2DYOA

The crystal structure of saccharomyces cerevisiae atg5- atg16(1-57) complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
286
structure length
269
Chain Sequence
HMNDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPLIWNKIKSFLSFDPEKYFWFEHNKTPIPWNYPVGVLFDCLAGKSAVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKEGDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein turnover/protein turnover
molecule keywords Autophagy protein 5
publication title Structure of Atg5.Atg16, a complex essential for autophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 269
sequence length 286
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dyoA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dyoA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dyoA01
3APCA 5AZHA 1NDDA 2KQSA 1XT9B 1WM2A 3CSFA 1UD7A 3JSVA 2R2QA 2ZEQA 3A4SC 4W9EA 3DVGX 2DAFA 1P1AA 4XC2A 3SD5A 2O6VA 3AI5A 4KDIC 1L7YA 2KTFA 3T8MA 2MSED 3L17A 1WFYA 4IWQA 2K6DB 3QHTA 1LQBA 2KK8A 2KVRA 3WAOA 3L08A 4BKGA 3A9KB 2ZVOA 4RM8A 5E6NA 1OQYA 2FNJB 1E7VA 4W9FA 2HTHA 4K1RB 4FADA 2N1VA 3PVLA 2KOXA 2CKHB 3APFA 2D2QA 5D7GA 4PYZA 1GC7A 3RT3B 3S2AA 1C1YB 2KTRA 4M8MA 2OJRA 2G45B 2ASQA 3QX1A 2NR2A 2MP2B 2O6VD 2V4LA 3L16A 4BOSC 3VTVA 2IY0B 3NS8A 5AEKB 3A9JA 3KW5B 3ZRFA 2KJRA 4OVVA 2BPSA 2AL3A 1X1MA 1WGHA 4B95A 2BWFA 4IWOA 3WAPA 5CHFA 3R7QA 3A33B 3PRMB 2O2VA 2MW5A 4KSLC 4AWJA 1RFAA 4F8CB 3RYTA 3OJ4B 2KNBA 2EMTA 1SIFA 2WX0A 1R4NI 4A20A 3AXCA 2JZ3B 4PYUA 3N30A 3NY5A 2KWUB 4J6IA 1GNUA 2CHXA 2LVPA 5HKHA 5CHVC 2DZMA 3ZNGC 1OTRB 2V1YA 2G4SA 3ALBA 2EKEC 2YLMA 1Q1OA 4NJ7A 2ZPYA 3JSVB 5L83A 2PJHA 2LRWA 1E90A 1UZXB 4DWFA 2A5UA 2WWZA 3V61A 1GJZA 2O6VB 3LDZE 4ANWA 4CYEA 4B6WA 1VD2A 3ONSA 2KDFB 5J17A 4CO7A 4KIKA 4GSWA 4F1SA 3UIPB 3OAWA 4BKTA 2BYVE 2JPHA 5LXIB 4B9KA 1KM7A 5E6PA 3N32A 1J19A 3N3KB 3DVNU 5J18A 1WE7A 3ECIA 3L13A 2DYBA 4MGYE 4MDKE 3WA0A 4EZJA 2NS5A 1YD8U 2KTRB 4IC7B 4DXAB 4URKA 1KJTA 2JUOA 2IY1B 4I6NB 2LXCA 3OJ3A 1H4RA 3A9JB 5JZEB 1KOTA 2XEWA 2KLCA 2LWPA 1ZKHA 3KUCB 3B08A 3PPAA 3AULA 3QC8B 3ZDMC 4W9IA 4MJSA 2LD9A 2KMCA 2B3AA 2L3ZA 5G55A 2O2VB 2L7RA 2D10A 4ZRIA 2IO3B 3GOEA 5C1ZA 5JHBA 1I42A 2KN5A 2MWSB 4IWPA 4EKUA 2VRRB 2C60A 3JVZX 1Q5WB 4A3PA 3ZTCA 1EF1A 1GC6A 3QWZB 2W9NA 4LCDE 4P7IA 4WWNA 3TJPA 3NZSA 1WY8A 2BWES 3H9DA 1WXSA 2KJHB 3DVGY 2M8SA 4W9HA 3PTFC 3RULA 4ICVA 3CMMB 2N9EB 5CTRC 2PE6B 4KIKB 1E8XA 2AL6A 4M8NA 3DBRI 4DHZB 3ZLZA 4DDGD 1IPGA 2GBMA 1V80A 1K8RB 4HCPB 3IG3A 4LDTD 4GB9A 3TCAA 5D6JB 2XK5A 2JY6A 3PGEA 1YQBA 1V86A 1WXMA 3RUIB 4DK5A 5IA7A 5C23A 1UBIA 4JL9A 2K25A 2KX3A 2M4NA 4HLEA 1C3TA 1LFDA 1I35A 4FJYA 2HJ8A 2FAZA 1WE6A 4X57B 1SE9A 3IVFA 3PSEB 4TUUA 3VH4B 2DENB 2KO3A 2NBVB 2Y5BB 5DPWA 2M1MA 4NAWB 1TZ1A 5DCNA 4GDLB 1JRUA 2J0JA 3D32A 4TQ1A 3ZNZB 4KSKC 1E8ZA 3M95A 2BGFA 4MGKE 3ZDTA 2BKFA 4W9KA 2JZZA 1GG3A 1WR1A 1WH3A 3L0WB 4FULA 1VCBA 2KXJA 3K9OB 1WRDB 3TBLD 4IG7B 2DX5B 1UBQA 1WGGA 5J2RA 1XQQA 2KJ6A 5EDSA 4PS3A 2QHOA 4MGIE 3DBHI 3ENEA 3X0WA 3PV1A 3HIZA 4GN1A 2JT4B 2V3SA 4DHZE 2PE9A 3ZNID 2IBIB 3CF6E 4EFOA 2KLGA 2IO2B 2KQ7A 2OOBB 5KHQA 4FJZA 3HM6X 4MELA 1UELA 3B1LX 3RZFA 5JH5C 3H7SA 2ZJDA 3NZUA 3DDCB 1WF9A 2K1FA 1ISNA 2KDBA 4W9JA 4W9CA 2L0TA 2NVUI 3QIJA 3RZWC 2XK5B 2KKCA 2IYDB 3AU4A 3W1YA 1M94A 2D3GA 4FLHA 2CHWA 3PREA 4WJOA 1EF5A 4G11A 4CHKA 2RGFA 2NBUA 3CSTA 5KHOA 2XBBC 4GMVA 1A5RA 2IO1B 1E8YA 4EZKA 2UWQA 2LJ5A 3KH0A 1Q0WB 2K6QA 2LI5A 4N9F4 4NPNA 1U4AA 4AUQC 1G6JA 4ANXA 3VFKA 1WMHA 3APDA 2N7DA 4ICUA 3U7DA 4YL8A 3KYDD 2HE7A 3VQIA 4FHKA 3PS6A 4DHJD 2LZ6A 2C7HA 3MTNB 2MBOA 4AJYB 2IO0B 1EUVB 3I3TB 2NPTA 4ZRKA 4FHJA 3V6EB 5LXHA 3A1QA 1J0GA 1BT0A 3VXWA 3V62A 2FCSA 3C0RB 2KANA 2KC2A 3TIXA 2KX0A 4HVBA 3QAQA 2L00B 2MA9B 1LM8B 5IAAC 2KHWB 3VUYA 2ZCBA 4MM3A 2EMSA 3RD2A 2L0FA 4AOFA 1WGDA 4G3XB 4I6LB 2HD5B 3EFUA 1NI2A 4F7ZA 4EEWA 2AWTA 2LASA 4HJKA 3LJ3A 3NOBA 1WX8A 4DHJB 4HCNB 5TR5A 2JF5A 4FBJB 1QZEA 3ZO5B 3IHPC 4JQWC 2LGDA 1PQSA 2WDTB 4XX5A 4M0WB 3WANA 3NHEB 1V5TA 2LUEA 4WWOA 2JRIB 3VUXA 2KDEB 4HDQA 4MSMB 2CHZA 3M63B 4BFRA 4II2B 2Z0DB 3UQBA 1F9JA 5BO4B 4W9DA 3PLVA 1WMHB 2C7NB 3K9PB 4DBGA 2KFJA 5G2NA 3UIOB 2CS4A 4BBNF 4IW0A 2KMAA 2LXAA 3JYUA 4E74A 2FCNA 2NBWB 3VVWB 3KYCD 2YVCA 4MEMA 2JXXA 4NQLB 2NPTB 3H6NA 2K8CA 2DAJA 3DBLI 3R3MA 3GZNI 3V60A 2MBEA 2NCNA 2FUHB 3A9KA 4NY0A 3UINB 3VUWA 2K39A 4KZ0A 2KD0A 2GOWA 1P0RA 3PHWB 3EECA 4ANVA 3SHQA 4BKSD 2JWZA 1IP9A 1WGRA 1P98A 4PS7A 2ZZPB 4G50A 1SGHA 3DOWA 2N7EA 4K7WA 4NNJB 2KZRA 2LVQA 3UQAA 4WWPA 3OLMD 1V2YA 3ZNHB 2KFKA 4K7SA 1OEYJ 4JLCA 4DDID 1V5OA 2AEHA 3IFWB 3JW0X 3ZRCA 1WJUA 4MJSB 3WAMA 4BBNC 4BVUC 1ZGUB 1V6EA 4WAAA 3UF8A 2CR5A 2FIFA 3T9LA 1Y8RC 2KDIA 1WXVA 1HE8A 4TV3A 3ZKJC 3H7PA 3HM3A 1AARA 2BYEA 4XZ4A 3QCAA 1L2NA 2N4FA 2N1WA 4LDTB 4BOZB 1YX5B 1WR6E 1WX9A 1WZ3A 1S3SG 2BF8B 1R4MI 5E6OA 2MBHA 2KWVB 2MRPA 2IZVB 2J7QB 4E3CA 1ZW7A 3KUZA 2WX1A 1WX7A 1E8WA 3VTWA 1XD3B 3EC8A 2GBKA 2G4DB 3PZDA 2KWCA 1TBEA 2FIDA 3QA8A 2L05A 3DBSA 2C7MB 4KZCA 2D11A 3W1SC 3UGBB 3VHTC 1TTNA 3BY4B 2MX2A 1IYFA 4A3OA 2K8HA 3KUDB 2WYQA 2I1KA 5JHAA 4I6PA 4GOCA 2M0XA 2FCQA 2REXA 4ZYNA 3A4RA 4HK2A 1LXDA 2A4ZA 3VH3B 2JVCA 3HHMA 3ML8A 5DPRA 4ANUA 4RM9A 2J0KA 4GGQA 3TMPB 2RPQA 3QARA 4IM3A 4W9LA 2KFKB 2DZKA 1EO6A 3DCGA 3L54A 3U30A 3ZW3A 3H1UA 2KC1A 4HWIB 4IUMB 1P9DU 1V49A 4ASWC 1UGMA 1H8CA 4KVGB 1WIAA 4TKNA 2G3QB 3P2BA 3H7PB 3R7RA 4HPMB 4WJQA 1CMXB 4WJPA 4ZRJA 3M62B 3SU8X 3M3JA 1YX6B 5L95C 3KVFB 3Q3JA 3ZIMA 1KLVA 2N9XA 2UYZB 1E7UA 4NJ6A 3VDZA 3X23A 3EHVA 2M17A 5LLIA 1D3ZA 1Z2MA 5CX3A 2C9WB 2L8JA 1WZ0A 4FN2A 3SDLC 1V81A 2GBNA 2RR9A 3VTUA 2GMIC 2C5LC 5AZFA 1S1QB 4FJVB 1GUAB 3PLUA 3RCZA 3B0AA 4K81A 4GU2A 5D94A 4MSQB 4HPLB 2L76A 4G0NB 3VAWA 4IM0A 4RMAA 2LGYA 3IBEA 1WYWB 3DPDA 4AJWA 2I1JA 2LVOA 1FXTB 4EUTA 4EZLA 2DYMA 3ZTDA 1T0YA 1TGZB 2MQJA 3O65B 2Z59B 3R66C 4NQKE 4II3B 3MJWA 2Z0EB 4KDLB 1WJNA 4BKSA 4E71A 1RRBA 4GDKA 5FR6A 4MH0E 5GMVA 2D07B 4GIVA 3HK0A 1MG8A 1WJ6A 3Q3FA 3QQ8B 4ZDVA 2MBQA 2GBRA 2PEAA 3PT2B 4NAWA 4LJPB 2ZVNA 4GDLA 3PRPB 4HXDA 1OEYA 2AYOB 2JRHA 3ML9A 4WJNA 1YIWA 3TL5A 5D2MB 1YJ1A 1NBFC 2DHZA 4JIOU 3A1QB 1OGWA 2ZNVC 2R2OA 4W9GA 2MLBA 3V6CB 4WQOB 2LGXA 2K8BA 5DPTA 1E5WA 2DYOA 3QJZA 3WALA 2BKRB 2CU1A 1RAXA 4LJOB 2FCMA 1WJ4A 5DPSA 2MBBB 4K7UA 3DVNV 1UH6A 4TQ0A 2MP2A 3QK0A 1V9JA 3DQVA 3ZVVA 4MGZE 2RD0A 2PPHA 5AZGA 4AP4C 4GXBA 2DZJA 3BINA 3U8ZA 1P3QU 3MHSD 2MCNB 1WI0A 4JGHB 3W1SA 1WM3A 2RSUA 2BYFA 2ZCCA 4IM2A 3PRZA 3WIMA 1WGYA 1Z5SB 2ZNVB 3L10B 1RLFA 1WXAA 4FA6A 4OVUA 4KV2A 3AU5A 1J8CA 2DZIA 2GBJA 2J0MA 2ZPNA 4HDOA 5CHWA 4EOYA 3ZUNA 2N9PC 4PS8A 3PHXB 4GDKB 2LRUA
chains in the Genus database with same CATH superfamily
1NDDA 4OR0A 1MA9A 4K3BA 2R2QA 3SD5A 3DVGX 4I9OA 1EM7A 4WURA 1ZUD2 4JX1C 4ZOHC 1LQBA 3WAOA 1TZOA 2ZVOA 3GS2A 4W9FA 4K1RB 2DBWA 1I4XA 2KOXA 2ZW0A 2E0YA 5DQFA 4EE2A 1C1YB 2OJRA 3QX1A 3KWLA 1FM0D 2O6VD 2V4LA 3GB1A 4BOSC 2IY0B 5EE9A 3BPJA 2AL3A 5HHDG 1X1MA 1YN5A 3ZYYX 3R7QA 3A33B 2O2VA 2MW5A 2IGGA 4LUFA 1QT9A 1VZSA 3RYTA 3HVDA 2KNBA 2BXLA 2ONQA 1SIFA 2WX0A 3ETRA 5EE3A 1BMLC 3SQJA 1J8CA 3ALBA 2ZPYA 1GJZA 2YEPF 4ARIA 2CJNA 4ANWA 4B6WA 2G9HD 4F1SA 2BYVE 2GRIA 1KM7A 5E6PA 1TKGA 4PO0A 1J19A 1SB3C 3N3KB 3DVNU 5J18A 4FK5B 2NS5A 3AEBB 2BS4B 2KTRB 3C19A 1E7PB 4URKA 2KWFA 4AQ7A 2JUOA 2IY1B 1N5XA 5JZEB 2KLCA 2PIAA 4W9IA 5G55A 2LD9A 2B3AA 2XN9C 2L7RA 5C1ZA 1I42A 5FKAC 1HK1A 2MWSB 1WXQA 2BBCA 2C60A 1L6VA 1EF1A 1GC6A 2W9NA 4LCDE 1N6ZA 1CK1A 2KJHB 4L9QA 1E7GA 3DVGY 3ABVB 2M8SA 3PTFC 3RULA 4ICVA 5CTRC 1LOTA 2WLBA 1E8XA 2AL6A 4OVZA 3DBRI 3W5UB 3ZLZA 1QOFA 1IPGA 2GBMA 1V80A 1KTKA 2N9KA 3IG3A 3SFEB 4LDTD 4GB9A 4Z69A 2JY6A 1ZPSA 2J42A 1V86A 4G04A 1N62A 4LNOA 2BTEA 2KX3A 2M4NA 4HLEA 2XVUA 1WYGA 3ZXVA 3IVFA 2Z8JA 2DENB 2FE8A 5BPKA 2M1MA 3P4QB 5DCNA 2EFCA 3DBRB 2J0JA 1MJDA 4JPSA 3WCQA 4MGKE 2BKFA 2JZZA 5ID7A 2KXJA 2BXAA 1RWSA 2BXGA 1WGGA 5EDSA 3CIRB 1GB1A 3ICXA 4YTNB 2QHOA 1ET9A 3ZNID 2IBIB 1VRAB 3CF6E 2IO2B 4YSZB 1UELA 5JH5C 5BMIA 3H7SA 1ISNA 2WDVB 4MH8A 3O13A 2BXFA 3RZWC 1M94A 3TEXA 1WWTA 1EF5A 4YTPB 4R3DA 5GIOA 2NBUA 2DBYA 4EZKA 2UWQA 3KH0A 1C76A 1Q0WB 2LHDA 4ANXA 1VZ7A 4G03A 2N7DA 2K22A 4FHKA 4N3ZA 2KACA 3Q14C 4Q2JA 4C7YA 1EUVB 3E9SA 3HRDD 3NVWA 1L0XB 3Q8BA 1BT0A 2WNMA 1HZ5A 2KANA 1MIWA 2L00B 2V36A 2MJDA 1LM8B 3NVKA 4OHJA 1BJ5A 4MM3A 4YXDB 3RD2A 2L0FA 4C00A 5BMHA 2IGHA 2LGSA 2NQOA 4ZCGA 4HJKA 3NOBA 1WX8A 4F5SA 4F5VA 2I30A 1FO4A 3ZQ4A 4S0RA 2V4IB 2NTSA 4C56C 2LGDA 1PQSA 4OZCA 1L4DB 2JRIB 3VUXA 4MSMB 2CHZA 1HZ6A 2VDBA 3M63B 3BIID 1SXTA 3AEGB 1L5PA 3UQBA 3AE2B 3KWVA 5IJ5A 2KMAA 2LXAA 3JYUA 4E74A 1L6UA 2JXXA 2K8CA 1SBBB 3DWGC 2Z8IA 3R3MA 3NVYA 2FUHB 1TJEA 5IJFA 2KD0A 1OQQA 1FNWA 1P0RA 4ANVA 4BKSD 3URYA 1SGHA 1HK3A 4L1BA 1SJHD 2TSSA 4WWPA 5I4DA 1V2YA 3AEDB 1OEYJ 1WGKA 4BVUC 3JW0X 1UORA 1D5XC 4REZA 2FIFA 3GE8C 1Y8RC 2KDIA 3L4PA 2WXHA 4XZ4A 3QCAA 4OTUA 4LDTB 1WR6E 2WXOA 1S3SG 1P7FA 2MBHA 2KWVB 3W2DA 4WIPA 1E8WA 2BX8A 3PZDA 3FWBC 2GBKA 2KWCA 4US9A 2N9LA 2C7MB 3GQUA 2INNE 3VHTC 2MX2A 1YMHE 5ID9A 1DOIA 4A3OA 3KUDB 2FCQA 4NZLB 2H88B 4HK2A 1LXDA 3BYTB 2JVCA 2LEKA 3A73A 3AECB 2Q5WD 4OTTA 4ANUA 3GP7A 3TMPB 2RPQA 2DZKA 1EO6A 2VUEA 3ZW3A 4L8UA 2EFDA 4O1NA 1V49A 4ASWC 4P6VF 2LXTA 4LUHA 4C4VA 3Q8CA 3M3JA 3KIKA 1YX6B 1WSPA 3AM9A 1DOXA 2RDHA 1RYJA 2INPE 1D3ZA 1Z2MA 5CX3A 2C9WB 1ZOYB 4FN2A 1N61A 3I57A 3H3AA 3U2SC 3BVGA 3DHIC 5BYQA 2INCC 1DGJA 1GUAB 2AX5A 4GU2A 4G0NB 1B9RA 3UIVA 4LNNA 2I1JA 2LVOA 1FXTB 2WDQB 3HVZA 3MJWA 4E71A 3FKYA 5FR6A 1ZDXA 4XGAB 2Z8LA 3Q3FA 1WJ6A 3QQ8B 3PT2B 2ZVNA 3PRPB 1IUEA 2AYOB 1KLUD 1QQRA 3H8HA 4WJNA 1YIWA 1TT5B 2ZNVC 1MIYA 4W9GA 1TS2A 2MLBA 1YQ3B 4B0MA 4WQOB 1JWSD 1E7AA 2LGXA 2K8BA 2SAKA 2DYOA 1R7SA 3QJZA 2CU1A 3BWUD 1TS5A 1WJ4A 2E3TA 5DPSA 4K7UA 3DVNV 4TQ0A 2MP2A 2RPVA 3QK0A 4UDUC 3MFGA 5AZGA 3H37A 3KQ4A 1E7BA 1WGYA 4KV2A 3V08A 1E9MA 1PDXA 2ZPNA 5CHWA 4EOYA 5FK9C 1JRPA 2WXGA 5AZHA 3PZ7A 1OFFA 1WM2A 3JSVA 3A4SC 4W9EA 1EWCA 2DAFA 2AGHB 3AI5A 4A90A 3T8MA 2MSED 1WFYA 2KVRA 2KK8A 3AE8B 4ITKA 4BKGA 3A9KB 4RM8A 1JWUD 5E6NA 2FNJB 2BVCA 4F5UA 4P1BC 4ZBQA 1FD6A 2BXIA 5D7GA 1GC7A 2G45B 2DBXA 3NS8A 2PTLA 3A9JA 2KJRA 1WGHA 4IWOA 3WAPA 4N6EB 5CHFA 2LOQA 1XEEA 4JE3B 4KSLC 2DLBA 3KLSX 2L83A 3OJ4B 5HG2A 2JZ3B 2KWUB 2LVPA 1NENB 2DZMA 2ACZB 2G4SA 4NJ7A 1ZXIA 1E90A 2OT3A 1FXAA 1UZXB 2A5UA 3Q6BA 4CO7A 4KIKA 4IW1A 1SE2A 5LXIB 2JPHA 4B9KA 1MHXA 1XF5L 2X8XX 1FMAD 2ROHA 2HDEA 2KYWA 1L0YB 1WE7A 3N1XC 4MGYE 3WA0A 4EZJA 1YD8U 1IBXA 4IC7B 4RNAA 2LJIA 1KJTA 3OJ3A 1KOTA 3J9CA 2XEWA 2LWPA 1QILA 3B08A 3AULA 3QC8B 4MJSA 2KMCA 2D3AA 2O2VB 1FNUA 2JYTA 2IO3B 4IWPA 2LHEA 1UGJA 1BUIC 2VRRB 3JVZX 3ZTCA 1TY0A 1UWXA 2D3CA 4WWNA 3TJPA 2BWES 3H9DA 3Q8EA 1OQRA 3CMMB 5IKCM 2KT7A 3AE7B 1VJKA 4DDGD 1UNSA 3AE4B 3MHHB 2BS2B 2LFIA 1TS3A 2XK5A 3PGEA 1PGAA 3RUIB 4JL9A 4LLGM 4P1CC 2K25A 2WGSA 1I35A 2EELA 2HJ8A 1WE6A 4TUUA 3BVMA 2KO3A 3VH4B 2NBVB 5DPWA 5IFOA 4BKEA 2LUMA 1PYWD 3ZNZB 3M95A 4L23A 3C8YA 2I38A 2BXQA 3Q8AA 1GG3A 4FULA 1VCBA 4XYCA 2QM6A 3TBLD 4IG7B 1UBQA 2KJ6A 1KH0A 3X0WA 3FNMA 3HIZA 2X38A 4GN1A 2JT4B 2YDFA 2KLGA 2OOBB 1QOGA 5EE1A 4A6QA 3LYYA 4W4UB 2CJOA 3AE9B 3DDCB 1WF9A 2M19A 5G5HA 4W9CA 3QIJA 2IYDB 1JWAD 2BT6A 3W1YA 2HJ1A 1HK4A 1HXYD 2CHWA 4G11A 4CHKA 1J78A 1MI0A 4M0WA 1A5RA 1E8YA 2KDMA 4GG2A 2LI5A 4N9F4 2GI9A 3W9CB 1U4AA 1WMHA 3APDA 3U7DA 2WXMA 3KYDD 5LNK1 1T3QA 3PS6A 2C7HA 1C77A 4AJYB 2MBOA 4JWUC 1B1ZA 2NPTA 3GE3C 1J0GA 3A1QA 4OZBA 1J7BA 5EE0A 3V62A 2WQYB 2KX0A 2QJLA 2V3NA 1YN3A 2ZCBA 2EMSA 3P42A 1QOBA 4I6LB 4F7ZA 2AWTA 4MBEC 2LASA 3LJ3A 4PK1A 4DHJB 1D5ZC 2JF5A 3MJ5A 4CQNA 3B9JA 3B2GA 4XX5A 2LUEA 2WXIA 1GNJA 2JQRB 4BFRA 1AYFA 4II2B 2XSIA 2D5GA 5D3DA 1CQVA 4ZRPA 2YEPB 3MP9A 4BBNF 4IW0A 2QIEB 3RMKC 4ZC6A 1ROEA 2YVCA 1KFYB 1F0ZA 3V60A 4US8A 2NCNA 3VUWA 4NY0A 1HA5A 3UINB 2K39A 4N0FD 4A9AA 3EECA 3SHQA 1IP9A 2ICIA 3N1YC 5H8YE 4MM3B 3JQZA 3IXSA 4NNJB 3UQAA 1C4PA 1NYQA 2KFKA 4WH4A 1TS4A 4LB9A 1V5OA 2AEHA 1MG4A 4GLSC 3EUB2 2K3UA 1T5XD 2CR5A 1VFIA 3EFCA 3T9LA 3H7PA 1AARA 2XVWA 1L2NA 2N1WA 1HA2A 1YX5B 2BS3B 4ZHPA 1WX9A 1LGRA 2MRPA 2IZVB 1FEHA 1WX7A 1XD3B 1UWMA 1TBEA 2FBWB 3DBSA 3TEWA 2D11A 3I63C 3W1SC 3RNEC 2I1KA 3CWIA 1IGDA 4ZYNA 3V03A 4S1YA 2BW2A 4WAFA 3V3XA 4HEA1 3RN9C 4RM9A 4FXCA 4ZYSA 4W9LA 3DCGA 1T0SC 3U30A 3H1UA 1NT2B 1H8CA 4KVGB 1WIAA 2G3QB 3P2BA 4DXFA 3B9LA 1TY2A 4WJQA 2W55A 1I4QA 3M62B 4LNIA 3KVFB 3ZIMA 1J7AA 1KLVA 2UYZB 1KDXA 3Q3OC 3VDZA 4LNKA 5LLIA 2K9XA 2L8JA 1WZ0A 1V81A 2GMIC 5GHKA 3NG0A 4FJVB 1QLBB 5GXGB 1XLQA 5C2TB 3B0AA 3RCZA 4JWSC 3DHHC 3VAWA 1TXUA 3IBEA 4D7XA 1HEZE 4HGKA 3EGRA 4XWTA 4EUTA 1TGZB 2Z59B 4NQKE 2Z0EB 5GIPA 4B0EA 1MG8A 4ZDVA 2GBRA 1V8CA 4C4VB 2QC8A 4HXDA 3ML9A 2JUHA 1NBFC 2J52A 1LNSA 2R2OA 1FNVA 1UUPA 1ZP0B 2PMVA 2BXEA 1FXIA 2G1EA 4BAXA 2BB6A 3AE6B 3AE1B 4HPPA 2M0AA 3B9MA 1UH6A 1N63A 3BZDB 3TDLA 1V9JA 4MGZE 3AEFB 3MC9A 4GXBA 4G01A 1C4CA 2MCNB 3MHSD 1WI0A 1JWBD 3P4SB 4JGHB 2RSUA 3WIMA 1AWDA 4LTUA 2WXFA 1RLFA 1WXAA 4IDIA 3WHQA 2OEDA 3AH7A 1VZ6A 1K52A 2N9PC 4RH6A 4PS8A 3APCA 3CSFA 1XT9B 1UD7A 2ZEQA 2MJEA 2WXNA 2O6VA 2BXNA 4KKJA 4KDIC 2ZW1A 3L17A 1XCQL 1JQ4A 1HTOA 4IWQA 3QHTA 1E7FA 1ET6A 3L08A 1VDVA 1E7VA 2W82A 2HTHA 4FADA 2XW0A 3P1MA 4RCOA 2CKHB 1CZPA 4IW2A 4PYZA 3RT3B 4M8MA 2MP2B 1E0ZA 1TIFA 3VTVA 2LQHA 2OJWA 3KW5B 3ZRFA 4OVVA 2BPSA 4HROA 2BWFA 3PRMB 1RFAA 1I4PA 1R4NI 4A20A 3AXCA 4PYUA 4NJCA 3NY5A 4KX6B 5MPOA 4J6IA 2LXSA 1K50A 1BM0A 5HKHA 3ZNGC 2EKEC 2YLMA 3Q8FA 3JSVB 2PJHA 2LRWA 4DWFA 3V61A 3LDZE 1VD2A 2KDFB 2DBUA 2W3SA 2V9HA 3UIPB 4BKTA 3N32A 4HKZE 1AN8A 2Y3AA 1V1OA 3ECIA 1E7EA 1R4NB 3L13A 4P16A 2GUTA 2NNWA 1GPXA 5IIUA 3NRZA 4DXAB 4RF0A 3RNCC 4GDXA 3N1ZC 2LXCA 1H4RA 3A9JB 4YSXB 3KUCB 3PPAA 1ZXHA 3ZDMC 4DXGA 4ZRIA 3GOEA 2E6XA 5JHBA 5HI1A 1TKYA 1XXGA 2R61A 3N9YC 4A3PA 3NUHB 3I9V1 2DG5A 1MUHA 1XLNA 1MFWA 3FILA 2QCZA 1WXSA 4KGTA 2IPKD 4XDDA 5HOZA 2PE6B 4KIKB 4WA6B 2WXKA 4ACFA 1K8RB 2VZKD 3PZ8A 1V1PB 1Q10A 1SSNA 1YQBA 2D3BA 4DK5A 1IBXB 3SFDB 1C3TA 1LFDA 3P4RB 1BKEA 2K0NA 2FAZA 4X57B 3PSEB 3VRAB 1JNBA 4NAWB 1ZDVA 4GDLB 3ZDTA 3JRYA 3MHSB 1ZE3D 1JW9D 1WH3A 3K9OB 4AS1A 5AUKA 2DX5B 5J2RA 1F77A 3DBHI 1KW2A 3ENEA 4YT0B 4L9KA 1T0RC 4NAMA 3NJTA 4DHZE 4EFOA 1VZ8A 1TYGB 5KHQA 3LU7A 3AEAB 3RZFA 3NZUA 2ZJDA 3BVZA 2PVGC 4W9JA 2K1FA 2L0TA 2XK5B 4M00A 2KN4A 2D3GA 3Q3NC 3PREA 4MACA 3LU8A 1P7EA 1C79A 3RFZB 3DBHB 4HJGE 2IO1B 3MHZA 2QEJC 3RNAC 3VFKA 4ICUA 3VQIA 2KBZA 4DHJD 1HK2A 2LZ6A 4C80A 1MVKA 3MTNB 2IO0B 2JYEA 1IGCA 4RGOS 3V6EB 2MJ3A 1C9FA 2FCSA 2RDBC 3C0RB 3FC4A 3QAQA 2MA9B 2KHWB 3VUYA 2BXMA 3RNFC 4N0UD 1WGDA 4G3XB 3EFUA 2HD5B 1NI2A 4EEWA 1IJGA 1YOVB 2K0PA 5G5GA 1D4BA 3IHPC 4JQWC 1YN4A 2WDTB 2W3RA 4M0WB 3WANA 3NHEB 1V5TA 4WWOA 2KDEB 2VUFA 1VLBA 3AE3B 2Z0DB 1GOZA 5BO4B 4W9DA 3AMZA 1WMHB 2C7NB 3K9PB 3TUOA 4DBGA 5G2NA 2CS4A 5IP4D 2BYTA 2FCNA 2GLSA 3VVWB 1DYQA 1TKEA 4NQLB 2NPTB 3DBLI 3GZNI 3A9KA 1SB0A 1CJEA 5IJEA 1XCTL 2EFEA 1P98A 1SE4A 3DOWA 5H92C 2KZRA 3OLMD 4ZUXV 4S17A 3SIUB 1YNTE 4K7SA 4JLCA 3ZRCA 3TEYA 1WJUA 1ZGUB 1V6EA 4WAAA 3DHGC 1LO5D 4TV3A 3ZKJC 3DBLB 2AQ3B 3GZNB 2MH7A 2BYEA 3ZJTA 1QOAA 2VZKB 2N4FA 4BOZB 3NVZA 2BF8B 1PGXA 4MT5A 1KLGD 3PO0A 3M99C 2J7QB 4E3CA 3KUZA 3VR9B 3EC8A 2G4DB 1SE3A 1Y56A 3QA8A 2L05A 3BY4B 3Q3MC 2K8HA 4EMXA 1STEA 4I6PA 4GOCA 5JHAA 2REXA 2JZPA 2UU7A 5GINA 2A4ZA 3VH3B 3ML8A 5DPRA 1L0VB 1EU4A 2J0KA 4GGQA 4ZBKA 2BXHA 3QARA 2KFKB 3L54A 4HGMB 4HWIB 4IUMB 1P9DU 2XVVA 4TKNA 2WS3B 3H7PB 3R7RA 3UI3A 2V0GA 1CMXB 4ZRJA 3SU8X 5IN7A 1SF0A 3ZXRA 5L95C 3BK2A 1C78A 2N9XA 4M02A 3X23A 2BB5A 3EHVA 1FCCC 3OG5A 5E6JA 3SDLC 2GBNA 4XE0A 2RR9A 2WU2B 1M4VA 3VTUA 2C5LC 3PLUA 2N0SB 1PUTA 4H2AA 4C31B 4MSQB 1E7CA 1NVID 2BXKA 1ESFA 4WQMA 4RMAA 3P4PB 2LGYA 1YQ4B 1WYWB 3T3OA 4EZLA 2DYMA 1N5UA 1T0YA 3O65B 3TEZA 3LXFA 3R66C 1FIQA 4YTMB 4KDLB 1WJNA 1RRBA 4GDKA 4N58A 2D07B 4GIVA 2JXTA 2MBQA 2PEAA 4IKGA 2OZBB 1GB4A 4LJPB 4K2CA 1OEYA 1F52A 1N5WA 3TL5A 5D2MB 4JIOU 2VH1A 1H5WA 2QMCA 3V6CB 3RPFC 3RNGC 4LJOB 2FCMA 3RI7C 2AJEA 3FAHA 2RD0A 4ARCA 3DWMA 1I4RA 1P3QU 2GB1A 1V97A 2RMMA 1WM3A 3SIVB 2BYFA 2WXRA 2ZCCA 4IM2A 1K53A 2ZNVB 2KMMA 1SIJA 2N7JA 2J0MA 3ZUNA 1E78A 3BYYB 2W54A 2LRUA 4DHXB 3AE5B 1I7HA 1N60A 4Z9OA 2KQSA 4XC2A 1P1AA 1L7YA 2KTFA 5FR3A 2K6DB 3GQXA 2BXDA 1H9ZA 1OQYA 1SJED 2N1VA 3PVLA 3APFA 1XO3A 2D2QA 3S2AA 5BMGA 2KTRA 2ASQA 2NR2A 3NVVA 3NMUA 3Q2AC 1FCLA 3L16A 3OWEB 5AEKB 2V3PA 2L32A 1F2RI 4PT5A 4YSYB 1XLPA 4B95A 2PW9A 2EFHA 2JSVX 4AWJA 4F8CB 1QKZA 2JX5A 3A75A 2EMTA 1VR9A 3N30A 1GNUA 2CHXA 5CHVC 1EU3A 1OTRB 2V1YA 5L83A 1Q1OA 4M01A 3IAS1 1NYRA 2QHBA 2I2YA 2WWZA 2O6VB 4KGRA 4CYEA 2BXOA 3ONSA 1ENFA 5J17A 3NVIA 4GSWA 3AV8A 3OAWA 1GNIA 2Y5CA 1AW7A 2DYBA 4MDKE 1KRHA 4FJCB 3ECPA 4KKIA 2FUG1 4I6NB 3U7ZA 1BXTA 1ZKHA 5BYRA 2VH2A 4RGTA 2DWQA 2L3ZA 2D10A 5IIXA 5HFYA 2KN5A 2K5PA 4EKUA 1I4GA 1Q5WB 3QWZB 4P7IA 3U52E 3NZSA 1WY8A 3AB5A 3TSSA 5IOIA 1RM6C 4W9HA 2N9EB 1FRRA 5JXVA 2XW1A 4M8NA 4DHZB 4HCPB 1L4ZB 3TCAA 5D6JB 1WXMA 2EKIA 3B2FA 5IA7A 5C23A 1UBIA 2DNFA 2BXPA 2XVQA 1XLOA 4FJYA 4ZBRA 5IIHA 1SE9A 2Y5BB 2M56B 1TZ1A 2LGIA 2XNAC 1JRUA 2E0XA 4TQ1A 3D32A 2CKXA 4KSKC 1E8ZA 4HKQA 2BGFA 1C4AA 4W9KA 2I2ZA 1WR1A 3L0WB 4ZHOA 3V09A 1ACCA 4LB2A 1WRDB 3WHSA 1XQQA 1JMLA 3FILB 1F1HA 4PS3A 4RGNA 4MGIE 4XDCA 1E7IA 3PV1A 1MHHE 2V3SA 2PE9A 2NMQA 2KQ7A 2MEKA 4FJZA 3HM6X 1AO6A 2KQ4X 3P63A 3B1LX 4LK0M 4MELA 4RF1A 1RFKA 1FOUA 2KDBA 2Y5PA 1HTQA 2NVUI 1EWYC 2KKCA 3AU4A 1PGBA 3U4EG 3MC8A 2LMCA 4FLHA 4WJOA 2RGFA 2IDYA 3CSTA 3SR6A 1SEBD 5KHOA 2XBBC 3WHRA 4GMVA 2LJ5A 4E99A 2K6QA 4NPNA 1G6JA 4AUQC 1J7EA 4YL8A 4RFBA 2HE7A 1MPEA 2QILA 2QMTA 4DQOC 3I3TB 4ZRKA 4FHJA 4A8XC 5LXHA 3VXWA 4L2YA 3NVMA 2KC2A 4HVBA 3TIXA 4OT2A 5IAAC 4YWGG 1YJIA 2WHIA 4AOFA 4FIPB 1NEKB 4F5TA 4M70B 4HCNB 4KGSA 5TR5A 4FBJB 1QZEA 3ZO5B 4K71A 4IOIE 3VR8B 1K51A 4A55A 1NI3A 4HDQA 1F9JA 3T3NA 3V05A 3G9KD 3PLVA 3LU6A 1JCKB 2PVOD 2KFJA 3CX9A 3UIOB 2IJ0A 3N20C 4TSSA 2KWDA 2NBWB 4HRSA 3KYCD 4MEMA 3H6NA 2DAJA 4J2VA 2H89B 2MBEA 2B76B 1O9XA 4BY9C 2BQQA 4KZ0A 2GOWA 4ZRQA 1UF0A 2MHJA 3PHWB 2JWZA 1WGRA 4PS7A 2ZZPB 4G50A 2N7EA 2JWUA 4K7WA 2CU3A 2LVQA 3ZNHB 4DDID 3IFWB 4BBNC 2WP9B 4MJSB 3WAMA 3UF8A 4OZAA 1MM8A 1JWMD 1WXVA 2OHFA 1HE8A 3HM3A 3GA9L 1GAQB 1FFUA 1KXPD 3LB8C 1WZ3A 2J53A 1R4MI 5E6OA 2XMOA 1ZW7A 2WX1A 3ZGZA 3VTWA 3ZJVA 3FWCC 2JU6X 3MC0B 2WXPA 2FIDA 2L52A 3HUIA 4RGMA 4KZCA 1JALA 3UGBB 1IYFA 1TTNA 1DOYA 4LA0A 2WYQA 3EA6A 3IAM1 5IO9A 4N59A 2M0XA 3IT6B 2INDC 1FRDA 3A4RA 3RNBC 3NZ3A 3HHMA 1R4MB 2WDRB 3I5JC 2AQ1B 4IM3A 4OW0A 1WRIA 1YJJA 2PLPA 2IGDA 5BYSA 2KC1A 2QSDA 1UGMA 1F2RC 2LQIA 4HPMB 4WJPA 2Z8KA 4BZAA 4K3CA 3ZJUA 5DBYA 1D5MC 4J3OD 2RDGA 3AN1A 3Q3JA 3KJLA 1KF6B 3W5VB 1E7UA 4NJ6A 5C3JB 1TF0A 4C7ZA 2M17A 1E10A 2J4XA 2WXQA 1I4HA 2NTTA 2ON8A 5AZFA 1S1QB 4K81A 5D94A 1MIVA 4HPLB 2L76A 3IT4B 1J7CA 1JROA 1D6EC 4IM0A 1QF6A 2L1AA 1V1PA 3AEEB 3DPDA 1T6BX 4AJWA 3ZTDA 2MQJA 4JK4A 4II3B 3BK1A 2PKOA 4BKSA 5T8IA 4MH0E 5GMVA 1PFDA 1MUSA 4WWMA 3VRBB 3HK0A 3R2IA 1FPYA 1HQRD 4NAWA 5B5TA 4GDLA 2JRHA 5D3IB 1YJ1A 2DHZA 3A1QB 1OGWA 1HK5A 5AUIA 2HTME 2BXCA 5DPTA 4LNFA 1E5WA 1A70A 3WALA 2BKRB 2WXJA 1RAXA 4TMAB 3E56A 4XWWA 5TSSA 5FUOA 2KAJA 2WU5B 2QDFA 2MBBB 2AQ2B 3SEBA 2SEBD 1T0QC 4QAYA 3DQVA 3R2TA 3ZVVA 2PPHA 2WXLA 4AP4C 3BINA 2DZJA 3U8ZA 3R8BA 3PLAA 3NS1A 3W1SA 1E7HA 1FFVA 3PRZA 1Z5SB 4USAA 3L10B 4FA6A 4OVUA 3AU5A 4D2KA 2DZIA 2GBJA 1E6EB 4HDOA 4DM0A 2KVZA 3PHXB 3Q69A 4GDKB 2BXBA
chains in the Genus database with same CATH topology
1NDDA 4OR0A 1MA9A 2R2QA 3SD5A 3DVGX 1EM7A 4WURA 1ZUD2 4JX1C 4ZOHC 1LQBA 3WAOA 1TZOA 2ZVOA 3GS2A 4W9FA 4K1RB 2DBWA 1I4XA 2KOXA 2ZW0A 2E0YA 5DQFA 4EE2A 1C1YB 2OJRA 3QX1A 3KWLA 1FM0D 2O6VD 2V4LA 3GB1A 4BOSC 2IY0B 5EE9A 2AL3A 5HHDG 1X1MA 1YN5A 3ZYYX 3R7QA 3A33B 2O2VA 2MW5A 2IGGA 4LUFA 1QT9A 1VZSA 3RYTA 3HVDA 2KNBA 2BXLA 2ONQA 1SIFA 2WX0A 3ETRA 5EE3A 1BMLC 3SQJA 1J8CA 3ALBA 2ZPYA 1GJZA 2YEPF 4ARIA 2CJNA 4ANWA 4B6WA 2G9HD 4F1SA 2BYVE 2GRIA 1KM7A 5E6PA 1TKGA 4PO0A 1J19A 1SB3C 3N3KB 3DVNU 5J18A 4FK5B 2NS5A 3AEBB 2KTRB 2BS4B 1E7PB 4URKA 4AQ7A 2JUOA 2IY1B 1N5XA 5JZEB 2KLCA 2PIAA 4W9IA 5G55A 2LD9A 2B3AA 2XN9C 2L7RA 5C1ZA 1I42A 5FKAC 1HK1A 2MWSB 1WXQA 2BBCA 2C60A 1L6VA 1EF1A 1GC6A 2W9NA 4LCDE 1CK1A 2KJHB 4L9QA 1E7GA 3DVGY 3ABVB 2M8SA 3PTFC 3RULA 4ICVA 5CTRC 1LOTA 2WLBA 1E8XA 2AL6A 4OVZA 3DBRI 3W5UB 3ZLZA 1QOFA 1IPGA 2GBMA 1V80A 1KTKA 2N9KA 3IG3A 3SFEB 4LDTD 4GB9A 4Z69A 2JY6A 1ZPSA 2J42A 1V86A 4G04A 1N62A 2BTEA 2KX3A 2M4NA 4HLEA 2XVUA 1WYGA 3IVFA 2Z8JA 2DENB 2FE8A 5BPKA 2M1MA 5DCNA 3P4QB 2EFCA 2J0JA 4JPSA 3WCQA 4MGKE 2BKFA 2JZZA 5ID7A 2KXJA 2BXAA 1RWSA 2BXGA 1WGGA 5EDSA 3CIRB 1GB1A 3ICXA 4YTNB 2QHOA 1ET9A 3ZNID 2IBIB 3CF6E 1VRAB 2IO2B 4YSZB 1UELA 5JH5C 5BMIA 3H7SA 1ISNA 2WDVB 4MH8A 3O13A 2BXFA 3RZWC 1M94A 3TEXA 1WWTA 1EF5A 4YTPB 4R3DA 5GIOA 2NBUA 2DBYA 4EZKA 2UWQA 3KH0A 1C76A 1Q0WB 2LHDA 4ANXA 1VZ7A 4G03A 2N7DA 2K22A 4FHKA 4N3ZA 2KACA 4Q2JA 4C7YA 1EUVB 3E9SA 3HRDD 3NVWA 1L0XB 3Q8BA 1BT0A 2WNMA 1HZ5A 2KANA 1MIWA 2L00B 2V36A 2MJDA 1LM8B 3NVKA 4OHJA 1BJ5A 4MM3A 4YXDB 3RD2A 2L0FA 5BMHA 2IGHA 2NQOA 4ZCGA 4HJKA 3NOBA 1WX8A 4F5SA 4F5VA 2I30A 1FO4A 3ZQ4A 2V4IB 2NTSA 4C56C 2LGDA 1PQSA 4OZCA 1L4DB 2JRIB 3VUXA 4MSMB 2CHZA 1HZ6A 2VDBA 3M63B 3BIID 1SXTA 3AEGB 1L5PA 3UQBA 3AE2B 3KWVA 5IJ5A 2KMAA 2LXAA 3JYUA 4E74A 1L6UA 2JXXA 2K8CA 1SBBB 3DWGC 2Z8IA 3R3MA 3NVYA 2FUHB 1TJEA 5IJFA 2KD0A 1OQQA 1FNWA 1P0RA 4ANVA 4BKSD 3URYA 1SGHA 1HK3A 4L1BA 1SJHD 2TSSA 4WWPA 5I4DA 1V2YA 3AEDB 1OEYJ 1WGKA 4BVUC 3JW0X 1UORA 1D5XC 4REZA 2FIFA 1Y8RC 2KDIA 3L4PA 2WXHA 4XZ4A 3QCAA 4OTUA 4LDTB 1WR6E 2WXOA 1S3SG 2MBHA 1P7FA 2KWVB 3W2DA 4WIPA 1E8WA 2BX8A 3PZDA 3FWBC 2GBKA 2KWCA 4US9A 2N9LA 2C7MB 3GQUA 3VHTC 2INNE 2MX2A 1YMHE 5ID9A 1DOIA 4A3OA 3KUDB 2FCQA 4NZLB 2H88B 4HK2A 1LXDA 3BYTB 2JVCA 2LEKA 3A73A 3AECB 2Q5WD 4OTTA 4ANUA 3GP7A 3TMPB 2RPQA 2DZKA 1EO6A 2VUEA 3ZW3A 4L8UA 2EFDA 4O1NA 1V49A 4ASWC 4P6VF 4LUHA 3Q8CA 3M3JA 3KIKA 1YX6B 1WSPA 3AM9A 1DOXA 2RDHA 1RYJA 2INPE 1D3ZA 1Z2MA 5CX3A 2C9WB 1ZOYB 4FN2A 1N61A 3I57A 3H3AA 3U2SC 3BVGA 5BYQA 1DGJA 1GUAB 2AX5A 4GU2A 4G0NB 1B9RA 3UIVA 2I1JA 2LVOA 1FXTB 2WDQB 3HVZA 3MJWA 4E71A 5FR6A 1ZDXA 2Z8LA 3Q3FA 1WJ6A 3QQ8B 3PT2B 2ZVNA 3PRPB 1IUEA 2AYOB 1KLUD 1QQRA 3H8HA 4WJNA 1YIWA 2ZNVC 1MIYA 4W9GA 2MLBA 1TS2A 1YQ3B 4B0MA 4WQOB 1JWSD 1E7AA 2LGXA 2K8BA 2SAKA 2DYOA 3QJZA 1R7SA 2CU1A 3BWUD 1TS5A 1WJ4A 2E3TA 5DPSA 4K7UA 3DVNV 4TQ0A 2MP2A 2RPVA 3QK0A 4UDUC 3MFGA 5AZGA 3H37A 3KQ4A 1E7BA 1WGYA 4KV2A 3V08A 1E9MA 1PDXA 2ZPNA 5CHWA 4EOYA 5FK9C 1JRPA 2WXGA 5AZHA 3PZ7A 1OFFA 1WM2A 3JSVA 3A4SC 4W9EA 1EWCA 2DAFA 3AI5A 4A90A 3T8MA 2MSED 1WFYA 2KVRA 2KK8A 4BKGA 3AE8B 4ITKA 3A9KB 4RM8A 5E6NA 1JWUD 2FNJB 4F5UA 4ZBQA 1FD6A 2BXIA 5D7GA 1GC7A 2G45B 2DBXA 3NS8A 2PTLA 3A9JA 2KJRA 1WGHA 4IWOA 3WAPA 4N6EB 5CHFA 2LOQA 1XEEA 4JE3B 4KSLC 2DLBA 3KLSX 2L83A 3OJ4B 5HG2A 2JZ3B 2KWUB 2LVPA 1NENB 2DZMA 2ACZB 2G4SA 4NJ7A 1ZXIA 1E90A 2OT3A 1UZXB 2A5UA 1FXAA 4CO7A 4KIKA 4IW1A 5LXIB 1SE2A 2JPHA 4B9KA 1MHXA 1XF5L 1FMAD 2ROHA 2HDEA 1L0YB 1WE7A 4MGYE 3WA0A 4EZJA 1YD8U 1IBXA 4IC7B 4RNAA 2LJIA 1KJTA 3OJ3A 1KOTA 3J9CA 2XEWA 2LWPA 1QILA 3B08A 3AULA 3QC8B 4MJSA 2KMCA 2O2VB 1FNUA 2JYTA 2IO3B 4IWPA 2LHEA 1UGJA 2VRRB 1BUIC 3JVZX 3ZTCA 1TY0A 1UWXA 4WWNA 3TJPA 2BWES 3H9DA 3Q8EA 1OQRA 3CMMB 3AE7B 1VJKA 4DDGD 1UNSA 3AE4B 3MHHB 2XK5A 2BS2B 1TS3A 2LFIA 3PGEA 1PGAA 3RUIB 4JL9A 4LLGM 2K25A 1I35A 2EELA 2HJ8A 1WE6A 4TUUA 3VH4B 2KO3A 3BVMA 2NBVB 5DPWA 5IFOA 4BKEA 2LUMA 1PYWD 3ZNZB 3M95A 4L23A 3C8YA 2I38A 2BXQA 3Q8AA 1GG3A 4FULA 1VCBA 2QM6A 3TBLD 4IG7B 1UBQA 2KJ6A 1KH0A 3X0WA 3FNMA 3HIZA 4GN1A 2X38A 2JT4B 2YDFA 2KLGA 2OOBB 1QOGA 5EE1A 4A6QA 3LYYA 4W4UB 2CJOA 3AE9B 3DDCB 1WF9A 2M19A 5G5HA 4W9CA 3QIJA 2IYDB 1JWAD 3W1YA 2BT6A 1HK4A 1HXYD 2CHWA 4G11A 4CHKA 1J78A 1MI0A 4M0WA 1A5RA 1E8YA 2KDMA 4GG2A 2LI5A 4N9F4 2GI9A 3W9CB 1U4AA 1WMHA 3APDA 3U7DA 2WXMA 3KYDD 5LNK1 3PS6A 1T3QA 2C7HA 1C77A 4AJYB 2MBOA 4JWUC 1B1ZA 2NPTA 1J0GA 3A1QA 4OZBA 1J7BA 5EE0A 3V62A 2WQYB 2KX0A 2QJLA 2V3NA 1YN3A 2ZCBA 2EMSA 3P42A 4I6LB 1QOBA 4F7ZA 2AWTA 4MBEC 2LASA 3LJ3A 4DHJB 1D5ZC 2JF5A 3MJ5A 4CQNA 3B9JA 3B2GA 4XX5A 2LUEA 2WXIA 1GNJA 2JQRB 4BFRA 1AYFA 4II2B 2XSIA 2D5GA 5D3DA 1CQVA 4ZRPA 2YEPB 3MP9A 4BBNF 4IW0A 2QIEB 4ZC6A 2YVCA 1ROEA 1KFYB 1F0ZA 3V60A 4US8A 3VUWA 2NCNA 4NY0A 1HA5A 3UINB 2K39A 4N0FD 4A9AA 3EECA 3SHQA 1IP9A 2ICIA 5H8YE 4MM3B 3JQZA 3IXSA 4NNJB 3UQAA 1C4PA 1NYQA 2KFKA 4WH4A 1TS4A 4LB9A 1V5OA 2AEHA 4GLSC 3EUB2 2K3UA 2CR5A 1T5XD 1VFIA 3T9LA 3H7PA 1AARA 2XVWA 1L2NA 2N1WA 1HA2A 1YX5B 2BS3B 4ZHPA 1WX9A 2MRPA 2IZVB 1FEHA 1WX7A 1XD3B 1UWMA 1TBEA 2FBWB 3DBSA 3TEWA 2D11A 3W1SC 2I1KA 3CWIA 1IGDA 4ZYNA 3V03A 4S1YA 2BW2A 4WAFA 3V3XA 4HEA1 4RM9A 4FXCA 4ZYSA 4W9LA 3DCGA 3U30A 3H1UA 1NT2B 1H8CA 4KVGB 1WIAA 2G3QB 3P2BA 4DXFA 3B9LA 1TY2A 4WJQA 2W55A 3M62B 1I4QA 3KVFB 3ZIMA 1J7AA 1KLVA 2UYZB 3VDZA 5LLIA 2K9XA 2L8JA 1WZ0A 1V81A 2GMIC 5GHKA 4FJVB 3RCZA 1QLBB 1XLQA 5GXGB 3B0AA 5C2TB 4JWSC 3VAWA 1TXUA 3IBEA 1HEZE 3EGRA 4HGKA 4XWTA 4EUTA 1TGZB 2Z59B 4NQKE 2Z0EB 5GIPA 4B0EA 1MG8A 4ZDVA 2GBRA 1V8CA 4HXDA 3ML9A 2JUHA 1NBFC 2J52A 1LNSA 2R2OA 1FNVA 1UUPA 1ZP0B 2PMVA 2BXEA 1FXIA 2G1EA 2BB6A 3AE6B 3AE1B 2M0AA 3B9MA 1UH6A 1N63A 3BZDB 3TDLA 1V9JA 4MGZE 3AEFB 4GXBA 1C4CA 4G01A 2MCNB 3MHSD 1WI0A 1JWBD 3P4SB 4JGHB 2RSUA 3WIMA 1AWDA 4LTUA 2WXFA 1RLFA 1WXAA 4IDIA 3WHQA 2OEDA 3AH7A 1VZ6A 1K52A 2N9PC 4RH6A 4PS8A 3APCA 3CSFA 1XT9B 1UD7A 2ZEQA 2MJEA 2WXNA 2O6VA 2BXNA 4KKJA 4KDIC 2ZW1A 3L17A 1XCQL 1JQ4A 4IWQA 3QHTA 1E7FA 1ET6A 3L08A 1VDVA 1E7VA 2W82A 2HTHA 4FADA 2XW0A 3P1MA 4RCOA 2CKHB 1CZPA 4IW2A 4PYZA 3RT3B 4M8MA 2MP2B 1E0ZA 3VTVA 3KW5B 3ZRFA 4OVVA 2BPSA 4HROA 2BWFA 3PRMB 1RFAA 1I4PA 1R4NI 4A20A 3AXCA 4PYUA 4NJCA 3NY5A 4KX6B 5MPOA 4J6IA 1K50A 1BM0A 5HKHA 3ZNGC 2EKEC 2YLMA 3Q8FA 3JSVB 2PJHA 2LRWA 4DWFA 3V61A 3LDZE 1VD2A 2KDFB 2DBUA 2W3SA 3UIPB 4BKTA 3N32A 4HKZE 1AN8A 2Y3AA 1V1OA 3ECIA 1E7EA 3L13A 4P16A 2NNWA 1GPXA 5IIUA 3NRZA 4DXAB 4RF0A 4GDXA 2LXCA 1H4RA 3A9JB 4YSXB 3KUCB 3PPAA 3ZDMC 1ZXHA 4DXGA 4ZRIA 3GOEA 5JHBA 2E6XA 5HI1A 1TKYA 1XXGA 2R61A 3N9YC 4A3PA 3NUHB 3I9V1 2DG5A 1XLNA 3FILA 1WXSA 4KGTA 2IPKD 4XDDA 5HOZA 2PE6B 4KIKB 4WA6B 2WXKA 1K8RB 2VZKD 3PZ8A 1V1PB 1Q10A 1YQBA 1SSNA 4DK5A 1IBXB 3SFDB 1C3TA 1LFDA 3P4RB 1BKEA 2FAZA 4X57B 3PSEB 3VRAB 1JNBA 4NAWB 1ZDVA 4GDLB 3ZDTA 3JRYA 3MHSB 1ZE3D 1JW9D 1WH3A 3K9OB 4AS1A 5AUKA 2DX5B 5J2RA 1F77A 3DBHI 1KW2A 3ENEA 4YT0B 4L9KA 4NAMA 4DHZE 4EFOA 1VZ8A 1TYGB 5KHQA 3LU7A 3AEAB 3RZFA 3NZUA 2ZJDA 3BVZA 2PVGC 4W9JA 2K1FA 2L0TA 2XK5B 2KN4A 2D3GA 3PREA 4MACA 3LU8A 1P7EA 1C79A 3RFZB 4HJGE 2IO1B 3MHZA 2QEJC 3VFKA 4ICUA 3VQIA 2KBZA 4DHJD 1HK2A 2LZ6A 4C80A 1MVKA 3MTNB 2IO0B 2JYEA 1IGCA 4RGOS 3V6EB 2MJ3A 1C9FA 2FCSA 3C0RB 3FC4A 3QAQA 2MA9B 2KHWB 3VUYA 2BXMA 4N0UD 1WGDA 4G3XB 2HD5B 3EFUA 1NI2A 4EEWA 1IJGA 2K0PA 5G5GA 1D4BA 3IHPC 4JQWC 1YN4A 2WDTB 2W3RA 4M0WB 3WANA 3NHEB 1V5TA 4WWOA 2KDEB 2VUFA 1VLBA 3AE3B 2Z0DB 5BO4B 1GOZA 4W9DA 3AMZA 1WMHB 2C7NB 3K9PB 4DBGA 3TUOA 5G2NA 2CS4A 2BYTA 2FCNA 3VVWB 1DYQA 1TKEA 4NQLB 2NPTB 3DBLI 3GZNI 3A9KA 1XCTL 1CJEA 5IJEA 2EFEA 1P98A 1SE4A 3DOWA 5H92C 2KZRA 3OLMD 4ZUXV 3SIUB 1YNTE 4K7SA 4JLCA 3ZRCA 3TEYA 1WJUA 1ZGUB 1V6EA 4WAAA 1LO5D 4TV3A 3ZKJC 2AQ3B 2MH7A 2BYEA 3ZJTA 1QOAA 2VZKB 2N4FA 4BOZB 3NVZA 2BF8B 1PGXA 4MT5A 1KLGD 3PO0A 3M99C 2J7QB 4E3CA 3KUZA 3VR9B 3EC8A 2G4DB 1SE3A 1Y56A 3QA8A 2L05A 3BY4B 2K8HA 4EMXA 4I6PA 5JHAA 4GOCA 1STEA 2REXA 2JZPA 5GINA 2A4ZA 3VH3B 3ML8A 5DPRA 1L0VB 2J0KA 4GGQA 1EU4A 4ZBKA 2BXHA 3QARA 2KFKB 3L54A 4HGMB 4HWIB 4IUMB 1P9DU 2XVVA 4TKNA 2WS3B 3H7PB 3R7RA 3UI3A 2V0GA 1CMXB 4ZRJA 3SU8X 1SF0A 5L95C 3BK2A 1C78A 2N9XA 3X23A 2BB5A 3EHVA 1FCCC 5E6JA 3SDLC 2GBNA 4XE0A 2RR9A 2WU2B 1M4VA 3VTUA 2C5LC 3PLUA 2N0SB 1PUTA 4H2AA 4C31B 4MSQB 1E7CA 1NVID 2BXKA 1ESFA 4WQMA 4RMAA 3P4PB 2LGYA 1YQ4B 1WYWB 3T3OA 4EZLA 2DYMA 1N5UA 1T0YA 3O65B 3TEZA 3LXFA 3R66C 1FIQA 4YTMB 4KDLB 1WJNA 1RRBA 4GDKA 4N58A 2D07B 4GIVA 2MBQA 2JXTA 2PEAA 4IKGA 2OZBB 1GB4A 4LJPB 4K2CA 1OEYA 1N5WA 3TL5A 5D2MB 4JIOU 1H5WA 2QMCA 3V6CB 3RPFC 4LJOB 2FCMA 2AJEA 3FAHA 2RD0A 4ARCA 3DWMA 1I4RA 1P3QU 2GB1A 1V97A 2RMMA 1WM3A 3SIVB 2BYFA 2ZCCA 4IM2A 2WXRA 2ZNVB 1K53A 2KMMA 1SIJA 2N7JA 2J0MA 3ZUNA 1E78A 3BYYB 2W54A 2LRUA 4DHXB 1I7HA 3AE5B 2KQSA 4Z9OA 1N60A 4XC2A 1P1AA 1L7YA 2KTFA 5FR3A 2K6DB 3GQXA 2BXDA 1H9ZA 1OQYA 1SJED 2N1VA 3PVLA 3APFA 1XO3A 2D2QA 3S2AA 5BMGA 2KTRA 2ASQA 2NR2A 3NVVA 3NMUA 1FCLA 3L16A 3OWEB 5AEKB 2V3PA 2L32A 1F2RI 4PT5A 4YSYB 1XLPA 4B95A 2PW9A 2EFHA 2JSVX 4AWJA 4F8CB 1QKZA 2JX5A 3A75A 2EMTA 1VR9A 3N30A 1GNUA 2CHXA 5CHVC 1EU3A 1OTRB 2V1YA 5L83A 1Q1OA 3IAS1 1NYRA 2QHBA 2I2YA 2WWZA 2O6VB 4KGRA 4CYEA 2BXOA 3ONSA 1ENFA 5J17A 3NVIA 4GSWA 3OAWA 3AV8A 1GNIA 2Y5CA 1AW7A 2DYBA 4MDKE 1KRHA 4FJCB 4KKIA 2FUG1 4I6NB 3U7ZA 1BXTA 1ZKHA 5BYRA 4RGTA 2L3ZA 2DWQA 2D10A 5IIXA 5HFYA 2KN5A 2K5PA 4EKUA 1I4GA 1Q5WB 3QWZB 4P7IA 3U52E 3NZSA 1WY8A 3AB5A 3TSSA 1RM6C 4W9HA 2N9EB 1FRRA 5JXVA 2XW1A 4M8NA 4DHZB 4HCPB 1L4ZB 3TCAA 5D6JB 1WXMA 5IA7A 2EKIA 3B2FA 5C23A 1UBIA 2BXPA 2XVQA 1XLOA 4FJYA 4ZBRA 5IIHA 1SE9A 2Y5BB 2M56B 1TZ1A 2LGIA 2XNAC 1JRUA 2E0XA 4TQ1A 3D32A 2CKXA 4KSKC 1E8ZA 4HKQA 2BGFA 1C4AA 4W9KA 2I2ZA 1WR1A 3L0WB 4ZHOA 3V09A 1ACCA 4LB2A 1WRDB 3WHSA 1XQQA 1JMLA 3FILB 4PS3A 4RGNA 4MGIE 4XDCA 1E7IA 3PV1A 1MHHE 2V3SA 2PE9A 2NMQA 2KQ7A 2MEKA 4FJZA 3HM6X 1AO6A 4MELA 2KQ4X 3B1LX 3P63A 4LK0M 4RF1A 1RFKA 1FOUA 2KDBA 2Y5PA 2NVUI 1EWYC 2KKCA 3AU4A 1PGBA 3U4EG 2LMCA 4FLHA 4WJOA 2RGFA 2IDYA 3CSTA 3SR6A 1SEBD 5KHOA 2XBBC 3WHRA 4GMVA 2LJ5A 4E99A 2K6QA 4NPNA 1G6JA 4AUQC 1J7EA 4YL8A 4RFBA 2HE7A 1MPEA 2QILA 2QMTA 4DQOC 3I3TB 4ZRKA 4FHJA 4A8XC 5LXHA 3VXWA 4L2YA 3NVMA 2KC2A 4HVBA 3TIXA 4OT2A 5IAAC 4YWGG 1YJIA 4AOFA 4FIPB 1NEKB 4F5TA 4M70B 4HCNB 4KGSA 5TR5A 4FBJB 1QZEA 3ZO5B 4K71A 4IOIE 3VR8B 1K51A 4A55A 1NI3A 4HDQA 1F9JA 3T3NA 3V05A 3G9KD 3PLVA 3LU6A 1JCKB 2PVOD 2KFJA 3CX9A 3UIOB 2IJ0A 4TSSA 2KWDA 2NBWB 4HRSA 3KYCD 4MEMA 3H6NA 2DAJA 4J2VA 2H89B 2MBEA 2B76B 1O9XA 4BY9C 4KZ0A 2GOWA 4ZRQA 3PHWB 2JWZA 1WGRA 4PS7A 2ZZPB 4G50A 2N7EA 4K7WA 2JWUA 2CU3A 2LVQA 3ZNHB 4DDID 3IFWB 4BBNC 4MJSB 3WAMA 2WP9B 3UF8A 4OZAA 1JWMD 1WXVA 2OHFA 1HE8A 3HM3A 3GA9L 1GAQB 1FFUA 1KXPD 3LB8C 1WZ3A 2J53A 1R4MI 5E6OA 2XMOA 1ZW7A 2WX1A 3ZGZA 3VTWA 3ZJVA 3FWCC 2JU6X 3MC0B 2WXPA 2FIDA 2L52A 3HUIA 4RGMA 4KZCA 1JALA 3UGBB 1IYFA 1TTNA 1DOYA 4LA0A 2WYQA 3EA6A 3IAM1 4N59A 2M0XA 3IT6B 3A4RA 1FRDA 3NZ3A 3HHMA 2WDRB 4IM3A 2AQ1B 4OW0A 1WRIA 1YJJA 2PLPA 2IGDA 5BYSA 2KC1A 2QSDA 1UGMA 1F2RC 4HPMB 4WJPA 2Z8KA 3ZJUA 5DBYA 1D5MC 4J3OD 2RDGA 3AN1A 3Q3JA 3KJLA 1KF6B 3W5VB 1E7UA 4NJ6A 5C3JB 1TF0A 4C7ZA 2M17A 1E10A 2J4XA 2WXQA 1I4HA 2NTTA 2ON8A 5AZFA 1S1QB 4K81A 5D94A 1MIVA 4HPLB 2L76A 3IT4B 1J7CA 1JROA 4IM0A 1D6EC 1QF6A 2L1AA 1V1PA 3AEEB 3DPDA 4AJWA 1T6BX 3ZTDA 2MQJA 4JK4A 4II3B 3BK1A 2PKOA 4BKSA 5T8IA 4MH0E 5GMVA 1PFDA 3VRBB 4WWMA 3HK0A 3R2IA 4NAWA 1HQRD 5B5TA 4GDLA 2JRHA 5D3IB 1YJ1A 2DHZA 3A1QB 1OGWA 1HK5A 5AUIA 2HTME 2BXCA 5DPTA 1E5WA 1A70A 3WALA 2BKRB 2WXJA 1RAXA 4TMAB 3E56A 4XWWA 5TSSA 5FUOA 2KAJA 2WU5B 2MBBB 2AQ2B 3SEBA 2SEBD 3DQVA 3ZVVA 3R2TA 2PPHA 2WXLA 4AP4C 3U8ZA 2DZJA 3BINA 3R8BA 3PLAA 3NS1A 3W1SA 1E7HA 1FFVA 3PRZA 1Z5SB 4USAA 3L10B 4FA6A 4OVUA 3AU5A 4D2KA 2DZIA 2GBJA 4HDOA 1E6EB 3PHXB 3Q69A 4GDKB 2BXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APC A;  5AZH A;  1NDD A;  2KQS A;  1XT9 B;  1WM2 A;  3CSF A;  1UD7 A;  3JSV A;  2R2Q A;  2ZEQ A;  3A4S C;  4W9E A;  3DVG X;  2DAF A;  1P1A A;  4XC2 A;  3SD5 A;  2O6V A;  3AI5 A;  4KDI C;  1L7Y A;  2KTF A;  3T8M A;  2MSE D;  3L17 A;  1WFY A;  4IWQ A;  2K6D B;  3QHT A;  1LQB A;  2KK8 A;  2KVR A;  3WAO A;  3L08 A;  4BKG A;  3A9K B;  2ZVO A;  4RM8 A;  5E6N A;  1OQY A;  2FNJ B;  1E7V A;  4W9F A;  2HTH A;  4K1R B;  4FAD A;  2N1V A;  3PVL A;  2KOX A;  2CKH B;  3APF A;  2D2Q A;  5D7G A;  4PYZ A;  1GC7 A;  3RT3 B;  3S2A A;  1C1Y B;  2KTR A;  4M8M A;  2OJR A;  2G45 B;  2ASQ A;  3QX1 A;  2NR2 A;  2MP2 B;  2O6V D;  2V4L A;  3L16 A;  4BOS C;  3VTV A;  2IY0 B;  3NS8 A;  5AEK B;  3A9J A;  3KW5 B;  3ZRF A;  2KJR A;  4OVV A;  2BPS A;  2AL3 A;  1X1M A;  1WGH A;  4B95 A;  2BWF A;  4IWO A;  3WAP A;  5CHF A;  3R7Q A;  3A33 B;  3PRM B;  2O2V A;  2MW5 A;  4KSL C;  4AWJ A;  1RFA A;  4F8C B;  3RYT A;  3OJ4 B;  2KNB A;  2EMT A;  1SIF A;  2WX0 A;  1R4N I;  4A20 A;  3AXC A;  2JZ3 B;  4PYU A;  3N30 A;  3NY5 A;  2KWU B;  4J6I A;  1GNU A;  2CHX A;  2LVP A;  5HKH A;  5CHV C;  2DZM A;  3ZNG C;  1OTR B;  2V1Y A;  2G4S A;  3ALB A;  2EKE C;  2YLM A;  1Q1O A;  4NJ7 A;  2ZPY A;  3JSV B;  5L83 A;  2PJH A;  2LRW A;  1E90 A;  1UZX B;  4DWF A;  2A5U A;  2WWZ A;  3V61 A;  1GJZ A;  2O6V B;  3LDZ E;  4ANW A;  4CYE A;  4B6W A;  1VD2 A;  3ONS A;  2KDF B;  5J17 A;  4CO7 A;  4KIK A;  4GSW A;  4F1S A;  3UIP B;  3OAW A;  4BKT A;  2BYV E;  2JPH A;  5LXI B;  4B9K A;  1KM7 A;  5E6P A;  3N32 A;  1J19 A;  3N3K B;  3DVN U;  5J18 A;  1WE7 A;  3ECI A;  3L13 A;  2DYB A;  4MGY E;  4MDK E;  3WA0 A;  4EZJ A;  2NS5 A;  1YD8 U;  2KTR B;  4IC7 B;  4DXA B;  4URK A;  1KJT A;  2JUO A;  2IY1 B;  4I6N B;  2LXC A;  3OJ3 A;  1H4R A;  3A9J B;  5JZE B;  1KOT A;  2XEW A;  2KLC A;  2LWP A;  1ZKH A;  3KUC B;  3B08 A;  3PPA A;  3AUL A;  3QC8 B;  3ZDM C;  4W9I A;  4MJS A;  2LD9 A;  2KMC A;  2B3A A;  2L3Z A;  5G55 A;  2O2V B;  2L7R A;  2D10 A;  4ZRI A;  2IO3 B;  3GOE A;  5C1Z A;  5JHB A;  1I42 A;  2KN5 A;  2MWS B;  4IWP A;  4EKU A;  2VRR B;  2C60 A;  3JVZ X;  1Q5W B;  4A3P A;  3ZTC A;  1EF1 A;  1GC6 A;  3QWZ B;  2W9N A;  4LCD E;  4P7I A;  4WWN A;  3TJP A;  3NZS A;  1WY8 A;  2BWE S;  3H9D A;  1WXS A;  2KJH B;  3DVG Y;  2M8S A;  4W9H A;  3PTF C;  3RUL A;  4ICV A;  3CMM B;  2N9E B;  5CTR C;  2PE6 B;  4KIK B;  1E8X A;  2AL6 A;  4M8N A;  3DBR I;  4DHZ B;  3ZLZ A;  4DDG D;  1IPG A;  2GBM A;  1V80 A;  1K8R B;  4HCP B;  3IG3 A;  4LDT D;  4GB9 A;  3TCA A;  5D6J B;  2XK5 A;  2JY6 A;  3PGE A;  1YQB A;  1V86 A;  1WXM A;  3RUI B;  4DK5 A;  5IA7 A;  5C23 A;  1UBI A;  4JL9 A;  2K25 A;  2KX3 A;  2M4N A;  4HLE A;  1C3T A;  1LFD A;  1I35 A;  4FJY A;  2HJ8 A;  2FAZ A;  1WE6 A;  4X57 B;  1SE9 A;  3IVF A;  3PSE B;  4TUU A;  3VH4 B;  2DEN B;  2KO3 A;  2NBV B;  2Y5B B;  5DPW A;  2M1M A;  4NAW B;  1TZ1 A;  5DCN A;  4GDL B;  1JRU A;  2J0J A;  3D32 A;  4TQ1 A;  3ZNZ B;  4KSK C;  1E8Z A;  3M95 A;  2BGF A;  4MGK E;  3ZDT A;  2BKF A;  4W9K A;  2JZZ A;  1GG3 A;  1WR1 A;  1WH3 A;  3L0W B;  4FUL A;  1VCB A;  2KXJ A;  3K9O B;  1WRD B;  3TBL D;  4IG7 B;  2DX5 B;  1UBQ A;  1WGG A;  5J2R A;  1XQQ A;  2KJ6 A;  5EDS A;  4PS3 A;  2QHO A;  4MGI E;  3DBH I;  3ENE A;  3X0W A;  3PV1 A;  3HIZ A;  4GN1 A;  2JT4 B;  2V3S A;  4DHZ E;  2PE9 A;  3ZNI D;  2IBI B;  3CF6 E;  4EFO A;  2KLG A;  2IO2 B;  2KQ7 A;  2OOB B;  5KHQ A;  4FJZ A;  3HM6 X;  4MEL A;  1UEL A;  3B1L X;  3RZF A;  5JH5 C;  3H7S A;  2ZJD A;  3NZU A;  3DDC B;  1WF9 A;  2K1F A;  1ISN A;  2KDB A;  4W9J A;  4W9C A;  2L0T A;  2NVU I;  3QIJ A;  3RZW C;  2XK5 B;  2KKC A;  2IYD B;  3AU4 A;  3W1Y A;  1M94 A;  2D3G A;  4FLH A;  2CHW A;  3PRE A;  4WJO A;  1EF5 A;  4G11 A;  4CHK A;  2RGF A;  2NBU A;  3CST A;  5KHO A;  2XBB C;  4GMV A;  1A5R A;  2IO1 B;  1E8Y A;  4EZK A;  2UWQ A;  2LJ5 A;  3KH0 A;  1Q0W B;  2K6Q A;  2LI5 A;  4N9F 4;  4NPN A;  1U4A A;  4AUQ C;  1G6J A;  4ANX A;  3VFK A;  1WMH A;  3APD A;  2N7D A;  4ICU A;  3U7D A;  4YL8 A;  3KYD D;  2HE7 A;  3VQI A;  4FHK A;  3PS6 A;  4DHJ D;  2LZ6 A;  2C7H A;  3MTN B;  2MBO A;  4AJY B;  2IO0 B;  1EUV B;  3I3T B;  2NPT A;  4ZRK A;  4FHJ A;  3V6E B;  5LXH A;  3A1Q A;  1J0G A;  1BT0 A;  3VXW A;  3V62 A;  2FCS A;  3C0R B;  2KAN A;  2KC2 A;  3TIX A;  2KX0 A;  4HVB A;  3QAQ A;  2L00 B;  2MA9 B;  1LM8 B;  5IAA C;  2KHW B;  3VUY A;  2ZCB A;  4MM3 A;  2EMS A;  3RD2 A;  2L0F A;  4AOF A;  1WGD A;  4G3X B;  4I6L B;  2HD5 B;  3EFU A;  1NI2 A;  4F7Z A;  4EEW A;  2AWT A;  2LAS A;  4HJK A;  3LJ3 A;  3NOB A;  1WX8 A;  4DHJ B;  4HCN B;  5TR5 A;  2JF5 A;  4FBJ B;  1QZE A;  3ZO5 B;  3IHP C;  4JQW C;  2LGD A;  1PQS A;  2WDT B;  4XX5 A;  4M0W B;  3WAN A;  3NHE B;  1V5T A;  2LUE A;  4WWO A;  2JRI B;  3VUX A;  2KDE B;  4HDQ A;  4MSM B;  2CHZ A;  3M63 B;  4BFR A;  4II2 B;  2Z0D B;  3UQB A;  1F9J A;  5BO4 B;  4W9D A;  3PLV A;  1WMH B;  2C7N B;  3K9P B;  4DBG A;  2KFJ A;  5G2N A;  3UIO B;  2CS4 A;  4BBN F;  4IW0 A;  2KMA A;  2LXA A;  3JYU A;  4E74 A;  2FCN A;  2NBW B;  3VVW B;  3KYC D;  2YVC A;  4MEM A;  2JXX A;  4NQL B;  2NPT B;  3H6N A;  2K8C A;  2DAJ A;  3DBL I;  3R3M A;  3GZN I;  3V60 A;  2MBE A;  2NCN A;  2FUH B;  3A9K A;  4NY0 A;  3UIN B;  3VUW A;  2K39 A;  4KZ0 A;  2KD0 A;  2GOW A;  1P0R A;  3PHW B;  3EEC A;  4ANV A;  3SHQ A;  4BKS D;  2JWZ A;  1IP9 A;  1WGR A;  1P98 A;  4PS7 A;  2ZZP B;  4G50 A;  1SGH A;  3DOW A;  2N7E A;  4K7W A;  4NNJ B;  2KZR A;  2LVQ A;  3UQA A;  4WWP A;  3OLM D;  1V2Y A;  3ZNH B;  2KFK A;  4K7S A;  1OEY J;  4JLC A;  4DDI D;  1V5O A;  2AEH A;  3IFW B;  3JW0 X;  3ZRC A;  1WJU A;  4MJS B;  3WAM A;  4BBN C;  4BVU C;  1ZGU B;  1V6E A;  4WAA A;  3UF8 A;  2CR5 A;  2FIF A;  3T9L A;  1Y8R C;  2KDI A;  1WXV A;  1HE8 A;  4TV3 A;  3ZKJ C;  3H7P A;  3HM3 A;  1AAR A;  2BYE A;  4XZ4 A;  3QCA A;  1L2N A;  2N4F A;  2N1W A;  4LDT B;  4BOZ B;  1YX5 B;  1WR6 E;  1WX9 A;  1WZ3 A;  1S3S G;  2BF8 B;  1R4M I;  5E6O A;  2MBH A;  2KWV B;  2MRP A;  2IZV B;  2J7Q B;  4E3C A;  1ZW7 A;  3KUZ A;  2WX1 A;  1WX7 A;  1E8W A;  3VTW A;  1XD3 B;  3EC8 A;  2GBK A;  2G4D B;  3PZD A;  2KWC A;  1TBE A;  2FID A;  3QA8 A;  2L05 A;  3DBS A;  2C7M B;  4KZC A;  2D11 A;  3W1S C;  3UGB B;  3VHT C;  1TTN A;  3BY4 B;  2MX2 A;  1IYF A;  4A3O A;  2K8H A;  3KUD B;  2WYQ A;  2I1K A;  5JHA A;  4I6P A;  4GOC A;  2M0X A;  2FCQ A;  2REX A;  4ZYN A;  3A4R A;  4HK2 A;  1LXD A;  2A4Z A;  3VH3 B;  2JVC A;  3HHM A;  3ML8 A;  5DPR A;  4ANU A;  4RM9 A;  2J0K A;  4GGQ A;  3TMP B;  2RPQ A;  3QAR A;  4IM3 A;  4W9L A;  2KFK B;  2DZK A;  1EO6 A;  3DCG A;  3L54 A;  3U30 A;  3ZW3 A;  3H1U A;  2KC1 A;  4HWI B;  4IUM B;  1P9D U;  1V49 A;  4ASW C;  1UGM A;  1H8C A;  4KVG B;  1WIA A;  4TKN A;  2G3Q B;  3P2B A;  3H7P B;  3R7R A;  4HPM B;  4WJQ A;  1CMX B;  4WJP A;  4ZRJ A;  3M62 B;  3SU8 X;  3M3J A;  1YX6 B;  5L95 C;  3KVF B;  3Q3J A;  3ZIM A;  1KLV A;  2N9X A;  2UYZ B;  1E7U A;  4NJ6 A;  3VDZ A;  3X23 A;  3EHV A;  2M17 A;  5LLI A;  1D3Z A;  1Z2M A;  5CX3 A;  2C9W B;  2L8J A;  1WZ0 A;  4FN2 A;  3SDL C;  1V81 A;  2GBN A;  2RR9 A;  3VTU A;  2GMI C;  2C5L C;  5AZF A;  1S1Q B;  4FJV B;  1GUA B;  3PLU A;  3RCZ A;  3B0A A;  4K81 A;  4GU2 A;  5D94 A;  4MSQ B;  4HPL B;  2L76 A;  4G0N B;  3VAW A;  4IM0 A;  4RMA A;  2LGY A;  3IBE A;  1WYW B;  3DPD A;  4AJW A;  2I1J A;  2LVO A;  1FXT B;  4EUT A;  4EZL A;  2DYM A;  3ZTD A;  1T0Y A;  1TGZ B;  2MQJ A;  3O65 B;  2Z59 B;  3R66 C;  4NQK E;  4II3 B;  3MJW A;  2Z0E B;  4KDL B;  1WJN A;  4BKS A;  4E71 A;  1RRB A;  4GDK A;  5FR6 A;  4MH0 E;  5GMV A;  2D07 B;  4GIV A;  3HK0 A;  1MG8 A;  1WJ6 A;  3Q3F A;  3QQ8 B;  4ZDV A;  2MBQ A;  2GBR A;  2PEA A;  3PT2 B;  4NAW A;  4LJP B;  2ZVN A;  4GDL A;  3PRP B;  4HXD A;  1OEY A;  2AYO B;  2JRH A;  3ML9 A;  4WJN A;  1YIW A;  3TL5 A;  5D2M B;  1YJ1 A;  1NBF C;  2DHZ A;  4JIO U;  3A1Q B;  1OGW A;  2ZNV C;  2R2O A;  4W9G A;  2MLB A;  3V6C B;  4WQO B;  2LGX A;  2K8B A;  5DPT A;  1E5W A;  2DYO A;  3QJZ A;  3WAL A;  2BKR B;  2CU1 A;  1RAX A;  4LJO B;  2FCM A;  1WJ4 A;  5DPS A;  2MBB B;  4K7U A;  3DVN V;  1UH6 A;  4TQ0 A;  2MP2 A;  3QK0 A;  1V9J A;  3DQV A;  3ZVV A;  4MGZ E;  2RD0 A;  2PPH A;  5AZG A;  4AP4 C;  4GXB A;  2DZJ A;  3BIN A;  3U8Z A;  1P3Q U;  3MHS D;  2MCN B;  1WI0 A;  4JGH B;  3W1S A;  1WM3 A;  2RSU A;  2BYF A;  2ZCC A;  4IM2 A;  3PRZ A;  3WIM A;  1WGY A;  1Z5S B;  2ZNV B;  3L10 B;  1RLF A;  1WXA A;  4FA6 A;  4OVU A;  4KV2 A;  3AU5 A;  1J8C A;  2DZI A;  2GBJ A;  2J0M A;  2ZPN A;  4HDO A;  5CHW A;  4EOY A;  3ZUN A;  2N9P C;  4PS8 A;  3PHX B;  4GDK B;  2LRU A; 
#chains in the Genus database with same CATH topology
 1NDD A;  4OR0 A;  1MA9 A;  4K3B A;  2R2Q A;  3SD5 A;  3DVG X;  4I9O A;  1EM7 A;  4WUR A;  1ZUD 2;  4JX1 C;  4ZOH C;  1LQB A;  3WAO A;  1TZO A;  2ZVO A;  3GS2 A;  4W9F A;  4K1R B;  2DBW A;  1I4X A;  2KOX A;  2ZW0 A;  2E0Y A;  5DQF A;  4EE2 A;  1C1Y B;  2OJR A;  3QX1 A;  3KWL A;  1FM0 D;  2O6V D;  2V4L A;  3GB1 A;  4BOS C;  2IY0 B;  5EE9 A;  3BPJ A;  2AL3 A;  5HHD G;  1X1M A;  1YN5 A;  3ZYY X;  3R7Q A;  3A33 B;  2O2V A;  2MW5 A;  2IGG A;  4LUF A;  1QT9 A;  1VZS A;  3RYT A;  3HVD A;  2KNB A;  2BXL A;  2ONQ A;  1SIF A;  2WX0 A;  3ETR A;  5EE3 A;  1BML C;  3SQJ A;  1J8C A;  3ALB A;  2ZPY A;  1GJZ A;  2YEP F;  4ARI A;  2CJN A;  4ANW A;  4B6W A;  2G9H D;  4F1S A;  2BYV E;  2GRI A;  1KM7 A;  5E6P A;  1TKG A;  4PO0 A;  1J19 A;  1SB3 C;  3N3K B;  3DVN U;  5J18 A;  4FK5 B;  2NS5 A;  3AEB B;  2BS4 B;  2KTR B;  3C19 A;  1E7P B;  4URK A;  2KWF A;  4AQ7 A;  2JUO A;  2IY1 B;  1N5X A;  5JZE B;  2KLC A;  2PIA A;  4W9I A;  5G55 A;  2LD9 A;  2B3A A;  2XN9 C;  2L7R A;  5C1Z A;  1I42 A;  5FKA C;  1HK1 A;  2MWS B;  1WXQ A;  2BBC A;  2C60 A;  1L6V A;  1EF1 A;  1GC6 A;  2W9N A;  4LCD E;  1N6Z A;  1CK1 A;  2KJH B;  4L9Q A;  1E7G A;  3DVG Y;  3ABV B;  2M8S A;  3PTF C;  3RUL A;  4ICV A;  5CTR C;  1LOT A;  2WLB A;  1E8X A;  2AL6 A;  4OVZ A;  3DBR I;  3W5U B;  3ZLZ A;  1QOF A;  1IPG A;  2GBM A;  1V80 A;  1KTK A;  2N9K A;  3IG3 A;  3SFE B;  4LDT D;  4GB9 A;  4Z69 A;  2JY6 A;  1ZPS A;  2J42 A;  1V86 A;  4G04 A;  1N62 A;  4LNO A;  2BTE A;  2KX3 A;  2M4N A;  4HLE A;  2XVU A;  1WYG A;  3ZXV A;  3IVF A;  2Z8J A;  2DEN B;  2FE8 A;  5BPK A;  2M1M A;  3P4Q B;  5DCN A;  2EFC A;  3DBR B;  2J0J A;  1MJD A;  4JPS A;  3WCQ A;  4MGK E;  2BKF A;  2JZZ A;  5ID7 A;  2KXJ A;  2BXA A;  1RWS A;  2BXG A;  1WGG A;  5EDS A;  3CIR B;  1GB1 A;  3ICX A;  4YTN B;  2QHO A;  1ET9 A;  3ZNI D;  2IBI B;  1VRA B;  3CF6 E;  2IO2 B;  4YSZ B;  1UEL A;  5JH5 C;  5BMI A;  3H7S A;  1ISN A;  2WDV B;  4MH8 A;  3O13 A;  2BXF A;  3RZW C;  1M94 A;  3TEX A;  1WWT A;  1EF5 A;  4YTP B;  4R3D A;  5GIO A;  2NBU A;  2DBY A;  4EZK A;  2UWQ A;  3KH0 A;  1C76 A;  1Q0W B;  2LHD A;  4ANX A;  1VZ7 A;  4G03 A;  2N7D A;  2K22 A;  4FHK A;  4N3Z A;  2KAC A;  3Q14 C;  4Q2J A;  4C7Y A;  1EUV B;  3E9S A;  3HRD D;  3NVW A;  1L0X B;  3Q8B A;  1BT0 A;  2WNM A;  1HZ5 A;  2KAN A;  1MIW A;  2L00 B;  2V36 A;  2MJD A;  1LM8 B;  3NVK A;  4OHJ A;  1BJ5 A;  4MM3 A;  4YXD B;  3RD2 A;  2L0F A;  4C00 A;  5BMH A;  2IGH A;  2LGS A;  2NQO A;  4ZCG A;  4HJK A;  3NOB A;  1WX8 A;  4F5S A;  4F5V A;  2I30 A;  1FO4 A;  3ZQ4 A;  4S0R A;  2V4I B;  2NTS A;  4C56 C;  2LGD A;  1PQS A;  4OZC A;  1L4D B;  2JRI B;  3VUX A;  4MSM B;  2CHZ A;  1HZ6 A;  2VDB A;  3M63 B;  3BII D;  1SXT A;  3AEG B;  1L5P A;  3UQB A;  3AE2 B;  3KWV A;  5IJ5 A;  2KMA A;  2LXA A;  3JYU A;  4E74 A;  1L6U A;  2JXX A;  2K8C A;  1SBB B;  3DWG C;  2Z8I A;  3R3M A;  3NVY A;  2FUH B;  1TJE A;  5IJF A;  2KD0 A;  1OQQ A;  1FNW A;  1P0R A;  4ANV A;  4BKS D;  3URY A;  1SGH A;  1HK3 A;  4L1B A;  1SJH D;  2TSS A;  4WWP A;  5I4D A;  1V2Y A;  3AED B;  1OEY J;  1WGK A;  4BVU C;  3JW0 X;  1UOR A;  1D5X C;  4REZ A;  2FIF A;  3GE8 C;  1Y8R C;  2KDI A;  3L4P A;  2WXH A;  4XZ4 A;  3QCA A;  4OTU A;  4LDT B;  1WR6 E;  2WXO A;  1S3S G;  1P7F A;  2MBH A;  2KWV B;  3W2D A;  4WIP A;  1E8W A;  2BX8 A;  3PZD A;  3FWB C;  2GBK A;  2KWC A;  4US9 A;  2N9L A;  2C7M B;  3GQU A;  2INN E;  3VHT C;  2MX2 A;  1YMH E;  5ID9 A;  1DOI A;  4A3O A;  3KUD B;  2FCQ A;  4NZL B;  2H88 B;  4HK2 A;  1LXD A;  3BYT B;  2JVC A;  2LEK A;  3A73 A;  3AEC B;  2Q5W D;  4OTT A;  4ANU A;  3GP7 A;  3TMP B;  2RPQ A;  2DZK A;  1EO6 A;  2VUE A;  3ZW3 A;  4L8U A;  2EFD A;  4O1N A;  1V49 A;  4ASW C;  4P6V F;  2LXT A;  4LUH A;  4C4V A;  3Q8C A;  3M3J A;  3KIK A;  1YX6 B;  1WSP A;  3AM9 A;  1DOX A;  2RDH A;  1RYJ A;  2INP E;  1D3Z A;  1Z2M A;  5CX3 A;  2C9W B;  1ZOY B;  4FN2 A;  1N61 A;  3I57 A;  3H3A A;  3U2S C;  3BVG A;  3DHI C;  5BYQ A;  2INC C;  1DGJ A;  1GUA B;  2AX5 A;  4GU2 A;  4G0N B;  1B9R A;  3UIV A;  4LNN A;  2I1J A;  2LVO A;  1FXT B;  2WDQ B;  3HVZ A;  3MJW A;  4E71 A;  3FKY A;  5FR6 A;  1ZDX A;  4XGA B;  2Z8L A;  3Q3F A;  1WJ6 A;  3QQ8 B;  3PT2 B;  2ZVN A;  3PRP B;  1IUE A;  2AYO B;  1KLU D;  1QQR A;  3H8H A;  4WJN A;  1YIW A;  1TT5 B;  2ZNV C;  1MIY A;  4W9G A;  1TS2 A;  2MLB A;  1YQ3 B;  4B0M A;  4WQO B;  1JWS D;  1E7A A;  2LGX A;  2K8B A;  2SAK A;  2DYO A;  1R7S A;  3QJZ A;  2CU1 A;  3BWU D;  1TS5 A;  1WJ4 A;  2E3T A;  5DPS A;  4K7U A;  3DVN V;  4TQ0 A;  2MP2 A;  2RPV A;  3QK0 A;  4UDU C;  3MFG A;  5AZG A;  3H37 A;  3KQ4 A;  1E7B A;  1WGY A;  4KV2 A;  3V08 A;  1E9M A;  1PDX A;  2ZPN A;  5CHW A;  4EOY A;  5FK9 C;  1JRP A;  2WXG A;  5AZH A;  3PZ7 A;  1OFF A;  1WM2 A;  3JSV A;  3A4S C;  4W9E A;  1EWC A;  2DAF A;  2AGH B;  3AI5 A;  4A90 A;  3T8M A;  2MSE D;  1WFY A;  2KVR A;  2KK8 A;  3AE8 B;  4ITK A;  4BKG A;  3A9K B;  4RM8 A;  1JWU D;  5E6N A;  2FNJ B;  2BVC A;  4F5U A;  4P1B C;  4ZBQ A;  1FD6 A;  2BXI A;  5D7G A;  1GC7 A;  2G45 B;  2DBX A;  3NS8 A;  2PTL A;  3A9J A;  2KJR A;  1WGH A;  4IWO A;  3WAP A;  4N6E B;  5CHF A;  2LOQ A;  1XEE A;  4JE3 B;  4KSL C;  2DLB A;  3KLS X;  2L83 A;  3OJ4 B;  5HG2 A;  2JZ3 B;  2KWU B;  2LVP A;  1NEN B;  2DZM A;  2ACZ B;  2G4S A;  4NJ7 A;  1ZXI A;  1E90 A;  2OT3 A;  1FXA A;  1UZX B;  2A5U A;  3Q6B A;  4CO7 A;  4KIK A;  4IW1 A;  1SE2 A;  5LXI B;  2JPH A;  4B9K A;  1MHX A;  1XF5 L;  2X8X X;  1FMA D;  2ROH A;  2HDE A;  2KYW A;  1L0Y B;  1WE7 A;  3N1X C;  4MGY E;  3WA0 A;  4EZJ A;  1YD8 U;  1IBX A;  4IC7 B;  4RNA A;  2LJI A;  1KJT A;  3OJ3 A;  1KOT A;  3J9C A;  2XEW A;  2LWP A;  1QIL A;  3B08 A;  3AUL A;  3QC8 B;  4MJS A;  2KMC A;  2D3A A;  2O2V B;  1FNU A;  2JYT A;  2IO3 B;  4IWP A;  2LHE A;  1UGJ A;  1BUI C;  2VRR B;  3JVZ X;  3ZTC A;  1TY0 A;  1UWX A;  2D3C A;  4WWN A;  3TJP A;  2BWE S;  3H9D A;  3Q8E A;  1OQR A;  3CMM B;  5IKC M;  2KT7 A;  3AE7 B;  1VJK A;  4DDG D;  1UNS A;  3AE4 B;  3MHH B;  2BS2 B;  2LFI A;  1TS3 A;  2XK5 A;  3PGE A;  1PGA A;  3RUI B;  4JL9 A;  4LLG M;  4P1C C;  2K25 A;  2WGS A;  1I35 A;  2EEL A;  2HJ8 A;  1WE6 A;  4TUU A;  3BVM A;  2KO3 A;  3VH4 B;  2NBV B;  5DPW A;  5IFO A;  4BKE A;  2LUM A;  1PYW D;  3ZNZ B;  3M95 A;  4L23 A;  3C8Y A;  2I38 A;  2BXQ A;  3Q8A A;  1GG3 A;  4FUL A;  1VCB A;  4XYC A;  2QM6 A;  3TBL D;  4IG7 B;  1UBQ A;  2KJ6 A;  1KH0 A;  3X0W A;  3FNM A;  3HIZ A;  2X38 A;  4GN1 A;  2JT4 B;  2YDF A;  2KLG A;  2OOB B;  1QOG A;  5EE1 A;  4A6Q A;  3LYY A;  4W4U B;  2CJO A;  3AE9 B;  3DDC B;  1WF9 A;  2M19 A;  5G5H A;  4W9C A;  3QIJ A;  2IYD B;  1JWA D;  2BT6 A;  3W1Y A;  2HJ1 A;  1HK4 A;  1HXY D;  2CHW A;  4G11 A;  4CHK A;  1J78 A;  1MI0 A;  4M0W A;  1A5R A;  1E8Y A;  2KDM A;  4GG2 A;  2LI5 A;  4N9F 4;  2GI9 A;  3W9C B;  1U4A A;  1WMH A;  3APD A;  3U7D A;  2WXM A;  3KYD D;  5LNK 1;  1T3Q A;  3PS6 A;  2C7H A;  1C77 A;  4AJY B;  2MBO A;  4JWU C;  1B1Z A;  2NPT A;  3GE3 C;  1J0G A;  3A1Q A;  4OZB A;  1J7B A;  5EE0 A;  3V62 A;  2WQY B;  2KX0 A;  2QJL A;  2V3N A;  1YN3 A;  2ZCB A;  2EMS A;  3P42 A;  1QOB A;  4I6L B;  4F7Z A;  2AWT A;  4MBE C;  2LAS A;  3LJ3 A;  4PK1 A;  4DHJ B;  1D5Z C;  2JF5 A;  3MJ5 A;  4CQN A;  3B9J A;  3B2G A;  4XX5 A;  2LUE A;  2WXI A;  1GNJ A;  2JQR B;  4BFR A;  1AYF A;  4II2 B;  2XSI A;  2D5G A;  5D3D A;  1CQV A;  4ZRP A;  2YEP B;  3MP9 A;  4BBN F;  4IW0 A;  2QIE B;  3RMK C;  4ZC6 A;  1ROE A;  2YVC A;  1KFY B;  1F0Z A;  3V60 A;  4US8 A;  2NCN A;  3VUW A;  4NY0 A;  1HA5 A;  3UIN B;  2K39 A;  4N0F D;  4A9A A;  3EEC A;  3SHQ A;  1IP9 A;  2ICI A;  3N1Y C;  5H8Y E;  4MM3 B;  3JQZ A;  3IXS A;  4NNJ B;  3UQA A;  1C4P A;  1NYQ A;  2KFK A;  4WH4 A;  1TS4 A;  4LB9 A;  1V5O A;  2AEH A;  1MG4 A;  4GLS C;  3EUB 2;  2K3U A;  1T5X D;  2CR5 A;  1VFI A;  3EFC A;  3T9L A;  3H7P A;  1AAR A;  2XVW A;  1L2N A;  2N1W A;  1HA2 A;  1YX5 B;  2BS3 B;  4ZHP A;  1WX9 A;  1LGR A;  2MRP A;  2IZV B;  1FEH A;  1WX7 A;  1XD3 B;  1UWM A;  1TBE A;  2FBW B;  3DBS A;  3TEW A;  2D11 A;  3I63 C;  3W1S C;  3RNE C;  2I1K A;  3CWI A;  1IGD A;  4ZYN A;  3V03 A;  4S1Y A;  2BW2 A;  4WAF A;  3V3X A;  4HEA 1;  3RN9 C;  4RM9 A;  4FXC A;  4ZYS A;  4W9L A;  3DCG A;  1T0S C;  3U30 A;  3H1U A;  1NT2 B;  1H8C A;  4KVG B;  1WIA A;  2G3Q B;  3P2B A;  4DXF A;  3B9L A;  1TY2 A;  4WJQ A;  2W55 A;  1I4Q A;  3M62 B;  4LNI A;  3KVF B;  3ZIM A;  1J7A A;  1KLV A;  2UYZ B;  1KDX A;  3Q3O C;  3VDZ A;  4LNK A;  5LLI A;  2K9X A;  2L8J A;  1WZ0 A;  1V81 A;  2GMI C;  5GHK A;  3NG0 A;  4FJV B;  1QLB B;  5GXG B;  1XLQ A;  5C2T B;  3B0A A;  3RCZ A;  4JWS C;  3DHH C;  3VAW A;  1TXU A;  3IBE A;  4D7X A;  1HEZ E;  4HGK A;  3EGR A;  4XWT A;  4EUT A;  1TGZ B;  2Z59 B;  4NQK E;  2Z0E B;  5GIP A;  4B0E A;  1MG8 A;  4ZDV A;  2GBR A;  1V8C A;  4C4V B;  2QC8 A;  4HXD A;  3ML9 A;  2JUH A;  1NBF C;  2J52 A;  1LNS A;  2R2O A;  1FNV A;  1UUP A;  1ZP0 B;  2PMV A;  2BXE A;  1FXI A;  2G1E A;  4BAX A;  2BB6 A;  3AE6 B;  3AE1 B;  4HPP A;  2M0A A;  3B9M A;  1UH6 A;  1N63 A;  3BZD B;  3TDL A;  1V9J A;  4MGZ E;  3AEF B;  3MC9 A;  4GXB A;  4G01 A;  1C4C A;  2MCN B;  3MHS D;  1WI0 A;  1JWB D;  3P4S B;  4JGH B;  2RSU A;  3WIM A;  1AWD A;  4LTU A;  2WXF A;  1RLF A;  1WXA A;  4IDI A;  3WHQ A;  2OED A;  3AH7 A;  1VZ6 A;  1K52 A;  2N9P C;  4RH6 A;  4PS8 A;  3APC A;  3CSF A;  1XT9 B;  1UD7 A;  2ZEQ A;  2MJE A;  2WXN A;  2O6V A;  2BXN A;  4KKJ A;  4KDI C;  2ZW1 A;  3L17 A;  1XCQ L;  1JQ4 A;  1HTO A;  4IWQ A;  3QHT A;  1E7F A;  1ET6 A;  3L08 A;  1VDV A;  1E7V A;  2W82 A;  2HTH A;  4FAD A;  2XW0 A;  3P1M A;  4RCO A;  2CKH B;  1CZP A;  4IW2 A;  4PYZ A;  3RT3 B;  4M8M A;  2MP2 B;  1E0Z A;  1TIF A;  3VTV A;  2LQH A;  2OJW A;  3KW5 B;  3ZRF A;  4OVV A;  2BPS A;  4HRO A;  2BWF A;  3PRM B;  1RFA A;  1I4P A;  1R4N I;  4A20 A;  3AXC A;  4PYU A;  4NJC A;  3NY5 A;  4KX6 B;  5MPO A;  4J6I A;  2LXS A;  1K50 A;  1BM0 A;  5HKH A;  3ZNG C;  2EKE C;  2YLM A;  3Q8F A;  3JSV B;  2PJH A;  2LRW A;  4DWF A;  3V61 A;  3LDZ E;  1VD2 A;  2KDF B;  2DBU A;  2W3S A;  2V9H A;  3UIP B;  4BKT A;  3N32 A;  4HKZ E;  1AN8 A;  2Y3A A;  1V1O A;  3ECI A;  1E7E A;  1R4N B;  3L13 A;  4P16 A;  2GUT A;  2NNW A;  1GPX A;  5IIU A;  3NRZ A;  4DXA B;  4RF0 A;  3RNC C;  4GDX A;  3N1Z C;  2LXC A;  1H4R A;  3A9J B;  4YSX B;  3KUC B;  3PPA A;  1ZXH A;  3ZDM C;  4DXG A;  4ZRI A;  3GOE A;  2E6X A;  5JHB A;  5HI1 A;  1TKY A;  1XXG A;  2R61 A;  3N9Y C;  4A3P A;  3NUH B;  3I9V 1;  2DG5 A;  1MUH A;  1XLN A;  1MFW A;  3FIL A;  2QCZ A;  1WXS A;  4KGT A;  2IPK D;  4XDD A;  5HOZ A;  2PE6 B;  4KIK B;  4WA6 B;  2WXK A;  4ACF A;  1K8R B;  2VZK D;  3PZ8 A;  1V1P B;  1Q10 A;  1SSN A;  1YQB A;  2D3B A;  4DK5 A;  1IBX B;  3SFD B;  1C3T A;  1LFD A;  3P4R B;  1BKE A;  2K0N A;  2FAZ A;  4X57 B;  3PSE B;  3VRA B;  1JNB A;  4NAW B;  1ZDV A;  4GDL B;  3ZDT A;  3JRY A;  3MHS B;  1ZE3 D;  1JW9 D;  1WH3 A;  3K9O B;  4AS1 A;  5AUK A;  2DX5 B;  5J2R A;  1F77 A;  3DBH I;  1KW2 A;  3ENE A;  4YT0 B;  4L9K A;  1T0R C;  4NAM A;  3NJT A;  4DHZ E;  4EFO A;  1VZ8 A;  1TYG B;  5KHQ A;  3LU7 A;  3AEA B;  3RZF A;  3NZU A;  2ZJD A;  3BVZ A;  2PVG C;  4W9J A;  2K1F A;  2L0T A;  2XK5 B;  4M00 A;  2KN4 A;  2D3G A;  3Q3N C;  3PRE A;  4MAC A;  3LU8 A;  1P7E A;  1C79 A;  3RFZ B;  3DBH B;  4HJG E;  2IO1 B;  3MHZ A;  2QEJ C;  3RNA C;  3VFK A;  4ICU A;  3VQI A;  2KBZ A;  4DHJ D;  1HK2 A;  2LZ6 A;  4C80 A;  1MVK A;  3MTN B;  2IO0 B;  2JYE A;  1IGC A;  4RGO S;  3V6E B;  2MJ3 A;  1C9F A;  2FCS A;  2RDB C;  3C0R B;  3FC4 A;  3QAQ A;  2MA9 B;  2KHW B;  3VUY A;  2BXM A;  3RNF C;  4N0U D;  1WGD A;  4G3X B;  3EFU A;  2HD5 B;  1NI2 A;  4EEW A;  1IJG A;  1YOV B;  2K0P A;  5G5G A;  1D4B A;  3IHP C;  4JQW C;  1YN4 A;  2WDT B;  2W3R A;  4M0W B;  3WAN A;  3NHE B;  1V5T A;  4WWO A;  2KDE B;  2VUF A;  1VLB A;  3AE3 B;  2Z0D B;  1GOZ A;  5BO4 B;  4W9D A;  3AMZ A;  1WMH B;  2C7N B;  3K9P B;  3TUO A;  4DBG A;  5G2N A;  2CS4 A;  5IP4 D;  2BYT A;  2FCN A;  2GLS A;  3VVW B;  1DYQ A;  1TKE A;  4NQL B;  2NPT B;  3DBL I;  3GZN I;  3A9K A;  1SB0 A;  1CJE A;  5IJE A;  1XCT L;  2EFE A;  1P98 A;  1SE4 A;  3DOW A;  5H92 C;  2KZR A;  3OLM D;  4ZUX V;  4S17 A;  3SIU B;  1YNT E;  4K7S A;  4JLC A;  3ZRC A;  3TEY A;  1WJU A;  1ZGU B;  1V6E A;  4WAA A;  3DHG C;  1LO5 D;  4TV3 A;  3ZKJ C;  3DBL B;  2AQ3 B;  3GZN B;  2MH7 A;  2BYE A;  3ZJT A;  1QOA A;  2VZK B;  2N4F A;  4BOZ B;  3NVZ A;  2BF8 B;  1PGX A;  4MT5 A;  1KLG D;  3PO0 A;  3M99 C;  2J7Q B;  4E3C A;  3KUZ A;  3VR9 B;  3EC8 A;  2G4D B;  1SE3 A;  1Y56 A;  3QA8 A;  2L05 A;  3BY4 B;  3Q3M C;  2K8H A;  4EMX A;  1STE A;  4I6P A;  4GOC A;  5JHA A;  2REX A;  2JZP A;  2UU7 A;  5GIN A;  2A4Z A;  3VH3 B;  3ML8 A;  5DPR A;  1L0V B;  1EU4 A;  2J0K A;  4GGQ A;  4ZBK A;  2BXH A;  3QAR A;  2KFK B;  3L54 A;  4HGM B;  4HWI B;  4IUM B;  1P9D U;  2XVV A;  4TKN A;  2WS3 B;  3H7P B;  3R7R A;  3UI3 A;  2V0G A;  1CMX B;  4ZRJ A;  3SU8 X;  5IN7 A;  1SF0 A;  3ZXR A;  5L95 C;  3BK2 A;  1C78 A;  2N9X A;  4M02 A;  3X23 A;  2BB5 A;  3EHV A;  1FCC C;  3OG5 A;  5E6J A;  3SDL C;  2GBN A;  4XE0 A;  2RR9 A;  2WU2 B;  1M4V A;  3VTU A;  2C5L C;  3PLU A;  2N0S B;  1PUT A;  4H2A A;  4C31 B;  4MSQ B;  1E7C A;  1NVI D;  2BXK A;  1ESF A;  4WQM A;  4RMA A;  3P4P B;  2LGY A;  1YQ4 B;  1WYW B;  3T3O A;  4EZL A;  2DYM A;  1N5U A;  1T0Y A;  3O65 B;  3TEZ A;  3LXF A;  3R66 C;  1FIQ A;  4YTM B;  4KDL B;  1WJN A;  1RRB A;  4GDK A;  4N58 A;  2D07 B;  4GIV A;  2JXT A;  2MBQ A;  2PEA A;  4IKG A;  2OZB B;  1GB4 A;  4LJP B;  4K2C A;  1OEY A;  1F52 A;  1N5W A;  3TL5 A;  5D2M B;  4JIO U;  2VH1 A;  1H5W A;  2QMC A;  3V6C B;  3RPF C;  3RNG C;  4LJO B;  2FCM A;  3RI7 C;  2AJE A;  3FAH A;  2RD0 A;  4ARC A;  3DWM A;  1I4R A;  1P3Q U;  2GB1 A;  1V97 A;  2RMM A;  1WM3 A;  3SIV B;  2BYF A;  2WXR A;  2ZCC A;  4IM2 A;  1K53 A;  2ZNV B;  2KMM A;  1SIJ A;  2N7J A;  2J0M A;  3ZUN A;  1E78 A;  3BYY B;  2W54 A;  2LRU A;  4DHX B;  3AE5 B;  1I7H A;  1N60 A;  4Z9O A;  2KQS A;  4XC2 A;  1P1A A;  1L7Y A;  2KTF A;  5FR3 A;  2K6D B;  3GQX A;  2BXD A;  1H9Z A;  1OQY A;  1SJE D;  2N1V A;  3PVL A;  3APF A;  1XO3 A;  2D2Q A;  3S2A A;  5BMG A;  2KTR A;  2ASQ A;  2NR2 A;  3NVV A;  3NMU A;  3Q2A C;  1FCL A;  3L16 A;  3OWE B;  5AEK B;  2V3P A;  2L32 A;  1F2R I;  4PT5 A;  4YSY B;  1XLP A;  4B95 A;  2PW9 A;  2EFH A;  2JSV X;  4AWJ A;  4F8C B;  1QKZ A;  2JX5 A;  3A75 A;  2EMT A;  1VR9 A;  3N30 A;  1GNU A;  2CHX A;  5CHV C;  1EU3 A;  1OTR B;  2V1Y A;  5L83 A;  1Q1O A;  4M01 A;  3IAS 1;  1NYR A;  2QHB A;  2I2Y A;  2WWZ A;  2O6V B;  4KGR A;  4CYE A;  2BXO A;  3ONS A;  1ENF A;  5J17 A;  3NVI A;  4GSW A;  3AV8 A;  3OAW A;  1GNI A;  2Y5C A;  1AW7 A;  2DYB A;  4MDK E;  1KRH A;  4FJC B;  3ECP A;  4KKI A;  2FUG 1;  4I6N B;  3U7Z A;  1BXT A;  1ZKH A;  5BYR A;  2VH2 A;  4RGT A;  2DWQ A;  2L3Z A;  2D10 A;  5IIX A;  5HFY A;  2KN5 A;  2K5P A;  4EKU A;  1I4G A;  1Q5W B;  3QWZ B;  4P7I A;  3U52 E;  3NZS A;  1WY8 A;  3AB5 A;  3TSS A;  5IOI A;  1RM6 C;  4W9H A;  2N9E B;  1FRR A;  5JXV A;  2XW1 A;  4M8N A;  4DHZ B;  4HCP B;  1L4Z B;  3TCA A;  5D6J B;  1WXM A;  2EKI A;  3B2F A;  5IA7 A;  5C23 A;  1UBI A;  2DNF A;  2BXP A;  2XVQ A;  1XLO A;  4FJY A;  4ZBR A;  5IIH A;  1SE9 A;  2Y5B B;  2M56 B;  1TZ1 A;  2LGI A;  2XNA C;  1JRU A;  2E0X A;  4TQ1 A;  3D32 A;  2CKX A;  4KSK C;  1E8Z A;  4HKQ A;  2BGF A;  1C4A A;  4W9K A;  2I2Z A;  1WR1 A;  3L0W B;  4ZHO A;  3V09 A;  1ACC A;  4LB2 A;  1WRD B;  3WHS A;  1XQQ A;  1JML A;  3FIL B;  1F1H A;  4PS3 A;  4RGN A;  4MGI E;  4XDC A;  1E7I A;  3PV1 A;  1MHH E;  2V3S A;  2PE9 A;  2NMQ A;  2KQ7 A;  2MEK A;  4FJZ A;  3HM6 X;  1AO6 A;  2KQ4 X;  3P63 A;  3B1L X;  4LK0 M;  4MEL A;  4RF1 A;  1RFK A;  1FOU A;  2KDB A;  2Y5P A;  1HTQ A;  2NVU I;  1EWY C;  2KKC A;  3AU4 A;  1PGB A;  3U4E G;  3MC8 A;  2LMC A;  4FLH A;  4WJO A;  2RGF A;  2IDY A;  3CST A;  3SR6 A;  1SEB D;  5KHO A;  2XBB C;  3WHR A;  4GMV A;  2LJ5 A;  4E99 A;  2K6Q A;  4NPN A;  1G6J A;  4AUQ C;  1J7E A;  4YL8 A;  4RFB A;  2HE7 A;  1MPE A;  2QIL A;  2QMT A;  4DQO C;  3I3T B;  4ZRK A;  4FHJ A;  4A8X C;  5LXH A;  3VXW A;  4L2Y A;  3NVM A;  2KC2 A;  4HVB A;  3TIX A;  4OT2 A;  5IAA C;  4YWG G;  1YJI A;  2WHI A;  4AOF A;  4FIP B;  1NEK B;  4F5T A;  4M70 B;  4HCN B;  4KGS A;  5TR5 A;  4FBJ B;  1QZE A;  3ZO5 B;  4K71 A;  4IOI E;  3VR8 B;  1K51 A;  4A55 A;  1NI3 A;  4HDQ A;  1F9J A;  3T3N A;  3V05 A;  3G9K D;  3PLV A;  3LU6 A;  1JCK B;  2PVO D;  2KFJ A;  3CX9 A;  3UIO B;  2IJ0 A;  3N20 C;  4TSS A;  2KWD A;  2NBW B;  4HRS A;  3KYC D;  4MEM A;  3H6N A;  2DAJ A;  4J2V A;  2H89 B;  2MBE A;  2B76 B;  1O9X A;  4BY9 C;  2BQQ A;  4KZ0 A;  2GOW A;  4ZRQ A;  1UF0 A;  2MHJ A;  3PHW B;  2JWZ A;  1WGR A;  4PS7 A;  2ZZP B;  4G50 A;  2N7E A;  2JWU A;  4K7W A;  2CU3 A;  2LVQ A;  3ZNH B;  4DDI D;  3IFW B;  4BBN C;  2WP9 B;  4MJS B;  3WAM A;  3UF8 A;  4OZA A;  1MM8 A;  1JWM D;  1WXV A;  2OHF A;  1HE8 A;  3HM3 A;  3GA9 L;  1GAQ B;  1FFU A;  1KXP D;  3LB8 C;  1WZ3 A;  2J53 A;  1R4M I;  5E6O A;  2XMO A;  1ZW7 A;  2WX1 A;  3ZGZ A;  3VTW A;  3ZJV A;  3FWC C;  2JU6 X;  3MC0 B;  2WXP A;  2FID A;  2L52 A;  3HUI A;  4RGM A;  4KZC A;  1JAL A;  3UGB B;  1IYF A;  1TTN A;  1DOY A;  4LA0 A;  2WYQ A;  3EA6 A;  3IAM 1;  5IO9 A;  4N59 A;  2M0X A;  3IT6 B;  2IND C;  1FRD A;  3A4R A;  3RNB C;  3NZ3 A;  3HHM A;  1R4M B;  2WDR B;  3I5J C;  2AQ1 B;  4IM3 A;  4OW0 A;  1WRI A;  1YJJ A;  2PLP A;  2IGD A;  5BYS A;  2KC1 A;  2QSD A;  1UGM A;  1F2R C;  2LQI A;  4HPM B;  4WJP A;  2Z8K A;  4BZA A;  4K3C A;  3ZJU A;  5DBY A;  1D5M C;  4J3O D;  2RDG A;  3AN1 A;  3Q3J A;  3KJL A;  1KF6 B;  3W5V B;  1E7U A;  4NJ6 A;  5C3J B;  1TF0 A;  4C7Z A;  2M17 A;  1E10 A;  2J4X A;  2WXQ A;  1I4H A;  2NTT A;  2ON8 A;  5AZF A;  1S1Q B;  4K81 A;  5D94 A;  1MIV A;  4HPL B;  2L76 A;  3IT4 B;  1J7C A;  1JRO A;  1D6E C;  4IM0 A;  1QF6 A;  2L1A A;  1V1P A;  3AEE B;  3DPD A;  1T6B X;  4AJW A;  3ZTD A;  2MQJ A;  4JK4 A;  4II3 B;  3BK1 A;  2PKO A;  4BKS A;  5T8I A;  4MH0 E;  5GMV A;  1PFD A;  1MUS A;  4WWM A;  3VRB B;  3HK0 A;  3R2I A;  1FPY A;  1HQR D;  4NAW A;  5B5T A;  4GDL A;  2JRH A;  5D3I B;  1YJ1 A;  2DHZ A;  3A1Q B;  1OGW A;  1HK5 A;  5AUI A;  2HTM E;  2BXC A;  5DPT A;  4LNF A;  1E5W A;  1A70 A;  3WAL A;  2BKR B;  2WXJ A;  1RAX A;  4TMA B;  3E56 A;  4XWW A;  5TSS A;  5FUO A;  2KAJ A;  2WU5 B;  2QDF A;  2MBB B;  2AQ2 B;  3SEB A;  2SEB D;  1T0Q C;  4QAY A;  3DQV A;  3R2T A;  3ZVV A;  2PPH A;  2WXL A;  4AP4 C;  3BIN A;  2DZJ A;  3U8Z A;  3R8B A;  3PLA A;  3NS1 A;  3W1S A;  1E7H A;  1FFV A;  3PRZ A;  1Z5S B;  4USA A;  3L10 B;  4FA6 A;  4OVU A;  3AU5 A;  4D2K A;  2DZI A;  2GBJ A;  1E6E B;  4HDO A;  4DM0 A;  2KVZ A;  3PHX B;  3Q69 A;  4GDK B;  2BXB A; 
#chains in the Genus database with same CATH homology
 1NDD A;  4OR0 A;  1MA9 A;  2R2Q A;  3SD5 A;  3DVG X;  1EM7 A;  4WUR A;  1ZUD 2;  4JX1 C;  4ZOH C;  1LQB A;  3WAO A;  1TZO A;  2ZVO A;  3GS2 A;  4W9F A;  4K1R B;  2DBW A;  1I4X A;  2KOX A;  2ZW0 A;  2E0Y A;  5DQF A;  4EE2 A;  1C1Y B;  2OJR A;  3QX1 A;  3KWL A;  1FM0 D;  2O6V D;  2V4L A;  3GB1 A;  4BOS C;  2IY0 B;  5EE9 A;  2AL3 A;  5HHD G;  1X1M A;  1YN5 A;  3ZYY X;  3R7Q A;  3A33 B;  2O2V A;  2MW5 A;  2IGG A;  4LUF A;  1QT9 A;  1VZS A;  3RYT A;  3HVD A;  2KNB A;  2BXL A;  2ONQ A;  1SIF A;  2WX0 A;  3ETR A;  5EE3 A;  1BML C;  3SQJ A;  1J8C A;  3ALB A;  2ZPY A;  1GJZ A;  2YEP F;  4ARI A;  2CJN A;  4ANW A;  4B6W A;  2G9H D;  4F1S A;  2BYV E;  2GRI A;  1KM7 A;  5E6P A;  1TKG A;  4PO0 A;  1J19 A;  1SB3 C;  3N3K B;  3DVN U;  5J18 A;  4FK5 B;  2NS5 A;  3AEB B;  2KTR B;  2BS4 B;  1E7P B;  4URK A;  4AQ7 A;  2JUO A;  2IY1 B;  1N5X A;  5JZE B;  2KLC A;  2PIA A;  4W9I A;  5G55 A;  2LD9 A;  2B3A A;  2XN9 C;  2L7R A;  5C1Z A;  1I42 A;  5FKA C;  1HK1 A;  2MWS B;  1WXQ A;  2BBC A;  2C60 A;  1L6V A;  1EF1 A;  1GC6 A;  2W9N A;  4LCD E;  1CK1 A;  2KJH B;  4L9Q A;  1E7G A;  3DVG Y;  3ABV B;  2M8S A;  3PTF C;  3RUL A;  4ICV A;  5CTR C;  1LOT A;  2WLB A;  1E8X A;  2AL6 A;  4OVZ A;  3DBR I;  3W5U B;  3ZLZ A;  1QOF A;  1IPG A;  2GBM A;  1V80 A;  1KTK A;  2N9K A;  3IG3 A;  3SFE B;  4LDT D;  4GB9 A;  4Z69 A;  2JY6 A;  1ZPS A;  2J42 A;  1V86 A;  4G04 A;  1N62 A;  2BTE A;  2KX3 A;  2M4N A;  4HLE A;  2XVU A;  1WYG A;  3IVF A;  2Z8J A;  2DEN B;  2FE8 A;  5BPK A;  2M1M A;  5DCN A;  3P4Q B;  2EFC A;  2J0J A;  4JPS A;  3WCQ A;  4MGK E;  2BKF A;  2JZZ A;  5ID7 A;  2KXJ A;  2BXA A;  1RWS A;  2BXG A;  1WGG A;  5EDS A;  3CIR B;  1GB1 A;  3ICX A;  4YTN B;  2QHO A;  1ET9 A;  3ZNI D;  2IBI B;  3CF6 E;  1VRA B;  2IO2 B;  4YSZ B;  1UEL A;  5JH5 C;  5BMI A;  3H7S A;  1ISN A;  2WDV B;  4MH8 A;  3O13 A;  2BXF A;  3RZW C;  1M94 A;  3TEX A;  1WWT A;  1EF5 A;  4YTP B;  4R3D A;  5GIO A;  2NBU A;  2DBY A;  4EZK A;  2UWQ A;  3KH0 A;  1C76 A;  1Q0W B;  2LHD A;  4ANX A;  1VZ7 A;  4G03 A;  2N7D A;  2K22 A;  4FHK A;  4N3Z A;  2KAC A;  4Q2J A;  4C7Y A;  1EUV B;  3E9S A;  3HRD D;  3NVW A;  1L0X B;  3Q8B A;  1BT0 A;  2WNM A;  1HZ5 A;  2KAN A;  1MIW A;  2L00 B;  2V36 A;  2MJD A;  1LM8 B;  3NVK A;  4OHJ A;  1BJ5 A;  4MM3 A;  4YXD B;  3RD2 A;  2L0F A;  5BMH A;  2IGH A;  2NQO A;  4ZCG A;  4HJK A;  3NOB A;  1WX8 A;  4F5S A;  4F5V A;  2I30 A;  1FO4 A;  3ZQ4 A;  2V4I B;  2NTS A;  4C56 C;  2LGD A;  1PQS A;  4OZC A;  1L4D B;  2JRI B;  3VUX A;  4MSM B;  2CHZ A;  1HZ6 A;  2VDB A;  3M63 B;  3BII D;  1SXT A;  3AEG B;  1L5P A;  3UQB A;  3AE2 B;  3KWV A;  5IJ5 A;  2KMA A;  2LXA A;  3JYU A;  4E74 A;  1L6U A;  2JXX A;  2K8C A;  1SBB B;  3DWG C;  2Z8I A;  3R3M A;  3NVY A;  2FUH B;  1TJE A;  5IJF A;  2KD0 A;  1OQQ A;  1FNW A;  1P0R A;  4ANV A;  4BKS D;  3URY A;  1SGH A;  1HK3 A;  4L1B A;  1SJH D;  2TSS A;  4WWP A;  5I4D A;  1V2Y A;  3AED B;  1OEY J;  1WGK A;  4BVU C;  3JW0 X;  1UOR A;  1D5X C;  4REZ A;  2FIF A;  1Y8R C;  2KDI A;  3L4P A;  2WXH A;  4XZ4 A;  3QCA A;  4OTU A;  4LDT B;  1WR6 E;  2WXO A;  1S3S G;  2MBH A;  1P7F A;  2KWV B;  3W2D A;  4WIP A;  1E8W A;  2BX8 A;  3PZD A;  3FWB C;  2GBK A;  2KWC A;  4US9 A;  2N9L A;  2C7M B;  3GQU A;  3VHT C;  2INN E;  2MX2 A;  1YMH E;  5ID9 A;  1DOI A;  4A3O A;  3KUD B;  2FCQ A;  4NZL B;  2H88 B;  4HK2 A;  1LXD A;  3BYT B;  2JVC A;  2LEK A;  3A73 A;  3AEC B;  2Q5W D;  4OTT A;  4ANU A;  3GP7 A;  3TMP B;  2RPQ A;  2DZK A;  1EO6 A;  2VUE A;  3ZW3 A;  4L8U A;  2EFD A;  4O1N A;  1V49 A;  4ASW C;  4P6V F;  4LUH A;  3Q8C A;  3M3J A;  3KIK A;  1YX6 B;  1WSP A;  3AM9 A;  1DOX A;  2RDH A;  1RYJ A;  2INP E;  1D3Z A;  1Z2M A;  5CX3 A;  2C9W B;  1ZOY B;  4FN2 A;  1N61 A;  3I57 A;  3H3A A;  3U2S C;  3BVG A;  5BYQ A;  1DGJ A;  1GUA B;  2AX5 A;  4GU2 A;  4G0N B;  1B9R A;  3UIV A;  2I1J A;  2LVO A;  1FXT B;  2WDQ B;  3HVZ A;  3MJW A;  4E71 A;  5FR6 A;  1ZDX A;  2Z8L A;  3Q3F A;  1WJ6 A;  3QQ8 B;  3PT2 B;  2ZVN A;  3PRP B;  1IUE A;  2AYO B;  1KLU D;  1QQR A;  3H8H A;  4WJN A;  1YIW A;  2ZNV C;  1MIY A;  4W9G A;  2MLB A;  1TS2 A;  1YQ3 B;  4B0M A;  4WQO B;  1JWS D;  1E7A A;  2LGX A;  2K8B A;  2SAK A;  2DYO A;  3QJZ A;  1R7S A;  2CU1 A;  3BWU D;  1TS5 A;  1WJ4 A;  2E3T A;  5DPS A;  4K7U A;  3DVN V;  4TQ0 A;  2MP2 A;  2RPV A;  3QK0 A;  4UDU C;  3MFG A;  5AZG A;  3H37 A;  3KQ4 A;  1E7B A;  1WGY A;  4KV2 A;  3V08 A;  1E9M A;  1PDX A;  2ZPN A;  5CHW A;  4EOY A;  5FK9 C;  1JRP A;  2WXG A;  5AZH A;  3PZ7 A;  1OFF A;  1WM2 A;  3JSV A;  3A4S C;  4W9E A;  1EWC A;  2DAF A;  3AI5 A;  4A90 A;  3T8M A;  2MSE D;  1WFY A;  2KVR A;  2KK8 A;  4BKG A;  3AE8 B;  4ITK A;  3A9K B;  4RM8 A;  5E6N A;  1JWU D;  2FNJ B;  4F5U A;  4ZBQ A;  1FD6 A;  2BXI A;  5D7G A;  1GC7 A;  2G45 B;  2DBX A;  3NS8 A;  2PTL A;  3A9J A;  2KJR A;  1WGH A;  4IWO A;  3WAP A;  4N6E B;  5CHF A;  2LOQ A;  1XEE A;  4JE3 B;  4KSL C;  2DLB A;  3KLS X;  2L83 A;  3OJ4 B;  5HG2 A;  2JZ3 B;  2KWU B;  2LVP A;  1NEN B;  2DZM A;  2ACZ B;  2G4S A;  4NJ7 A;  1ZXI A;  1E90 A;  2OT3 A;  1UZX B;  2A5U A;  1FXA A;  4CO7 A;  4KIK A;  4IW1 A;  5LXI B;  1SE2 A;  2JPH A;  4B9K A;  1MHX A;  1XF5 L;  1FMA D;  2ROH A;  2HDE A;  1L0Y B;  1WE7 A;  4MGY E;  3WA0 A;  4EZJ A;  1YD8 U;  1IBX A;  4IC7 B;  4RNA A;  2LJI A;  1KJT A;  3OJ3 A;  1KOT A;  3J9C A;  2XEW A;  2LWP A;  1QIL A;  3B08 A;  3AUL A;  3QC8 B;  4MJS A;  2KMC A;  2O2V B;  1FNU A;  2JYT A;  2IO3 B;  4IWP A;  2LHE A;  1UGJ A;  2VRR B;  1BUI C;  3JVZ X;  3ZTC A;  1TY0 A;  1UWX A;  4WWN A;  3TJP A;  2BWE S;  3H9D A;  3Q8E A;  1OQR A;  3CMM B;  3AE7 B;  1VJK A;  4DDG D;  1UNS A;  3AE4 B;  3MHH B;  2XK5 A;  2BS2 B;  1TS3 A;  2LFI A;  3PGE A;  1PGA A;  3RUI B;  4JL9 A;  4LLG M;  2K25 A;  1I35 A;  2EEL A;  2HJ8 A;  1WE6 A;  4TUU A;  3VH4 B;  2KO3 A;  3BVM A;  2NBV B;  5DPW A;  5IFO A;  4BKE A;  2LUM A;  1PYW D;  3ZNZ B;  3M95 A;  4L23 A;  3C8Y A;  2I38 A;  2BXQ A;  3Q8A A;  1GG3 A;  4FUL A;  1VCB A;  2QM6 A;  3TBL D;  4IG7 B;  1UBQ A;  2KJ6 A;  1KH0 A;  3X0W A;  3FNM A;  3HIZ A;  4GN1 A;  2X38 A;  2JT4 B;  2YDF A;  2KLG A;  2OOB B;  1QOG A;  5EE1 A;  4A6Q A;  3LYY A;  4W4U B;  2CJO A;  3AE9 B;  3DDC B;  1WF9 A;  2M19 A;  5G5H A;  4W9C A;  3QIJ A;  2IYD B;  1JWA D;  3W1Y A;  2BT6 A;  1HK4 A;  1HXY D;  2CHW A;  4G11 A;  4CHK A;  1J78 A;  1MI0 A;  4M0W A;  1A5R A;  1E8Y A;  2KDM A;  4GG2 A;  2LI5 A;  4N9F 4;  2GI9 A;  3W9C B;  1U4A A;  1WMH A;  3APD A;  3U7D A;  2WXM A;  3KYD D;  5LNK 1;  3PS6 A;  1T3Q A;  2C7H A;  1C77 A;  4AJY B;  2MBO A;  4JWU C;  1B1Z A;  2NPT A;  1J0G A;  3A1Q A;  4OZB A;  1J7B A;  5EE0 A;  3V62 A;  2WQY B;  2KX0 A;  2QJL A;  2V3N A;  1YN3 A;  2ZCB A;  2EMS A;  3P42 A;  4I6L B;  1QOB A;  4F7Z A;  2AWT A;  4MBE C;  2LAS A;  3LJ3 A;  4DHJ B;  1D5Z C;  2JF5 A;  3MJ5 A;  4CQN A;  3B9J A;  3B2G A;  4XX5 A;  2LUE A;  2WXI A;  1GNJ A;  2JQR B;  4BFR A;  1AYF A;  4II2 B;  2XSI A;  2D5G A;  5D3D A;  1CQV A;  4ZRP A;  2YEP B;  3MP9 A;  4BBN F;  4IW0 A;  2QIE B;  4ZC6 A;  2YVC A;  1ROE A;  1KFY B;  1F0Z A;  3V60 A;  4US8 A;  3VUW A;  2NCN A;  4NY0 A;  1HA5 A;  3UIN B;  2K39 A;  4N0F D;  4A9A A;  3EEC A;  3SHQ A;  1IP9 A;  2ICI A;  5H8Y E;  4MM3 B;  3JQZ A;  3IXS A;  4NNJ B;  3UQA A;  1C4P A;  1NYQ A;  2KFK A;  4WH4 A;  1TS4 A;  4LB9 A;  1V5O A;  2AEH A;  4GLS C;  3EUB 2;  2K3U A;  2CR5 A;  1T5X D;  1VFI A;  3T9L A;  3H7P A;  1AAR A;  2XVW A;  1L2N A;  2N1W A;  1HA2 A;  1YX5 B;  2BS3 B;  4ZHP A;  1WX9 A;  2MRP A;  2IZV B;  1FEH A;  1WX7 A;  1XD3 B;  1UWM A;  1TBE A;  2FBW B;  3DBS A;  3TEW A;  2D11 A;  3W1S C;  2I1K A;  3CWI A;  1IGD A;  4ZYN A;  3V03 A;  4S1Y A;  2BW2 A;  4WAF A;  3V3X A;  4HEA 1;  4RM9 A;  4FXC A;  4ZYS A;  4W9L A;  3DCG A;  3U30 A;  3H1U A;  1NT2 B;  1H8C A;  4KVG B;  1WIA A;  2G3Q B;  3P2B A;  4DXF A;  3B9L A;  1TY2 A;  4WJQ A;  2W55 A;  3M62 B;  1I4Q A;  3KVF B;  3ZIM A;  1J7A A;  1KLV A;  2UYZ B;  3VDZ A;  5LLI A;  2K9X A;  2L8J A;  1WZ0 A;  1V81 A;  2GMI C;  5GHK A;  4FJV B;  3RCZ A;  1QLB B;  1XLQ A;  5GXG B;  3B0A A;  5C2T B;  4JWS C;  3VAW A;  1TXU A;  3IBE A;  1HEZ E;  3EGR A;  4HGK A;  4XWT A;  4EUT A;  1TGZ B;  2Z59 B;  4NQK E;  2Z0E B;  5GIP A;  4B0E A;  1MG8 A;  4ZDV A;  2GBR A;  1V8C A;  4HXD A;  3ML9 A;  2JUH A;  1NBF C;  2J52 A;  1LNS A;  2R2O A;  1FNV A;  1UUP A;  1ZP0 B;  2PMV A;  2BXE A;  1FXI A;  2G1E A;  2BB6 A;  3AE6 B;  3AE1 B;  2M0A A;  3B9M A;  1UH6 A;  1N63 A;  3BZD B;  3TDL A;  1V9J A;  4MGZ E;  3AEF B;  4GXB A;  1C4C A;  4G01 A;  2MCN B;  3MHS D;  1WI0 A;  1JWB D;  3P4S B;  4JGH B;  2RSU A;  3WIM A;  1AWD A;  4LTU A;  2WXF A;  1RLF A;  1WXA A;  4IDI A;  3WHQ A;  2OED A;  3AH7 A;  1VZ6 A;  1K52 A;  2N9P C;  4RH6 A;  4PS8 A;  3APC A;  3CSF A;  1XT9 B;  1UD7 A;  2ZEQ A;  2MJE A;  2WXN A;  2O6V A;  2BXN A;  4KKJ A;  4KDI C;  2ZW1 A;  3L17 A;  1XCQ L;  1JQ4 A;  4IWQ A;  3QHT A;  1E7F A;  1ET6 A;  3L08 A;  1VDV A;  1E7V A;  2W82 A;  2HTH A;  4FAD A;  2XW0 A;  3P1M A;  4RCO A;  2CKH B;  1CZP A;  4IW2 A;  4PYZ A;  3RT3 B;  4M8M A;  2MP2 B;  1E0Z A;  3VTV A;  3KW5 B;  3ZRF A;  4OVV A;  2BPS A;  4HRO A;  2BWF A;  3PRM B;  1RFA A;  1I4P A;  1R4N I;  4A20 A;  3AXC A;  4PYU A;  4NJC A;  3NY5 A;  4KX6 B;  5MPO A;  4J6I A;  1K50 A;  1BM0 A;  5HKH A;  3ZNG C;  2EKE C;  2YLM A;  3Q8F A;  3JSV B;  2PJH A;  2LRW A;  4DWF A;  3V61 A;  3LDZ E;  1VD2 A;  2KDF B;  2DBU A;  2W3S A;  3UIP B;  4BKT A;  3N32 A;  4HKZ E;  1AN8 A;  2Y3A A;  1V1O A;  3ECI A;  1E7E A;  3L13 A;  4P16 A;  2NNW A;  1GPX A;  5IIU A;  3NRZ A;  4DXA B;  4RF0 A;  4GDX A;  2LXC A;  1H4R A;  3A9J B;  4YSX B;  3KUC B;  3PPA A;  3ZDM C;  1ZXH A;  4DXG A;  4ZRI A;  3GOE A;  5JHB A;  2E6X A;  5HI1 A;  1TKY A;  1XXG A;  2R61 A;  3N9Y C;  4A3P A;  3NUH B;  3I9V 1;  2DG5 A;  1XLN A;  3FIL A;  1WXS A;  4KGT A;  2IPK D;  4XDD A;  5HOZ A;  2PE6 B;  4KIK B;  4WA6 B;  2WXK A;  1K8R B;  2VZK D;  3PZ8 A;  1V1P B;  1Q10 A;  1YQB A;  1SSN A;  4DK5 A;  1IBX B;  3SFD B;  1C3T A;  1LFD A;  3P4R B;  1BKE A;  2FAZ A;  4X57 B;  3PSE B;  3VRA B;  1JNB A;  4NAW B;  1ZDV A;  4GDL B;  3ZDT A;  3JRY A;  3MHS B;  1ZE3 D;  1JW9 D;  1WH3 A;  3K9O B;  4AS1 A;  5AUK A;  2DX5 B;  5J2R A;  1F77 A;  3DBH I;  1KW2 A;  3ENE A;  4YT0 B;  4L9K A;  4NAM A;  4DHZ E;  4EFO A;  1VZ8 A;  1TYG B;  5KHQ A;  3LU7 A;  3AEA B;  3RZF A;  3NZU A;  2ZJD A;  3BVZ A;  2PVG C;  4W9J A;  2K1F A;  2L0T A;  2XK5 B;  2KN4 A;  2D3G A;  3PRE A;  4MAC A;  3LU8 A;  1P7E A;  1C79 A;  3RFZ B;  4HJG E;  2IO1 B;  3MHZ A;  2QEJ C;  3VFK A;  4ICU A;  3VQI A;  2KBZ A;  4DHJ D;  1HK2 A;  2LZ6 A;  4C80 A;  1MVK A;  3MTN B;  2IO0 B;  2JYE A;  1IGC A;  4RGO S;  3V6E B;  2MJ3 A;  1C9F A;  2FCS A;  3C0R B;  3FC4 A;  3QAQ A;  2MA9 B;  2KHW B;  3VUY A;  2BXM A;  4N0U D;  1WGD A;  4G3X B;  2HD5 B;  3EFU A;  1NI2 A;  4EEW A;  1IJG A;  2K0P A;  5G5G A;  1D4B A;  3IHP C;  4JQW C;  1YN4 A;  2WDT B;  2W3R A;  4M0W B;  3WAN A;  3NHE B;  1V5T A;  4WWO A;  2KDE B;  2VUF A;  1VLB A;  3AE3 B;  2Z0D B;  5BO4 B;  1GOZ A;  4W9D A;  3AMZ A;  1WMH B;  2C7N B;  3K9P B;  4DBG A;  3TUO A;  5G2N A;  2CS4 A;  2BYT A;  2FCN A;  3VVW B;  1DYQ A;  1TKE A;  4NQL B;  2NPT B;  3DBL I;  3GZN I;  3A9K A;  1XCT L;  1CJE A;  5IJE A;  2EFE A;  1P98 A;  1SE4 A;  3DOW A;  5H92 C;  2KZR A;  3OLM D;  4ZUX V;  3SIU B;  1YNT E;  4K7S A;  4JLC A;  3ZRC A;  3TEY A;  1WJU A;  1ZGU B;  1V6E A;  4WAA A;  1LO5 D;  4TV3 A;  3ZKJ C;  2AQ3 B;  2MH7 A;  2BYE A;  3ZJT A;  1QOA A;  2VZK B;  2N4F A;  4BOZ B;  3NVZ A;  2BF8 B;  1PGX A;  4MT5 A;  1KLG D;  3PO0 A;  3M99 C;  2J7Q B;  4E3C A;  3KUZ A;  3VR9 B;  3EC8 A;  2G4D B;  1SE3 A;  1Y56 A;  3QA8 A;  2L05 A;  3BY4 B;  2K8H A;  4EMX A;  4I6P A;  5JHA A;  4GOC A;  1STE A;  2REX A;  2JZP A;  5GIN A;  2A4Z A;  3VH3 B;  3ML8 A;  5DPR A;  1L0V B;  2J0K A;  4GGQ A;  1EU4 A;  4ZBK A;  2BXH A;  3QAR A;  2KFK B;  3L54 A;  4HGM B;  4HWI B;  4IUM B;  1P9D U;  2XVV A;  4TKN A;  2WS3 B;  3H7P B;  3R7R A;  3UI3 A;  2V0G A;  1CMX B;  4ZRJ A;  3SU8 X;  1SF0 A;  5L95 C;  3BK2 A;  1C78 A;  2N9X A;  3X23 A;  2BB5 A;  3EHV A;  1FCC C;  5E6J A;  3SDL C;  2GBN A;  4XE0 A;  2RR9 A;  2WU2 B;  1M4V A;  3VTU A;  2C5L C;  3PLU A;  2N0S B;  1PUT A;  4H2A A;  4C31 B;  4MSQ B;  1E7C A;  1NVI D;  2BXK A;  1ESF A;  4WQM A;  4RMA A;  3P4P B;  2LGY A;  1YQ4 B;  1WYW B;  3T3O A;  4EZL A;  2DYM A;  1N5U A;  1T0Y A;  3O65 B;  3TEZ A;  3LXF A;  3R66 C;  1FIQ A;  4YTM B;  4KDL B;  1WJN A;  1RRB A;  4GDK A;  4N58 A;  2D07 B;  4GIV A;  2MBQ A;  2JXT A;  2PEA A;  4IKG A;  2OZB B;  1GB4 A;  4LJP B;  4K2C A;  1OEY A;  1N5W A;  3TL5 A;  5D2M B;  4JIO U;  1H5W A;  2QMC A;  3V6C B;  3RPF C;  4LJO B;  2FCM A;  2AJE A;  3FAH A;  2RD0 A;  4ARC A;  3DWM A;  1I4R A;  1P3Q U;  2GB1 A;  1V97 A;  2RMM A;  1WM3 A;  3SIV B;  2BYF A;  2ZCC A;  4IM2 A;  2WXR A;  2ZNV B;  1K53 A;  2KMM A;  1SIJ A;  2N7J A;  2J0M A;  3ZUN A;  1E78 A;  3BYY B;  2W54 A;  2LRU A;  4DHX B;  1I7H A;  3AE5 B;  2KQS A;  4Z9O A;  1N60 A;  4XC2 A;  1P1A A;  1L7Y A;  2KTF A;  5FR3 A;  2K6D B;  3GQX A;  2BXD A;  1H9Z A;  1OQY A;  1SJE D;  2N1V A;  3PVL A;  3APF A;  1XO3 A;  2D2Q A;  3S2A A;  5BMG A;  2KTR A;  2ASQ A;  2NR2 A;  3NVV A;  3NMU A;  1FCL A;  3L16 A;  3OWE B;  5AEK B;  2V3P A;  2L32 A;  1F2R I;  4PT5 A;  4YSY B;  1XLP A;  4B95 A;  2PW9 A;  2EFH A;  2JSV X;  4AWJ A;  4F8C B;  1QKZ A;  2JX5 A;  3A75 A;  2EMT A;  1VR9 A;  3N30 A;  1GNU A;  2CHX A;  5CHV C;  1EU3 A;  1OTR B;  2V1Y A;  5L83 A;  1Q1O A;  3IAS 1;  1NYR A;  2QHB A;  2I2Y A;  2WWZ A;  2O6V B;  4KGR A;  4CYE A;  2BXO A;  3ONS A;  1ENF A;  5J17 A;  3NVI A;  4GSW A;  3OAW A;  3AV8 A;  1GNI A;  2Y5C A;  1AW7 A;  2DYB A;  4MDK E;  1KRH A;  4FJC B;  4KKI A;  2FUG 1;  4I6N B;  3U7Z A;  1BXT A;  1ZKH A;  5BYR A;  4RGT A;  2L3Z A;  2DWQ A;  2D10 A;  5IIX A;  5HFY A;  2KN5 A;  2K5P A;  4EKU A;  1I4G A;  1Q5W B;  3QWZ B;  4P7I A;  3U52 E;  3NZS A;  1WY8 A;  3AB5 A;  3TSS A;  1RM6 C;  4W9H A;  2N9E B;  1FRR A;  5JXV A;  2XW1 A;  4M8N A;  4DHZ B;  4HCP B;  1L4Z B;  3TCA A;  5D6J B;  1WXM A;  5IA7 A;  2EKI A;  3B2F A;  5C23 A;  1UBI A;  2BXP A;  2XVQ A;  1XLO A;  4FJY A;  4ZBR A;  5IIH A;  1SE9 A;  2Y5B B;  2M56 B;  1TZ1 A;  2LGI A;  2XNA C;  1JRU A;  2E0X A;  4TQ1 A;  3D32 A;  2CKX A;  4KSK C;  1E8Z A;  4HKQ A;  2BGF A;  1C4A A;  4W9K A;  2I2Z A;  1WR1 A;  3L0W B;  4ZHO A;  3V09 A;  1ACC A;  4LB2 A;  1WRD B;  3WHS A;  1XQQ A;  1JML A;  3FIL B;  4PS3 A;  4RGN A;  4MGI E;  4XDC A;  1E7I A;  3PV1 A;  1MHH E;  2V3S A;  2PE9 A;  2NMQ A;  2KQ7 A;  2MEK A;  4FJZ A;  3HM6 X;  1AO6 A;  4MEL A;  2KQ4 X;  3B1L X;  3P63 A;  4LK0 M;  4RF1 A;  1RFK A;  1FOU A;  2KDB A;  2Y5P A;  2NVU I;  1EWY C;  2KKC A;  3AU4 A;  1PGB A;  3U4E G;  2LMC A;  4FLH A;  4WJO A;  2RGF A;  2IDY A;  3CST A;  3SR6 A;  1SEB D;  5KHO A;  2XBB C;  3WHR A;  4GMV A;  2LJ5 A;  4E99 A;  2K6Q A;  4NPN A;  1G6J A;  4AUQ C;  1J7E A;  4YL8 A;  4RFB A;  2HE7 A;  1MPE A;  2QIL A;  2QMT A;  4DQO C;  3I3T B;  4ZRK A;  4FHJ A;  4A8X C;  5LXH A;  3VXW A;  4L2Y A;  3NVM A;  2KC2 A;  4HVB A;  3TIX A;  4OT2 A;  5IAA C;  4YWG G;  1YJI A;  4AOF A;  4FIP B;  1NEK B;  4F5T A;  4M70 B;  4HCN B;  4KGS A;  5TR5 A;  4FBJ B;  1QZE A;  3ZO5 B;  4K71 A;  4IOI E;  3VR8 B;  1K51 A;  4A55 A;  1NI3 A;  4HDQ A;  1F9J A;  3T3N A;  3V05 A;  3G9K D;  3PLV A;  3LU6 A;  1JCK B;  2PVO D;  2KFJ A;  3CX9 A;  3UIO B;  2IJ0 A;  4TSS A;  2KWD A;  2NBW B;  4HRS A;  3KYC D;  4MEM A;  3H6N A;  2DAJ A;  4J2V A;  2H89 B;  2MBE A;  2B76 B;  1O9X A;  4BY9 C;  4KZ0 A;  2GOW A;  4ZRQ A;  3PHW B;  2JWZ A;  1WGR A;  4PS7 A;  2ZZP B;  4G50 A;  2N7E A;  4K7W A;  2JWU A;  2CU3 A;  2LVQ A;  3ZNH B;  4DDI D;  3IFW B;  4BBN C;  4MJS B;  3WAM A;  2WP9 B;  3UF8 A;  4OZA A;  1JWM D;  1WXV A;  2OHF A;  1HE8 A;  3HM3 A;  3GA9 L;  1GAQ B;  1FFU A;  1KXP D;  3LB8 C;  1WZ3 A;  2J53 A;  1R4M I;  5E6O A;  2XMO A;  1ZW7 A;  2WX1 A;  3ZGZ A;  3VTW A;  3ZJV A;  3FWC C;  2JU6 X;  3MC0 B;  2WXP A;  2FID A;  2L52 A;  3HUI A;  4RGM A;  4KZC A;  1JAL A;  3UGB B;  1IYF A;  1TTN A;  1DOY A;  4LA0 A;  2WYQ A;  3EA6 A;  3IAM 1;  4N59 A;  2M0X A;  3IT6 B;  3A4R A;  1FRD A;  3NZ3 A;  3HHM A;  2WDR B;  4IM3 A;  2AQ1 B;  4OW0 A;  1WRI A;  1YJJ A;  2PLP A;  2IGD A;  5BYS A;  2KC1 A;  2QSD A;  1UGM A;  1F2R C;  4HPM B;  4WJP A;  2Z8K A;  3ZJU A;  5DBY A;  1D5M C;  4J3O D;  2RDG A;  3AN1 A;  3Q3J A;  3KJL A;  1KF6 B;  3W5V B;  1E7U A;  4NJ6 A;  5C3J B;  1TF0 A;  4C7Z A;  2M17 A;  1E10 A;  2J4X A;  2WXQ A;  1I4H A;  2NTT A;  2ON8 A;  5AZF A;  1S1Q B;  4K81 A;  5D94 A;  1MIV A;  4HPL B;  2L76 A;  3IT4 B;  1J7C A;  1JRO A;  4IM0 A;  1D6E C;  1QF6 A;  2L1A A;  1V1P A;  3AEE B;  3DPD A;  4AJW A;  1T6B X;  3ZTD A;  2MQJ A;  4JK4 A;  4II3 B;  3BK1 A;  2PKO A;  4BKS A;  5T8I A;  4MH0 E;  5GMV A;  1PFD A;  3VRB B;  4WWM A;  3HK0 A;  3R2I A;  4NAW A;  1HQR D;  5B5T A;  4GDL A;  2JRH A;  5D3I B;  1YJ1 A;  2DHZ A;  3A1Q B;  1OGW A;  1HK5 A;  5AUI A;  2HTM E;  2BXC A;  5DPT A;  1E5W A;  1A70 A;  3WAL A;  2BKR B;  2WXJ A;  1RAX A;  4TMA B;  3E56 A;  4XWW A;  5TSS A;  5FUO A;  2KAJ A;  2WU5 B;  2MBB B;  2AQ2 B;  3SEB A;  2SEB D;  3DQV A;  3ZVV A;  3R2T A;  2PPH A;  2WXL A;  4AP4 C;  3U8Z A;  2DZJ A;  3BIN A;  3R8B A;  3PLA A;  3NS1 A;  3W1S A;  1E7H A;  1FFV A;  3PRZ A;  1Z5S B;  4USA A;  3L10 B;  4FA6 A;  4OVU A;  3AU5 A;  4D2K A;  2DZI A;  2GBJ A;  4HDO A;  1E6E B;  3PHX B;  3Q69 A;  4GDK B;  2BXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...