4WA6B

Structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
rcsb
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
molecule tags Hydrolase/transcription
source organism Saccharomyces cerevisiae
total genus 38
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4wa6B00
3MHHB 4FJCB 3KJLA 3FWCC 4FIPB 3KIKA 4FK5B 4MBEC 4W4UB 3FWBC 4WA6B 3MHSB 4C31B 4DHXB 4ZUXV 3M99C
chains in the Genus database with same CATH superfamily
3MHHB 4N3ZA 1SB0A 4F5TA 2BXPA 5IFOA 1HK5A 2NQOA 4EMXA 2QM6A 4DM0A 3A73A 1E7FA 2BXQA 4IW2A 5GINA 2EFDA 4L9QA 4JK4A 5GHKA 1AO6A 3NVIA 3VQIA 2LQIA 1MIWA 4GG2A 3SQJA 4TQ0A 4ZBKA 1BJ5A 4D7XA 2KWFA 2AGHB 2BXIA 2OZBB 4G01A 3WHRA 1TF0A 2DBWA 2XVWA 3V09A 3LU7A 1E78A 4C31B 2KBZA 4GDLB 2I2ZA 2XSIA 5B5TA 3NVKA 3TDLA 1MUSA 1HK2A 4OR0A 1E7GA 2BXGA 1GNJA 4IW1A 4K71A 2ROHA 4F5VA 1KW2A 4BY9C 3JQZA 1MIYA 4F5SA 5IIUA 1LNSA 4WA6B 1KDXA 4G04A 2BXEA 2BXCA 1J78A 2XW1A 4ZC6A 2VUFA 4FK5B 4LA0A 4NAWB 1VFIA 4J2VA 1JNBA 2YDFA 3V03A 4ZBRA 3WHSA 2BXDA 1IJGA 5IJ5A 2K0NA 3LU6A 4GDKB 1E7AA 4G03A 4BKEA 5ID7A 2BX8A 4FIPB 2EFHA 2JUHA 4W4UB 4DHXB 2LOQA 2XVQA 2I30A 3FWBC 4E99A 5IIHA 2QMCA 5IJEA 2EFEA 2V36A 1HK3A 3PLAA 3BPJA 2DYMA 3ICXA 2BXAA 4GDXA 2Z8IA 1BKEA 3B9MA 4L8UA 1N5UA 1VZSA 5BPKA 3GQXA 3SIVB 1KXPD 2BXLA 4F5UA 3H37A 3ECPA 1E7HA 2XMOA 4I9OA 4MBEC 2BXKA 3H3AA 2LXTA 2GUTA 1BM0A 4HGMB 1E7CA 2DBUA 3M99C 4LUFA 5D7GA 1FOUA 3NVMA 2AJEA 4Z9OA 4PO0A 4M70B 3LU8A 3MHSB 2BXFA 1MM8A 2LQHA 1H5WA 3GA9L 3NMUA 5GIOA 2LXSA 4LUHA 2VUEA 1O9XA 4Z69A 4FJCB 1MUHA 1HK4A 3SIUB 2BXNA 4OT2A 5ID9A 3W1SA 5GIPA 4ZUXV 4LB9A 4S1YA 2NNWA 2DYOA 5FUOA 4K2CA 2DG5A 2Z8JA 4LB2A 4N0FD 1HK1A 5DQFA 4ZBQA 5HOZA 2BXOA 3CX9A 3B9LA 4HGKA 2XVUA 3A75A 4OTUA 5IIXA 1E7IA 1HA2A 5IJFA 3KIKA 2OT3A 2QHBA 1H9ZA 4OTTA 3FWCC 2E0XA 2Z8KA 3G9KD 3V08A 3FNMA 4ZCGA 3UIVA 3KJLA 2BXHA 3JRYA 2BXBA 2E0YA 1GNIA 2XVVA 3WHQA 2VDBA 2CKXA 3GQUA 2DBXA 1E7BA 4L9KA 1J7EA 4N0UD 1E7EA 2XW0A 1MA9A 1UORA 4TQ1A 1MIVA 2BXMA 5DBYA 1NT2B 1LOTA 2EFCA 1TXUA
chains in the Genus database with same CATH topology
3MHHB 4N3ZA 4F5TA 2BXPA 5IFOA 1HK5A 2NQOA 4EMXA 2QM6A 3A73A 1E7FA 2BXQA 4IW2A 5GINA 2EFDA 4L9QA 4JK4A 5GHKA 1AO6A 3NVIA 3VQIA 1MIWA 4GG2A 3SQJA 4TQ0A 4ZBKA 1BJ5A 2BXIA 2OZBB 4G01A 3WHRA 1TF0A 2DBWA 2XVWA 3V09A 3LU7A 1E78A 4C31B 2KBZA 4GDLB 2I2ZA 2XSIA 5B5TA 3NVKA 3TDLA 1HK2A 4OR0A 1E7GA 2BXGA 1GNJA 4IW1A 4K71A 2ROHA 4F5VA 1KW2A 4BY9C 3JQZA 1MIYA 4F5SA 5IIUA 1LNSA 4WA6B 4G04A 2BXEA 2BXCA 1J78A 2XW1A 4ZC6A 2VUFA 4FK5B 4LA0A 4NAWB 1VFIA 4J2VA 1JNBA 2YDFA 3V03A 4ZBRA 3WHSA 2BXDA 1IJGA 5IJ5A 3LU6A 4GDKB 1E7AA 4G03A 4BKEA 5ID7A 2BX8A 4FIPB 2JUHA 2EFHA 4W4UB 4DHXB 2LOQA 2XVQA 2I30A 3FWBC 4E99A 5IIHA 2QMCA 5IJEA 2EFEA 2V36A 1HK3A 3PLAA 2DYMA 3ICXA 2BXAA 4GDXA 2Z8IA 1BKEA 3B9MA 4L8UA 1N5UA 1VZSA 5BPKA 3GQXA 3SIVB 1KXPD 2BXLA 4F5UA 3H37A 1E7HA 2XMOA 4MBEC 2BXKA 3H3AA 4HGMB 1BM0A 1E7CA 2DBUA 3M99C 4LUFA 5D7GA 1FOUA 3NVMA 2AJEA 4Z9OA 4PO0A 4M70B 3LU8A 3MHSB 2BXFA 1H5WA 3GA9L 3NMUA 5GIOA 4LUHA 2VUEA 1O9XA 4Z69A 4FJCB 1HK4A 3SIUB 2BXNA 4OT2A 5ID9A 3W1SA 5GIPA 4ZUXV 4LB9A 4S1YA 2NNWA 2DYOA 5FUOA 4K2CA 2DG5A 2Z8JA 4LB2A 4N0FD 1HK1A 5DQFA 4ZBQA 5HOZA 2BXOA 3CX9A 3B9LA 4HGKA 2XVUA 3A75A 4OTUA 5IIXA 1E7IA 1HA2A 5IJFA 3KIKA 2OT3A 2QHBA 1H9ZA 4OTTA 3FWCC 2E0XA 2Z8KA 3G9KD 3V08A 3FNMA 4ZCGA 3UIVA 3KJLA 2BXHA 3JRYA 2BXBA 2E0YA 1GNIA 2XVVA 3WHQA 2VDBA 2CKXA 3GQUA 2DBXA 1E7BA 4L9KA 1J7EA 4N0UD 1E7EA 2XW0A 1MA9A 1UORA 4TQ1A 1MIVA 2BXMA 5DBYA 1NT2B 1LOTA 2EFCA 1TXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH B;  4FJC B;  3KJL A;  3FWC C;  4FIP B;  3KIK A;  4FK5 B;  4MBE C;  4W4U B;  3FWB C;  4WA6 B;  3MHS B;  4C31 B;  4DHX B;  4ZUX V;  3M99 C; 
#chains in the Genus database with same CATH topology
 3MHH B;  4N3Z A;  1SB0 A;  4F5T A;  2BXP A;  5IFO A;  1HK5 A;  2NQO A;  4EMX A;  2QM6 A;  4DM0 A;  3A73 A;  1E7F A;  2BXQ A;  4IW2 A;  5GIN A;  2EFD A;  4L9Q A;  4JK4 A;  5GHK A;  1AO6 A;  3NVI A;  3VQI A;  2LQI A;  1MIW A;  4GG2 A;  3SQJ A;  4TQ0 A;  4ZBK A;  1BJ5 A;  4D7X A;  2KWF A;  2AGH B;  2BXI A;  2OZB B;  4G01 A;  3WHR A;  1TF0 A;  2DBW A;  2XVW A;  3V09 A;  3LU7 A;  1E78 A;  4C31 B;  2KBZ A;  4GDL B;  2I2Z A;  2XSI A;  5B5T A;  3NVK A;  3TDL A;  1MUS A;  1HK2 A;  4OR0 A;  1E7G A;  2BXG A;  1GNJ A;  4IW1 A;  4K71 A;  2ROH A;  4F5V A;  1KW2 A;  4BY9 C;  3JQZ A;  1MIY A;  4F5S A;  5IIU A;  1LNS A;  4WA6 B;  1KDX A;  4G04 A;  2BXE A;  2BXC A;  1J78 A;  2XW1 A;  4ZC6 A;  2VUF A;  4FK5 B;  4LA0 A;  4NAW B;  1VFI A;  4J2V A;  1JNB A;  2YDF A;  3V03 A;  4ZBR A;  3WHS A;  2BXD A;  1IJG A;  5IJ5 A;  2K0N A;  3LU6 A;  4GDK B;  1E7A A;  4G03 A;  4BKE A;  5ID7 A;  2BX8 A;  4FIP B;  2EFH A;  2JUH A;  4W4U B;  4DHX B;  2LOQ A;  2XVQ A;  2I30 A;  3FWB C;  4E99 A;  5IIH A;  2QMC A;  5IJE A;  2EFE A;  2V36 A;  1HK3 A;  3PLA A;  3BPJ A;  2DYM A;  3ICX A;  2BXA A;  4GDX A;  2Z8I A;  1BKE A;  3B9M A;  4L8U A;  1N5U A;  1VZS A;  5BPK A;  3GQX A;  3SIV B;  1KXP D;  2BXL A;  4F5U A;  3H37 A;  3ECP A;  1E7H A;  2XMO A;  4I9O A;  4MBE C;  2BXK A;  3H3A A;  2LXT A;  2GUT A;  1BM0 A;  4HGM B;  1E7C A;  2DBU A;  3M99 C;  4LUF A;  5D7G A;  1FOU A;  3NVM A;  2AJE A;  4Z9O A;  4PO0 A;  4M70 B;  3LU8 A;  3MHS B;  2BXF A;  1MM8 A;  2LQH A;  1H5W A;  3GA9 L;  3NMU A;  5GIO A;  2LXS A;  4LUH A;  2VUE A;  1O9X A;  4Z69 A;  4FJC B;  1MUH A;  1HK4 A;  3SIU B;  2BXN A;  4OT2 A;  5ID9 A;  3W1S A;  5GIP A;  4ZUX V;  4LB9 A;  4S1Y A;  2NNW A;  2DYO A;  5FUO A;  4K2C A;  2DG5 A;  2Z8J A;  4LB2 A;  4N0F D;  1HK1 A;  5DQF A;  4ZBQ A;  5HOZ A;  2BXO A;  3CX9 A;  3B9L A;  4HGK A;  2XVU A;  3A75 A;  4OTU A;  5IIX A;  1E7I A;  1HA2 A;  5IJF A;  3KIK A;  2OT3 A;  2QHB A;  1H9Z A;  4OTT A;  3FWC C;  2E0X A;  2Z8K A;  3G9K D;  3V08 A;  3FNM A;  4ZCG A;  3UIV A;  3KJL A;  2BXH A;  3JRY A;  2BXB A;  2E0Y A;  1GNI A;  2XVV A;  3WHQ A;  2VDB A;  2CKX A;  3GQU A;  2DBX A;  1E7B A;  4L9K A;  1J7E A;  4N0U D;  1E7E A;  2XW0 A;  1MA9 A;  1UOR A;  4TQ1 A;  1MIV A;  2BXM A;  5DBY A;  1NT2 B;  1LOT A;  2EFC A;  1TXU A; 
#chains in the Genus database with same CATH homology
 3MHH B;  4N3Z A;  4F5T A;  2BXP A;  5IFO A;  1HK5 A;  2NQO A;  4EMX A;  2QM6 A;  3A73 A;  1E7F A;  2BXQ A;  4IW2 A;  5GIN A;  2EFD A;  4L9Q A;  4JK4 A;  5GHK A;  1AO6 A;  3NVI A;  3VQI A;  1MIW A;  4GG2 A;  3SQJ A;  4TQ0 A;  4ZBK A;  1BJ5 A;  2BXI A;  2OZB B;  4G01 A;  3WHR A;  1TF0 A;  2DBW A;  2XVW A;  3V09 A;  3LU7 A;  1E78 A;  4C31 B;  2KBZ A;  4GDL B;  2I2Z A;  2XSI A;  5B5T A;  3NVK A;  3TDL A;  1HK2 A;  4OR0 A;  1E7G A;  2BXG A;  1GNJ A;  4IW1 A;  4K71 A;  2ROH A;  4F5V A;  1KW2 A;  4BY9 C;  3JQZ A;  1MIY A;  4F5S A;  5IIU A;  1LNS A;  4WA6 B;  4G04 A;  2BXE A;  2BXC A;  1J78 A;  2XW1 A;  4ZC6 A;  2VUF A;  4FK5 B;  4LA0 A;  4NAW B;  1VFI A;  4J2V A;  1JNB A;  2YDF A;  3V03 A;  4ZBR A;  3WHS A;  2BXD A;  1IJG A;  5IJ5 A;  3LU6 A;  4GDK B;  1E7A A;  4G03 A;  4BKE A;  5ID7 A;  2BX8 A;  4FIP B;  2JUH A;  2EFH A;  4W4U B;  4DHX B;  2LOQ A;  2XVQ A;  2I30 A;  3FWB C;  4E99 A;  5IIH A;  2QMC A;  5IJE A;  2EFE A;  2V36 A;  1HK3 A;  3PLA A;  2DYM A;  3ICX A;  2BXA A;  4GDX A;  2Z8I A;  1BKE A;  3B9M A;  4L8U A;  1N5U A;  1VZS A;  5BPK A;  3GQX A;  3SIV B;  1KXP D;  2BXL A;  4F5U A;  3H37 A;  1E7H A;  2XMO A;  4MBE C;  2BXK A;  3H3A A;  4HGM B;  1BM0 A;  1E7C A;  2DBU A;  3M99 C;  4LUF A;  5D7G A;  1FOU A;  3NVM A;  2AJE A;  4Z9O A;  4PO0 A;  4M70 B;  3LU8 A;  3MHS B;  2BXF A;  1H5W A;  3GA9 L;  3NMU A;  5GIO A;  4LUH A;  2VUE A;  1O9X A;  4Z69 A;  4FJC B;  1HK4 A;  3SIU B;  2BXN A;  4OT2 A;  5ID9 A;  3W1S A;  5GIP A;  4ZUX V;  4LB9 A;  4S1Y A;  2NNW A;  2DYO A;  5FUO A;  4K2C A;  2DG5 A;  2Z8J A;  4LB2 A;  4N0F D;  1HK1 A;  5DQF A;  4ZBQ A;  5HOZ A;  2BXO A;  3CX9 A;  3B9L A;  4HGK A;  2XVU A;  3A75 A;  4OTU A;  5IIX A;  1E7I A;  1HA2 A;  5IJF A;  3KIK A;  2OT3 A;  2QHB A;  1H9Z A;  4OTT A;  3FWC C;  2E0X A;  2Z8K A;  3G9K D;  3V08 A;  3FNM A;  4ZCG A;  3UIV A;  3KJL A;  2BXH A;  3JRY A;  2BXB A;  2E0Y A;  1GNI A;  2XVV A;  3WHQ A;  2VDB A;  2CKX A;  3GQU A;  2DBX A;  1E7B A;  4L9K A;  1J7E A;  4N0U D;  1E7E A;  2XW0 A;  1MA9 A;  1UOR A;  4TQ1 A;  1MIV A;  2BXM A;  5DBY A;  1NT2 B;  1LOT A;  2EFC A;  1TXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...