 2IZVB 1YN3A 1VDVA 2O2VB 2K3UA 3H7SA 5IA7A 3KWVA 2M17A 3UIPB 2JUHA 4L2YA 2LRUA 3RZWC 3K9OB 3BWUD 2J0JA 2CHXA 4GLSC 2INNE 2MBOA 2E0XA 1ACCA 4EE2A 4JE3B 2XW0A 3PVLA 4HLEA 1P3QU 2Z59B 1T3QA 2GBRA 1YN4A 1S1QB 2XEWA 1GOZA 3W1YA 1C78A 3M62B 1F0ZA 1DYQA 5FR3A 1PYWD 4WQMA 4LNKA 2JU6X 4BVUC 3AM9A 2I38A 3B0AA 3ZJUA 3ICXA 2IPKD 1HTQA 1UZXB 1SSNA 2M8SA 1OEYJ 2VZKD 3ALBA 1PQSA 4MELA 4NZLB 1TF0A 1ZDVA 3QARA 4N59A 4YTPB 1UF0A 1QLBB 4UDUC 2G45B 5EE1A 4ZRIA 1MUSA 2JXXA 2NR2A 1MFWA 2LZ6A 1WXMA 2OJWA 2Y3AA 1JWBD 2BXQA 3ZJVA 5H8YE 3ECPA 4J2VA 4IW2A 2L1AA 2IY0B 4NJ6A 2MQJA 2KT7A 3NZUA 1P9DU 2ZEQA 2LGXA 4HCNB 3L4PA 1ZGUB 1E7FA 1SF0A 4YWGG 3PLVA 2RGFA 5IAAC 4M0WB 1WF9A 4HK2A 3ZDTA 3OG5A 4DDGD 1P0RA 3I63C 2ACZB 4KZ0A 1C4CA 2BPSA 3W2DA 4XWWA 3W1SA 5HOZA 2MJDA 3OWEB 1ESFA 2IY1B 2BXEA 3S2AA 2KDMA 1BUIC 4BBNC 3RUIB 2BXDA 5MPOA 1HK3A 1ZW7A 1N5WA 3U52E 2L0TA 1WY8A 3NVMA 3BVZA 4RGOS 3IVFA 1MIVA 1I4HA 2VH1A 4BBNF 2RD0A 1TS4A 4A8XC 1B9RA 2L32A 3MHHB 1QOGA 1SXTA 2L00B 2QJLA 3H8HA 4FHKA 1ZKHA 3IHPC 3MHSB 1NI3A 1E7HA 3FAHA 1N5UA 3EC8A 2K25A 1RFAA 2I2YA 4DQOC 2LVQA 1V6EA 4KIKB 3AE9B 3DVGX 2WXLA 4REZA 3DOWA 2XVVA 2AQ3B 5BMIA 5LXHA 3H37A 1EU3A 2JX5A 2KDBA 2H88B 1FPYA 5I4DA 3N32A 4P16A 1WX7A 1JMLA 2FNJB 1YMHE 3RD2A 1QF6A 4W9CA 4LNFA 3L10B 3R66C 4ZRPA 3VH4B 4II3B 4LNNA 2MP2A 2JYTA 3NVVA 1K52A 4N0UD 1Q0WB 3ML9A 3B08A 2JWUA 4M01A 1EM7A 2XBBC 2FE8A 3HVZA 3H7PA 4G50A 2A4ZA 2FBWB 1SIJA 3MHSD 2JWZA 1KTKA 1NVID 1AN8A 3ZTDA 1IBXB 1WYWB 3A9KA 1D3ZA 1WH3A 5BPKA 2QHOA 2PTLA 2JVCA 5IIHA 3RN9C 3WHRA 1SEBD 1I4XA 4YT0B 3R7RA 2K39A 1ZXIA 4K81A 1O9XA 3Q8BA 3Q8CA 5BYRA 2NCNA 1MA9A 4YL8A 1L0YB 3P63A 3QQ8B 3SIVB 4K2CA 2QDFA 3J9CA 4K7SA 3AE3B 5JZEB 2MBBB 3JRYA 1XO3A 4N9F4 3AE6B 4P1CC 3H9DA 1HK4A 3PV1A 2KX3A 1OEYA 1SIFA 2MH7A 4HGKA 2J7QB 4WWPA 1H8CA 3TEZA 1LNSA 3WA0A 3NVZA 3PRPB 1QT9A 2MLBA 4K71A 1MIWA 1UH6A 1R4NB 3BYTB 2K9XA 2D07B 2Y5PA 1WM3A 2BYFA 3DHGC 2FIFA 2OEDA 3RULA 4W9LA 2WDVB 2EELA 3FILA 2BXNA 3WHSA 1KJTA 1WMHA 2UYZB 5DCNA 1CJEA 3JW0X 1ROEA 1RYJA 3AU4A 1V97A 4P1BC 1XXGA 2BS3B 2WXGA 4ZRJA 2MA9B 1SB0A 3NJTA 2KTRA 3A75A 5EE3A 1V80A 4YTNB 3V3XA 3L08A 2CHWA 3V61A 1E9MA 4L9QA 2XNAC 1YX6B 2KFJA 5EE0A 3A9JB 4S0RA 1UORA 3PGEA 2DHZA 4DHZB 4G0NB 3FILB 3ZQ4A 4HVBA 3EGRA 1E5WA 1ZP0B 3RNBC 4MJSB 1EF5A 3DWMA 1XQQA 4ZHOA 4TQ1A 1E8XA 1LQBA 3KVFB 1WE7A 3TEWA 5D2MB 1WGKA 2GMIC 1XT9B 2WXMA 5E6JA 1SGHA 1FRRA 2L05A 5L95C 1WGYA 4EEWA 5E6PA 2DAJA 5GMVA 2BWES 4ARCA 4ANWA 2DBXA 4AJYB 3VDZA 5CTRC 1EF1A 4BKGA 2B3AA 3VUWA 2H89B 3ZTCA 3P1MA 2LQIA 4C31B 2Z8KA 2WU2B 2ZCBA 4E3CA 3PZ8A 1YQBA 1KLUD 4AUQC 4IM0A 1T0QC 3DBHI 3PZDA 4ZUXV 2LD9A 2K5PA 1JRPA 4R3DA 2IBIB 2AWTA 3VH3B 3URYA 3EFCA 1J7AA 2GRIA 3V60A 3PO0A 3KLSX 4BOSC 4DHXB 2WXOA 4YSXB 4US9A 1Q1OA 3C19A 3KUZA 4M0WA 3RMKC 3BINA 3VHTC 3R2TA 2J42A 3KW5B 2G4DB 1E8ZA 3EHVA 2ICIA 3AEEB 2I2ZA 4S17A 2BGFA 3OAWA 3L13A 2DX5B 4TKNA 2LXAA 3BY4B 4LNIA 1TZOA 2WXNA 5C23A 5D94A 2WXJA 2G4SA 3PREA 4WWMA 2DZJA 3T3NA 2FAZA 1XLNA 1TBEA 1T0SC 4Z9OA 2DBYA 2GI9A 3TEYA 4RM8A 1E7CA 4IM3A 5D7GA 4N0FD 2PW9A 3KYCD 3N20C 4BAXA 4CYEA 4TSSA 3HUIA 3DDCB 2RMMA 2N9KA 2W55A 5T8IA 5H92C 1BM0A 2FCMA 1L2NA 2HD5B 4WQOB 3SDLC 4D7XA 3VQIA 3PHXB 2WDQB 1YJ1A 2MW5A 3EUB2 2KMAA 1V1OA 4OVZA 2SAKA 4EOYA 2KXJA 4IWPA 4FIPB 2XK5A 2N0SB 4BKTA 2LHDA 2NVUI 2LVPA 3Q8FA 2BB5A 5IJFA 2JQRB 2XMOA 1FNVA 3H6NA 4W9KA 4NAMA 4KSKC 1SE4A 2PJHA 1WRIA 2BXLA 1ENFA 2O6VB 3TCAA 4HROA 3LDZE 2KMMA 2BS2B 1JWMD 4XGAB 2M0AA 2RPVA 2GBJA 1R4MB 1LFDA 1HZ6A 5GHKA 3WHQA 2LGSA 3LU7A 2W3RA 5AEKB 1HEZE 1FRDA 2W9NA 2MBHA 1S3SG 3LB8C 2KD0A 3KJLA 1PFDA 2V36A 2DYBA 4I6LB 4LA0A 3DBLB 1TXUA 4KV2A 1WJNA 3I9V1 4NPNA 2OT3A 1YN5A 2HTHA 4B95A 3QHTA 5IIXA 4CHKA 4GDXA 4GMVA 3B9MA 4DHZE 3N1XC 1C9FA 2CU1A 4FJYA 2Z8IA 2NTTA 2D3BA 1N60A 2LUEA 3UQAA 2KOXA 4IM2A 3FWCC 4W4UB 4US8A 1V1PB 1VRAB 2LUMA 2EFHA 2ZNVB 3AEAB 1OTRB 3AXCA 4W9FA 2KFKB 2XSIA 2VRRB 4FN2A 4XDDA 2BYVE 3Q69A 4ZRKA 3SQJA 1OQRA 2IGGA 1K51A 2C7MB 2D5GA 2GLSA 2WX0A 3BPJA 3P42A 1K53A 1TS3A 1KLGD 1PUTA 2V4LA 4WAAA 2YDFA 2KKCA 2ZCCA 3P4QB 3PSEB 3Q3JA 3UIVA 4LTUA 4QAYA 4ZBRA 2J0MA 2KQSA 2WDRB 4GG2A 2JYEA 4DHJB 2ON8A 3HM3A 3MJ5A 3VRBB 3O13A 1H9ZA 3V08A 4W9HA 3U4EG 3MP9A 3VAWA 5ID9A 2N7DA 3PHWB 4WAFA 1WX8A 1TKGA 1TT5B 1AARA 1N61A 4ANUA 3M63B 1YD8U 4WURA 4MH0E 4DXGA 1C1YB 2V0GA 3WALA 2N1WA 2OZBB 4LCDE 4TQ0A 1Q5WB 4XZ4A 5HHDG 1NEKB 4LJPB 5IFOA 4G3XB 1JW9D 1UWXA 3EFUA 2W82A 5BMGA 4MT5A 4FULA 4N6EB 3MFGA 4RNAA 2KVRA 1MVKA 1L6UA 2BXKA 2IGHA 2GBNA 1HK5A 3VUXA 3L54A 4HKQA 1C4AA 1LO5D 4OZAA 3CSTA 2J4XA 3ZNZB 1FO4A 1FFVA 2R2QA 3KIKA 1GG3A 3A1QB 3GZNI 1TTNA 2GBKA 2EMTA 2PPHA 1YQ4B 5CHFA 5C1ZA 4JWSC 2EFDA 1NYQA 2KO3A 3EECA 1FNWA 3NMUA 1WR1A 4OW0A 4JX1C 5DPSA 4MACA 4MM3B 4NAWB 1IUEA 4B9KA 3DWGC 3AECB 1KRHA 2NBWB 3DCGA 2BX8A 1PGBA 3AV8A 1ZXHA 1MG8A 3AEFB 4K3CA 2DZIA 1T6BX 1QOBA 1V5TA 1X1MA 3UF8A 4EZJA 4G03A 3NVWA 3TDLA 2DAFA 1WXSA 3RNAC 4Q2JA 2KJ6A 4NJCA 4GDLA 1P7FA 2Y5BB 3DBRI 1XLPA 2UU7A 3MTNB 2LGYA 4ZC6A 2C60A 3HHMA 4RF0A 3VTVA 1ZOYB 1FXAA 1XCQL 4ZYSA 3TUOA 1GC6A 3R3MA 1KOTA 1V8CA 3BVMA 1D5ZC 3FC4A 1E0ZA 4JGHB 1HE8A 5JH5C 1KW2A 3WIMA 2M4NA 2DG5A 1BT0A 2D3CA 3Q6BA 1YJIA 1WMHB 1E7BA 4G11A 2IO3B 3RT3B 2KLCA 3NOBA 1C4PA 2GOWA 2E3TA 2KK8A 3SD5A 3DQVA 2WXIA 2WS3B 2RR9A 3HRDD 3NVYA 4OVUA 4PT5A 1WGGA 2K8HA 3PRZA 4TV3A 5BO4B 2AJEA 3BVGA 3A1QA 5JHAA 2BXHA 4OTTA 4L9KA 2BXPA 2BXBA 1C76A 3NS1A 4ACFA 2NBVB 2NTSA 1QILA 1CK1A 5E6NA 5IN7A 1MHXA 2WXPA 4TMAB 1HXYD 2WP9B 5IJ5A 2QMTA 4ZYNA 4EZKA 2V1YA 3V05A 2UWQA 1IGCA 1RLFA 1WGRA 2HDEA 2EFEA 3WAPA 1L6VA 2C5LC 3RYTA 2BYEA 2BXMA 1N5XA 1T5XD 2DLBA 2OOBB 3P2BA 1XF5L 2LEKA 1QOAA 1FOUA 3HK0A 4GDLB 1PDXA 1WJUA 3LYYA 1GUAB 1R4NI 2KC2A 4MGKE 1F2RC 2PE9A 4WJPA 3L17A 1E10A 4DXAB 1GB4A 3W9CB 1YJJA 4OT2A 3GP7A 1WXAA 2WXFA 3I57A 4D2KA 5KHOA 3Q3OC 2XVUA 2KHWB 2KYWA 4H2AA 3RCZA 4F7ZA 4GGQA 2D3AA 2KNBA 3VTUA 2BXAA 1RAXA 1SE2A 4W9EA 3RNEC 1KF6B 3AMZA 1NBFC 3ZVVA 3E56A 2JF5A 5IOIA 1LXDA 3UINB 1IYFA 2BXOA 5AUIA 1WR6E 3GOEA 1DGJA 3V03A 2K8BA 2QM6A 1FFUA 2RDGA 4KGTA 4DM0A 3NVKA 4NQLB 2QMCA 1NI2A 3WAOA 2REXA 2HJ8A 1E90A 4K7WA 5J2RA 4A9AA 4HGMB 4BKSA 4DHJD 2FUG1 4BY9C 2WXQA 4F5VA 3GQXA 3RNCC 1J19A 4GIVA 3A33B 1C77A 4YXDB 4JIOU 2DWQA 2MJ3A 2WHIA 3H7PB 4HPMB 3ZDMC 1M4VA 4KGRA 2GBMA 3TSSA 3V62A 2NS5A 2M19A 4W9IA 4A6QA 2JUOA 4JL9A 1ZE3D 4DXFA 2LXCA 4AP4C 4GSWA 5FKAC 4N58A 3SR6A 1J8CA 4N3ZA 1F52A 4Z69A 3W5VB 4IOIE 2BKFA 4YSZB 3WCQA 2FCNA 3IG3A 4LDTD 2LJIA 1GNUA 2MCNB 2E0YA 2WU5B 1EWCA 1WE6A 2SEBD 1BJ5A 4P7IA 1ET9A 2AYOB 3AE8B 1ZUD2 4RF1A 1V9JA 3ENEA 4FJVB 5LNK1 4IG7B 2BS4B 4XWTA 5C3JB 2V3SA 4JPSA 2N4FA 5CHWA 4RH6A 2KDEB 3R2IA 3VFKA 2KWUB 3Q2AC 1NDDA 5G5GA 2MHJA 2LXTA 3ML8A 5D3IB 4C56C 5AZHA 1ISNA 1YNTE 5DPRA 1P1AA 2BQQA 1RRBA 2KQ4X 4M70B 1HK2A 3QCAA 3FKYA 4LJOB 2KDIA 1WJ4A 2IDYA 4M00A 2QEJC 3KUCB 4W9JA 3ZNGC 4F5TA 3AB5A 4PS8A 2IO2B 3PTFC 4A55A 3ZLZA 5FK9C 2ONQA 2KVZA 3QA8A 3CX9A 5JXVA 1HA2A 1FXTB 5J17A 2ZPYA 3NVIA 3U30A 2CKXA 2QILA 2QCZA 4S1YA 2D10A 4CO7A 4F5SA 2RSUA 3Q14C 2B76B 2I1JA 3AE4B 3MC9A 4LUFA 2ZNVC 4ANXA 5IJEA 1MPEA 2NNWA 1VZSA 3QAQA 4EMXA 3DBSA 1E7UA 1UUPA 1HQRD 1JNBA 2A5UA 2LFIA 3SIUB 2K8CA 2K1FA 1J7EA 4JK4A 3NS8A 5D6JB 2NPTB 2XN9C 5BYSA 1N6ZA 2QC8A 3NRZA 2LRWA 3L0WB 2I1KA 2DENB 2AL6A 3ZIMA 3FNMA 4LK0M 4IWOA 4YTMB 4JLCA 3X0WA 3M99C 4C4VA 2D3GA 1A5RA 1T0RC 3ZRCA 1G6JA 2CJOA 2ROHA 3B2GA 2WQYB 2GB1A 3A4RA 4ICUA 1PGXA 3JVZX 2MRPA 5GIOA 2VDBA 1OQQA 4PK1A 1FXIA 1L5PA 3N1YC 4FJCB 3GE8C 2IGDA 2N7JA 2C9WB 5CX3A 2LQHA 1VZ6A 4LLGM 1EU4A 2IJ0A 1TGZB 4FXCA 3VTWA 2N9EB 4GDKA 2JRHA 4LNOA 5EE9A 3U7DA 3IAS1 4E99A 1GB1A 3ZUNA 3IBEA 1C79A 4KKIA 3V6CB 3RNFC 2CKHB 2FUHB 2KMCA 3M95A 4ZBQA 4IDIA 3AEBB 4HJKA 3ZO5B 2QHBA 4IWQA 3MHZA 4MJSA 4XX5A 5DQFA 3MJWA 1VFIA 4G01A 5IIUA 3AE1B 3IT6B 3BYYB 1BKEA 2MJEA 2V3NA 4GN1A 1CZPA 1KXPD 4MGYE 1UNSA 3U2SC 2LVOA 3AEGB 1NT2B 4RMAA 2I30A 1VZ8A 2PVOD 4G04A 2LOQA 1YX5B 3KQ4A 4MM3A 2M56B 1E7AA 3ZRFA 3TIXA 3JSVA 1UELA 4GXBA 1WM2A 3MC0B 1MIYA 2DBUA 2KN4A 1HA5A 2LI5A 2JZZA 1Y8RC 3V09A 2XK5B 3NZ3A 5IKCM 2HTME 2DYOA 3GA9L 1JQ4A 4KZCA 4L8UA 1P98A 2IO1B 5G2NA 4ANVA 2YEPF 1BMLC 2EKIA 2R2OA 2XVWA 4HWIB 5EDSA 3UIOB 3IFWB 1VR9A 2FCQA 4EUTA 1L7YA 3SHQA 1FMAD 3JSVB 3AN1A 2PKOA 4IKGA 4MBEC 3N1ZC 2CS4A 3GQUA 4WJQA 2Z8LA 1SBBB 2BW2A 3M3JA 1Y56A 4B6WA 2W3SA 1IP9A 2YVCA 1Q10A 1YQ3B 2J53A 3OJ4B 1IPGA 2AGHB 3E9SA 3WAMA 1VJKA 1E7VA 2WX1A 3QK0A 2KC1A 5G55A 4E71A 2JZPA 2G1EA 3ZJTA 4PO0A 2ZJDA 4F1SA 1E6EB 2Z0EB 4P6VF 4I9OA 1UBQA 2L83A 1TY2A 2D2QA 2AQ2B 1FCLA 2WLBA 4AWJA 2HJ1A 3AU5A 3BZDB 4AQ7A 5ID7A 4BZAA 4AS1A 5C2TB 2KWFA 3C0RB 1XD3B 3BK2A 3QJZA 1NENB 3DHHC 3KYDD 1AO6A 2AEHA 3TEXA 2N9PC 4EKUA 3ZW3A 4WH4A 4DK5A 4LDTB 4OZBA 1JRUA 2MX2A 2EMSA 5HKHA 2N9XA 3NUHB 4MDKE 5TR5A 2BBCA 3B1LX 1UWMA 4NJ7A 3LJ3A 2HE7A 5G5HA 2L8JA 4HCPB 4WIPA 2ZW1A 3ZXVA 2ZZPB 1FCCC 1J7CA 2CR5A 5KHQA 3RZFA 3ZYYX 4XC2A 3P4SB 3VUYA 2BKRB 4C80A 4CQNA 3ABVB 3LU8A 4ZOHC 3HIZA 4C7ZA 1STEA 5FR6A 3A4SC 3QC8B 3H1UA 4IW1A 4KGSA 4I6NB 2XVQA 1XEEA 3Q8EA 5HG2A 5IO9A 3VR9B 4MGZE 1SE3A 1OQYA 3HVDA 4HXDA 2JY6A 1DOYA 3TMPB 2VZKB 5HI1A 3JQZA 4MSQB 2V3PA 1XLOA 3APFA 2DYMA 1M94A 1TJEA 3SFDB 1NYRA 1TIFA 1V81A 4WA6B 4C00A 1L0VB 1WX9A 1JWSD 1J78A 4PYZA 2V9HA 2X38A 4LUHA 3AE7B 3AE2B 2J52A 2BWFA 2L3ZA 3N30A 1GC7A 1QZEA 1IBXA 4J6IA 3A73A 1VD2A 4M8MA 3A9KB 4E74A 3DBHB 1V1PA 1UD7A 2ASQA 4K7UA 2G3QB 2ZVOA 3CMMB 1V2YA 1JROA 2L7RA 1I35A 2NPTA 3DHIC 3LU6A 1LM8B 1F2RI 1PGAA 5DPWA 3V6EB 1MHHE 3DPDA 1E7GA 2Z8JA 3BK1A 2L52A 1WIAA 2XW1A 2MWSB 5CHVC 2AQ1B 1Z5SB 2K6DB 1RWSA 1IGDA 3Q8AA 2O2VA 2JRIB 1WI0A 2BB6A 4ZBKA 4HPLB 2CU3A 4NAWA 1I4GA 3VVWB 1J0GA 4EFOA 1T0YA 1D5MC 1WRDB 4LB9A 2WYQA 1K50A 2BF8B 1MM8A 1L4DB 1OFFA 4W9DA 1WZ3A 2PVGC 2VH2A 3U8ZA 1D6EC 5AUKA 2INCC 1J7BA 3RPFC 2LJ5A 1TKYA 4JQWC 3VXWA 4ICVA 4PYUA 4JWUC 2DZKA 3TBLD 3C8YA 1QQRA 3U7ZA 3B2FA 1RFKA 1U4AA 2BYTA 4OR0A 4HRSA 4NQKE 3RNGC 3PPAA 2Z0DB 3PLAA 5GXGB 1YIWA 4A3OA 2CHZA 2KWCA 4C7YA 3APDA 3RI7C 2FIDA 3GZNB 1AWDA 3BIID 2WGSA 2BXCA 2BXFA 4I6PA 4A20A 4MGIE 3R8BA 2DZMA 2KWVB 4XYCA 1KFYB 4ITKA 3ZGZA 3Q3FA 2BVCA 3CIRB 3CWIA 4GB9A 4ZRQA 4EZLA 2G9HD 3P4RB 3NZSA 2R61A 1R4MI 4KDLB 1MG4A 2CJNA 4GDKB
chains in the Genus database with same CATH topology
4RGTA 2KQ7A 5DPTA 2KLGA 3NY5A 4A90A 2FCSA 1WYGA 2IYDB 2WXRA 4KKJA 1E8WA 3D32A 3IT4B 1BXTA 1R7SA 1QOFA 4FHJA 5AZFA 4K1RB 4A3PA 2WNMA 2YEPB 4F8CB 1LOTA 5E6OA 4OVVA 5TSSA 2JT4B 2W54A 3QX1A 2OHFA 3IXSA 4DDID 3EA6A 2LGDA 1E8YA 1MI0A 1SJED 4GOCA 4ARIA 1JALA 1SB3C 4HDQA 5GINA 2O6VD 2KN5A 3AEDB 4II2B 4RM9A 1I4QA 4RCOA 3IAM1 3HM6X 3SFEB 3ZKJC 3I3TB 3B9LA 2N7EA 1L4ZB 1JWAD 3O65B 4BOZB 3AI5A 4IC7B 3H3AA 3CF6E 2PMVA 1I4RA 2LGIA 2VUEA 4NNJB 3FWBC 5GIPA 1RM6C 4YSYB 1ET6A 1H5WA 3ECIA 1K8RB 3L16A 3N3KB 4WJOA 3PLUA 3B9JA 1I42A 3NHEB 2M0XA 2DBWA 2BTEA 1QKZA 1FD6A 5JHBA 3QIJA 1AYFA 1N62A 2J0KA 4RFBA 3WANA 1WGHA 2K6QA 2PLPA 2Q5WD 1GNIA 2KACA 4DBGA 1V49A 2BT6A 3KWLA 1VLBA 2JSVX 3QWZB 2JPHA 3PRMB 2TSSA 2K22A 3RFZB 4M8NA 4FLHA 1GJZA 4ZDVA 1TKEA 3K9PB 2O6VA 4ASWC 3DVNU 2M1MA 2KFKA 2RPQA 1H4RA 4XE0A 2OJRA 3UQBA 4FJZA 2L0FA 2N1VA 2KDFB 2RDHA 1JWUD 4L23A 4KIKA 2NQOA 4XDCA 2IO0B 1TY0A 3TL5A 5FUOA 2LHEA 3ONSA 2C7NB 2YLMA 3TJPA 3PT2B 1FNUA 3W5UB 1I4PA 3ZNHB 3GB1A 3T8MA 4F5UA 3GS2A 1KM7A 3UGBB 2Y5CA 4MH8A 1TZ1A 1WXVA 5D3DA 1DOXA 5LXIB 3ETRA 4KSLC 3SEBA 2WXHA 1WGDA 1JCKB 4NY0A 1GAQB 2PE6B 2KZRA 4LB2A 1XLQA 2LASA 1A70A 1SE9A 5BMHA 3AULA 1N63A 3AH7A 4ZHPA 1FM0D 3KUDB 3DVGY 4WWNA 2QSDA 3N9YC 5HFYA 1VCBA 3OJ3A 4PS3A 2KTFA 1VZ7A 1SJHD 1FEHA 5AZGA 1KH0A 4KDIC 4HEA1 4FADA 1TS5A 2AL3A 1GNJA 2WWZA 1I7HA 1F77A 1D5XC 2ZPNA 4URKA 2JXTA 4RGNA 1F9JA 1WXQA 3OLMD 1UGJA 2PIAA 2KWDA 2QIEB 5J18A 5DBYA 1C3TA 4B0MA 2L76A 2EKEC 1ZDXA 2KBZA 5B5TA 4HKZE 1HK1A 1WSPA 3LXFA 1ZPSA 4DWFA 1WWTA 2K0PA 1E78A 2KAJA 2NMQA 4O1NA 5BYQA 3ZNID 4W9GA 2LWPA 1AW7A 4BKSD 2LMCA 3PZ7A 2ZVNA 2ZW0A 1P7EA 3VRAB 2E6XA 4B0EA 4FK5B 1E7PB 2KX0A 2MP2B 4WJNA 2JZ3B 1WZ0A 4FBJB 1XCTL 1CMXB 4J3OD 4IW0A 4TUUA 4BFRA 3PS6A 2VUFA 2WDTB 3W1SC 3T3OA 1IJGA 3X23A 1UGMA 1V5OA 2PEAA 1Z2MA 4BKEA 2EFCA 4HDOA 3G9KD 1UBIA 3CSFA 3T9LA 5L83A 1OGWA 1FIQA 2KTRB 1V86A 4MSMB 3KH0A 2KJRA 3SU8X 2WXKA 1TYGB 1WFYA 2NBUA 5LLIA 2MBQA 4ZCGA 3A9JA 4GU2A 3P4PB 4KX6B 1EUVB 2KJHB 2N9LA 4AJWA 1E7IA 3R7QA 3JYUA 1TS2A 4KVGB 1B1ZA 3DVNV 1KLVA 4PS7A 1GPXA 2MSED 4X57B 4L1BA 4OTUA 2BXIA 1L0XB 2MEKA 1CQVA 1HZ5A 2INPE 2V4IB 4HJGE 2C7HA 2KANA 4AOFA 4FA6A 1E7EA 3AE5B 1D4BA 2AX5A 4OZCA 4RGMA 4MEMA 3DBLI 1EWYC 4OHJA 3VR8B 3APCA 4USAA 1DOIA 2D11A 2MBEA 4IUMB 2BXGA 1WJ6A 4WWOA 3UI3A 1EO6A 2IZVB 1YN3A 1VDVA 2O2VB 2K3UA 3H7SA 5IA7A 3KWVA 2M17A 3UIPB 2JUHA 4L2YA 2LRUA 3RZWC 3K9OB 3BWUD 2J0JA 2CHXA 4GLSC 2INNE 2MBOA 2E0XA 1ACCA 4EE2A 4JE3B 2XW0A 3PVLA 4HLEA 1P3QU 2Z59B 1T3QA 2GBRA 1YN4A 1S1QB 2XEWA 1GOZA 3W1YA 1C78A 3M62B 1F0ZA 1DYQA 5FR3A 1PYWD 4WQMA 4BVUC 2JU6X 3AM9A 2I38A 3B0AA 3ZJUA 3ICXA 2IPKD 1UZXB 1SSNA 2M8SA 1OEYJ 3ALBA 2VZKD 1PQSA 4MELA 4NZLB 1TF0A 1ZDVA 3QARA 4N59A 4YTPB 1QLBB 4UDUC 2G45B 5EE1A 4ZRIA 2JXXA 2NR2A 2LZ6A 1WXMA 2Y3AA 1JWBD 2BXQA 3ZJVA 5H8YE 4J2VA 4IW2A 2L1AA 2IY0B 4NJ6A 2MQJA 3NZUA 1P9DU 2ZEQA 2LGXA 4HCNB 3L4PA 1ZGUB 1E7FA 1SF0A 4YWGG 2RGFA 3PLVA 5IAAC 4M0WB 1WF9A 4HK2A 3ZDTA 4DDGD 1P0RA 4KZ0A 2ACZB 1C4CA 2BPSA 3W2DA 4XWWA 3W1SA 5HOZA 2MJDA 3OWEB 1ESFA 2IY1B 2BXEA 3S2AA 2KDMA 4BBNC 1BUIC 3RUIB 2BXDA 5MPOA 1HK3A 1ZW7A 1N5WA 3U52E 2L0TA 1WY8A 3NVMA 3BVZA 4RGOS 3IVFA 1MIVA 1I4HA 4BBNF 2RD0A 1TS4A 4A8XC 1B9RA 2L32A 3MHHB 1QOGA 1SXTA 2L00B 2QJLA 3H8HA 4FHKA 1ZKHA 3IHPC 3MHSB 1NI3A 1E7HA 3FAHA 1N5UA 3EC8A 2K25A 1RFAA 2I2YA 4DQOC 2LVQA 1V6EA 4KIKB 3AE9B 3DVGX 2WXLA 4REZA 3DOWA 2XVVA 2AQ3B 5BMIA 5LXHA 3H37A 1EU3A 2JX5A 2KDBA 2H88B 5I4DA 3N32A 4P16A 1WX7A 1JMLA 2FNJB 1YMHE 3RD2A 1QF6A 4W9CA 3L10B 3R66C 4ZRPA 3VH4B 4II3B 2MP2A 2JYTA 3NVVA 1K52A 4N0UD 1Q0WB 3ML9A 3B08A 2JWUA 1EM7A 2XBBC 4G50A 2FE8A 3H7PA 3HVZA 2A4ZA 2FBWB 1SIJA 3MHSD 2JWZA 1KTKA 1NVID 3ZTDA 1AN8A 1IBXB 1WYWB 3A9KA 1D3ZA 1WH3A 5BPKA 2QHOA 2PTLA 2JVCA 5IIHA 3WHRA 1SEBD 1I4XA 4YT0B 3R7RA 2K39A 4K81A 1ZXIA 1O9XA 3Q8BA 3Q8CA 5BYRA 2NCNA 1MA9A 4YL8A 1L0YB 3P63A 3QQ8B 3SIVB 4K2CA 3J9CA 4K7SA 5JZEB 3AE3B 2MBBB 3JRYA 4N9F4 1XO3A 3AE6B 3H9DA 1HK4A 3PV1A 2KX3A 1OEYA 1SIFA 2MH7A 4HGKA 2J7QB 4WWPA 1H8CA 3TEZA 1LNSA 3WA0A 3NVZA 3PRPB 1QT9A 2MLBA 4K71A 1MIWA 1UH6A 3BYTB 2K9XA 2D07B 2Y5PA 1WM3A 2BYFA 2FIFA 2OEDA 3RULA 4W9LA 2WDVB 2EELA 3FILA 2BXNA 3WHSA 1KJTA 1WMHA 2UYZB 5DCNA 1CJEA 3JW0X 1ROEA 1RYJA 3AU4A 1V97A 1XXGA 2BS3B 2WXGA 4ZRJA 2MA9B 2KTRA 3A75A 5EE3A 1V80A 4YTNB 3V3XA 3L08A 2CHWA 3V61A 1E9MA 4L9QA 2XNAC 1YX6B 2KFJA 5EE0A 3A9JB 1UORA 3PGEA 2DHZA 4DHZB 4G0NB 3FILB 3ZQ4A 4HVBA 3EGRA 1E5WA 1ZP0B 4MJSB 1EF5A 3DWMA 1XQQA 4ZHOA 4TQ1A 1E8XA 1LQBA 3KVFB 1WE7A 3TEWA 5D2MB 2GMIC 1WGKA 1XT9B 2WXMA 5E6JA 1SGHA 1FRRA 2L05A 5L95C 1WGYA 4EEWA 5E6PA 2DAJA 5GMVA 2BWES 4ARCA 4ANWA 2DBXA 4AJYB 3VDZA 5CTRC 1EF1A 4BKGA 2B3AA 3VUWA 3ZTCA 2H89B 3P1MA 4C31B 2Z8KA 2ZCBA 4E3CA 2WU2B 3PZ8A 1YQBA 1KLUD 4AUQC 4IM0A 3DBHI 3PZDA 4ZUXV 2LD9A 2K5PA 1JRPA 4R3DA 2IBIB 2AWTA 3VH3B 3URYA 1J7AA 2GRIA 3V60A 3PO0A 4BOSC 3KLSX 4DHXB 2WXOA 4YSXB 4US9A 1Q1OA 3KUZA 4M0WA 3BINA 3VHTC 3R2TA 2J42A 3KW5B 2G4DB 1E8ZA 3EHVA 2ICIA 3AEEB 2I2ZA 2BGFA 3OAWA 3L13A 2DX5B 4TKNA 2LXAA 3BY4B 1TZOA 2WXNA 5C23A 5D94A 2WXJA 2G4SA 3PREA 4WWMA 2DZJA 3T3NA 2FAZA 1XLNA 1TBEA 4Z9OA 2DBYA 2GI9A 3TEYA 4RM8A 1E7CA 4IM3A 5D7GA 4N0FD 2PW9A 3KYCD 4CYEA 4TSSA 3HUIA 3DDCB 2RMMA 2N9KA 2W55A 5T8IA 5H92C 1BM0A 2FCMA 1L2NA 2HD5B 4WQOB 3SDLC 3VQIA 3PHXB 2WDQB 1YJ1A 2MW5A 3EUB2 2KMAA 1V1OA 4OVZA 4EOYA 2SAKA 2KXJA 4IWPA 4FIPB 2XK5A 2N0SB 4BKTA 2LHDA 2NVUI 2LVPA 3Q8FA 2BB5A 5IJFA 2JQRB 2XMOA 1FNVA 3H6NA 4W9KA 4NAMA 4KSKC 2PJHA 1SE4A 1WRIA 2BXLA 1ENFA 2O6VB 3TCAA 4HROA 3LDZE 2KMMA 2BS2B 1JWMD 2M0AA 2RPVA 2GBJA 1LFDA 1HZ6A 5GHKA 3WHQA 3LU7A 2W3RA 5AEKB 1HEZE 2W9NA 1FRDA 2MBHA 1S3SG 3LB8C 2KD0A 3KJLA 1PFDA 2V36A 2DYBA 4I6LB 4LA0A 1TXUA 4KV2A 1WJNA 3I9V1 4NPNA 2OT3A 1YN5A 2HTHA 4B95A 3QHTA 5IIXA 4CHKA 4GDXA 4GMVA 3B9MA 4DHZE 1C9FA 2CU1A 4FJYA 2Z8IA 2NTTA 1N60A 2LUEA 3UQAA 2KOXA 4IM2A 3FWCC 4W4UB 4US8A 1V1PB 1VRAB 2LUMA 2EFHA 2ZNVB 3AXCA 1OTRB 3AEAB 4W9FA 2KFKB 2XSIA 2VRRB 4FN2A 4XDDA 2BYVE 3Q69A 4ZRKA 3SQJA 1OQRA 2IGGA 1K51A 2C7MB 2D5GA 2WX0A 3P42A 1K53A 1TS3A 1KLGD 2V4LA 4WAAA 1PUTA 2YDFA 2KKCA 2ZCCA 3PSEB 3Q3JA 3P4QB 3UIVA 4LTUA 4ZBRA 2J0MA 2KQSA 2WDRB 4GG2A 2JYEA 4DHJB 2ON8A 3HM3A 3MJ5A 3VRBB 3O13A 1H9ZA 3V08A 4W9HA 3U4EG 3MP9A 3VAWA 5ID9A 2N7DA 3PHWB 4WAFA 1WX8A 1TKGA 1AARA 1N61A 4ANUA 3M63B 1YD8U 4WURA 4MH0E 4DXGA 1C1YB 2V0GA 3WALA 2N1WA 2OZBB 4LCDE 4TQ0A 1Q5WB 4XZ4A 5HHDG 1NEKB 4LJPB 5IFOA 4G3XB 1JW9D 1UWXA 3EFUA 2W82A 5BMGA 4MT5A 4FULA 4N6EB 3MFGA 4RNAA 2KVRA 1MVKA 1L6UA 2BXKA 2IGHA 2GBNA 1HK5A 3VUXA 3L54A 4HKQA 1C4AA 1LO5D 4OZAA 3CSTA 3ZNZB 2J4XA 1FO4A 1FFVA 2R2QA 3KIKA 1GG3A 3A1QB 3GZNI 1TTNA 2GBKA 2EMTA 2PPHA 5C1ZA 5CHFA 1YQ4B 4JWSC 2EFDA 1NYQA 2KO3A 3EECA 1FNWA 3NMUA 1WR1A 4OW0A 4JX1C 5DPSA 4MACA 4MM3B 4NAWB 1IUEA 4B9KA 3DWGC 3AECB 1KRHA 2NBWB 3DCGA 2BX8A 1PGBA 3AV8A 1ZXHA 1MG8A 3AEFB 2DZIA 1T6BX 1QOBA 1V5TA 1X1MA 4EZJA 3UF8A 4G03A 3NVWA 3TDLA 2DAFA 1WXSA 4Q2JA 2KJ6A 4NJCA 4GDLA 1P7FA 2Y5BB 3DBRI 1XLPA 3MTNB 2LGYA 4ZC6A 2C60A 3HHMA 3VTVA 4RF0A 1ZOYB 1FXAA 1XCQL 4ZYSA 3TUOA 1GC6A 3R3MA 1KOTA 1V8CA 3BVMA 1D5ZC 3FC4A 1E0ZA 4JGHB 1HE8A 5JH5C 1KW2A 3WIMA 2M4NA 2DG5A 1BT0A 1YJIA 1WMHB 1E7BA 4G11A 2IO3B 3RT3B 2KLCA 3NOBA 1C4PA 2GOWA 2E3TA 2KK8A 3SD5A 3DQVA 2WXIA 2WS3B 2RR9A 3HRDD 3NVYA 4OVUA 4PT5A 1WGGA 2K8HA 3PRZA 4TV3A 5BO4B 2AJEA 3BVGA 3A1QA 5JHAA 2BXHA 4OTTA 4L9KA 2BXPA 2BXBA 1C76A 3NS1A 2NBVB 2NTSA 1QILA 1CK1A 5E6NA 1MHXA 2WXPA 4TMAB 1HXYD 2WP9B 5IJ5A 4ZYNA 2QMTA 4EZKA 2V1YA 3V05A 2UWQA 1IGCA 1RLFA 1WGRA 2HDEA 2EFEA 3WAPA 2C5LC 3RYTA 1L6VA 2BYEA 2BXMA 1N5XA 1T5XD 2DLBA 2OOBB 3P2BA 1XF5L 2LEKA 3HK0A 1FOUA 1QOAA 4GDLB 1WJUA 1PDXA 3LYYA 1GUAB 1R4NI 2KC2A 4MGKE 1F2RC 2PE9A 4WJPA 3L17A 1E10A 4DXAB 1GB4A 3W9CB 1YJJA 4OT2A 3GP7A 1WXAA 2WXFA 3I57A 4D2KA 5KHOA 2XVUA 2KHWB 4H2AA 3RCZA 4F7ZA 4GGQA 2KNBA 3VTUA 2BXAA 1RAXA 1SE2A 4W9EA 1KF6B 3AMZA 1NBFC 3ZVVA 3E56A 2JF5A 1LXDA 3UINB 1IYFA 2BXOA 5AUIA 1WR6E 3GOEA 1DGJA 3V03A 2K8BA 2QM6A 1FFUA 2RDGA 4KGTA 3NVKA 4NQLB 2QMCA 1NI2A 3WAOA 2REXA 2HJ8A 1E90A 4K7WA 5J2RA 4A9AA 4HGMB 4BKSA 4DHJD 2FUG1 4BY9C 2WXQA 4F5VA 3GQXA 1J19A 4GIVA 3A33B 1C77A 4YXDB 4JIOU 2DWQA 2MJ3A 3H7PB 4HPMB 3ZDMC 1M4VA 4KGRA 2GBMA 3TSSA 3V62A 2NS5A 2M19A 4W9IA 4A6QA 2JUOA 4JL9A 1ZE3D 4DXFA 2LXCA 4AP4C 4GSWA 5FKAC 4N58A 3SR6A 1J8CA 4N3ZA 4Z69A 3W5VB 4IOIE 2BKFA 4YSZB 3WCQA 2FCNA 3IG3A 4LDTD 2LJIA 1GNUA 2MCNB 2E0YA 2WU5B 1EWCA 1WE6A 2SEBD 1BJ5A 4P7IA 1ET9A 2AYOB 3AE8B 1ZUD2 4RF1A 1V9JA 3ENEA 4FJVB 5LNK1 4IG7B 2BS4B 4XWTA 5C3JB 2V3SA 4JPSA 2N4FA 5CHWA 4RH6A 2KDEB 3R2IA 3VFKA 2KWUB 1NDDA 5G5GA 3ML8A 5D3IB 4C56C 5AZHA 1ISNA 1YNTE 5DPRA 1P1AA 1RRBA 2KQ4X 4M70B 1HK2A 3QCAA 4LJOB 2KDIA 1WJ4A 2IDYA 2QEJC 3KUCB 4W9JA 3ZNGC 4F5TA 4PS8A 3AB5A 2IO2B 3PTFC 4A55A 3ZLZA 5FK9C 2ONQA 3QA8A 3CX9A 5JXVA 1HA2A 1FXTB 5J17A 2ZPYA 3NVIA 3U30A 2CKXA 2QILA 4S1YA 2D10A 4CO7A 4F5SA 2RSUA 2I1JA 2B76B 3AE4B 4LUFA 2ZNVC 4ANXA 5IJEA 1MPEA 2NNWA 1VZSA 3QAQA 4EMXA 3DBSA 1E7UA 1UUPA 1HQRD 1JNBA 2A5UA 2LFIA 3SIUB 2K8CA 2K1FA 1J7EA 4JK4A 3NS8A 5D6JB 2NPTB 2XN9C 5BYSA 3NRZA 2LRWA 3L0WB 2I1KA 2DENB 2AL6A 3ZIMA 3FNMA 4LK0M 4IWOA 4YTMB 4JLCA 3X0WA 3M99C 2D3GA 1A5RA 3ZRCA 1G6JA 2CJOA 2ROHA 3B2GA 2WQYB 2GB1A 3A4RA 4ICUA 1PGXA 3JVZX 2MRPA 5GIOA 2VDBA 1OQQA 1FXIA 1L5PA 4FJCB 2IGDA 2N7JA 2C9WB 5CX3A 1VZ6A 4LLGM 1EU4A 2IJ0A 1TGZB 3VTWA 4FXCA 2N9EB 4GDKA 2JRHA 3U7DA 5EE9A 3IAS1 4E99A 1GB1A 3ZUNA 3IBEA 1C79A 4KKIA 3V6CB 2CKHB 2FUHB 2KMCA 3M95A 4ZBQA 4IDIA 3AEBB 4HJKA 3ZO5B 2QHBA 4IWQA 3MHZA 4MJSA 4XX5A 5DQFA 3MJWA 1VFIA 4G01A 5IIUA 3AE1B 3IT6B 3BYYB 1BKEA 2MJEA 2V3NA 4GN1A 1CZPA 1KXPD 4MGYE 1UNSA 3U2SC 2LVOA 3AEGB 1NT2B 4RMAA 2I30A 1VZ8A 2PVOD 4G04A 2LOQA 1YX5B 4MM3A 3KQ4A 2M56B 1E7AA 3ZRFA 3TIXA 3JSVA 1UELA 4GXBA 1WM2A 3MC0B 1MIYA 2DBUA 2KN4A 1HA5A 2LI5A 2JZZA 1Y8RC 3V09A 2XK5B 3NZ3A 2HTME 2DYOA 3GA9L 1JQ4A 4KZCA 4L8UA 1P98A 2IO1B 5G2NA 4ANVA 2YEPF 1BMLC 2EKIA 2R2OA 2XVWA 4HWIB 5EDSA 3UIOB 3IFWB 1VR9A 2FCQA 4EUTA 1L7YA 3SHQA 1FMAD 3JSVB 3AN1A 2PKOA 4IKGA 4MBEC 2CS4A 3GQUA 4WJQA 2Z8LA 1SBBB 2BW2A 3M3JA 4B6WA 1Y56A 1IP9A 2W3SA 2YVCA 1Q10A 1YQ3B 3OJ4B 2J53A 1IPGA 3E9SA 3WAMA 1VJKA 1E7VA 2WX1A 3QK0A 2KC1A 5G55A 4E71A 2JZPA 2G1EA 3ZJTA 4PO0A 2ZJDA 4F1SA 1E6EB 2Z0EB 4P6VF 1UBQA 2L83A 1TY2A 2D2QA 2AQ2B 1FCLA 2WLBA 4AWJA 3AU5A 3BZDB 4AQ7A 5ID7A 4AS1A 5C2TB 3C0RB 1XD3B 3QJZA 3BK2A 1NENB 3KYDD 1AO6A 2AEHA 3TEXA 2N9PC 4EKUA 3ZW3A 4DK5A 4WH4A 4LDTB 4OZBA 1JRUA 2MX2A 2EMSA 5HKHA 2N9XA 4MDKE 3NUHB 5TR5A 2BBCA 3B1LX 1UWMA 4NJ7A 3LJ3A 2HE7A 5G5HA 2L8JA 4HCPB 4WIPA 2ZW1A 2ZZPB 1FCCC 2CR5A 5KHQA 1J7CA 3RZFA 3ZYYX 4XC2A 3P4SB 3VUYA 2BKRB 4C80A 4CQNA 3ABVB 3LU8A 4ZOHC 3HIZA 4C7ZA 1STEA 5FR6A 3A4SC 3QC8B 3H1UA 4IW1A 4KGSA 4I6NB 2XVQA 1XEEA 3Q8EA 5HG2A 3VR9B 4MGZE 4HXDA 1OQYA 1SE3A 3HVDA 2JY6A 1DOYA 3TMPB 2VZKB 5HI1A 3JQZA 4MSQB 2V3PA 1XLOA 3APFA 2DYMA 1M94A 1TJEA 3SFDB 1NYRA 1V81A 4WA6B 1L0VB 1WX9A 1JWSD 1J78A 4PYZA 2X38A 4LUHA 3AE7B 3AE2B 2J52A 2BWFA 2L3ZA 3N30A 1GC7A 1QZEA 1IBXA 4J6IA 3A73A 1VD2A 4M8MA 3A9KB 4E74A 1V1PA 1UD7A 2ASQA 4K7UA 2G3QB 2ZVOA 3CMMB 1V2YA 2L7RA 1I35A 1JROA 2NPTA 3LU6A 1LM8B 1F2RI 1PGAA 5DPWA 3V6EB 1MHHE 3DPDA 1E7GA 2Z8JA 3BK1A 2L52A 1WIAA 2XW1A 2MWSB 5CHVC 2AQ1B 1Z5SB 2K6DB 1RWSA 1IGDA 3Q8AA 2O2VA 2JRIB 1WI0A 2BB6A 4ZBKA 4HPLB 2CU3A 4NAWA 1I4GA 3VVWB 1J0GA 4EFOA 1T0YA 1D5MC 1WRDB 4LB9A 2WYQA 1K50A 2BF8B 1L4DB 4W9DA 1OFFA 1WZ3A 2PVGC 3U8ZA 1D6EC 5AUKA 1J7BA 3RPFC 2LJ5A 4JQWC 1TKYA 3VXWA 4ICVA 4PYUA 4JWUC 2DZKA 3TBLD 3C8YA 1QQRA 3U7ZA 3B2FA 1RFKA 1U4AA 2BYTA 4OR0A 4HRSA 4NQKE 3PPAA 2Z0DB 3PLAA 5GXGB 1YIWA 4A3OA 2CHZA 2KWCA 4C7YA 3APDA 2FIDA 1AWDA 3BIID 2BXCA 2BXFA 4I6PA 4A20A 4MGIE 3R8BA 2DZMA 2KWVB 1KFYB 4ITKA 3ZGZA 3Q3FA 3CIRB 3CWIA 4GB9A 4EZLA 4ZRQA 2G9HD 3P4RB 3NZSA 2R61A 1R4MI 4KDLB 2CJNA 4GDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  4FN2 A;  3W1S A;  2KQ7 A;  2ZNV C;  5DPT A;  2BYV E;  2KLG A;  3NY5 A;  2IY1 B;  3S2A A;  2FCS A;  4ANX A;  4BBN C;  4ZRK A;  3RUI B;  2IYD B;  3QAQ A;  2C7M B;  3DBS A;  1E8W A;  1ZW7 A;  3D32 A;  1E7U A;  2WX0 A;  2A5U A;  2L0T A;  1WY8 A;  4FHJ A;  5AZF A;  4K1R B;  2K8C A;  4A3P A;  2K1F A;  4F8C B;  2V4L A;  4WAA A;  4OVV A;  5E6O A;  2KKC A;  2ZCC A;  3PSE B;  3Q3J A;  2JT4 B;  3IVF A;  3NS8 A;  5D6J B;  2NPT B;  2J0M A;  2KQS A;  4BBN F;  2RD0 A;  3QX1 A;  4DHJ B;  2LRW A;  3L0W B;  3HM3 A;  4DDI D;  2I1K A;  2LGD A;  1E8Y A;  2DEN B;  4GOC A;  2AL6 A;  2L00 B;  3ZIM A;  4HDQ A;  4FHK A;  1ZKH A;  2O6V D;  4W9H A;  4IWO A;  3IHP C;  2KN5 A;  4JLC A;  4II2 B;  4RM9 A;  3X0W A;  3VAW A;  2D3G A;  1A5R A;  2N7D A;  3EC8 A;  3HM6 X;  3PHW B;  3ZRC A;  1G6J A;  2K25 A;  3ZKJ C;  1RFA A;  3I3T B;  1WX8 A;  2N7E A;  2LVQ A;  1V6E A;  3A4R A;  1AAR A;  4ICU A;  4KIK B;  4ANU A;  3M63 B;  3DVG X;  1YD8 U;  3JVZ X;  3O65 B;  4BOZ B;  3DOW A;  4MH0 E;  3AI5 A;  4IC7 B;  2MRP A;  1C1Y B;  3CF6 E;  3WAL A;  5LXH A;  2N1W A;  4LCD E;  4NNJ B;  2KDB A;  4TQ0 A;  1Q5W B;  4XZ4 A;  2C9W B;  5CX3 A;  4LJP B;  3ECI A;  1K8R B;  3L16 A;  3N32 A;  3N3K B;  4WJO A;  3PLU A;  4G3X B;  1I42 A;  1TGZ B;  2M0X A;  3NHE B;  3EFU A;  3VTW A;  1WX7 A;  2N9E B;  2JRH A;  2FNJ B;  4GDK A;  3U7D A;  3RD2 A;  5JHB A;  3QIJ A;  4W9C A;  3ZUN A;  3L10 B;  3R66 C;  3VH4 B;  4II3 B;  2J0K A;  3IBE A;  4FUL A;  3WAN A;  1WGH A;  2MP2 A;  2K6Q A;  3V6C B;  2KVR A;  2CKH B;  2FUH B;  2KMC A;  1Q0W B;  3M95 A;  3ML9 A;  3B08 A;  2GBN A;  4DBG A;  3VUX A;  4HJK A;  3ZO5 B;  1V49 A;  2XBB C;  4G50 A;  3H7P A;  2A4Z A;  4IWQ A;  3L54 A;  4MJS A;  4XX5 A;  3MHS D;  2JWZ A;  3CST A;  3ZNZ B;  3QWZ B;  3ZTD A;  3MJW A;  1WYW B;  2R2Q A;  3A9K A;  1D3Z A;  1GG3 A;  1WH3 A;  2JPH A;  2QHO A;  3PRM B;  3A1Q B;  3GZN I;  2JVC A;  1TTN A;  4FLH A;  4GN1 A;  4M8N A;  1GJZ A;  2GBK A;  2EMT A;  4ZDV A;  2PPH A;  5C1Z A;  5CHF A;  3K9P B;  3R7R A;  2K39 A;  4K81 A;  2KO3 A;  3EEC A;  4MGY E;  2O6V A;  4ASW C;  2LVO A;  3DVN U;  2M1M A;  2KFK A;  2RPQ A;  4RMA A;  1H4R A;  1YX5 B;  4MM3 A;  2OJR A;  2NCN A;  1WR1 A;  3UQB A;  4YL8 A;  5DPS A;  4FJZ A;  2L0F A;  3ZRF A;  2N1V A;  3TIX A;  2KDF B;  3JSV A;  3QQ8 B;  4NAW B;  1UEL A;  4B9K A;  4GXB A;  1WM2 A;  4K7S A;  2NBW B;  3DCG A;  4KIK A;  5JZE B;  2MBB B;  1MG8 A;  2IO0 B;  2LI5 A;  2JZZ A;  2DZI A;  4N9F 4;  1Y8R C;  3TL5 A;  1V5T A;  3ONS A;  1X1M A;  2C7N B;  2XK5 B;  3H9D A;  3UF8 A;  3PV1 A;  4EZJ A;  2YLM A;  2KX3 A;  2DAF A;  1WXS A;  3TJP A;  1OEY A;  1SIF A;  3PT2 B;  2KJ6 A;  4GDL A;  2J7Q B;  4WWP A;  2Y5B B;  2DYO A;  3DBR I;  3ZNH B;  4KZC A;  3MTN B;  1P98 A;  2LGY A;  3T8M A;  2IO1 B;  5G2N A;  2C60 A;  3HHM A;  1KM7 A;  3VTV A;  4ANV A;  3UGB B;  1H8C A;  1TZ1 A;  1WXV A;  2R2O A;  4HWI B;  1GC6 A;  5LXI B;  5EDS A;  4KSL C;  3R3M A;  3WA0 A;  3UIO B;  1KOT A;  3IFW B;  1WGD A;  2FCQ A;  4EUT A;  4NY0 A;  3PRP B;  2MLB A;  1L7Y A;  3SHQ A;  2PE6 B;  1UH6 A;  3JSV B;  2KZR A;  4JGH B;  1HE8 A;  5JH5 C;  2LAS A;  3WIM A;  1SE9 A;  2M4N A;  2D07 B;  3AUL A;  1BT0 A;  2CS4 A;  1WM3 A;  4WJQ A;  3KUD B;  3DVG Y;  1WMH B;  4WWN A;  2BYF A;  2FIF A;  3RUL A;  4W9L A;  3M3J A;  4B6W A;  1VCB A;  3OJ3 A;  4G11 A;  2IO3 B;  4PS3 A;  2KTF A;  2YVC A;  1KJT A;  1WMH A;  2UYZ B;  5DCN A;  2KLC A;  3RT3 B;  1IP9 A;  3NOB A;  5AZG A;  3JW0 X;  4KDI C;  3OJ4 B;  1IPG A;  3AU4 A;  3WAM A;  4FAD A;  1E7V A;  2AL3 A;  2WWZ A;  2WX1 A;  3QK0 A;  4ZRJ A;  2MA9 B;  2GOW A;  2ZPN A;  2KC1 A;  2KK8 A;  5G55 A;  3SD5 A;  2KTR A;  4E71 A;  4URK A;  1F9J A;  2ZJD A;  3DQV A;  4F1S A;  2Z0E B;  3OLM D;  1V80 A;  5J18 A;  1C3T A;  2L76 A;  2EKE C;  2RR9 A;  1UBQ A;  3L08 A;  2CHW A;  3V61 A;  4OVU A;  2D2Q A;  1WGG A;  1YX6 B;  2K8H A;  2KFJ A;  3PRZ A;  4TV3 A;  5BO4 B;  3A9J B;  4AWJ A;  3PGE A;  2DHZ A;  4DHZ B;  3AU5 A;  4G0N B;  4DWF A;  3A1Q A;  5JHA A;  4HVB A;  1E5W A;  3ZNI D;  4W9G A;  2NBV B;  1EF5 A;  4MJS B;  2LWP A;  1XQQ A;  4BKS D;  4TQ1 A;  1E8X A;  1LQB A;  1XD3 B;  2ZVN A;  3C0R B;  3QJZ A;  3KVF B;  1WE7 A;  5D2M B;  3KYD D;  2GMI C;  1XT9 B;  2AEH A;  2N9P C;  1SGH A;  5E6N A;  3ZW3 A;  4EKU A;  2L05 A;  2KX0 A;  4DK5 A;  4ZYN A;  2MP2 B;  4LDT B;  4WJN A;  1WGY A;  4EZK A;  5L95 C;  2JZ3 B;  2V1Y A;  1WZ0 A;  4FBJ B;  1JRU A;  2UWQ A;  1CMX B;  4EEW A;  1RLF A;  5E6P A;  1WGR A;  2EMS A;  2DAJ A;  2MX2 A;  5HKH A;  2N9X A;  4IW0 A;  4MDK E;  4TUU A;  5GMV A;  5TR5 A;  3WAP A;  2C5L C;  3B1L X;  3RYT A;  2BYE A;  3PS6 A;  2BWE S;  2OOB B;  3P2B A;  3LJ3 A;  2HE7 A;  4NJ7 A;  4ANW A;  2L8J A;  4BFR A;  4HCP B;  2WDT B;  3W1S C;  4AJY B;  3HK0 A;  3VDZ A;  4GDL B;  1WJU A;  2ZZP B;  5CTR C;  1EF1 A;  2CR5 A;  5KHQ A;  3X23 A;  1UGM A;  1V5O A;  1GUA B;  1R4N I;  3RZF A;  2VRR B;  2B3A A;  4BKG A;  4XC2 A;  3VUW A;  3ZTC A;  2KC2 A;  2BKR B;  4MGK E;  3VUY A;  2PEA A;  1Z2M A;  2PE9 A;  4WJP A;  3L17 A;  2ZCB A;  4HDO A;  4E3C A;  4DXA B;  1UBI A;  1YQB A;  3HIZ A;  3CSF A;  1WXA A;  3T9L A;  5FR6 A;  3A4S C;  4AUQ C;  3QC8 B;  5L83 A;  1OGW A;  5KHO A;  3H1U A;  4IM0 A;  2KTR B;  1V86 A;  2KHW B;  4I6N B;  3DBH I;  4MSM B;  3PZD A;  3RCZ A;  3KH0 A;  4F7Z A;  4GGQ A;  2LD9 A;  2KJR A;  4MGZ E;  3SU8 X;  2IBI B;  2AWT A;  2KNB A;  3VH3 B;  3VTU A;  1WFY A;  1OQY A;  1RAX A;  4HXD A;  2JY6 A;  2NBU A;  4W9E A;  3TMP B;  5LLI A;  1NBF C;  2MBQ A;  3V60 A;  3A9J A;  4GU2 A;  3ZVV A;  4BOS C;  2JF5 A;  1EUV B;  2KJH B;  1LXD A;  4MSQ B;  4AJW A;  1Q1O A;  3KUZ A;  3UIN B;  1IYF A;  3R7Q A;  3JYU A;  3BIN A;  3VHT C;  3APF A;  2DYM A;  1WR6 E;  4KVG B;  3GOE A;  3DVN V;  3KW5 B;  1M94 A;  1KLV A;  2G4D B;  4PS7 A;  1E8Z A;  3EHV A;  2K8B A;  2MSE D;  4X57 B;  1V81 A;  4NQL B;  2BGF A;  3OAW A;  1WX9 A;  3L13 A;  2DX5 B;  4PYZ A;  1NI2 A;  4TKN A;  2REX A;  3WAO A;  2LXA A;  3BY4 B;  2HJ8 A;  1E90 A;  2C7H A;  2KAN A;  4K7W A;  5J2R A;  5C23 A;  4BKS A;  4DHJ D;  5D94 A;  2BWF A;  2L3Z A;  3N30 A;  4AOF A;  1GC7 A;  4FA6 A;  1QZE A;  2G4S A;  4J6I A;  4M8M A;  1J19 A;  1VD2 A;  3A9K B;  2DZJ A;  3PRE A;  2FAZ A;  4E74 A;  4GIV A;  1UD7 A;  4MEM A;  2ASQ A;  3A33 B;  1TBE A;  2G3Q B;  2ZVO A;  3CMM B;  3DBL I;  4JIO U;  4K7U A;  1V2Y A;  3H7P B;  4HPM B;  3ZDM C;  2L7R A;  1I35 A;  2GBM A;  2NPT A;  3APC A;  4RM8 A;  1LM8 B;  3V62 A;  4IM3 A;  5D7G A;  2NS5 A;  3KYC D;  5DPW A;  4W9I A;  4CYE A;  3V6E B;  2JUO A;  2D11 A;  4JL9 A;  2MBE A;  3DDC B;  3DPD A;  2LXC A;  4IUM B;  4AP4 C;  1WJ6 A;  4GSW A;  4WWO A;  1EO6 A;  1WIA A;  2IZV B;  2MWS B;  2FCM A;  1J8C A;  1L2N A;  2HD5 B;  2O2V B;  3H7S A;  4WQO B;  5CHV C;  5IA7 A;  3SDL C;  1Z5S B;  3VQI A;  2M17 A;  3PHX B;  2K6D B;  3UIP B;  1YJ1 A;  2LRU A;  2MW5 A;  3RZW C;  3K9O B;  2BKF A;  2KMA A;  2J0J A;  2JRI B;  2CHX A;  2O2V A;  4EOY A;  2KXJ A;  4IWP A;  1WI0 A;  2XK5 A;  4HPL B;  2FCN A;  3IG3 A;  4LDT D;  4NAW A;  2MBO A;  4BKT A;  1GNU A;  2LVP A;  2NVU I;  2MCN B;  3VVW B;  1J0G A;  3H6N A;  4W9K A;  4EFO A;  1T0Y A;  3PVL A;  1WE6 A;  4HLE A;  1WRD B;  4KSK C;  2PJH A;  2WYQ A;  1P3Q U;  2Z59 B;  2GBR A;  2BF8 B;  1S1Q B;  2XEW A;  4P7I A;  2AYO B;  3W1Y A;  2O6V B;  3M62 B;  4W9D A;  1WZ3 A;  1V9J A;  3TCA A;  3U8Z A;  4BVU C;  3LDZ E;  3ENE A;  4FJV B;  2LJ5 A;  4JQW C;  4IG7 B;  3VXW A;  3B0A A;  2GBJ A;  4ICV A;  2V3S A;  2N4F A;  4PYU A;  5CHW A;  1LFD A;  1UZX B;  2DZK A;  3TBL D;  2M8S A;  1OEY J;  3ALB A;  2KDE B;  1PQS A;  4MEL A;  3VFK A;  1U4A A;  2KWU B;  5AEK B;  3QAR A;  2W9N A;  1NDD A;  2MBH A;  4NQK E;  3PPA A;  1S3S G;  2G45 B;  3ML8 A;  4ZRI A;  2KD0 A;  5AZH A;  2Z0D B;  1ISN A;  2JXX A;  5DPR A;  2DYB A;  1P1A A;  2NR2 A;  1RRB A;  1YIW A;  4I6L B;  4A3O A;  2CHZ A;  2KWC A;  2LZ6 A;  3APD A;  3QCA A;  4LJO B;  2FID A;  1WXM A;  2KDI A;  4KV2 A;  1WJN A;  1WJ4 A;  4NPN A;  3KUC B;  4W9J A;  4I6P A;  3ZNG C;  2HTH A;  4A20 A;  4MGI E;  4PS8 A;  4B95 A;  2IO2 B;  3QHT A;  4CHK A;  3PTF C;  2IY0 B;  4GMV A;  4NJ6 A;  4DHZ E;  2DZM A;  2KWV B;  2MQJ A;  3ZLZ A;  2CU1 A;  4FJY A;  3NZU A;  1P9D U;  2ZEQ A;  2LGX A;  4HCN B;  3QA8 A;  1ZGU B;  3Q3F A;  2RGF A;  2LUE A;  3PLV A;  5IAA C;  1FXT B;  2KOX A;  5J17 A;  2ZPY A;  3UQA A;  4IM2 A;  3U30 A;  4M0W B;  1WF9 A;  4GB9 A;  4HK2 A;  4EZL A;  3NZS A;  1R4M I;  3ZDT A;  2D10 A;  4KDL B;  4DDG D;  1P0R A;  4CO7 A;  2ZNV B;  3AXC A;  1OTR B;  4W9F A;  2RSU A;  2KFK B;  4KZ0 A;  2BPS A;  4GDK B; 
#chains in the Genus database with same CATH topology
 4RGT A;  5IP4 D;  2KQ7 A;  5DPT A;  2KLG A;  3NY5 A;  4A90 A;  1WYG A;  2FCS A;  2IYD B;  3DBR B;  2WXR A;  4KKJ A;  1E8W A;  3D32 A;  3IT4 B;  1BXT A;  1R7S A;  1QOF A;  4FHJ A;  5AZF A;  4K1R B;  4A3P A;  2WNM A;  2YEP B;  4F8C B;  1LOT A;  5E6O A;  4OVV A;  5TSS A;  2JT4 B;  2W54 A;  3QX1 A;  2LXS A;  2OHF A;  3IXS A;  4DDI D;  3EA6 A;  1MI0 A;  1KDX A;  1E8Y A;  2DNF A;  1MJD A;  1SJE D;  2LGD A;  4GOC A;  4C4V B;  4ARI A;  1JAL A;  1SB3 C;  4HDQ A;  5GIN A;  2O6V D;  2KN5 A;  3AED B;  4II2 B;  4RM9 A;  1I4Q A;  4RCO A;  3IAM 1;  3HM6 X;  3SFE B;  3ZKJ C;  3I3T B;  3B9L A;  2N7E A;  1MUH A;  1L4Z B;  1JWA D;  3O65 B;  4BOZ B;  3AI5 A;  4IC7 B;  3H3A A;  3CF6 E;  2PMV A;  1I4R A;  2IND C;  2LGI A;  2VUE A;  4NNJ B;  3FWB C;  5GIP A;  1RM6 C;  4YSY B;  1ET6 A;  1H5W A;  3ECI A;  1K8R B;  3L16 A;  1HTO A;  3N3K B;  4WJO A;  3PLU A;  3B9J A;  1I42 A;  3NHE B;  2M0X A;  2DBW A;  2BTE A;  1QKZ A;  1FD6 A;  5JHB A;  3QIJ A;  1AYF A;  1N62 A;  2J0K A;  4RFB A;  3WAN A;  1WGH A;  2K6Q A;  2PLP A;  2Q5W D;  3NG0 A;  1GNI A;  2KAC A;  4DBG A;  1V49 A;  2BT6 A;  3KWL A;  1VLB A;  2JSV X;  3QWZ B;  3GE3 C;  2JPH A;  3PRM B;  2TSS A;  2K22 A;  3RFZ B;  4M8N A;  4FLH A;  1GJZ A;  4ZDV A;  1TKE A;  3K9P B;  2O6V A;  4ASW C;  3DVN U;  2M1M A;  2KFK A;  2RPQ A;  1H4R A;  4XE0 A;  2OJR A;  3UQB A;  4FJZ A;  2L0F A;  2N1V A;  2KDF B;  2RDH A;  1JWU D;  4L23 A;  4KIK A;  2NQO A;  4XDC A;  2IO0 B;  1TY0 A;  3TL5 A;  5FUO A;  2LHE A;  3ONS A;  2C7N B;  2YLM A;  2X8X X;  3TJP A;  3PT2 B;  1FNU A;  3Q3M C;  3W5U B;  1I4P A;  3ZNH B;  3GB1 A;  3T8M A;  4F5U A;  3GS2 A;  3I5J C;  1KM7 A;  3UGB B;  2Y5C A;  4MH8 A;  1TZ1 A;  1WXV A;  5D3D A;  1DOX A;  3ZXR A;  3ETR A;  5LXI B;  4KSL C;  3SEB A;  2WXH A;  1WGD A;  1JCK B;  4NY0 A;  4M02 A;  1GAQ B;  2PE6 B;  2KZR A;  4LB2 A;  1XLQ A;  1A70 A;  2LAS A;  2K0N A;  1SE9 A;  5BMH A;  3AUL A;  1N63 A;  3AH7 A;  4ZHP A;  1FM0 D;  3KUD B;  3DVG Y;  2QSD A;  4WWN A;  1LGR A;  3N9Y C;  5HFY A;  1VCB A;  3OJ3 A;  1VZ7 A;  2KTF A;  4PS3 A;  1SJH D;  1FEH A;  1KH0 A;  5AZG A;  4KDI C;  4HEA 1;  4FAD A;  2RDB C;  1TS5 A;  2AL3 A;  1GNJ A;  2WWZ A;  1I7H A;  1F77 A;  1D5X C;  2ZPN A;  4URK A;  2JXT A;  4RGN A;  1F9J A;  1WXQ A;  1UGJ A;  3OLM D;  2PIA A;  2KWD A;  2QIE B;  5J18 A;  5DBY A;  1C3T A;  4B0M A;  2L76 A;  2EKE C;  1ZDX A;  2KBZ A;  5B5T A;  4HKZ E;  1HK1 A;  1WSP A;  3LXF A;  1ZPS A;  4DWF A;  1WWT A;  2K0P A;  1E78 A;  2KAJ A;  2NMQ A;  4O1N A;  5BYQ A;  3ZNI D;  4W9G A;  2LWP A;  1AW7 A;  4BKS D;  2LMC A;  3PZ7 A;  2ZVN A;  2ZW0 A;  1P7E A;  3VRA B;  2E6X A;  4B0E A;  4FK5 B;  1E7P B;  2KX0 A;  2MP2 B;  4WJN A;  2JZ3 B;  1WZ0 A;  1XCT L;  4FBJ B;  1CMX B;  4J3O D;  4IW0 A;  4TUU A;  3PS6 A;  4BFR A;  2VUF A;  2WDT B;  3W1S C;  3T3O A;  1IJG A;  3MC8 A;  3X23 A;  1UGM A;  1V5O A;  4K3B A;  2GUT A;  2PEA A;  1Z2M A;  4BKE A;  2EFC A;  4HDO A;  3G9K D;  1UBI A;  3CSF A;  3T9L A;  5L83 A;  1FIQ A;  1OGW A;  2KTR B;  1V86 A;  4MSM B;  1YOV B;  3KH0 A;  2KJR A;  2WXK A;  3SU8 X;  1TYG B;  1WFY A;  2NBU A;  5LLI A;  2MBQ A;  4ZCG A;  1F1H A;  3A9J A;  3P4P B;  4GU2 A;  4KX6 B;  1EUV B;  2KJH B;  2N9L A;  4AJW A;  1E7I A;  3R7Q A;  3JYU A;  1TS2 A;  3Q3N C;  4KVG B;  1B1Z A;  3DVN V;  1KLV A;  4PS7 A;  1GPX A;  2MSE D;  4X57 B;  4L1B A;  4OTU A;  2BXI A;  1L0X B;  2MEK A;  1CQV A;  1HZ5 A;  2INP E;  2V4I B;  4HJG E;  2C7H A;  2KAN A;  4AOF A;  4FA6 A;  1E7E A;  3AE5 B;  1D4B A;  2AX5 A;  4OZC A;  4RGM A;  4MEM A;  3DBL I;  1EWY C;  4OHJ A;  3VR8 B;  3APC A;  4USA A;  1DOI A;  2D11 A;  2MBE A;  4IUM B;  4HPP A;  2BXG A;  1WJ6 A;  4WWO A;  3UI3 A;  1EO6 A;  2IZV B;  1YN3 A;  1VDV A;  2O2V B;  2K3U A;  3H7S A;  5IA7 A;  3KWV A;  2M17 A;  3UIP B;  2JUH A;  4L2Y A;  2LRU A;  3RZW C;  3K9O B;  3BWU D;  2J0J A;  2CHX A;  4GLS C;  2INN E;  2MBO A;  2E0X A;  1ACC A;  4EE2 A;  4JE3 B;  2XW0 A;  3PVL A;  4HLE A;  1P3Q U;  2Z59 B;  1T3Q A;  2GBR A;  1YN4 A;  1S1Q B;  2XEW A;  1GOZ A;  3W1Y A;  1C78 A;  3M62 B;  1F0Z A;  1DYQ A;  5FR3 A;  1PYW D;  4WQM A;  4LNK A;  2JU6 X;  4BVU C;  3AM9 A;  2I38 A;  3B0A A;  3ZJU A;  3ICX A;  2IPK D;  1HTQ A;  1UZX B;  1SSN A;  2M8S A;  1OEY J;  2VZK D;  3ALB A;  1PQS A;  4MEL A;  4NZL B;  1TF0 A;  1ZDV A;  3QAR A;  4N59 A;  4YTP B;  1UF0 A;  1QLB B;  4UDU C;  2G45 B;  5EE1 A;  4ZRI A;  1MUS A;  2JXX A;  2NR2 A;  1MFW A;  2LZ6 A;  1WXM A;  2OJW A;  2Y3A A;  1JWB D;  2BXQ A;  3ZJV A;  5H8Y E;  3ECP A;  4J2V A;  4IW2 A;  2L1A A;  2IY0 B;  4NJ6 A;  2MQJ A;  2KT7 A;  3NZU A;  1P9D U;  2ZEQ A;  2LGX A;  4HCN B;  3L4P A;  1ZGU B;  1E7F A;  1SF0 A;  4YWG G;  3PLV A;  2RGF A;  5IAA C;  4M0W B;  1WF9 A;  4HK2 A;  3ZDT A;  3OG5 A;  4DDG D;  1P0R A;  3I63 C;  2ACZ B;  4KZ0 A;  1C4C A;  2BPS A;  3W2D A;  4XWW A;  3W1S A;  5HOZ A;  2MJD A;  3OWE B;  1ESF A;  2IY1 B;  2BXE A;  3S2A A;  2KDM A;  1BUI C;  4BBN C;  3RUI B;  2BXD A;  5MPO A;  1HK3 A;  1ZW7 A;  1N5W A;  3U52 E;  2L0T A;  1WY8 A;  3NVM A;  3BVZ A;  4RGO S;  3IVF A;  1MIV A;  1I4H A;  2VH1 A;  4BBN F;  2RD0 A;  1TS4 A;  4A8X C;  1B9R A;  2L32 A;  3MHH B;  1QOG A;  1SXT A;  2L00 B;  2QJL A;  3H8H A;  4FHK A;  1ZKH A;  3IHP C;  3MHS B;  1NI3 A;  1E7H A;  3FAH A;  1N5U A;  3EC8 A;  2K25 A;  1RFA A;  2I2Y A;  4DQO C;  2LVQ A;  1V6E A;  4KIK B;  3AE9 B;  3DVG X;  2WXL A;  4REZ A;  3DOW A;  2XVV A;  2AQ3 B;  5BMI A;  5LXH A;  3H37 A;  1EU3 A;  2JX5 A;  2KDB A;  2H88 B;  1FPY A;  5I4D A;  3N32 A;  4P16 A;  1WX7 A;  1JML A;  2FNJ B;  1YMH E;  3RD2 A;  1QF6 A;  4W9C A;  4LNF A;  3L10 B;  3R66 C;  4ZRP A;  3VH4 B;  4II3 B;  4LNN A;  2MP2 A;  2JYT A;  3NVV A;  1K52 A;  4N0U D;  1Q0W B;  3ML9 A;  3B08 A;  2JWU A;  4M01 A;  1EM7 A;  2XBB C;  2FE8 A;  3HVZ A;  3H7P A;  4G50 A;  2A4Z A;  2FBW B;  1SIJ A;  3MHS D;  2JWZ A;  1KTK A;  1NVI D;  1AN8 A;  3ZTD A;  1IBX B;  1WYW B;  3A9K A;  1D3Z A;  1WH3 A;  5BPK A;  2QHO A;  2PTL A;  2JVC A;  5IIH A;  3RN9 C;  3WHR A;  1SEB D;  1I4X A;  4YT0 B;  3R7R A;  2K39 A;  1ZXI A;  4K81 A;  1O9X A;  3Q8B A;  3Q8C A;  5BYR A;  2NCN A;  1MA9 A;  4YL8 A;  1L0Y B;  3P63 A;  3QQ8 B;  3SIV B;  4K2C A;  2QDF A;  3J9C A;  4K7S A;  3AE3 B;  5JZE B;  2MBB B;  3JRY A;  1XO3 A;  4N9F 4;  3AE6 B;  4P1C C;  3H9D A;  1HK4 A;  3PV1 A;  2KX3 A;  1OEY A;  1SIF A;  2MH7 A;  4HGK A;  2J7Q B;  4WWP A;  1H8C A;  3TEZ A;  1LNS A;  3WA0 A;  3NVZ A;  3PRP B;  1QT9 A;  2MLB A;  4K71 A;  1MIW A;  1UH6 A;  1R4N B;  3BYT B;  2K9X A;  2D07 B;  2Y5P A;  1WM3 A;  2BYF A;  3DHG C;  2FIF A;  2OED A;  3RUL A;  4W9L A;  2WDV B;  2EEL A;  3FIL A;  2BXN A;  3WHS A;  1KJT A;  1WMH A;  2UYZ B;  5DCN A;  1CJE A;  3JW0 X;  1ROE A;  1RYJ A;  3AU4 A;  1V97 A;  4P1B C;  1XXG A;  2BS3 B;  2WXG A;  4ZRJ A;  2MA9 B;  1SB0 A;  3NJT A;  2KTR A;  3A75 A;  5EE3 A;  1V80 A;  4YTN B;  3V3X A;  3L08 A;  2CHW A;  3V61 A;  1E9M A;  4L9Q A;  2XNA C;  1YX6 B;  2KFJ A;  5EE0 A;  3A9J B;  4S0R A;  1UOR A;  3PGE A;  2DHZ A;  4DHZ B;  4G0N B;  3FIL B;  3ZQ4 A;  4HVB A;  3EGR A;  1E5W A;  1ZP0 B;  3RNB C;  4MJS B;  1EF5 A;  3DWM A;  1XQQ A;  4ZHO A;  4TQ1 A;  1E8X A;  1LQB A;  3KVF B;  1WE7 A;  3TEW A;  5D2M B;  1WGK A;  2GMI C;  1XT9 B;  2WXM A;  5E6J A;  1SGH A;  1FRR A;  2L05 A;  5L95 C;  1WGY A;  4EEW A;  5E6P A;  2DAJ A;  5GMV A;  2BWE S;  4ARC A;  4ANW A;  2DBX A;  4AJY B;  3VDZ A;  5CTR C;  1EF1 A;  4BKG A;  2B3A A;  3VUW A;  2H89 B;  3ZTC A;  3P1M A;  2LQI A;  4C31 B;  2Z8K A;  2WU2 B;  2ZCB A;  4E3C A;  3PZ8 A;  1YQB A;  1KLU D;  4AUQ C;  4IM0 A;  1T0Q C;  3DBH I;  3PZD A;  4ZUX V;  2LD9 A;  2K5P A;  1JRP A;  4R3D A;  2IBI B;  2AWT A;  3VH3 B;  3URY A;  3EFC A;  1J7A A;  2GRI A;  3V60 A;  3PO0 A;  3KLS X;  4BOS C;  4DHX B;  2WXO A;  4YSX B;  4US9 A;  1Q1O A;  3C19 A;  3KUZ A;  4M0W A;  3RMK C;  3BIN A;  3VHT C;  3R2T A;  2J42 A;  3KW5 B;  2G4D B;  1E8Z A;  3EHV A;  2ICI A;  3AEE B;  2I2Z A;  4S17 A;  2BGF A;  3OAW A;  3L13 A;  2DX5 B;  4TKN A;  2LXA A;  3BY4 B;  4LNI A;  1TZO A;  2WXN A;  5C23 A;  5D94 A;  2WXJ A;  2G4S A;  3PRE A;  4WWM A;  2DZJ A;  3T3N A;  2FAZ A;  1XLN A;  1TBE A;  1T0S C;  4Z9O A;  2DBY A;  2GI9 A;  3TEY A;  4RM8 A;  1E7C A;  4IM3 A;  5D7G A;  4N0F D;  2PW9 A;  3KYC D;  3N20 C;  4BAX A;  4CYE A;  4TSS A;  3HUI A;  3DDC B;  2RMM A;  2N9K A;  2W55 A;  5T8I A;  5H92 C;  1BM0 A;  2FCM A;  1L2N A;  2HD5 B;  4WQO B;  3SDL C;  4D7X A;  3VQI A;  3PHX B;  2WDQ B;  1YJ1 A;  2MW5 A;  3EUB 2;  2KMA A;  1V1O A;  4OVZ A;  2SAK A;  4EOY A;  2KXJ A;  4IWP A;  4FIP B;  2XK5 A;  2N0S B;  4BKT A;  2LHD A;  2NVU I;  2LVP A;  3Q8F A;  2BB5 A;  5IJF A;  2JQR B;  2XMO A;  1FNV A;  3H6N A;  4W9K A;  4NAM A;  4KSK C;  1SE4 A;  2PJH A;  1WRI A;  2BXL A;  1ENF A;  2O6V B;  3TCA A;  4HRO A;  3LDZ E;  2KMM A;  2BS2 B;  1JWM D;  4XGA B;  2M0A A;  2RPV A;  2GBJ A;  1R4M B;  1LFD A;  1HZ6 A;  5GHK A;  3WHQ A;  2LGS A;  3LU7 A;  2W3R A;  5AEK B;  1HEZ E;  1FRD A;  2W9N A;  2MBH A;  1S3S G;  3LB8 C;  2KD0 A;  3KJL A;  1PFD A;  2V36 A;  2DYB A;  4I6L B;  4LA0 A;  3DBL B;  1TXU A;  4KV2 A;  1WJN A;  3I9V 1;  4NPN A;  2OT3 A;  1YN5 A;  2HTH A;  4B95 A;  3QHT A;  5IIX A;  4CHK A;  4GDX A;  4GMV A;  3B9M A;  4DHZ E;  3N1X C;  1C9F A;  2CU1 A;  4FJY A;  2Z8I A;  2NTT A;  2D3B A;  1N60 A;  2LUE A;  3UQA A;  2KOX A;  4IM2 A;  3FWC C;  4W4U B;  4US8 A;  1V1P B;  1VRA B;  2LUM A;  2EFH A;  2ZNV B;  3AEA B;  1OTR B;  3AXC A;  4W9F A;  2KFK B;  2XSI A;  2VRR B;  4FN2 A;  4XDD A;  2BYV E;  3Q69 A;  4ZRK A;  3SQJ A;  1OQR A;  2IGG A;  1K51 A;  2C7M B;  2D5G A;  2GLS A;  2WX0 A;  3BPJ A;  3P42 A;  1K53 A;  1TS3 A;  1KLG D;  1PUT A;  2V4L A;  4WAA A;  2YDF A;  2KKC A;  2ZCC A;  3P4Q B;  3PSE B;  3Q3J A;  3UIV A;  4LTU A;  4QAY A;  4ZBR A;  2J0M A;  2KQS A;  2WDR B;  4GG2 A;  2JYE A;  4DHJ B;  2ON8 A;  3HM3 A;  3MJ5 A;  3VRB B;  3O13 A;  1H9Z A;  3V08 A;  4W9H A;  3U4E G;  3MP9 A;  3VAW A;  5ID9 A;  2N7D A;  3PHW B;  4WAF A;  1WX8 A;  1TKG A;  1TT5 B;  1AAR A;  1N61 A;  4ANU A;  3M63 B;  1YD8 U;  4WUR A;  4MH0 E;  4DXG A;  1C1Y B;  2V0G A;  3WAL A;  2N1W A;  2OZB B;  4LCD E;  4TQ0 A;  1Q5W B;  4XZ4 A;  5HHD G;  1NEK B;  4LJP B;  5IFO A;  4G3X B;  1JW9 D;  1UWX A;  3EFU A;  2W82 A;  5BMG A;  4MT5 A;  4FUL A;  4N6E B;  3MFG A;  4RNA A;  2KVR A;  1MVK A;  1L6U A;  2BXK A;  2IGH A;  2GBN A;  1HK5 A;  3VUX A;  3L54 A;  4HKQ A;  1C4A A;  1LO5 D;  4OZA A;  3CST A;  2J4X A;  3ZNZ B;  1FO4 A;  1FFV A;  2R2Q A;  3KIK A;  1GG3 A;  3A1Q B;  3GZN I;  1TTN A;  2GBK A;  2EMT A;  2PPH A;  1YQ4 B;  5CHF A;  5C1Z A;  4JWS C;  2EFD A;  1NYQ A;  2KO3 A;  3EEC A;  1FNW A;  3NMU A;  1WR1 A;  4OW0 A;  4JX1 C;  5DPS A;  4MAC A;  4MM3 B;  4NAW B;  1IUE A;  4B9K A;  3DWG C;  3AEC B;  1KRH A;  2NBW B;  3DCG A;  2BX8 A;  1PGB A;  3AV8 A;  1ZXH A;  1MG8 A;  3AEF B;  4K3C A;  2DZI A;  1T6B X;  1QOB A;  1V5T A;  1X1M A;  3UF8 A;  4EZJ A;  4G03 A;  3NVW A;  3TDL A;  2DAF A;  1WXS A;  3RNA C;  4Q2J A;  2KJ6 A;  4NJC A;  4GDL A;  1P7F A;  2Y5B B;  3DBR I;  1XLP A;  2UU7 A;  3MTN B;  2LGY A;  4ZC6 A;  2C60 A;  3HHM A;  4RF0 A;  3VTV A;  1ZOY B;  1FXA A;  1XCQ L;  4ZYS A;  3TUO A;  1GC6 A;  3R3M A;  1KOT A;  1V8C A;  3BVM A;  1D5Z C;  3FC4 A;  1E0Z A;  4JGH B;  1HE8 A;  5JH5 C;  1KW2 A;  3WIM A;  2M4N A;  2DG5 A;  1BT0 A;  2D3C A;  3Q6B A;  1YJI A;  1WMH B;  1E7B A;  4G11 A;  2IO3 B;  3RT3 B;  2KLC A;  3NOB A;  1C4P A;  2GOW A;  2E3T A;  2KK8 A;  3SD5 A;  3DQV A;  2WXI A;  2WS3 B;  2RR9 A;  3HRD D;  3NVY A;  4OVU A;  4PT5 A;  1WGG A;  2K8H A;  3PRZ A;  4TV3 A;  5BO4 B;  2AJE A;  3BVG A;  3A1Q A;  5JHA A;  2BXH A;  4OTT A;  4L9K A;  2BXP A;  2BXB A;  1C76 A;  3NS1 A;  4ACF A;  2NBV B;  2NTS A;  1QIL A;  1CK1 A;  5E6N A;  5IN7 A;  1MHX A;  2WXP A;  4TMA B;  1HXY D;  2WP9 B;  5IJ5 A;  2QMT A;  4ZYN A;  4EZK A;  2V1Y A;  3V05 A;  2UWQ A;  1IGC A;  1RLF A;  1WGR A;  2HDE A;  2EFE A;  3WAP A;  1L6V A;  2C5L C;  3RYT A;  2BYE A;  2BXM A;  1N5X A;  1T5X D;  2DLB A;  2OOB B;  3P2B A;  1XF5 L;  2LEK A;  1QOA A;  1FOU A;  3HK0 A;  4GDL B;  1PDX A;  1WJU A;  3LYY A;  1GUA B;  1R4N I;  2KC2 A;  4MGK E;  1F2R C;  2PE9 A;  4WJP A;  3L17 A;  1E10 A;  4DXA B;  1GB4 A;  3W9C B;  1YJJ A;  4OT2 A;  3GP7 A;  1WXA A;  2WXF A;  3I57 A;  4D2K A;  5KHO A;  3Q3O C;  2XVU A;  2KHW B;  2KYW A;  4H2A A;  3RCZ A;  4F7Z A;  4GGQ A;  2D3A A;  2KNB A;  3VTU A;  2BXA A;  1RAX A;  1SE2 A;  4W9E A;  3RNE C;  1KF6 B;  3AMZ A;  1NBF C;  3ZVV A;  3E56 A;  2JF5 A;  5IOI A;  1LXD A;  3UIN B;  1IYF A;  2BXO A;  5AUI A;  1WR6 E;  3GOE A;  1DGJ A;  3V03 A;  2K8B A;  2QM6 A;  1FFU A;  2RDG A;  4KGT A;  4DM0 A;  3NVK A;  4NQL B;  2QMC A;  1NI2 A;  3WAO A;  2REX A;  2HJ8 A;  1E90 A;  4K7W A;  5J2R A;  4A9A A;  4HGM B;  4BKS A;  4DHJ D;  2FUG 1;  4BY9 C;  2WXQ A;  4F5V A;  3GQX A;  3RNC C;  1J19 A;  4GIV A;  3A33 B;  1C77 A;  4YXD B;  4JIO U;  2DWQ A;  2MJ3 A;  2WHI A;  3H7P B;  4HPM B;  3ZDM C;  1M4V A;  4KGR A;  2GBM A;  3TSS A;  3V62 A;  2NS5 A;  2M19 A;  4W9I A;  4A6Q A;  2JUO A;  4JL9 A;  1ZE3 D;  4DXF A;  2LXC A;  4AP4 C;  4GSW A;  5FKA C;  4N58 A;  3SR6 A;  1J8C A;  4N3Z A;  1F52 A;  4Z69 A;  3W5V B;  4IOI E;  2BKF A;  4YSZ B;  3WCQ A;  2FCN A;  3IG3 A;  4LDT D;  2LJI A;  1GNU A;  2MCN B;  2E0Y A;  2WU5 B;  1EWC A;  1WE6 A;  2SEB D;  1BJ5 A;  4P7I A;  1ET9 A;  2AYO B;  3AE8 B;  1ZUD 2;  4RF1 A;  1V9J A;  3ENE A;  4FJV B;  5LNK 1;  4IG7 B;  2BS4 B;  4XWT A;  5C3J B;  2V3S A;  4JPS A;  2N4F A;  5CHW A;  4RH6 A;  2KDE B;  3R2I A;  3VFK A;  2KWU B;  3Q2A C;  1NDD A;  5G5G A;  2MHJ A;  2LXT A;  3ML8 A;  5D3I B;  4C56 C;  5AZH A;  1ISN A;  1YNT E;  5DPR A;  1P1A A;  2BQQ A;  1RRB A;  2KQ4 X;  4M70 B;  1HK2 A;  3QCA A;  3FKY A;  4LJO B;  2KDI A;  1WJ4 A;  2IDY A;  4M00 A;  2QEJ C;  3KUC B;  4W9J A;  3ZNG C;  4F5T A;  3AB5 A;  4PS8 A;  2IO2 B;  3PTF C;  4A55 A;  3ZLZ A;  5FK9 C;  2ONQ A;  2KVZ A;  3QA8 A;  3CX9 A;  5JXV A;  1HA2 A;  1FXT B;  5J17 A;  2ZPY A;  3NVI A;  3U30 A;  2CKX A;  2QIL A;  2QCZ A;  4S1Y A;  2D10 A;  4CO7 A;  4F5S A;  2RSU A;  3Q14 C;  2B76 B;  2I1J A;  3AE4 B;  3MC9 A;  4LUF A;  2ZNV C;  4ANX A;  5IJE A;  1MPE A;  2NNW A;  1VZS A;  3QAQ A;  4EMX A;  3DBS A;  1E7U A;  1UUP A;  1HQR D;  1JNB A;  2A5U A;  2LFI A;  3SIU B;  2K8C A;  2K1F A;  1J7E A;  4JK4 A;  3NS8 A;  5D6J B;  2NPT B;  2XN9 C;  5BYS A;  1N6Z A;  2QC8 A;  3NRZ A;  2LRW A;  3L0W B;  2I1K A;  2DEN B;  2AL6 A;  3ZIM A;  3FNM A;  4LK0 M;  4IWO A;  4YTM B;  4JLC A;  3X0W A;  3M99 C;  4C4V A;  2D3G A;  1A5R A;  1T0R C;  3ZRC A;  1G6J A;  2CJO A;  2ROH A;  3B2G A;  2WQY B;  2GB1 A;  3A4R A;  4ICU A;  1PGX A;  3JVZ X;  2MRP A;  5GIO A;  2VDB A;  1OQQ A;  4PK1 A;  1FXI A;  1L5P A;  3N1Y C;  4FJC B;  3GE8 C;  2IGD A;  2N7J A;  2C9W B;  5CX3 A;  2LQH A;  1VZ6 A;  4LLG M;  1EU4 A;  2IJ0 A;  1TGZ B;  4FXC A;  3VTW A;  2N9E B;  4GDK A;  2JRH A;  4LNO A;  5EE9 A;  3U7D A;  3IAS 1;  4E99 A;  1GB1 A;  3ZUN A;  3IBE A;  1C79 A;  4KKI A;  3V6C B;  3RNF C;  2CKH B;  2FUH B;  2KMC A;  3M95 A;  4ZBQ A;  4IDI A;  3AEB B;  4HJK A;  3ZO5 B;  2QHB A;  4IWQ A;  3MHZ A;  4MJS A;  4XX5 A;  5DQF A;  3MJW A;  1VFI A;  4G01 A;  5IIU A;  3AE1 B;  3IT6 B;  3BYY B;  1BKE A;  2MJE A;  2V3N A;  4GN1 A;  1CZP A;  1KXP D;  4MGY E;  1UNS A;  3U2S C;  2LVO A;  3AEG B;  1NT2 B;  4RMA A;  2I30 A;  1VZ8 A;  2PVO D;  4G04 A;  2LOQ A;  1YX5 B;  3KQ4 A;  4MM3 A;  2M56 B;  1E7A A;  3ZRF A;  3TIX A;  3JSV A;  1UEL A;  4GXB A;  1WM2 A;  3MC0 B;  1MIY A;  2DBU A;  2KN4 A;  1HA5 A;  2LI5 A;  2JZZ A;  1Y8R C;  3V09 A;  2XK5 B;  3NZ3 A;  5IKC M;  2HTM E;  2DYO A;  3GA9 L;  1JQ4 A;  4KZC A;  4L8U A;  1P98 A;  2IO1 B;  5G2N A;  4ANV A;  2YEP F;  1BML C;  2EKI A;  2R2O A;  2XVW A;  4HWI B;  5EDS A;  3UIO B;  3IFW B;  1VR9 A;  2FCQ A;  4EUT A;  1L7Y A;  3SHQ A;  1FMA D;  3JSV B;  3AN1 A;  2PKO A;  4IKG A;  4MBE C;  3N1Z C;  2CS4 A;  3GQU A;  4WJQ A;  2Z8L A;  1SBB B;  2BW2 A;  3M3J A;  1Y56 A;  4B6W A;  2W3S A;  1IP9 A;  2YVC A;  1Q10 A;  1YQ3 B;  2J53 A;  3OJ4 B;  1IPG A;  2AGH B;  3E9S A;  3WAM A;  1VJK A;  1E7V A;  2WX1 A;  3QK0 A;  2KC1 A;  5G55 A;  4E71 A;  2JZP A;  2G1E A;  3ZJT A;  4PO0 A;  2ZJD A;  4F1S A;  1E6E B;  2Z0E B;  4P6V F;  4I9O A;  1UBQ A;  2L83 A;  1TY2 A;  2D2Q A;  2AQ2 B;  1FCL A;  2WLB A;  4AWJ A;  2HJ1 A;  3AU5 A;  3BZD B;  4AQ7 A;  5ID7 A;  4BZA A;  4AS1 A;  5C2T B;  2KWF A;  3C0R B;  1XD3 B;  3BK2 A;  3QJZ A;  1NEN B;  3DHH C;  3KYD D;  1AO6 A;  2AEH A;  3TEX A;  2N9P C;  4EKU A;  3ZW3 A;  4WH4 A;  4DK5 A;  4LDT B;  4OZB A;  1JRU A;  2MX2 A;  2EMS A;  5HKH A;  2N9X A;  3NUH B;  4MDK E;  5TR5 A;  2BBC A;  3B1L X;  1UWM A;  4NJ7 A;  3LJ3 A;  2HE7 A;  5G5H A;  2L8J A;  4HCP B;  4WIP A;  2ZW1 A;  3ZXV A;  2ZZP B;  1FCC C;  1J7C A;  2CR5 A;  5KHQ A;  3RZF A;  3ZYY X;  4XC2 A;  3P4S B;  3VUY A;  2BKR B;  4C80 A;  4CQN A;  3ABV B;  3LU8 A;  4ZOH C;  3HIZ A;  4C7Z A;  1STE A;  5FR6 A;  3A4S C;  3QC8 B;  3H1U A;  4IW1 A;  4KGS A;  4I6N B;  2XVQ A;  1XEE A;  3Q8E A;  5HG2 A;  5IO9 A;  3VR9 B;  4MGZ E;  1SE3 A;  1OQY A;  3HVD A;  4HXD A;  2JY6 A;  1DOY A;  3TMP B;  2VZK B;  5HI1 A;  3JQZ A;  4MSQ B;  2V3P A;  1XLO A;  3APF A;  2DYM A;  1M94 A;  1TJE A;  3SFD B;  1NYR A;  1TIF A;  1V81 A;  4WA6 B;  4C00 A;  1L0V B;  1WX9 A;  1JWS D;  1J78 A;  4PYZ A;  2V9H A;  2X38 A;  4LUH A;  3AE7 B;  3AE2 B;  2J52 A;  2BWF A;  2L3Z A;  3N30 A;  1GC7 A;  1QZE A;  1IBX A;  4J6I A;  3A73 A;  1VD2 A;  4M8M A;  3A9K B;  4E74 A;  3DBH B;  1V1P A;  1UD7 A;  2ASQ A;  4K7U A;  2G3Q B;  2ZVO A;  3CMM B;  1V2Y A;  1JRO A;  2L7R A;  1I35 A;  2NPT A;  3DHI C;  3LU6 A;  1LM8 B;  1F2R I;  1PGA A;  5DPW A;  3V6E B;  1MHH E;  3DPD A;  1E7G A;  2Z8J A;  3BK1 A;  2L52 A;  1WIA A;  2XW1 A;  2MWS B;  5CHV C;  2AQ1 B;  1Z5S B;  2K6D B;  1RWS A;  1IGD A;  3Q8A A;  2O2V A;  2JRI B;  1WI0 A;  2BB6 A;  4ZBK A;  4HPL B;  2CU3 A;  4NAW A;  1I4G A;  3VVW B;  1J0G A;  4EFO A;  1T0Y A;  1D5M C;  1WRD B;  4LB9 A;  2WYQ A;  1K50 A;  2BF8 B;  1MM8 A;  1L4D B;  1OFF A;  4W9D A;  1WZ3 A;  2PVG C;  2VH2 A;  3U8Z A;  1D6E C;  5AUK A;  2INC C;  1J7B A;  3RPF C;  2LJ5 A;  1TKY A;  4JQW C;  3VXW A;  4ICV A;  4PYU A;  4JWU C;  2DZK A;  3TBL D;  3C8Y A;  1QQR A;  3U7Z A;  3B2F A;  1RFK A;  1U4A A;  2BYT A;  4OR0 A;  4HRS A;  4NQK E;  3RNG C;  3PPA A;  2Z0D B;  3PLA A;  5GXG B;  1YIW A;  4A3O A;  2CHZ A;  2KWC A;  4C7Y A;  3APD A;  3RI7 C;  2FID A;  3GZN B;  1AWD A;  3BII D;  2WGS A;  2BXC A;  2BXF A;  4I6P A;  4A20 A;  4MGI E;  3R8B A;  2DZM A;  2KWV B;  4XYC A;  1KFY B;  4ITK A;  3ZGZ A;  3Q3F A;  2BVC A;  3CIR B;  3CWI A;  4GB9 A;  4ZRQ A;  4EZL A;  2G9H D;  3P4R B;  3NZS A;  2R61 A;  1R4M I;  4KDL B;  1MG4 A;  2CJN A;  4GDK B; 
#chains in the Genus database with same CATH homology
 4RGT A;  2KQ7 A;  5DPT A;  2KLG A;  3NY5 A;  4A90 A;  2FCS A;  1WYG A;  2IYD B;  2WXR A;  4KKJ A;  1E8W A;  3D32 A;  3IT4 B;  1BXT A;  1R7S A;  1QOF A;  4FHJ A;  5AZF A;  4K1R B;  4A3P A;  2WNM A;  2YEP B;  4F8C B;  1LOT A;  5E6O A;  4OVV A;  5TSS A;  2JT4 B;  2W54 A;  3QX1 A;  2OHF A;  3IXS A;  4DDI D;  3EA6 A;  2LGD A;  1E8Y A;  1MI0 A;  1SJE D;  4GOC A;  4ARI A;  1JAL A;  1SB3 C;  4HDQ A;  5GIN A;  2O6V D;  2KN5 A;  3AED B;  4II2 B;  4RM9 A;  1I4Q A;  4RCO A;  3IAM 1;  3HM6 X;  3SFE B;  3ZKJ C;  3I3T B;  3B9L A;  2N7E A;  1L4Z B;  1JWA D;  3O65 B;  4BOZ B;  3AI5 A;  4IC7 B;  3H3A A;  3CF6 E;  2PMV A;  1I4R A;  2LGI A;  2VUE A;  4NNJ B;  3FWB C;  5GIP A;  1RM6 C;  4YSY B;  1ET6 A;  1H5W A;  3ECI A;  1K8R B;  3L16 A;  3N3K B;  4WJO A;  3PLU A;  3B9J A;  1I42 A;  3NHE B;  2M0X A;  2DBW A;  2BTE A;  1QKZ A;  1FD6 A;  5JHB A;  3QIJ A;  1AYF A;  1N62 A;  2J0K A;  4RFB A;  3WAN A;  1WGH A;  2K6Q A;  2PLP A;  2Q5W D;  1GNI A;  2KAC A;  4DBG A;  1V49 A;  2BT6 A;  3KWL A;  1VLB A;  2JSV X;  3QWZ B;  2JPH A;  3PRM B;  2TSS A;  2K22 A;  3RFZ B;  4M8N A;  4FLH A;  1GJZ A;  4ZDV A;  1TKE A;  3K9P B;  2O6V A;  4ASW C;  3DVN U;  2M1M A;  2KFK A;  2RPQ A;  1H4R A;  4XE0 A;  2OJR A;  3UQB A;  4FJZ A;  2L0F A;  2N1V A;  2KDF B;  2RDH A;  1JWU D;  4L23 A;  4KIK A;  2NQO A;  4XDC A;  2IO0 B;  1TY0 A;  3TL5 A;  5FUO A;  2LHE A;  3ONS A;  2C7N B;  2YLM A;  3TJP A;  3PT2 B;  1FNU A;  3W5U B;  1I4P A;  3ZNH B;  3GB1 A;  3T8M A;  4F5U A;  3GS2 A;  1KM7 A;  3UGB B;  2Y5C A;  4MH8 A;  1TZ1 A;  1WXV A;  5D3D A;  1DOX A;  5LXI B;  3ETR A;  4KSL C;  3SEB A;  2WXH A;  1WGD A;  1JCK B;  4NY0 A;  1GAQ B;  2PE6 B;  2KZR A;  4LB2 A;  1XLQ A;  2LAS A;  1A70 A;  1SE9 A;  5BMH A;  3AUL A;  1N63 A;  3AH7 A;  4ZHP A;  1FM0 D;  3KUD B;  3DVG Y;  4WWN A;  2QSD A;  3N9Y C;  5HFY A;  1VCB A;  3OJ3 A;  4PS3 A;  2KTF A;  1VZ7 A;  1SJH D;  1FEH A;  5AZG A;  1KH0 A;  4KDI C;  4HEA 1;  4FAD A;  1TS5 A;  2AL3 A;  1GNJ A;  2WWZ A;  1I7H A;  1F77 A;  1D5X C;  2ZPN A;  4URK A;  2JXT A;  4RGN A;  1F9J A;  1WXQ A;  3OLM D;  1UGJ A;  2PIA A;  2KWD A;  2QIE B;  5J18 A;  5DBY A;  1C3T A;  4B0M A;  2L76 A;  2EKE C;  1ZDX A;  2KBZ A;  5B5T A;  4HKZ E;  1HK1 A;  1WSP A;  3LXF A;  1ZPS A;  4DWF A;  1WWT A;  2K0P A;  1E78 A;  2KAJ A;  2NMQ A;  4O1N A;  5BYQ A;  3ZNI D;  4W9G A;  2LWP A;  1AW7 A;  4BKS D;  2LMC A;  3PZ7 A;  2ZVN A;  2ZW0 A;  1P7E A;  3VRA B;  2E6X A;  4B0E A;  4FK5 B;  1E7P B;  2KX0 A;  2MP2 B;  4WJN A;  2JZ3 B;  1WZ0 A;  4FBJ B;  1XCT L;  1CMX B;  4J3O D;  4IW0 A;  4TUU A;  4BFR A;  3PS6 A;  2VUF A;  2WDT B;  3W1S C;  3T3O A;  1IJG A;  3X23 A;  1UGM A;  1V5O A;  2PEA A;  1Z2M A;  4BKE A;  2EFC A;  4HDO A;  3G9K D;  1UBI A;  3CSF A;  3T9L A;  5L83 A;  1OGW A;  1FIQ A;  2KTR B;  1V86 A;  4MSM B;  3KH0 A;  2KJR A;  3SU8 X;  2WXK A;  1TYG B;  1WFY A;  2NBU A;  5LLI A;  2MBQ A;  4ZCG A;  3A9J A;  4GU2 A;  3P4P B;  4KX6 B;  1EUV B;  2KJH B;  2N9L A;  4AJW A;  1E7I A;  3R7Q A;  3JYU A;  1TS2 A;  4KVG B;  1B1Z A;  3DVN V;  1KLV A;  4PS7 A;  1GPX A;  2MSE D;  4X57 B;  4L1B A;  4OTU A;  2BXI A;  1L0X B;  2MEK A;  1CQV A;  1HZ5 A;  2INP E;  2V4I B;  4HJG E;  2C7H A;  2KAN A;  4AOF A;  4FA6 A;  1E7E A;  3AE5 B;  1D4B A;  2AX5 A;  4OZC A;  4RGM A;  4MEM A;  3DBL I;  1EWY C;  4OHJ A;  3VR8 B;  3APC A;  4USA A;  1DOI A;  2D11 A;  2MBE A;  4IUM B;  2BXG A;  1WJ6 A;  4WWO A;  3UI3 A;  1EO6 A;  2IZV B;  1YN3 A;  1VDV A;  2O2V B;  2K3U A;  3H7S A;  5IA7 A;  3KWV A;  2M17 A;  3UIP B;  2JUH A;  4L2Y A;  2LRU A;  3RZW C;  3K9O B;  3BWU D;  2J0J A;  2CHX A;  4GLS C;  2INN E;  2MBO A;  2E0X A;  1ACC A;  4EE2 A;  4JE3 B;  2XW0 A;  3PVL A;  4HLE A;  1P3Q U;  2Z59 B;  1T3Q A;  2GBR A;  1YN4 A;  1S1Q B;  2XEW A;  1GOZ A;  3W1Y A;  1C78 A;  3M62 B;  1F0Z A;  1DYQ A;  5FR3 A;  1PYW D;  4WQM A;  4BVU C;  2JU6 X;  3AM9 A;  2I38 A;  3B0A A;  3ZJU A;  3ICX A;  2IPK D;  1UZX B;  1SSN A;  2M8S A;  1OEY J;  3ALB A;  2VZK D;  1PQS A;  4MEL A;  4NZL B;  1TF0 A;  1ZDV A;  3QAR A;  4N59 A;  4YTP B;  1QLB B;  4UDU C;  2G45 B;  5EE1 A;  4ZRI A;  2JXX A;  2NR2 A;  2LZ6 A;  1WXM A;  2Y3A A;  1JWB D;  2BXQ A;  3ZJV A;  5H8Y E;  4J2V A;  4IW2 A;  2L1A A;  2IY0 B;  4NJ6 A;  2MQJ A;  3NZU A;  1P9D U;  2ZEQ A;  2LGX A;  4HCN B;  3L4P A;  1ZGU B;  1E7F A;  1SF0 A;  4YWG G;  2RGF A;  3PLV A;  5IAA C;  4M0W B;  1WF9 A;  4HK2 A;  3ZDT A;  4DDG D;  1P0R A;  4KZ0 A;  2ACZ B;  1C4C A;  2BPS A;  3W2D A;  4XWW A;  3W1S A;  5HOZ A;  2MJD A;  3OWE B;  1ESF A;  2IY1 B;  2BXE A;  3S2A A;  2KDM A;  4BBN C;  1BUI C;  3RUI B;  2BXD A;  5MPO A;  1HK3 A;  1ZW7 A;  1N5W A;  3U52 E;  2L0T A;  1WY8 A;  3NVM A;  3BVZ A;  4RGO S;  3IVF A;  1MIV A;  1I4H A;  4BBN F;  2RD0 A;  1TS4 A;  4A8X C;  1B9R A;  2L32 A;  3MHH B;  1QOG A;  1SXT A;  2L00 B;  2QJL A;  3H8H A;  4FHK A;  1ZKH A;  3IHP C;  3MHS B;  1NI3 A;  1E7H A;  3FAH A;  1N5U A;  3EC8 A;  2K25 A;  1RFA A;  2I2Y A;  4DQO C;  2LVQ A;  1V6E A;  4KIK B;  3AE9 B;  3DVG X;  2WXL A;  4REZ A;  3DOW A;  2XVV A;  2AQ3 B;  5BMI A;  5LXH A;  3H37 A;  1EU3 A;  2JX5 A;  2KDB A;  2H88 B;  5I4D A;  3N32 A;  4P16 A;  1WX7 A;  1JML A;  2FNJ B;  1YMH E;  3RD2 A;  1QF6 A;  4W9C A;  3L10 B;  3R66 C;  4ZRP A;  3VH4 B;  4II3 B;  2MP2 A;  2JYT A;  3NVV A;  1K52 A;  4N0U D;  1Q0W B;  3ML9 A;  3B08 A;  2JWU A;  1EM7 A;  2XBB C;  4G50 A;  2FE8 A;  3H7P A;  3HVZ A;  2A4Z A;  2FBW B;  1SIJ A;  3MHS D;  2JWZ A;  1KTK A;  1NVI D;  3ZTD A;  1AN8 A;  1IBX B;  1WYW B;  3A9K A;  1D3Z A;  1WH3 A;  5BPK A;  2QHO A;  2PTL A;  2JVC A;  5IIH A;  3WHR A;  1SEB D;  1I4X A;  4YT0 B;  3R7R A;  2K39 A;  4K81 A;  1ZXI A;  1O9X A;  3Q8B A;  3Q8C A;  5BYR A;  2NCN A;  1MA9 A;  4YL8 A;  1L0Y B;  3P63 A;  3QQ8 B;  3SIV B;  4K2C A;  3J9C A;  4K7S A;  5JZE B;  3AE3 B;  2MBB B;  3JRY A;  4N9F 4;  1XO3 A;  3AE6 B;  3H9D A;  1HK4 A;  3PV1 A;  2KX3 A;  1OEY A;  1SIF A;  2MH7 A;  4HGK A;  2J7Q B;  4WWP A;  1H8C A;  3TEZ A;  1LNS A;  3WA0 A;  3NVZ A;  3PRP B;  1QT9 A;  2MLB A;  4K71 A;  1MIW A;  1UH6 A;  3BYT B;  2K9X A;  2D07 B;  2Y5P A;  1WM3 A;  2BYF A;  2FIF A;  2OED A;  3RUL A;  4W9L A;  2WDV B;  2EEL A;  3FIL A;  2BXN A;  3WHS A;  1KJT A;  1WMH A;  2UYZ B;  5DCN A;  1CJE A;  3JW0 X;  1ROE A;  1RYJ A;  3AU4 A;  1V97 A;  1XXG A;  2BS3 B;  2WXG A;  4ZRJ A;  2MA9 B;  2KTR A;  3A75 A;  5EE3 A;  1V80 A;  4YTN B;  3V3X A;  3L08 A;  2CHW A;  3V61 A;  1E9M A;  4L9Q A;  2XNA C;  1YX6 B;  2KFJ A;  5EE0 A;  3A9J B;  1UOR A;  3PGE A;  2DHZ A;  4DHZ B;  4G0N B;  3FIL B;  3ZQ4 A;  4HVB A;  3EGR A;  1E5W A;  1ZP0 B;  4MJS B;  1EF5 A;  3DWM A;  1XQQ A;  4ZHO A;  4TQ1 A;  1E8X A;  1LQB A;  3KVF B;  1WE7 A;  3TEW A;  5D2M B;  2GMI C;  1WGK A;  1XT9 B;  2WXM A;  5E6J A;  1SGH A;  1FRR A;  2L05 A;  5L95 C;  1WGY A;  4EEW A;  5E6P A;  2DAJ A;  5GMV A;  2BWE S;  4ARC A;  4ANW A;  2DBX A;  4AJY B;  3VDZ A;  5CTR C;  1EF1 A;  4BKG A;  2B3A A;  3VUW A;  3ZTC A;  2H89 B;  3P1M A;  4C31 B;  2Z8K A;  2ZCB A;  4E3C A;  2WU2 B;  3PZ8 A;  1YQB A;  1KLU D;  4AUQ C;  4IM0 A;  3DBH I;  3PZD A;  4ZUX V;  2LD9 A;  2K5P A;  1JRP A;  4R3D A;  2IBI B;  2AWT A;  3VH3 B;  3URY A;  1J7A A;  2GRI A;  3V60 A;  3PO0 A;  4BOS C;  3KLS X;  4DHX B;  2WXO A;  4YSX B;  4US9 A;  1Q1O A;  3KUZ A;  4M0W A;  3BIN A;  3VHT C;  3R2T A;  2J42 A;  3KW5 B;  2G4D B;  1E8Z A;  3EHV A;  2ICI A;  3AEE B;  2I2Z A;  2BGF A;  3OAW A;  3L13 A;  2DX5 B;  4TKN A;  2LXA A;  3BY4 B;  1TZO A;  2WXN A;  5C23 A;  5D94 A;  2WXJ A;  2G4S A;  3PRE A;  4WWM A;  2DZJ A;  3T3N A;  2FAZ A;  1XLN A;  1TBE A;  4Z9O A;  2DBY A;  2GI9 A;  3TEY A;  4RM8 A;  1E7C A;  4IM3 A;  5D7G A;  4N0F D;  2PW9 A;  3KYC D;  4CYE A;  4TSS A;  3HUI A;  3DDC B;  2RMM A;  2N9K A;  2W55 A;  5T8I A;  5H92 C;  1BM0 A;  2FCM A;  1L2N A;  2HD5 B;  4WQO B;  3SDL C;  3VQI A;  3PHX B;  2WDQ B;  1YJ1 A;  2MW5 A;  3EUB 2;  2KMA A;  1V1O A;  4OVZ A;  4EOY A;  2SAK A;  2KXJ A;  4IWP A;  4FIP B;  2XK5 A;  2N0S B;  4BKT A;  2LHD A;  2NVU I;  2LVP A;  3Q8F A;  2BB5 A;  5IJF A;  2JQR B;  2XMO A;  1FNV A;  3H6N A;  4W9K A;  4NAM A;  4KSK C;  2PJH A;  1SE4 A;  1WRI A;  2BXL A;  1ENF A;  2O6V B;  3TCA A;  4HRO A;  3LDZ E;  2KMM A;  2BS2 B;  1JWM D;  2M0A A;  2RPV A;  2GBJ A;  1LFD A;  1HZ6 A;  5GHK A;  3WHQ A;  3LU7 A;  2W3R A;  5AEK B;  1HEZ E;  2W9N A;  1FRD A;  2MBH A;  1S3S G;  3LB8 C;  2KD0 A;  3KJL A;  1PFD A;  2V36 A;  2DYB A;  4I6L B;  4LA0 A;  1TXU A;  4KV2 A;  1WJN A;  3I9V 1;  4NPN A;  2OT3 A;  1YN5 A;  2HTH A;  4B95 A;  3QHT A;  5IIX A;  4CHK A;  4GDX A;  4GMV A;  3B9M A;  4DHZ E;  1C9F A;  2CU1 A;  4FJY A;  2Z8I A;  2NTT A;  1N60 A;  2LUE A;  3UQA A;  2KOX A;  4IM2 A;  3FWC C;  4W4U B;  4US8 A;  1V1P B;  1VRA B;  2LUM A;  2EFH A;  2ZNV B;  3AXC A;  1OTR B;  3AEA B;  4W9F A;  2KFK B;  2XSI A;  2VRR B;  4FN2 A;  4XDD A;  2BYV E;  3Q69 A;  4ZRK A;  3SQJ A;  1OQR A;  2IGG A;  1K51 A;  2C7M B;  2D5G A;  2WX0 A;  3P42 A;  1K53 A;  1TS3 A;  1KLG D;  2V4L A;  4WAA A;  1PUT A;  2YDF A;  2KKC A;  2ZCC A;  3PSE B;  3Q3J A;  3P4Q B;  3UIV A;  4LTU A;  4ZBR A;  2J0M A;  2KQS A;  2WDR B;  4GG2 A;  2JYE A;  4DHJ B;  2ON8 A;  3HM3 A;  3MJ5 A;  3VRB B;  3O13 A;  1H9Z A;  3V08 A;  4W9H A;  3U4E G;  3MP9 A;  3VAW A;  5ID9 A;  2N7D A;  3PHW B;  4WAF A;  1WX8 A;  1TKG A;  1AAR A;  1N61 A;  4ANU A;  3M63 B;  1YD8 U;  4WUR A;  4MH0 E;  4DXG A;  1C1Y B;  2V0G A;  3WAL A;  2N1W A;  2OZB B;  4LCD E;  4TQ0 A;  1Q5W B;  4XZ4 A;  5HHD G;  1NEK B;  4LJP B;  5IFO A;  4G3X B;  1JW9 D;  1UWX A;  3EFU A;  2W82 A;  5BMG A;  4MT5 A;  4FUL A;  4N6E B;  3MFG A;  4RNA A;  2KVR A;  1MVK A;  1L6U A;  2BXK A;  2IGH A;  2GBN A;  1HK5 A;  3VUX A;  3L54 A;  4HKQ A;  1C4A A;  1LO5 D;  4OZA A;  3CST A;  3ZNZ B;  2J4X A;  1FO4 A;  1FFV A;  2R2Q A;  3KIK A;  1GG3 A;  3A1Q B;  3GZN I;  1TTN A;  2GBK A;  2EMT A;  2PPH A;  5C1Z A;  5CHF A;  1YQ4 B;  4JWS C;  2EFD A;  1NYQ A;  2KO3 A;  3EEC A;  1FNW A;  3NMU A;  1WR1 A;  4OW0 A;  4JX1 C;  5DPS A;  4MAC A;  4MM3 B;  4NAW B;  1IUE A;  4B9K A;  3DWG C;  3AEC B;  1KRH A;  2NBW B;  3DCG A;  2BX8 A;  1PGB A;  3AV8 A;  1ZXH A;  1MG8 A;  3AEF B;  2DZI A;  1T6B X;  1QOB A;  1V5T A;  1X1M A;  4EZJ A;  3UF8 A;  4G03 A;  3NVW A;  3TDL A;  2DAF A;  1WXS A;  4Q2J A;  2KJ6 A;  4NJC A;  4GDL A;  1P7F A;  2Y5B B;  3DBR I;  1XLP A;  3MTN B;  2LGY A;  4ZC6 A;  2C60 A;  3HHM A;  3VTV A;  4RF0 A;  1ZOY B;  1FXA A;  1XCQ L;  4ZYS A;  3TUO A;  1GC6 A;  3R3M A;  1KOT A;  1V8C A;  3BVM A;  1D5Z C;  3FC4 A;  1E0Z A;  4JGH B;  1HE8 A;  5JH5 C;  1KW2 A;  3WIM A;  2M4N A;  2DG5 A;  1BT0 A;  1YJI A;  1WMH B;  1E7B A;  4G11 A;  2IO3 B;  3RT3 B;  2KLC A;  3NOB A;  1C4P A;  2GOW A;  2E3T A;  2KK8 A;  3SD5 A;  3DQV A;  2WXI A;  2WS3 B;  2RR9 A;  3HRD D;  3NVY A;  4OVU A;  4PT5 A;  1WGG A;  2K8H A;  3PRZ A;  4TV3 A;  5BO4 B;  2AJE A;  3BVG A;  3A1Q A;  5JHA A;  2BXH A;  4OTT A;  4L9K A;  2BXP A;  2BXB A;  1C76 A;  3NS1 A;  2NBV B;  2NTS A;  1QIL A;  1CK1 A;  5E6N A;  1MHX A;  2WXP A;  4TMA B;  1HXY D;  2WP9 B;  5IJ5 A;  4ZYN A;  2QMT A;  4EZK A;  2V1Y A;  3V05 A;  2UWQ A;  1IGC A;  1RLF A;  1WGR A;  2HDE A;  2EFE A;  3WAP A;  2C5L C;  3RYT A;  1L6V A;  2BYE A;  2BXM A;  1N5X A;  1T5X D;  2DLB A;  2OOB B;  3P2B A;  1XF5 L;  2LEK A;  3HK0 A;  1FOU A;  1QOA A;  4GDL B;  1WJU A;  1PDX A;  3LYY A;  1GUA B;  1R4N I;  2KC2 A;  4MGK E;  1F2R C;  2PE9 A;  4WJP A;  3L17 A;  1E10 A;  4DXA B;  1GB4 A;  3W9C B;  1YJJ A;  4OT2 A;  3GP7 A;  1WXA A;  2WXF A;  3I57 A;  4D2K A;  5KHO A;  2XVU A;  2KHW B;  4H2A A;  3RCZ A;  4F7Z A;  4GGQ A;  2KNB A;  3VTU A;  2BXA A;  1RAX A;  1SE2 A;  4W9E A;  1KF6 B;  3AMZ A;  1NBF C;  3ZVV A;  3E56 A;  2JF5 A;  1LXD A;  3UIN B;  1IYF A;  2BXO A;  5AUI A;  1WR6 E;  3GOE A;  1DGJ A;  3V03 A;  2K8B A;  2QM6 A;  1FFU A;  2RDG A;  4KGT A;  3NVK A;  4NQL B;  2QMC A;  1NI2 A;  3WAO A;  2REX A;  2HJ8 A;  1E90 A;  4K7W A;  5J2R A;  4A9A A;  4HGM B;  4BKS A;  4DHJ D;  2FUG 1;  4BY9 C;  2WXQ A;  4F5V A;  3GQX A;  1J19 A;  4GIV A;  3A33 B;  1C77 A;  4YXD B;  4JIO U;  2DWQ A;  2MJ3 A;  3H7P B;  4HPM B;  3ZDM C;  1M4V A;  4KGR A;  2GBM A;  3TSS A;  3V62 A;  2NS5 A;  2M19 A;  4W9I A;  4A6Q A;  2JUO A;  4JL9 A;  1ZE3 D;  4DXF A;  2LXC A;  4AP4 C;  4GSW A;  5FKA C;  4N58 A;  3SR6 A;  1J8C A;  4N3Z A;  4Z69 A;  3W5V B;  4IOI E;  2BKF A;  4YSZ B;  3WCQ A;  2FCN A;  3IG3 A;  4LDT D;  2LJI A;  1GNU A;  2MCN B;  2E0Y A;  2WU5 B;  1EWC A;  1WE6 A;  2SEB D;  1BJ5 A;  4P7I A;  1ET9 A;  2AYO B;  3AE8 B;  1ZUD 2;  4RF1 A;  1V9J A;  3ENE A;  4FJV B;  5LNK 1;  4IG7 B;  2BS4 B;  4XWT A;  5C3J B;  2V3S A;  4JPS A;  2N4F A;  5CHW A;  4RH6 A;  2KDE B;  3R2I A;  3VFK A;  2KWU B;  1NDD A;  5G5G A;  3ML8 A;  5D3I B;  4C56 C;  5AZH A;  1ISN A;  1YNT E;  5DPR A;  1P1A A;  1RRB A;  2KQ4 X;  4M70 B;  1HK2 A;  3QCA A;  4LJO B;  2KDI A;  1WJ4 A;  2IDY A;  2QEJ C;  3KUC B;  4W9J A;  3ZNG C;  4F5T A;  4PS8 A;  3AB5 A;  2IO2 B;  3PTF C;  4A55 A;  3ZLZ A;  5FK9 C;  2ONQ A;  3QA8 A;  3CX9 A;  5JXV A;  1HA2 A;  1FXT B;  5J17 A;  2ZPY A;  3NVI A;  3U30 A;  2CKX A;  2QIL A;  4S1Y A;  2D10 A;  4CO7 A;  4F5S A;  2RSU A;  2I1J A;  2B76 B;  3AE4 B;  4LUF A;  2ZNV C;  4ANX A;  5IJE A;  1MPE A;  2NNW A;  1VZS A;  3QAQ A;  4EMX A;  3DBS A;  1E7U A;  1UUP A;  1HQR D;  1JNB A;  2A5U A;  2LFI A;  3SIU B;  2K8C A;  2K1F A;  1J7E A;  4JK4 A;  3NS8 A;  5D6J B;  2NPT B;  2XN9 C;  5BYS A;  3NRZ A;  2LRW A;  3L0W B;  2I1K A;  2DEN B;  2AL6 A;  3ZIM A;  3FNM A;  4LK0 M;  4IWO A;  4YTM B;  4JLC A;  3X0W A;  3M99 C;  2D3G A;  1A5R A;  3ZRC A;  1G6J A;  2CJO A;  2ROH A;  3B2G A;  2WQY B;  2GB1 A;  3A4R A;  4ICU A;  1PGX A;  3JVZ X;  2MRP A;  5GIO A;  2VDB A;  1OQQ A;  1FXI A;  1L5P A;  4FJC B;  2IGD A;  2N7J A;  2C9W B;  5CX3 A;  1VZ6 A;  4LLG M;  1EU4 A;  2IJ0 A;  1TGZ B;  3VTW A;  4FXC A;  2N9E B;  4GDK A;  2JRH A;  3U7D A;  5EE9 A;  3IAS 1;  4E99 A;  1GB1 A;  3ZUN A;  3IBE A;  1C79 A;  4KKI A;  3V6C B;  2CKH B;  2FUH B;  2KMC A;  3M95 A;  4ZBQ A;  4IDI A;  3AEB B;  4HJK A;  3ZO5 B;  2QHB A;  4IWQ A;  3MHZ A;  4MJS A;  4XX5 A;  5DQF A;  3MJW A;  1VFI A;  4G01 A;  5IIU A;  3AE1 B;  3IT6 B;  3BYY B;  1BKE A;  2MJE A;  2V3N A;  4GN1 A;  1CZP A;  1KXP D;  4MGY E;  1UNS A;  3U2S C;  2LVO A;  3AEG B;  1NT2 B;  4RMA A;  2I30 A;  1VZ8 A;  2PVO D;  4G04 A;  2LOQ A;  1YX5 B;  4MM3 A;  3KQ4 A;  2M56 B;  1E7A A;  3ZRF A;  3TIX A;  3JSV A;  1UEL A;  4GXB A;  1WM2 A;  3MC0 B;  1MIY A;  2DBU A;  2KN4 A;  1HA5 A;  2LI5 A;  2JZZ A;  1Y8R C;  3V09 A;  2XK5 B;  3NZ3 A;  2HTM E;  2DYO A;  3GA9 L;  1JQ4 A;  4KZC A;  4L8U A;  1P98 A;  2IO1 B;  5G2N A;  4ANV A;  2YEP F;  1BML C;  2EKI A;  2R2O A;  2XVW A;  4HWI B;  5EDS A;  3UIO B;  3IFW B;  1VR9 A;  2FCQ A;  4EUT A;  1L7Y A;  3SHQ A;  1FMA D;  3JSV B;  3AN1 A;  2PKO A;  4IKG A;  4MBE C;  2CS4 A;  3GQU A;  4WJQ A;  2Z8L A;  1SBB B;  2BW2 A;  3M3J A;  4B6W A;  1Y56 A;  1IP9 A;  2W3S A;  2YVC A;  1Q10 A;  1YQ3 B;  3OJ4 B;  2J53 A;  1IPG A;  3E9S A;  3WAM A;  1VJK A;  1E7V A;  2WX1 A;  3QK0 A;  2KC1 A;  5G55 A;  4E71 A;  2JZP A;  2G1E A;  3ZJT A;  4PO0 A;  2ZJD A;  4F1S A;  1E6E B;  2Z0E B;  4P6V F;  1UBQ A;  2L83 A;  1TY2 A;  2D2Q A;  2AQ2 B;  1FCL A;  2WLB A;  4AWJ A;  3AU5 A;  3BZD B;  4AQ7 A;  5ID7 A;  4AS1 A;  5C2T B;  3C0R B;  1XD3 B;  3QJZ A;  3BK2 A;  1NEN B;  3KYD D;  1AO6 A;  2AEH A;  3TEX A;  2N9P C;  4EKU A;  3ZW3 A;  4DK5 A;  4WH4 A;  4LDT B;  4OZB A;  1JRU A;  2MX2 A;  2EMS A;  5HKH A;  2N9X A;  4MDK E;  3NUH B;  5TR5 A;  2BBC A;  3B1L X;  1UWM A;  4NJ7 A;  3LJ3 A;  2HE7 A;  5G5H A;  2L8J A;  4HCP B;  4WIP A;  2ZW1 A;  2ZZP B;  1FCC C;  2CR5 A;  5KHQ A;  1J7C A;  3RZF A;  3ZYY X;  4XC2 A;  3P4S B;  3VUY A;  2BKR B;  4C80 A;  4CQN A;  3ABV B;  3LU8 A;  4ZOH C;  3HIZ A;  4C7Z A;  1STE A;  5FR6 A;  3A4S C;  3QC8 B;  3H1U A;  4IW1 A;  4KGS A;  4I6N B;  2XVQ A;  1XEE A;  3Q8E A;  5HG2 A;  3VR9 B;  4MGZ E;  4HXD A;  1OQY A;  1SE3 A;  3HVD A;  2JY6 A;  1DOY A;  3TMP B;  2VZK B;  5HI1 A;  3JQZ A;  4MSQ B;  2V3P A;  1XLO A;  3APF A;  2DYM A;  1M94 A;  1TJE A;  3SFD B;  1NYR A;  1V81 A;  4WA6 B;  1L0V B;  1WX9 A;  1JWS D;  1J78 A;  4PYZ A;  2X38 A;  4LUH A;  3AE7 B;  3AE2 B;  2J52 A;  2BWF A;  2L3Z A;  3N30 A;  1GC7 A;  1QZE A;  1IBX A;  4J6I A;  3A73 A;  1VD2 A;  4M8M A;  3A9K B;  4E74 A;  1V1P A;  1UD7 A;  2ASQ A;  4K7U A;  2G3Q B;  2ZVO A;  3CMM B;  1V2Y A;  2L7R A;  1I35 A;  1JRO A;  2NPT A;  3LU6 A;  1LM8 B;  1F2R I;  1PGA A;  5DPW A;  3V6E B;  1MHH E;  3DPD A;  1E7G A;  2Z8J A;  3BK1 A;  2L52 A;  1WIA A;  2XW1 A;  2MWS B;  5CHV C;  2AQ1 B;  1Z5S B;  2K6D B;  1RWS A;  1IGD A;  3Q8A A;  2O2V A;  2JRI B;  1WI0 A;  2BB6 A;  4ZBK A;  4HPL B;  2CU3 A;  4NAW A;  1I4G A;  3VVW B;  1J0G A;  4EFO A;  1T0Y A;  1D5M C;  1WRD B;  4LB9 A;  2WYQ A;  1K50 A;  2BF8 B;  1L4D B;  4W9D A;  1OFF A;  1WZ3 A;  2PVG C;  3U8Z A;  1D6E C;  5AUK A;  1J7B A;  3RPF C;  2LJ5 A;  4JQW C;  1TKY A;  3VXW A;  4ICV A;  4PYU A;  4JWU C;  2DZK A;  3TBL D;  3C8Y A;  1QQR A;  3U7Z A;  3B2F A;  1RFK A;  1U4A A;  2BYT A;  4OR0 A;  4HRS A;  4NQK E;  3PPA A;  2Z0D B;  3PLA A;  5GXG B;  1YIW A;  4A3O A;  2CHZ A;  2KWC A;  4C7Y A;  3APD A;  2FID A;  1AWD A;  3BII D;  2BXC A;  2BXF A;  4I6P A;  4A20 A;  4MGI E;  3R8B A;  2DZM A;  2KWV B;  1KFY B;  4ITK A;  3ZGZ A;  3Q3F A;  3CIR B;  3CWI A;  4GB9 A;  4EZL A;  4ZRQ A;  2G9H D;  3P4R B;  3NZS A;  2R61 A;  1R4M I;  4KDL B;  2CJN A;  4GDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...