3WHRA

Crystal structure of gamma-glutamyltranspeptidase from bacillus subtilis (crystal soaked for 3min. in acivicin soln. )
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
359
structure length
359
Chain Sequence
EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase
molecule keywords Gamma-glutamyltranspeptidase large chain
publication title Structure of Bacillus subtilis gamma-glutamyl-transpeptidase in complex with acivicin: diversity of the binding mode of a classical and electrophilic active-site-directed glutamate analogue
doi rcsb
source organism Bacillus subtilis
total genus 108
structure length 359
sequence length 359
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3whrA02
4Z9OA 5BPKA 2DBXA 4OTUA 2Z8JA 4GDXA 3FNMA 2QM6A 2Z8KA 2NQOA 3WHRA 5B5TA 2QMCA 4ZC6A 3WHSA 2DBWA 3A75A 4ZBKA 2E0YA 4OTTA 2DBUA 2Z8IA 2V36A 3WHQA 4GG2A 2E0XA 2DG5A 4ZCGA
chains in the Genus database with same CATH superfamily
1E7CA 2BXEA 5DBYA 2DYOA 2BXBA 2BXKA 4OTUA 2LQIA 3NVMA 4FJCB 4E99A 5GINA 5GIPA 2EFDA 3UIVA 1J78A 2BXAA 4ZBQA 1H9ZA 1MIVA 2BXMA 5B5TA 1LNSA 1N5UA 4MBEC 4WA6B 1MM8A 3JQZA 2DBWA 3A75A 3MHHB 1TF0A 4GDLB 4BKEA 3NMUA 5HOZA 4FK5B 3NVIA 2EFHA 4L8UA 3B9MA 3W1SA 3SIUB 4HGKA 5GHKA 1NT2B 2BXDA 3FWBC 3WHQA 1MA9A 4GG2A 4L9KA 2KWFA 4LA0A 4Z9OA 4TQ1A 3G9KD 3KJLA 2XVQA 2EFEA 3JRYA 2NNWA 4GDXA 2BXHA 2LQHA 5IIXA 5IIHA 4EMXA 2VUEA 2QM6A 2QHBA 3H37A 2Z8KA 2NQOA 2XW0A 1VZSA 5ID9A 3WHRA 4NAWB 4IW2A 1KW2A 1MUHA 2LXSA 2YDFA 4GDKB 4FIPB 4ZC6A 1IJGA 2XMOA 1E7HA 4K71A 4F5TA 3V09A 4S1YA 4IW1A 1TXUA 3MHSB 2V36A 4F5SA 3GQXA 4ZBRA 3V08A 1E78A 1E7IA 5FUOA 1E7AA 4G03A 4N3ZA 4Z69A 2AGHB 4PO0A 2K0NA 1HK3A 1MUSA 2ROHA 3SIVB 4I9OA 5BPKA 1MIYA 5IJEA 1BM0A 2I30A 1H5WA 2Z8JA 1MIWA 1JNBA 2BXFA 1FOUA 3FNMA 3LU8A 3GA9L 3FWCC 1HK1A 1UORA 4JK4A 1GNJA 5DQFA 1HK5A 2JUHA 1GNIA 5IJ5A 2LOQA 1O9XA 4J2VA 3ICXA 4W4UB 5GIOA 4LUHA 3WHSA 3H3AA 3CX9A 5IFOA 4D7XA 1KXPD 4ZBKA 1HK2A 2BXIA 4OTTA 4ZUXV 1KDXA 2DBUA 2Z8IA 2XSIA 1BKEA 3SQJA 4C31B 3TDLA 4BY9C 4OR0A 2KBZA 1E7FA 3PLAA 1E7EA 2BXCA 2AJEA 4N0FD 2XVUA 1J7EA 2BXNA 4F5VA 2VDBA 1SB0A 2BXOA 4ZCGA 4N0UD 4L9QA 5IIUA 4LB2A 2DBXA 1E7GA 3LU7A 1BJ5A 2BXPA 2BXGA 3NVKA 1LOTA 4K2CA 4OT2A 2BXQA 3ECPA 2BXLA 2LXTA 3A73A 4LB9A 3B9LA 1HK4A 4HGMB 2QMCA 3LU6A 2CKXA 2GUTA 2I2ZA 4TQ0A 2BX8A 1AO6A 2XVVA 2E0YA 2OZBB 1E7BA 3BPJA 3V03A 3KIKA 1VFIA 2XW1A 1HA2A 2VUFA 4M70B 4DHXB 3M99C 4F5UA 2OT3A 4LUFA 2XVWA 5D7GA 3VQIA 5ID7A 5IJFA 2DYMA 2DG5A 2E0XA 4DM0A 4G01A 2EFCA 3GQUA 4G04A
chains in the Genus database with same CATH topology
1E7CA 2BXEA 5DBYA 2DYOA 2BXBA 2BXKA 4OTUA 4E99A 3NVMA 4FJCB 5GINA 5GIPA 2EFDA 3UIVA 1J78A 2BXAA 4ZBQA 1H9ZA 1MIVA 2BXMA 5B5TA 1LNSA 1N5UA 4MBEC 4WA6B 3JQZA 2DBWA 3A75A 3MHHB 1TF0A 4GDLB 4BKEA 3NMUA 5HOZA 4FK5B 3NVIA 2EFHA 4L8UA 3B9MA 3W1SA 3SIUB 4HGKA 5GHKA 1NT2B 2BXDA 3FWBC 3WHQA 1MA9A 4GG2A 4L9KA 4LA0A 4Z9OA 4TQ1A 3G9KD 3KJLA 2XVQA 2EFEA 3JRYA 2NNWA 4GDXA 2BXHA 5IIXA 5IIHA 4EMXA 2VUEA 2QM6A 2QHBA 3H37A 2Z8KA 2NQOA 2XW0A 1VZSA 5ID9A 3WHRA 4NAWB 4IW2A 1KW2A 2YDFA 4GDKB 4FIPB 4ZC6A 1IJGA 2XMOA 1E7HA 4K71A 4F5TA 3V09A 4S1YA 4IW1A 1TXUA 3MHSB 2V36A 4F5SA 3GQXA 4ZBRA 3V08A 1E78A 1E7IA 5FUOA 1E7AA 4G03A 4N3ZA 4Z69A 4PO0A 1HK3A 2ROHA 3SIVB 5BPKA 1MIYA 5IJEA 1BM0A 2I30A 1H5WA 2Z8JA 1MIWA 1JNBA 2BXFA 1FOUA 3FNMA 3LU8A 3GA9L 3FWCC 1HK1A 1UORA 4JK4A 1GNJA 5DQFA 1HK5A 2JUHA 1GNIA 5IJ5A 2LOQA 1O9XA 4J2VA 3ICXA 4W4UB 5GIOA 4LUHA 3WHSA 3H3AA 3CX9A 5IFOA 1KXPD 4ZBKA 1HK2A 2BXIA 4OTTA 4ZUXV 2DBUA 2Z8IA 2XSIA 1BKEA 3SQJA 4C31B 3TDLA 4BY9C 4OR0A 2KBZA 1E7FA 3PLAA 1E7EA 2BXCA 2AJEA 4N0FD 2XVUA 1J7EA 2BXNA 4F5VA 2VDBA 2BXOA 4ZCGA 4N0UD 4L9QA 5IIUA 4LB2A 2DBXA 1E7GA 3LU7A 1BJ5A 2BXPA 2BXGA 3NVKA 1LOTA 4K2CA 4OT2A 2BXQA 2BXLA 3A73A 4LB9A 3B9LA 1HK4A 4HGMB 2QMCA 3LU6A 2CKXA 4TQ0A 2I2ZA 2BX8A 1AO6A 2XVVA 2E0YA 2OZBB 1E7BA 3V03A 3KIKA 1VFIA 2XW1A 1HA2A 2VUFA 4M70B 4DHXB 3M99C 4F5UA 2OT3A 4LUFA 2XVWA 5D7GA 3VQIA 5ID7A 5IJFA 2DYMA 2DG5A 2E0XA 4G01A 2EFCA 3GQUA 4G04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9O A;  5BPK A;  2DBX A;  4OTU A;  2Z8J A;  4GDX A;  3FNM A;  2QM6 A;  2Z8K A;  2NQO A;  3WHR A;  5B5T A;  2QMC A;  4ZC6 A;  3WHS A;  2DBW A;  3A75 A;  4ZBK A;  2E0Y A;  4OTT A;  2DBU A;  2Z8I A;  2V36 A;  3WHQ A;  4GG2 A;  2E0X A;  2DG5 A;  4ZCG A; 
#chains in the Genus database with same CATH topology
 1E7C A;  2BXE A;  5DBY A;  2DYO A;  2BXB A;  2BXK A;  4OTU A;  2LQI A;  3NVM A;  4FJC B;  4E99 A;  5GIN A;  5GIP A;  2EFD A;  3UIV A;  1J78 A;  2BXA A;  4ZBQ A;  1H9Z A;  1MIV A;  2BXM A;  5B5T A;  1LNS A;  1N5U A;  4MBE C;  4WA6 B;  1MM8 A;  3JQZ A;  2DBW A;  3A75 A;  3MHH B;  1TF0 A;  4GDL B;  4BKE A;  3NMU A;  5HOZ A;  4FK5 B;  3NVI A;  2EFH A;  4L8U A;  3B9M A;  3W1S A;  3SIU B;  4HGK A;  5GHK A;  1NT2 B;  2BXD A;  3FWB C;  3WHQ A;  1MA9 A;  4GG2 A;  4L9K A;  2KWF A;  4LA0 A;  4Z9O A;  4TQ1 A;  3G9K D;  3KJL A;  2XVQ A;  2EFE A;  3JRY A;  2NNW A;  4GDX A;  2BXH A;  2LQH A;  5IIX A;  5IIH A;  4EMX A;  2VUE A;  2QM6 A;  2QHB A;  3H37 A;  2Z8K A;  2NQO A;  2XW0 A;  1VZS A;  5ID9 A;  3WHR A;  4NAW B;  4IW2 A;  1KW2 A;  1MUH A;  2LXS A;  2YDF A;  4GDK B;  4FIP B;  4ZC6 A;  1IJG A;  2XMO A;  1E7H A;  4K71 A;  4F5T A;  3V09 A;  4S1Y A;  4IW1 A;  1TXU A;  3MHS B;  2V36 A;  4F5S A;  3GQX A;  4ZBR A;  3V08 A;  1E78 A;  1E7I A;  5FUO A;  1E7A A;  4G03 A;  4N3Z A;  4Z69 A;  2AGH B;  4PO0 A;  2K0N A;  1HK3 A;  1MUS A;  2ROH A;  3SIV B;  4I9O A;  5BPK A;  1MIY A;  5IJE A;  1BM0 A;  2I30 A;  1H5W A;  2Z8J A;  1MIW A;  1JNB A;  2BXF A;  1FOU A;  3FNM A;  3LU8 A;  3GA9 L;  3FWC C;  1HK1 A;  1UOR A;  4JK4 A;  1GNJ A;  5DQF A;  1HK5 A;  2JUH A;  1GNI A;  5IJ5 A;  2LOQ A;  1O9X A;  4J2V A;  3ICX A;  4W4U B;  5GIO A;  4LUH A;  3WHS A;  3H3A A;  3CX9 A;  5IFO A;  4D7X A;  1KXP D;  4ZBK A;  1HK2 A;  2BXI A;  4OTT A;  4ZUX V;  1KDX A;  2DBU A;  2Z8I A;  2XSI A;  1BKE A;  3SQJ A;  4C31 B;  3TDL A;  4BY9 C;  4OR0 A;  2KBZ A;  1E7F A;  3PLA A;  1E7E A;  2BXC A;  2AJE A;  4N0F D;  2XVU A;  1J7E A;  2BXN A;  4F5V A;  2VDB A;  1SB0 A;  2BXO A;  4ZCG A;  4N0U D;  4L9Q A;  5IIU A;  4LB2 A;  2DBX A;  1E7G A;  3LU7 A;  1BJ5 A;  2BXP A;  2BXG A;  3NVK A;  1LOT A;  4K2C A;  4OT2 A;  2BXQ A;  3ECP A;  2BXL A;  2LXT A;  3A73 A;  4LB9 A;  3B9L A;  1HK4 A;  4HGM B;  2QMC A;  3LU6 A;  2CKX A;  2GUT A;  2I2Z A;  4TQ0 A;  2BX8 A;  1AO6 A;  2XVV A;  2E0Y A;  2OZB B;  1E7B A;  3BPJ A;  3V03 A;  3KIK A;  1VFI A;  2XW1 A;  1HA2 A;  2VUF A;  4M70 B;  4DHX B;  3M99 C;  4F5U A;  2OT3 A;  4LUF A;  2XVW A;  5D7G A;  3VQI A;  5ID7 A;  5IJF A;  2DYM A;  2DG5 A;  2E0X A;  4DM0 A;  4G01 A;  2EFC A;  3GQU A;  4G04 A; 
#chains in the Genus database with same CATH homology
 1E7C A;  2BXE A;  5DBY A;  2DYO A;  2BXB A;  2BXK A;  4OTU A;  4E99 A;  3NVM A;  4FJC B;  5GIN A;  5GIP A;  2EFD A;  3UIV A;  1J78 A;  2BXA A;  4ZBQ A;  1H9Z A;  1MIV A;  2BXM A;  5B5T A;  1LNS A;  1N5U A;  4MBE C;  4WA6 B;  3JQZ A;  2DBW A;  3A75 A;  3MHH B;  1TF0 A;  4GDL B;  4BKE A;  3NMU A;  5HOZ A;  4FK5 B;  3NVI A;  2EFH A;  4L8U A;  3B9M A;  3W1S A;  3SIU B;  4HGK A;  5GHK A;  1NT2 B;  2BXD A;  3FWB C;  3WHQ A;  1MA9 A;  4GG2 A;  4L9K A;  4LA0 A;  4Z9O A;  4TQ1 A;  3G9K D;  3KJL A;  2XVQ A;  2EFE A;  3JRY A;  2NNW A;  4GDX A;  2BXH A;  5IIX A;  5IIH A;  4EMX A;  2VUE A;  2QM6 A;  2QHB A;  3H37 A;  2Z8K A;  2NQO A;  2XW0 A;  1VZS A;  5ID9 A;  3WHR A;  4NAW B;  4IW2 A;  1KW2 A;  2YDF A;  4GDK B;  4FIP B;  4ZC6 A;  1IJG A;  2XMO A;  1E7H A;  4K71 A;  4F5T A;  3V09 A;  4S1Y A;  4IW1 A;  1TXU A;  3MHS B;  2V36 A;  4F5S A;  3GQX A;  4ZBR A;  3V08 A;  1E78 A;  1E7I A;  5FUO A;  1E7A A;  4G03 A;  4N3Z A;  4Z69 A;  4PO0 A;  1HK3 A;  2ROH A;  3SIV B;  5BPK A;  1MIY A;  5IJE A;  1BM0 A;  2I30 A;  1H5W A;  2Z8J A;  1MIW A;  1JNB A;  2BXF A;  1FOU A;  3FNM A;  3LU8 A;  3GA9 L;  3FWC C;  1HK1 A;  1UOR A;  4JK4 A;  1GNJ A;  5DQF A;  1HK5 A;  2JUH A;  1GNI A;  5IJ5 A;  2LOQ A;  1O9X A;  4J2V A;  3ICX A;  4W4U B;  5GIO A;  4LUH A;  3WHS A;  3H3A A;  3CX9 A;  5IFO A;  1KXP D;  4ZBK A;  1HK2 A;  2BXI A;  4OTT A;  4ZUX V;  2DBU A;  2Z8I A;  2XSI A;  1BKE A;  3SQJ A;  4C31 B;  3TDL A;  4BY9 C;  4OR0 A;  2KBZ A;  1E7F A;  3PLA A;  1E7E A;  2BXC A;  2AJE A;  4N0F D;  2XVU A;  1J7E A;  2BXN A;  4F5V A;  2VDB A;  2BXO A;  4ZCG A;  4N0U D;  4L9Q A;  5IIU A;  4LB2 A;  2DBX A;  1E7G A;  3LU7 A;  1BJ5 A;  2BXP A;  2BXG A;  3NVK A;  1LOT A;  4K2C A;  4OT2 A;  2BXQ A;  2BXL A;  3A73 A;  4LB9 A;  3B9L A;  1HK4 A;  4HGM B;  2QMC A;  3LU6 A;  2CKX A;  4TQ0 A;  2I2Z A;  2BX8 A;  1AO6 A;  2XVV A;  2E0Y A;  2OZB B;  1E7B A;  3V03 A;  3KIK A;  1VFI A;  2XW1 A;  1HA2 A;  2VUF A;  4M70 B;  4DHX B;  3M99 C;  4F5U A;  2OT3 A;  4LUF A;  2XVW A;  5D7G A;  3VQI A;  5ID7 A;  5IJF A;  2DYM A;  2DG5 A;  2E0X A;  4G01 A;  2EFC A;  3GQU A;  4G04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...