3WHSA

Crystal structure of bacillus subtilis gamma-glutamyltranspeptidase in complex with acivicin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
359
structure length
359
Chain Sequence
EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase
molecule keywords Gamma-glutamyltranspeptidase large chain
publication title Structure of Bacillus subtilis gamma-glutamyl-transpeptidase in complex with acivicin: diversity of the binding mode of a classical and electrophilic active-site-directed glutamate analogue
doi rcsb
source organism Bacillus subtilis
total genus 106
structure length 359
sequence length 359
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3whsA02
3WHQA 3WHRA 2QMCA 3A75A 4OTUA 4ZCGA 2DBUA 5BPKA 2DG5A 2E0XA 4GG2A 2Z8IA 2E0YA 2DBWA 4ZC6A 3FNMA 2NQOA 2DBXA 4OTTA 2V36A 4Z9OA 3WHSA 2Z8KA 4GDXA 4ZBKA 5B5TA 2Z8JA 2QM6A
chains in the Genus database with same CATH superfamily
2EFHA 1E7AA 2BX8A 3WHRA 2OZBB 2XVVA 4OTUA 2I2ZA 2CKXA 3ICXA 3JRYA 4N3ZA 2DYOA 4G03A 3PLAA 1KXPD 3B9MA 4F5SA 3SIUB 2VDBA 2LXSA 1H5WA 1E7BA 5DBYA 4TQ1A 2E0YA 1GNJA 1LOTA 2GUTA 5IIXA 4ZBRA 2V36A 4BY9C 2XMOA 3NVIA 4NAWB 2BXKA 3CX9A 2Z8KA 1TXUA 4L8UA 4ZBKA 2EFCA 4D7XA 2BXFA 5IFOA 5B5TA 1HA2A 1KDXA 4LUFA 3FWCC 5GIPA 2XW0A 4ZBQA 1HK5A 4DM0A 4HGMB 2BXCA 1E7HA 1MA9A 2JUHA 4K71A 4EMXA 2LQIA 4M70B 1SB0A 2BXBA 4ZCGA 4J2VA 1IJGA 2DBUA 3A73A 4E99A 4F5TA 4ZUXV 5BPKA 3V09A 2DG5A 4LA0A 5FUOA 2Z8IA 2XSIA 3V08A 2DBWA 4S1YA 1FOUA 3FNMA 2XVUA 2K0NA 5GHKA 3UIVA 3V03A 3B9LA 2BXLA 1KW2A 4LB2A 2BXOA 4FK5B 2EFEA 1UORA 2QHBA 4OR0A 2NNWA 4GDXA 2BXNA 2BXMA 5IJFA 2Z8JA 4IW1A 3NVMA 2BXIA 2BXPA 3BPJA 1JNBA 1E78A 3KJLA 3ECPA 4FIPB 5D7GA 3MHSB 4F5VA 3VQIA 2VUEA 1TF0A 2QMCA 1LNSA 3A75A 2ROHA 4LUHA 4LB9A 5IJ5A 2XVQA 2BXGA 2EFDA 3SQJA 5IJEA 3FWBC 4L9QA 4GDKB 2XVWA 4TQ0A 4BKEA 2KBZA 4L9KA 1MIVA 3TDLA 1E7IA 4N0UD 2DBXA 4MBEC 3GA9L 3MHHB 1BKEA 4Z69A 1MM8A 2OT3A 5GIOA 4PO0A 1BJ5A 2VUFA 3G9KD 3WHSA 1J78A 1MIYA 4G01A 3W1SA 2BXHA 3H3AA 3GQXA 5DQFA 1J7EA 2QM6A 5IIUA 5ID7A 3NVKA 4HGKA 4OT2A 1E7EA 4W4UB 3GQUA 2BXAA 3WHQA 2LQHA 2LXTA 4DHXB 2XW1A 2BXQA 1E7CA 1NT2B 2DYMA 3LU7A 4K2CA 2AGHB 2BXDA 2LOQA 1HK1A 1N5UA 1E7FA 4WA6B 2E0XA 1HK3A 4GDLB 4GG2A 1E7GA 3H37A 4JK4A 4IW2A 1VFIA 3KIKA 4ZC6A 2NQOA 2BXEA 3JQZA 4OTTA 1HK4A 3LU6A 3LU8A 4C31B 3NMUA 2I30A 2YDFA 4F5UA 4FJCB 4Z9OA 4G04A 1MUSA 1AO6A 1O9XA 5ID9A 1HK2A 1MIWA 4I9OA 5HOZA 3M99C 3SIVB 1H9ZA 1VZSA 4N0FD 1BM0A 5IIHA 2KWFA 2AJEA 1GNIA 5GINA 1MUHA
chains in the Genus database with same CATH topology
2EFHA 1E7AA 2BX8A 3WHRA 2OZBB 2XVVA 4OTUA 2I2ZA 2CKXA 3ICXA 3JRYA 4N3ZA 2DYOA 4G03A 3PLAA 1KXPD 3B9MA 4F5SA 3SIUB 2VDBA 1H5WA 1E7BA 5DBYA 4TQ1A 2E0YA 1GNJA 1LOTA 5IIXA 4ZBRA 2V36A 4BY9C 2XMOA 3NVIA 4NAWB 2BXKA 3CX9A 2Z8KA 1TXUA 4L8UA 4ZBKA 2EFCA 5B5TA 2BXFA 5IFOA 1HA2A 4LUFA 3FWCC 5GIPA 2XW0A 4ZBQA 1HK5A 4HGMB 2BXCA 1E7HA 2JUHA 1MA9A 4K71A 4EMXA 4M70B 2BXBA 4ZCGA 4J2VA 1IJGA 2DBUA 3A73A 4E99A 4F5TA 4ZUXV 5BPKA 3V09A 2DG5A 4LA0A 5FUOA 2Z8IA 2XSIA 3V08A 2DBWA 4S1YA 1FOUA 3FNMA 2XVUA 5GHKA 3V03A 3UIVA 3B9LA 2BXLA 1KW2A 4LB2A 2BXOA 4FK5B 2EFEA 1UORA 2QHBA 4OR0A 2NNWA 4GDXA 2BXNA 2BXMA 5IJFA 2Z8JA 4IW1A 3NVMA 2BXIA 2BXPA 1JNBA 1E78A 3KJLA 4FIPB 5D7GA 3MHSB 4F5VA 3VQIA 2VUEA 1TF0A 2QMCA 1LNSA 3A75A 2ROHA 4LUHA 4LB9A 5IJ5A 2XVQA 2BXGA 2EFDA 3SQJA 5IJEA 3FWBC 4L9QA 4GDKB 2XVWA 4TQ0A 4BKEA 2KBZA 4L9KA 1MIVA 3TDLA 1E7IA 4N0UD 2DBXA 4MBEC 3GA9L 3MHHB 1BKEA 4Z69A 2OT3A 5GIOA 4PO0A 1BJ5A 2VUFA 3G9KD 3WHSA 1J78A 1MIYA 4G01A 3W1SA 2BXHA 3H3AA 3GQXA 5DQFA 1J7EA 2QM6A 5IIUA 5ID7A 3NVKA 4HGKA 4OT2A 1E7EA 4W4UB 3GQUA 2BXAA 3WHQA 4DHXB 2XW1A 2BXQA 1E7CA 1NT2B 2DYMA 3LU7A 4K2CA 2BXDA 2LOQA 1HK1A 1N5UA 1E7FA 4WA6B 2E0XA 1HK3A 4GDLB 4GG2A 1E7GA 3H37A 4JK4A 4IW2A 1VFIA 3KIKA 4ZC6A 2NQOA 2BXEA 3JQZA 4OTTA 1HK4A 3LU6A 3LU8A 4C31B 3NMUA 2I30A 2YDFA 4F5UA 4FJCB 4Z9OA 4G04A 1AO6A 1O9XA 5ID9A 1HK2A 1MIWA 5HOZA 3M99C 3SIVB 1H9ZA 1VZSA 4N0FD 1BM0A 5IIHA 2AJEA 1GNIA 5GINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHQ A;  3WHR A;  2QMC A;  3A75 A;  4OTU A;  4ZCG A;  2DBU A;  5BPK A;  2DG5 A;  2E0X A;  4GG2 A;  2Z8I A;  2E0Y A;  2DBW A;  4ZC6 A;  3FNM A;  2NQO A;  2DBX A;  4OTT A;  2V36 A;  4Z9O A;  3WHS A;  2Z8K A;  4GDX A;  4ZBK A;  5B5T A;  2Z8J A;  2QM6 A; 
#chains in the Genus database with same CATH topology
 2EFH A;  1E7A A;  2BX8 A;  3WHR A;  2OZB B;  2XVV A;  4OTU A;  2I2Z A;  2CKX A;  3ICX A;  3JRY A;  4N3Z A;  2DYO A;  4G03 A;  3PLA A;  1KXP D;  3B9M A;  4F5S A;  3SIU B;  2VDB A;  2LXS A;  1H5W A;  1E7B A;  5DBY A;  4TQ1 A;  2E0Y A;  1GNJ A;  1LOT A;  2GUT A;  5IIX A;  4ZBR A;  2V36 A;  4BY9 C;  2XMO A;  3NVI A;  4NAW B;  2BXK A;  3CX9 A;  2Z8K A;  1TXU A;  4L8U A;  4ZBK A;  2EFC A;  4D7X A;  2BXF A;  5IFO A;  5B5T A;  1HA2 A;  1KDX A;  4LUF A;  3FWC C;  5GIP A;  2XW0 A;  4ZBQ A;  1HK5 A;  4DM0 A;  4HGM B;  2BXC A;  1E7H A;  1MA9 A;  2JUH A;  4K71 A;  4EMX A;  2LQI A;  4M70 B;  1SB0 A;  2BXB A;  4ZCG A;  4J2V A;  1IJG A;  2DBU A;  3A73 A;  4E99 A;  4F5T A;  4ZUX V;  5BPK A;  3V09 A;  2DG5 A;  4LA0 A;  5FUO A;  2Z8I A;  2XSI A;  3V08 A;  2DBW A;  4S1Y A;  1FOU A;  3FNM A;  2XVU A;  2K0N A;  5GHK A;  3UIV A;  3V03 A;  3B9L A;  2BXL A;  1KW2 A;  4LB2 A;  2BXO A;  4FK5 B;  2EFE A;  1UOR A;  2QHB A;  4OR0 A;  2NNW A;  4GDX A;  2BXN A;  2BXM A;  5IJF A;  2Z8J A;  4IW1 A;  3NVM A;  2BXI A;  2BXP A;  3BPJ A;  1JNB A;  1E78 A;  3KJL A;  3ECP A;  4FIP B;  5D7G A;  3MHS B;  4F5V A;  3VQI A;  2VUE A;  1TF0 A;  2QMC A;  1LNS A;  3A75 A;  2ROH A;  4LUH A;  4LB9 A;  5IJ5 A;  2XVQ A;  2BXG A;  2EFD A;  3SQJ A;  5IJE A;  3FWB C;  4L9Q A;  4GDK B;  2XVW A;  4TQ0 A;  4BKE A;  2KBZ A;  4L9K A;  1MIV A;  3TDL A;  1E7I A;  4N0U D;  2DBX A;  4MBE C;  3GA9 L;  3MHH B;  1BKE A;  4Z69 A;  1MM8 A;  2OT3 A;  5GIO A;  4PO0 A;  1BJ5 A;  2VUF A;  3G9K D;  3WHS A;  1J78 A;  1MIY A;  4G01 A;  3W1S A;  2BXH A;  3H3A A;  3GQX A;  5DQF A;  1J7E A;  2QM6 A;  5IIU A;  5ID7 A;  3NVK A;  4HGK A;  4OT2 A;  1E7E A;  4W4U B;  3GQU A;  2BXA A;  3WHQ A;  2LQH A;  2LXT A;  4DHX B;  2XW1 A;  2BXQ A;  1E7C A;  1NT2 B;  2DYM A;  3LU7 A;  4K2C A;  2AGH B;  2BXD A;  2LOQ A;  1HK1 A;  1N5U A;  1E7F A;  4WA6 B;  2E0X A;  1HK3 A;  4GDL B;  4GG2 A;  1E7G A;  3H37 A;  4JK4 A;  4IW2 A;  1VFI A;  3KIK A;  4ZC6 A;  2NQO A;  2BXE A;  3JQZ A;  4OTT A;  1HK4 A;  3LU6 A;  3LU8 A;  4C31 B;  3NMU A;  2I30 A;  2YDF A;  4F5U A;  4FJC B;  4Z9O A;  4G04 A;  1MUS A;  1AO6 A;  1O9X A;  5ID9 A;  1HK2 A;  1MIW A;  4I9O A;  5HOZ A;  3M99 C;  3SIV B;  1H9Z A;  1VZS A;  4N0F D;  1BM0 A;  5IIH A;  2KWF A;  2AJE A;  1GNI A;  5GIN A;  1MUH A; 
#chains in the Genus database with same CATH homology
 2EFH A;  1E7A A;  2BX8 A;  3WHR A;  2OZB B;  2XVV A;  4OTU A;  2I2Z A;  2CKX A;  3ICX A;  3JRY A;  4N3Z A;  2DYO A;  4G03 A;  3PLA A;  1KXP D;  3B9M A;  4F5S A;  3SIU B;  2VDB A;  1H5W A;  1E7B A;  5DBY A;  4TQ1 A;  2E0Y A;  1GNJ A;  1LOT A;  5IIX A;  4ZBR A;  2V36 A;  4BY9 C;  2XMO A;  3NVI A;  4NAW B;  2BXK A;  3CX9 A;  2Z8K A;  1TXU A;  4L8U A;  4ZBK A;  2EFC A;  5B5T A;  2BXF A;  5IFO A;  1HA2 A;  4LUF A;  3FWC C;  5GIP A;  2XW0 A;  4ZBQ A;  1HK5 A;  4HGM B;  2BXC A;  1E7H A;  2JUH A;  1MA9 A;  4K71 A;  4EMX A;  4M70 B;  2BXB A;  4ZCG A;  4J2V A;  1IJG A;  2DBU A;  3A73 A;  4E99 A;  4F5T A;  4ZUX V;  5BPK A;  3V09 A;  2DG5 A;  4LA0 A;  5FUO A;  2Z8I A;  2XSI A;  3V08 A;  2DBW A;  4S1Y A;  1FOU A;  3FNM A;  2XVU A;  5GHK A;  3V03 A;  3UIV A;  3B9L A;  2BXL A;  1KW2 A;  4LB2 A;  2BXO A;  4FK5 B;  2EFE A;  1UOR A;  2QHB A;  4OR0 A;  2NNW A;  4GDX A;  2BXN A;  2BXM A;  5IJF A;  2Z8J A;  4IW1 A;  3NVM A;  2BXI A;  2BXP A;  1JNB A;  1E78 A;  3KJL A;  4FIP B;  5D7G A;  3MHS B;  4F5V A;  3VQI A;  2VUE A;  1TF0 A;  2QMC A;  1LNS A;  3A75 A;  2ROH A;  4LUH A;  4LB9 A;  5IJ5 A;  2XVQ A;  2BXG A;  2EFD A;  3SQJ A;  5IJE A;  3FWB C;  4L9Q A;  4GDK B;  2XVW A;  4TQ0 A;  4BKE A;  2KBZ A;  4L9K A;  1MIV A;  3TDL A;  1E7I A;  4N0U D;  2DBX A;  4MBE C;  3GA9 L;  3MHH B;  1BKE A;  4Z69 A;  2OT3 A;  5GIO A;  4PO0 A;  1BJ5 A;  2VUF A;  3G9K D;  3WHS A;  1J78 A;  1MIY A;  4G01 A;  3W1S A;  2BXH A;  3H3A A;  3GQX A;  5DQF A;  1J7E A;  2QM6 A;  5IIU A;  5ID7 A;  3NVK A;  4HGK A;  4OT2 A;  1E7E A;  4W4U B;  3GQU A;  2BXA A;  3WHQ A;  4DHX B;  2XW1 A;  2BXQ A;  1E7C A;  1NT2 B;  2DYM A;  3LU7 A;  4K2C A;  2BXD A;  2LOQ A;  1HK1 A;  1N5U A;  1E7F A;  4WA6 B;  2E0X A;  1HK3 A;  4GDL B;  4GG2 A;  1E7G A;  3H37 A;  4JK4 A;  4IW2 A;  1VFI A;  3KIK A;  4ZC6 A;  2NQO A;  2BXE A;  3JQZ A;  4OTT A;  1HK4 A;  3LU6 A;  3LU8 A;  4C31 B;  3NMU A;  2I30 A;  2YDF A;  4F5U A;  4FJC B;  4Z9O A;  4G04 A;  1AO6 A;  1O9X A;  5ID9 A;  1HK2 A;  1MIW A;  5HOZ A;  3M99 C;  3SIV B;  1H9Z A;  1VZS A;  4N0F D;  1BM0 A;  5IIH A;  2AJE A;  1GNI A;  5GIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...