4ZUXV

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
TAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 89
sequence length 89
chains with identical sequence a, f, k
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4zuxV00
3M99C 3FWCC 4C31B 3MHSB 3KIKA 4DHXB 4ZUXV 3FWBC 4FK5B 4MBEC 4W4UB 4FIPB 4WA6B 4FJCB 3MHHB 3KJLA
chains in the Genus database with same CATH superfamily
1FOUA 4OT2A 5GHKA 3SQJA 4IW2A 4ZBKA 2XMOA 3NVMA 5IIHA 1HK3A 1H9ZA 1TXUA 2DBXA 2XVWA 3GQUA 1J78A 1MUHA 2EFCA 1VFIA 4NAWB 4ZUXV 5ID9A 5DBYA 4N0FD 3NVIA 4W4UB 4Z69A 2XSIA 4S1YA 4F5SA 4N3ZA 4ZC6A 4LB9A 3A75A 4M70B 2AGHB 4L9KA 2XW0A 2CKXA 1E7CA 4I9OA 2VUEA 3B9MA 5DQFA 3NMUA 1GNJA 2EFDA 5FUOA 4DHXB 3FWBC 5BPKA 1KW2A 3GA9L 2LOQA 3H3AA 3M99C 4TQ1A 2BXIA 3ECPA 4OR0A 2GUTA 1HA2A 2AJEA 3PLAA 2EFHA 5B5TA 2BXQA 1VZSA 2DBUA 3WHRA 2BXDA 5D7GA 4LB2A 3MHSB 1E7HA 1AO6A 2YDFA 2VDBA 2I2ZA 3JQZA 4LUFA 2BXGA 1GNIA 4K71A 4OTUA 4PO0A 3CX9A 4F5VA 2Z8KA 1J7EA 1LOTA 2BXHA 4C31B 1KDXA 2XVQA 2Z8IA 4IW1A 5IJFA 2ROHA 3SIVB 2KWFA 1E7GA 3V03A 4BY9C 4F5UA 1BJ5A 3H37A 4G03A 4ZBRA 4FJCB 2KBZA 1BKEA 3B9LA 3FWCC 3G9KD 5GIOA 1MIVA 5HOZA 2LXSA 3GQXA 2BXOA 2DBWA 2NQOA 4ZCGA 1E7BA 2K0NA 4L8UA 5IIXA 2OZBB 3W1SA 3JRYA 4HGKA 3WHSA 1E7AA 3ICXA 5GINA 1MUSA 1IJGA 1E7FA 2DG5A 4OTTA 3TDLA 2BXNA 4WA6B 1HK1A 1HK2A 2BXKA 2LXTA 4F5TA 1SB0A 1HK4A 2DYOA 2BXLA 1E7EA 2V36A 1JNBA 1TF0A 2LQIA 3KJLA 3KIKA 5IFOA 4GDLB 3UIVA 1O9XA 3SIUB 2LQHA 2QM6A 5ID7A 4K2CA 1LNSA 1MIYA 3VQIA 2E0YA 3LU7A 1MA9A 2BXFA 4D7XA 1MM8A 4E99A 2BXAA 2VUFA 4MBEC 4N0UD 3LU6A 4LUHA 3A73A 2BXBA 4ZBQA 1UORA 2E0XA 4GG2A 4L9QA 4Z9OA 3WHQA 4TQ0A 2QMCA 2XVUA 3NVKA 1E7IA 4GDKB 1KXPD 2Z8JA 2BXEA 1H5WA 1HK5A 2XW1A 4J2VA 2BXMA 2NNWA 3V08A 4FIPB 4GDXA 4JK4A 5GIPA 3FNMA 3MHHB 4FK5B 4DM0A 4G01A 2BX8A 2QHBA 4EMXA 2OT3A 1MIWA 4LA0A 3V09A 5IJ5A 1NT2B 2EFEA 2JUHA 2BXPA 1BM0A 2XVVA 5IIUA 1N5UA 2BXCA 3BPJA 4BKEA 3LU8A 5IJEA 2I30A 4HGMB 2DYMA 1E78A 4G04A
chains in the Genus database with same CATH topology
1FOUA 4OT2A 5GHKA 3SQJA 4IW2A 4ZBKA 2XMOA 3NVMA 5IIHA 1HK3A 1H9ZA 1TXUA 2DBXA 2XVWA 3GQUA 1J78A 2EFCA 1VFIA 4NAWB 4ZUXV 5ID9A 5DBYA 4N0FD 3NVIA 4W4UB 4Z69A 2XSIA 4S1YA 4F5SA 4N3ZA 4ZC6A 4LB9A 3A75A 4M70B 4L9KA 2XW0A 2CKXA 1E7CA 2VUEA 3B9MA 5DQFA 3NMUA 1GNJA 2EFDA 4DHXB 3FWBC 5BPKA 1KW2A 3GA9L 2LOQA 3H3AA 3M99C 4TQ1A 2BXIA 4OR0A 1HA2A 2AJEA 3PLAA 2EFHA 5B5TA 2BXQA 1VZSA 2DBUA 3WHRA 2BXDA 5D7GA 4LB2A 3MHSB 1E7HA 1AO6A 2YDFA 2VDBA 2I2ZA 3JQZA 4LUFA 2BXGA 1GNIA 4K71A 4OTUA 4PO0A 3CX9A 4F5VA 2Z8KA 1J7EA 1LOTA 2BXHA 4C31B 2XVQA 2Z8IA 4IW1A 5IJFA 2ROHA 3SIVB 3V03A 1E7GA 4BY9C 4F5UA 1BJ5A 3H37A 4G03A 4ZBRA 4FJCB 2KBZA 1BKEA 3B9LA 3FWCC 3G9KD 5GIOA 1MIVA 5HOZA 3GQXA 2BXOA 2DBWA 2NQOA 4ZCGA 1E7BA 4L8UA 5IIXA 2OZBB 3W1SA 3JRYA 4HGKA 3WHSA 1E7AA 3ICXA 5GINA 1IJGA 1E7FA 2DG5A 4OTTA 3TDLA 2BXNA 4WA6B 1HK1A 1HK2A 2BXKA 4F5TA 5FUOA 1HK4A 2DYOA 2BXLA 1E7EA 2V36A 1JNBA 1TF0A 3KJLA 3KIKA 5IFOA 4GDLB 3UIVA 1O9XA 3SIUB 2QM6A 5ID7A 4K2CA 1LNSA 1MIYA 3VQIA 2E0YA 3LU7A 1MA9A 2BXFA 4E99A 2BXAA 2VUFA 4MBEC 4N0UD 3LU6A 4LUHA 3A73A 2BXBA 4ZBQA 1UORA 2E0XA 4GG2A 4L9QA 4Z9OA 3WHQA 4TQ0A 2QMCA 2XVUA 3NVKA 1E7IA 4GDKB 1KXPD 2Z8JA 2BXEA 1H5WA 1HK5A 2XW1A 4J2VA 2BXMA 2NNWA 3V08A 4FIPB 4GDXA 4JK4A 5GIPA 3FNMA 3MHHB 4FK5B 4G01A 2BX8A 2QHBA 4EMXA 2OT3A 1MIWA 4LA0A 3V09A 5IJ5A 1NT2B 2EFEA 2JUHA 2BXPA 1BM0A 2XVVA 5IIUA 1N5UA 2BXCA 4BKEA 5IJEA 3LU8A 2I30A 4HGMB 2DYMA 1E78A 4G04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 C;  3FWC C;  4C31 B;  3MHS B;  3KIK A;  4DHX B;  4ZUX V;  3FWB C;  4FK5 B;  4MBE C;  4W4U B;  4FIP B;  4WA6 B;  4FJC B;  3MHH B;  3KJL A; 
#chains in the Genus database with same CATH topology
 1FOU A;  4OT2 A;  5GHK A;  3SQJ A;  4IW2 A;  4ZBK A;  2XMO A;  3NVM A;  5IIH A;  1HK3 A;  1H9Z A;  1TXU A;  2DBX A;  2XVW A;  3GQU A;  1J78 A;  1MUH A;  2EFC A;  1VFI A;  4NAW B;  4ZUX V;  5ID9 A;  5DBY A;  4N0F D;  3NVI A;  4W4U B;  4Z69 A;  2XSI A;  4S1Y A;  4F5S A;  4N3Z A;  4ZC6 A;  4LB9 A;  3A75 A;  4M70 B;  2AGH B;  4L9K A;  2XW0 A;  2CKX A;  1E7C A;  4I9O A;  2VUE A;  3B9M A;  5DQF A;  3NMU A;  1GNJ A;  2EFD A;  5FUO A;  4DHX B;  3FWB C;  5BPK A;  1KW2 A;  3GA9 L;  2LOQ A;  3H3A A;  3M99 C;  4TQ1 A;  2BXI A;  3ECP A;  4OR0 A;  2GUT A;  1HA2 A;  2AJE A;  3PLA A;  2EFH A;  5B5T A;  2BXQ A;  1VZS A;  2DBU A;  3WHR A;  2BXD A;  5D7G A;  4LB2 A;  3MHS B;  1E7H A;  1AO6 A;  2YDF A;  2VDB A;  2I2Z A;  3JQZ A;  4LUF A;  2BXG A;  1GNI A;  4K71 A;  4OTU A;  4PO0 A;  3CX9 A;  4F5V A;  2Z8K A;  1J7E A;  1LOT A;  2BXH A;  4C31 B;  1KDX A;  2XVQ A;  2Z8I A;  4IW1 A;  5IJF A;  2ROH A;  3SIV B;  2KWF A;  1E7G A;  3V03 A;  4BY9 C;  4F5U A;  1BJ5 A;  3H37 A;  4G03 A;  4ZBR A;  4FJC B;  2KBZ A;  1BKE A;  3B9L A;  3FWC C;  3G9K D;  5GIO A;  1MIV A;  5HOZ A;  2LXS A;  3GQX A;  2BXO A;  2DBW A;  2NQO A;  4ZCG A;  1E7B A;  2K0N A;  4L8U A;  5IIX A;  2OZB B;  3W1S A;  3JRY A;  4HGK A;  3WHS A;  1E7A A;  3ICX A;  5GIN A;  1MUS A;  1IJG A;  1E7F A;  2DG5 A;  4OTT A;  3TDL A;  2BXN A;  4WA6 B;  1HK1 A;  1HK2 A;  2BXK A;  2LXT A;  4F5T A;  1SB0 A;  1HK4 A;  2DYO A;  2BXL A;  1E7E A;  2V36 A;  1JNB A;  1TF0 A;  2LQI A;  3KJL A;  3KIK A;  5IFO A;  4GDL B;  3UIV A;  1O9X A;  3SIU B;  2LQH A;  2QM6 A;  5ID7 A;  4K2C A;  1LNS A;  1MIY A;  3VQI A;  2E0Y A;  3LU7 A;  1MA9 A;  2BXF A;  4D7X A;  1MM8 A;  4E99 A;  2BXA A;  2VUF A;  4MBE C;  4N0U D;  3LU6 A;  4LUH A;  3A73 A;  2BXB A;  4ZBQ A;  1UOR A;  2E0X A;  4GG2 A;  4L9Q A;  4Z9O A;  3WHQ A;  4TQ0 A;  2QMC A;  2XVU A;  3NVK A;  1E7I A;  4GDK B;  1KXP D;  2Z8J A;  2BXE A;  1H5W A;  1HK5 A;  2XW1 A;  4J2V A;  2BXM A;  2NNW A;  3V08 A;  4FIP B;  4GDX A;  4JK4 A;  5GIP A;  3FNM A;  3MHH B;  4FK5 B;  4DM0 A;  4G01 A;  2BX8 A;  2QHB A;  4EMX A;  2OT3 A;  1MIW A;  4LA0 A;  3V09 A;  5IJ5 A;  1NT2 B;  2EFE A;  2JUH A;  2BXP A;  1BM0 A;  2XVV A;  5IIU A;  1N5U A;  2BXC A;  3BPJ A;  4BKE A;  3LU8 A;  5IJE A;  2I30 A;  4HGM B;  2DYM A;  1E78 A;  4G04 A; 
#chains in the Genus database with same CATH homology
 1FOU A;  4OT2 A;  5GHK A;  3SQJ A;  4IW2 A;  4ZBK A;  2XMO A;  3NVM A;  5IIH A;  1HK3 A;  1H9Z A;  1TXU A;  2DBX A;  2XVW A;  3GQU A;  1J78 A;  2EFC A;  1VFI A;  4NAW B;  4ZUX V;  5ID9 A;  5DBY A;  4N0F D;  3NVI A;  4W4U B;  4Z69 A;  2XSI A;  4S1Y A;  4F5S A;  4N3Z A;  4ZC6 A;  4LB9 A;  3A75 A;  4M70 B;  4L9K A;  2XW0 A;  2CKX A;  1E7C A;  2VUE A;  3B9M A;  5DQF A;  3NMU A;  1GNJ A;  2EFD A;  4DHX B;  3FWB C;  5BPK A;  1KW2 A;  3GA9 L;  2LOQ A;  3H3A A;  3M99 C;  4TQ1 A;  2BXI A;  4OR0 A;  1HA2 A;  2AJE A;  3PLA A;  2EFH A;  5B5T A;  2BXQ A;  1VZS A;  2DBU A;  3WHR A;  2BXD A;  5D7G A;  4LB2 A;  3MHS B;  1E7H A;  1AO6 A;  2YDF A;  2VDB A;  2I2Z A;  3JQZ A;  4LUF A;  2BXG A;  1GNI A;  4K71 A;  4OTU A;  4PO0 A;  3CX9 A;  4F5V A;  2Z8K A;  1J7E A;  1LOT A;  2BXH A;  4C31 B;  2XVQ A;  2Z8I A;  4IW1 A;  5IJF A;  2ROH A;  3SIV B;  3V03 A;  1E7G A;  4BY9 C;  4F5U A;  1BJ5 A;  3H37 A;  4G03 A;  4ZBR A;  4FJC B;  2KBZ A;  1BKE A;  3B9L A;  3FWC C;  3G9K D;  5GIO A;  1MIV A;  5HOZ A;  3GQX A;  2BXO A;  2DBW A;  2NQO A;  4ZCG A;  1E7B A;  4L8U A;  5IIX A;  2OZB B;  3W1S A;  3JRY A;  4HGK A;  3WHS A;  1E7A A;  3ICX A;  5GIN A;  1IJG A;  1E7F A;  2DG5 A;  4OTT A;  3TDL A;  2BXN A;  4WA6 B;  1HK1 A;  1HK2 A;  2BXK A;  4F5T A;  5FUO A;  1HK4 A;  2DYO A;  2BXL A;  1E7E A;  2V36 A;  1JNB A;  1TF0 A;  3KJL A;  3KIK A;  5IFO A;  4GDL B;  3UIV A;  1O9X A;  3SIU B;  2QM6 A;  5ID7 A;  4K2C A;  1LNS A;  1MIY A;  3VQI A;  2E0Y A;  3LU7 A;  1MA9 A;  2BXF A;  4E99 A;  2BXA A;  2VUF A;  4MBE C;  4N0U D;  3LU6 A;  4LUH A;  3A73 A;  2BXB A;  4ZBQ A;  1UOR A;  2E0X A;  4GG2 A;  4L9Q A;  4Z9O A;  3WHQ A;  4TQ0 A;  2QMC A;  2XVU A;  3NVK A;  1E7I A;  4GDK B;  1KXP D;  2Z8J A;  2BXE A;  1H5W A;  1HK5 A;  2XW1 A;  4J2V A;  2BXM A;  2NNW A;  3V08 A;  4FIP B;  4GDX A;  4JK4 A;  5GIP A;  3FNM A;  3MHH B;  4FK5 B;  4G01 A;  2BX8 A;  2QHB A;  4EMX A;  2OT3 A;  1MIW A;  4LA0 A;  3V09 A;  5IJ5 A;  1NT2 B;  2EFE A;  2JUH A;  2BXP A;  1BM0 A;  2XVV A;  5IIU A;  1N5U A;  2BXC A;  4BKE A;  5IJE A;  3LU8 A;  2I30 A;  4HGM B;  2DYM A;  1E78 A;  4G04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...