4W4UB

Structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncovering the role of Sgf73 in maintaining SAGA deubiquitinating module structure and activity.
pubmed doi rcsb
molecule keywords Ubiquitin carboxyl-terminal hydrolase
molecule tags Transcription/hydrolase
source organism Saccharomyces cerevisiae
total genus 37
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4w4uB00
3FWBC 4FIPB 3M99C 4FJCB 4C31B 4WA6B 3FWCC 4W4UB 3KJLA 4FK5B 4DHXB 3MHSB 3MHHB 4MBEC 3KIKA 4ZUXV
chains in the Genus database with same CATH superfamily
2EFEA 1E7HA 2AGHB 2DBUA 1HK2A 3NVIA 3A75A 2BXLA 3B9MA 3W1SA 1E7GA 4ZBQA 4G01A 4Z9OA 4ZC6A 4F5TA 3M99C 2OZBB 2AJEA 1HK4A 1BM0A 2LOQA 2GUTA 1IJGA 1N5UA 3KIKA 2E0YA 4Z69A 1E7FA 3SIVB 2YDFA 2XVWA 2DBWA 4JK4A 2VDBA 2LQIA 1J7EA 4WA6B 1H9ZA 5IJEA 4HGKA 3SIUB 1E78A 2VUEA 3VQIA 3WHQA 2E0XA 4E99A 1E7EA 4EMXA 1BKEA 2DG5A 3UIVA 2CKXA 1KW2A 1VZSA 1H5WA 2XVUA 4IW2A 1BJ5A 3MHHB 4MBEC 4OT2A 2I30A 3V03A 3NMUA 4IW1A 1MIVA 2NNWA 2BXMA 2QM6A 5IJ5A 2BXBA 2DYMA 1MIYA 5D7GA 5IIHA 4N0UD 3GA9L 3GQUA 3WHSA 3FNMA 2LQHA 4N0FD 5FUOA 4BY9C 1E7IA 2DYOA 4LB2A 4ZCGA 2BXKA 2BXQA 5ID7A 3A73A 1E7CA 2BXOA 3NVMA 4G04A 3LU8A 4S1YA 1TF0A 3MHSB 4GDXA 4HGMB 2JUHA 1HK5A 2XVVA 2BXPA 1JNBA 2EFCA 3PLAA 4PO0A 2QMCA 1HA2A 1FOUA 5BPKA 4GDLB 1KDXA 1VFIA 4DM0A 1MUSA 4OTTA 1TXUA 2BXDA 3TDLA 1LOTA 5DQFA 3V08A 2BXAA 1AO6A 5DBYA 2EFHA 2BXHA 3LU7A 4FJCB 2Z8KA 2BXCA 2BXFA 1E7BA 1LNSA 2KWFA 3V09A 4BKEA 2XMOA 4NAWB 1MA9A 5IJFA 3G9KD 2BXIA 3KJLA 4I9OA 2DBXA 4K2CA 4ZBRA 3SQJA 1J78A 5GINA 5IIUA 4M70B 5GIOA 4L9KA 4GDKB 4K71A 2LXSA 4G03A 4F5VA 2ROHA 2VUFA 2OT3A 3JQZA 4DHXB 5B5TA 4OR0A 5GHKA 2EFDA 3ICXA 4TQ0A 4ZUXV 3FWBC 3BPJA 4FIPB 1GNIA 1GNJA 2I2ZA 4GG2A 5ID9A 2BX8A 4F5SA 3LU6A 4N3ZA 1NT2B 2V36A 3H3AA 2BXGA 3NVKA 3H37A 4OTUA 5GIPA 1MM8A 4W4UB 3B9LA 4L9QA 3CX9A 4L8UA 2LXTA 1E7AA 4LA0A 1O9XA 5IFOA 5HOZA 2BXEA 4LUHA 1KXPD 4F5UA 1MUHA 2XW0A 2NQOA 1UORA 2XVQA 3WHRA 4C31B 1SB0A 2QHBA 3FWCC 1HK1A 3GQXA 5IIXA 2Z8JA 4J2VA 3JRYA 4D7XA 2XW1A 4TQ1A 2BXNA 1HK3A 1MIWA 2KBZA 2XSIA 4LUFA 4FK5B 3ECPA 4LB9A 4ZBKA 2Z8IA 2K0NA
chains in the Genus database with same CATH topology
2EFEA 1E7HA 2DBUA 1HK2A 3NVIA 3A75A 2BXLA 3B9MA 3W1SA 1E7GA 4ZBQA 4G01A 4Z9OA 4ZC6A 4F5TA 3M99C 2OZBB 2AJEA 1HK4A 1BM0A 2LOQA 1IJGA 1N5UA 3KIKA 2E0YA 4Z69A 1E7FA 3SIVB 2YDFA 2XVWA 2DBWA 4JK4A 2VDBA 4WA6B 1J7EA 1H9ZA 5IJEA 4HGKA 3SIUB 1E78A 2VUEA 3VQIA 3WHQA 2E0XA 4E99A 1E7EA 4EMXA 1BKEA 2DG5A 3UIVA 2CKXA 1KW2A 1VZSA 1H5WA 2XVUA 4IW2A 1BJ5A 3MHHB 4MBEC 4OT2A 2I30A 3V03A 3NMUA 4IW1A 1MIVA 2NNWA 2BXMA 2QM6A 5IJ5A 2BXBA 2DYMA 1MIYA 5D7GA 5IIHA 4N0UD 3GA9L 3GQUA 3WHSA 3FNMA 4BY9C 4N0FD 5FUOA 1E7IA 2DYOA 4LB2A 4ZCGA 2BXKA 2BXQA 5ID7A 3A73A 1E7CA 2BXOA 3NVMA 4G04A 3LU8A 4S1YA 1TF0A 3MHSB 4GDXA 4HGMB 2JUHA 1HK5A 2XVVA 2BXPA 1JNBA 2EFCA 3PLAA 4PO0A 2QMCA 1HA2A 1FOUA 5BPKA 4GDLB 1VFIA 4OTTA 1TXUA 2BXDA 3TDLA 1LOTA 5DQFA 3V08A 2BXAA 1AO6A 5DBYA 2EFHA 2BXHA 3LU7A 4FJCB 2Z8KA 2BXCA 2BXFA 1E7BA 1LNSA 3V09A 4BKEA 2XMOA 4NAWB 1MA9A 5IJFA 3G9KD 2BXIA 3KJLA 4K2CA 2DBXA 4ZBRA 3SQJA 1J78A 5GINA 5IIUA 4M70B 5GIOA 4L9KA 4GDKB 4K71A 4G03A 4F5VA 2ROHA 2VUFA 2OT3A 3JQZA 4DHXB 5B5TA 4OR0A 5GHKA 2EFDA 3ICXA 4TQ0A 4ZUXV 3FWBC 4FIPB 1GNIA 1GNJA 2I2ZA 4GG2A 5ID9A 2BX8A 4F5SA 3LU6A 4N3ZA 1NT2B 2V36A 3H3AA 2BXGA 3NVKA 3H37A 4OTUA 5GIPA 4W4UB 3B9LA 4L9QA 3CX9A 4L8UA 1E7AA 4LA0A 1O9XA 5IFOA 5HOZA 2BXEA 4LUHA 1KXPD 4F5UA 2XW0A 2NQOA 1UORA 2XVQA 3WHRA 4C31B 2QHBA 3FWCC 1HK1A 3GQXA 5IIXA 2Z8JA 4J2VA 3JRYA 2XW1A 4TQ1A 2BXNA 1HK3A 1MIWA 2KBZA 2XSIA 4LUFA 4FK5B 4LB9A 4ZBKA 2Z8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWB C;  4FIP B;  3M99 C;  4FJC B;  4C31 B;  4WA6 B;  3FWC C;  4W4U B;  3KJL A;  4FK5 B;  4DHX B;  3MHS B;  3MHH B;  4MBE C;  3KIK A;  4ZUX V; 
#chains in the Genus database with same CATH topology
 2EFE A;  1E7H A;  2AGH B;  2DBU A;  1HK2 A;  3NVI A;  3A75 A;  2BXL A;  3B9M A;  3W1S A;  1E7G A;  4ZBQ A;  4G01 A;  4Z9O A;  4ZC6 A;  4F5T A;  3M99 C;  2OZB B;  2AJE A;  1HK4 A;  1BM0 A;  2LOQ A;  2GUT A;  1IJG A;  1N5U A;  3KIK A;  2E0Y A;  4Z69 A;  1E7F A;  3SIV B;  2YDF A;  2XVW A;  2DBW A;  4JK4 A;  2VDB A;  2LQI A;  1J7E A;  4WA6 B;  1H9Z A;  5IJE A;  4HGK A;  3SIU B;  1E78 A;  2VUE A;  3VQI A;  3WHQ A;  2E0X A;  4E99 A;  1E7E A;  4EMX A;  1BKE A;  2DG5 A;  3UIV A;  2CKX A;  1KW2 A;  1VZS A;  1H5W A;  2XVU A;  4IW2 A;  1BJ5 A;  3MHH B;  4MBE C;  4OT2 A;  2I30 A;  3V03 A;  3NMU A;  4IW1 A;  1MIV A;  2NNW A;  2BXM A;  2QM6 A;  5IJ5 A;  2BXB A;  2DYM A;  1MIY A;  5D7G A;  5IIH A;  4N0U D;  3GA9 L;  3GQU A;  3WHS A;  3FNM A;  2LQH A;  4N0F D;  5FUO A;  4BY9 C;  1E7I A;  2DYO A;  4LB2 A;  4ZCG A;  2BXK A;  2BXQ A;  5ID7 A;  3A73 A;  1E7C A;  2BXO A;  3NVM A;  4G04 A;  3LU8 A;  4S1Y A;  1TF0 A;  3MHS B;  4GDX A;  4HGM B;  2JUH A;  1HK5 A;  2XVV A;  2BXP A;  1JNB A;  2EFC A;  3PLA A;  4PO0 A;  2QMC A;  1HA2 A;  1FOU A;  5BPK A;  4GDL B;  1KDX A;  1VFI A;  4DM0 A;  1MUS A;  4OTT A;  1TXU A;  2BXD A;  3TDL A;  1LOT A;  5DQF A;  3V08 A;  2BXA A;  1AO6 A;  5DBY A;  2EFH A;  2BXH A;  3LU7 A;  4FJC B;  2Z8K A;  2BXC A;  2BXF A;  1E7B A;  1LNS A;  2KWF A;  3V09 A;  4BKE A;  2XMO A;  4NAW B;  1MA9 A;  5IJF A;  3G9K D;  2BXI A;  3KJL A;  4I9O A;  2DBX A;  4K2C A;  4ZBR A;  3SQJ A;  1J78 A;  5GIN A;  5IIU A;  4M70 B;  5GIO A;  4L9K A;  4GDK B;  4K71 A;  2LXS A;  4G03 A;  4F5V A;  2ROH A;  2VUF A;  2OT3 A;  3JQZ A;  4DHX B;  5B5T A;  4OR0 A;  5GHK A;  2EFD A;  3ICX A;  4TQ0 A;  4ZUX V;  3FWB C;  3BPJ A;  4FIP B;  1GNI A;  1GNJ A;  2I2Z A;  4GG2 A;  5ID9 A;  2BX8 A;  4F5S A;  3LU6 A;  4N3Z A;  1NT2 B;  2V36 A;  3H3A A;  2BXG A;  3NVK A;  3H37 A;  4OTU A;  5GIP A;  1MM8 A;  4W4U B;  3B9L A;  4L9Q A;  3CX9 A;  4L8U A;  2LXT A;  1E7A A;  4LA0 A;  1O9X A;  5IFO A;  5HOZ A;  2BXE A;  4LUH A;  1KXP D;  4F5U A;  1MUH A;  2XW0 A;  2NQO A;  1UOR A;  2XVQ A;  3WHR A;  4C31 B;  1SB0 A;  2QHB A;  3FWC C;  1HK1 A;  3GQX A;  5IIX A;  2Z8J A;  4J2V A;  3JRY A;  4D7X A;  2XW1 A;  4TQ1 A;  2BXN A;  1HK3 A;  1MIW A;  2KBZ A;  2XSI A;  4LUF A;  4FK5 B;  3ECP A;  4LB9 A;  4ZBK A;  2Z8I A;  2K0N A; 
#chains in the Genus database with same CATH homology
 2EFE A;  1E7H A;  2DBU A;  1HK2 A;  3NVI A;  3A75 A;  2BXL A;  3B9M A;  3W1S A;  1E7G A;  4ZBQ A;  4G01 A;  4Z9O A;  4ZC6 A;  4F5T A;  3M99 C;  2OZB B;  2AJE A;  1HK4 A;  1BM0 A;  2LOQ A;  1IJG A;  1N5U A;  3KIK A;  2E0Y A;  4Z69 A;  1E7F A;  3SIV B;  2YDF A;  2XVW A;  2DBW A;  4JK4 A;  2VDB A;  4WA6 B;  1J7E A;  1H9Z A;  5IJE A;  4HGK A;  3SIU B;  1E78 A;  2VUE A;  3VQI A;  3WHQ A;  2E0X A;  4E99 A;  1E7E A;  4EMX A;  1BKE A;  2DG5 A;  3UIV A;  2CKX A;  1KW2 A;  1VZS A;  1H5W A;  2XVU A;  4IW2 A;  1BJ5 A;  3MHH B;  4MBE C;  4OT2 A;  2I30 A;  3V03 A;  3NMU A;  4IW1 A;  1MIV A;  2NNW A;  2BXM A;  2QM6 A;  5IJ5 A;  2BXB A;  2DYM A;  1MIY A;  5D7G A;  5IIH A;  4N0U D;  3GA9 L;  3GQU A;  3WHS A;  3FNM A;  4BY9 C;  4N0F D;  5FUO A;  1E7I A;  2DYO A;  4LB2 A;  4ZCG A;  2BXK A;  2BXQ A;  5ID7 A;  3A73 A;  1E7C A;  2BXO A;  3NVM A;  4G04 A;  3LU8 A;  4S1Y A;  1TF0 A;  3MHS B;  4GDX A;  4HGM B;  2JUH A;  1HK5 A;  2XVV A;  2BXP A;  1JNB A;  2EFC A;  3PLA A;  4PO0 A;  2QMC A;  1HA2 A;  1FOU A;  5BPK A;  4GDL B;  1VFI A;  4OTT A;  1TXU A;  2BXD A;  3TDL A;  1LOT A;  5DQF A;  3V08 A;  2BXA A;  1AO6 A;  5DBY A;  2EFH A;  2BXH A;  3LU7 A;  4FJC B;  2Z8K A;  2BXC A;  2BXF A;  1E7B A;  1LNS A;  3V09 A;  4BKE A;  2XMO A;  4NAW B;  1MA9 A;  5IJF A;  3G9K D;  2BXI A;  3KJL A;  4K2C A;  2DBX A;  4ZBR A;  3SQJ A;  1J78 A;  5GIN A;  5IIU A;  4M70 B;  5GIO A;  4L9K A;  4GDK B;  4K71 A;  4G03 A;  4F5V A;  2ROH A;  2VUF A;  2OT3 A;  3JQZ A;  4DHX B;  5B5T A;  4OR0 A;  5GHK A;  2EFD A;  3ICX A;  4TQ0 A;  4ZUX V;  3FWB C;  4FIP B;  1GNI A;  1GNJ A;  2I2Z A;  4GG2 A;  5ID9 A;  2BX8 A;  4F5S A;  3LU6 A;  4N3Z A;  1NT2 B;  2V36 A;  3H3A A;  2BXG A;  3NVK A;  3H37 A;  4OTU A;  5GIP A;  4W4U B;  3B9L A;  4L9Q A;  3CX9 A;  4L8U A;  1E7A A;  4LA0 A;  1O9X A;  5IFO A;  5HOZ A;  2BXE A;  4LUH A;  1KXP D;  4F5U A;  2XW0 A;  2NQO A;  1UOR A;  2XVQ A;  3WHR A;  4C31 B;  2QHB A;  3FWC C;  1HK1 A;  3GQX A;  5IIX A;  2Z8J A;  4J2V A;  3JRY A;  2XW1 A;  4TQ1 A;  2BXN A;  1HK3 A;  1MIW A;  2KBZ A;  2XSI A;  4LUF A;  4FK5 B;  4LB9 A;  4ZBK A;  2Z8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...