3WHQA

Crystal structure of gamma-glutamyltranspeptidase from bacillus subtilis (crystal soaked for 0 min. in acivicin soln. )
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
360
structure length
360
Chain Sequence
EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase
molecule keywords Gamma-glutamyltranspeptidase large chain
publication title Structure of Bacillus subtilis gamma-glutamyl-transpeptidase in complex with acivicin: diversity of the binding mode of a classical and electrophilic active-site-directed glutamate analogue
doi rcsb
source organism Bacillus subtilis
total genus 104
structure length 360
sequence length 360
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3whqA02
2QMCA 4GG2A 2Z8JA 3FNMA 2V36A 2Z8KA 4OTUA 4ZC6A 2QM6A 2DBUA 4GDXA 5B5TA 2E0XA 3A75A 3WHSA 2E0YA 4ZBKA 2DBXA 2Z8IA 4ZCGA 4OTTA 2DG5A 4Z9OA 2NQOA 2DBWA 3WHRA 3WHQA 5BPKA
chains in the Genus database with same CATH superfamily
1MUSA 1E7GA 4FJCB 3WHRA 2QMCA 3TDLA 2BXDA 5IIHA 1H5WA 5GIOA 2AGHB 5IJEA 1FOUA 2EFEA 4IW1A 2I30A 2BXHA 3NVMA 4HGMB 2EFHA 2XW1A 2KBZA 2XMOA 4DHXB 3A73A 1J78A 2BXFA 2CKXA 4GDXA 1VFIA 3NVIA 1GNIA 3A75A 5GIPA 3WHSA 1MUHA 5GHKA 4IW2A 2LOQA 2VUFA 1MA9A 3VQIA 4F5UA 2BXEA 3G9KD 1MIYA 1UORA 4ZCGA 1LNSA 2DG5A 4Z9OA 1HA2A 2XW0A 2BXGA 2BXCA 1TXUA 4FIPB 3B9LA 1JNBA 3FWBC 1KW2A 4L9QA 1MIVA 4M70B 4ZBRA 2ROHA 4E99A 4BY9C 1AO6A 4G04A 1E7AA 2Z8JA 3GQUA 4TQ1A 1H9ZA 4L8UA 2QHBA 1E78A 3SIUB 3MHSB 4J2VA 4WA6B 2BXAA 1KDXA 2XSIA 4LB9A 1N5UA 4F5TA 4OTUA 2XVUA 4N0FD 4GDLB 3NMUA 1E7IA 2LQIA 2LQHA 3V08A 3PLAA 1BKEA 2E0YA 1BJ5A 3M99C 4LUFA 3V03A 2DYMA 1SB0A 2DBXA 2Z8IA 1J7EA 2BXOA 5IIUA 2BXQA 3LU8A 5ID7A 2LXSA 3KJLA 4I9OA 3W1SA 2KWFA 5IJFA 4N3ZA 4S1YA 4EMXA 5ID9A 5IIXA 2VUEA 5GINA 3FWCC 4GG2A 2BXIA 3KIKA 4BKEA 1BM0A 1E7EA 1HK3A 2BXNA 5D7GA 3FNMA 2V36A 5IJ5A 4LB2A 1E7CA 4TQ0A 1NT2B 4OT2A 2XVQA 3LU7A 4L9KA 3SQJA 2XVVA 4C31B 2DBUA 1HK4A 3GQXA 1HK1A 2OZBB 3JRYA 1KXPD 3GA9L 4LA0A 2OT3A 4W4UB 1O9XA 2K0NA 3LU6A 3JQZA 4PO0A 1E7HA 4GDKB 1TF0A 4ZBKA 3V09A 2BXBA 4K2CA 2EFDA 1E7FA 1GNJA 2I2ZA 4OTTA 1MM8A 1LOTA 2NQOA 1HK2A 2GUTA 2YDFA 4ZUXV 3WHQA 1VZSA 4K71A 3NVKA 2LXTA 3B9MA 4FK5B 2BX8A 4LUHA 2DYOA 5DBYA 4NAWB 3CX9A 4OR0A 3H37A 5IFOA 4Z69A 2Z8KA 2BXPA 3ECPA 2BXLA 3ICXA 4N0UD 4JK4A 1IJGA 5HOZA 4F5SA 4ZBQA 3UIVA 2AJEA 2BXKA 4ZC6A 4D7XA 3MHHB 2QM6A 3H3AA 4HGKA 4DM0A 2JUHA 5B5TA 2E0XA 4MBEC 2BXMA 3SIVB 2NNWA 1E7BA 4G01A 1MIWA 5DQFA 1HK5A 2XVWA 4G03A 4F5VA 2VDBA 5FUOA 2DBWA 3BPJA 2EFCA 5BPKA
chains in the Genus database with same CATH topology
1E7GA 4FJCB 2QMCA 3TDLA 2BXDA 5IIHA 1H5WA 5GIOA 5IJEA 1FOUA 2EFEA 4IW1A 2I30A 2BXHA 3NVMA 4HGMB 2EFHA 2XW1A 2KBZA 2XMOA 4DHXB 3A73A 1J78A 2BXFA 2CKXA 4GDXA 1VFIA 3NVIA 1GNIA 3A75A 5GIPA 3WHSA 5GHKA 4IW2A 2LOQA 2VUFA 1MA9A 3VQIA 4F5UA 2BXEA 3G9KD 1MIYA 1UORA 4ZCGA 1LNSA 2DG5A 4Z9OA 1HA2A 2XW0A 2BXGA 2BXCA 1TXUA 4FIPB 3B9LA 1JNBA 3FWBC 1KW2A 4L9QA 1MIVA 4M70B 4ZBRA 2ROHA 4E99A 4BY9C 1AO6A 4G04A 1E7AA 2Z8JA 3GQUA 4TQ1A 1H9ZA 4L8UA 2QHBA 1E78A 3SIUB 3MHSB 4J2VA 4WA6B 2BXAA 2XSIA 4LB9A 1N5UA 4F5TA 4OTUA 2XVUA 4N0FD 4GDLB 3NMUA 1E7IA 3V08A 3PLAA 1BKEA 2E0YA 1BJ5A 3M99C 4LUFA 3V03A 2DYMA 2DBXA 2Z8IA 1J7EA 2BXOA 5IIUA 2BXQA 3LU8A 5ID7A 3KJLA 3W1SA 5IJFA 4N3ZA 4S1YA 4EMXA 5ID9A 5IIXA 2VUEA 5GINA 3FWCC 4GG2A 2BXIA 3KIKA 4BKEA 1BM0A 1E7EA 1HK3A 2BXNA 5D7GA 3FNMA 2V36A 5IJ5A 4LB2A 1E7CA 4TQ0A 1NT2B 4OT2A 2XVQA 3LU7A 4L9KA 3SQJA 2XVVA 4C31B 2DBUA 1HK4A 3GQXA 1HK1A 2OZBB 3JRYA 1KXPD 3GA9L 4LA0A 2OT3A 4W4UB 1O9XA 3LU6A 3JQZA 4PO0A 1E7HA 4GDKB 1TF0A 4ZBKA 3V09A 2BXBA 4K2CA 2EFDA 1E7FA 1GNJA 2I2ZA 4OTTA 1LOTA 2NQOA 1HK2A 2YDFA 4ZUXV 3WHQA 1VZSA 4K71A 3NVKA 3B9MA 4FK5B 2BX8A 4LUHA 2DYOA 5DBYA 4NAWB 3CX9A 4OR0A 3H37A 5IFOA 4Z69A 2Z8KA 2BXPA 2BXLA 3ICXA 4N0UD 4JK4A 1IJGA 5HOZA 4F5SA 4ZBQA 3UIVA 2AJEA 2BXKA 4ZC6A 3MHHB 2QM6A 3H3AA 4HGKA 2JUHA 5B5TA 2E0XA 4MBEC 2BXMA 3SIVB 2NNWA 1E7BA 4G01A 1MIWA 5DQFA 1HK5A 2XVWA 4G03A 4F5VA 2VDBA 5FUOA 2DBWA 3WHRA 2EFCA 5BPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMC A;  4GG2 A;  2Z8J A;  3FNM A;  2V36 A;  2Z8K A;  4OTU A;  4ZC6 A;  2QM6 A;  2DBU A;  4GDX A;  5B5T A;  2E0X A;  3A75 A;  3WHS A;  2E0Y A;  4ZBK A;  2DBX A;  2Z8I A;  4ZCG A;  4OTT A;  2DG5 A;  4Z9O A;  2NQO A;  2DBW A;  3WHR A;  3WHQ A;  5BPK A; 
#chains in the Genus database with same CATH topology
 1MUS A;  1E7G A;  4FJC B;  3WHR A;  2QMC A;  3TDL A;  2BXD A;  5IIH A;  1H5W A;  5GIO A;  2AGH B;  5IJE A;  1FOU A;  2EFE A;  4IW1 A;  2I30 A;  2BXH A;  3NVM A;  4HGM B;  2EFH A;  2XW1 A;  2KBZ A;  2XMO A;  4DHX B;  3A73 A;  1J78 A;  2BXF A;  2CKX A;  4GDX A;  1VFI A;  3NVI A;  1GNI A;  3A75 A;  5GIP A;  3WHS A;  1MUH A;  5GHK A;  4IW2 A;  2LOQ A;  2VUF A;  1MA9 A;  3VQI A;  4F5U A;  2BXE A;  3G9K D;  1MIY A;  1UOR A;  4ZCG A;  1LNS A;  2DG5 A;  4Z9O A;  1HA2 A;  2XW0 A;  2BXG A;  2BXC A;  1TXU A;  4FIP B;  3B9L A;  1JNB A;  3FWB C;  1KW2 A;  4L9Q A;  1MIV A;  4M70 B;  4ZBR A;  2ROH A;  4E99 A;  4BY9 C;  1AO6 A;  4G04 A;  1E7A A;  2Z8J A;  3GQU A;  4TQ1 A;  1H9Z A;  4L8U A;  2QHB A;  1E78 A;  3SIU B;  3MHS B;  4J2V A;  4WA6 B;  2BXA A;  1KDX A;  2XSI A;  4LB9 A;  1N5U A;  4F5T A;  4OTU A;  2XVU A;  4N0F D;  4GDL B;  3NMU A;  1E7I A;  2LQI A;  2LQH A;  3V08 A;  3PLA A;  1BKE A;  2E0Y A;  1BJ5 A;  3M99 C;  4LUF A;  3V03 A;  2DYM A;  1SB0 A;  2DBX A;  2Z8I A;  1J7E A;  2BXO A;  5IIU A;  2BXQ A;  3LU8 A;  5ID7 A;  2LXS A;  3KJL A;  4I9O A;  3W1S A;  2KWF A;  5IJF A;  4N3Z A;  4S1Y A;  4EMX A;  5ID9 A;  5IIX A;  2VUE A;  5GIN A;  3FWC C;  4GG2 A;  2BXI A;  3KIK A;  4BKE A;  1BM0 A;  1E7E A;  1HK3 A;  2BXN A;  5D7G A;  3FNM A;  2V36 A;  5IJ5 A;  4LB2 A;  1E7C A;  4TQ0 A;  1NT2 B;  4OT2 A;  2XVQ A;  3LU7 A;  4L9K A;  3SQJ A;  2XVV A;  4C31 B;  2DBU A;  1HK4 A;  3GQX A;  1HK1 A;  2OZB B;  3JRY A;  1KXP D;  3GA9 L;  4LA0 A;  2OT3 A;  4W4U B;  1O9X A;  2K0N A;  3LU6 A;  3JQZ A;  4PO0 A;  1E7H A;  4GDK B;  1TF0 A;  4ZBK A;  3V09 A;  2BXB A;  4K2C A;  2EFD A;  1E7F A;  1GNJ A;  2I2Z A;  4OTT A;  1MM8 A;  1LOT A;  2NQO A;  1HK2 A;  2GUT A;  2YDF A;  4ZUX V;  3WHQ A;  1VZS A;  4K71 A;  3NVK A;  2LXT A;  3B9M A;  4FK5 B;  2BX8 A;  4LUH A;  2DYO A;  5DBY A;  4NAW B;  3CX9 A;  4OR0 A;  3H37 A;  5IFO A;  4Z69 A;  2Z8K A;  2BXP A;  3ECP A;  2BXL A;  3ICX A;  4N0U D;  4JK4 A;  1IJG A;  5HOZ A;  4F5S A;  4ZBQ A;  3UIV A;  2AJE A;  2BXK A;  4ZC6 A;  4D7X A;  3MHH B;  2QM6 A;  3H3A A;  4HGK A;  4DM0 A;  2JUH A;  5B5T A;  2E0X A;  4MBE C;  2BXM A;  3SIV B;  2NNW A;  1E7B A;  4G01 A;  1MIW A;  5DQF A;  1HK5 A;  2XVW A;  4G03 A;  4F5V A;  2VDB A;  5FUO A;  2DBW A;  3BPJ A;  2EFC A;  5BPK A; 
#chains in the Genus database with same CATH homology
 1E7G A;  4FJC B;  2QMC A;  3TDL A;  2BXD A;  5IIH A;  1H5W A;  5GIO A;  5IJE A;  1FOU A;  2EFE A;  4IW1 A;  2I30 A;  2BXH A;  3NVM A;  4HGM B;  2EFH A;  2XW1 A;  2KBZ A;  2XMO A;  4DHX B;  3A73 A;  1J78 A;  2BXF A;  2CKX A;  4GDX A;  1VFI A;  3NVI A;  1GNI A;  3A75 A;  5GIP A;  3WHS A;  5GHK A;  4IW2 A;  2LOQ A;  2VUF A;  1MA9 A;  3VQI A;  4F5U A;  2BXE A;  3G9K D;  1MIY A;  1UOR A;  4ZCG A;  1LNS A;  2DG5 A;  4Z9O A;  1HA2 A;  2XW0 A;  2BXG A;  2BXC A;  1TXU A;  4FIP B;  3B9L A;  1JNB A;  3FWB C;  1KW2 A;  4L9Q A;  1MIV A;  4M70 B;  4ZBR A;  2ROH A;  4E99 A;  4BY9 C;  1AO6 A;  4G04 A;  1E7A A;  2Z8J A;  3GQU A;  4TQ1 A;  1H9Z A;  4L8U A;  2QHB A;  1E78 A;  3SIU B;  3MHS B;  4J2V A;  4WA6 B;  2BXA A;  2XSI A;  4LB9 A;  1N5U A;  4F5T A;  4OTU A;  2XVU A;  4N0F D;  4GDL B;  3NMU A;  1E7I A;  3V08 A;  3PLA A;  1BKE A;  2E0Y A;  1BJ5 A;  3M99 C;  4LUF A;  3V03 A;  2DYM A;  2DBX A;  2Z8I A;  1J7E A;  2BXO A;  5IIU A;  2BXQ A;  3LU8 A;  5ID7 A;  3KJL A;  3W1S A;  5IJF A;  4N3Z A;  4S1Y A;  4EMX A;  5ID9 A;  5IIX A;  2VUE A;  5GIN A;  3FWC C;  4GG2 A;  2BXI A;  3KIK A;  4BKE A;  1BM0 A;  1E7E A;  1HK3 A;  2BXN A;  5D7G A;  3FNM A;  2V36 A;  5IJ5 A;  4LB2 A;  1E7C A;  4TQ0 A;  1NT2 B;  4OT2 A;  2XVQ A;  3LU7 A;  4L9K A;  3SQJ A;  2XVV A;  4C31 B;  2DBU A;  1HK4 A;  3GQX A;  1HK1 A;  2OZB B;  3JRY A;  1KXP D;  3GA9 L;  4LA0 A;  2OT3 A;  4W4U B;  1O9X A;  3LU6 A;  3JQZ A;  4PO0 A;  1E7H A;  4GDK B;  1TF0 A;  4ZBK A;  3V09 A;  2BXB A;  4K2C A;  2EFD A;  1E7F A;  1GNJ A;  2I2Z A;  4OTT A;  1LOT A;  2NQO A;  1HK2 A;  2YDF A;  4ZUX V;  3WHQ A;  1VZS A;  4K71 A;  3NVK A;  3B9M A;  4FK5 B;  2BX8 A;  4LUH A;  2DYO A;  5DBY A;  4NAW B;  3CX9 A;  4OR0 A;  3H37 A;  5IFO A;  4Z69 A;  2Z8K A;  2BXP A;  2BXL A;  3ICX A;  4N0U D;  4JK4 A;  1IJG A;  5HOZ A;  4F5S A;  4ZBQ A;  3UIV A;  2AJE A;  2BXK A;  4ZC6 A;  3MHH B;  2QM6 A;  3H3A A;  4HGK A;  2JUH A;  5B5T A;  2E0X A;  4MBE C;  2BXM A;  3SIV B;  2NNW A;  1E7B A;  4G01 A;  1MIW A;  5DQF A;  1HK5 A;  2XVW A;  4G03 A;  4F5V A;  2VDB A;  5FUO A;  2DBW A;  3WHR A;  2EFC A;  5BPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...