4I9OA

Crystal structure of gackix l664c tethered to 1-10
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
RKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKECE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ordering a dynamic protein via a small-molecule stabilizer.
pubmed doi rcsb
molecule keywords CREB-binding protein
molecule tags Transferase
source organism Mus musculus
total genus 25
structure length 78
sequence length 78
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02172 KIX KIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.20 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Coactivator CBP, KIX domain 4i9oA00
2LXSA 2AGHB 2LXTA 2GUTA 4D7XA 2LQHA 2KWFA 4I9OA 2K0NA 1SB0A 1KDXA 2LQIA
chains in the Genus database with same CATH superfamily
1E7IA 2YDFA 3GQUA 1MA9A 4LB9A 4JK4A 3NVIA 3MHSB 5IIXA 1BJ5A 1MUSA 1BKEA 3B9MA 2EFHA 2BXDA 2LQIA 1NT2B 2BXQA 1MM8A 2EFEA 3SIVB 2V36A 4DM0A 4BY9C 2KBZA 1E7HA 1TXUA 3MHHB 4OTTA 1E7FA 2VUEA 4HGKA 4IW2A 4F5UA 5IIUA 1VFIA 4LUHA 2BXLA 4PO0A 3CX9A 2I2ZA 2BXAA 3WHQA 3NMUA 1GNIA 1MIVA 2XSIA 4LUFA 3M99C 4HGMB 3SQJA 4D7XA 2EFDA 4G03A 4FK5B 2NNWA 2EFCA 4G01A 2DG5A 5IFOA 2BXCA 2NQOA 3GA9L 4ZCGA 3TDLA 4N0FD 5D7GA 3WHSA 1J78A 2GUTA 2BXKA 4LA0A 4ZUXV 1LOTA 3G9KD 2QMCA 4GG2A 2XMOA 4NAWB 2ROHA 2XVWA 3VQIA 5GIPA 4K2CA 3GQXA 1HK3A 2DBUA 2VUFA 3LU6A 1E7AA 1SB0A 1BM0A 4W4UB 3NVMA 4F5SA 5IIHA 3H3AA 1AO6A 1KXPD 4G04A 2VDBA 4GDLB 4L9QA 3V09A 2DYMA 4TQ0A 5GINA 4EMXA 2I30A 5GHKA 3A75A 4TQ1A 5HOZA 4F5VA 1E78A 2DBWA 5GIOA 5IJ5A 1O9XA 3BPJA 4ZBRA 4ZC6A 5BPKA 2BXHA 3ECPA 3UIVA 3ICXA 2BXIA 2DYOA 2XW1A 4OT2A 5IJEA 4C31B 2K0NA 4N3ZA 1MUHA 2BXOA 1FOUA 5B5TA 5ID9A 3H37A 5ID7A 2LXSA 4K71A 2XVQA 4Z9OA 1HK4A 1MIYA 1TF0A 3PLAA 3WHRA 3JRYA 3KJLA 1MIWA 4F5TA 4OTUA 3NVKA 2BXNA 2DBXA 4S1YA 1VZSA 1H5WA 1GNJA 1KW2A 4FJCB 1N5UA 1LNSA 4GDXA 4IW1A 1H9ZA 4N0UD 2CKXA 4GDKB 1E7BA 3W1SA 2E0XA 1HA2A 4BKEA 3V03A 2XW0A 1J7EA 2AGHB 4J2VA 2BXBA 2LQHA 4I9OA 4L9KA 2LOQA 4MBEC 1HK5A 3KIKA 2BXPA 4LB2A 3JQZA 4FIPB 2KWFA 2BXGA 4DHXB 1IJGA 2QM6A 2Z8IA 4ZBQA 2BXEA 2Z8JA 2BXFA 4E99A 1KDXA 1UORA 2BXMA 3B9LA 1E7GA 3SIUB 4L8UA 2OZBB 4M70B 3LU7A 3V08A 5IJFA 3FWCC 2BX8A 2JUHA 2E0YA 5FUOA 2XVUA 1E7CA 4ZBKA 1HK1A 3LU8A 2LXTA 2OT3A 2XVVA 3A73A 1JNBA 3FWBC 5DBYA 4OR0A 4WA6B 5DQFA 3FNMA 2QHBA 2AJEA 2Z8KA 4Z69A 1HK2A 1E7EA
chains in the Genus database with same CATH topology
2LXSA 2AGHB 2LXTA 2GUTA 4D7XA 2LQHA 2KWFA 4I9OA 2K0NA 1SB0A 1KDXA 2LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXS A;  2AGH B;  2LXT A;  2GUT A;  4D7X A;  2LQH A;  2KWF A;  4I9O A;  2K0N A;  1SB0 A;  1KDX A;  2LQI A; 
#chains in the Genus database with same CATH topology
 1E7I A;  2YDF A;  3GQU A;  1MA9 A;  4LB9 A;  4JK4 A;  3NVI A;  3MHS B;  5IIX A;  1BJ5 A;  1MUS A;  1BKE A;  3B9M A;  2EFH A;  2BXD A;  2LQI A;  1NT2 B;  2BXQ A;  1MM8 A;  2EFE A;  3SIV B;  2V36 A;  4DM0 A;  4BY9 C;  2KBZ A;  1E7H A;  1TXU A;  3MHH B;  4OTT A;  1E7F A;  2VUE A;  4HGK A;  4IW2 A;  4F5U A;  5IIU A;  1VFI A;  4LUH A;  2BXL A;  4PO0 A;  3CX9 A;  2I2Z A;  2BXA A;  3WHQ A;  3NMU A;  1GNI A;  1MIV A;  2XSI A;  4LUF A;  3M99 C;  4HGM B;  3SQJ A;  4D7X A;  2EFD A;  4G03 A;  4FK5 B;  2NNW A;  2EFC A;  4G01 A;  2DG5 A;  5IFO A;  2BXC A;  2NQO A;  3GA9 L;  4ZCG A;  3TDL A;  4N0F D;  5D7G A;  3WHS A;  1J78 A;  2GUT A;  2BXK A;  4LA0 A;  4ZUX V;  1LOT A;  3G9K D;  2QMC A;  4GG2 A;  2XMO A;  4NAW B;  2ROH A;  2XVW A;  3VQI A;  5GIP A;  4K2C A;  3GQX A;  1HK3 A;  2DBU A;  2VUF A;  3LU6 A;  1E7A A;  1SB0 A;  1BM0 A;  4W4U B;  3NVM A;  4F5S A;  5IIH A;  3H3A A;  1AO6 A;  1KXP D;  4G04 A;  2VDB A;  4GDL B;  4L9Q A;  3V09 A;  2DYM A;  4TQ0 A;  5GIN A;  4EMX A;  2I30 A;  5GHK A;  3A75 A;  4TQ1 A;  5HOZ A;  4F5V A;  1E78 A;  2DBW A;  5GIO A;  5IJ5 A;  1O9X A;  3BPJ A;  4ZBR A;  4ZC6 A;  5BPK A;  2BXH A;  3ECP A;  3UIV A;  3ICX A;  2BXI A;  2DYO A;  2XW1 A;  4OT2 A;  5IJE A;  4C31 B;  2K0N A;  4N3Z A;  1MUH A;  2BXO A;  1FOU A;  5B5T A;  5ID9 A;  3H37 A;  5ID7 A;  2LXS A;  4K71 A;  2XVQ A;  4Z9O A;  1HK4 A;  1MIY A;  1TF0 A;  3PLA A;  3WHR A;  3JRY A;  3KJL A;  1MIW A;  4F5T A;  4OTU A;  3NVK A;  2BXN A;  2DBX A;  4S1Y A;  1VZS A;  1H5W A;  1GNJ A;  1KW2 A;  4FJC B;  1N5U A;  1LNS A;  4GDX A;  4IW1 A;  1H9Z A;  4N0U D;  2CKX A;  4GDK B;  1E7B A;  3W1S A;  2E0X A;  1HA2 A;  4BKE A;  3V03 A;  2XW0 A;  1J7E A;  2AGH B;  4J2V A;  2BXB A;  2LQH A;  4I9O A;  4L9K A;  2LOQ A;  4MBE C;  1HK5 A;  3KIK A;  2BXP A;  4LB2 A;  3JQZ A;  4FIP B;  2KWF A;  2BXG A;  4DHX B;  1IJG A;  2QM6 A;  2Z8I A;  4ZBQ A;  2BXE A;  2Z8J A;  2BXF A;  4E99 A;  1KDX A;  1UOR A;  2BXM A;  3B9L A;  1E7G A;  3SIU B;  4L8U A;  2OZB B;  4M70 B;  3LU7 A;  3V08 A;  5IJF A;  3FWC C;  2BX8 A;  2JUH A;  2E0Y A;  5FUO A;  2XVU A;  1E7C A;  4ZBK A;  1HK1 A;  3LU8 A;  2LXT A;  2OT3 A;  2XVV A;  3A73 A;  1JNB A;  3FWB C;  5DBY A;  4OR0 A;  4WA6 B;  5DQF A;  3FNM A;  2QHB A;  2AJE A;  2Z8K A;  4Z69 A;  1HK2 A;  1E7E A; 
#chains in the Genus database with same CATH homology
 2LXS A;  2AGH B;  2LXT A;  2GUT A;  4D7X A;  2LQH A;  2KWF A;  4I9O A;  2K0N A;  1SB0 A;  1KDX A;  2LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...