1VHYA

Crystal structure of haemophilus influenzae protein hi0303, pfam duf558
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
245
structure length
241
Chain Sequence
b'IPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVIRMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI0303
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 241
sequence length 245
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhyA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhyA02
1VHYA 1NS5A 2EGWA 1P9PA 1UAJA 4YQ5A 1OY5A 5GMCA 4YVKA 3DCMX 4YQJA 4MCDA 4KGNA 4YQQA 3O7BA 1VHKA 1MXIA 4YQCA 3AXZA 4MCBA 3OIIA 1K3RA 3OIJA 3ONPA 5GMBA 4E8BA 4YQSA 3NK6A 5D9FA 4YVGA 4YQRA 4PZKA 4YVJA 4YQBA 4H3ZA 3BBDA 4YQ9A 4YQAA 4YQ2A 3N4JA 4J3CA 1GZ0A 4JAKA 4YQNA 4YQ0A 5CO4A 1O6DA 3KNUA 4IG6A 5FAIA 1Z85A 4X3LA 4YPWA 4YQTA 1V6ZA 3N4KA 3IEFA 1UAMA 2CX8A 1IPAA 3L8UA 4YPXA 4YQOA 4L69A 4YQGA 1TO0A 1X7OA 3NK7A 4YPZA 1ZJRA 3KTYA 2YY8A 4YQ8A 1VH0A 3BBHA 1NXZA 4KDZA 4CNDA 5GM8A 4YQ4A 3QUVA 1J85A 4YVHA 4JALA 3KW2A 2NWAA 3GYQA 4XBOA 4YQDA 4CNFA 2QWVA 3AIAA 4RG1A 4YQKA 1UALA 4YQLA 1UAKA 2EGVA 4YQIA 4YQ7A 4FAKA 3AI9X 2QMMA 3IC6A 4YQ1A 4CNGA 4X3MA 3ILKA 2Z0YA 2O3AA 4YVIA 3OINA 4YQPA 4YQ6A 4MCCA 3BBEA 2V3JA 4H3YA 1X7PA 4YPYA 3E5YA 4YQ3A 2HA8A 3KY7A 1V2XA 4CNEA 2V3KA 2I6DA
chains in the Genus database with same CATH superfamily
1VHYA 1NS5A 2EGWA 1P9PA 1UAJA 1QRSA 5GAEW 4YQ5A 1OY5A 5GMCA 2HZ7A 1GTSA 4JXZA 3DCMX 4WFBS 4YVKA 3CZBA 1O0CA 5BNZA 4YQJA 4MCDA 4KGNA 4YQQA 4H3SA 3O7BA 1VHKA 1MXIA 4YQCA 3AXZA 4MCBA 3OIIA 1K3RA 3OIJA 3ONPA 5GMBA 3J7ZV 4UY88 4E8BA 4YQSA 3NK6A 5D9FA 4YVGA 4JYZA 4PZKA 4YQRA 4YVJA 4YQBA 4H3ZA 3BBDA 1FEUA 1EUYA 1QTQA 4YQ9A 5IZNA 4YQAA 2PNWA 4YQ2A 3N4JA 4FMWA 4J3CA 1GZ0A 4JAKA 4YQNA 3DLLS 4JXXA 4YQ0A 3PIOS 1EUQA 5CO4A 1O6DA 3KNUA 4IG6A 1QRUA 4IOCS 5FAIA 1Z85A 5GAGW 4IO9S 4X3LA 4YPWA 4YQTA 1V6ZA 2AE0X 1ZJWA 3N4KA 3IEFA 1UAMA 2CX8A 2ZJRS 1D6KA 1UDXA 1IPAA 3L8UA 4YPXA 4WFNS 2ZJQS 3AIIA 4YQOA 1B75A 4L69A 4JWJA 4YQGA 1TO0A 1X7OA 3NK7A 4YPZA 4WF9S 1ZJRA 5GAHW 3KTYA 2YY8A 4YQ8A 1VH0A 4JWFA 3BBHA 1NXZA 5GADW 4KDZA 4WFAS 3CF5S 4CNDA 2PICA 4U67S 5GM8A 4YQ4A 3QUVA 1J85A 3W2WB 5HL7S 4YVHA 5DM6S 3X1LB 2G6GA 2PJJA 4JALA 3KW2A 2NWAA 3GYQA 4XBOA 4YQDA 2G5DA 4CNFA 2QWVA 3AIAA 4RG1A 4YQKA 1UALA 4YQLA 1UAKA 2EGVA 4YQIA 4YQ7A 4FAKA 2RD2A 3AI9X 2QMMA 3IC6A 1QRTA 4IOAS 4JWHA 4YQ1A 4CNGA 4X3MA 3ILKA 1GTRA 2PI8A 2Z0YA 4V194 2O3AA 4YVIA 2ZJPS 3OINA 4YQPA 1EXDA 4YQ6A 3W2VB 4MCCA 5JVHS 5JVGS 4H4KA 3BBEA 2V3JA 4H3YA 1X7PA 1O0BA 4YPYA 3E5YA 4YQ3A 2RE8A 1DFUP 2GAEA 3PIPS 5DM7S 2HA8A 3KY7A 4P2BA 4WCES 1V2XA 2V3KA 4CNEA 2I6DA 4JWGA 1NYLA
chains in the Genus database with same CATH topology
1VHYA 1NS5A 2EGWA 1P9PA 1UAJA 4YQ5A 1OY5A 5GMCA 4YVKA 3DCMX 4YQJA 4MCDA 4KGNA 4YQQA 3O7BA 1VHKA 1MXIA 4YQCA 3AXZA 4MCBA 3OIIA 1K3RA 3OIJA 3ONPA 5GMBA 4E8BA 4YQSA 3NK6A 5D9FA 4YVGA 4YQRA 4PZKA 4YVJA 4YQBA 4H3ZA 3BBDA 4YQ9A 4YQAA 4YQ2A 3N4JA 4FMWA 4J3CA 1GZ0A 4JAKA 4YQNA 4YQ0A 5CO4A 1O6DA 3KNUA 4IG6A 5FAIA 1Z85A 4X3LA 4YPWA 4YQTA 1V6ZA 3N4KA 3IEFA 1UAMA 2CX8A 1IPAA 3L8UA 4YPXA 4YQOA 4L69A 4JWJA 4YQGA 1TO0A 1X7OA 3NK7A 4YPZA 1ZJRA 3KTYA 2YY8A 4YQ8A 1VH0A 4JWFA 3BBHA 1NXZA 4KDZA 4CNDA 5GM8A 4YQ4A 3QUVA 1J85A 4YVHA 4JALA 3KW2A 2NWAA 3GYQA 4XBOA 4YQDA 4CNFA 2QWVA 3AIAA 4RG1A 4YQKA 1UALA 4YQLA 1UAKA 2EGVA 4YQIA 4YQ7A 4FAKA 3AI9X 2QMMA 3IC6A 4JWHA 4YQ1A 4CNGA 4X3MA 3ILKA 2Z0YA 2O3AA 4YVIA 3OINA 4YQPA 4YQ6A 4MCCA 3BBEA 2V3JA 4H3YA 1X7PA 4YPYA 3E5YA 4YQ3A 2HA8A 3KY7A 1V2XA 4CNEA 2V3KA 2I6DA 4JWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHY A;  1NS5 A;  2EGW A;  1P9P A;  1UAJ A;  4YQ5 A;  1OY5 A;  5GMC A;  4YVK A;  3DCM X;  4YQJ A;  4MCD A;  4KGN A;  4YQQ A;  3O7B A;  1VHK A;  1MXI A;  4YQC A;  3AXZ A;  4MCB A;  3OII A;  1K3R A;  3OIJ A;  3ONP A;  5GMB A;  4E8B A;  4YQS A;  3NK6 A;  5D9F A;  4YVG A;  4YQR A;  4PZK A;  4YVJ A;  4YQB A;  4H3Z A;  3BBD A;  4YQ9 A;  4YQA A;  4YQ2 A;  3N4J A;  4J3C A;  1GZ0 A;  4JAK A;  4YQN A;  4YQ0 A;  5CO4 A;  1O6D A;  3KNU A;  4IG6 A;  5FAI A;  1Z85 A;  4X3L A;  4YPW A;  4YQT A;  1V6Z A;  3N4K A;  3IEF A;  1UAM A;  2CX8 A;  1IPA A;  3L8U A;  4YPX A;  4YQO A;  4L69 A;  4YQG A;  1TO0 A;  1X7O A;  3NK7 A;  4YPZ A;  1ZJR A;  3KTY A;  2YY8 A;  4YQ8 A;  1VH0 A;  3BBH A;  1NXZ A;  4KDZ A;  4CND A;  5GM8 A;  4YQ4 A;  3QUV A;  1J85 A;  4YVH A;  4JAL A;  3KW2 A;  2NWA A;  3GYQ A;  4XBO A;  4YQD A;  4CNF A;  2QWV A;  3AIA A;  4RG1 A;  4YQK A;  1UAL A;  4YQL A;  1UAK A;  2EGV A;  4YQI A;  4YQ7 A;  4FAK A;  3AI9 X;  2QMM A;  3IC6 A;  4YQ1 A;  4CNG A;  4X3M A;  3ILK A;  2Z0Y A;  2O3A A;  4YVI A;  3OIN A;  4YQP A;  4YQ6 A;  4MCC A;  3BBE A;  2V3J A;  4H3Y A;  1X7P A;  4YPY A;  3E5Y A;  4YQ3 A;  2HA8 A;  3KY7 A;  1V2X A;  4CNE A;  2V3K A;  2I6D A; 
#chains in the Genus database with same CATH topology
 1VHY A;  1NS5 A;  2EGW A;  1P9P A;  1UAJ A;  1QRS A;  5GAE W;  4YQ5 A;  1OY5 A;  5GMC A;  2HZ7 A;  1GTS A;  4JXZ A;  3DCM X;  4WFB S;  4YVK A;  3CZB A;  1O0C A;  5BNZ A;  4YQJ A;  4MCD A;  4KGN A;  4YQQ A;  4H3S A;  3O7B A;  1VHK A;  1MXI A;  4YQC A;  3AXZ A;  4MCB A;  3OII A;  1K3R A;  3OIJ A;  3ONP A;  5GMB A;  3J7Z V;  4UY8 8;  4E8B A;  4YQS A;  3NK6 A;  5D9F A;  4YVG A;  4JYZ A;  4PZK A;  4YQR A;  4YVJ A;  4YQB A;  4H3Z A;  3BBD A;  1FEU A;  1EUY A;  1QTQ A;  4YQ9 A;  5IZN A;  4YQA A;  2PNW A;  4YQ2 A;  3N4J A;  4FMW A;  4J3C A;  1GZ0 A;  4JAK A;  4YQN A;  3DLL S;  4JXX A;  4YQ0 A;  3PIO S;  1EUQ A;  5CO4 A;  1O6D A;  3KNU A;  4IG6 A;  1QRU A;  4IOC S;  5FAI A;  1Z85 A;  5GAG W;  4IO9 S;  4X3L A;  4YPW A;  4YQT A;  1V6Z A;  2AE0 X;  1ZJW A;  3N4K A;  3IEF A;  1UAM A;  2CX8 A;  2ZJR S;  1D6K A;  1UDX A;  1IPA A;  3L8U A;  4YPX A;  4WFN S;  2ZJQ S;  3AII A;  4YQO A;  1B75 A;  4L69 A;  4JWJ A;  4YQG A;  1TO0 A;  1X7O A;  3NK7 A;  4YPZ A;  4WF9 S;  1ZJR A;  5GAH W;  3KTY A;  2YY8 A;  4YQ8 A;  1VH0 A;  4JWF A;  3BBH A;  1NXZ A;  5GAD W;  4KDZ A;  4WFA S;  3CF5 S;  4CND A;  2PIC A;  4U67 S;  5GM8 A;  4YQ4 A;  3QUV A;  1J85 A;  3W2W B;  5HL7 S;  4YVH A;  5DM6 S;  3X1L B;  2G6G A;  2PJJ A;  4JAL A;  3KW2 A;  2NWA A;  3GYQ A;  4XBO A;  4YQD A;  2G5D A;  4CNF A;  2QWV A;  3AIA A;  4RG1 A;  4YQK A;  1UAL A;  4YQL A;  1UAK A;  2EGV A;  4YQI A;  4YQ7 A;  4FAK A;  2RD2 A;  3AI9 X;  2QMM A;  3IC6 A;  1QRT A;  4IOA S;  4JWH A;  4YQ1 A;  4CNG A;  4X3M A;  3ILK A;  1GTR A;  2PI8 A;  2Z0Y A;  4V19 4;  2O3A A;  4YVI A;  2ZJP S;  3OIN A;  4YQP A;  1EXD A;  4YQ6 A;  3W2V B;  4MCC A;  5JVH S;  5JVG S;  4H4K A;  3BBE A;  2V3J A;  4H3Y A;  1X7P A;  1O0B A;  4YPY A;  3E5Y A;  4YQ3 A;  2RE8 A;  1DFU P;  2GAE A;  3PIP S;  5DM7 S;  2HA8 A;  3KY7 A;  4P2B A;  4WCE S;  1V2X A;  2V3K A;  4CNE A;  2I6D A;  4JWG A;  1NYL A; 
#chains in the Genus database with same CATH homology
 1VHY A;  1NS5 A;  2EGW A;  1P9P A;  1UAJ A;  4YQ5 A;  1OY5 A;  5GMC A;  4YVK A;  3DCM X;  4YQJ A;  4MCD A;  4KGN A;  4YQQ A;  3O7B A;  1VHK A;  1MXI A;  4YQC A;  3AXZ A;  4MCB A;  3OII A;  1K3R A;  3OIJ A;  3ONP A;  5GMB A;  4E8B A;  4YQS A;  3NK6 A;  5D9F A;  4YVG A;  4YQR A;  4PZK A;  4YVJ A;  4YQB A;  4H3Z A;  3BBD A;  4YQ9 A;  4YQA A;  4YQ2 A;  3N4J A;  4FMW A;  4J3C A;  1GZ0 A;  4JAK A;  4YQN A;  4YQ0 A;  5CO4 A;  1O6D A;  3KNU A;  4IG6 A;  5FAI A;  1Z85 A;  4X3L A;  4YPW A;  4YQT A;  1V6Z A;  3N4K A;  3IEF A;  1UAM A;  2CX8 A;  1IPA A;  3L8U A;  4YPX A;  4YQO A;  4L69 A;  4JWJ A;  4YQG A;  1TO0 A;  1X7O A;  3NK7 A;  4YPZ A;  1ZJR A;  3KTY A;  2YY8 A;  4YQ8 A;  1VH0 A;  4JWF A;  3BBH A;  1NXZ A;  4KDZ A;  4CND A;  5GM8 A;  4YQ4 A;  3QUV A;  1J85 A;  4YVH A;  4JAL A;  3KW2 A;  2NWA A;  3GYQ A;  4XBO A;  4YQD A;  4CNF A;  2QWV A;  3AIA A;  4RG1 A;  4YQK A;  1UAL A;  4YQL A;  1UAK A;  2EGV A;  4YQI A;  4YQ7 A;  4FAK A;  3AI9 X;  2QMM A;  3IC6 A;  4JWH A;  4YQ1 A;  4CNG A;  4X3M A;  3ILK A;  2Z0Y A;  2O3A A;  4YVI A;  3OIN A;  4YQP A;  4YQ6 A;  4MCC A;  3BBE A;  2V3J A;  4H3Y A;  1X7P A;  4YPY A;  3E5Y A;  4YQ3 A;  2HA8 A;  3KY7 A;  1V2X A;  4CNE A;  2V3K A;  2I6D A;  4JWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...