4UORA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes in complex with glycerol phosphate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
Knots found
sequence length
418
structure length
417
Chain Sequence
SSDVTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transferase
molecule keywords LIPOTEICHOIC ACID SYNTHASE
total genus 168
structure length 417
sequence length 418
chains with identical sequence B, C, D, E, F, G, H, I, J, K
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uorA02
1EI6A 3DYCA 3WAYA 4UOPA 2GA3A 4GTYA 5IJSA 1ED9A 1SHNA 4CXUA 2IUCA 4UPHA 3UNYA 2GLQA 3WAWA 4LRAA 4KM4A 1ANIA 4GTZA 2W5RA 5DLWA 1ZEBA 4GTWA 2XRGA 1ALHA 3M8WA 1AJCA 3WAXA 2X98A 3NVLA 4UPKA 1ZEDA 1ED8A 3NKOA 1O99A 3UN2A 4CXSA 3WBHA 3KD8A 3SZYA 2W8DA 1E33P 2G9YA 5GRRA 3NKNA 4MY4A 1URAA 1EW9A 3DPCA 4LQYA 3SZZA 2W8SA 1ELXA 2GSNA 5EGHA 2W5WA 3BDHA 1AJBA 1Y6VA 1EJJA 4FDIA 4MIVA 5EGEA 3B5QA 3CMRA 4LR7A 4CYSA 1AUKA 1E1ZP 1EW8A 5K4PA 4KJGA 5KXAA 3OT9A 3WAVA 4UPLA 1HQAA 1AJDA 4LRCA 5L0EA 4LRBA 1KH9A 4B56A 1P49A 1ALJA 5L0KA 1URBA 2ANHA 2W5SA 4ZG9A 3T02A 2D1GA 5GOVA 5LIAA 3LXQA 5L0BA 3IDDA 4CYRA 1B8JA 3TX0A 3NKRA 2W5QA 1SHQA 3UO0A 1E2SP 3IGYB 1KH4A 3BDGA 4NWXA 4N7TA 1K7HA 2W5TA 1EQJA 1ELYA 3M7VA 4YR1A 3E2DA 4LREA 1ANJA 4UPIA 2VQRA 1N2LA 3MK1A 5C66A 1KH7A 4UOOA 5LRNA 3T01A 4NWJA 3A52A 2W5XA 4FDJA 4ZGAA 5DLVA 4LRDA 4GTXA 2GSOA 1ALKA 4KAVA 4LR8A 4ZG7A 2RH6A 3M8ZA 5TJ3A 4LRFA 3UN3A 1ZEFA 5INHA 2W5VA 3M8YA 3NKPA 1FSUA 1E3CP 3BDFA 2QZUA 3Q3QA 1ALIA 5LQQA 4ZG6A 3NKMA 3IGZB 3BDGB 1KHNA 5DLTA 4KAYA 1KH5A 3ED4A 2GSUA 3T00A 1O98A 4UORA 1HJKA 1KHJA 3NKQA 4TN0A 3TWZA 3TG0A 4QAXA 2ZKTA 4LR2A 1ELZA 1KHLA 1EW2A 1N2KA 5AJ9A 5LRMA 5IJQA 4CXKA 3MK2A 2XR9A 4MHXA 1KHKA 2IUCB 1Y7AA 4LR9A 1HDHA 3UN5A 3MK0A 5HRTA 4KJDA 2IFYA 1AJAA
chains in the Genus database with same CATH superfamily
1EI6A 3DYCA 3WAYA 4UOPA 2GA3A 4GTYA 5IJSA 1ED9A 1SHNA 4CXUA 2IUCA 4UPHA 3UNYA 2GLQA 3WAWA 4LRAA 4KM4A 1ANIA 4GTZA 2W5RA 5DLWA 1ZEBA 4GTWA 2XRGA 1ALHA 3M8WA 1AJCA 3WAXA 2X98A 3NVLA 4UPKA 1ZEDA 1ED8A 3NKOA 1O99A 3UN2A 4CXSA 3WBHA 3KD8A 3SZYA 2W8DA 1E33P 2G9YA 5GRRA 3NKNA 4MY4A 1URAA 1EW9A 3DPCA 4LQYA 3SZZA 2W8SA 1ELXA 2GSNA 5EGHA 2W5WA 3BDHA 1AJBA 1Y6VA 1EJJA 4FDIA 4MIVA 5EGEA 3B5QA 3CMRA 4LR7A 4CYSA 1AUKA 1E1ZP 1EW8A 5K4PA 4KJGA 5KXAA 3OT9A 3WAVA 4UPLA 1HQAA 1AJDA 4LRCA 5L0EA 4LRBA 1KH9A 4B56A 1P49A 1ALJA 5L0KA 1URBA 2ANHA 2W5SA 4ZG9A 3T02A 2D1GA 5GOVA 5LIAA 3LXQA 5L0BA 3IDDA 4CYRA 1B8JA 3TX0A 3NKRA 2W5QA 1SHQA 3UO0A 1E2SP 3IGYB 1KH4A 3BDGA 4NWXA 4N7TA 1K7HA 2W5TA 1EQJA 1ELYA 3M7VA 4YR1A 3E2DA 4LREA 1ANJA 4UPIA 2VQRA 1N2LA 3MK1A 5C66A 1KH7A 4UOOA 5LRNA 3T01A 4NWJA 3A52A 2W5XA 4FDJA 4ZGAA 5DLVA 4LRDA 4GTXA 2GSOA 1ALKA 4KAVA 4LR8A 4ZG7A 2RH6A 3M8ZA 5TJ3A 4LRFA 3UN3A 1ZEFA 5INHA 2W5VA 3M8YA 3NKPA 1FSUA 1E3CP 3BDFA 2QZUA 3Q3QA 1ALIA 5LQQA 4ZG6A 3NKMA 3IGZB 3BDGB 1KHNA 5DLTA 4KAYA 1KH5A 3ED4A 2GSUA 3T00A 1O98A 4UORA 1HJKA 1KHJA 3NKQA 4TN0A 3TWZA 3TG0A 4QAXA 2ZKTA 4LR2A 1ELZA 1KHLA 1EW2A 1N2KA 5AJ9A 5LRMA 5IJQA 4CXKA 3MK2A 2XR9A 4MHXA 1KHKA 2IUCB 1Y7AA 4LR9A 1HDHA 3UN5A 3MK0A 5HRTA 4KJDA 2IFYA 1AJAA
chains in the Genus database with same CATH topology
1EI6A 3DYCA 3WAYA 4UOPA 2GA3A 4GTYA 5IJSA 1ED9A 1SHNA 4CXUA 2IUCA 4UPHA 3UNYA 2GLQA 3WAWA 4LRAA 4KM4A 1ANIA 4GTZA 2W5RA 5DLWA 1ZEBA 4GTWA 2XRGA 1ALHA 3M8WA 1AJCA 3WAXA 2X98A 3NVLA 4UPKA 1ZEDA 1ED8A 3NKOA 1O99A 3UN2A 4CXSA 3WBHA 3KD8A 3SZYA 2W8DA 1E33P 2G9YA 5GRRA 3NKNA 4MY4A 1URAA 1EW9A 3DPCA 4LQYA 3SZZA 2W8SA 1ELXA 2GSNA 5EGHA 2W5WA 3BDHA 1AJBA 1Y6VA 1EJJA 4FDIA 4MIVA 5EGEA 3B5QA 3CMRA 4LR7A 4CYSA 1AUKA 1E1ZP 1EW8A 5K4PA 4KJGA 5KXAA 3OT9A 3WAVA 4UPLA 1HQAA 1AJDA 4LRCA 5L0EA 4LRBA 1KH9A 4B56A 1P49A 1ALJA 5L0KA 1URBA 2ANHA 2W5SA 4ZG9A 3T02A 2D1GA 5GOVA 5LIAA 3LXQA 5L0BA 3IDDA 4CYRA 1B8JA 3TX0A 3NKRA 2W5QA 1SHQA 3UO0A 1E2SP 3IGYB 1KH4A 3BDGA 4NWXA 4N7TA 1K7HA 2W5TA 1EQJA 1ELYA 3M7VA 4YR1A 3E2DA 4LREA 1ANJA 4UPIA 2VQRA 1N2LA 3MK1A 5C66A 1KH7A 4UOOA 5LRNA 3T01A 4NWJA 3A52A 2W5XA 4FDJA 4ZGAA 5DLVA 4LRDA 4GTXA 2GSOA 1ALKA 4KAVA 4LR8A 4ZG7A 2RH6A 3M8ZA 5TJ3A 4LRFA 3UN3A 1ZEFA 5INHA 2W5VA 3M8YA 3NKPA 1FSUA 1E3CP 3BDFA 2QZUA 3Q3QA 1ALIA 5LQQA 4ZG6A 3NKMA 3IGZB 3BDGB 1KHNA 5DLTA 4KAYA 1KH5A 3ED4A 2GSUA 3T00A 1O98A 4UORA 1HJKA 1KHJA 3NKQA 4TN0A 3TWZA 3TG0A 4QAXA 2ZKTA 4LR2A 1ELZA 1KHLA 1EW2A 1N2KA 5AJ9A 5LRMA 5IJQA 4CXKA 3MK2A 2XR9A 4MHXA 1KHKA 2IUCB 1Y7AA 4LR9A 1HDHA 3UN5A 3MK0A 5HRTA 4KJDA 2IFYA 1AJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI6 A;  3DYC A;  3WAY A;  4UOP A;  2GA3 A;  4GTY A;  5IJS A;  1ED9 A;  1SHN A;  4CXU A;  2IUC A;  4UPH A;  3UNY A;  2GLQ A;  3WAW A;  4LRA A;  4KM4 A;  1ANI A;  4GTZ A;  2W5R A;  5DLW A;  1ZEB A;  4GTW A;  2XRG A;  1ALH A;  3M8W A;  1AJC A;  3WAX A;  2X98 A;  3NVL A;  4UPK A;  1ZED A;  1ED8 A;  3NKO A;  1O99 A;  3UN2 A;  4CXS A;  3WBH A;  3KD8 A;  3SZY A;  2W8D A;  1E33 P;  2G9Y A;  5GRR A;  3NKN A;  4MY4 A;  1URA A;  1EW9 A;  3DPC A;  4LQY A;  3SZZ A;  2W8S A;  1ELX A;  2GSN A;  5EGH A;  2W5W A;  3BDH A;  1AJB A;  1Y6V A;  1EJJ A;  4FDI A;  4MIV A;  5EGE A;  3B5Q A;  3CMR A;  4LR7 A;  4CYS A;  1AUK A;  1E1Z P;  1EW8 A;  5K4P A;  4KJG A;  5KXA A;  3OT9 A;  3WAV A;  4UPL A;  1HQA A;  1AJD A;  4LRC A;  5L0E A;  4LRB A;  1KH9 A;  4B56 A;  1P49 A;  1ALJ A;  5L0K A;  1URB A;  2ANH A;  2W5S A;  4ZG9 A;  3T02 A;  2D1G A;  5GOV A;  5LIA A;  3LXQ A;  5L0B A;  3IDD A;  4CYR A;  1B8J A;  3TX0 A;  3NKR A;  2W5Q A;  1SHQ A;  3UO0 A;  1E2S P;  3IGY B;  1KH4 A;  3BDG A;  4NWX A;  4N7T A;  1K7H A;  2W5T A;  1EQJ A;  1ELY A;  3M7V A;  4YR1 A;  3E2D A;  4LRE A;  1ANJ A;  4UPI A;  2VQR A;  1N2L A;  3MK1 A;  5C66 A;  1KH7 A;  4UOO A;  5LRN A;  3T01 A;  4NWJ A;  3A52 A;  2W5X A;  4FDJ A;  4ZGA A;  5DLV A;  4LRD A;  4GTX A;  2GSO A;  1ALK A;  4KAV A;  4LR8 A;  4ZG7 A;  2RH6 A;  3M8Z A;  5TJ3 A;  4LRF A;  3UN3 A;  1ZEF A;  5INH A;  2W5V A;  3M8Y A;  3NKP A;  1FSU A;  1E3C P;  3BDF A;  2QZU A;  3Q3Q A;  1ALI A;  5LQQ A;  4ZG6 A;  3NKM A;  3IGZ B;  3BDG B;  1KHN A;  5DLT A;  4KAY A;  1KH5 A;  3ED4 A;  2GSU A;  3T00 A;  1O98 A;  4UOR A;  1HJK A;  1KHJ A;  3NKQ A;  4TN0 A;  3TWZ A;  3TG0 A;  4QAX A;  2ZKT A;  4LR2 A;  1ELZ A;  1KHL A;  1EW2 A;  1N2K A;  5AJ9 A;  5LRM A;  5IJQ A;  4CXK A;  3MK2 A;  2XR9 A;  4MHX A;  1KHK A;  2IUC B;  1Y7A A;  4LR9 A;  1HDH A;  3UN5 A;  3MK0 A;  5HRT A;  4KJD A;  2IFY A;  1AJA A; 
#chains in the Genus database with same CATH topology
 1EI6 A;  3DYC A;  3WAY A;  4UOP A;  2GA3 A;  4GTY A;  5IJS A;  1ED9 A;  1SHN A;  4CXU A;  2IUC A;  4UPH A;  3UNY A;  2GLQ A;  3WAW A;  4LRA A;  4KM4 A;  1ANI A;  4GTZ A;  2W5R A;  5DLW A;  1ZEB A;  4GTW A;  2XRG A;  1ALH A;  3M8W A;  1AJC A;  3WAX A;  2X98 A;  3NVL A;  4UPK A;  1ZED A;  1ED8 A;  3NKO A;  1O99 A;  3UN2 A;  4CXS A;  3WBH A;  3KD8 A;  3SZY A;  2W8D A;  1E33 P;  2G9Y A;  5GRR A;  3NKN A;  4MY4 A;  1URA A;  1EW9 A;  3DPC A;  4LQY A;  3SZZ A;  2W8S A;  1ELX A;  2GSN A;  5EGH A;  2W5W A;  3BDH A;  1AJB A;  1Y6V A;  1EJJ A;  4FDI A;  4MIV A;  5EGE A;  3B5Q A;  3CMR A;  4LR7 A;  4CYS A;  1AUK A;  1E1Z P;  1EW8 A;  5K4P A;  4KJG A;  5KXA A;  3OT9 A;  3WAV A;  4UPL A;  1HQA A;  1AJD A;  4LRC A;  5L0E A;  4LRB A;  1KH9 A;  4B56 A;  1P49 A;  1ALJ A;  5L0K A;  1URB A;  2ANH A;  2W5S A;  4ZG9 A;  3T02 A;  2D1G A;  5GOV A;  5LIA A;  3LXQ A;  5L0B A;  3IDD A;  4CYR A;  1B8J A;  3TX0 A;  3NKR A;  2W5Q A;  1SHQ A;  3UO0 A;  1E2S P;  3IGY B;  1KH4 A;  3BDG A;  4NWX A;  4N7T A;  1K7H A;  2W5T A;  1EQJ A;  1ELY A;  3M7V A;  4YR1 A;  3E2D A;  4LRE A;  1ANJ A;  4UPI A;  2VQR A;  1N2L A;  3MK1 A;  5C66 A;  1KH7 A;  4UOO A;  5LRN A;  3T01 A;  4NWJ A;  3A52 A;  2W5X A;  4FDJ A;  4ZGA A;  5DLV A;  4LRD A;  4GTX A;  2GSO A;  1ALK A;  4KAV A;  4LR8 A;  4ZG7 A;  2RH6 A;  3M8Z A;  5TJ3 A;  4LRF A;  3UN3 A;  1ZEF A;  5INH A;  2W5V A;  3M8Y A;  3NKP A;  1FSU A;  1E3C P;  3BDF A;  2QZU A;  3Q3Q A;  1ALI A;  5LQQ A;  4ZG6 A;  3NKM A;  3IGZ B;  3BDG B;  1KHN A;  5DLT A;  4KAY A;  1KH5 A;  3ED4 A;  2GSU A;  3T00 A;  1O98 A;  4UOR A;  1HJK A;  1KHJ A;  3NKQ A;  4TN0 A;  3TWZ A;  3TG0 A;  4QAX A;  2ZKT A;  4LR2 A;  1ELZ A;  1KHL A;  1EW2 A;  1N2K A;  5AJ9 A;  5LRM A;  5IJQ A;  4CXK A;  3MK2 A;  2XR9 A;  4MHX A;  1KHK A;  2IUC B;  1Y7A A;  4LR9 A;  1HDH A;  3UN5 A;  3MK0 A;  5HRT A;  4KJD A;  2IFY A;  1AJA A; 
#chains in the Genus database with same CATH homology
 1EI6 A;  3DYC A;  3WAY A;  4UOP A;  2GA3 A;  4GTY A;  5IJS A;  1ED9 A;  1SHN A;  4CXU A;  2IUC A;  4UPH A;  3UNY A;  2GLQ A;  3WAW A;  4LRA A;  4KM4 A;  1ANI A;  4GTZ A;  2W5R A;  5DLW A;  1ZEB A;  4GTW A;  2XRG A;  1ALH A;  3M8W A;  1AJC A;  3WAX A;  2X98 A;  3NVL A;  4UPK A;  1ZED A;  1ED8 A;  3NKO A;  1O99 A;  3UN2 A;  4CXS A;  3WBH A;  3KD8 A;  3SZY A;  2W8D A;  1E33 P;  2G9Y A;  5GRR A;  3NKN A;  4MY4 A;  1URA A;  1EW9 A;  3DPC A;  4LQY A;  3SZZ A;  2W8S A;  1ELX A;  2GSN A;  5EGH A;  2W5W A;  3BDH A;  1AJB A;  1Y6V A;  1EJJ A;  4FDI A;  4MIV A;  5EGE A;  3B5Q A;  3CMR A;  4LR7 A;  4CYS A;  1AUK A;  1E1Z P;  1EW8 A;  5K4P A;  4KJG A;  5KXA A;  3OT9 A;  3WAV A;  4UPL A;  1HQA A;  1AJD A;  4LRC A;  5L0E A;  4LRB A;  1KH9 A;  4B56 A;  1P49 A;  1ALJ A;  5L0K A;  1URB A;  2ANH A;  2W5S A;  4ZG9 A;  3T02 A;  2D1G A;  5GOV A;  5LIA A;  3LXQ A;  5L0B A;  3IDD A;  4CYR A;  1B8J A;  3TX0 A;  3NKR A;  2W5Q A;  1SHQ A;  3UO0 A;  1E2S P;  3IGY B;  1KH4 A;  3BDG A;  4NWX A;  4N7T A;  1K7H A;  2W5T A;  1EQJ A;  1ELY A;  3M7V A;  4YR1 A;  3E2D A;  4LRE A;  1ANJ A;  4UPI A;  2VQR A;  1N2L A;  3MK1 A;  5C66 A;  1KH7 A;  4UOO A;  5LRN A;  3T01 A;  4NWJ A;  3A52 A;  2W5X A;  4FDJ A;  4ZGA A;  5DLV A;  4LRD A;  4GTX A;  2GSO A;  1ALK A;  4KAV A;  4LR8 A;  4ZG7 A;  2RH6 A;  3M8Z A;  5TJ3 A;  4LRF A;  3UN3 A;  1ZEF A;  5INH A;  2W5V A;  3M8Y A;  3NKP A;  1FSU A;  1E3C P;  3BDF A;  2QZU A;  3Q3Q A;  1ALI A;  5LQQ A;  4ZG6 A;  3NKM A;  3IGZ B;  3BDG B;  1KHN A;  5DLT A;  4KAY A;  1KH5 A;  3ED4 A;  2GSU A;  3T00 A;  1O98 A;  4UOR A;  1HJK A;  1KHJ A;  3NKQ A;  4TN0 A;  3TWZ A;  3TG0 A;  4QAX A;  2ZKT A;  4LR2 A;  1ELZ A;  1KHL A;  1EW2 A;  1N2K A;  5AJ9 A;  5LRM A;  5IJQ A;  4CXK A;  3MK2 A;  2XR9 A;  4MHX A;  1KHK A;  2IUC B;  1Y7A A;  4LR9 A;  1HDH A;  3UN5 A;  3MK0 A;  5HRT A;  4KJD A;  2IFY A;  1AJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...