4UORA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes in complex with glycerol phosphate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
Knots found
sequence length
418
structure length
417
Chain Sequence
b'SSDVTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOTEICHOIC ACID SYNTHASE
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transferase
total genus 168
structure length 417
sequence length 418
chains with identical sequence B, C, D, E, F, G, H, I, J, K
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uorA02
4UPKA 4UPHA 4MY4A 4UOPA 4KAYA 1P49A 1ZEBA 5HRTA 1KH9A 2RH6A 4CXKA 4N7TA 5KXAA 3IDDA 2GSNA 2GSOA 1EQJA 4MIVA 1SHNA 2W8DA 4UOOA 5L0EA 2XRGA 3BDGB 2G9YA 3NKNA 1KH7A 1K7HA 2W5SA 1KH4A 3MK2A 4MHXA 1HJKA 1EI6A 2IUCA 1HQAA 1ELYA 3CMRA 1EW8A 5C66A 4B56A 2ANHA 1KHLA 4NWXA 2IUCB 1EW9A 2X98A 3NKRA 5DLTA 3IGZB 3M8YA 5TJ3A 5EGEA 4UPLA 4CXSA 3ED4A 5LRMA 4TN0A 3TG0A 1AUKA 4GTZA 4KM4A 3B5QA 3WAYA 3A52A 4ZG6A 2VQRA 1N2LA 1AJCA 1ANIA 4LRCA 4KJDA 3UN5A 1ELXA 1KHJA 1B8JA 4CXUA 4FDJA 1Y6VA 1KH5A 3IGYB 3TWZA 1ANJA 5LQQA 4NWJA 5LRNA 2XR9A 2W5WA 3NKPA 3SZZA 2GLQA 1ZEDA 5INHA 3WAXA 3E2DA 3BDFA 5K4PA 4ZG9A 1EJJA 4LREA 1HDHA 2D1GA 4LRAA 3DPCA 3UN2A 3SZYA 4UORA 3MK1A 1E2SP 3WAWA 1Y7AA 3MK0A 3KD8A 4FDIA 4LRDA 5EGHA 3UN3A 3NKQA 2W5XA 3Q3QA 5IJSA 1KHKA 4ZGAA 1ELZA 4GTYA 3T00A 1O99A 4CYRA 2W5VA 1URAA 3T02A 2W8SA 1E33P 1ED9A 1N2KA 1AJDA 5LIAA 1O98A 3UNYA 1ALJA 4GTXA 3T01A 1EW2A 4QAXA 1FSUA 4KJGA 4ZG7A 1ALKA 4LR8A 5DLVA 3M8WA 1AJBA 1E3CP 1SHQA 3NKMA 4KAVA 4LR2A 4LR9A 1E1ZP 1ED8A 3WBHA 4GTWA 3WAVA 5L0KA 5AJ9A 3BDGA 5GRRA 3LXQA 3M8ZA 3DYCA 2W5QA 4LQYA 1ALHA 5GOVA 1ZEFA 4UPIA 3OT9A 5L0BA 2ZKTA 1ALIA 4LRBA 3BDHA 2IFYA 2GA3A 4LRFA 5IJQA 3NVLA 3NKOA 3TX0A 2GSUA 3M7VA 4YR1A 3UO0A 1AJAA 2QZUA 4CYSA 1URBA 2W5RA 5DLWA 4LR7A 2W5TA 1KHNA
chains in the Genus database with same CATH superfamily
4UPKA 4UPHA 4MY4A 4UOPA 4KAYA 1P49A 1ZEBA 5HRTA 1KH9A 2RH6A 4CXKA 4N7TA 5KXAA 3IDDA 2GSNA 2GSOA 1EQJA 4MIVA 1SHNA 2W8DA 4UOOA 5L0EA 2XRGA 3BDGB 2G9YA 3NKNA 1KH7A 1K7HA 2W5SA 1KH4A 3MK2A 4MHXA 1HJKA 1EI6A 2IUCA 1HQAA 1ELYA 3CMRA 1EW8A 5C66A 4B56A 2ANHA 1KHLA 4NWXA 2IUCB 1EW9A 2X98A 3NKRA 5DLTA 3IGZB 3M8YA 5TJ3A 5EGEA 4UPLA 4CXSA 3ED4A 5LRMA 4TN0A 3TG0A 1AUKA 4GTZA 4KM4A 3B5QA 3WAYA 3A52A 4ZG6A 2VQRA 1N2LA 1AJCA 1ANIA 4LRCA 4KJDA 3UN5A 1ELXA 1KHJA 1B8JA 4CXUA 4FDJA 1Y6VA 1KH5A 3IGYB 3TWZA 1ANJA 5LQQA 4NWJA 5LRNA 2XR9A 2W5WA 3NKPA 3SZZA 2GLQA 1ZEDA 5INHA 3WAXA 3E2DA 3BDFA 5K4PA 4ZG9A 1EJJA 4LREA 1HDHA 2D1GA 4LRAA 3DPCA 3UN2A 3SZYA 4UORA 3MK1A 1E2SP 3WAWA 1Y7AA 3MK0A 3KD8A 4FDIA 4LRDA 5EGHA 3UN3A 3NKQA 2W5XA 3Q3QA 5IJSA 1KHKA 4ZGAA 1ELZA 4GTYA 3T00A 1O99A 4CYRA 2W5VA 1URAA 3T02A 2W8SA 1E33P 1ED9A 1N2KA 1AJDA 5LIAA 1O98A 3UNYA 1ALJA 4GTXA 3T01A 1EW2A 4QAXA 1FSUA 4KJGA 4ZG7A 1ALKA 4LR8A 5DLVA 3M8WA 1AJBA 1E3CP 1SHQA 3NKMA 4KAVA 4LR2A 4LR9A 1E1ZP 1ED8A 3WBHA 4GTWA 3WAVA 5L0KA 5AJ9A 3BDGA 5GRRA 3LXQA 3M8ZA 3DYCA 2W5QA 4LQYA 1ALHA 5GOVA 1ZEFA 4UPIA 3OT9A 5L0BA 2ZKTA 1ALIA 4LRBA 3BDHA 2IFYA 2GA3A 4LRFA 5IJQA 3NVLA 3NKOA 3TX0A 2GSUA 3M7VA 4YR1A 3UO0A 1AJAA 2QZUA 4CYSA 1URBA 2W5RA 5DLWA 4LR7A 2W5TA 1KHNA
chains in the Genus database with same CATH topology
4UPKA 4UPHA 4MY4A 4UOPA 4KAYA 1P49A 1ZEBA 5HRTA 1KH9A 2RH6A 4CXKA 4N7TA 5KXAA 3IDDA 2GSNA 2GSOA 1EQJA 4MIVA 1SHNA 2W8DA 4UOOA 5L0EA 2XRGA 3BDGB 2G9YA 3NKNA 1KH7A 1K7HA 2W5SA 1KH4A 3MK2A 4MHXA 1HJKA 1EI6A 2IUCA 1HQAA 1ELYA 3CMRA 1EW8A 5C66A 4B56A 2ANHA 1KHLA 4NWXA 2IUCB 1EW9A 2X98A 3NKRA 5DLTA 3IGZB 3M8YA 5TJ3A 5EGEA 4UPLA 4CXSA 3ED4A 5LRMA 4TN0A 3TG0A 1AUKA 4GTZA 4KM4A 3B5QA 3WAYA 3A52A 4ZG6A 2VQRA 1N2LA 1AJCA 1ANIA 4LRCA 4KJDA 3UN5A 1ELXA 1KHJA 1B8JA 4CXUA 4FDJA 1Y6VA 1KH5A 3IGYB 3TWZA 1ANJA 5LQQA 4NWJA 5LRNA 2XR9A 2W5WA 3NKPA 3SZZA 2GLQA 1ZEDA 5INHA 3WAXA 3E2DA 3BDFA 5K4PA 4ZG9A 1EJJA 4LREA 1HDHA 2D1GA 4LRAA 3DPCA 3UN2A 3SZYA 4UORA 3MK1A 1E2SP 3WAWA 1Y7AA 3MK0A 3KD8A 4FDIA 4LRDA 5EGHA 3UN3A 3NKQA 2W5XA 3Q3QA 5IJSA 1KHKA 4ZGAA 1ELZA 4GTYA 3T00A 1O99A 4CYRA 2W5VA 1URAA 3T02A 2W8SA 1E33P 1ED9A 1N2KA 1AJDA 5LIAA 1O98A 3UNYA 1ALJA 4GTXA 3T01A 1EW2A 4QAXA 1FSUA 4KJGA 4ZG7A 1ALKA 4LR8A 5DLVA 3M8WA 1AJBA 1E3CP 1SHQA 3NKMA 4KAVA 4LR2A 4LR9A 1E1ZP 1ED8A 3WBHA 4GTWA 3WAVA 5L0KA 5AJ9A 3BDGA 5GRRA 3LXQA 3M8ZA 3DYCA 2W5QA 4LQYA 1ALHA 5GOVA 1ZEFA 4UPIA 3OT9A 5L0BA 2ZKTA 1ALIA 4LRBA 3BDHA 2IFYA 2GA3A 4LRFA 5IJQA 3NVLA 3NKOA 3TX0A 2GSUA 3M7VA 4YR1A 3UO0A 1AJAA 2QZUA 4CYSA 1URBA 2W5RA 5DLWA 4LR7A 2W5TA 1KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPK A;  4UPH A;  4MY4 A;  4UOP A;  4KAY A;  1P49 A;  1ZEB A;  5HRT A;  1KH9 A;  2RH6 A;  4CXK A;  4N7T A;  5KXA A;  3IDD A;  2GSN A;  2GSO A;  1EQJ A;  4MIV A;  1SHN A;  2W8D A;  4UOO A;  5L0E A;  2XRG A;  3BDG B;  2G9Y A;  3NKN A;  1KH7 A;  1K7H A;  2W5S A;  1KH4 A;  3MK2 A;  4MHX A;  1HJK A;  1EI6 A;  2IUC A;  1HQA A;  1ELY A;  3CMR A;  1EW8 A;  5C66 A;  4B56 A;  2ANH A;  1KHL A;  4NWX A;  2IUC B;  1EW9 A;  2X98 A;  3NKR A;  5DLT A;  3IGZ B;  3M8Y A;  5TJ3 A;  5EGE A;  4UPL A;  4CXS A;  3ED4 A;  5LRM A;  4TN0 A;  3TG0 A;  1AUK A;  4GTZ A;  4KM4 A;  3B5Q A;  3WAY A;  3A52 A;  4ZG6 A;  2VQR A;  1N2L A;  1AJC A;  1ANI A;  4LRC A;  4KJD A;  3UN5 A;  1ELX A;  1KHJ A;  1B8J A;  4CXU A;  4FDJ A;  1Y6V A;  1KH5 A;  3IGY B;  3TWZ A;  1ANJ A;  5LQQ A;  4NWJ A;  5LRN A;  2XR9 A;  2W5W A;  3NKP A;  3SZZ A;  2GLQ A;  1ZED A;  5INH A;  3WAX A;  3E2D A;  3BDF A;  5K4P A;  4ZG9 A;  1EJJ A;  4LRE A;  1HDH A;  2D1G A;  4LRA A;  3DPC A;  3UN2 A;  3SZY A;  4UOR A;  3MK1 A;  1E2S P;  3WAW A;  1Y7A A;  3MK0 A;  3KD8 A;  4FDI A;  4LRD A;  5EGH A;  3UN3 A;  3NKQ A;  2W5X A;  3Q3Q A;  5IJS A;  1KHK A;  4ZGA A;  1ELZ A;  4GTY A;  3T00 A;  1O99 A;  4CYR A;  2W5V A;  1URA A;  3T02 A;  2W8S A;  1E33 P;  1ED9 A;  1N2K A;  1AJD A;  5LIA A;  1O98 A;  3UNY A;  1ALJ A;  4GTX A;  3T01 A;  1EW2 A;  4QAX A;  1FSU A;  4KJG A;  4ZG7 A;  1ALK A;  4LR8 A;  5DLV A;  3M8W A;  1AJB A;  1E3C P;  1SHQ A;  3NKM A;  4KAV A;  4LR2 A;  4LR9 A;  1E1Z P;  1ED8 A;  3WBH A;  4GTW A;  3WAV A;  5L0K A;  5AJ9 A;  3BDG A;  5GRR A;  3LXQ A;  3M8Z A;  3DYC A;  2W5Q A;  4LQY A;  1ALH A;  5GOV A;  1ZEF A;  4UPI A;  3OT9 A;  5L0B A;  2ZKT A;  1ALI A;  4LRB A;  3BDH A;  2IFY A;  2GA3 A;  4LRF A;  5IJQ A;  3NVL A;  3NKO A;  3TX0 A;  2GSU A;  3M7V A;  4YR1 A;  3UO0 A;  1AJA A;  2QZU A;  4CYS A;  1URB A;  2W5R A;  5DLW A;  4LR7 A;  2W5T A;  1KHN A; 
#chains in the Genus database with same CATH topology
 4UPK A;  4UPH A;  4MY4 A;  4UOP A;  4KAY A;  1P49 A;  1ZEB A;  5HRT A;  1KH9 A;  2RH6 A;  4CXK A;  4N7T A;  5KXA A;  3IDD A;  2GSN A;  2GSO A;  1EQJ A;  4MIV A;  1SHN A;  2W8D A;  4UOO A;  5L0E A;  2XRG A;  3BDG B;  2G9Y A;  3NKN A;  1KH7 A;  1K7H A;  2W5S A;  1KH4 A;  3MK2 A;  4MHX A;  1HJK A;  1EI6 A;  2IUC A;  1HQA A;  1ELY A;  3CMR A;  1EW8 A;  5C66 A;  4B56 A;  2ANH A;  1KHL A;  4NWX A;  2IUC B;  1EW9 A;  2X98 A;  3NKR A;  5DLT A;  3IGZ B;  3M8Y A;  5TJ3 A;  5EGE A;  4UPL A;  4CXS A;  3ED4 A;  5LRM A;  4TN0 A;  3TG0 A;  1AUK A;  4GTZ A;  4KM4 A;  3B5Q A;  3WAY A;  3A52 A;  4ZG6 A;  2VQR A;  1N2L A;  1AJC A;  1ANI A;  4LRC A;  4KJD A;  3UN5 A;  1ELX A;  1KHJ A;  1B8J A;  4CXU A;  4FDJ A;  1Y6V A;  1KH5 A;  3IGY B;  3TWZ A;  1ANJ A;  5LQQ A;  4NWJ A;  5LRN A;  2XR9 A;  2W5W A;  3NKP A;  3SZZ A;  2GLQ A;  1ZED A;  5INH A;  3WAX A;  3E2D A;  3BDF A;  5K4P A;  4ZG9 A;  1EJJ A;  4LRE A;  1HDH A;  2D1G A;  4LRA A;  3DPC A;  3UN2 A;  3SZY A;  4UOR A;  3MK1 A;  1E2S P;  3WAW A;  1Y7A A;  3MK0 A;  3KD8 A;  4FDI A;  4LRD A;  5EGH A;  3UN3 A;  3NKQ A;  2W5X A;  3Q3Q A;  5IJS A;  1KHK A;  4ZGA A;  1ELZ A;  4GTY A;  3T00 A;  1O99 A;  4CYR A;  2W5V A;  1URA A;  3T02 A;  2W8S A;  1E33 P;  1ED9 A;  1N2K A;  1AJD A;  5LIA A;  1O98 A;  3UNY A;  1ALJ A;  4GTX A;  3T01 A;  1EW2 A;  4QAX A;  1FSU A;  4KJG A;  4ZG7 A;  1ALK A;  4LR8 A;  5DLV A;  3M8W A;  1AJB A;  1E3C P;  1SHQ A;  3NKM A;  4KAV A;  4LR2 A;  4LR9 A;  1E1Z P;  1ED8 A;  3WBH A;  4GTW A;  3WAV A;  5L0K A;  5AJ9 A;  3BDG A;  5GRR A;  3LXQ A;  3M8Z A;  3DYC A;  2W5Q A;  4LQY A;  1ALH A;  5GOV A;  1ZEF A;  4UPI A;  3OT9 A;  5L0B A;  2ZKT A;  1ALI A;  4LRB A;  3BDH A;  2IFY A;  2GA3 A;  4LRF A;  5IJQ A;  3NVL A;  3NKO A;  3TX0 A;  2GSU A;  3M7V A;  4YR1 A;  3UO0 A;  1AJA A;  2QZU A;  4CYS A;  1URB A;  2W5R A;  5DLW A;  4LR7 A;  2W5T A;  1KHN A; 
#chains in the Genus database with same CATH homology
 4UPK A;  4UPH A;  4MY4 A;  4UOP A;  4KAY A;  1P49 A;  1ZEB A;  5HRT A;  1KH9 A;  2RH6 A;  4CXK A;  4N7T A;  5KXA A;  3IDD A;  2GSN A;  2GSO A;  1EQJ A;  4MIV A;  1SHN A;  2W8D A;  4UOO A;  5L0E A;  2XRG A;  3BDG B;  2G9Y A;  3NKN A;  1KH7 A;  1K7H A;  2W5S A;  1KH4 A;  3MK2 A;  4MHX A;  1HJK A;  1EI6 A;  2IUC A;  1HQA A;  1ELY A;  3CMR A;  1EW8 A;  5C66 A;  4B56 A;  2ANH A;  1KHL A;  4NWX A;  2IUC B;  1EW9 A;  2X98 A;  3NKR A;  5DLT A;  3IGZ B;  3M8Y A;  5TJ3 A;  5EGE A;  4UPL A;  4CXS A;  3ED4 A;  5LRM A;  4TN0 A;  3TG0 A;  1AUK A;  4GTZ A;  4KM4 A;  3B5Q A;  3WAY A;  3A52 A;  4ZG6 A;  2VQR A;  1N2L A;  1AJC A;  1ANI A;  4LRC A;  4KJD A;  3UN5 A;  1ELX A;  1KHJ A;  1B8J A;  4CXU A;  4FDJ A;  1Y6V A;  1KH5 A;  3IGY B;  3TWZ A;  1ANJ A;  5LQQ A;  4NWJ A;  5LRN A;  2XR9 A;  2W5W A;  3NKP A;  3SZZ A;  2GLQ A;  1ZED A;  5INH A;  3WAX A;  3E2D A;  3BDF A;  5K4P A;  4ZG9 A;  1EJJ A;  4LRE A;  1HDH A;  2D1G A;  4LRA A;  3DPC A;  3UN2 A;  3SZY A;  4UOR A;  3MK1 A;  1E2S P;  3WAW A;  1Y7A A;  3MK0 A;  3KD8 A;  4FDI A;  4LRD A;  5EGH A;  3UN3 A;  3NKQ A;  2W5X A;  3Q3Q A;  5IJS A;  1KHK A;  4ZGA A;  1ELZ A;  4GTY A;  3T00 A;  1O99 A;  4CYR A;  2W5V A;  1URA A;  3T02 A;  2W8S A;  1E33 P;  1ED9 A;  1N2K A;  1AJD A;  5LIA A;  1O98 A;  3UNY A;  1ALJ A;  4GTX A;  3T01 A;  1EW2 A;  4QAX A;  1FSU A;  4KJG A;  4ZG7 A;  1ALK A;  4LR8 A;  5DLV A;  3M8W A;  1AJB A;  1E3C P;  1SHQ A;  3NKM A;  4KAV A;  4LR2 A;  4LR9 A;  1E1Z P;  1ED8 A;  3WBH A;  4GTW A;  3WAV A;  5L0K A;  5AJ9 A;  3BDG A;  5GRR A;  3LXQ A;  3M8Z A;  3DYC A;  2W5Q A;  4LQY A;  1ALH A;  5GOV A;  1ZEF A;  4UPI A;  3OT9 A;  5L0B A;  2ZKT A;  1ALI A;  4LRB A;  3BDH A;  2IFY A;  2GA3 A;  4LRF A;  5IJQ A;  3NVL A;  3NKO A;  3TX0 A;  2GSU A;  3M7V A;  4YR1 A;  3UO0 A;  1AJA A;  2QZU A;  4CYS A;  1URB A;  2W5R A;  5DLW A;  4LR7 A;  2W5T A;  1KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...