3NVIA

Structure of n-terminal truncated nop56/58 bound with l7ae and box c/d rna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
247
structure length
247
Chain Sequence
QSGARDKMVIQAIEALDDVDKVINLLVARLREWYSLHFPELDELLPKHPQYVAFVKTVGHRDNINEEVLRELGLSEEKIKKILEAKEKTMGAWMDQTDIEVVRQLAEEIDRLYQLRKKLEDYIDRAMDDVAPNLKALVGAKLAARLISLAGGLRELAMMPSSTIQVLGAEKALFRHLRTGAKPPKHGVIYQYPAINRSPWWQRGKIARALAGKLAIAARVDYFSGEYIAEELKKELEARIREIKEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 93
structure length 247
sequence length 247
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01798 Nop snoRNA binding domain, fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.90 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3nviA02
4BY9C 3GQUA 3NVMA 5GIOA 5GIPA 3NVIA 2NNWA 3GQXA 1NT2B 3NMUA 3SIUB 3PLAA 3NVKA 2OZBB 3SIVB 3ICXA 5GINA
chains in the Genus database with same CATH superfamily
4BY9C 5DQFA 2KBZA 2LQHA 4GDKB 2NNWA 3BPJA 2EFCA 2I30A 4ZCGA 4E99A 4ZUXV 2V36A 3W1SA 3GQXA 4L9KA 2BXPA 2BXFA 3KIKA 4ZBRA 3V08A 2I2ZA 3V03A 3NVKA 1UORA 2BXKA 4GDXA 3A73A 5ID7A 3FWBC 3GQUA 5IIXA 4HGMB 4IW2A 4EMXA 3G9KD 1HK3A 1NT2B 4N3ZA 1KW2A 1BM0A 4JK4A 5IFOA 3LU8A 2K0NA 2EFEA 4L8UA 2QHBA 1MA9A 3JQZA 1HA2A 2VUEA 2LQIA 4N0UD 3LU6A 1VZSA 1BJ5A 4K71A 4IW1A 1JNBA 1J7EA 2XMOA 4NAWB 2DBUA 5IJFA 3ECPA 4LUHA 4OTTA 1HK1A 2BXHA 2BXMA 4GDLB 5IJ5A 1E7CA 2BXEA 1MUSA 3KJLA 4PO0A 2CKXA 3B9LA 2YDFA 2AGHB 2BXGA 1E7IA 4F5UA 4F5VA 1E7HA 5IIHA 5GHKA 1MUHA 2BX8A 2LXTA 2BXCA 1E7AA 1TF0A 2XVWA 4FIPB 2DBXA 4I9OA 1HK5A 1LNSA 4C31B 1MIVA 4ZC6A 4GG2A 2BXNA 2LXSA 4Z9OA 1LOTA 3GA9L 2VDBA 2DYOA 3B9MA 1MIWA 2BXOA 2VUFA 4S1YA 3VQIA 1MM8A 2QM6A 5GINA 1H5WA 4Z69A 1KDXA 4M70B 4K2CA 5FUOA 2XW0A 1BKEA 4LB9A 4ZBQA 3PLAA 4TQ1A 3WHRA 5D7GA 2EFHA 4TQ0A 1IJGA 2BXQA 2Z8IA 2QMCA 3TDLA 3SIUB 3NMUA 1H9ZA 5IIUA 1E7BA 3MHSB 3H3AA 4W4UB 2ROHA 3LU7A 1VFIA 2BXLA 4G04A 1E7GA 1MIYA 2E0YA 4OT2A 1HK4A 4LB2A 3UIVA 1E7FA 2XVQA 1GNJA 4ZBKA 1HK2A 2E0XA 5ID9A 3FWCC 2XVUA 2BXIA 4FK5B 2JUHA 4MBEC 4J2VA 2DBWA 2Z8JA 4LUFA 3A75A 1GNIA 4F5TA 3SIVB 1FOUA 2DYMA 2BXAA 2XVVA 1O9XA 3NVMA 4D7XA 4WA6B 4G03A 3H37A 3M99C 4DHXB 4N0FD 5DBYA 3WHQA 2BXBA 1AO6A 2DG5A 2OZBB 1KXPD 1TXUA 2EFDA 4DM0A 1J78A 2LOQA 4HGKA 3MHHB 4FJCB 4LA0A 3V09A 1E7EA 5BPKA 4OR0A 1SB0A 5HOZA 3FNMA 2XW1A 1N5UA 2Z8KA 2AJEA 2GUTA 4BKEA 2BXDA 4G01A 1E78A 2NQOA 3ICXA 4F5SA 3SQJA 3CX9A 5B5TA 4OTUA 5GIOA 5GIPA 3NVIA 3JRYA 2OT3A 4L9QA 3WHSA 2KWFA 5IJEA 2XSIA
chains in the Genus database with same CATH topology
4BY9C 5DQFA 2KBZA 4GDKB 2NNWA 2EFCA 2I30A 4ZCGA 4E99A 4ZUXV 2V36A 3W1SA 3GQXA 4L9KA 2BXPA 2BXFA 3KIKA 4ZBRA 3V08A 2I2ZA 3V03A 3NVKA 1UORA 2BXKA 4GDXA 3A73A 5ID7A 3FWBC 3GQUA 5IIXA 4HGMB 4IW2A 4EMXA 3G9KD 1HK3A 1NT2B 4N3ZA 1KW2A 1BM0A 4JK4A 5IFOA 3LU8A 4L8UA 2EFEA 2QHBA 1MA9A 3JQZA 1HA2A 2VUEA 4N0UD 3LU6A 1VZSA 1BJ5A 4K71A 4IW1A 1JNBA 1J7EA 2XMOA 4NAWB 2DBUA 5IJFA 4LUHA 4OTTA 1HK1A 2BXHA 2BXMA 4GDLB 5IJ5A 1E7CA 2BXEA 3KJLA 4PO0A 2CKXA 3B9LA 2YDFA 2BXGA 1E7IA 4F5UA 4F5VA 1E7HA 5IIHA 5GHKA 2BX8A 2BXCA 1E7AA 1TF0A 2XVWA 4FIPB 2DBXA 1HK5A 1LNSA 4C31B 1MIVA 4ZC6A 4GG2A 2BXNA 4Z9OA 1LOTA 3GA9L 2VDBA 2DYOA 3B9MA 1MIWA 2BXOA 2VUFA 4S1YA 3VQIA 2QM6A 5GINA 1H5WA 4Z69A 4M70B 4K2CA 5FUOA 2XW0A 1BKEA 4LB9A 4ZBQA 3PLAA 4TQ1A 3WHRA 5D7GA 2EFHA 4TQ0A 1IJGA 2BXQA 2Z8IA 2QMCA 3TDLA 3SIUB 3NMUA 1H9ZA 5IIUA 1E7BA 3MHSB 3H3AA 4W4UB 2ROHA 3LU7A 1VFIA 2BXLA 4G04A 1E7GA 1MIYA 2E0YA 4OT2A 1HK4A 4LB2A 3UIVA 1E7FA 2XVQA 1GNJA 4ZBKA 1HK2A 2E0XA 5ID9A 3FWCC 2XVUA 2BXIA 4FK5B 2JUHA 4MBEC 4J2VA 2DBWA 2Z8JA 4LUFA 3A75A 1GNIA 4F5TA 3SIVB 1FOUA 2DYMA 2BXAA 2XVVA 1O9XA 3NVMA 4WA6B 4G03A 3H37A 3M99C 4DHXB 4N0FD 5DBYA 3WHQA 2BXBA 1AO6A 2DG5A 2OZBB 1KXPD 1TXUA 2EFDA 1J78A 2LOQA 4HGKA 3MHHB 4FJCB 4LA0A 3V09A 1E7EA 5BPKA 4OR0A 5HOZA 3FNMA 2XW1A 1N5UA 2Z8KA 2AJEA 4BKEA 2BXDA 4G01A 1E78A 4F5SA 3ICXA 3SQJA 3CX9A 5B5TA 4OTUA 5GIOA 5GIPA 3NVIA 3JRYA 2OT3A 4L9QA 3WHSA 2NQOA 5IJEA 2XSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY9 C;  3GQU A;  3NVM A;  5GIO A;  5GIP A;  3NVI A;  2NNW A;  3GQX A;  1NT2 B;  3NMU A;  3SIU B;  3PLA A;  3NVK A;  2OZB B;  3SIV B;  3ICX A;  5GIN A; 
#chains in the Genus database with same CATH topology
 4BY9 C;  5DQF A;  2KBZ A;  2LQH A;  4GDK B;  2NNW A;  3BPJ A;  2EFC A;  2I30 A;  4ZCG A;  4E99 A;  4ZUX V;  2V36 A;  3W1S A;  3GQX A;  4L9K A;  2BXP A;  2BXF A;  3KIK A;  4ZBR A;  3V08 A;  2I2Z A;  3V03 A;  3NVK A;  1UOR A;  2BXK A;  4GDX A;  3A73 A;  5ID7 A;  3FWB C;  3GQU A;  5IIX A;  4HGM B;  4IW2 A;  4EMX A;  3G9K D;  1HK3 A;  1NT2 B;  4N3Z A;  1KW2 A;  1BM0 A;  4JK4 A;  5IFO A;  3LU8 A;  2K0N A;  2EFE A;  4L8U A;  2QHB A;  1MA9 A;  3JQZ A;  1HA2 A;  2VUE A;  2LQI A;  4N0U D;  3LU6 A;  1VZS A;  1BJ5 A;  4K71 A;  4IW1 A;  1JNB A;  1J7E A;  2XMO A;  4NAW B;  2DBU A;  5IJF A;  3ECP A;  4LUH A;  4OTT A;  1HK1 A;  2BXH A;  2BXM A;  4GDL B;  5IJ5 A;  1E7C A;  2BXE A;  1MUS A;  3KJL A;  4PO0 A;  2CKX A;  3B9L A;  2YDF A;  2AGH B;  2BXG A;  1E7I A;  4F5U A;  4F5V A;  1E7H A;  5IIH A;  5GHK A;  1MUH A;  2BX8 A;  2LXT A;  2BXC A;  1E7A A;  1TF0 A;  2XVW A;  4FIP B;  2DBX A;  4I9O A;  1HK5 A;  1LNS A;  4C31 B;  1MIV A;  4ZC6 A;  4GG2 A;  2BXN A;  2LXS A;  4Z9O A;  1LOT A;  3GA9 L;  2VDB A;  2DYO A;  3B9M A;  1MIW A;  2BXO A;  2VUF A;  4S1Y A;  3VQI A;  1MM8 A;  2QM6 A;  5GIN A;  1H5W A;  4Z69 A;  1KDX A;  4M70 B;  4K2C A;  5FUO A;  2XW0 A;  1BKE A;  4LB9 A;  4ZBQ A;  3PLA A;  4TQ1 A;  3WHR A;  5D7G A;  2EFH A;  4TQ0 A;  1IJG A;  2BXQ A;  2Z8I A;  2QMC A;  3TDL A;  3SIU B;  3NMU A;  1H9Z A;  5IIU A;  1E7B A;  3MHS B;  3H3A A;  4W4U B;  2ROH A;  3LU7 A;  1VFI A;  2BXL A;  4G04 A;  1E7G A;  1MIY A;  2E0Y A;  4OT2 A;  1HK4 A;  4LB2 A;  3UIV A;  1E7F A;  2XVQ A;  1GNJ A;  4ZBK A;  1HK2 A;  2E0X A;  5ID9 A;  3FWC C;  2XVU A;  2BXI A;  4FK5 B;  2JUH A;  4MBE C;  4J2V A;  2DBW A;  2Z8J A;  4LUF A;  3A75 A;  1GNI A;  4F5T A;  3SIV B;  1FOU A;  2DYM A;  2BXA A;  2XVV A;  1O9X A;  3NVM A;  4D7X A;  4WA6 B;  4G03 A;  3H37 A;  3M99 C;  4DHX B;  4N0F D;  5DBY A;  3WHQ A;  2BXB A;  1AO6 A;  2DG5 A;  2OZB B;  1KXP D;  1TXU A;  2EFD A;  4DM0 A;  1J78 A;  2LOQ A;  4HGK A;  3MHH B;  4FJC B;  4LA0 A;  3V09 A;  1E7E A;  5BPK A;  4OR0 A;  1SB0 A;  5HOZ A;  3FNM A;  2XW1 A;  1N5U A;  2Z8K A;  2AJE A;  2GUT A;  4BKE A;  2BXD A;  4G01 A;  1E78 A;  2NQO A;  3ICX A;  4F5S A;  3SQJ A;  3CX9 A;  5B5T A;  4OTU A;  5GIO A;  5GIP A;  3NVI A;  3JRY A;  2OT3 A;  4L9Q A;  3WHS A;  2KWF A;  5IJE A;  2XSI A; 
#chains in the Genus database with same CATH homology
 4BY9 C;  5DQF A;  2KBZ A;  4GDK B;  2NNW A;  2EFC A;  2I30 A;  4ZCG A;  4E99 A;  4ZUX V;  2V36 A;  3W1S A;  3GQX A;  4L9K A;  2BXP A;  2BXF A;  3KIK A;  4ZBR A;  3V08 A;  2I2Z A;  3V03 A;  3NVK A;  1UOR A;  2BXK A;  4GDX A;  3A73 A;  5ID7 A;  3FWB C;  3GQU A;  5IIX A;  4HGM B;  4IW2 A;  4EMX A;  3G9K D;  1HK3 A;  1NT2 B;  4N3Z A;  1KW2 A;  1BM0 A;  4JK4 A;  5IFO A;  3LU8 A;  4L8U A;  2EFE A;  2QHB A;  1MA9 A;  3JQZ A;  1HA2 A;  2VUE A;  4N0U D;  3LU6 A;  1VZS A;  1BJ5 A;  4K71 A;  4IW1 A;  1JNB A;  1J7E A;  2XMO A;  4NAW B;  2DBU A;  5IJF A;  4LUH A;  4OTT A;  1HK1 A;  2BXH A;  2BXM A;  4GDL B;  5IJ5 A;  1E7C A;  2BXE A;  3KJL A;  4PO0 A;  2CKX A;  3B9L A;  2YDF A;  2BXG A;  1E7I A;  4F5U A;  4F5V A;  1E7H A;  5IIH A;  5GHK A;  2BX8 A;  2BXC A;  1E7A A;  1TF0 A;  2XVW A;  4FIP B;  2DBX A;  1HK5 A;  1LNS A;  4C31 B;  1MIV A;  4ZC6 A;  4GG2 A;  2BXN A;  4Z9O A;  1LOT A;  3GA9 L;  2VDB A;  2DYO A;  3B9M A;  1MIW A;  2BXO A;  2VUF A;  4S1Y A;  3VQI A;  2QM6 A;  5GIN A;  1H5W A;  4Z69 A;  4M70 B;  4K2C A;  5FUO A;  2XW0 A;  1BKE A;  4LB9 A;  4ZBQ A;  3PLA A;  4TQ1 A;  3WHR A;  5D7G A;  2EFH A;  4TQ0 A;  1IJG A;  2BXQ A;  2Z8I A;  2QMC A;  3TDL A;  3SIU B;  3NMU A;  1H9Z A;  5IIU A;  1E7B A;  3MHS B;  3H3A A;  4W4U B;  2ROH A;  3LU7 A;  1VFI A;  2BXL A;  4G04 A;  1E7G A;  1MIY A;  2E0Y A;  4OT2 A;  1HK4 A;  4LB2 A;  3UIV A;  1E7F A;  2XVQ A;  1GNJ A;  4ZBK A;  1HK2 A;  2E0X A;  5ID9 A;  3FWC C;  2XVU A;  2BXI A;  4FK5 B;  2JUH A;  4MBE C;  4J2V A;  2DBW A;  2Z8J A;  4LUF A;  3A75 A;  1GNI A;  4F5T A;  3SIV B;  1FOU A;  2DYM A;  2BXA A;  2XVV A;  1O9X A;  3NVM A;  4WA6 B;  4G03 A;  3H37 A;  3M99 C;  4DHX B;  4N0F D;  5DBY A;  3WHQ A;  2BXB A;  1AO6 A;  2DG5 A;  2OZB B;  1KXP D;  1TXU A;  2EFD A;  1J78 A;  2LOQ A;  4HGK A;  3MHH B;  4FJC B;  4LA0 A;  3V09 A;  1E7E A;  5BPK A;  4OR0 A;  5HOZ A;  3FNM A;  2XW1 A;  1N5U A;  2Z8K A;  2AJE A;  4BKE A;  2BXD A;  4G01 A;  1E78 A;  4F5S A;  3ICX A;  3SQJ A;  3CX9 A;  5B5T A;  4OTU A;  5GIO A;  5GIP A;  3NVI A;  3JRY A;  2OT3 A;  4L9Q A;  3WHS A;  2NQO A;  5IJE A;  2XSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...