4UORA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes in complex with glycerol phosphate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
Knots found
sequence length
418
structure length
417
Chain Sequence
SSDVTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transferase
molecule keywords LIPOTEICHOIC ACID SYNTHASE
total genus 168
structure length 417
sequence length 418
chains with identical sequence B, C, D, E, F, G, H, I, J, K
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uorA02
4LQYA 2W5WA 5IJSA 3KD8A 3UN5A 5GRRA 1ALIA 3T02A 2W5SA 1O99A 5KXAA 3DPCA 2GA3A 1AJDA 2GSUA 1ELZA 1KH7A 3TWZA 4LR8A 1AUKA 1E2SP 3NKNA 3T01A 5HRTA 2ZKTA 4MIVA 2D1GA 4GTZA 2GSOA 4UOPA 1ALKA 5L0BA 4CYRA 4KAYA 3WAYA 3E2DA 3MK0A 4LRCA 2GSNA 1FSUA 1AJCA 1HJKA 4CXKA 1HDHA 4KAVA 4LREA 1SHNA 2G9YA 1ANJA 4TN0A 1K7HA 4YR1A 4ZG7A 1ALJA 5LQQA 4FDIA 4NWJA 4ZG9A 3CMRA 3BDHA 3BDGA 5GOVA 2W5RA 1URAA 1Y7AA 5DLTA 1E33P 2W5QA 1EW2A 4N7TA 4LR9A 2VQRA 3NKPA 3Q3QA 3MK1A 1ED8A 2GLQA 3B5QA 4NWXA 4KJDA 1B8JA 2IUCA 3TX0A 3MK2A 5EGEA 4CXSA 1SHQA 3M8ZA 4FDJA 4LRDA 4ZGAA 4GTYA 2XRGA 3DYCA 4LR7A 3T00A 3M8YA 5TJ3A 1KHJA 4UORA 1KH5A 5INHA 1EW8A 3WAVA 4UPHA 1ALHA 2W5VA 3UO0A 3IDDA 1EI6A 3BDFA 3UN3A 1ZEBA 1N2LA 2W5TA 5DLVA 3IGZB 2W8SA 1O98A 4MY4A 5AJ9A 3WBHA 3WAWA 5EGHA 4MHXA 2W5XA 4KM4A 3NKOA 1Y6VA 1URBA 3NKMA 5C66A 4ZG6A 3SZZA 4B56A 5L0EA 3OT9A 5DLWA 1EQJA 1AJAA 4CXUA 5LRMA 2X98A 2RH6A 1E1ZP 5LIAA 1KHLA 4QAXA 1ED9A 1KH9A 3WAXA 3UNYA 4CYSA 1ELXA 3M7VA 2IUCB 4LR2A 1ANIA 1KHNA 5K4PA 4LRBA 1HQAA 3LXQA 4GTXA 3UN2A 5L0KA 2XR9A 4UOOA 1ZEDA 4LRAA 2ANHA 1EW9A 1E3CP 4GTWA 3M8WA 1EJJA 4UPLA 2IFYA 1KH4A 3A52A 3ED4A 2QZUA 3BDGB 3NKRA 3IGYB 1ELYA 1N2KA 3SZYA 1ZEFA 3NKQA 4UPKA 1AJBA 4KJGA 3TG0A 1KHKA 4UPIA 5LRNA 4LRFA 5IJQA 1P49A 2W8DA 3NVLA
chains in the Genus database with same CATH superfamily
4LQYA 2W5WA 5IJSA 3KD8A 3UN5A 5GRRA 1ALIA 3T02A 2W5SA 1O99A 5KXAA 3DPCA 2GA3A 1AJDA 2GSUA 1ELZA 1KH7A 3TWZA 4LR8A 1AUKA 1E2SP 3NKNA 3T01A 5HRTA 2ZKTA 4MIVA 2D1GA 4GTZA 2GSOA 4UOPA 1ALKA 5L0BA 4CYRA 4KAYA 3WAYA 3E2DA 3MK0A 4LRCA 2GSNA 1FSUA 1AJCA 1HJKA 4CXKA 1HDHA 4KAVA 4LREA 1SHNA 2G9YA 1ANJA 4TN0A 1K7HA 4YR1A 4ZG7A 1ALJA 5LQQA 4FDIA 4NWJA 4ZG9A 3CMRA 3BDHA 3BDGA 5GOVA 2W5RA 1URAA 1Y7AA 5DLTA 1E33P 2W5QA 1EW2A 4N7TA 4LR9A 2VQRA 3NKPA 3Q3QA 3MK1A 1ED8A 2GLQA 3B5QA 4NWXA 4KJDA 1B8JA 2IUCA 3TX0A 3MK2A 5EGEA 4CXSA 1SHQA 3M8ZA 4FDJA 4LRDA 4ZGAA 4GTYA 2XRGA 3DYCA 4LR7A 3T00A 3M8YA 5TJ3A 1KHJA 4UORA 1KH5A 5INHA 1EW8A 3WAVA 4UPHA 1ALHA 2W5VA 3UO0A 3IDDA 1EI6A 3BDFA 3UN3A 1ZEBA 1N2LA 2W5TA 5DLVA 3IGZB 2W8SA 1O98A 4MY4A 5AJ9A 3WBHA 3WAWA 5EGHA 4MHXA 2W5XA 4KM4A 3NKOA 1Y6VA 1URBA 3NKMA 5C66A 4ZG6A 3SZZA 4B56A 5L0EA 3OT9A 5DLWA 1EQJA 1AJAA 4CXUA 5LRMA 2X98A 2RH6A 1E1ZP 5LIAA 1KHLA 4QAXA 1ED9A 1KH9A 3WAXA 3UNYA 4CYSA 1ELXA 3M7VA 2IUCB 4LR2A 1ANIA 1KHNA 5K4PA 4LRBA 1HQAA 3LXQA 4GTXA 3UN2A 5L0KA 2XR9A 4UOOA 1ZEDA 4LRAA 2ANHA 1EW9A 1E3CP 4GTWA 3M8WA 1EJJA 4UPLA 2IFYA 1KH4A 3A52A 3ED4A 2QZUA 3BDGB 3NKRA 3IGYB 1ELYA 1N2KA 3SZYA 1ZEFA 3NKQA 4UPKA 1AJBA 4KJGA 3TG0A 1KHKA 4UPIA 5LRNA 4LRFA 5IJQA 1P49A 2W8DA 3NVLA
chains in the Genus database with same CATH topology
4LQYA 2W5WA 5IJSA 3KD8A 3UN5A 5GRRA 1ALIA 3T02A 2W5SA 1O99A 5KXAA 3DPCA 2GA3A 1AJDA 2GSUA 1ELZA 1KH7A 3TWZA 4LR8A 1AUKA 1E2SP 3NKNA 3T01A 5HRTA 2ZKTA 4MIVA 2D1GA 4GTZA 2GSOA 4UOPA 1ALKA 5L0BA 4CYRA 4KAYA 3WAYA 3E2DA 3MK0A 4LRCA 2GSNA 1FSUA 1AJCA 1HJKA 4CXKA 1HDHA 4KAVA 4LREA 1SHNA 2G9YA 1ANJA 4TN0A 1K7HA 4YR1A 4ZG7A 1ALJA 5LQQA 4FDIA 4NWJA 4ZG9A 3CMRA 3BDHA 3BDGA 5GOVA 2W5RA 1URAA 1Y7AA 5DLTA 1E33P 2W5QA 1EW2A 4N7TA 4LR9A 2VQRA 3NKPA 3Q3QA 3MK1A 1ED8A 2GLQA 3B5QA 4NWXA 4KJDA 1B8JA 2IUCA 3TX0A 3MK2A 5EGEA 4CXSA 1SHQA 3M8ZA 4FDJA 4LRDA 4ZGAA 4GTYA 2XRGA 3DYCA 4LR7A 3T00A 3M8YA 5TJ3A 1KHJA 4UORA 1KH5A 5INHA 1EW8A 3WAVA 4UPHA 1ALHA 2W5VA 3UO0A 3IDDA 1EI6A 3BDFA 3UN3A 1ZEBA 1N2LA 2W5TA 5DLVA 3IGZB 2W8SA 1O98A 4MY4A 5AJ9A 3WBHA 3WAWA 5EGHA 4MHXA 2W5XA 4KM4A 3NKOA 1Y6VA 1URBA 3NKMA 5C66A 4ZG6A 3SZZA 4B56A 5L0EA 3OT9A 5DLWA 1EQJA 1AJAA 4CXUA 5LRMA 2X98A 2RH6A 1E1ZP 5LIAA 1KHLA 4QAXA 1ED9A 1KH9A 3WAXA 3UNYA 4CYSA 1ELXA 3M7VA 2IUCB 4LR2A 1ANIA 1KHNA 5K4PA 4LRBA 1HQAA 3LXQA 4GTXA 3UN2A 5L0KA 2XR9A 4UOOA 1ZEDA 4LRAA 2ANHA 1EW9A 1E3CP 4GTWA 3M8WA 1EJJA 4UPLA 2IFYA 1KH4A 3A52A 3ED4A 2QZUA 3BDGB 3NKRA 3IGYB 1ELYA 1N2KA 3SZYA 1ZEFA 3NKQA 4UPKA 1AJBA 4KJGA 3TG0A 1KHKA 4UPIA 5LRNA 4LRFA 5IJQA 1P49A 2W8DA 3NVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQY A;  2W5W A;  5IJS A;  3KD8 A;  3UN5 A;  5GRR A;  1ALI A;  3T02 A;  2W5S A;  1O99 A;  5KXA A;  3DPC A;  2GA3 A;  1AJD A;  2GSU A;  1ELZ A;  1KH7 A;  3TWZ A;  4LR8 A;  1AUK A;  1E2S P;  3NKN A;  3T01 A;  5HRT A;  2ZKT A;  4MIV A;  2D1G A;  4GTZ A;  2GSO A;  4UOP A;  1ALK A;  5L0B A;  4CYR A;  4KAY A;  3WAY A;  3E2D A;  3MK0 A;  4LRC A;  2GSN A;  1FSU A;  1AJC A;  1HJK A;  4CXK A;  1HDH A;  4KAV A;  4LRE A;  1SHN A;  2G9Y A;  1ANJ A;  4TN0 A;  1K7H A;  4YR1 A;  4ZG7 A;  1ALJ A;  5LQQ A;  4FDI A;  4NWJ A;  4ZG9 A;  3CMR A;  3BDH A;  3BDG A;  5GOV A;  2W5R A;  1URA A;  1Y7A A;  5DLT A;  1E33 P;  2W5Q A;  1EW2 A;  4N7T A;  4LR9 A;  2VQR A;  3NKP A;  3Q3Q A;  3MK1 A;  1ED8 A;  2GLQ A;  3B5Q A;  4NWX A;  4KJD A;  1B8J A;  2IUC A;  3TX0 A;  3MK2 A;  5EGE A;  4CXS A;  1SHQ A;  3M8Z A;  4FDJ A;  4LRD A;  4ZGA A;  4GTY A;  2XRG A;  3DYC A;  4LR7 A;  3T00 A;  3M8Y A;  5TJ3 A;  1KHJ A;  4UOR A;  1KH5 A;  5INH A;  1EW8 A;  3WAV A;  4UPH A;  1ALH A;  2W5V A;  3UO0 A;  3IDD A;  1EI6 A;  3BDF A;  3UN3 A;  1ZEB A;  1N2L A;  2W5T A;  5DLV A;  3IGZ B;  2W8S A;  1O98 A;  4MY4 A;  5AJ9 A;  3WBH A;  3WAW A;  5EGH A;  4MHX A;  2W5X A;  4KM4 A;  3NKO A;  1Y6V A;  1URB A;  3NKM A;  5C66 A;  4ZG6 A;  3SZZ A;  4B56 A;  5L0E A;  3OT9 A;  5DLW A;  1EQJ A;  1AJA A;  4CXU A;  5LRM A;  2X98 A;  2RH6 A;  1E1Z P;  5LIA A;  1KHL A;  4QAX A;  1ED9 A;  1KH9 A;  3WAX A;  3UNY A;  4CYS A;  1ELX A;  3M7V A;  2IUC B;  4LR2 A;  1ANI A;  1KHN A;  5K4P A;  4LRB A;  1HQA A;  3LXQ A;  4GTX A;  3UN2 A;  5L0K A;  2XR9 A;  4UOO A;  1ZED A;  4LRA A;  2ANH A;  1EW9 A;  1E3C P;  4GTW A;  3M8W A;  1EJJ A;  4UPL A;  2IFY A;  1KH4 A;  3A52 A;  3ED4 A;  2QZU A;  3BDG B;  3NKR A;  3IGY B;  1ELY A;  1N2K A;  3SZY A;  1ZEF A;  3NKQ A;  4UPK A;  1AJB A;  4KJG A;  3TG0 A;  1KHK A;  4UPI A;  5LRN A;  4LRF A;  5IJQ A;  1P49 A;  2W8D A;  3NVL A; 
#chains in the Genus database with same CATH topology
 4LQY A;  2W5W A;  5IJS A;  3KD8 A;  3UN5 A;  5GRR A;  1ALI A;  3T02 A;  2W5S A;  1O99 A;  5KXA A;  3DPC A;  2GA3 A;  1AJD A;  2GSU A;  1ELZ A;  1KH7 A;  3TWZ A;  4LR8 A;  1AUK A;  1E2S P;  3NKN A;  3T01 A;  5HRT A;  2ZKT A;  4MIV A;  2D1G A;  4GTZ A;  2GSO A;  4UOP A;  1ALK A;  5L0B A;  4CYR A;  4KAY A;  3WAY A;  3E2D A;  3MK0 A;  4LRC A;  2GSN A;  1FSU A;  1AJC A;  1HJK A;  4CXK A;  1HDH A;  4KAV A;  4LRE A;  1SHN A;  2G9Y A;  1ANJ A;  4TN0 A;  1K7H A;  4YR1 A;  4ZG7 A;  1ALJ A;  5LQQ A;  4FDI A;  4NWJ A;  4ZG9 A;  3CMR A;  3BDH A;  3BDG A;  5GOV A;  2W5R A;  1URA A;  1Y7A A;  5DLT A;  1E33 P;  2W5Q A;  1EW2 A;  4N7T A;  4LR9 A;  2VQR A;  3NKP A;  3Q3Q A;  3MK1 A;  1ED8 A;  2GLQ A;  3B5Q A;  4NWX A;  4KJD A;  1B8J A;  2IUC A;  3TX0 A;  3MK2 A;  5EGE A;  4CXS A;  1SHQ A;  3M8Z A;  4FDJ A;  4LRD A;  4ZGA A;  4GTY A;  2XRG A;  3DYC A;  4LR7 A;  3T00 A;  3M8Y A;  5TJ3 A;  1KHJ A;  4UOR A;  1KH5 A;  5INH A;  1EW8 A;  3WAV A;  4UPH A;  1ALH A;  2W5V A;  3UO0 A;  3IDD A;  1EI6 A;  3BDF A;  3UN3 A;  1ZEB A;  1N2L A;  2W5T A;  5DLV A;  3IGZ B;  2W8S A;  1O98 A;  4MY4 A;  5AJ9 A;  3WBH A;  3WAW A;  5EGH A;  4MHX A;  2W5X A;  4KM4 A;  3NKO A;  1Y6V A;  1URB A;  3NKM A;  5C66 A;  4ZG6 A;  3SZZ A;  4B56 A;  5L0E A;  3OT9 A;  5DLW A;  1EQJ A;  1AJA A;  4CXU A;  5LRM A;  2X98 A;  2RH6 A;  1E1Z P;  5LIA A;  1KHL A;  4QAX A;  1ED9 A;  1KH9 A;  3WAX A;  3UNY A;  4CYS A;  1ELX A;  3M7V A;  2IUC B;  4LR2 A;  1ANI A;  1KHN A;  5K4P A;  4LRB A;  1HQA A;  3LXQ A;  4GTX A;  3UN2 A;  5L0K A;  2XR9 A;  4UOO A;  1ZED A;  4LRA A;  2ANH A;  1EW9 A;  1E3C P;  4GTW A;  3M8W A;  1EJJ A;  4UPL A;  2IFY A;  1KH4 A;  3A52 A;  3ED4 A;  2QZU A;  3BDG B;  3NKR A;  3IGY B;  1ELY A;  1N2K A;  3SZY A;  1ZEF A;  3NKQ A;  4UPK A;  1AJB A;  4KJG A;  3TG0 A;  1KHK A;  4UPI A;  5LRN A;  4LRF A;  5IJQ A;  1P49 A;  2W8D A;  3NVL A; 
#chains in the Genus database with same CATH homology
 4LQY A;  2W5W A;  5IJS A;  3KD8 A;  3UN5 A;  5GRR A;  1ALI A;  3T02 A;  2W5S A;  1O99 A;  5KXA A;  3DPC A;  2GA3 A;  1AJD A;  2GSU A;  1ELZ A;  1KH7 A;  3TWZ A;  4LR8 A;  1AUK A;  1E2S P;  3NKN A;  3T01 A;  5HRT A;  2ZKT A;  4MIV A;  2D1G A;  4GTZ A;  2GSO A;  4UOP A;  1ALK A;  5L0B A;  4CYR A;  4KAY A;  3WAY A;  3E2D A;  3MK0 A;  4LRC A;  2GSN A;  1FSU A;  1AJC A;  1HJK A;  4CXK A;  1HDH A;  4KAV A;  4LRE A;  1SHN A;  2G9Y A;  1ANJ A;  4TN0 A;  1K7H A;  4YR1 A;  4ZG7 A;  1ALJ A;  5LQQ A;  4FDI A;  4NWJ A;  4ZG9 A;  3CMR A;  3BDH A;  3BDG A;  5GOV A;  2W5R A;  1URA A;  1Y7A A;  5DLT A;  1E33 P;  2W5Q A;  1EW2 A;  4N7T A;  4LR9 A;  2VQR A;  3NKP A;  3Q3Q A;  3MK1 A;  1ED8 A;  2GLQ A;  3B5Q A;  4NWX A;  4KJD A;  1B8J A;  2IUC A;  3TX0 A;  3MK2 A;  5EGE A;  4CXS A;  1SHQ A;  3M8Z A;  4FDJ A;  4LRD A;  4ZGA A;  4GTY A;  2XRG A;  3DYC A;  4LR7 A;  3T00 A;  3M8Y A;  5TJ3 A;  1KHJ A;  4UOR A;  1KH5 A;  5INH A;  1EW8 A;  3WAV A;  4UPH A;  1ALH A;  2W5V A;  3UO0 A;  3IDD A;  1EI6 A;  3BDF A;  3UN3 A;  1ZEB A;  1N2L A;  2W5T A;  5DLV A;  3IGZ B;  2W8S A;  1O98 A;  4MY4 A;  5AJ9 A;  3WBH A;  3WAW A;  5EGH A;  4MHX A;  2W5X A;  4KM4 A;  3NKO A;  1Y6V A;  1URB A;  3NKM A;  5C66 A;  4ZG6 A;  3SZZ A;  4B56 A;  5L0E A;  3OT9 A;  5DLW A;  1EQJ A;  1AJA A;  4CXU A;  5LRM A;  2X98 A;  2RH6 A;  1E1Z P;  5LIA A;  1KHL A;  4QAX A;  1ED9 A;  1KH9 A;  3WAX A;  3UNY A;  4CYS A;  1ELX A;  3M7V A;  2IUC B;  4LR2 A;  1ANI A;  1KHN A;  5K4P A;  4LRB A;  1HQA A;  3LXQ A;  4GTX A;  3UN2 A;  5L0K A;  2XR9 A;  4UOO A;  1ZED A;  4LRA A;  2ANH A;  1EW9 A;  1E3C P;  4GTW A;  3M8W A;  1EJJ A;  4UPL A;  2IFY A;  1KH4 A;  3A52 A;  3ED4 A;  2QZU A;  3BDG B;  3NKR A;  3IGY B;  1ELY A;  1N2K A;  3SZY A;  1ZEF A;  3NKQ A;  4UPK A;  1AJB A;  4KJG A;  3TG0 A;  1KHK A;  4UPI A;  5LRN A;  4LRF A;  5IJQ A;  1P49 A;  2W8D A;  3NVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...