4OTTA

Crystal structure of the gamma-glutamyltranspeptidase from bacillus licheniformis.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
357
structure length
357
Chain Sequence
DKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Low resolution X-ray structure of gamma-glutamyltranspeptidase from Bacillus licheniformis: Opened active site cleft and a cluster of acid residues potentially involved in the recognition of a metal ion.
pubmed doi rcsb
molecule keywords Gamma glutamyl transpeptidase
molecule tags Hydrolase
source organism Bacillus licheniformis
total genus 91
structure length 357
sequence length 357
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4ottA02
2DBUA 2Z8IA 3A75A 4Z9OA 2Z8JA 2E0XA 3WHQA 3WHSA 3FNMA 4OTUA 4GDXA 2Z8KA 2V36A 4GG2A 2QMCA 2DBWA 2DG5A 4ZCGA 2E0YA 2DBXA 5B5TA 2QM6A 2NQOA 5BPKA 4ZBKA 4ZC6A 4OTTA 3WHRA
chains in the Genus database with same CATH superfamily
3LU6A 4PO0A 1SB0A 2BXHA 1KXPD 1O9XA 2DBUA 2VUEA 3JRYA 2XW1A 1VZSA 1VFIA 3KJLA 3V03A 5IFOA 2BXKA 2E0XA 1JNBA 2Z8JA 3NVIA 1LOTA 2BXNA 2BXPA 3G9KD 4MBEC 2BXGA 2DYMA 2EFHA 4L8UA 1KDXA 4F5SA 3GA9L 1NT2B 4ZCGA 1E7EA 5IJEA 3FWCC 4G01A 4ZBQA 2OT3A 2OZBB 2EFCA 4ZC6A 4OR0A 4J2VA 3LU8A 4K71A 4BY9C 1BM0A 2EFEA 4OTTA 1MIYA 2BXAA 1MIWA 1LNSA 1HK5A 3BPJA 1MIVA 3GQXA 5GINA 1E78A 5ID9A 2BXDA 3VQIA 3A75A 2XVUA 2AGHB 3ECPA 4E99A 4ZUXV 4HGMB 4Z9OA 2AJEA 3LU7A 1E7CA 3WHQA 5ID7A 1J78A 1MUSA 4HGKA 4F5TA 5IJ5A 4IW1A 2XVWA 2ROHA 3FNMA 4OTUA 2BXQA 3M99C 2LQHA 2V36A 4FIPB 4N0UD 4W4UB 1H9ZA 1HK4A 3W1SA 2BXBA 3ICXA 4JK4A 4LUFA 2GUTA 1N5UA 2DBXA 5GHKA 3NVMA 4EMXA 5IIHA 4FK5B 5B5TA 1TXUA 4FJCB 3H3AA 5IIXA 4G03A 2XW0A 3V09A 1E7BA 2NQOA 2BXCA 3TDLA 3A73A 3WHRA 4F5UA 4TQ0A 1E7GA 2Z8IA 3MHSB 2XSIA 4G04A 4DHXB 1HA2A 3MHHB 1GNIA 4N3ZA 3FWBC 2BXIA 2CKXA 3B9LA 3JQZA 2VUFA 2XVQA 4GDKB 3NVKA 4M70B 2I30A 4L9KA 2LXSA 4F5VA 1IJGA 4GG2A 4Z69A 2QMCA 5IIUA 2XMOA 3B9MA 4S1YA 1MUHA 1E7HA 2VDBA 3UIVA 2JUHA 3GQUA 5FUOA 4I9OA 2LQIA 2QM6A 3SQJA 1E7FA 4C31B 5BPKA 1KW2A 4K2CA 4ZBKA 1HK1A 1E7AA 5GIOA 3CX9A 2BXEA 4LB2A 4LUHA 2BXMA 2EFDA 4LB9A 2K0NA 4WA6B 5HOZA 3V08A 1BKEA 1UORA 4ZBRA 1BJ5A 4BKEA 4GDLB 1GNJA 3H37A 4OT2A 4NAWB 3WHSA 1AO6A 3PLAA 4LA0A 1MM8A 1MA9A 3SIUB 1HK3A 2I2ZA 2KBZA 4L9QA 1TF0A 3SIVB 2KWFA 3KIKA 5GIPA 4GDXA 1HK2A 2Z8KA 2LXTA 2DBWA 2DG5A 1E7IA 2LOQA 2NNWA 5DQFA 2E0YA 1J7EA 2BXFA 4TQ1A 1H5WA 2YDFA 2BXOA 4IW2A 5IJFA 5D7GA 1FOUA 2QHBA 5DBYA 2XVVA 3NMUA 4N0FD 4D7XA 2DYOA 4DM0A 2BXLA 2BX8A
chains in the Genus database with same CATH topology
3LU6A 4PO0A 2BXHA 1KXPD 1O9XA 2DBUA 2VUEA 3JRYA 2XW1A 1VZSA 1VFIA 3KJLA 3V03A 5IFOA 2BXKA 2E0XA 1JNBA 2Z8JA 3NVIA 1LOTA 2BXNA 2BXPA 3G9KD 4MBEC 2BXGA 2DYMA 2EFHA 4L8UA 4F5SA 3GA9L 1NT2B 4ZCGA 1E7EA 5IJEA 3FWCC 4G01A 4ZBQA 2OT3A 2OZBB 2EFCA 4ZC6A 4OR0A 4J2VA 3LU8A 4K71A 4BY9C 1BM0A 2EFEA 4OTTA 1MIYA 2BXAA 1MIWA 1LNSA 1HK5A 1MIVA 3GQXA 5GINA 1E78A 5ID9A 2BXDA 3VQIA 3A75A 2XVUA 4E99A 4ZUXV 4HGMB 4Z9OA 2AJEA 3LU7A 1E7CA 3WHQA 5ID7A 1J78A 4HGKA 4F5TA 5IJ5A 4IW1A 2XVWA 2ROHA 3FNMA 4OTUA 2BXQA 3M99C 2V36A 4FIPB 4N0UD 4W4UB 1H9ZA 1HK4A 3W1SA 2BXBA 3ICXA 4JK4A 4LUFA 1N5UA 2DBXA 5GHKA 3NVMA 4EMXA 5IIHA 4FK5B 5B5TA 1TXUA 4FJCB 3H3AA 5IIXA 4G03A 2XW0A 3V09A 1E7BA 2NQOA 2BXCA 3TDLA 3A73A 3WHRA 4F5UA 4TQ0A 1E7GA 2Z8IA 3MHSB 2XSIA 4G04A 4DHXB 1HA2A 3MHHB 1GNIA 4N3ZA 3FWBC 2BXIA 2CKXA 3B9LA 3JQZA 2VUFA 2XVQA 4GDKB 3NVKA 4M70B 2I30A 4L9KA 4F5VA 1IJGA 4GG2A 4Z69A 2QMCA 5IIUA 2XMOA 3B9MA 4S1YA 1E7HA 2VDBA 3UIVA 2JUHA 3GQUA 5FUOA 2QM6A 3SQJA 1E7FA 4C31B 5BPKA 1KW2A 4K2CA 4ZBKA 1HK1A 1E7AA 5GIOA 3CX9A 2BXEA 4LB2A 4LUHA 2BXMA 2EFDA 4LB9A 4WA6B 5HOZA 3V08A 1BKEA 1UORA 4ZBRA 1BJ5A 4BKEA 4GDLB 1GNJA 3H37A 4OT2A 4NAWB 3WHSA 1AO6A 3PLAA 4LA0A 1MA9A 3SIUB 1HK3A 2I2ZA 2KBZA 4L9QA 1TF0A 3SIVB 3KIKA 5GIPA 4GDXA 1HK2A 2Z8KA 5DQFA 2DBWA 2DG5A 1E7IA 2LOQA 2NNWA 2E0YA 1J7EA 2BXFA 4TQ1A 1H5WA 2YDFA 2BXOA 4IW2A 5IJFA 5D7GA 1FOUA 2QHBA 5DBYA 2XVVA 3NMUA 4N0FD 2DYOA 2BXLA 2BX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBU A;  2Z8I A;  3A75 A;  4Z9O A;  2Z8J A;  2E0X A;  3WHQ A;  3WHS A;  3FNM A;  4OTU A;  4GDX A;  2Z8K A;  2V36 A;  4GG2 A;  2QMC A;  2DBW A;  2DG5 A;  4ZCG A;  2E0Y A;  2DBX A;  5B5T A;  2QM6 A;  2NQO A;  5BPK A;  4ZBK A;  4ZC6 A;  4OTT A;  3WHR A; 
#chains in the Genus database with same CATH topology
 3LU6 A;  4PO0 A;  1SB0 A;  2BXH A;  1KXP D;  1O9X A;  2DBU A;  2VUE A;  3JRY A;  2XW1 A;  1VZS A;  1VFI A;  3KJL A;  3V03 A;  5IFO A;  2BXK A;  2E0X A;  1JNB A;  2Z8J A;  3NVI A;  1LOT A;  2BXN A;  2BXP A;  3G9K D;  4MBE C;  2BXG A;  2DYM A;  2EFH A;  4L8U A;  1KDX A;  4F5S A;  3GA9 L;  1NT2 B;  4ZCG A;  1E7E A;  5IJE A;  3FWC C;  4G01 A;  4ZBQ A;  2OT3 A;  2OZB B;  2EFC A;  4ZC6 A;  4OR0 A;  4J2V A;  3LU8 A;  4K71 A;  4BY9 C;  1BM0 A;  2EFE A;  4OTT A;  1MIY A;  2BXA A;  1MIW A;  1LNS A;  1HK5 A;  3BPJ A;  1MIV A;  3GQX A;  5GIN A;  1E78 A;  5ID9 A;  2BXD A;  3VQI A;  3A75 A;  2XVU A;  2AGH B;  3ECP A;  4E99 A;  4ZUX V;  4HGM B;  4Z9O A;  2AJE A;  3LU7 A;  1E7C A;  3WHQ A;  5ID7 A;  1J78 A;  1MUS A;  4HGK A;  4F5T A;  5IJ5 A;  4IW1 A;  2XVW A;  2ROH A;  3FNM A;  4OTU A;  2BXQ A;  3M99 C;  2LQH A;  2V36 A;  4FIP B;  4N0U D;  4W4U B;  1H9Z A;  1HK4 A;  3W1S A;  2BXB A;  3ICX A;  4JK4 A;  4LUF A;  2GUT A;  1N5U A;  2DBX A;  5GHK A;  3NVM A;  4EMX A;  5IIH A;  4FK5 B;  5B5T A;  1TXU A;  4FJC B;  3H3A A;  5IIX A;  4G03 A;  2XW0 A;  3V09 A;  1E7B A;  2NQO A;  2BXC A;  3TDL A;  3A73 A;  3WHR A;  4F5U A;  4TQ0 A;  1E7G A;  2Z8I A;  3MHS B;  2XSI A;  4G04 A;  4DHX B;  1HA2 A;  3MHH B;  1GNI A;  4N3Z A;  3FWB C;  2BXI A;  2CKX A;  3B9L A;  3JQZ A;  2VUF A;  2XVQ A;  4GDK B;  3NVK A;  4M70 B;  2I30 A;  4L9K A;  2LXS A;  4F5V A;  1IJG A;  4GG2 A;  4Z69 A;  2QMC A;  5IIU A;  2XMO A;  3B9M A;  4S1Y A;  1MUH A;  1E7H A;  2VDB A;  3UIV A;  2JUH A;  3GQU A;  5FUO A;  4I9O A;  2LQI A;  2QM6 A;  3SQJ A;  1E7F A;  4C31 B;  5BPK A;  1KW2 A;  4K2C A;  4ZBK A;  1HK1 A;  1E7A A;  5GIO A;  3CX9 A;  2BXE A;  4LB2 A;  4LUH A;  2BXM A;  2EFD A;  4LB9 A;  2K0N A;  4WA6 B;  5HOZ A;  3V08 A;  1BKE A;  1UOR A;  4ZBR A;  1BJ5 A;  4BKE A;  4GDL B;  1GNJ A;  3H37 A;  4OT2 A;  4NAW B;  3WHS A;  1AO6 A;  3PLA A;  4LA0 A;  1MM8 A;  1MA9 A;  3SIU B;  1HK3 A;  2I2Z A;  2KBZ A;  4L9Q A;  1TF0 A;  3SIV B;  2KWF A;  3KIK A;  5GIP A;  4GDX A;  1HK2 A;  2Z8K A;  2LXT A;  2DBW A;  2DG5 A;  1E7I A;  2LOQ A;  2NNW A;  5DQF A;  2E0Y A;  1J7E A;  2BXF A;  4TQ1 A;  1H5W A;  2YDF A;  2BXO A;  4IW2 A;  5IJF A;  5D7G A;  1FOU A;  2QHB A;  5DBY A;  2XVV A;  3NMU A;  4N0F D;  4D7X A;  2DYO A;  4DM0 A;  2BXL A;  2BX8 A; 
#chains in the Genus database with same CATH homology
 3LU6 A;  4PO0 A;  2BXH A;  1KXP D;  1O9X A;  2DBU A;  2VUE A;  3JRY A;  2XW1 A;  1VZS A;  1VFI A;  3KJL A;  3V03 A;  5IFO A;  2BXK A;  2E0X A;  1JNB A;  2Z8J A;  3NVI A;  1LOT A;  2BXN A;  2BXP A;  3G9K D;  4MBE C;  2BXG A;  2DYM A;  2EFH A;  4L8U A;  4F5S A;  3GA9 L;  1NT2 B;  4ZCG A;  1E7E A;  5IJE A;  3FWC C;  4G01 A;  4ZBQ A;  2OT3 A;  2OZB B;  2EFC A;  4ZC6 A;  4OR0 A;  4J2V A;  3LU8 A;  4K71 A;  4BY9 C;  1BM0 A;  2EFE A;  4OTT A;  1MIY A;  2BXA A;  1MIW A;  1LNS A;  1HK5 A;  1MIV A;  3GQX A;  5GIN A;  1E78 A;  5ID9 A;  2BXD A;  3VQI A;  3A75 A;  2XVU A;  4E99 A;  4ZUX V;  4HGM B;  4Z9O A;  2AJE A;  3LU7 A;  1E7C A;  3WHQ A;  5ID7 A;  1J78 A;  4HGK A;  4F5T A;  5IJ5 A;  4IW1 A;  2XVW A;  2ROH A;  3FNM A;  4OTU A;  2BXQ A;  3M99 C;  2V36 A;  4FIP B;  4N0U D;  4W4U B;  1H9Z A;  1HK4 A;  3W1S A;  2BXB A;  3ICX A;  4JK4 A;  4LUF A;  1N5U A;  2DBX A;  5GHK A;  3NVM A;  4EMX A;  5IIH A;  4FK5 B;  5B5T A;  1TXU A;  4FJC B;  3H3A A;  5IIX A;  4G03 A;  2XW0 A;  3V09 A;  1E7B A;  2NQO A;  2BXC A;  3TDL A;  3A73 A;  3WHR A;  4F5U A;  4TQ0 A;  1E7G A;  2Z8I A;  3MHS B;  2XSI A;  4G04 A;  4DHX B;  1HA2 A;  3MHH B;  1GNI A;  4N3Z A;  3FWB C;  2BXI A;  2CKX A;  3B9L A;  3JQZ A;  2VUF A;  2XVQ A;  4GDK B;  3NVK A;  4M70 B;  2I30 A;  4L9K A;  4F5V A;  1IJG A;  4GG2 A;  4Z69 A;  2QMC A;  5IIU A;  2XMO A;  3B9M A;  4S1Y A;  1E7H A;  2VDB A;  3UIV A;  2JUH A;  3GQU A;  5FUO A;  2QM6 A;  3SQJ A;  1E7F A;  4C31 B;  5BPK A;  1KW2 A;  4K2C A;  4ZBK A;  1HK1 A;  1E7A A;  5GIO A;  3CX9 A;  2BXE A;  4LB2 A;  4LUH A;  2BXM A;  2EFD A;  4LB9 A;  4WA6 B;  5HOZ A;  3V08 A;  1BKE A;  1UOR A;  4ZBR A;  1BJ5 A;  4BKE A;  4GDL B;  1GNJ A;  3H37 A;  4OT2 A;  4NAW B;  3WHS A;  1AO6 A;  3PLA A;  4LA0 A;  1MA9 A;  3SIU B;  1HK3 A;  2I2Z A;  2KBZ A;  4L9Q A;  1TF0 A;  3SIV B;  3KIK A;  5GIP A;  4GDX A;  1HK2 A;  2Z8K A;  5DQF A;  2DBW A;  2DG5 A;  1E7I A;  2LOQ A;  2NNW A;  2E0Y A;  1J7E A;  2BXF A;  4TQ1 A;  1H5W A;  2YDF A;  2BXO A;  4IW2 A;  5IJF A;  5D7G A;  1FOU A;  2QHB A;  5DBY A;  2XVV A;  3NMU A;  4N0F D;  2DYO A;  2BXL A;  2BX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...