4UORA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes in complex with glycerol phosphate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
Knots found
sequence length
418
structure length
417
Chain Sequence
SSDVTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords LIPOTEICHOIC ACID SYNTHASE
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
total genus 168
structure length 417
sequence length 418
chains with identical sequence B, C, D, E, F, G, H, I, J, K
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uorA02
2D1GA 2GSUA 4KAVA 4GTZA 5INHA 5IJSA 1ED9A 1ZEDA 3T00A 3NKRA 3UN5A 1E1ZP 2GSNA 5GRRA 4MIVA 2IFYA 1KHNA 2W5VA 4QAXA 5DLTA 3UO0A 2W5RA 4LRDA 1ELYA 1HDHA 4ZG7A 2QZUA 1ALKA 5HRTA 4YR1A 4CXSA 3M7VA 3NKMA 3WAWA 3TX0A 4ZG6A 4LREA 1E33P 1EJJA 3IDDA 4MHXA 3WBHA 4N7TA 4ZG9A 5LRMA 1SHNA 2XR9A 3NKNA 4ZGAA 1O98A 5LQQA 4NWJA 3B5QA 3NKOA 3NKQA 1O99A 1AJAA 3BDHA 5LIAA 3E2DA 3UN3A 1URBA 1FSUA 4UPIA 3T01A 3SZZA 3KD8A 5DLVA 4LRCA 4LRBA 2W5QA 3LXQA 2W5TA 5LRNA 1ALJA 3M8WA 1KHJA 1KH7A 1P49A 5TJ3A 3OT9A 3Q3QA 1AJCA 2GA3A 3SZYA 1N2LA 4LR9A 5L0EA 3A52A 1ELXA 1EQJA 1EW9A 1AJDA 4NWXA 1N2KA 4GTWA 4TN0A 3TWZA 5AJ9A 2W8DA 2GSOA 4CXKA 5L0KA 2X98A 5C66A 4KJGA 3M8ZA 2VQRA 4GTXA 4UORA 1ELZA 1EW2A 2RH6A 2ZKTA 1Y6VA 4FDJA 1ALIA 2XRGA 3DYCA 5IJQA 3MK2A 3ED4A 3WAYA 2IUCA 1HJKA 5GOVA 5L0BA 4UPLA 2W5WA 1ZEBA 4UPHA 3UN2A 1ANIA 5K4PA 4B56A 4KAYA 4CYRA 3T02A 1ED8A 1KH9A 1SHQA 1AUKA 3MK0A 4LR2A 3M8YA 5EGHA 2GLQA 1AJBA 3NKPA 2IUCB 3TG0A 4LQYA 1URAA 1HQAA 2G9YA 4FDIA 1EI6A 4GTYA 1EW8A 4KJDA 5KXAA 3BDGB 5EGEA 3BDFA 3NVLA 3UNYA 1KH5A 3CMRA 4LRFA 5DLWA 2W5SA 4LR7A 1KHKA 4KM4A 4CYSA 4LRAA 3IGZB 2ANHA 1KHLA 1B8JA 4CXUA 3DPCA 1K7HA 4MY4A 1ALHA 3BDGA 3IGYB 3WAXA 4LR8A 4UPKA 1E2SP 1Y7AA 4UOPA 4UOOA 1E3CP 2W8SA 3MK1A 3WAVA 1KH4A 1ZEFA 2W5XA 1ANJA
chains in the Genus database with same CATH superfamily
2D1GA 2GSUA 4KAVA 4GTZA 5INHA 5IJSA 1ED9A 1ZEDA 3T00A 3NKRA 3UN5A 1E1ZP 2GSNA 5GRRA 4MIVA 2IFYA 1KHNA 2W5VA 4QAXA 5DLTA 3UO0A 2W5RA 4LRDA 1ELYA 1HDHA 4ZG7A 2QZUA 1ALKA 5HRTA 4YR1A 4CXSA 3M7VA 3NKMA 3WAWA 3TX0A 4ZG6A 4LREA 1E33P 1EJJA 3IDDA 4MHXA 3WBHA 4N7TA 4ZG9A 5LRMA 1SHNA 2XR9A 3NKNA 4ZGAA 1O98A 5LQQA 4NWJA 3B5QA 3NKOA 3NKQA 1O99A 1AJAA 3BDHA 5LIAA 3E2DA 3UN3A 1URBA 1FSUA 4UPIA 3T01A 3SZZA 3KD8A 5DLVA 4LRCA 4LRBA 2W5QA 3LXQA 2W5TA 5LRNA 1ALJA 3M8WA 1KHJA 1KH7A 1P49A 5TJ3A 3OT9A 3Q3QA 1AJCA 2GA3A 3SZYA 1N2LA 4LR9A 5L0EA 3A52A 1ELXA 1EQJA 1EW9A 1AJDA 4NWXA 1N2KA 4GTWA 4TN0A 3TWZA 5AJ9A 2W8DA 2GSOA 4CXKA 5L0KA 2X98A 5C66A 4KJGA 3M8ZA 2VQRA 4GTXA 4UORA 1ELZA 1EW2A 2RH6A 2ZKTA 1Y6VA 4FDJA 1ALIA 2XRGA 3DYCA 5IJQA 3MK2A 3ED4A 3WAYA 2IUCA 1HJKA 5GOVA 5L0BA 4UPLA 2W5WA 1ZEBA 4UPHA 3UN2A 1ANIA 5K4PA 4B56A 4KAYA 4CYRA 3T02A 1ED8A 1KH9A 1SHQA 1AUKA 3MK0A 4LR2A 3M8YA 5EGHA 2GLQA 1AJBA 3NKPA 2IUCB 3TG0A 4LQYA 1URAA 1HQAA 2G9YA 4FDIA 1EI6A 4GTYA 1EW8A 4KJDA 5KXAA 3BDGB 5EGEA 3BDFA 3NVLA 3UNYA 1KH5A 3CMRA 4LRFA 5DLWA 2W5SA 4LR7A 1KHKA 4KM4A 4CYSA 4LRAA 3IGZB 2ANHA 1KHLA 1B8JA 4CXUA 3DPCA 1K7HA 4MY4A 1ALHA 3BDGA 3IGYB 3WAXA 4LR8A 4UPKA 1E2SP 1Y7AA 4UOPA 4UOOA 1E3CP 2W8SA 3MK1A 3WAVA 1KH4A 1ZEFA 2W5XA 1ANJA
chains in the Genus database with same CATH topology
2D1GA 2GSUA 4KAVA 4GTZA 5INHA 5IJSA 1ED9A 1ZEDA 3T00A 3NKRA 3UN5A 1E1ZP 2GSNA 5GRRA 4MIVA 2IFYA 1KHNA 2W5VA 4QAXA 5DLTA 3UO0A 2W5RA 4LRDA 1ELYA 1HDHA 4ZG7A 2QZUA 1ALKA 5HRTA 4YR1A 4CXSA 3M7VA 3NKMA 3WAWA 3TX0A 4ZG6A 4LREA 1E33P 1EJJA 3IDDA 4MHXA 3WBHA 4N7TA 4ZG9A 5LRMA 1SHNA 2XR9A 3NKNA 4ZGAA 1O98A 5LQQA 4NWJA 3B5QA 3NKOA 3NKQA 1O99A 1AJAA 3BDHA 5LIAA 3E2DA 3UN3A 1URBA 1FSUA 4UPIA 3T01A 3SZZA 3KD8A 5DLVA 4LRCA 4LRBA 2W5QA 3LXQA 2W5TA 5LRNA 1ALJA 3M8WA 1KHJA 1KH7A 1P49A 5TJ3A 3OT9A 3Q3QA 1AJCA 2GA3A 3SZYA 1N2LA 4LR9A 5L0EA 3A52A 1ELXA 1EQJA 1EW9A 1AJDA 4NWXA 1N2KA 4GTWA 4TN0A 3TWZA 5AJ9A 2W8DA 2GSOA 4CXKA 5L0KA 2X98A 5C66A 4KJGA 3M8ZA 2VQRA 4GTXA 4UORA 1ELZA 1EW2A 2RH6A 2ZKTA 1Y6VA 4FDJA 1ALIA 2XRGA 3DYCA 5IJQA 3MK2A 3ED4A 3WAYA 2IUCA 1HJKA 5GOVA 5L0BA 4UPLA 2W5WA 1ZEBA 4UPHA 3UN2A 1ANIA 5K4PA 4B56A 4KAYA 4CYRA 3T02A 1ED8A 1KH9A 1SHQA 1AUKA 3MK0A 4LR2A 3M8YA 5EGHA 2GLQA 1AJBA 3NKPA 2IUCB 3TG0A 4LQYA 1URAA 1HQAA 2G9YA 4FDIA 1EI6A 4GTYA 1EW8A 4KJDA 5KXAA 3BDGB 5EGEA 3BDFA 3NVLA 3UNYA 1KH5A 3CMRA 4LRFA 5DLWA 2W5SA 4LR7A 1KHKA 4KM4A 4CYSA 4LRAA 3IGZB 2ANHA 1KHLA 1B8JA 4CXUA 3DPCA 1K7HA 4MY4A 1ALHA 3BDGA 3IGYB 3WAXA 4LR8A 4UPKA 1E2SP 1Y7AA 4UOPA 4UOOA 1E3CP 2W8SA 3MK1A 3WAVA 1KH4A 1ZEFA 2W5XA 1ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1G A;  2GSU A;  4KAV A;  4GTZ A;  5INH A;  5IJS A;  1ED9 A;  1ZED A;  3T00 A;  3NKR A;  3UN5 A;  1E1Z P;  2GSN A;  5GRR A;  4MIV A;  2IFY A;  1KHN A;  2W5V A;  4QAX A;  5DLT A;  3UO0 A;  2W5R A;  4LRD A;  1ELY A;  1HDH A;  4ZG7 A;  2QZU A;  1ALK A;  5HRT A;  4YR1 A;  4CXS A;  3M7V A;  3NKM A;  3WAW A;  3TX0 A;  4ZG6 A;  4LRE A;  1E33 P;  1EJJ A;  3IDD A;  4MHX A;  3WBH A;  4N7T A;  4ZG9 A;  5LRM A;  1SHN A;  2XR9 A;  3NKN A;  4ZGA A;  1O98 A;  5LQQ A;  4NWJ A;  3B5Q A;  3NKO A;  3NKQ A;  1O99 A;  1AJA A;  3BDH A;  5LIA A;  3E2D A;  3UN3 A;  1URB A;  1FSU A;  4UPI A;  3T01 A;  3SZZ A;  3KD8 A;  5DLV A;  4LRC A;  4LRB A;  2W5Q A;  3LXQ A;  2W5T A;  5LRN A;  1ALJ A;  3M8W A;  1KHJ A;  1KH7 A;  1P49 A;  5TJ3 A;  3OT9 A;  3Q3Q A;  1AJC A;  2GA3 A;  3SZY A;  1N2L A;  4LR9 A;  5L0E A;  3A52 A;  1ELX A;  1EQJ A;  1EW9 A;  1AJD A;  4NWX A;  1N2K A;  4GTW A;  4TN0 A;  3TWZ A;  5AJ9 A;  2W8D A;  2GSO A;  4CXK A;  5L0K A;  2X98 A;  5C66 A;  4KJG A;  3M8Z A;  2VQR A;  4GTX A;  4UOR A;  1ELZ A;  1EW2 A;  2RH6 A;  2ZKT A;  1Y6V A;  4FDJ A;  1ALI A;  2XRG A;  3DYC A;  5IJQ A;  3MK2 A;  3ED4 A;  3WAY A;  2IUC A;  1HJK A;  5GOV A;  5L0B A;  4UPL A;  2W5W A;  1ZEB A;  4UPH A;  3UN2 A;  1ANI A;  5K4P A;  4B56 A;  4KAY A;  4CYR A;  3T02 A;  1ED8 A;  1KH9 A;  1SHQ A;  1AUK A;  3MK0 A;  4LR2 A;  3M8Y A;  5EGH A;  2GLQ A;  1AJB A;  3NKP A;  2IUC B;  3TG0 A;  4LQY A;  1URA A;  1HQA A;  2G9Y A;  4FDI A;  1EI6 A;  4GTY A;  1EW8 A;  4KJD A;  5KXA A;  3BDG B;  5EGE A;  3BDF A;  3NVL A;  3UNY A;  1KH5 A;  3CMR A;  4LRF A;  5DLW A;  2W5S A;  4LR7 A;  1KHK A;  4KM4 A;  4CYS A;  4LRA A;  3IGZ B;  2ANH A;  1KHL A;  1B8J A;  4CXU A;  3DPC A;  1K7H A;  4MY4 A;  1ALH A;  3BDG A;  3IGY B;  3WAX A;  4LR8 A;  4UPK A;  1E2S P;  1Y7A A;  4UOP A;  4UOO A;  1E3C P;  2W8S A;  3MK1 A;  3WAV A;  1KH4 A;  1ZEF A;  2W5X A;  1ANJ A; 
#chains in the Genus database with same CATH topology
 2D1G A;  2GSU A;  4KAV A;  4GTZ A;  5INH A;  5IJS A;  1ED9 A;  1ZED A;  3T00 A;  3NKR A;  3UN5 A;  1E1Z P;  2GSN A;  5GRR A;  4MIV A;  2IFY A;  1KHN A;  2W5V A;  4QAX A;  5DLT A;  3UO0 A;  2W5R A;  4LRD A;  1ELY A;  1HDH A;  4ZG7 A;  2QZU A;  1ALK A;  5HRT A;  4YR1 A;  4CXS A;  3M7V A;  3NKM A;  3WAW A;  3TX0 A;  4ZG6 A;  4LRE A;  1E33 P;  1EJJ A;  3IDD A;  4MHX A;  3WBH A;  4N7T A;  4ZG9 A;  5LRM A;  1SHN A;  2XR9 A;  3NKN A;  4ZGA A;  1O98 A;  5LQQ A;  4NWJ A;  3B5Q A;  3NKO A;  3NKQ A;  1O99 A;  1AJA A;  3BDH A;  5LIA A;  3E2D A;  3UN3 A;  1URB A;  1FSU A;  4UPI A;  3T01 A;  3SZZ A;  3KD8 A;  5DLV A;  4LRC A;  4LRB A;  2W5Q A;  3LXQ A;  2W5T A;  5LRN A;  1ALJ A;  3M8W A;  1KHJ A;  1KH7 A;  1P49 A;  5TJ3 A;  3OT9 A;  3Q3Q A;  1AJC A;  2GA3 A;  3SZY A;  1N2L A;  4LR9 A;  5L0E A;  3A52 A;  1ELX A;  1EQJ A;  1EW9 A;  1AJD A;  4NWX A;  1N2K A;  4GTW A;  4TN0 A;  3TWZ A;  5AJ9 A;  2W8D A;  2GSO A;  4CXK A;  5L0K A;  2X98 A;  5C66 A;  4KJG A;  3M8Z A;  2VQR A;  4GTX A;  4UOR A;  1ELZ A;  1EW2 A;  2RH6 A;  2ZKT A;  1Y6V A;  4FDJ A;  1ALI A;  2XRG A;  3DYC A;  5IJQ A;  3MK2 A;  3ED4 A;  3WAY A;  2IUC A;  1HJK A;  5GOV A;  5L0B A;  4UPL A;  2W5W A;  1ZEB A;  4UPH A;  3UN2 A;  1ANI A;  5K4P A;  4B56 A;  4KAY A;  4CYR A;  3T02 A;  1ED8 A;  1KH9 A;  1SHQ A;  1AUK A;  3MK0 A;  4LR2 A;  3M8Y A;  5EGH A;  2GLQ A;  1AJB A;  3NKP A;  2IUC B;  3TG0 A;  4LQY A;  1URA A;  1HQA A;  2G9Y A;  4FDI A;  1EI6 A;  4GTY A;  1EW8 A;  4KJD A;  5KXA A;  3BDG B;  5EGE A;  3BDF A;  3NVL A;  3UNY A;  1KH5 A;  3CMR A;  4LRF A;  5DLW A;  2W5S A;  4LR7 A;  1KHK A;  4KM4 A;  4CYS A;  4LRA A;  3IGZ B;  2ANH A;  1KHL A;  1B8J A;  4CXU A;  3DPC A;  1K7H A;  4MY4 A;  1ALH A;  3BDG A;  3IGY B;  3WAX A;  4LR8 A;  4UPK A;  1E2S P;  1Y7A A;  4UOP A;  4UOO A;  1E3C P;  2W8S A;  3MK1 A;  3WAV A;  1KH4 A;  1ZEF A;  2W5X A;  1ANJ A; 
#chains in the Genus database with same CATH homology
 2D1G A;  2GSU A;  4KAV A;  4GTZ A;  5INH A;  5IJS A;  1ED9 A;  1ZED A;  3T00 A;  3NKR A;  3UN5 A;  1E1Z P;  2GSN A;  5GRR A;  4MIV A;  2IFY A;  1KHN A;  2W5V A;  4QAX A;  5DLT A;  3UO0 A;  2W5R A;  4LRD A;  1ELY A;  1HDH A;  4ZG7 A;  2QZU A;  1ALK A;  5HRT A;  4YR1 A;  4CXS A;  3M7V A;  3NKM A;  3WAW A;  3TX0 A;  4ZG6 A;  4LRE A;  1E33 P;  1EJJ A;  3IDD A;  4MHX A;  3WBH A;  4N7T A;  4ZG9 A;  5LRM A;  1SHN A;  2XR9 A;  3NKN A;  4ZGA A;  1O98 A;  5LQQ A;  4NWJ A;  3B5Q A;  3NKO A;  3NKQ A;  1O99 A;  1AJA A;  3BDH A;  5LIA A;  3E2D A;  3UN3 A;  1URB A;  1FSU A;  4UPI A;  3T01 A;  3SZZ A;  3KD8 A;  5DLV A;  4LRC A;  4LRB A;  2W5Q A;  3LXQ A;  2W5T A;  5LRN A;  1ALJ A;  3M8W A;  1KHJ A;  1KH7 A;  1P49 A;  5TJ3 A;  3OT9 A;  3Q3Q A;  1AJC A;  2GA3 A;  3SZY A;  1N2L A;  4LR9 A;  5L0E A;  3A52 A;  1ELX A;  1EQJ A;  1EW9 A;  1AJD A;  4NWX A;  1N2K A;  4GTW A;  4TN0 A;  3TWZ A;  5AJ9 A;  2W8D A;  2GSO A;  4CXK A;  5L0K A;  2X98 A;  5C66 A;  4KJG A;  3M8Z A;  2VQR A;  4GTX A;  4UOR A;  1ELZ A;  1EW2 A;  2RH6 A;  2ZKT A;  1Y6V A;  4FDJ A;  1ALI A;  2XRG A;  3DYC A;  5IJQ A;  3MK2 A;  3ED4 A;  3WAY A;  2IUC A;  1HJK A;  5GOV A;  5L0B A;  4UPL A;  2W5W A;  1ZEB A;  4UPH A;  3UN2 A;  1ANI A;  5K4P A;  4B56 A;  4KAY A;  4CYR A;  3T02 A;  1ED8 A;  1KH9 A;  1SHQ A;  1AUK A;  3MK0 A;  4LR2 A;  3M8Y A;  5EGH A;  2GLQ A;  1AJB A;  3NKP A;  2IUC B;  3TG0 A;  4LQY A;  1URA A;  1HQA A;  2G9Y A;  4FDI A;  1EI6 A;  4GTY A;  1EW8 A;  4KJD A;  5KXA A;  3BDG B;  5EGE A;  3BDF A;  3NVL A;  3UNY A;  1KH5 A;  3CMR A;  4LRF A;  5DLW A;  2W5S A;  4LR7 A;  1KHK A;  4KM4 A;  4CYS A;  4LRA A;  3IGZ B;  2ANH A;  1KHL A;  1B8J A;  4CXU A;  3DPC A;  1K7H A;  4MY4 A;  1ALH A;  3BDG A;  3IGY B;  3WAX A;  4LR8 A;  4UPK A;  1E2S P;  1Y7A A;  4UOP A;  4UOO A;  1E3C P;  2W8S A;  3MK1 A;  3WAV A;  1KH4 A;  1ZEF A;  2W5X A;  1ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...