4DHXB

Eny2:ganp complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
DAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/dna binding protein
molecule keywords 80 kDa MCM3-associated protein
publication title Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 91
sequence length 91
chains with identical sequence C, E, F
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4dhxB00
4FJCB 4MBEC 4FK5B 3FWCC 4W4UB 4WA6B 3KIKA 3M99C 4DHXB 3MHSB 4C31B 3KJLA 4ZUXV 4FIPB 3MHHB 3FWBC
chains in the Genus database with same CATH superfamily
4FJCB 1E7CA 1MIVA 2LOQA 2K0NA 2BXDA 2BXHA 4D7XA 1MA9A 4OTTA 2BXQA 4GDXA 4EMXA 2BXEA 3GQXA 1HK3A 3MHSB 1HK2A 4LB2A 4N0UD 3V08A 3W1SA 4C31B 4FK5B 4M70B 2DG5A 1VZSA 1E78A 1E7EA 2DBWA 4F5SA 1HK1A 4LB9A 5B5TA 3H37A 4IW1A 4GDLB 4L8UA 3MHHB 2BX8A 2XVWA 2I2ZA 3JRYA 2XW1A 4TQ1A 4NAWB 4PO0A 1KXPD 2DYMA 4WA6B 3SQJA 1LNSA 2LQHA 1E7BA 1N5UA 2XVVA 4OR0A 4TQ0A 2BXMA 1E7FA 2Z8IA 1IJGA 1J78A 4W4UB 2E0XA 5IFOA 3WHSA 4DM0A 1AO6A 3FNMA 4GG2A 1E7GA 5GIOA 4L9KA 2OZBB 2BXKA 1SB0A 1MUHA 3V09A 1H9ZA 1BKEA 5DBYA 1UORA 3M99C 4OTUA 5ID9A 3GQUA 3NVIA 2XVUA 3GA9L 2EFHA 5GINA 2QM6A 3SIUB 2I30A 4HGKA 4ZBKA 2YDFA 4F5VA 2KWFA 1MM8A 1NT2B 5HOZA 5ID7A 1MIYA 3JQZA 3LU6A 3V03A 3TDLA 2V36A 2QMCA 2BXFA 4MBEC 2QHBA 1E7AA 3H3AA 3WHRA 4ZBQA 4ZBRA 4ZCGA 1MIWA 2VUEA 2DBXA 5IIXA 2BXPA 2BXIA 2JUHA 4L9QA 4ZC6A 2NQOA 2BXGA 2XW0A 5IIUA 5GHKA 5GIPA 2GUTA 2LXTA 5FUOA 3WHQA 2BXAA 1BJ5A 1TXUA 2BXNA 2Z8JA 3BPJA 2BXBA 3B9MA 4J2VA 4OT2A 2Z8KA 3A73A 3KJLA 4G01A 2XVQA 4LA0A 4Z9OA 2E0YA 4E99A 4F5TA 4N0FD 4Z69A 2VDBA 5BPKA 3LU8A 5DQFA 2VUFA 5IJ5A 5IJEA 2BXLA 1GNIA 1MUSA 1GNJA 3VQIA 1LOTA 2AGHB 3FWBC 4K71A 1H5WA 4G04A 4LUFA 3FWCC 4HGMB 3B9LA 4G03A 3G9KD 3A75A 2DBUA 4K2CA 2LXSA 2LQIA 1E7HA 1BM0A 3NVMA 5IJFA 1JNBA 4BKEA 1TF0A 4LUHA 2CKXA 1HA2A 4IW2A 2ROHA 4JK4A 2EFDA 1HK5A 2BXCA 2XSIA 2EFCA 3KIKA 1VFIA 5D7GA 1O9XA 1KW2A 1HK4A 3NVKA 1E7IA 2XMOA 4FIPB 2BXOA 2OT3A 1KDXA 5IIHA 4S1YA 3ECPA 2AJEA 2DYOA 3SIVB 1J7EA 2EFEA 1FOUA 4I9OA 4DHXB 4F5UA 3LU7A 3PLAA 4N3ZA 3UIVA 4BY9C 2KBZA 3CX9A 4ZUXV 3NMUA 3ICXA 2NNWA 4GDKB
chains in the Genus database with same CATH topology
4FJCB 1E7CA 1MIVA 2LOQA 2BXDA 2BXHA 1MA9A 4OTTA 2BXQA 4GDXA 4EMXA 2BXEA 3GQXA 1HK3A 3MHSB 1HK2A 4LB2A 4N0UD 3V08A 3W1SA 4C31B 4FK5B 4M70B 2DG5A 1VZSA 1E78A 1E7EA 2DBWA 4F5SA 1HK1A 4LB9A 5B5TA 3H37A 4IW1A 4GDLB 4L8UA 3MHHB 2BX8A 2XVWA 2I2ZA 3JRYA 2XW1A 4TQ1A 4NAWB 4PO0A 1KXPD 2DYMA 4WA6B 3SQJA 1LNSA 1E7BA 1N5UA 2XVVA 4OR0A 4TQ0A 2BXMA 1E7FA 2Z8IA 1IJGA 1J78A 4W4UB 2E0XA 5IFOA 3WHSA 1AO6A 3FNMA 4GG2A 1E7GA 5GIOA 4L9KA 2OZBB 2BXKA 3V09A 1H9ZA 1BKEA 5DBYA 1UORA 3M99C 4OTUA 5ID9A 3GQUA 3NVIA 2XVUA 3GA9L 2EFHA 5GINA 2QM6A 3SIUB 2I30A 4HGKA 4ZBKA 2YDFA 4F5VA 1NT2B 5HOZA 5ID7A 1MIYA 3JQZA 3LU6A 3V03A 3TDLA 2V36A 2QMCA 2BXFA 4MBEC 2QHBA 1E7AA 3H3AA 3WHRA 4ZBQA 4ZBRA 4ZCGA 1MIWA 2VUEA 2DBXA 5IIXA 2BXPA 2BXIA 2JUHA 4L9QA 4ZC6A 2NQOA 2BXGA 2XW0A 5IIUA 5GHKA 5GIPA 5FUOA 3WHQA 2BXAA 1BJ5A 1TXUA 2BXNA 2Z8JA 4OT2A 2BXBA 3B9MA 4J2VA 2Z8KA 3A73A 3KJLA 4G01A 2XVQA 4LA0A 4Z9OA 2E0YA 4E99A 4F5TA 4N0FD 4Z69A 2VDBA 5BPKA 3LU8A 5DQFA 2VUFA 5IJ5A 5IJEA 2BXLA 1GNIA 1GNJA 3VQIA 1LOTA 3FWBC 4K71A 1H5WA 4G04A 4LUFA 3FWCC 4HGMB 3B9LA 4G03A 3G9KD 3A75A 2DBUA 4K2CA 1E7HA 1BM0A 3NVMA 5IJFA 1JNBA 4BKEA 1TF0A 4LUHA 2CKXA 1HA2A 4IW2A 2ROHA 4JK4A 2EFDA 1HK5A 2BXCA 2XSIA 2EFCA 3KIKA 1VFIA 5D7GA 1O9XA 1KW2A 1HK4A 3NVKA 1E7IA 2XMOA 4FIPB 2BXOA 2OT3A 5IIHA 4S1YA 2AJEA 2DYOA 3SIVB 1J7EA 2EFEA 1FOUA 4DHXB 4F5UA 3LU7A 3PLAA 4N3ZA 3UIVA 4BY9C 2KBZA 3CX9A 4ZUXV 3NMUA 3ICXA 2NNWA 4GDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJC B;  4MBE C;  4FK5 B;  3FWC C;  4W4U B;  4WA6 B;  3KIK A;  3M99 C;  4DHX B;  3MHS B;  4C31 B;  3KJL A;  4ZUX V;  4FIP B;  3MHH B;  3FWB C; 
#chains in the Genus database with same CATH topology
 4FJC B;  1E7C A;  1MIV A;  2LOQ A;  2K0N A;  2BXD A;  2BXH A;  4D7X A;  1MA9 A;  4OTT A;  2BXQ A;  4GDX A;  4EMX A;  2BXE A;  3GQX A;  1HK3 A;  3MHS B;  1HK2 A;  4LB2 A;  4N0U D;  3V08 A;  3W1S A;  4C31 B;  4FK5 B;  4M70 B;  2DG5 A;  1VZS A;  1E78 A;  1E7E A;  2DBW A;  4F5S A;  1HK1 A;  4LB9 A;  5B5T A;  3H37 A;  4IW1 A;  4GDL B;  4L8U A;  3MHH B;  2BX8 A;  2XVW A;  2I2Z A;  3JRY A;  2XW1 A;  4TQ1 A;  4NAW B;  4PO0 A;  1KXP D;  2DYM A;  4WA6 B;  3SQJ A;  1LNS A;  2LQH A;  1E7B A;  1N5U A;  2XVV A;  4OR0 A;  4TQ0 A;  2BXM A;  1E7F A;  2Z8I A;  1IJG A;  1J78 A;  4W4U B;  2E0X A;  5IFO A;  3WHS A;  4DM0 A;  1AO6 A;  3FNM A;  4GG2 A;  1E7G A;  5GIO A;  4L9K A;  2OZB B;  2BXK A;  1SB0 A;  1MUH A;  3V09 A;  1H9Z A;  1BKE A;  5DBY A;  1UOR A;  3M99 C;  4OTU A;  5ID9 A;  3GQU A;  3NVI A;  2XVU A;  3GA9 L;  2EFH A;  5GIN A;  2QM6 A;  3SIU B;  2I30 A;  4HGK A;  4ZBK A;  2YDF A;  4F5V A;  2KWF A;  1MM8 A;  1NT2 B;  5HOZ A;  5ID7 A;  1MIY A;  3JQZ A;  3LU6 A;  3V03 A;  3TDL A;  2V36 A;  2QMC A;  2BXF A;  4MBE C;  2QHB A;  1E7A A;  3H3A A;  3WHR A;  4ZBQ A;  4ZBR A;  4ZCG A;  1MIW A;  2VUE A;  2DBX A;  5IIX A;  2BXP A;  2BXI A;  2JUH A;  4L9Q A;  4ZC6 A;  2NQO A;  2BXG A;  2XW0 A;  5IIU A;  5GHK A;  5GIP A;  2GUT A;  2LXT A;  5FUO A;  3WHQ A;  2BXA A;  1BJ5 A;  1TXU A;  2BXN A;  2Z8J A;  3BPJ A;  2BXB A;  3B9M A;  4J2V A;  4OT2 A;  2Z8K A;  3A73 A;  3KJL A;  4G01 A;  2XVQ A;  4LA0 A;  4Z9O A;  2E0Y A;  4E99 A;  4F5T A;  4N0F D;  4Z69 A;  2VDB A;  5BPK A;  3LU8 A;  5DQF A;  2VUF A;  5IJ5 A;  5IJE A;  2BXL A;  1GNI A;  1MUS A;  1GNJ A;  3VQI A;  1LOT A;  2AGH B;  3FWB C;  4K71 A;  1H5W A;  4G04 A;  4LUF A;  3FWC C;  4HGM B;  3B9L A;  4G03 A;  3G9K D;  3A75 A;  2DBU A;  4K2C A;  2LXS A;  2LQI A;  1E7H A;  1BM0 A;  3NVM A;  5IJF A;  1JNB A;  4BKE A;  1TF0 A;  4LUH A;  2CKX A;  1HA2 A;  4IW2 A;  2ROH A;  4JK4 A;  2EFD A;  1HK5 A;  2BXC A;  2XSI A;  2EFC A;  3KIK A;  1VFI A;  5D7G A;  1O9X A;  1KW2 A;  1HK4 A;  3NVK A;  1E7I A;  2XMO A;  4FIP B;  2BXO A;  2OT3 A;  1KDX A;  5IIH A;  4S1Y A;  3ECP A;  2AJE A;  2DYO A;  3SIV B;  1J7E A;  2EFE A;  1FOU A;  4I9O A;  4DHX B;  4F5U A;  3LU7 A;  3PLA A;  4N3Z A;  3UIV A;  4BY9 C;  2KBZ A;  3CX9 A;  4ZUX V;  3NMU A;  3ICX A;  2NNW A;  4GDK B; 
#chains in the Genus database with same CATH homology
 4FJC B;  1E7C A;  1MIV A;  2LOQ A;  2BXD A;  2BXH A;  1MA9 A;  4OTT A;  2BXQ A;  4GDX A;  4EMX A;  2BXE A;  3GQX A;  1HK3 A;  3MHS B;  1HK2 A;  4LB2 A;  4N0U D;  3V08 A;  3W1S A;  4C31 B;  4FK5 B;  4M70 B;  2DG5 A;  1VZS A;  1E78 A;  1E7E A;  2DBW A;  4F5S A;  1HK1 A;  4LB9 A;  5B5T A;  3H37 A;  4IW1 A;  4GDL B;  4L8U A;  3MHH B;  2BX8 A;  2XVW A;  2I2Z A;  3JRY A;  2XW1 A;  4TQ1 A;  4NAW B;  4PO0 A;  1KXP D;  2DYM A;  4WA6 B;  3SQJ A;  1LNS A;  1E7B A;  1N5U A;  2XVV A;  4OR0 A;  4TQ0 A;  2BXM A;  1E7F A;  2Z8I A;  1IJG A;  1J78 A;  4W4U B;  2E0X A;  5IFO A;  3WHS A;  1AO6 A;  3FNM A;  4GG2 A;  1E7G A;  5GIO A;  4L9K A;  2OZB B;  2BXK A;  3V09 A;  1H9Z A;  1BKE A;  5DBY A;  1UOR A;  3M99 C;  4OTU A;  5ID9 A;  3GQU A;  3NVI A;  2XVU A;  3GA9 L;  2EFH A;  5GIN A;  2QM6 A;  3SIU B;  2I30 A;  4HGK A;  4ZBK A;  2YDF A;  4F5V A;  1NT2 B;  5HOZ A;  5ID7 A;  1MIY A;  3JQZ A;  3LU6 A;  3V03 A;  3TDL A;  2V36 A;  2QMC A;  2BXF A;  4MBE C;  2QHB A;  1E7A A;  3H3A A;  3WHR A;  4ZBQ A;  4ZBR A;  4ZCG A;  1MIW A;  2VUE A;  2DBX A;  5IIX A;  2BXP A;  2BXI A;  2JUH A;  4L9Q A;  4ZC6 A;  2NQO A;  2BXG A;  2XW0 A;  5IIU A;  5GHK A;  5GIP A;  5FUO A;  3WHQ A;  2BXA A;  1BJ5 A;  1TXU A;  2BXN A;  2Z8J A;  4OT2 A;  2BXB A;  3B9M A;  4J2V A;  2Z8K A;  3A73 A;  3KJL A;  4G01 A;  2XVQ A;  4LA0 A;  4Z9O A;  2E0Y A;  4E99 A;  4F5T A;  4N0F D;  4Z69 A;  2VDB A;  5BPK A;  3LU8 A;  5DQF A;  2VUF A;  5IJ5 A;  5IJE A;  2BXL A;  1GNI A;  1GNJ A;  3VQI A;  1LOT A;  3FWB C;  4K71 A;  1H5W A;  4G04 A;  4LUF A;  3FWC C;  4HGM B;  3B9L A;  4G03 A;  3G9K D;  3A75 A;  2DBU A;  4K2C A;  1E7H A;  1BM0 A;  3NVM A;  5IJF A;  1JNB A;  4BKE A;  1TF0 A;  4LUH A;  2CKX A;  1HA2 A;  4IW2 A;  2ROH A;  4JK4 A;  2EFD A;  1HK5 A;  2BXC A;  2XSI A;  2EFC A;  3KIK A;  1VFI A;  5D7G A;  1O9X A;  1KW2 A;  1HK4 A;  3NVK A;  1E7I A;  2XMO A;  4FIP B;  2BXO A;  2OT3 A;  5IIH A;  4S1Y A;  2AJE A;  2DYO A;  3SIV B;  1J7E A;  2EFE A;  1FOU A;  4DHX B;  4F5U A;  3LU7 A;  3PLA A;  4N3Z A;  3UIV A;  4BY9 C;  2KBZ A;  3CX9 A;  4ZUX V;  3NMU A;  3ICX A;  2NNW A;  4GDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...