1KDXA

Kix domain of mouse cbp (creb binding protein) in complex with phosphorylated kinase inducible domain (pkid) of rat creb (cyclic amp response element binding protein), nmr 17 structures
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation complex
molecule keywords CBP
publication title Solution structure of the KIX domain of CBP bound to the transactivation domain of CREB: a model for activator:coactivator interactions.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 81
sequence length 81
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1997-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02172 KIX KIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.20 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Coactivator CBP, KIX domain 1kdxA00
2K0NA 4D7XA 2LQHA 1KDXA 2LQIA 2KWFA 2AGHB 2LXTA 4I9OA 2LXSA 1SB0A 2GUTA
chains in the Genus database with same CATH superfamily
1H9ZA 4HGKA 2LQHA 1E7AA 2BXPA 4F5SA 2AGHB 2LXSA 2BXKA 4K2CA 4OT2A 5HOZA 1HK1A 4DHXB 5GIOA 3FWBC 5ID7A 4LA0A 2I30A 1BJ5A 1LOTA 2KBZA 4HGMB 2BXBA 4Z9OA 4GDKB 3M99C 3V09A 2CKXA 2BX8A 3WHRA 4OTTA 1J78A 1MIYA 2EFDA 3FWCC 3CX9A 2DBXA 5B5TA 4GG2A 3JQZA 3FNMA 4GDXA 5IJFA 1KW2A 2VUFA 4LB2A 1E7BA 1VZSA 3G9KD 3ICXA 4IW1A 4EMXA 2BXQA 3UIVA 3PLAA 3NVMA 2BXIA 2BXFA 1E7FA 1HK5A 2DBUA 2LOQA 3WHSA 1KDXA 3MHSB 4G04A 2VUEA 4F5TA 4Z69A 3H3AA 3SIVB 2E0YA 2BXHA 2QMCA 4N3ZA 3SIUB 1TF0A 2XW1A 1HK2A 2DG5A 4K71A 2XVQA 4ZBKA 4ZBQA 4BKEA 2Z8KA 5D7GA 2BXEA 2XVVA 5IIXA 2BXAA 3GQXA 2K0NA 2OZBB 2AJEA 1H5WA 2E0XA 2KWFA 5GIPA 5IJ5A 1NT2B 5IIUA 4FK5B 4FIPB 1E7EA 1TXUA 2BXLA 4ZCGA 1J7EA 3B9MA 5ID9A 2EFEA 1E7GA 2YDFA 1BKEA 4L8UA 1MUSA 4M70B 2I2ZA 3MHHB 3V08A 4W4UB 1E7HA 1O9XA 3JRYA 4JK4A 3GQUA 3BPJA 2OT3A 4OTUA 2XVWA 2BXOA 1AO6A 4GDLB 4ZUXV 4DM0A 2VDBA 1MIVA 1LNSA 3NVIA 1MUHA 3H37A 1MIWA 3VQIA 5IIHA 3LU8A 1VFIA 1HA2A 4F5VA 2DYOA 1E7IA 2QHBA 3ECPA 4L9KA 4D7XA 3A75A 1GNIA 4ZC6A 1SB0A 1UORA 3LU6A 1E78A 4LUHA 4N0FD 5DQFA 3SQJA 4L9QA 1N5UA 2EFHA 5GHKA 2QM6A 4C31B 3NVKA 1MA9A 2EFCA 2Z8IA 2XVUA 1IJGA 2BXMA 2LXTA 5DBYA 3LU7A 5FUOA 2NQOA 4BY9C 1KXPD 4OR0A 2LQIA 2BXGA 2XMOA 1MM8A 2JUHA 2DYMA 2BXNA 1HK3A 1E7CA 2DBWA 4I9OA 3V03A 2XW0A 4TQ1A 3WHQA 2Z8JA 3A73A 4LB9A 4PO0A 3W1SA 4F5UA 4J2VA 5BPKA 5GINA 4E99A 4MBEC 1JNBA 3KJLA 2BXCA 1GNJA 2NNWA 2BXDA 4FJCB 4N0UD 4WA6B 4NAWB 1BM0A 3KIKA 4G03A 4IW2A 5IFOA 4ZBRA 2XSIA 3B9LA 3GA9L 5IJEA 2GUTA 4S1YA 3TDLA 2V36A 3NMUA 4G01A 1HK4A 2ROHA 1FOUA 4TQ0A 4LUFA
chains in the Genus database with same CATH topology
2K0NA 4D7XA 2LQHA 1KDXA 2LQIA 2KWFA 2AGHB 2LXTA 4I9OA 2LXSA 1SB0A 2GUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0N A;  4D7X A;  2LQH A;  1KDX A;  2LQI A;  2KWF A;  2AGH B;  2LXT A;  4I9O A;  2LXS A;  1SB0 A;  2GUT A; 
#chains in the Genus database with same CATH topology
 1H9Z A;  4HGK A;  2LQH A;  1E7A A;  2BXP A;  4F5S A;  2AGH B;  2LXS A;  2BXK A;  4K2C A;  4OT2 A;  5HOZ A;  1HK1 A;  4DHX B;  5GIO A;  3FWB C;  5ID7 A;  4LA0 A;  2I30 A;  1BJ5 A;  1LOT A;  2KBZ A;  4HGM B;  2BXB A;  4Z9O A;  4GDK B;  3M99 C;  3V09 A;  2CKX A;  2BX8 A;  3WHR A;  4OTT A;  1J78 A;  1MIY A;  2EFD A;  3FWC C;  3CX9 A;  2DBX A;  5B5T A;  4GG2 A;  3JQZ A;  3FNM A;  4GDX A;  5IJF A;  1KW2 A;  2VUF A;  4LB2 A;  1E7B A;  1VZS A;  3G9K D;  3ICX A;  4IW1 A;  4EMX A;  2BXQ A;  3UIV A;  3PLA A;  3NVM A;  2BXI A;  2BXF A;  1E7F A;  1HK5 A;  2DBU A;  2LOQ A;  3WHS A;  1KDX A;  3MHS B;  4G04 A;  2VUE A;  4F5T A;  4Z69 A;  3H3A A;  3SIV B;  2E0Y A;  2BXH A;  2QMC A;  4N3Z A;  3SIU B;  1TF0 A;  2XW1 A;  1HK2 A;  2DG5 A;  4K71 A;  2XVQ A;  4ZBK A;  4ZBQ A;  4BKE A;  2Z8K A;  5D7G A;  2BXE A;  2XVV A;  5IIX A;  2BXA A;  3GQX A;  2K0N A;  2OZB B;  2AJE A;  1H5W A;  2E0X A;  2KWF A;  5GIP A;  5IJ5 A;  1NT2 B;  5IIU A;  4FK5 B;  4FIP B;  1E7E A;  1TXU A;  2BXL A;  4ZCG A;  1J7E A;  3B9M A;  5ID9 A;  2EFE A;  1E7G A;  2YDF A;  1BKE A;  4L8U A;  1MUS A;  4M70 B;  2I2Z A;  3MHH B;  3V08 A;  4W4U B;  1E7H A;  1O9X A;  3JRY A;  4JK4 A;  3GQU A;  3BPJ A;  2OT3 A;  4OTU A;  2XVW A;  2BXO A;  1AO6 A;  4GDL B;  4ZUX V;  4DM0 A;  2VDB A;  1MIV A;  1LNS A;  3NVI A;  1MUH A;  3H37 A;  1MIW A;  3VQI A;  5IIH A;  3LU8 A;  1VFI A;  1HA2 A;  4F5V A;  2DYO A;  1E7I A;  2QHB A;  3ECP A;  4L9K A;  4D7X A;  3A75 A;  1GNI A;  4ZC6 A;  1SB0 A;  1UOR A;  3LU6 A;  1E78 A;  4LUH A;  4N0F D;  5DQF A;  3SQJ A;  4L9Q A;  1N5U A;  2EFH A;  5GHK A;  2QM6 A;  4C31 B;  3NVK A;  1MA9 A;  2EFC A;  2Z8I A;  2XVU A;  1IJG A;  2BXM A;  2LXT A;  5DBY A;  3LU7 A;  5FUO A;  2NQO A;  4BY9 C;  1KXP D;  4OR0 A;  2LQI A;  2BXG A;  2XMO A;  1MM8 A;  2JUH A;  2DYM A;  2BXN A;  1HK3 A;  1E7C A;  2DBW A;  4I9O A;  3V03 A;  2XW0 A;  4TQ1 A;  3WHQ A;  2Z8J A;  3A73 A;  4LB9 A;  4PO0 A;  3W1S A;  4F5U A;  4J2V A;  5BPK A;  5GIN A;  4E99 A;  4MBE C;  1JNB A;  3KJL A;  2BXC A;  1GNJ A;  2NNW A;  2BXD A;  4FJC B;  4N0U D;  4WA6 B;  4NAW B;  1BM0 A;  3KIK A;  4G03 A;  4IW2 A;  5IFO A;  4ZBR A;  2XSI A;  3B9L A;  3GA9 L;  5IJE A;  2GUT A;  4S1Y A;  3TDL A;  2V36 A;  3NMU A;  4G01 A;  1HK4 A;  2ROH A;  1FOU A;  4TQ0 A;  4LUF A; 
#chains in the Genus database with same CATH homology
 2K0N A;  4D7X A;  2LQH A;  1KDX A;  2LQI A;  2KWF A;  2AGH B;  2LXT A;  4I9O A;  2LXS A;  1SB0 A;  2GUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...