The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
96
|
structure length |
96
|
Chain Sequence |
QYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis for the function of the Saccharomyces cerevisiae Gfd1 protein in mRNA nuclear export.
pubmed doi rcsb |
| molecule tags |
Nuclear protein
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
Nuclear polyadenylated RNA-binding protein NAB2
|
| total genus |
34
|
| structure length |
96
|
| sequence length |
96
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-01-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11517 | Nab2 | Nuclear abundant poly(A) RNA-bind protein 2 (Nab2) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Endonuclease III; domain 1 | Endonuclease III; domain 1 |
#chains in the Genus database with same CATH superfamily 3LCN A; 2JPS A; 2V75 A; #chains in the Genus database with same CATH topology 1KG6 A; 5DPK A; 3CWU A; 3IH7 A; 1KG7 A; 4OFA A; 3CW7 A; 3FSP A; 3D4V A; 3OY9 A; 2I5W A; 2NOE A; 2W04 A; 3FHF A; 4BE2 A; 3IHO A; 1N3C A; 3CWT A; 3I0X A; 1YQL A; 4EW0 A; 4EW4 A; 4BDZ A; 4AI4 A; 4ZTF A; 4BE1 A; 1DIZ A; 1EBM A; 1LWY A; 1WEI A; 1PVS A; 4PII A; 1PU6 A; 1KG3 A; 3NNQ A; 4OFH A; 1NKU A; 2OFK A; 2ABK A; 3L2R A; 5FRN A; 3OH6 A; 4EJZ A; 1YQM A; 3FHG A; 3OS0 A; 2NOI A; 3OYD A; 1LMZ A; 4B24 A; 1XQO A; 3G0Q A; 3CVT A; 4DK9 A; 1KQJ A; 1HU0 A; 4UOB A; 1ORP A; 5FRO A; 1ORN A; 3L2V A; 1FN7 A; 4BAC A; 2NOF A; 2H56 A; 3S3N A; 1MUY A; 4EJY A; 2NOB A; 1N3A A; 1KG2 A; 4YPH A; 5CHZ A; 3OYJ A; 4BE0 A; 4E9F A; 1PU7 A; 3OYB A; 3OYL A; 4BDY A; 3OYC A; 3I0W A; 4E9H A; 1PU8 A; 3VW4 A; 4EA4 A; 3OYH A; 4B22 A; 4IKF A; 2JHN A; 1WEF A; 3OYN A; 3CVS A; 1VRL A; 1NGN A; 1KO9 A; 1LWV A; 2NOH A; 1XG7 A; 3OYF A; 1YQK A; 1P59 A; 4EVV A; 5KN9 A; 3CWA A; 2JG6 A; 2JPS A; 3OYA A; 1N39 A; 4E9E A; 3OYK A; 1MUN A; 1YQR A; 4OFE A; 4E7K A; 1M3Q A; 3OYG A; 3OGD A; 5AN4 A; 4E9G A; 4E7I A; 1M3H A; 3S6I A; 2NOL A; 4E7J A; 4AIA A; 3KTU A; 3KNT A; 2V75 A; 1U84 A; 3S3M A; 3L2U A; 4B23 A; 5FRM A; 3F0Z A; 2XHI A; 1KG5 A; 1MPG A; 3L2W A; 1P7M A; 5KN8 A; 1LWW A; 2JHJ A; 1RRS A; 3N0U A; 1RRQ A; 3OYM A; 2YG8 A; 4NZG A; 3R2X C; 3F10 A; 4ZTJ A; 3OH9 A; 1KEA A; 3N5N X; 4UNF A; 3OYE A; 4YPR A; 3L2Q A; 4E7L A; 2OFI A; 2NOZ A; 1WEG A; 1MUD A; 3OYI A; 1XQP A; 4AI5 A; 4EA5 A; 3CWS A; 3LCN A; 4E7H A; 3S3O A; 1KG4 A; 4HSB A; 4YOQ A; 2W03 A; 2YG9 A; 3OS2 A; 3OS1 A; 4B21 A; #chains in the Genus database with same CATH homology 3L2W A; 3OS0 A; 3OYF A; 3OYD A; 3OY9 A; 2W04 A; 3OYM A; 4BE2 A; 2JPS A; 3OYA A; 4NZG A; 3OYK A; 5FRM A; 4ZTJ A; 5FRO A; 3L2V A; 4BAC A; 3OYE A; 3L2Q A; 4E7L A; 3S3N A; 4BDZ A; 4E7K A; 3OYG A; 4BE1 A; 4ZTF A; 4E7I A; 3OYI A; 3OYJ A; 4BE0 A; 3OYB A; 3LCN A; 4E7H A; 3OYL A; 4E7J A; 4BDY A; 3OYC A; 3S3O A; 5FRN A; 3OYN A; 2V75 A; 3NNQ A; 3VW4 A; 2W03 A; 3S3M A; 3OYH A; 4IKF A; 3L2U A; 3L2R A; 3OS2 A; 3OS1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
