The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
source organism |
Mus musculus
|
publication title |
Structures of KIX domain of CBP in complex with two FOXO3a transactivation domains reveal promiscuity and plasticity in coactivator recruitment.
pubmed doi rcsb |
molecule keywords |
CREB-binding protein
|
total genus |
31
|
structure length |
87
|
sequence length |
87
|
ec nomenclature |
ec
2.3.1.48: Histone acetyltransferase. |
pdb deposition date | 2012-03-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02172 | KIX | KIX domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Serum Albumin; Chain A, Domain 1 | Coactivator CBP, KIX domain |
#chains in the Genus database with same CATH superfamily 1KDX A; 2KWF A; 2LXS A; 1SB0 A; 2LQH A; 4D7X A; 4I9O A; 2GUT A; 2LQI A; 2LXT A; 2AGH B; 2K0N A; #chains in the Genus database with same CATH topology 4M70 B; 2NNW A; 4K2C A; 1E7C A; 1FOU A; 4G01 A; 5IFO A; 4MBE C; 1MIV A; 3B9L A; 4L9K A; 3W1S A; 3JRY A; 4EMX A; 5ID9 A; 1AO6 A; 5IIX A; 4D7X A; 1H5W A; 4G04 A; 4Z9O A; 3WHQ A; 5GHK A; 1LNS A; 4HGK A; 5FUO A; 2QHB A; 1E7B A; 2EFC A; 3UIV A; 2KWF A; 4LB2 A; 1MM8 A; 1HK4 A; 2AGH B; 5ID7 A; 4F5T A; 2KBZ A; 1HA2 A; 2BXP A; 3FNM A; 1GNI A; 4N3Z A; 4NAW B; 2JUH A; 3NVI A; 3CX9 A; 4L9Q A; 4PO0 A; 3H37 A; 5IJE A; 5D7G A; 4ZBK A; 1MUH A; 3FWC C; 3G9K D; 3ICX A; 1HK3 A; 3BPJ A; 2Z8I A; 1E7E A; 2XVW A; 3NMU A; 1J7E A; 2EFD A; 1KXP D; 1TF0 A; 1N5U A; 2BXC A; 2CKX A; 3KIK A; 4TQ1 A; 2NQO A; 4J2V A; 2BXG A; 2GUT A; 3GA9 L; 2ROH A; 5GIO A; 2BXM A; 3MHH B; 2BXK A; 4GDX A; 3FWB C; 1MA9 A; 1HK1 A; 2I30 A; 4W4U B; 3V03 A; 4DHX B; 2DBW A; 3PLA A; 1MIW A; 3M99 C; 2XW0 A; 4LA0 A; 4TQ0 A; 1VFI A; 1HK2 A; 3TDL A; 1E7H A; 4IW2 A; 5IIU A; 4GDK B; 3ECP A; 4DM0 A; 2VDB A; 1UOR A; 4I9O A; 2DYM A; 4IW1 A; 4F5U A; 4N0U D; 2VUF A; 2XVV A; 1E7G A; 3A73 A; 4ZUX V; 2LOQ A; 2BXO A; 2DYO A; 2V36 A; 2BXN A; 3LU8 A; 4FK5 B; 4LUF A; 2OT3 A; 3MHS B; 4OR0 A; 2K0N A; 2BXD A; 1JNB A; 5HOZ A; 2BXF A; 2Z8J A; 1KDX A; 2DBU A; 5GIP A; 3JQZ A; 2YDF A; 3KJL A; 4ZCG A; 2BXE A; 4E99 A; 3NVK A; 4WA6 B; 5IJF A; 1BJ5 A; 5IJ5 A; 1TXU A; 1E7F A; 2XVQ A; 2EFE A; 3V08 A; 4Z69 A; 1H9Z A; 4K71 A; 1E7I A; 2LXS A; 1O9X A; 4F5V A; 2VUE A; 1MIY A; 2BXA A; 4FIP B; 4C31 B; 3V09 A; 4S1Y A; 3WHR A; 4OT2 A; 4N0F D; 3GQU A; 2LXT A; 4JK4 A; 3H3A A; 2BXQ A; 3SQJ A; 1BKE A; 2DBX A; 4HGM B; 4OTT A; 2QM6 A; 5DQF A; 1KW2 A; 1E78 A; 4BY9 C; 2DG5 A; 2XSI A; 5B5T A; 3LU7 A; 2E0Y A; 1BM0 A; 1GNJ A; 1NT2 B; 3SIU B; 3VQI A; 2QMC A; 2BXH A; 2XW1 A; 4ZC6 A; 4L8U A; 1HK5 A; 3A75 A; 3B9M A; 5IIH A; 3LU6 A; 1MUS A; 4ZBR A; 2Z8K A; 2BXI A; 2BXL A; 2LQI A; 4BKE A; 2EFH A; 1E7A A; 2AJE A; 1J78 A; 2XMO A; 1VZS A; 2XVU A; 4LB9 A; 4G03 A; 3WHS A; 4GG2 A; 3GQX A; 4F5S A; 1LOT A; 3NVM A; 5BPK A; 5GIN A; 3SIV B; 2OZB B; 2I2Z A; 2BX8 A; 4FJC B; 4LUH A; 1IJG A; 1SB0 A; 4GDL B; 4ZBQ A; 2E0X A; 2LQH A; 4OTU A; 2BXB A; 5DBY A; #chains in the Genus database with same CATH homology 1KDX A; 2KWF A; 2LXS A; 1SB0 A; 2LQH A; 4D7X A; 4I9O A; 2GUT A; 2LQI A; 2LXT A; 2AGH B; 2K0N A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...