4C31B

Nup1:sac3:sus1 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
DTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords NUCLEAR MRNA EXPORT PROTEIN SAC3
publication title Structural Basis for Binding the Trex2 Complex to Nuclear Pores, Gal1 Localisation and Mrna Export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 92
sequence length 92
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4c31B00
3M99C 3KJLA 4W4UB 4FJCB 4C31B 4FIPB 4MBEC 3FWCC 4DHXB 3MHHB 3MHSB 4FK5B 4WA6B 4ZUXV 3FWBC 3KIKA
chains in the Genus database with same CATH superfamily
1E7HA 1HA2A 1LNSA 2DBXA 3KJLA 3SIUB 1KW2A 1E7EA 4ZBQA 3CX9A 3LU8A 4HGMB 1UORA 4G03A 2XW0A 4K71A 3TDLA 4N0FD 5GHKA 2BXLA 2DYMA 1TXUA 2BXDA 2LXTA 3H37A 2BXBA 4C31B 2EFEA 4GDLB 3B9MA 4ZCGA 2YDFA 2QMCA 5D7GA 2OT3A 4Z9OA 2KBZA 2BXMA 5ID9A 5IJEA 2NQOA 4HGKA 4FJCB 1TF0A 3FWCC 4I9OA 4LA0A 4F5SA 1BKEA 1E7FA 3M99C 2EFCA 4K2CA 2Z8IA 4ZBKA 2JUHA 5IJFA 3UIVA 5ID7A 1FOUA 2BXOA 2LQIA 2LXSA 2V36A 2XVQA 3GQXA 3NVIA 3GA9L 3SQJA 3ICXA 4GDXA 4DHXB 3G9KD 2XSIA 4G01A 3WHRA 1E7AA 4M70B 1HK5A 1IJGA 4NAWB 3A75A 5DQFA 1MIYA 3KIKA 1HK3A 1LOTA 3WHQA 2BXIA 3V03A 5IIUA 2EFDA 3BPJA 4MBEC 5IIXA 4LB2A 2ROHA 2GUTA 1BM0A 3W1SA 4F5TA 1MM8A 2DBUA 1H5WA 1MA9A 4E99A 2I2ZA 4S1YA 3V08A 2I30A 5GIPA 2AGHB 4WA6B 5IIHA 1SB0A 3FWBC 2QM6A 5HOZA 4IW2A 4D7XA 4ZC6A 4W4UB 2XW1A 2BXFA 3JRYA 5B5TA 3LU6A 2KWFA 1MIWA 1VFIA 2BXNA 2Z8KA 2CKXA 4L9KA 4LUFA 4EMXA 1H9ZA 2DBWA 4N0UD 2DG5A 3H3AA 2BXPA 2XVVA 1MUSA 2VDBA 2LQHA 1E7BA 1HK4A 2AJEA 2E0XA 2K0NA 1MIVA 2EFHA 4L8UA 1N5UA 3MHSB 1J7EA 4PO0A 2XMOA 4LUHA 2BX8A 2BXQA 2BXHA 4JK4A 4GG2A 5BPKA 1VZSA 1BJ5A 4FIPB 3FNMA 4FK5B 4GDKB 1HK1A 4TQ0A 2BXAA 4N3ZA 4ZBRA 3A73A 4IW1A 3V09A 1J78A 3VQIA 4BY9C 3NVKA 1E7CA 2E0YA 5GINA 5GIOA 3WHSA 3PLAA 1KDXA 4ZUXV 1NT2B 4G04A 5DBYA 4BKEA 2BXKA 4L9QA 3SIVB 4F5VA 4Z69A 1MUHA 3ECPA 1E7GA 1HK2A 1O9XA 1E78A 2BXEA 1AO6A 5IJ5A 3NVMA 1GNJA 2BXGA 1GNIA 4OR0A 4TQ1A 5IFOA 1E7IA 4F5UA 4J2VA 3NMUA 2XVWA 3GQUA 1JNBA 1KXPD 2DYOA 2XVUA 4OTUA 5FUOA 4DM0A 2NNWA 3JQZA 4OTTA 4LB9A 2BXCA 2VUEA 3MHHB 2QHBA 3B9LA 2LOQA 2OZBB 4OT2A 2VUFA 3LU7A 2Z8JA
chains in the Genus database with same CATH topology
1E7HA 1HA2A 1LNSA 2DBXA 3KJLA 3SIUB 1KW2A 1E7EA 4ZBQA 3CX9A 3LU8A 4HGMB 1UORA 4G03A 2XW0A 4K71A 3TDLA 4N0FD 5GHKA 2BXLA 2DYMA 1TXUA 2BXDA 3H37A 2BXBA 4C31B 2EFEA 4GDLB 3B9MA 4ZCGA 2YDFA 2QMCA 5D7GA 2OT3A 4Z9OA 2KBZA 2BXMA 5ID9A 5IJEA 2NQOA 4HGKA 4FJCB 1TF0A 3FWCC 4F5SA 4LA0A 1BKEA 1E7FA 3M99C 2EFCA 4K2CA 2Z8IA 4ZBKA 2JUHA 5IJFA 3UIVA 5ID7A 1FOUA 2BXOA 2V36A 2XVQA 3GQXA 3NVIA 3GA9L 3SQJA 3ICXA 4GDXA 4DHXB 3G9KD 2XSIA 4G01A 3WHRA 1E7AA 4M70B 1HK5A 1IJGA 4NAWB 3A75A 5DQFA 1MIYA 3KIKA 1HK3A 1LOTA 3WHQA 2BXIA 3V03A 5IIUA 2EFDA 4MBEC 5IIXA 4LB2A 2ROHA 1BM0A 3W1SA 4F5TA 2DBUA 1H5WA 1MA9A 4E99A 2I2ZA 4S1YA 3V08A 2I30A 5GIPA 5IIHA 4WA6B 3FWBC 2QM6A 5HOZA 4IW2A 4ZC6A 4W4UB 2XW1A 2BXFA 3JRYA 5B5TA 3LU6A 1MIWA 1VFIA 2BXNA 2Z8KA 2CKXA 4L9KA 4LUFA 4EMXA 1H9ZA 2DBWA 4N0UD 2DG5A 3H3AA 2BXPA 2XVVA 2VDBA 1E7BA 1HK4A 2AJEA 2E0XA 1MIVA 2EFHA 4L8UA 1N5UA 3MHSB 1J7EA 4PO0A 2XMOA 4LUHA 2BX8A 2BXQA 2BXHA 4JK4A 4GG2A 5BPKA 1VZSA 1BJ5A 4FIPB 3FNMA 4FK5B 4GDKB 1HK1A 4TQ0A 2BXAA 4N3ZA 4ZBRA 3A73A 4IW1A 3V09A 1J78A 3VQIA 4BY9C 3NVKA 1E7CA 2E0YA 5GINA 5GIOA 3WHSA 3PLAA 4ZUXV 1NT2B 4G04A 5DBYA 4BKEA 2BXKA 4L9QA 3SIVB 4F5VA 4Z69A 1E7GA 1HK2A 1O9XA 1E78A 2BXEA 1AO6A 5IJ5A 3NVMA 1GNJA 2BXGA 1GNIA 4OR0A 4TQ1A 5IFOA 1E7IA 4F5UA 4J2VA 3NMUA 2XVWA 3GQUA 1JNBA 1KXPD 2DYOA 2XVUA 4OTUA 5FUOA 2NNWA 3JQZA 4OTTA 4LB9A 2BXCA 2VUEA 3MHHB 2QHBA 3B9LA 2LOQA 2OZBB 4OT2A 2VUFA 3LU7A 2Z8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 C;  3KJL A;  4W4U B;  4FJC B;  4C31 B;  4FIP B;  4MBE C;  3FWC C;  4DHX B;  3MHH B;  3MHS B;  4FK5 B;  4WA6 B;  4ZUX V;  3FWB C;  3KIK A; 
#chains in the Genus database with same CATH topology
 1E7H A;  1HA2 A;  1LNS A;  2DBX A;  3KJL A;  3SIU B;  1KW2 A;  1E7E A;  4ZBQ A;  3CX9 A;  3LU8 A;  4HGM B;  1UOR A;  4G03 A;  2XW0 A;  4K71 A;  3TDL A;  4N0F D;  5GHK A;  2BXL A;  2DYM A;  1TXU A;  2BXD A;  2LXT A;  3H37 A;  2BXB A;  4C31 B;  2EFE A;  4GDL B;  3B9M A;  4ZCG A;  2YDF A;  2QMC A;  5D7G A;  2OT3 A;  4Z9O A;  2KBZ A;  2BXM A;  5ID9 A;  5IJE A;  2NQO A;  4HGK A;  4FJC B;  1TF0 A;  3FWC C;  4I9O A;  4LA0 A;  4F5S A;  1BKE A;  1E7F A;  3M99 C;  2EFC A;  4K2C A;  2Z8I A;  4ZBK A;  2JUH A;  5IJF A;  3UIV A;  5ID7 A;  1FOU A;  2BXO A;  2LQI A;  2LXS A;  2V36 A;  2XVQ A;  3GQX A;  3NVI A;  3GA9 L;  3SQJ A;  3ICX A;  4GDX A;  4DHX B;  3G9K D;  2XSI A;  4G01 A;  3WHR A;  1E7A A;  4M70 B;  1HK5 A;  1IJG A;  4NAW B;  3A75 A;  5DQF A;  1MIY A;  3KIK A;  1HK3 A;  1LOT A;  3WHQ A;  2BXI A;  3V03 A;  5IIU A;  2EFD A;  3BPJ A;  4MBE C;  5IIX A;  4LB2 A;  2ROH A;  2GUT A;  1BM0 A;  3W1S A;  4F5T A;  1MM8 A;  2DBU A;  1H5W A;  1MA9 A;  4E99 A;  2I2Z A;  4S1Y A;  3V08 A;  2I30 A;  5GIP A;  2AGH B;  4WA6 B;  5IIH A;  1SB0 A;  3FWB C;  2QM6 A;  5HOZ A;  4IW2 A;  4D7X A;  4ZC6 A;  4W4U B;  2XW1 A;  2BXF A;  3JRY A;  5B5T A;  3LU6 A;  2KWF A;  1MIW A;  1VFI A;  2BXN A;  2Z8K A;  2CKX A;  4L9K A;  4LUF A;  4EMX A;  1H9Z A;  2DBW A;  4N0U D;  2DG5 A;  3H3A A;  2BXP A;  2XVV A;  1MUS A;  2VDB A;  2LQH A;  1E7B A;  1HK4 A;  2AJE A;  2E0X A;  2K0N A;  1MIV A;  2EFH A;  4L8U A;  1N5U A;  3MHS B;  1J7E A;  4PO0 A;  2XMO A;  4LUH A;  2BX8 A;  2BXQ A;  2BXH A;  4JK4 A;  4GG2 A;  5BPK A;  1VZS A;  1BJ5 A;  4FIP B;  3FNM A;  4FK5 B;  4GDK B;  1HK1 A;  4TQ0 A;  2BXA A;  4N3Z A;  4ZBR A;  3A73 A;  4IW1 A;  3V09 A;  1J78 A;  3VQI A;  4BY9 C;  3NVK A;  1E7C A;  2E0Y A;  5GIN A;  5GIO A;  3WHS A;  3PLA A;  1KDX A;  4ZUX V;  1NT2 B;  4G04 A;  5DBY A;  4BKE A;  2BXK A;  4L9Q A;  3SIV B;  4F5V A;  4Z69 A;  1MUH A;  3ECP A;  1E7G A;  1HK2 A;  1O9X A;  1E78 A;  2BXE A;  1AO6 A;  5IJ5 A;  3NVM A;  1GNJ A;  2BXG A;  1GNI A;  4OR0 A;  4TQ1 A;  5IFO A;  1E7I A;  4F5U A;  4J2V A;  3NMU A;  2XVW A;  3GQU A;  1JNB A;  1KXP D;  2DYO A;  2XVU A;  4OTU A;  5FUO A;  4DM0 A;  2NNW A;  3JQZ A;  4OTT A;  4LB9 A;  2BXC A;  2VUE A;  3MHH B;  2QHB A;  3B9L A;  2LOQ A;  2OZB B;  4OT2 A;  2VUF A;  3LU7 A;  2Z8J A; 
#chains in the Genus database with same CATH homology
 1E7H A;  1HA2 A;  1LNS A;  2DBX A;  3KJL A;  3SIU B;  1KW2 A;  1E7E A;  4ZBQ A;  3CX9 A;  3LU8 A;  4HGM B;  1UOR A;  4G03 A;  2XW0 A;  4K71 A;  3TDL A;  4N0F D;  5GHK A;  2BXL A;  2DYM A;  1TXU A;  2BXD A;  3H37 A;  2BXB A;  4C31 B;  2EFE A;  4GDL B;  3B9M A;  4ZCG A;  2YDF A;  2QMC A;  5D7G A;  2OT3 A;  4Z9O A;  2KBZ A;  2BXM A;  5ID9 A;  5IJE A;  2NQO A;  4HGK A;  4FJC B;  1TF0 A;  3FWC C;  4F5S A;  4LA0 A;  1BKE A;  1E7F A;  3M99 C;  2EFC A;  4K2C A;  2Z8I A;  4ZBK A;  2JUH A;  5IJF A;  3UIV A;  5ID7 A;  1FOU A;  2BXO A;  2V36 A;  2XVQ A;  3GQX A;  3NVI A;  3GA9 L;  3SQJ A;  3ICX A;  4GDX A;  4DHX B;  3G9K D;  2XSI A;  4G01 A;  3WHR A;  1E7A A;  4M70 B;  1HK5 A;  1IJG A;  4NAW B;  3A75 A;  5DQF A;  1MIY A;  3KIK A;  1HK3 A;  1LOT A;  3WHQ A;  2BXI A;  3V03 A;  5IIU A;  2EFD A;  4MBE C;  5IIX A;  4LB2 A;  2ROH A;  1BM0 A;  3W1S A;  4F5T A;  2DBU A;  1H5W A;  1MA9 A;  4E99 A;  2I2Z A;  4S1Y A;  3V08 A;  2I30 A;  5GIP A;  5IIH A;  4WA6 B;  3FWB C;  2QM6 A;  5HOZ A;  4IW2 A;  4ZC6 A;  4W4U B;  2XW1 A;  2BXF A;  3JRY A;  5B5T A;  3LU6 A;  1MIW A;  1VFI A;  2BXN A;  2Z8K A;  2CKX A;  4L9K A;  4LUF A;  4EMX A;  1H9Z A;  2DBW A;  4N0U D;  2DG5 A;  3H3A A;  2BXP A;  2XVV A;  2VDB A;  1E7B A;  1HK4 A;  2AJE A;  2E0X A;  1MIV A;  2EFH A;  4L8U A;  1N5U A;  3MHS B;  1J7E A;  4PO0 A;  2XMO A;  4LUH A;  2BX8 A;  2BXQ A;  2BXH A;  4JK4 A;  4GG2 A;  5BPK A;  1VZS A;  1BJ5 A;  4FIP B;  3FNM A;  4FK5 B;  4GDK B;  1HK1 A;  4TQ0 A;  2BXA A;  4N3Z A;  4ZBR A;  3A73 A;  4IW1 A;  3V09 A;  1J78 A;  3VQI A;  4BY9 C;  3NVK A;  1E7C A;  2E0Y A;  5GIN A;  5GIO A;  3WHS A;  3PLA A;  4ZUX V;  1NT2 B;  4G04 A;  5DBY A;  4BKE A;  2BXK A;  4L9Q A;  3SIV B;  4F5V A;  4Z69 A;  1E7G A;  1HK2 A;  1O9X A;  1E78 A;  2BXE A;  1AO6 A;  5IJ5 A;  3NVM A;  1GNJ A;  2BXG A;  1GNI A;  4OR0 A;  4TQ1 A;  5IFO A;  1E7I A;  4F5U A;  4J2V A;  3NMU A;  2XVW A;  3GQU A;  1JNB A;  1KXP D;  2DYO A;  2XVU A;  4OTU A;  5FUO A;  2NNW A;  3JQZ A;  4OTT A;  4LB9 A;  2BXC A;  2VUE A;  3MHH B;  2QHB A;  3B9L A;  2LOQ A;  2OZB B;  4OT2 A;  2VUF A;  3LU7 A;  2Z8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...