2QHBA

Crystal structure of ngtrf complexed with telomeric dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords 5'-D(P*TP*TP*TP*AP*GP*GP*G)-3'
publication title Complex structure of plant telomere bindig protein, NgTRF and telomere DNA
rcsb
source organism Nicotiana glutinosa
total genus 25
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.220 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2qhbA00
2ROHA 2CKXA 2JUHA 2AJEA 2QHBA
chains in the Genus database with same CATH superfamily
3ECPA 2AGHB 2E0XA 4GG2A 5HOZA 1KXPD 1MA9A 3A75A 4E99A 4ZUXV 5DQFA 1FOUA 1HK2A 3FNMA 4TQ0A 2XVQA 1HK1A 4ZC6A 3G9KD 2BXDA 1HA2A 3LU7A 4F5VA 3SIUB 1KDXA 1IJGA 1E7AA 2BXLA 2GUTA 4F5UA 1LNSA 2XW1A 1GNIA 4JK4A 1BM0A 4LB2A 2BXFA 2XW0A 5IFOA 1N5UA 1HK5A 2OZBB 1GNJA 2K0NA 2LXTA 2DBUA 5B5TA 1JNBA 2XSIA 4G03A 2BXMA 2XVWA 5IJFA 2ROHA 4PO0A 3ICXA 2CKXA 4TQ1A 3FWCC 3A73A 4ZBRA 4I9OA 5GHKA 2XMOA 4NAWB 2LOQA 1E7HA 1E78A 5IJEA 2EFEA 2EFCA 4K71A 1MIVA 5IIUA 4BKEA 2DG5A 1E7BA 4DM0A 4K2CA 3KIKA 1BJ5A 2I2ZA 4L9KA 1E7FA 2VUEA 1UORA 4S1YA 4N0FD 2BX8A 3UIVA 1MM8A 3B9LA 2Z8IA 5IIHA 4L8UA 1H5WA 1J7EA 2BXKA 3B9MA 2DYOA 4IW1A 5GIOA 1HK3A 1MIYA 2XVUA 4J2VA 1E7GA 1MIWA 2AJEA 4GDKB 4G01A 5GIPA 3V08A 4LUFA 1E7IA 4G04A 3SQJA 5BPKA 5IIXA 4IW2A 2Z8JA 2DYMA 4Z69A 4LA0A 4EMXA 1H9ZA 1E7EA 3LU6A 4M70B 3JQZA 5D7GA 3JRYA 4W4UB 3H3AA 1VFIA 2BXCA 4N3ZA 4OR0A 1TXUA 4MBEC 4LUHA 2V36A 2LQIA 3NVMA 3W1SA 4C31B 3M99C 1BKEA 4Z9OA 2NNWA 2E0YA 5FUOA 4OTUA 2BXAA 1AO6A 3NVIA 2EFHA 4L9QA 4D7XA 3NMUA 2EFDA 3CX9A 2BXIA 3PLAA 4HGMB 3SIVB 2XVVA 4LB9A 1E7CA 2VUFA 5ID7A 1TF0A 2NQOA 3GQXA 2KBZA 2BXHA 4HGKA 1VZSA 2BXBA 2DBXA 1LOTA 5ID9A 2YDFA 2BXNA 1HK4A 1O9XA 4GDLB 3V09A 2BXOA 2BXQA 3MHSB 3GA9L 4OTTA 2BXPA 4WA6B 3WHQA 4FK5B 1KW2A 2I30A 3NVKA 4FIPB 3GQUA 5GINA 1SB0A 3LU8A 4FJCB 2BXEA 2LQHA 2QMCA 2VDBA 2Z8KA 2DBWA 4GDXA 2BXGA 5DBYA 3BPJA 4ZCGA 1MUSA 4DHXB 4F5TA 3WHRA 5IJ5A 4F5SA 4ZBQA 3WHSA 4OT2A 3H37A 1NT2B 3TDLA 2KWFA 3MHHB 2LXSA 4N0UD 2QHBA 1MUHA 2OT3A 4ZBKA 4BY9C 3VQIA 1J78A 3FWBC 2JUHA 2QM6A 3V03A 3KJLA
chains in the Genus database with same CATH topology
5HOZA 2E0XA 4GG2A 1KXPD 1MA9A 3A75A 4E99A 4ZUXV 5DQFA 1FOUA 1HK2A 3FNMA 4TQ0A 2XVQA 1HK1A 4ZC6A 3G9KD 2BXDA 1HA2A 3LU7A 4F5VA 3SIUB 1IJGA 1E7AA 2BXLA 4F5UA 1LNSA 2XW1A 1GNIA 4JK4A 1BM0A 4LB2A 2BXFA 2XW0A 5IFOA 1N5UA 1HK5A 2OZBB 1GNJA 5B5TA 2DBUA 1JNBA 2XSIA 4G03A 2BXMA 2XVWA 5IJFA 2ROHA 4PO0A 3ICXA 2CKXA 4TQ1A 3FWCC 3A73A 4ZBRA 5GHKA 2XMOA 4NAWB 2LOQA 1E7HA 1E78A 5IJEA 2EFEA 2EFCA 4K71A 1MIVA 5IIUA 4BKEA 2DG5A 1E7BA 4K2CA 3KIKA 1BJ5A 2I2ZA 4L9KA 1E7FA 2VUEA 1UORA 4S1YA 4N0FD 2BX8A 3UIVA 3B9LA 2Z8IA 5IIHA 4L8UA 1H5WA 1J7EA 2BXKA 3B9MA 2DYOA 4IW1A 5GIOA 1HK3A 1MIYA 2XVUA 4J2VA 1E7GA 1MIWA 2AJEA 4GDKB 4G01A 5GIPA 3V08A 4LUFA 1E7IA 4G04A 3SQJA 5BPKA 5IIXA 4IW2A 2Z8JA 2DYMA 4Z69A 4LA0A 4EMXA 1H9ZA 1E7EA 3LU6A 4M70B 3JQZA 5D7GA 3JRYA 4W4UB 3H3AA 1VFIA 2BXCA 4N3ZA 4OR0A 1TXUA 4MBEC 4LUHA 2V36A 3NVMA 4C31B 3W1SA 3M99C 1BKEA 4Z9OA 2NNWA 2E0YA 5FUOA 4OTUA 2BXAA 1AO6A 3NVIA 2EFHA 4L9QA 3NMUA 2EFDA 3CX9A 2BXIA 3PLAA 4HGMB 3SIVB 2XVVA 4LB9A 1E7CA 2VUFA 5ID7A 1TF0A 2NQOA 3GQXA 2KBZA 2BXHA 4HGKA 1VZSA 2BXBA 2DBXA 1LOTA 5ID9A 2YDFA 2BXNA 1HK4A 1O9XA 4GDLB 3V09A 2BXOA 2BXQA 3MHSB 3GA9L 4OTTA 2BXPA 4WA6B 3WHQA 4FK5B 1KW2A 2I30A 3NVKA 4FIPB 3GQUA 5GINA 3LU8A 4FJCB 2BXEA 2QMCA 2VDBA 2Z8KA 2DBWA 4GDXA 2BXGA 5DBYA 4ZCGA 4DHXB 4F5TA 3WHRA 5IJ5A 4F5SA 4ZBQA 3WHSA 4OT2A 3H37A 1NT2B 3TDLA 4N0UD 3MHHB 2QHBA 2OT3A 4ZBKA 4BY9C 3VQIA 1J78A 3FWBC 2JUHA 2QM6A 3V03A 3KJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROH A;  2CKX A;  2JUH A;  2AJE A;  2QHB A; 
#chains in the Genus database with same CATH topology
 3ECP A;  2AGH B;  2E0X A;  4GG2 A;  5HOZ A;  1KXP D;  1MA9 A;  3A75 A;  4E99 A;  4ZUX V;  5DQF A;  1FOU A;  1HK2 A;  3FNM A;  4TQ0 A;  2XVQ A;  1HK1 A;  4ZC6 A;  3G9K D;  2BXD A;  1HA2 A;  3LU7 A;  4F5V A;  3SIU B;  1KDX A;  1IJG A;  1E7A A;  2BXL A;  2GUT A;  4F5U A;  1LNS A;  2XW1 A;  1GNI A;  4JK4 A;  1BM0 A;  4LB2 A;  2BXF A;  2XW0 A;  5IFO A;  1N5U A;  1HK5 A;  2OZB B;  1GNJ A;  2K0N A;  2LXT A;  2DBU A;  5B5T A;  1JNB A;  2XSI A;  4G03 A;  2BXM A;  2XVW A;  5IJF A;  2ROH A;  4PO0 A;  3ICX A;  2CKX A;  4TQ1 A;  3FWC C;  3A73 A;  4ZBR A;  4I9O A;  5GHK A;  2XMO A;  4NAW B;  2LOQ A;  1E7H A;  1E78 A;  5IJE A;  2EFE A;  2EFC A;  4K71 A;  1MIV A;  5IIU A;  4BKE A;  2DG5 A;  1E7B A;  4DM0 A;  4K2C A;  3KIK A;  1BJ5 A;  2I2Z A;  4L9K A;  1E7F A;  2VUE A;  1UOR A;  4S1Y A;  4N0F D;  2BX8 A;  3UIV A;  1MM8 A;  3B9L A;  2Z8I A;  5IIH A;  4L8U A;  1H5W A;  1J7E A;  2BXK A;  3B9M A;  2DYO A;  4IW1 A;  5GIO A;  1HK3 A;  1MIY A;  2XVU A;  4J2V A;  1E7G A;  1MIW A;  2AJE A;  4GDK B;  4G01 A;  5GIP A;  3V08 A;  4LUF A;  1E7I A;  4G04 A;  3SQJ A;  5BPK A;  5IIX A;  4IW2 A;  2Z8J A;  2DYM A;  4Z69 A;  4LA0 A;  4EMX A;  1H9Z A;  1E7E A;  3LU6 A;  4M70 B;  3JQZ A;  5D7G A;  3JRY A;  4W4U B;  3H3A A;  1VFI A;  2BXC A;  4N3Z A;  4OR0 A;  1TXU A;  4MBE C;  4LUH A;  2V36 A;  2LQI A;  3NVM A;  3W1S A;  4C31 B;  3M99 C;  1BKE A;  4Z9O A;  2NNW A;  2E0Y A;  5FUO A;  4OTU A;  2BXA A;  1AO6 A;  3NVI A;  2EFH A;  4L9Q A;  4D7X A;  3NMU A;  2EFD A;  3CX9 A;  2BXI A;  3PLA A;  4HGM B;  3SIV B;  2XVV A;  4LB9 A;  1E7C A;  2VUF A;  5ID7 A;  1TF0 A;  2NQO A;  3GQX A;  2KBZ A;  2BXH A;  4HGK A;  1VZS A;  2BXB A;  2DBX A;  1LOT A;  5ID9 A;  2YDF A;  2BXN A;  1HK4 A;  1O9X A;  4GDL B;  3V09 A;  2BXO A;  2BXQ A;  3MHS B;  3GA9 L;  4OTT A;  2BXP A;  4WA6 B;  3WHQ A;  4FK5 B;  1KW2 A;  2I30 A;  3NVK A;  4FIP B;  3GQU A;  5GIN A;  1SB0 A;  3LU8 A;  4FJC B;  2BXE A;  2LQH A;  2QMC A;  2VDB A;  2Z8K A;  2DBW A;  4GDX A;  2BXG A;  5DBY A;  3BPJ A;  4ZCG A;  1MUS A;  4DHX B;  4F5T A;  3WHR A;  5IJ5 A;  4F5S A;  4ZBQ A;  3WHS A;  4OT2 A;  3H37 A;  1NT2 B;  3TDL A;  2KWF A;  3MHH B;  2LXS A;  4N0U D;  2QHB A;  1MUH A;  2OT3 A;  4ZBK A;  4BY9 C;  3VQI A;  1J78 A;  3FWB C;  2JUH A;  2QM6 A;  3V03 A;  3KJL A; 
#chains in the Genus database with same CATH homology
 5HOZ A;  2E0X A;  4GG2 A;  1KXP D;  1MA9 A;  3A75 A;  4E99 A;  4ZUX V;  5DQF A;  1FOU A;  1HK2 A;  3FNM A;  4TQ0 A;  2XVQ A;  1HK1 A;  4ZC6 A;  3G9K D;  2BXD A;  1HA2 A;  3LU7 A;  4F5V A;  3SIU B;  1IJG A;  1E7A A;  2BXL A;  4F5U A;  1LNS A;  2XW1 A;  1GNI A;  4JK4 A;  1BM0 A;  4LB2 A;  2BXF A;  2XW0 A;  5IFO A;  1N5U A;  1HK5 A;  2OZB B;  1GNJ A;  5B5T A;  2DBU A;  1JNB A;  2XSI A;  4G03 A;  2BXM A;  2XVW A;  5IJF A;  2ROH A;  4PO0 A;  3ICX A;  2CKX A;  4TQ1 A;  3FWC C;  3A73 A;  4ZBR A;  5GHK A;  2XMO A;  4NAW B;  2LOQ A;  1E7H A;  1E78 A;  5IJE A;  2EFE A;  2EFC A;  4K71 A;  1MIV A;  5IIU A;  4BKE A;  2DG5 A;  1E7B A;  4K2C A;  3KIK A;  1BJ5 A;  2I2Z A;  4L9K A;  1E7F A;  2VUE A;  1UOR A;  4S1Y A;  4N0F D;  2BX8 A;  3UIV A;  3B9L A;  2Z8I A;  5IIH A;  4L8U A;  1H5W A;  1J7E A;  2BXK A;  3B9M A;  2DYO A;  4IW1 A;  5GIO A;  1HK3 A;  1MIY A;  2XVU A;  4J2V A;  1E7G A;  1MIW A;  2AJE A;  4GDK B;  4G01 A;  5GIP A;  3V08 A;  4LUF A;  1E7I A;  4G04 A;  3SQJ A;  5BPK A;  5IIX A;  4IW2 A;  2Z8J A;  2DYM A;  4Z69 A;  4LA0 A;  4EMX A;  1H9Z A;  1E7E A;  3LU6 A;  4M70 B;  3JQZ A;  5D7G A;  3JRY A;  4W4U B;  3H3A A;  1VFI A;  2BXC A;  4N3Z A;  4OR0 A;  1TXU A;  4MBE C;  4LUH A;  2V36 A;  3NVM A;  4C31 B;  3W1S A;  3M99 C;  1BKE A;  4Z9O A;  2NNW A;  2E0Y A;  5FUO A;  4OTU A;  2BXA A;  1AO6 A;  3NVI A;  2EFH A;  4L9Q A;  3NMU A;  2EFD A;  3CX9 A;  2BXI A;  3PLA A;  4HGM B;  3SIV B;  2XVV A;  4LB9 A;  1E7C A;  2VUF A;  5ID7 A;  1TF0 A;  2NQO A;  3GQX A;  2KBZ A;  2BXH A;  4HGK A;  1VZS A;  2BXB A;  2DBX A;  1LOT A;  5ID9 A;  2YDF A;  2BXN A;  1HK4 A;  1O9X A;  4GDL B;  3V09 A;  2BXO A;  2BXQ A;  3MHS B;  3GA9 L;  4OTT A;  2BXP A;  4WA6 B;  3WHQ A;  4FK5 B;  1KW2 A;  2I30 A;  3NVK A;  4FIP B;  3GQU A;  5GIN A;  3LU8 A;  4FJC B;  2BXE A;  2QMC A;  2VDB A;  2Z8K A;  2DBW A;  4GDX A;  2BXG A;  5DBY A;  4ZCG A;  4DHX B;  4F5T A;  3WHR A;  5IJ5 A;  4F5S A;  4ZBQ A;  3WHS A;  4OT2 A;  3H37 A;  1NT2 B;  3TDL A;  4N0U D;  3MHH B;  2QHB A;  2OT3 A;  4ZBK A;  4BY9 C;  3VQI A;  1J78 A;  3FWB C;  2JUH A;  2QM6 A;  3V03 A;  3KJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...