4LRDA

Phosphopentomutase 4h11 variant
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSIGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYKVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase 4H11 variant
total genus 144
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrdA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrdA01
5LQQA 4GTXA 3WAXA 1ALJA 4NWXA 4LRFA 2IUCB 3BDGA 4GTYA 3M7VA 1E2SP 3T00A 1AJCA 3MK1A 4UOPA 5EGHA 4UPIA 1E33P 1Y7AA 2W5TA 5HRTA 5L0EA 4LRAA 1N2KA 5LRNA 4CYRA 3UO0A 2XRGA 1KHJA 2GSUA 2IUCA 3BDGB 3BDHA 4ZGAA 1KH5A 3WAWA 1ELXA 2W8DA 3DYCA 2W5SA 3NVLA 3B5QA 4CXSA 4CXKA 2QZUA 4TN0A 1ZEDA 1KH4A 2W5VA 5LIAA 1HQAA 5INHA 3SZZA 4FDJA 3NKRA 1ED8A 3M8WA 4MHXA 4KAYA 4CXUA 1ZEFA 4MIVA 5K4PA 4UOOA 1KH7A 5EGEA 3Q3QA 4ZG7A 4UPKA 1HJKA 1EW2A 3OT9A 3TX0A 2GSNA 4B56A 1EW9A 3M8ZA 5DLWA 1SHNA 1ELZA 4YR1A 3UN5A 3MK2A 5AJ9A 1ANIA 3E2DA 5C66A 2GSOA 2W5RA 3UN2A 3A52A 3BDFA 4MY4A 4UPLA 3UNYA 3MK0A 1KHLA 1ALKA 4LRBA 3M8YA 5IJQA 5IJSA 2W5XA 1KH9A 1KHNA 4UPHA 3KD8A 1EQJA 2W5WA 2ZKTA 2W5QA 4KAVA 4QAXA 5KXAA 1O98A 4GTWA 4ZG6A 2GA3A 4LR8A 1EJJA 2GLQA 5LRMA 1SHQA 2IFYA 1B8JA 4KJGA 1Y6VA 4LREA 5GOVA 4ZG9A 3NKQA 1EI6A 1ELYA 1AUKA 2G9YA 2D1GA 3IDDA 4LR9A 1AJDA 1AJBA 1FSUA 3CMRA 2ANHA 1ALHA 3NKMA 2W8SA 4GTZA 1ALIA 3NKNA 4LR7A 1URAA 2XR9A 3WAYA 3UN3A 2VQRA 1ED9A 4FDIA 3WBHA 5TJ3A 1ZEBA 3TWZA 1KHKA 1ANJA 3T01A 3IGYB 3LXQA 4CYSA 1N2LA 1EW8A 4KM4A 5DLTA 3WAVA 3DPCA 3SZYA 5L0KA 5DLVA 3NKPA 1E3CP 2RH6A 3NKOA 4KJDA 4UORA 3TG0A 5L0BA 4N7TA 1E1ZP 1K7HA 1O99A 5GRRA 4LRCA 4LR2A 2X98A 1URBA 3IGZB 3T02A 3ED4A 4NWJA 4LQYA 4LRDA 1AJAA 1HDHA 1P49A
chains in the Genus database with same CATH superfamily
3KNGA 2HS4A 4GTXA 1FJ7A 2VFSA 4RWXA 1CG2A 1HI1A 2MQPA 5LQQA 1FD2A 2DXDA 1S0OA 2QMUB 3S1TA 2LQ9A 2M52A 1IJEB 3OL9A 2XNQA 4ZVPB 2V2VA 5SUHA 1OYDA 3CDUA 1RT4B 3PVXA 3T1AA 1QTNB 3IM9A 1EKRA 2G0JA 3G86A 4GMKA 3TA1A 4WP8A 2BMBA 4HVZA 1OSDA 3VTIA 4EWTA 1RAAB 2LU2A 2M0GB 2B7CB 3UO0A 5IWAJ 1VMBA 4V19X 1KQSR 1P9YA 4FN5A 3TAMB 3DRRB 2ZC3A 3POTB 4ZJOA 2XMMA 2KZMA 1P9QC 3DDKA 4E0DA 3B5QA 4CXSA 4LF5J 1NK0A 2XMVA 2GGPB 3KWMA 1IKYA 1TAUA 1DJ0A 4H4KC 4HR2A 3M30B 2OUGA 4JI6F 3OSNA 3VGVA 5K9FA 5IT9Y 5LJ3Y 2NPFA 2RHQB 3CVKA 1RTDB 3N6LA 2CA9A 3JYTA 1Q82T 4ZDNA 1WTBA 4O3SA 3NMRA 5IM0B 1FRXA 2ZITA 3H20A 3PEJA 4W4MA 3NS6A 3M6VA 1T9TA 1Y10A 4EU0A 4NX9A 3QSIA 3C8YA 1FO1A 1S0VA 3BZQA 3T5KA 3KUEA 4WZMA 1NK7A 3HZEA 2NS1B 2B9EA 4ETXA 1X4EA 2ZFHA 1MNEA 1N5SA 1KDNA 4MJKA 5DDOC 2DGVA 1L3VA 1BD6A 2FVCA 2IFXA 4ZHRB 1G6BA 4QWAA 2XYGB 3OUYB 2GAHC 1N5TA 3CCWA 2EFQA 1HHSA 5CYMB 2YH1A 3UN2A 2JLFA 4B3SJ 3OLBA 1G7CB 3SEOA 4OX7A 3HVTA 2AYBA 1BQXA 3TUZC 1Q5VA 3KLHB 1KS2A 4NLXA 3EVWA 4X2BA 3VALA 1IKWA 1WC6A 5LL6d 4A8MP 3BPDA 1DTQA 2OPPA 2N4CA 3AT1B 2XM3A 2IDEA 3QRPA 3H0PA 4W90B 4RJVA 1KVKA 1D8ZA 2W7PA 1X4BA 4X64J 2C2EA 2FHMA 2ZH6A 3K0JA 2CWXA 4CQ1A 3DOKA 2IFYA 3VQTA 3OR1A 3ZTSA 3I4PA 4WU2A 3TZYA 3TX8A 2HG4A 2VQEJ 4NA2A 1PYTA 1EI6A 4C8LA 1YJ9S 1Y3KA 4U6PA 4WFZA 3I0SB 2OD4A 4CZCA 5GAGI 3IDDA 5DQGA 1RAEB 1RTIA 2MZJA 2OEJA 5GAEU 1AJBA 2IIHA 3MPYA 2ANHA 4EBDA 1KVIA 1VBKA 4HDHA 1M5PC 1OQ3A 2GCFA 2JJ4D 2ZZTA 3NWGA 4K4YA 2UUAF 2L9NA 3OFFA 1S1TB 5L46A 2MKKA 1L3TA 2VA3A 3UN3A 5BYRA 2L3MA 4U7CA 1VC0A 3FGVA 1TKXA 2KB2A 3HD2A 3C3LA 1HD0A 2RE1A 2PE8A 1WUUA 1K44A 5DQIA 1QTMA 2RQ4A 1KEKA 2ZOMA 1YKWA 2HRTA 2W8LA 2IRYA 1QD1A 1RP5A 4RU2A 2HWIA 2IRXA 3KFWX 1O8BA 4CYSA 1WC3A 4E8UA 4NI2A 5KAKA 2GQQA 2HPUA 2WAQD 1VRTA 2ZE2A 1S49A 4Q43A 3H4DA 2Z8QA 4USVA 1TK5A 5AXNA 4WE1A 3RR8A 1AT1B 4R5PB 8RUCA 1AA1B 4QW8A 3KLEB 2ASDA 5CYJA 1BQNA 1R31A 1LFPA 2VF3A 4X66J 1SB6A 3ZZRA 5ETSA 1J5EJ 4ZPCA 4DFJA 2VOPA 4EFAC 1AJAA 4RNOA 2YX7A 3QIDA 1WG1A 3VVTA 3R1HA 3WAXA 2HKEA 2XTJP 4UZCA 4NWXA 3GU0A 4F36A 3T9NA 3QAUA 1VQ9S 3DRSB 4NYZA 3LP0B 1S4EA 2PI5A 1PC5A 2H5EA 1NSAA 3QZ8A 2F9JA 1REVA 3UQSA 1K1QA 1JNZB 5HI7A 3GJQB 4WWSA 1Q1KA 2CQ2A 3N01A 5DZ6A 5A76A 3HSGA 3ELHA 5K5MA 2BJ7A 3NCPA 5IFMA 1N8RT 1ROFA 1LWEA 1TVRB 3PM9A 2BR0A 2CNLB 4MIVA 2QZUA 2FC8A 3MEGA 2VFTA 5GVQA 4NYOA 5KG6A 1SCJB 2OEMA 4PPDA 2MPUA 2HFUA 4L3KA 3D6MB 4A46A 4TQSA 1RACB 5T14A 2HBYB 4NLRA 4KH1B 1MMDA 5KFSA 1SL0A 4FDJA 5D4NA 1C1BA 2IBKA 3E51A 5K8PA 3VAHA 3BGFA 2JEJA 2KTQA 2B56A 1RAOA 3PO5A 5B0BA 2BKOA 3IRXB 4ZG7A 1U0SA 3TX0A 1EB0A 2FHJA 2XHCA 3A8EA 3H25A 4QYZJ 1SVDA 2O01C 2ZNZA 2DR5A 3IWLA 3QLHA 1H98A 2CUYA 4WU3A 4YR1A 2ZHOA 3EGNA 3KOAA 1AFJA 5D8HB 1ANIA 1OQ6A 2NREA 3RB3A 4YOEA 2CADA 2A6MA 1WI8A 4P2MA 4WJBA 4HLBA 4DPWA 3CDBA 5HATA 1FD8A 1S1VA 5AT1B 1UPPA 4JI5J 2CJ9A 2E5HA 2PI4A 4X4VA 1KHLA 2E5GA 3MWBA 2EK1A 2W4CA 2IAJA 4KGXB 4HKQA 5ETPA 3BYRA 5BR8F 4N8OA 3NY0A 4ID5B 1IXKA 3P5BP 3DOMB 4C8ZA 2WVDA 4ZVFA 5KFCA 2GQ2A 1XERA 1CJUA 4DU8A 2M9KA 4NLGA 4JI4J 4FPIA 2XLIA 1NJIT 6FDRA 3THPA 1T95A 2LQBA 5LRNA 4LR8A 2V34A 4NA1A 3CNQP 2PA3A 3FNNA 3EM1A 4RW9B 5J2NB 3CCMS 2HZVA 2RB7A 4RL1A 3E01A 4U96A 4JI1F 1UL3A 1XMOJ 4B3OA 5FLXU 2JX2A 2ZWPA 5GOVA 5CAAA 3M9MB 3TARA 5ETLA 1S99A 5LMUF 2E1CA 2HNYA 5HBMB 4CIOA 5DJBA 5CCLA 3W9IA 1NDCA 1SI9A 4OZ5A 2QL5B 5JVHQ 4MKBA 5KT2A 3MM6A 2YX1A 1BQMB 3AXMA 1DQ8A 1FDNA 1EP4A 2YH0A 2DGXA 3I5BA 4GKJF 2DNYA 3EZUA 1LKZA 3FBEA 2W8SA 2MY7A 3UDEA 2DNZA 3CJ4A 1YIJS 1WI6A 2XI3A 3CCRS 4JP8A 2BE2A 3GP9A 1Y11A 3KLVA 4RW7B 1YK9A 1KFDA 4G6VB 1PAEX 4DR3F 2XYPB 2XWXA 3CJ5A 5SZTA 3CCLS 1UEVA 4ZP9A 5BXIA 3IRWP 2CPEA 4WYLA 1X0PA 2Z30B 3DOLB 3SCIE 2MQQA 1T7PA 3QAEA 3Q8SB 3WC2A 4LF7J 1RXOB 1HWIA 2BM0A 2QRRA 3I32A 3PW2A 4I4BA 1UVKA 2Y1LB 1RTJB 1YG0A 4FYYB 4OI3A 5K20B 3CJ8A 2XS7A 4IFYA 1WOPA 2G0IA 2GVDB 4UORA 2RNEA 1F6TA 1S12A 3Q2SC 4Y65A 5KFZA 4C11B 1NK5A 4LR2A 2VQFF 1IKXA 1OO0B 2MKCA 1DARA 2NCKL 1SH0A 2NXNA 3LGHA 4IG0A 3CJKA 2HMIA 4KKOB 1G3OA 3LA0A 4HTJA 3UI3A 1LXJA 1HQEA 2ZBRA 3MM9A 5KFIA 4YB7A 3FC9A 4QZVB 1T0TV 4LRFA 5HQLA 2AW0A 2DNOA 2YQ3A 1CQNA 1PCAA 2B5JB 3T5LA 1TQLA 2DT9A 3MK1A 2FZCB 1MMNA 2JC0A 3SXLA 2WB1D 2WONB 3TJAA 4DV5J 1CBKA 3BSCA 2Y8YA 2YNIB 3A12A 1BUXA 1Z2LA 3IBFB 4FYDA 4PKDB 1W7WA 3L3CA 3UD3P 3W64A 2DNGA 3BBFA 2RRAA 3WZ0A 3CJSA 4BWJA 1NKEA 4LFAF 4EGLA 4ECXA 2QLJB 3ULHA 4I0WA 4FF3A 1LXNA 2M2BA 3TVYA 1FE0A 3M6UA 3VR1A 1RBAA 3MPUB 1PG5B 4IDKA 5KFBA 1WEXA 4IUFA 1PAUB 3R7BB 4O3OA 1KR4A 4RWWA 4DR4J 8ATCB 3HM9A 2CPDA 3KK1A 1ZM2A 4X65J 5HQMA 2ZJPQ 2C2NA 2G2YA 5HJXA 1Y0HA 3BN4A 3CIZA 2CPFA 2B0GA 3D1OA 3DRRA 3POTA 4C0OC 3NOCA 1KQKA 2J5AA 4ZPWR 2VBYA 4OLPA 5GAGU 1P6TA 5C7PA 3IM8A 4ZJLA 2HZAA 3NGRA 1ZH5A 2GSNA 4UPKA 2EFPA 1P27B 3M8ZA 4JI2F 4J9SA 3M30A 2AGPA 1IR2A 5EWGA 2JLEA 3OHAA 2WB4A 1CJKA 2QA4S 4QPTA 1UVMA 1N48A 5IM0A 3KYLA 3A52A 1I3OB 3HSZA 4HL9A 3MR6A 2EKYA 4DR2J 4RBUA 3M8YA 3O3LA 3CDWA 4ZLJA 4JV2A 4Q8EA 3ILJA 1SQGA 2RILA 3LUYA 9ATCB 2EI5A 5KFPA 3AQOA 3V6HA 1VDHA 1C1CB 2VPYB 3BGRB 4OJHA 2W5WA 2ADBA 4Y34A 2RQCA 2HHHJ 4E2FB 5IT9U 5CCMA 1KP6A 1LQ9A 2LDYA 2VL1A 4FDFA 5F9LA 3OJUA 3P6YC 1CC7A 2H5IB 3QT5A 4ED7A 1JX4A 4RUHA 1R8HA 3EXCX 2EFOA 5LRMA 2QFJA 1X5SA 2HIYA 1EKSA 4CH0S 3EVOA 3JSMB 5A0YA 3MR3A 1SH3A 2KJWA 2AIRB 2CXEA 2FY8A 2XQCA 1NJXA 2YWEA 4KFBA 1YRXA 4IH7A 4OI1A 2ZJRQ 4K0KJ 2D1GA 1D9DA 4PEOA 2I0XA 3GJTB 3LAMA 2YY3A 4FVMA 4RW4B 2VJVA 2Y0BB 3FK4A 1BWVA 5T41A 4CTAB 3OL7A 2YWWA 2WCXA 1T3NA 4JI6J 3C15A 4FKXA 4ECVA 1QM9A 3LANA 5J2QB 1AUDA 4DV0J 1AJCA 4WIIA 2V8PA 5D3GB 3J7A1 4RW8B 3T1YF 3K5MA 5A2QY 1FDBA 2EKNA 4DS5A 2HURA 3MMCA 4O3PA 4CT9A 4DG1B 4IRCA 3MPDA 2N3OA 3BH6B 4X4OA 2GV1A 4RUAA 3PJXA 3M8RA 3R8YA 5J2PA 2CQGA 1NHKL 1RU1A 2RF2A 3FZBA 2FJDB 4P2FA 2KYXA 3FMBA 1R7IA 2RS2A 2BQUA 4ELUA 3VQSA 1XR5A 2V2QA 4YHHF 4L3NA 5D4LA 2D3ZA 1IBMJ 4JI8J 2NZ4A 3W2WB 2M8DB 1S1TA 2N7YA 1WWHA 1RT1A 3ISND 4YFUA 1TKZA 1JJ2R 5CXTA 3DPCA 1FDAA 1TKXB 1XR7A 3CJRA 3FCWA 3JTNA 4C3LA 4YMEA 4DX6A 3OJSA 5HRTA 1MG7A 3B54A 2COLA 3CSKA 3NBPA 3RTVA 4RLEA 2MEWA 5L0BA 3MTJA 4ANEA 4M5JA 3I9ZA 5KFNA 2MZSA 2BJ8A 2ZOFA 3RRGA 4ZMMA 4A8XA 4ZPAA 2KVIA 2HK3A 4JI0F 3N5FA 3QO9A 2C28A 1S1UA 1FWLA 2C3MA 4DLEA 1PYSB 5DG9A 2KO1A 3RB6A 2XWYA 4C3MA 1U1LA 3H5SA 1P49A 3DLKB 1NPKA 5KFUA 1VBZA 3KLFA 3ENQA 4R5PA 1E2SP 1FXRA 4LVOP 2C22A 4HH0A 3KDNA 5U47A 5CABA 1BQNB 1LW0B 1UKUA 2UUWA 3QMQA 4CT8A 3EGZA 4Q0BA 2OI2A 2I5JB 3LF0A 4NLSA 1TK0A 1IR1A 1I1GA 1IQZA 1LFWA 3HHLA 4X4UA 2VPXB 4JI0J 2G4BA 2JDJA 3HULA 3QFHA 1RWMB 4JB8B 1NHVA 1TV6B 1TAQA 1S5ZA 1YJ7A 1H0HB 5CYQA 1UMJA 2HLUA 1KTVA 4BLGA 5GMDA 3Q2TC 2W8DA 4OX6A 2Z2LA 3LP0A 1VHIA 3NVLA 3IS9A 3UVJB 2RJZA 1MN9A 4F7VA 4WCEQ 3I56S 4P7VA 3DU6A 2DYAA 4HT7A 5B0CA 1N5YA 1DQAA 1HBNA 5IC4B 5INHA 2WZ1A 5HMZA 2BQ3A 2D41A 2ROPA 2UU9J 3M8WA 1IBMF 1NMEB 1BLUA 1NPRA 4RUCA 4JI8F 3B4DA 4YHHJ 4CXUA 1R8PA 4NLPA 3HLUA 3SCJE 2DR6A 3I9V9 4CM2A 4KGKA 4D3GA 3OL6A 2R7UA 5DGAA 4TKTA 3EMTA 1EW9A 2MLYA 3WC0A 3GFHA 2QE5A 1D0EA 4ZN3A 5AE1A 2F1FA 1KOOA 2GSOA 4MIWA 1ITPA 3Q8VA 2X51A 4M5MA 1T11A 1O6XA 1Q8LA 2E7XA 2H51B 2HHPA 4WXOA 3FUYA 5B0GA 4ECSA 4MY4A 1S79A 2W2NP 2E1MC 4KHMA 3PW5A 4OHXA 1F3VA 1JKHB 3N5BA 2AYMA 4WKYA 5HMXA 3V6DB 1HWUA 3HK2A 4WFXA 2JFKA 1U1PA 1TFYA 3ZZUA 4LF4J 2B4OA 2IM0A 3RZAA 2ZKTA 1UFWA 4ZPTR 2ATCB 2ZHAA 2Q43A 1A6LA 1BE4A 3V6KA 3A3PB 3W3SA 1R6VA 2W9BA 3KJQB 1BXNA 4OYWA 3MMBA 3OFHA 1X5OA 2DGOA 1IBLJ 1UCNA 3PIPQ 3J7YI 4LMZA 2HHHF 2U1AA 4HHUA 4DX5A 1S0NA 2L08A 3TA2A 3DOMA 3RBXA 4F3OA 5KG1A 1XNQF 1H6KX 3RBZA 4KV8B 4P73A 3CMES 1ELYA 2W2PP 4PZVA 3D66A 4LR9A 3ISNC 2P9EA 5DS7A 3OVAA 2PFFB 3K5PA 3ONQA 4ZVUB 5J2NA 3H5YA 4CI0B 3QT8A 3TVKA 4DUZF 4W92B 2ZH1A 3HHLD 2CAJA 3TOQA 4CYUB 1U48A 4FNHA 4KB7A 1J5OB 3MUMP 2IC3A 3V4IB 3Q8RB 1LW2A 4Q45A 1JJ4A 1WHWA 4PXCA 1Z1ZA 4ZPVR 1RBOB 4USUA 4DV3F 2R2RA 3HFZB 2Y1JA 5A8KA 3G82B 5LM7E 1YRTA 1UWBB 3UWTA 3SZ2A 3CCSS 4X84A 2XI2A 5DG7A 3PYEA 3CEDA 3D0GE 5L8RC 5KG3A 1EP4B 1JLQA 1U1QA 1VJWA 2QJ3A 4ANDA 3HDSA 2AJ2A 4DL7A 3R2DJ 5FLXY 5EGYA 4ECUA 1RTHB 4QYRA 3NGDA 5LXRA 1B3TA 1TL7A 2J9CA 4HDGA 1GMUA 3UCUP 2XC9A 3HKWA 3TNVA 4A8SA 2W4PA 3JSBA 5C2GA 1NJWA 3TG0A 4O3NA 5KT4A 5H1SV 2ROEA 1G2EA 2O1PA 3T6JA 3F73A 1Z2ZA 5I3UB 2A2CA 1SQEA 1MN7A 1U49A 4ED1A 1P1TA 3W5XA 2BJEA 2W2QP 2ZM6J 2C2ZB 3LO3A 3P4UB 4M5NA 1HBMA 4H4KA 4R25A 3UDVA 2J7KA 4LQ3A 1PBUA 2BV3A 1O51A 4WKRA 2O5DA 3P8BB 2OPRA 3TUJC 4DMZA 4IFYB 2ZH7A 1EIYB 4JI5F 2U2FA 3NEKA 1GXLA 2LYVA 2N82B 1N34J 2AZ3A 1CJTA 1JB0C 4F3QA 1UZHA 4KQZA 1NKBA 3CD6S 2ADCA 4I64A 1ZOTA 1N5VA 4G1QA 1P1LA 3MM9B 3PRDA 2WBMA 3R6GB 2HHQA 4B3MJ 2ASYA 1NKCA 2POKA 4PXEA 1YRUA 2XY7A 1K47A 1KH5A 2GIQA 1XMQJ 3DYAA 3MCMA 2YNHB 4KPYA 1SV5A 2JSXA 2I9SA 3PIOQ 1PJ5A 3I4HX 4L72B 3TVZA 4I69A 4TN0A 4BWMA 2YNIA 1OY9A 2F8HA 2J9DA 3HVWA 3OR2A 2IDLA 2C2DA 4FF4A 1W2IA 2GW8A 2ZD1B 4RU9A 2EBGA 3HT0A 5KT3A 1RT2B 1S6PB 4RO0A 4IDKB 1E6VB 3BKUA 4OYBA 5EGEA 4DF4A 1KLMB 2DNRA 2E5LF 4B56A 1PJ6A 2AJ0A 1V5IB 3SSSA 1AROP 1MWYA 3EGVA 3KK1B 1WG4A 1U4BA 4MK8A 2I1RA 2P2CB 2DJWA 2ZEJA 3FQLA 3GZ7A 4QU6A 4ZIVA 2UUBF 1WD6A 4UPLA 4LF5F 4HYKA 3EVMA 1RTZA 2DB1A 3BREA 5A6PA 5EDWA 3B4MA 1JK9B 3MD3A 2IA6A 2CNOB 2CPIA 2V2ZA 2V8GA 4I6YA 3SMZA 2MKIA 4NCGB 4IOCQ 1T03A 4KGMA 2LXFA 4LFCJ 2J76E 2DTJA 2NYIA 4O4GA 3MR5A 1F5CA 3V6JA 3QWUA 1MWZA 5HK4A 2HYIB 1HL6A 4B17A 2EWHA 1U6ZA 4ETZA 4PXDA 4GTWA 4M5DA 2OGUA 1X60A 2PT0A 2VB6A 3H90A 4ZVHA 1HA1A 1NU4A 2W7AA 3D6FB 1SHQA 3OTOJ 3DRPA 2E44A 1X9SA 3HHNB 4IRDA 1DQ9A 2VDHA 4LVNP 2ZDOA 4J37A 4C97A 1C1CA 3BGRA 2IA0A 3FVYA 2V0NA 4LFCF 2GJFA 2G9YA 4DR5J 3DHWC 4AFFA 4K59A 5A8WB 4N5SA 1UVNA 1AJDA 3MPWA 2D74B 3FDSA 4OYXA 1VBYA 4I6WA 1UVLA 4ECQA 2VFRA 4MIAA 3EZ5A 4UY85 1FSUA 2MQMA 3R5JB 1QVGR 4OYIA 2HIQA 3H4BA 2LEBA 1W2BR 2OAUA 5A0YB 3MM7B 1DTTB 5IV4A 1HMVB 2AV5A 1BC6A 4TY9A 4GO5X 1VQ7S 1QDUB 3BSNA 2F8MA 1ED9A 1OPIA 3TZZA 4LSNA 1FVSA 2YXLA 3ZXWA 2P6SA 3OTCA 4CRJA 2HW3A 1U2FA 3O44A 1P8GA 3CDEA 2QEXS 2QC3A 3MMAB 2IY5B 5E3QA 3C15B 5F8GA 3O8WA 1QAYA 3SCKE 2LECA 2CZ4A 2FJVA 5D3GA 1JXVA 1KONA 2B6AB 5GAEI 2VOOA 5DLTA 1SC1B 1Y5NB 5ETTA 3ZTOA 5C42A 4G1IA 2RDJA 1V3SA 3MMCB 4AQYJ 3MDFA 2MQNA 2P9GA 3PXGa 5J2PB 2OO4A 2RF2B 2AWZA 3MR7A 4QOTA 4PG6A 5F3ZA 5HMWA 5EHHA 2IHR1 1JLGB 3CMAS 2KI2A 4HHHA 2A6OA 2D1CA 3TJ8A 4N41A 3W2WA 5DZ7A 4DL3A 3VV2B 1RT1B 3EDRB 5KTQA 2F65A 3NGSA 1FEEA 3GV5B 3GYGA 2MDAA 4GC6A 4DL5A 4MK7A 2DCLA 1GX6A 3PX4A 4Z7YA 1HR0F 1WHYA 2BKNA 3A1YG 4C6AA 4OI4A 3Q0AA 1KQFB 4AUKA 3ZTPA 4UY8T 2BJDA 2GO9A 4ZP6A 3DXSX 3ZNJ1 1TUVA 2VDIA 4NLVA 1GTHA 2CRLA 4A8FA 1TTHB 2ZM6F 2FZKB 1JLEA 1ZA2B 4FBTA 1IR0A 3ZZZA 4UOHA 1EQ0A 1J5EF 1X5TA 2WVBA 2JL9A 1LOUA 2IYGA 3BR9A 1VR6A 4FKYA 3UDLA 4F4YA 2R8JA 2CJAA 5L1IA 2XBPA 2W01A 1ELXA 2K7KA 3DYCA 4ZCIA 1B0PA 5CQGA 2UP1A 1H72C 7FDRA 1U8SA 2HFSA 1RYSA 2DITA 2EXUA 4Q0BB 2YKOA 2YWKA 4TXSA 3IFEA 4PAAA 1FX2A 3HHLB 2DNLA 2LXUA 3IWNC 4DPYA 4F02A 2AJFE 5E3PA 2BOPA 1Q78A 3G8SA 4ERDA 1ED8A 4MHXA 5CYQB 1CC8A 1S1XB 4OZ3A 5CHCB 1ZEFA 1Y7PA 2FQQB 3AOCA 2DHAA 1Z4UA 2DK2A 4HTIA 2GMHA 3SQOP 2FY1A 4Y0FA 3Q3QA 3CTRA 2GGPA 1TELA 3OTEA 4ZK7M 1HQUA 1IKYB 3M2UA 1YBAA 2DEIA 5M2PA 1TP7A 2X1AA 3DRYA 1MWQA 3CIMA 1HBNB 1AZSA 5F41A 2NXCA 4WP9A 3P49B 1EQMA 2VQFJ 3JYTB 2ZH4A 2X1BA 2K1RA 1PILA 4NRUA 1CJVA 2KT5A 2QMXA 4CLYA 3S7RA 3PKYA 4NOHA 2F3JA 3K89A 3N6NA 1UP1A 3N6MA 4KHRA 3EYZA 4DR7F 4DCPB 2H48B 2E1PA 1JNRB 1O0PA 3MEDA 1KOHA 1SBRA 2ABYA 3W2VB 4B08A 4ZVOB 5HMYA 4P2XA 4WFAQ 2HLTA 1YI2S 4BCAA 3A3OB 5CYMA 2EFGA 3HHDA 2NUHA 1KBRA 2BJ1A 1IBLF 3NGUA 4YR3A 4QWCA 2DBBA 3BJYA 1SJFA 1FXLA 1HD1A 1IKWB 1RWPB 1EZZB 1KC8T 2YTCA 4DV6J 3DI6B 5B7WA 1V3ZA 5KT5A 1DTQB 1FWPA 2FB0A 4KHPJ 2R7WA 4L75A 2PMWA 2P9CA 2XZDB 4IQMA 1U1MA 4WFNQ 2A18A 3MMBB 5J2MA 1WDDA 3CMRA 4IQXA 1S76D 3GONA 2BYCA 4TLRA 2HVHA 2HQIA 2X3GA 4AT1B 5HN0A 4XTTA 3NKNA 3FMWA 3NLCA 4LR7A 4WBFA 2MKJA 3RG6A 4PQAA 3FSXA 3CD0A 4F0MA 5DETA 2DY9A 3SQGA 3TAQA 2FHKA 1AUSL 3PV8A 4DUYF 1JLFA 2FDNA 4NRTA 1U7LA 1M1GA 1XMBA 4ZLPA 3JAMU 2M7SA 2OH2A 1VJQA 1ZAVA 2JOQA 3QGHA 1KN6A 3CUNA 2DIUA 2NLWA 4CH7A 4KR0B 3AD9C 3SDEA 3QNWB 3CJTA 1RABB 2CJYB 3GTYX 4DV1J 3V4IA 4HT5A 1LW2B 4ZP8A 3LALA 1RZMA 1WELA 5F0UA 4KM4A 4ZOSA 1B4SA 1FTCA 9RUBA 4KAIA 1GT8A 4X4PA 3IR7B 3NKPA 1FESA 1UWBA 2YKNB 3LGMA 4TYBA 3GCXP 4IKAA 4N8NA 1IWGA 3U1MA 5C2CA 2F4VF 3L09A 1FWKA 1RU2A 1WJ9A 4DS4A 3CC2S 4X62J 2FHJD 1IBKJ 4F4KA 1RTHA 2M4MA 4C8KA 3HX9A 1HDHA 2GX8A 2YVSA 4NLOA 2ZE2B 5I42B 1VRTB 4ZVRB 1YHQS 2B9XA 2EBEA 4WE1B 5IXUA 5KFHA 2O66A 4ED3A 2W2MP 2YKMA 2CWKA 4PWDB 1XBWA 3D0IE 4I6AA 2HFVA 5EGHA 2Z58B 1ALKA 4UPIA 2OPSA 1U1OA 2NXJA 1R8AA 1UVJA 2HHVA 1XEZA 1E33P 1GTEA 2VJUA 1Y7AA 2NUUG 5HL7Q 5HROB 2FUG9 1VQKS 3QZ7A 1PO6A 3LOUA 3IGVA 4ED4A 3R2CJ 2KRRA 3F41A 2LA4A 1QLNA 1GNKA 4ECWA 4EI2A 4ECTA 4R0JA 2G2ZA 3GIKA 4A47A 1K1SA 1CJTB 2ASJA 2X1FA 4A8QA 2JFDA 3H5XA 4PG5A 3EPIA 4DV2F 2V8DA 1UEUA 2XHWA 2C2KB 2XYHB 3RYLA 3VVUA 1VCTA 2EPIA 1H3DA 4MAKA 2ALZA 3NMAA 2XO7A 2KN4A 2ZOGA 1IBKF 3DYAB 2DNHA 2EFVA 5L1JA 3W8GA 1SV5B 2AT1B 3CW2C 1FERA 3KG0A 5IC6B 4YEAA 3M8QA 4ED0A 3J7ZT 1LWFB 4FS2A 3OD2A 2FGOA 3OR2B 3UN5A 4CWBA 3QT7A 3WQPA 2R8GA 3KK2A 3B6BA 3BO4A 1C1BB 1UA0A 2KG1A 1QE1A 3PHEA 3AH6A 3PR5B 2PGCA 1QVFR 4KPCA 4YP3A 5B0DA 1CSJA 2CZ9A 1FNOA 3OPKA 2DGUA 3KXDA 2W1BA 3LGNA 2XZWA 1RHJB 3THTA 5IJSA 2VC1A 2GFFA 5KFLA 3RJMB 5KFEA 1S9GB 3L7OA 1OYEA 1HNWJ 1URNA 1S1VB 2IM3A 3V81B 2W9CA 1ZPVA 3VGUA 2MQLA 1ELOA 3KHHA 5KFFA 3N79A 2L41A 4C4WA 5H9FJ 2QL9B 4ZS6A 3ITHA 1RWWB 4LF9F 3I5AA 1S10A 4O0NA 3RR7A 1NZAA 1NSPA 2BEFA 1D3WA 2R3VA 2Y1RI 4P75A 4PWUA 4ZCKA 3I87A 4RW9A 3MCOA 1JXLA 2HWHA 1YJUA 1AW0A 4PQUA 2EK6A 2Z4PA 2KHDA 1F3FA 2R7QA 4E98A 1IM4A 3GLJA 3CJ0A 3AOAA 3NNCA 2H54B 5K14B 3DLHA 2QLFB 5EN1A 4MMOA 5F8JA 2R8KA 1NHUA 4I56A 3RU0A 3X1LB 1I6JA 4OI0A 4DSFA 1VQMS 3QIPB 1IN0A 2CPXA 3BR8A 3R97A 3RBDA 1BQMA 4OX9J 3T01A 1X5PA 5HP1A 3QFWA 3BPSP 4TY8A 2V9WA 3TQ1A 4B9MA 1IM6A 4Y28C 3N0VA 4DLGA 4O3RA 1MSWD 2AU0A 4F4XA 2BE2B 4USMA 4B3RJ 3TQEA 3IG1B 3D7SB 2WW8A 3G87A 4K5RA 2CNKB 4RW7A 5F8MA 3KJNB 3EE3A 1H38A 3Q83A 4DPTA 3SYZA 4A8WA 3W60A 1ULRA 4DR6F 1JMTA 3NKYA 2R9LA 1E1ZP 4GVLA 2X98A 3DOLA 5F8LA 1JXEA 3SFUA 2B6AA 1XTZA 1Y9OA 1WKLA 3P3DA 4QIWD 7FD1A 2GJ2A 2GS8A 4P2SA 4URQU 1GXTA 5KFRA 4Y00A 3J81U 3NOGA 3IO1A 5HLFA 2NQPA 2YWGA 3LAKA 2GNKA 4MKVA 5I3PA 3G6XA 4J9PA 4B9TA 1NRKA 2GVDA 4GVBA 4DCOB 1NSQA 4ZKAA 2ZC4A 2J8AA 2WOMA 1JLGA 3MCSA 2AF6A 3BYPA 3NGKA 5D77A 4C11A 3M9NB 2PMHA 2WVEA 4OMFG 3KMSA 4PWWA 3H5UA 3CJKB 1KSPA 1RHRB 4RX6A 4URGA 1N2KA 1HQEB 2HHTA 1TL3B 4O44A 2B4UA 5DDQC 5KFGA 2B8QA 2GSUA 2KFYA 2IJNA 4DL6A 4K4ZA 3AJ1A 1RI7A 1VBXA 3FEYB 5C24A 4K4VA 2W5SA 2LEAA 4DPXA 3CULA 1C4CA 2WONA 2FVPA 2WSEC 1R3NA 3HT3A 4QAXA 1VHFA 3MM5B 2VC0A 4DEZA 4USTA 3QWPA 3W9HA 3JSRA 3CJ3A 2IVYA 5E3RA 3G8TA 4C8MA 2M5YA 4JV5F 5K4PA 1FKOA 3JS9A 1XNRJ 4UOOA 3DFEA 3M8PA 4DR3J 2KL8A 3RGIA 3MAAA 2OPQA 3M1VA 2V50A 4IFVB 4LSZB 4OJ1A 3C6TA 4V1Ak 2ZBCA 2DVIA 4NXNF 4AXJA 1S6QA 1O5JA 1QUPA 2RSQA 4M95A 5GADU 3SV4A 3E2DA 3FRYA 2HS0A 2CQ3A 2LCWA 2CPZA 2ZH9A 4ECZA 1LEOA 2RAQA 2HBZB 3UD5A 3T3FA 1LV5A 5MLCV 2WRMA 2MYFA 4L6V3 1ZZNA 2UV8G 1WG5A 4OYOA 3DDNA 3GV8B 2WK4A 1NJZA 5LMUJ 2R7VA 2VH7A 1FRIA 3FBFA 3P45B 1ZM9A 2CJBA 4UPHA 1U47A 2BW7A 2V94A 2ZDPA 4RNFA 3G71S 3GV7B 1WSVA 2K1RB 2LKZA 3O5TB 3CPWR 2XS2A 4K50A 1CJVB 1SIZA 2DH7A 4BHQA 2R2UA 2FVQA 2K3KA 3W7BA 2E7VA 2GA3A 3UDCA 4F50A 4NXMF 1RLDA 1CQMA 1FFWB 2OJ3A 3MEDB 4J90A 4QWBA 3LP2B 2K3IA 2J9EA 3MAHA 1F9FA 3W2VA 2HHUA 4B9NA 1NLKL 2J0XA 5EUHA 1JLAB 4IO9Q 1HNZJ 1R0BG 4K4WA 2UXDJ 1HQ2A 3CT9A 1RSCA 1K0TA 2HGNA 5A6WA 2YKAA 3DXBA 4YY3J 1CULB 1HNZF 4K4XA 4EBEA 2DNMA 1PC4A 2HQ3A 4CLLA 2BABA 1SJ3P 4Z7CA 4C3KA 2RKIA 1Q4RA 1S72S 4EZ6A 1NB7A 5I3QA 1URAA 4TLQA 3DI6A 3CCES 3KJFB 4KFBB 3MEEB 5AJ3F 1YLXA 4K2XA 2Z2ZA 2DGTA 3D67A 3BO2A 2V69A 5TJ3A 4WTOB 3KLIB 1Q81T 1FRKA 3TWZA 1FVQA 3TP2A 5J2MB 2CQBA 4FF2A 1ZEBA 1ZYQA 1RKJA 2H65B 1G1XA 1HNIA 1K0VA 2VHGA 4ECYA 5J2QA 3GMGA 3DDIA 2HZCA 5L39A 2V68A 1QAJA 4RW8A 1RWVB 3UCGA 2HRUA 3T41A 1JLFB 3SSQA 2H5JB 5KOWA 2BA9A 2VIHA 4RNNA 1IJFB 3H2LA 3P96A 1H2TZ 1Q86T 5EWEA 1YVFA 1CLFA 5GRRA 1T9YA 2HVEA 1RT6B 2MXYA 1RT5B 2XNRA 3IA0A 4IO1A 1I51B 2N7CA 2BJ9A 2G9OA 2YPZA 3G96A 5H9FK 3OSPA 2JVOA 2LMIA 1Q0NA 3GG1A 4Y2KA 4YUDA 4YB6A 1B7YB 2MQ8A 2C3OA 4NLDA 2MZ1A 2ZZNA 3BDGA 4DSLA 3WX4A 2YKNA 3FBBA 4DFKA 1FX4A 3NBPB 1VRQC 3MECA 1Y5IB 2B3TB 2L9DA 4J5OA 4DL4A 2KRBA 3K58A 2ZH8A 3ZZTA 4CLTA 4RNHA 1KFSA 1N6QB 1SIWB 1RJJA 1S1UB 3I6PA 2CYYA 4MKAA 5IQ6A 1D9AA 1HHTP 2VA2A 3L95X 2X3DA 3KLFB 1WKKA 3HO1A 3TW0A 1KWMA 2A10A 2YKMB 1XC9A 3DLLQ 4PWDA 1TMJA 4UOCA 1TMMA 1LW0A 1YSJA 1ZBTA 1X4DA 3HSDA 3IBWA 3WX8A 1N34F 2I5JA 3MF5A 5DDPC 2ZH5A 3UD4P 3SI8A 1S57A 5HROA 2PD1A 2H3EB 4WP3A 3BS9A 2WVFA 2Z0GA 3W62A 2DRBA 4ELVA 2GZOA 5E7OB 3I55S 1TV6A 4NEZA 1OWXA 3NWRA 4U67Q 4DCJB 1X9MA 2UXDF 2AYGA 4KAYA 1FT8A 4NEYA 3DLGB 3CF5Q 4ELTA 2MHEA 3M32A 3OBIA 4USIA 5DO2A 3NCQA 3V2UC 4AL7A 2RD5C 1NDLA 3T6BA 4DR6J 3IAS9 4ILRA 4JI3F 4ATNA 2RUGA 4HI1A 3M6WA 1Y3JA 4K4UA 3N28A 1VQSA 2UUAJ 5J1EB 3HI9A 4DQIA 4QR1A 5IS2A 4F2SA 3HHKA 2QLBB 1J27A 3UNYA 2JEIA 3ISZA 2AGQA 3QGPA 1F5BA 2FZGB 2RU3A 1DHMA 1QJHA 1FNMA 4YDDB 4QIVA 2A3JA 4DX7A 1S7HA 3CC7S 1LWFA 1KNZA 2DHHA 1EX8A 1SKUB 2V67A 2V63A 2VQEF 4CLKA 2QX0A 4KSEB 2I2YA 2ZNYA 1ZAWA 5MAOA 2W5QA 2CQ0A 3P5TL 1O98A 3TA0A 3EUNA 1HNXJ 3ILOA 4C48A 3OVBA 4NXNJ 2DHGA 4BDPA 4FBUA 4WFBQ 1JKHA 1RE1B 3C16A 4OZLA 3V6DA 3AD7C 4OJ3A 4FXDA 1F2HA 1GQEA 5IT0A 1NO8A 3CB4A 3G6ES 1X4GA 1XN9A 3VGSA 2UVUA 5DLFA 1S9EB 2G1HA 3EWGA 2C2RA 1S9GA 3ILLA 4CNZA 4JV5J 5FJ4A 2W9BB 2EG1A 3BDEA 1I94F 3OFEA 1HBOB 2GHWA 4QIGA 2W9CB 4B3TJ 5D78A 2NSCA 2CQ4A 4KYZA 1YJTA 3HHEA 3LW5C 1FI4A 3A3NB 3AD8C 1SJ4P 5GMKa 3BGUA 2YQ1A 1GFWB 3HKZD 3ITHB 2AX0A 1UAWA 4KC5A 3BO3A 3IR6B 4AD6A 5IV3A 4IH5A 1TFWA 3BV8A 2D3UA 4EEYA 2DNNA 4FYXB 2ZVSA 5DGBA 4OYPA 1TK8A 1M5VC 3E8OA 3EDQB 2E1RA 1IBCB 2WBRA 4DI6A 3HFKA 1PSDA 2BXJA 2L48A 3NCRA 5KFJA 2BKPA 3KJVA 1J5OA 3JQKA 3ENWA 2B4PA 2IC3B 4KH0B 2BW2A 1R0CB 3TRGA 5L9XA 1NCLA 3U1NA 3WAVA 2OLWA 1ZA1B 2UVRA 2OFHX 1B0TA 5FD1A 3VGTA 3ZZ0A 5A8KB 4I2PB 5ETNA 3QJLA 2I8EA 2QA4G 3OVSA 4LF8F 3QIPA 1RHMB 1MLAA 2AMCB 3GSDA 1M5OC 1T3OA 1SUQB 1JLQB 3H7HB 1U1KA 4KE5A 3T02A 1C0UB 1IWAA 2R7SA 3E2EA 2H1YA 3IN5A 1IUJA 2QO3A 3IG1A 4M5HA 2VKZG 2VG5B 1TL7B 2B8PA 5D4OA 3KHLA 2RUSA 2HSEB 4J9KA 4JUZA 4Z2XA 2YNFB 2IUCB 3QT6A 1JJCB 2M70A 4CH1A 2DGSA 3MGJA 4A8YA 2MSTA 5F8NA 3PR4A 1GEHA 1N54B 5IZHA 2FVRA 1OY8A 2XGQA 1T9VA 2CDQA 2XMWA 3MAQA 2QFIA 2VODA 1BMQB 5DM7Q 3KK3A 1VQ8S 2UXBJ 1RT7B 2ALYB 1RQ0A 1RWKB 2HVZA 3Q86A 2XULA 4FNIA 4J9QA 5HLFB 3U02A 2C3UA 4D3HA 1S7IA 4YN3B 4DWIA 4GVBB 2HFZA 1UEKA 3D4JA 2AZ1A 4M5IA 4OZJA 4URSA 2WOMB 3HP6A 3V81A 1L3UA 4UW2A 2NXUA 2FLOA 4NWBA 4C7QA 2BDPA 2XSJB 1LWXA 1Q8IA 1VRUA 3KG4A 5IOLA 5L38A 1SJRA 4F2RA 1PBAA 2FLPA 2UXCF 1D9FA 2UXCJ 3JAMY 3WHIA 2C3PA 3JQJA 4LF2A 1T05A 3FQKA 1H73A 2GMJA 1SJ1A 4QR2A 1UJ6A 3J81Y 4FS1A 4IRKA 2FIUA 3LQVA 3E3XA 1XWLA 2EW9A 2XMJA 3OXLA 1KH7A 3NNHA 1BWEA 1K8AT 2YNHA 4PABA 4P52A 4GKKJ 1Q7LB 1REGX 4X62F 1KLNA 2UXBF 4O3QA 3MR2A 1ELZA 1KH4A 4B9UA 3I0RA 1HWLA 4WTYA 2VG6B 4DR1F 1FRJA 2F8EX 4DSEA 2DNPA 3KUHA 2K06A 3LPYA 4CLPA 2ILZA 2KHCA 1S6PA 4ES2A 4KGVB 4DUTA 4H4OB 2AD9A 2HNZB 1E6VA 2FJAB 3M8PB 3OTBA 4H4MA 4ICLB 5KFTA 3TZXA 3M1VB 3J80Y 1R0AA 1RLCL 3KLGB 2CIMA 3C6TB 3FEXB 4LBPA 1RAHB 5ETVA 1FKPA 3RBEA 2MB0B 1QSYA 2K7JA 1S6QB 1FK9B 3R5BA 5EX3A 2V4QA 4KIAA 1ZAXA 2YNGB 3GJRB 3OXGA 1UW9A 2DKOB 4CM0A 5HVGA 3Q8PB 1VC5A 4X4SA 2JEFA 1VIXA 4AYBD 1WHVA 3T5HA 2YBVA 3DMJB 2UUTA 2KT3A 1AB8A 4DV4J 1PJ7A 2VFVA 3KKFA 5HAOA 4GKKF 3N4WA 1M5KC 1MW7A 4NCGA 3QGIA 5GADI 4I2QA 4ZG9A 3H2UB 2PO4A 1FTRA 2R8IA 2R7OA 3AAWB 4Q44A 1VK8A 3SBMA 4DFPA 2IVMA 2QA2A 3FFIB 2GA7A 5KFVA 1D8YA 2HVIA 2E5IA 5BYQA 5F8HA 2FC9A 2LVWA 4PUOA 3DRPB 4HI2A 2HRYA 4LUBA 3LP2A 4L76A 3UR3C 1SQFA 5CH7B 3CCVS 2FJWA 2J0SD 1IQTA 1ALIA 2XR9A 3HXMA 1JLAA 4ES3A 3DLEB 2ATLA 2WSCC 1BGXT 2W4DA 2WHOA 1Q95G 1UVIA 1EARA 4B3TF 4A4JA 1ANJA 1RA7A 2AYEA 2FTRA 1GX5A 1M1KT 3ET6B 2XMTA 5CZVA 2R8HA 2JRSA 3CCTA 1M90T 4DXLA 3FSIA 4MIBA 3PZPA 2MLZA 3MM7A 4DL0C 5DG8A 1TU0B 1HMVA 2J7WA 3AJ2A 4N77A 1A0OB 2P6TA 2VUGA 3MEEA 4Y2AA 5BJRA 1NZ8A 1D1UA 2V4JA 1DLOA 4Y2CA 1SKSA 4IOAQ 3PCOB 4TU8A 5DLVA 1RCXB 3KLIA 5CZXA 3PDNA 3W5YA 4ZVGA 1FJGJ 3BBCA 3AB2B 1NH7A 4U7UK 3NAIA 2HHXA 1HNIB 4U9RA 5GAHU 3JTOA 1VISA 4A8KA 4LF6J 1HFEL 4XAKA 4XK8C 4NZ0A 2PEHA 2AJ1A 3MPVA 3ILIA 1DZ5A 2DY1A 4LF8J 5HANA 4K7QA 1C4AA 5T7LA 3I31A 4DV7F 5J1PA 2DISA 1VQOS 1QAXA 3BGOP 4UUWA 3TANA 2W7OA 2HS3A 4DR4F 4X4TA 2DCUB 2FGCA 4O0IA 1HIYA 1KRPA 4JYAJ 2DR7A 1NAQA 1RT5A 4UTGA 4ZCMA 2HQGA 2BANB 2LP4A 1RHKB 5EWFA 1LK5A 3S6EA 2DIVA 1M0SA 4WIQA 3RB4A 2HBRB 4I7FA 3AA8A 4CYRA 3BN7A 4OI6A 4BC9A 2XGPA 2XRGA 4LFAJ 3B78A 2R7RA 3W63A 1WOSA 2AEFA 4YDXA 2GC8A 3BDGB 4FYWB 2EC2A 1JJHA 1Q53A 2RS8A 2P5VA 2E29A 2W25A 4G1PA 5ETQA 4AXIA 1ZTWA 2IMWP 2Y3YA 2GAGC 4DV5F 2HBQB 2W5VA 3GIRA 2Z2MA 4TU9A 1JLEB 4P74A 4BC7A 4N47A 5KFMA 2YPYA 3MOJB 4K5SA 1NBEB 4C98A 4KT0C 2PEBA 1EHWA 1HR0J 3G2XA 3MM8B 2Q3PA 1DAXA 1DURA 1X31C 5DLGA 3VAJA 4CLZA 5JMNA 3DKDA 4IOBA 1HJKA 4NL5A 3Q8YA 4FPRA 1FHTA 5DLWA 4DR7J 4ZVTB 4KO0B 1RAFB 4C2MA 4DF8A 1SJQA 3WIVA 3DLBA 5HSPA 4MFBA 1S1XA 2Q66A 5LOQA 1EJ7L 2IMOA 1WC4A 3DLGA 3TJ9A 4IR9A 2O67A 2KZZA 2BZ2A 4OZ0A 4DSKA 1HQUB 3M2UB 4FVCA 4OLOA 2B9YA 4BBYA 5AE3A 1SKRA 4U7UD 1AZSB 2AHOB 2HNDA 1URRA 1RUSA 5F8IA 2QGFB 1FJCA 4UOFA 4ZG6A 1RGVA 1OY6A 4QIFA 3TUPA 1RHQB 4ED2A 4YY3F 1UFLA 3CCUS 4PR6A 1S77D 4LSLA 2HK2A 2EVZA 3RAMA 1N0UA 1B8JA 2YWHA 1F1BB 2D9PA 3T9ZA 1Y6VA 4CO1A 3EXYA 4ECRA 3T5JA 4OJGA 4P71A 2Y8WA 3D68A 4EBCA 3NKQA 1AUKA 3PFOA 1B0VA 4DR5F 2LDIA 5CA5A 4ILLA 1HNVB 2E7WA 3MTKA 1WKJA 5M2RA 4B9VA 2KJVA 3NS7B 3ZFVA 3CO9A 2YX4A 1RT3A 1N33F 3KNAA 4R0EA 1T9UA 1U1NA 3J7AN 1JQGA 3C16B 3CCJS 4F4WA 4JI1J 4OHYA 1WTFA 2OMLA 2Q1LA 3UNGC 1U09A 4ED8A 3QRQA 3FKBA 4UUXA 2V4RA 4EYIB 4NLYA 1WF0A 1JLBB 2HEKA 1M1HA 4RKUC 1Q7YT 4LFBF 4LBIA 1HBOA 3VAMA 2LFVA 1IKVB 3HZGA 1H7XA 2KU7A 4NA3A 2W24A 1VC6A 2DHSA 5BR8J 2GIFA 1PKUA 2OSQA 4OHVA 3IGYB 3TEGA 1NJYA 1F2GA 3F44A 1MROA 1EW8A 3AQPA 2R2TA 2R7XA 1TKTA 4NE9C 5G4DA 3PFEA 3SQGB 2AJQA 2QTWA 4L73A 2QN6B 3SSRA 1FA0A 3K57A 1NK8A 3BGLA 1NDKA 3GYXB 2KDOA 3L7UA 4ZCLA 3WIUA 4P72A 3H42A 3TI0A 3D1HA 4NXMJ 1HI0P 4KJDA 2R4FA 4QWDA 3PJWA 2B9WA 3SDEB 2CDRB 2Z57B 4C8NA 3FBCA 4UOGA 5D6GA 1BHNA 3KJVB 2BVZA 2CPHA 2MY8A 3D2WA 2FLLA 1V5VA 2CG4A 2JLGA 3AA9A 4F8RA 2AJ4A 3ED4A 3ICLA 4NWJA 3NG8A 4K4SA 1KD1T 1F5AA 3LWLA 4CLFA 2LXIA 1NM2A 2VBZA 3ETOA 3TAMA 4AQYF 2JEGA 1VIOA 1GXUA 1UZDA 3ETMA 4I2PA 4HEA9 4PG4A 4F4ZA 3T00A 1S1WB 4FF1A 4Y2IA 1B70B 4NASA 2HQFA 1SUQA 2GHVC 4UQTA 1ZTTA 3VAIA 3NL0A 1XMQF 1TKDA 2BACA 2DNKA 2JWNA 3GWCA 3K5NA 1RTDA 4ZP7A 4DQPA 3ZNUA 1RAGB 2CFXA 2VG5A 3Q89A 5I42A 2DNQA 2XO6A 1RWXB 3BEGB 4CLWA 7AT1B 2IUCA 4RUBA 4BS2A 3RW7A 3U27A 3KDOA 4RW6B 4UZBA 1XNRF 3HCXA 2J9DE 4EYHB 1U2CA 2GQCA 2E66A 4NLWA 6AT1B 5ITHA 3JB9k 1S48A 3W66A 2OPSB 1APSA 5K8NA 1ZEDA 4J9UE 1HWJA 1JIHA 2OKQA 4ZHRA 3BF4A 3NKRA 2CPJA 3OUYA 2VD3A 2F7VA 1Y00A 1YDLA 1RT7A 4CLSA 3GYNA 2B4VA 5E3CA 4F0HA 2DPIA 2BQRA 3US5A 2EFNA 2HAFA 4XDCA 5HVFA 2A2DA 3KLHA 2DR9A 2GIRA 1RWUA 3OTOF 3HD1A 1CS4B 1SHNA 1T9WA 1AYEA 2DGWA 1S4FA 1TL1B 4RNMA 4N56A 2JZ5A 3VCDA 3SZYA 2OPPB 2ZBQA 1F9EB 3MK2A 4C8YA 1T05B 4P10A 1EETA 3Q8UA 2W5RA 5L9NA 1GH8A 4X4RA 3OQ2A 4HHJA 2G13A 2DXFA 1WC1A 2AEMA 1ICEB 1RBLA 4ZVSB 3TR5A 3DOKB 4ID8A 3SIPB 3K17A 1KKHA 2AEJA 3M8QB 1E6YA 4MK9A 1N32F 3DM2B 3M2RA 3J7Z5 4K4TA 1HKAA 1FFGB 4A48A 3KK2B 3W8PA 5E5NA 2F40A 4HH1A 1OSCA 1TUGB 2BE7D 2CVEA 3DRXA 3I0SA 3M9OB 1QE1B 1VGYA 2H4YB 1VQLS 3IMQJ 4DOZA 1RISA 2HNZA 1HW8A 1H2VZ 2DH8A 1VLYA 4Q7AA 4HACB 3BDPA 2KVQE 3X3UA 2E5LJ 5K8MA 5GAHI 3KLGA 3VAGA 2L9WA 5AXKA 4CO2A 2ERRA 2CNNB 4NYPA 5LSOA 3C66A 2JVRA 2X1GA 4G65A 4NLUA 1YJRA 4JV0A 2LA6A 3GCWP 4DBQA 1YBTA 1WC5A 1W25A 2HQCA 1Q8KA 1YJNS 3MXHP 3NKMA 2YWFA 2FHOB 4MTPA 1WSRA 2G0CA 4R8UA 3PO4A 4MH8A 3VHQA 1SPBP 1X4FA 2CJQA 1YZ7A 4I2QB 2OFGX 2MTLA 4X64F 3W1YC 4XIUA 5AE2A 2QLXA 3O2IA 4LQ9A 4J91A 3RAQA 2E9ZA 1KHKA 2RRBA 1XK8A 1MMLA 1HPZA 2V8HA 1YTYA 2AP6A 1SXLA 4PQUB 1WACA 1HNXF 2F4FA 1N88A 5D0RA 5KFYA 1RB0A 1YGYA 2PC6A 2V2KA 3DHXA 3LP1A 5FDLB 5K14A 3DLEA 3ZZPA 2MGZB 3HPOA 4ZPBA 5J1NA 3BH7B 1F60B 3M2VA 4O4RA 4OZ2A 3WDOA 5C5JA 2FD2A 2D9OA 3NRBA 3M6XA 3GR0A 2GO8A 5C25B 3PKMA 1QAIA 3MD1A 1K7HA 3VF0B 1OMSA 3ET6A 3R27A 4TY8B 3PX6A 3IGZB 3ENAA 3ZC4A 1MU2B 3CMQA 4KBIA 2FJEB 1T02A 2CJXB 2HGMA 2QT7A 2CQCA 3NGTA 4Z37A 4QQBA 2ZH2A 1TL4A 2ZJQQ 2CKWA 5B0FA 2V4JB 1DLOB 2FYXA 3R5CA 3PHTA 2IRUA 2Q79A 5KG7A 3M7VA 5B0EA 1XJWB 2KKHA 3D3CJ 2NYHA 1UFKA 3GB0A 1N56A 3ENVA 1V9OA 3GG0A 4OI2A 4F04B 4ED6A 2RMLA 2MZQA 3PW0A 4DR1J 1F9HA 4LRAA 5DQHA 2XB2D 4B9SA 5T7LB 1R89A 4LF6F 2W8KA 5LXYA 3GPAA 4PG8A 1NUEA 4X4QA 8AT1B 2A0FB 2UUCJ 4ZGAA 1UTAA 2V5HG 3H40A 4OYMA 1SL2A 2OELA 2AX1A 4TU7A 2BANA 3QLHB 2XMUA 2HVDA 1ZS6A 3DGPB 5DRKA 1U02A 1YWXA 3PACA 5KG4A 4J9RA 3GE9A 3J81j 3MUVP 1TL3A 1RWNB 4O44B 4M5GA 3MFHA 5KG5A 4TNOA 3HVRA 1JLCB 2RHSB 4OV6A 4DPOA 1CEZA 1U24A 5KFKA 3D28A 1FKAF 1S6UA 3F0NA 5HJYA 4LF9J 2UV8A 5C24B 1NK9A 1NXIA 4C8OA 5LMNJ 1SC4B 1XNQJ 1EW2A 3T1HF 3UFCX 4P9SA 3PJ9A 3MM5A 2MQOA 1B7FA 2PIIA 1FFSB 1TUWA 4GRSA 2FJBB 5LSRA 4WF9Q 3NXZA 4NMLA 1HNWF 4YB1P 2PMZD 2Y9HA 1EAYC 1NK4A 1FKOB 1UJ5A 3OTDA 4OZ1A 4A8OA 4CLUA 5B08A 4LF4F 1Q8BA 2HWTA 1R8CA 2OPQB 3MAAB 4LRBA 2H9ZA 2VBXA 4U95A 3EX7B 4IFVA 5L1KA 4JI7J 5JXSA 4EO8A 3OHBA 4DN0A 1FNXH 3C6UB 5G0RB 2IVFB 5HBMA 5KOXA 4M1KA 3TAPA 4DV4F 1TR0A 3CGIA 1X9WA 4QWEA 3T1YJ 2B51A 2G1DA 1N52B 3MM6B 1KTQA 2IM2A 1NEEA 2VU5A 2RH3A 3PYFA 2DR8A 2VFUA 3QGGA 1VYAA 2VPZB 3ZTRA 3C14A 1NH8A 3OXFA 3AY0A 4DV1F 4PUOB 4V19J 3LH2S 5HVHA 2F63A 3FRZA 3OLAA 3G6YA 4K0KF 4YR0A 4PXBA 4TN2A 1HHQA 1LWCA 4DV2J 1YITS 4AE5A 1U45A 4IYQA 4LSLB 2GHPA 1S0MA 4ED5A 4EZ9A 4GTZA 2CQIA 2HHSA 3GFYA 3T19A 1UA1A 5E2QA 2O3DA 1WEZA 4OV1A 1HARA 3EJMA 3THVA 1C0TB 5ETOA 3D9BA 3IP0A 3QATA 3T1HJ 2CPYA 1HNVA 1RTJA 1X4AA 1CULA 3K5LA 4WFYA 4ZLLA 3CDAA 3G6VA 1RT3B 1VFJA 1ZPWX 3CWJA 3MURP 1D09B 2IM1A 2RKIB 1U26A 4M94A 3LXQA 2CQPA 2MJNA 2KH9A 4DSIA 4KHPF 4IH6A 4DR2F 2IPOB 2XSFA 3A8JA 3FZ2A 4FP9A 4KKOA 3D5MA 4Q2LA 4S0MA 2K2PA 4C0BA 4L74A 5L0KA 2LEPA 1JLBA 3ZO7A 1UWAA 2I6WA 4F3MA 4EO6A 5A8RB 3KHRA 2OTJS 1H74A 2B5JA 4NZ7A 2NSBA 3QBCA 1E3CP 3NKOA 3OV7A 2UUCF 2J0QD 1WNEA 1VQ6S 4QYZK 4N7TA 2KM8C 4JI2J 3TUIC 3MMJA 4F67A 5DM6Q 1URBA 3SFGA 3V5RA 1ACMB 1SL1A 2F4VJ 1MROB 3R9LA 4LQYA 4I67A 1TKTB 4KY3A 1YJVA 3PYDA 4LRDA 3ZTQA 2ZVIA 3ZZYA 3KMQA 1A9NB 2LQJA 1Q79A 1ZETA 3GR1A 4NCBA 3MHYA 3R5GA 5JUMA 2C3YA 3TO8A 4CDIA 1PGZA 4UOPA 3QPIA 1R27B 2RQMA 2OSRA 2YKPA 3PNIA 2NR0A 4PPZA 4O23A 1RT6A 2C2OB 3DNCA 4WK3A 2K8GA 2W5TA 5BYSA 4DX8H 5KG2A 2Y1IA 2QYGA 4F26A 3PX0A 2QG9B 4ZVQB 3B82A 4DUYJ 1L5UA 3V4MA 3KHGA 3LWMA 4G3IA 2ZUAA 1QSLA 4OZNA 2J0WA 3OFGA 1S1WA 2DRAA 1N4LA 3MECB 4CXKA 1SKWA 1HYSB 2J6SA 4IR1A 2M3DA 1HW9A 1Y4ZB 4OFZA 2VICA 4WXWA 1T8EA 3PTWA 2XMAA 1N6QA 4LJMA 1TZ0A 2AGOA 1CJKB 2XMKA 4I68A 2FVSA 1RK8A 2BUNA 3GILA 5E41A 4KRWA 1U8WA 1CPZA 4ZN1A 3OL8A 4RW6A 2F9DA 2JH3A 4USWA 4USJC 4EMDA 1TL5A 3L9ZA 1YX2A 2CVIA 1RAIB 2KXHA 2LQ5A 3R3TA 1NK6A 4N76A 3HJFA 3M05A 5B0AA 1NNDA 3PYGA 4XPCA 3VAFA 2ZKUA 3GJSB 3DGVA 3AXKA 1VLOA 4LT6A 4Y2MA 4ZIWA 3RRHA 5C66A 1K9MT 1SH2A 3QJJA 2QL7B 3AJDA 4RBVA 4ZLNA 3C2PA 3HHLC 1QY7A 3AODA 4DPUA 2CZVC 2MKHA 3M32B 3BQ0A 1KHVA 1I94J 1T94A 2DGQA 3DU5A 3ADAC 1CS4A 3F56A 3CXCR 2D3O1 3PRVA 3CJQA 5H9EJ 1TL1A 2B7BB 4OYAA 3JSMA 3NAHA 1B99A 1XQIA 1EQJA 3KD8A 2QA1A 5J1EA 2VG7A 4YS2A 1EETB 2XCPA 3R1LA 4CP5A 4RW4A 4U8VA 1YQHA 1OJ4A 3IR5B 5FIIA 3RB0A 5LSLA 4LF1A 5LJ5Y 4CTAA 4J9MA 1M5SA 2F5GA 1WORA 3D0HE 4IG3A 2ZBPA 1E6YB 1PIEA 2J6UA 1WEYA 3DM2A 2VZ9A 3M2RB 3LTOA 2CQDA 5RUBA 5HP1B 3GFZA 3FJ2A 2IJRA 3QYYA 4OQJA 4M8LA 4DG1A 2VPWB 4WYWA 1N32J 2KYZA 3R5DA 5ETKA 4X65F 3R6LB 4M5LA 3J80U 2XS5A 2EEYA 2Y0SD 1XR6A 4C9DA 2HHWA 4HACA 2W9AA 1M5HA 2GVZB 2OP5A 1U0HA 5KFAA 3QJPA 2NXEA 3WAYA 2ROGA 4ZITA 3M4XA 5AJ3J 2EG2A 4JI3J 1TKZB 1S9EA 4B02A 2AQ4A 2J8SA 1VOMA 1C2PA 3A4TA 2RDDA 3B8HA 5JJBA 3D6HB 4J7CA 2BJ3A 2ZHBA 3C46A 2MKYA 3AFGA 4ZVEA 3Q24A 2SXLA 1WDTA 4R8UB 4DQRA 1HBUA 3CE8A 2Z2YB 3DN9A 1VQPS 2CQ1A 1S97A 2I38A 2DO0A 2J7UA 2BM1A 3QO9B 1GMVA 4RBTA 3A8IA 2ACMA 3O6QA 5E3AA 2ACYA 6FD1A 2OTLS 4M63A 2E9TA 1HLWA 1RHUB 3DLKA 3U7JA 2EC0A 4YQWA 4H54A 2RH6A 3CCQS 2JC1A 3BQ2A 3K7RA 3W61A 4PYAA 4DQQA 2PN6A 1HPZB 3BQ1A 4J9LA 3AHPA 1RT4A 3KTQA 2MZTA 3R7NB 3HFVA 1FCAA 2RIJA 2W2OP 3EPGA 3PRBA 3LP1B 4PYDA 5FDLA 2MGZA 3K2YA 3TZWA 5HQ8A 1ALJA 2R42A 3M2VB 3C19A 3IWXA 5E0OA 4LF7F 3UPFA 4K8RA 3OW2R 1CVJA 2X7IA 4J9NA 5C25A 3IS9B 3PG9A 5D0GA 1ZZFA 2E1AA 3UVJA 4Y3CA 2UUBJ 2M88A 5D4PA 2UVWA 1NB2A 2GJIA 1C0UA 1N5YB 1MU2A 5I4MA 1AFIA 2G2OA 1NSKL 1G4CA 1RDRA 1KHJA 2ASLA 2IJFA 4WZQA 4GO7X 2YNFA 3WAWA 2C42A 3RRKA 4MYTA 4DU7A 4LBHA 2XY5A 4GKJJ 2OHDA 3KG1A 4PCQA 5LIAA 3BSAA 3SZZA 4DL2A 4M5KA 3A8KA 1RWOB 5KFWA 3KK3B 2NPIA 2BBEA 4WK1A 4PRFA 3FCVA 4TYAA 2HQDA 1WOOA 3D3BJ 4USHA 3D54A 3ZZOA 2QMWA 4NLQA 1XIQA 4DQSA 2XEXA 3HVTB 3I5CA 4NLTA 4LFBJ 4ZA1A 3L4BC 4QJVA 3BKTA 5AXLA 1XMOF 4ILMA 1V3RA 3BSOA 1OS5A 2XSJA 1VRUB 2C2MB 5ETMA 3DGPA 3L7PA 4XDDA 3CD5A 3S01A 4OL8A 3N9UC 2R7TA 1GMWD 1JLCA 2V6AA 3H59A 3G8QA 3PY8A 3H2VE 2D69A 3DC2A 4RR5A 4JI4F 3K5OA 3IBCB 1U25A 1GMWA 3MOZA 4QR0A 1N33J 2LLZA 2BOAA 2QLWA 5D0EA 4DN9A 1SC6A 1FRMA 5IQQA 4UQGA 4J9OA 2CJKA 3OR1B 2XY6A 2DPJA 1FF2A 1AXQA 1Q16B 3I0RB 2DEJA 4QIEA 4GC7A 4KV8A 4DFMA 4JV1A 2BE9B 2VG6A 2XZTB 3VZIA 2KG0A 4KAVA 2JHEA 4P7TA 5KXAA 4XPEA 3UW1A 4ALZA 1U1RA 4W98A 1RTIB 1B64A 4DDFA 1EJJA 3QQCD 4H4OA 1FEHA 2M8HA 3HSJA 4FYVB 4OIXA 3VWSA 4H4MB 4ICLA 2AKWB 2GLQA 1R0AB 4CYUA 2KXNB 2MKSA 2Q6BA 5L1LA 1FKPB 4LREA 2UZAA 1FJEB 1VQNS 4B3RF 4AL6A 1FK9A 4B9LA 3DCAA 3RW6A 4JBCA 3C6UA 5G0RA 4KJIA 2YNGA 2VBWA 4DHVA 4QPXA 4OX8A 2RVJA 2APOA 4OX9F 3G82A 1I5OB 2WW4A 3GSIA 4J9VA 2FLNA 3IC1A 1RYRA 2RDIA 3DMJA 3IXQA 1DRZA 2OEKA 3MUTP 2VONA 3GIJA 2OMOA 3H98A 4DV3J 1U6BA 3PEHA 1GK8A 3O1LA 4XO0A 1UW4A 4NI2B 3C14B 2ZH3A 2BRLA 5F9NA 1FDDA 1OPZA 3CD7A 3JTPA 4OHWA 3VAKA 1RA6A 3MFIA 1A7GE 2Z56B 2QSFA 2D3OR 2LU1A 3W65A 4B3MF 3FFIA 3WBHA 1YBUA 3AOBA 1LWCB 1L3SA 3TEHB 3R5AA 3SCLE 3KLEA 1KVJA 1ZM3A 1R6YA 3QRRA 3NS5A 4KTQA 1LNQA 5I3UA 5EX0A 1HI8A 2B43A 1IVZA 5H9EK 3GIMA 4EUVA 1C0TA 4ES1A 5KFQA 3CC4S 1HWKA 1ZM4A 1HBMB 3LPEA 4JOUA 5F3TA 2XLJA 1QSSA 2DXEA 3R7SB 1DFDA 2OPRB 4QU7A 5JVGQ 3DRSA 3U1LA 2VV5A 4MYUA 2QSWA 5KT7A 2DRDA 4ZJQA 4X66F 1KHWA 2MJUA 1KQGB 4Q2MA 5KFDA 2V9KA 3W9JA 3G4SS 5M2UA 1REVB 2RQKA 5A2QU 1RADB 4G1QB 4DJBA 4RPFA 5ETRA 5F0WA 1OIAA 2MSSA 4JYAF 4GTYA 5A8RA 4ZPDA 5IT4A 1TVRA 1LWEB 5KG0A 4C0HA 3RAXA 5E33A 5D0HA 1Y5LB 3MEGB 4DV7J 1WC0A 4CO0A 2HAIA 2QZ8A 2VASA 1DBDA 1RCOB 1S59A 3EICA 3JQMA 4ENOA 3Q8QB 2N3LA 4CO5A 2ZD1A 4NPOA 1FXDA 3CCZA 2QYCA 5KFOA 4AL5A 5THWA 3HVAA 1K73T 2ZZMA 2IBOA 1Q5YA 3BBBA 1RT2A 2V8VA 3BDHA 5IWAF 2ZBIA 1U2RA 3IRXA 2XCAA 1VQ4S 1FJGF 1KLMA 4X4NA 3HJVA 4U8YA 4CO4A 2Q6CA 1NDPA 3W5ZA 4DUZJ 3GIIA 2UU9F 1HQAA 1J2VA 3H8YA 4MT1A 4I7FB 1X4CA 2H4WB 2OIHA 2WSFC 3UCZP 2HFNA 4UT4A 2KXFA 3Q22A 5B09A 1X0FA 1U6FA 1GAOA 1SC3B 3G9CA 3OT9A 4QW9A 2IAJB 4CO3A 4CNYA 3FSYA 4Y6IA 4WPAA 1QUVA 4ID5A 4TQRA 1HYSA 1PYOB 1X8DA 1T03B 1CJUB 1T9XA 2RRNA 1X4HA 2BX6A 4O4GB 4F4AA 2PDAA 3J7YU 3RUBL 1UJ4A 5AJ9A 1F0XA 3UE2A 3JXOA 3MM8A 2E5JA 1S6OA 4PG7A 4NCAA 4M5DB 4NZ6A 3BDFA 1L3KA 2A1BA 4ITSA 3MK0A 3S8SA 1FE4A 1R8BA 3I82A 4ANCA 3GQCA 3EZOA 5K8OA 3Q23A 2UVVA 3IGNA 2LQ8A 4OHZA 3VZHA 4QBUA 3WBZA 2PFDA 2ZWOA 3E01B 4I1TA 1X7VA 3PW4A 4Q8FA 5IJQA 4B3OB 5L0EA 4FXWA 5HO4A 3IAM9 1KH9A 4KO0A 5GMEA 4P6QA 1KHNA 2W5XA 3MI7X 4B3SF 4Q5VA 1UETA 3JSYA 2HNYB 2WVCA 3A13A 4K2JA 5KT6A 5A8WA 4MFBB 4QCLA 1NPPA 1LK7A 3BKFA 1N0VC 3FCHA 3CO0P 2PA8D 1VS3A 2IYIA 3KUGA 1DY3A 3UR0A 4KGZB 2FPHX 4KJGA 4OYZA 4DSJA 3M8SA 3HMJG 3GFXA 2YKQA 4YR2A 2OD6A 1DTTA 4LIRA 2HNDB 5CD4H 2ZUGA 2DH9A 3SV3A 2D7SA 2VG7B 3CJ2A 5D15A 1N36J 3TYTA 1W26A 2HFOA 2MHNA 3BB5A 3DLJA 4LSNB 1N36F 2R2SA 2DD8S 2JNJA 1VQYA 1WF2A 2DHXA 2QIFA 3QSYB 2YQ0A 3NNAA 2MLXA 2KFNA 3MMAA 1ALHA 2XG8A 2RT3A 3D6TB 4IG3B 1YZ6A 4LIWA 5KFXA 4DZDA 2KM8B 1JWWA 3MCNA 1S9FA 1FRHA 2XLKA 2NZCA 1UPMB 4DZ6A 5C42B 2PSZA 3PW7A 3BM7A 4DV0F 2VQRA 2ILYA 1N5QA 1H7WA 4FDIA 1RAJA 2BRKA 1V6HA 2QV6A 1WF1A 3K8WA 2KT2A 1H2UX 1R43A 2MMYA 4NMXA 1VI7A 4ER8A 1VK3A 3NP5A 2GVZA 4TVAB 1YJWS 4JI7F 3MZIA 1U0HB 2P8IA 5ADZA 1IKXB 3HF5A 4IG0B 3K59A 4RZRA 2HMIB 3AB4B 2J6TA 1N2LA 5DDRC 3I96A 2N4DA 4FXVA 2CQHA 4EK2A 4DV6F 1VQ5S 5LT5A 2HGLA 1WHXA 5CD4A 3MEKA 3D1QA 2WTFA 2MZRA 4MKYA 2CG8A 1BY9A 1IKVA 2RU9A 2DO4A 1O99A 2KFZA 4LRCA 2GMLA 4F25A 1HBUB 1RKIA 3EGWB 5AXMA 5LMNF 2C1EB 2FJXA 1FRLA 2VKRA 3FEZA 4FZVA 4UF4A 4YB5A 4USKA 3K8VA 4F0KA 4CCHA 2E9RX
chains in the Genus database with same CATH topology
5LQQA 4GTXA 3WAXA 1ALJA 4NWXA 4LRFA 2IUCB 3BDGA 4GTYA 3M7VA 1E2SP 3T00A 1AJCA 3MK1A 4UOPA 5EGHA 4UPIA 1E33P 1Y7AA 2W5TA 5HRTA 5L0EA 4LRAA 1N2KA 5LRNA 4CYRA 3UO0A 2XRGA 1KHJA 2GSUA 2IUCA 3BDGB 3BDHA 4ZGAA 1KH5A 3WAWA 1ELXA 2W8DA 3DYCA 2W5SA 3NVLA 3B5QA 4CXSA 4CXKA 2QZUA 4TN0A 1ZEDA 1KH4A 2W5VA 5LIAA 1HQAA 5INHA 3SZZA 4FDJA 3NKRA 1ED8A 3M8WA 4MHXA 4KAYA 4CXUA 1ZEFA 4MIVA 5K4PA 4UOOA 1KH7A 5EGEA 3Q3QA 4ZG7A 4UPKA 1HJKA 1EW2A 3OT9A 3TX0A 2GSNA 4B56A 1EW9A 3M8ZA 5DLWA 1SHNA 1ELZA 4YR1A 3UN5A 3MK2A 5AJ9A 1ANIA 3E2DA 5C66A 2GSOA 2W5RA 3UN2A 3A52A 3BDFA 4MY4A 4UPLA 3UNYA 3MK0A 1KHLA 1ALKA 4LRBA 3M8YA 5IJQA 5IJSA 2W5XA 1KH9A 1KHNA 4UPHA 3KD8A 1EQJA 2W5WA 2ZKTA 2W5QA 4KAVA 4QAXA 5KXAA 1O98A 4GTWA 4ZG6A 2GA3A 4LR8A 1EJJA 2GLQA 5LRMA 1SHQA 2IFYA 1B8JA 4KJGA 1Y6VA 4LREA 5GOVA 4ZG9A 3NKQA 1EI6A 1ELYA 1AUKA 2G9YA 2D1GA 3IDDA 4LR9A 1AJDA 1AJBA 1FSUA 3CMRA 2ANHA 1ALHA 3NKMA 2W8SA 4GTZA 1ALIA 3NKNA 4LR7A 1URAA 2XR9A 3WAYA 3UN3A 2VQRA 1ED9A 4FDIA 3WBHA 5TJ3A 1ZEBA 3TWZA 1KHKA 1ANJA 3T01A 3IGYB 3LXQA 4CYSA 1N2LA 1EW8A 4KM4A 5DLTA 3WAVA 3DPCA 3SZYA 5L0KA 5DLVA 3NKPA 1E3CP 2RH6A 3NKOA 4KJDA 4UORA 3TG0A 5L0BA 4N7TA 1E1ZP 1K7HA 1O99A 5GRRA 4LRCA 4LR2A 2X98A 1URBA 3IGZB 3T02A 3ED4A 4NWJA 4LQYA 4LRDA 1AJAA 1HDHA 1P49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LQQ A;  4GTX A;  3WAX A;  1ALJ A;  4NWX A;  4LRF A;  2IUC B;  3BDG A;  4GTY A;  3M7V A;  1E2S P;  3T00 A;  1AJC A;  3MK1 A;  4UOP A;  5EGH A;  4UPI A;  1E33 P;  1Y7A A;  2W5T A;  5HRT A;  5L0E A;  4LRA A;  1N2K A;  5LRN A;  4CYR A;  3UO0 A;  2XRG A;  1KHJ A;  2GSU A;  2IUC A;  3BDG B;  3BDH A;  4ZGA A;  1KH5 A;  3WAW A;  1ELX A;  2W8D A;  3DYC A;  2W5S A;  3NVL A;  3B5Q A;  4CXS A;  4CXK A;  2QZU A;  4TN0 A;  1ZED A;  1KH4 A;  2W5V A;  5LIA A;  1HQA A;  5INH A;  3SZZ A;  4FDJ A;  3NKR A;  1ED8 A;  3M8W A;  4MHX A;  4KAY A;  4CXU A;  1ZEF A;  4MIV A;  5K4P A;  4UOO A;  1KH7 A;  5EGE A;  3Q3Q A;  4ZG7 A;  4UPK A;  1HJK A;  1EW2 A;  3OT9 A;  3TX0 A;  2GSN A;  4B56 A;  1EW9 A;  3M8Z A;  5DLW A;  1SHN A;  1ELZ A;  4YR1 A;  3UN5 A;  3MK2 A;  5AJ9 A;  1ANI A;  3E2D A;  5C66 A;  2GSO A;  2W5R A;  3UN2 A;  3A52 A;  3BDF A;  4MY4 A;  4UPL A;  3UNY A;  3MK0 A;  1KHL A;  1ALK A;  4LRB A;  3M8Y A;  5IJQ A;  5IJS A;  2W5X A;  1KH9 A;  1KHN A;  4UPH A;  3KD8 A;  1EQJ A;  2W5W A;  2ZKT A;  2W5Q A;  4KAV A;  4QAX A;  5KXA A;  1O98 A;  4GTW A;  4ZG6 A;  2GA3 A;  4LR8 A;  1EJJ A;  2GLQ A;  5LRM A;  1SHQ A;  2IFY A;  1B8J A;  4KJG A;  1Y6V A;  4LRE A;  5GOV A;  4ZG9 A;  3NKQ A;  1EI6 A;  1ELY A;  1AUK A;  2G9Y A;  2D1G A;  3IDD A;  4LR9 A;  1AJD A;  1AJB A;  1FSU A;  3CMR A;  2ANH A;  1ALH A;  3NKM A;  2W8S A;  4GTZ A;  1ALI A;  3NKN A;  4LR7 A;  1URA A;  2XR9 A;  3WAY A;  3UN3 A;  2VQR A;  1ED9 A;  4FDI A;  3WBH A;  5TJ3 A;  1ZEB A;  3TWZ A;  1KHK A;  1ANJ A;  3T01 A;  3IGY B;  3LXQ A;  4CYS A;  1N2L A;  1EW8 A;  4KM4 A;  5DLT A;  3WAV A;  3DPC A;  3SZY A;  5L0K A;  5DLV A;  3NKP A;  1E3C P;  2RH6 A;  3NKO A;  4KJD A;  4UOR A;  3TG0 A;  5L0B A;  4N7T A;  1E1Z P;  1K7H A;  1O99 A;  5GRR A;  4LRC A;  4LR2 A;  2X98 A;  1URB A;  3IGZ B;  3T02 A;  3ED4 A;  4NWJ A;  4LQY A;  4LRD A;  1AJA A;  1HDH A;  1P49 A; 
#chains in the Genus database with same CATH topology
 3KNG A;  2HS4 A;  4GTX A;  1FJ7 A;  2VFS A;  4RWX A;  1CG2 A;  1HI1 A;  2MQP A;  5LQQ A;  1FD2 A;  2DXD A;  1S0O A;  2QMU B;  3S1T A;  2LQ9 A;  2M52 A;  1IJE B;  3OL9 A;  2XNQ A;  4ZVP B;  2V2V A;  5SUH A;  1OYD A;  3CDU A;  1RT4 B;  3PVX A;  3T1A A;  1QTN B;  3IM9 A;  1EKR A;  2G0J A;  3G86 A;  4GMK A;  3TA1 A;  4WP8 A;  2BMB A;  4HVZ A;  1OSD A;  3VTI A;  4EWT A;  1RAA B;  2LU2 A;  2M0G B;  2B7C B;  3UO0 A;  5IWA J;  1VMB A;  4V19 X;  1KQS R;  1P9Y A;  4FN5 A;  3TAM B;  3DRR B;  2ZC3 A;  3POT B;  4ZJO A;  2XMM A;  2KZM A;  1P9Q C;  3DDK A;  4E0D A;  3B5Q A;  4CXS A;  4LF5 J;  1NK0 A;  2XMV A;  2GGP B;  3KWM A;  1IKY A;  1TAU A;  1DJ0 A;  4H4K C;  4HR2 A;  3M30 B;  2OUG A;  4JI6 F;  3OSN A;  3VGV A;  5K9F A;  5IT9 Y;  5LJ3 Y;  2NPF A;  2RHQ B;  3CVK A;  1RTD B;  3N6L A;  2CA9 A;  3JYT A;  1Q82 T;  4ZDN A;  1WTB A;  4O3S A;  3NMR A;  5IM0 B;  1FRX A;  2ZIT A;  3H20 A;  3PEJ A;  4W4M A;  3NS6 A;  3M6V A;  1T9T A;  1Y10 A;  4EU0 A;  4NX9 A;  3QSI A;  3C8Y A;  1FO1 A;  1S0V A;  3BZQ A;  3T5K A;  3KUE A;  4WZM A;  1NK7 A;  3HZE A;  2NS1 B;  2B9E A;  4ETX A;  1X4E A;  2ZFH A;  1MNE A;  1N5S A;  1KDN A;  4MJK A;  5DDO C;  2DGV A;  1L3V A;  1BD6 A;  2FVC A;  2IFX A;  4ZHR B;  1G6B A;  4QWA A;  2XYG B;  3OUY B;  2GAH C;  1N5T A;  3CCW A;  2EFQ A;  1HHS A;  5CYM B;  2YH1 A;  3UN2 A;  2JLF A;  4B3S J;  3OLB A;  1G7C B;  3SEO A;  4OX7 A;  3HVT A;  2AYB A;  1BQX A;  3TUZ C;  1Q5V A;  3KLH B;  1KS2 A;  4NLX A;  3EVW A;  4X2B A;  3VAL A;  1IKW A;  1WC6 A;  5LL6 d;  4A8M P;  3BPD A;  1DTQ A;  2OPP A;  2N4C A;  3AT1 B;  2XM3 A;  2IDE A;  3QRP A;  3H0P A;  4W90 B;  4RJV A;  1KVK A;  1D8Z A;  2W7P A;  1X4B A;  4X64 J;  2C2E A;  2FHM A;  2ZH6 A;  3K0J A;  2CWX A;  4CQ1 A;  3DOK A;  2IFY A;  3VQT A;  3OR1 A;  3ZTS A;  3I4P A;  4WU2 A;  3TZY A;  3TX8 A;  2HG4 A;  2VQE J;  4NA2 A;  1PYT A;  1EI6 A;  4C8L A;  1YJ9 S;  1Y3K A;  4U6P A;  4WFZ A;  3I0S B;  2OD4 A;  4CZC A;  5GAG I;  3IDD A;  5DQG A;  1RAE B;  1RTI A;  2MZJ A;  2OEJ A;  5GAE U;  1AJB A;  2IIH A;  3MPY A;  2ANH A;  4EBD A;  1KVI A;  1VBK A;  4HDH A;  1M5P C;  1OQ3 A;  2GCF A;  2JJ4 D;  2ZZT A;  3NWG A;  4K4Y A;  2UUA F;  2L9N A;  3OFF A;  1S1T B;  5L46 A;  2MKK A;  1L3T A;  2VA3 A;  3UN3 A;  5BYR A;  2L3M A;  4U7C A;  1VC0 A;  3FGV A;  1TKX A;  2KB2 A;  3HD2 A;  3C3L A;  1HD0 A;  2RE1 A;  2PE8 A;  1WUU A;  1K44 A;  5DQI A;  1QTM A;  2RQ4 A;  1KEK A;  2ZOM A;  1YKW A;  2HRT A;  2W8L A;  2IRY A;  1QD1 A;  1RP5 A;  4RU2 A;  2HWI A;  2IRX A;  3KFW X;  1O8B A;  4CYS A;  1WC3 A;  4E8U A;  4NI2 A;  5KAK A;  2GQQ A;  2HPU A;  2WAQ D;  1VRT A;  2ZE2 A;  1S49 A;  4Q43 A;  3H4D A;  2Z8Q A;  4USV A;  1TK5 A;  5AXN A;  4WE1 A;  3RR8 A;  1AT1 B;  4R5P B;  8RUC A;  1AA1 B;  4QW8 A;  3KLE B;  2ASD A;  5CYJ A;  1BQN A;  1R31 A;  1LFP A;  2VF3 A;  4X66 J;  1SB6 A;  3ZZR A;  5ETS A;  1J5E J;  4ZPC A;  4DFJ A;  2VOP A;  4EFA C;  1AJA A;  4RNO A;  2YX7 A;  3QID A;  1WG1 A;  3VVT A;  3R1H A;  3WAX A;  2HKE A;  2XTJ P;  4UZC A;  4NWX A;  3GU0 A;  4F36 A;  3T9N A;  3QAU A;  1VQ9 S;  3DRS B;  4NYZ A;  3LP0 B;  1S4E A;  2PI5 A;  1PC5 A;  2H5E A;  1NSA A;  3QZ8 A;  2F9J A;  1REV A;  3UQS A;  1K1Q A;  1JNZ B;  5HI7 A;  3GJQ B;  4WWS A;  1Q1K A;  2CQ2 A;  3N01 A;  5DZ6 A;  5A76 A;  3HSG A;  3ELH A;  5K5M A;  2BJ7 A;  3NCP A;  5IFM A;  1N8R T;  1ROF A;  1LWE A;  1TVR B;  3PM9 A;  2BR0 A;  2CNL B;  4MIV A;  2QZU A;  2FC8 A;  3MEG A;  2VFT A;  5GVQ A;  4NYO A;  5KG6 A;  1SCJ B;  2OEM A;  4PPD A;  2MPU A;  2HFU A;  4L3K A;  3D6M B;  4A46 A;  4TQS A;  1RAC B;  5T14 A;  2HBY B;  4NLR A;  4KH1 B;  1MMD A;  5KFS A;  1SL0 A;  4FDJ A;  5D4N A;  1C1B A;  2IBK A;  3E51 A;  5K8P A;  3VAH A;  3BGF A;  2JEJ A;  2KTQ A;  2B56 A;  1RAO A;  3PO5 A;  5B0B A;  2BKO A;  3IRX B;  4ZG7 A;  1U0S A;  3TX0 A;  1EB0 A;  2FHJ A;  2XHC A;  3A8E A;  3H25 A;  4QYZ J;  1SVD A;  2O01 C;  2ZNZ A;  2DR5 A;  3IWL A;  3QLH A;  1H98 A;  2CUY A;  4WU3 A;  4YR1 A;  2ZHO A;  3EGN A;  3KOA A;  1AFJ A;  5D8H B;  1ANI A;  1OQ6 A;  2NRE A;  3RB3 A;  4YOE A;  2CAD A;  2A6M A;  1WI8 A;  4P2M A;  4WJB A;  4HLB A;  4DPW A;  3CDB A;  5HAT A;  1FD8 A;  1S1V A;  5AT1 B;  1UPP A;  4JI5 J;  2CJ9 A;  2E5H A;  2PI4 A;  4X4V A;  1KHL A;  2E5G A;  3MWB A;  2EK1 A;  2W4C A;  2IAJ A;  4KGX B;  4HKQ A;  5ETP A;  3BYR A;  5BR8 F;  4N8O A;  3NY0 A;  4ID5 B;  1IXK A;  3P5B P;  3DOM B;  4C8Z A;  2WVD A;  4ZVF A;  5KFC A;  2GQ2 A;  1XER A;  1CJU A;  4DU8 A;  2M9K A;  4NLG A;  4JI4 J;  4FPI A;  2XLI A;  1NJI T;  6FDR A;  3THP A;  1T95 A;  2LQB A;  5LRN A;  4LR8 A;  2V34 A;  4NA1 A;  3CNQ P;  2PA3 A;  3FNN A;  3EM1 A;  4RW9 B;  5J2N B;  3CCM S;  2HZV A;  2RB7 A;  4RL1 A;  3E01 A;  4U96 A;  4JI1 F;  1UL3 A;  1XMO J;  4B3O A;  5FLX U;  2JX2 A;  2ZWP A;  5GOV A;  5CAA A;  3M9M B;  3TAR A;  5ETL A;  1S99 A;  5LMU F;  2E1C A;  2HNY A;  5HBM B;  4CIO A;  5DJB A;  5CCL A;  3W9I A;  1NDC A;  1SI9 A;  4OZ5 A;  2QL5 B;  5JVH Q;  4MKB A;  5KT2 A;  3MM6 A;  2YX1 A;  1BQM B;  3AXM A;  1DQ8 A;  1FDN A;  1EP4 A;  2YH0 A;  2DGX A;  3I5B A;  4GKJ F;  2DNY A;  3EZU A;  1LKZ A;  3FBE A;  2W8S A;  2MY7 A;  3UDE A;  2DNZ A;  3CJ4 A;  1YIJ S;  1WI6 A;  2XI3 A;  3CCR S;  4JP8 A;  2BE2 A;  3GP9 A;  1Y11 A;  3KLV A;  4RW7 B;  1YK9 A;  1KFD A;  4G6V B;  1PAE X;  4DR3 F;  2XYP B;  2XWX A;  3CJ5 A;  5SZT A;  3CCL S;  1UEV A;  4ZP9 A;  5BXI A;  3IRW P;  2CPE A;  4WYL A;  1X0P A;  2Z30 B;  3DOL B;  3SCI E;  2MQQ A;  1T7P A;  3QAE A;  3Q8S B;  3WC2 A;  4LF7 J;  1RXO B;  1HWI A;  2BM0 A;  2QRR A;  3I32 A;  3PW2 A;  4I4B A;  1UVK A;  2Y1L B;  1RTJ B;  1YG0 A;  4FYY B;  4OI3 A;  5K20 B;  3CJ8 A;  2XS7 A;  4IFY A;  1WOP A;  2G0I A;  2GVD B;  4UOR A;  2RNE A;  1F6T A;  1S12 A;  3Q2S C;  4Y65 A;  5KFZ A;  4C11 B;  1NK5 A;  4LR2 A;  2VQF F;  1IKX A;  1OO0 B;  2MKC A;  1DAR A;  2NCK L;  1SH0 A;  2NXN A;  3LGH A;  4IG0 A;  3CJK A;  2HMI A;  4KKO B;  1G3O A;  3LA0 A;  4HTJ A;  3UI3 A;  1LXJ A;  1HQE A;  2ZBR A;  3MM9 A;  5KFI A;  4YB7 A;  3FC9 A;  4QZV B;  1T0T V;  4LRF A;  5HQL A;  2AW0 A;  2DNO A;  2YQ3 A;  1CQN A;  1PCA A;  2B5J B;  3T5L A;  1TQL A;  2DT9 A;  3MK1 A;  2FZC B;  1MMN A;  2JC0 A;  3SXL A;  2WB1 D;  2WON B;  3TJA A;  4DV5 J;  1CBK A;  3BSC A;  2Y8Y A;  2YNI B;  3A12 A;  1BUX A;  1Z2L A;  3IBF B;  4FYD A;  4PKD B;  1W7W A;  3L3C A;  3UD3 P;  3W64 A;  2DNG A;  3BBF A;  2RRA A;  3WZ0 A;  3CJS A;  4BWJ A;  1NKE A;  4LFA F;  4EGL A;  4ECX A;  2QLJ B;  3ULH A;  4I0W A;  4FF3 A;  1LXN A;  2M2B A;  3TVY A;  1FE0 A;  3M6U A;  3VR1 A;  1RBA A;  3MPU B;  1PG5 B;  4IDK A;  5KFB A;  1WEX A;  4IUF A;  1PAU B;  3R7B B;  4O3O A;  1KR4 A;  4RWW A;  4DR4 J;  8ATC B;  3HM9 A;  2CPD A;  3KK1 A;  1ZM2 A;  4X65 J;  5HQM A;  2ZJP Q;  2C2N A;  2G2Y A;  5HJX A;  1Y0H A;  3BN4 A;  3CIZ A;  2CPF A;  2B0G A;  3D1O A;  3DRR A;  3POT A;  4C0O C;  3NOC A;  1KQK A;  2J5A A;  4ZPW R;  2VBY A;  4OLP A;  5GAG U;  1P6T A;  5C7P A;  3IM8 A;  4ZJL A;  2HZA A;  3NGR A;  1ZH5 A;  2GSN A;  4UPK A;  2EFP A;  1P27 B;  3M8Z A;  4JI2 F;  4J9S A;  3M30 A;  2AGP A;  1IR2 A;  5EWG A;  2JLE A;  3OHA A;  2WB4 A;  1CJK A;  2QA4 S;  4QPT A;  1UVM A;  1N48 A;  5IM0 A;  3KYL A;  3A52 A;  1I3O B;  3HSZ A;  4HL9 A;  3MR6 A;  2EKY A;  4DR2 J;  4RBU A;  3M8Y A;  3O3L A;  3CDW A;  4ZLJ A;  4JV2 A;  4Q8E A;  3ILJ A;  1SQG A;  2RIL A;  3LUY A;  9ATC B;  2EI5 A;  5KFP A;  3AQO A;  3V6H A;  1VDH A;  1C1C B;  2VPY B;  3BGR B;  4OJH A;  2W5W A;  2ADB A;  4Y34 A;  2RQC A;  2HHH J;  4E2F B;  5IT9 U;  5CCM A;  1KP6 A;  1LQ9 A;  2LDY A;  2VL1 A;  4FDF A;  5F9L A;  3OJU A;  3P6Y C;  1CC7 A;  2H5I B;  3QT5 A;  4ED7 A;  1JX4 A;  4RUH A;  1R8H A;  3EXC X;  2EFO A;  5LRM A;  2QFJ A;  1X5S A;  2HIY A;  1EKS A;  4CH0 S;  3EVO A;  3JSM B;  5A0Y A;  3MR3 A;  1SH3 A;  2KJW A;  2AIR B;  2CXE A;  2FY8 A;  2XQC A;  1NJX A;  2YWE A;  4KFB A;  1YRX A;  4IH7 A;  4OI1 A;  2ZJR Q;  4K0K J;  2D1G A;  1D9D A;  4PEO A;  2I0X A;  3GJT B;  3LAM A;  2YY3 A;  4FVM A;  4RW4 B;  2VJV A;  2Y0B B;  3FK4 A;  1BWV A;  5T41 A;  4CTA B;  3OL7 A;  2YWW A;  2WCX A;  1T3N A;  4JI6 J;  3C15 A;  4FKX A;  4ECV A;  1QM9 A;  3LAN A;  5J2Q B;  1AUD A;  4DV0 J;  1AJC A;  4WII A;  2V8P A;  5D3G B;  3J7A 1;  4RW8 B;  3T1Y F;  3K5M A;  5A2Q Y;  1FDB A;  2EKN A;  4DS5 A;  2HUR A;  3MMC A;  4O3P A;  4CT9 A;  4DG1 B;  4IRC A;  3MPD A;  2N3O A;  3BH6 B;  4X4O A;  2GV1 A;  4RUA A;  3PJX A;  3M8R A;  3R8Y A;  5J2P A;  2CQG A;  1NHK L;  1RU1 A;  2RF2 A;  3FZB A;  2FJD B;  4P2F A;  2KYX A;  3FMB A;  1R7I A;  2RS2 A;  2BQU A;  4ELU A;  3VQS A;  1XR5 A;  2V2Q A;  4YHH F;  4L3N A;  5D4L A;  2D3Z A;  1IBM J;  4JI8 J;  2NZ4 A;  3W2W B;  2M8D B;  1S1T A;  2N7Y A;  1WWH A;  1RT1 A;  3ISN D;  4YFU A;  1TKZ A;  1JJ2 R;  5CXT A;  3DPC A;  1FDA A;  1TKX B;  1XR7 A;  3CJR A;  3FCW A;  3JTN A;  4C3L A;  4YME A;  4DX6 A;  3OJS A;  5HRT A;  1MG7 A;  3B54 A;  2COL A;  3CSK A;  3NBP A;  3RTV A;  4RLE A;  2MEW A;  5L0B A;  3MTJ A;  4ANE A;  4M5J A;  3I9Z A;  5KFN A;  2MZS A;  2BJ8 A;  2ZOF A;  3RRG A;  4ZMM A;  4A8X A;  4ZPA A;  2KVI A;  2HK3 A;  4JI0 F;  3N5F A;  3QO9 A;  2C28 A;  1S1U A;  1FWL A;  2C3M A;  4DLE A;  1PYS B;  5DG9 A;  2KO1 A;  3RB6 A;  2XWY A;  4C3M A;  1U1L A;  3H5S A;  1P49 A;  3DLK B;  1NPK A;  5KFU A;  1VBZ A;  3KLF A;  3ENQ A;  4R5P A;  1E2S P;  1FXR A;  4LVO P;  2C22 A;  4HH0 A;  3KDN A;  5U47 A;  5CAB A;  1BQN B;  1LW0 B;  1UKU A;  2UUW A;  3QMQ A;  4CT8 A;  3EGZ A;  4Q0B A;  2OI2 A;  2I5J B;  3LF0 A;  4NLS A;  1TK0 A;  1IR1 A;  1I1G A;  1IQZ A;  1LFW A;  3HHL A;  4X4U A;  2VPX B;  4JI0 J;  2G4B A;  2JDJ A;  3HUL A;  3QFH A;  1RWM B;  4JB8 B;  1NHV A;  1TV6 B;  1TAQ A;  1S5Z A;  1YJ7 A;  1H0H B;  5CYQ A;  1UMJ A;  2HLU A;  1KTV A;  4BLG A;  5GMD A;  3Q2T C;  2W8D A;  4OX6 A;  2Z2L A;  3LP0 A;  1VHI A;  3NVL A;  3IS9 A;  3UVJ B;  2RJZ A;  1MN9 A;  4F7V A;  4WCE Q;  3I56 S;  4P7V A;  3DU6 A;  2DYA A;  4HT7 A;  5B0C A;  1N5Y A;  1DQA A;  1HBN A;  5IC4 B;  5INH A;  2WZ1 A;  5HMZ A;  2BQ3 A;  2D41 A;  2ROP A;  2UU9 J;  3M8W A;  1IBM F;  1NME B;  1BLU A;  1NPR A;  4RUC A;  4JI8 F;  3B4D A;  4YHH J;  4CXU A;  1R8P A;  4NLP A;  3HLU A;  3SCJ E;  2DR6 A;  3I9V 9;  4CM2 A;  4KGK A;  4D3G A;  3OL6 A;  2R7U A;  5DGA A;  4TKT A;  3EMT A;  1EW9 A;  2MLY A;  3WC0 A;  3GFH A;  2QE5 A;  1D0E A;  4ZN3 A;  5AE1 A;  2F1F A;  1KOO A;  2GSO A;  4MIW A;  1ITP A;  3Q8V A;  2X51 A;  4M5M A;  1T11 A;  1O6X A;  1Q8L A;  2E7X A;  2H51 B;  2HHP A;  4WXO A;  3FUY A;  5B0G A;  4ECS A;  4MY4 A;  1S79 A;  2W2N P;  2E1M C;  4KHM A;  3PW5 A;  4OHX A;  1F3V A;  1JKH B;  3N5B A;  2AYM A;  4WKY A;  5HMX A;  3V6D B;  1HWU A;  3HK2 A;  4WFX A;  2JFK A;  1U1P A;  1TFY A;  3ZZU A;  4LF4 J;  2B4O A;  2IM0 A;  3RZA A;  2ZKT A;  1UFW A;  4ZPT R;  2ATC B;  2ZHA A;  2Q43 A;  1A6L A;  1BE4 A;  3V6K A;  3A3P B;  3W3S A;  1R6V A;  2W9B A;  3KJQ B;  1BXN A;  4OYW A;  3MMB A;  3OFH A;  1X5O A;  2DGO A;  1IBL J;  1UCN A;  3PIP Q;  3J7Y I;  4LMZ A;  2HHH F;  2U1A A;  4HHU A;  4DX5 A;  1S0N A;  2L08 A;  3TA2 A;  3DOM A;  3RBX A;  4F3O A;  5KG1 A;  1XNQ F;  1H6K X;  3RBZ A;  4KV8 B;  4P73 A;  3CME S;  1ELY A;  2W2P P;  4PZV A;  3D66 A;  4LR9 A;  3ISN C;  2P9E A;  5DS7 A;  3OVA A;  2PFF B;  3K5P A;  3ONQ A;  4ZVU B;  5J2N A;  3H5Y A;  4CI0 B;  3QT8 A;  3TVK A;  4DUZ F;  4W92 B;  2ZH1 A;  3HHL D;  2CAJ A;  3TOQ A;  4CYU B;  1U48 A;  4FNH A;  4KB7 A;  1J5O B;  3MUM P;  2IC3 A;  3V4I B;  3Q8R B;  1LW2 A;  4Q45 A;  1JJ4 A;  1WHW A;  4PXC A;  1Z1Z A;  4ZPV R;  1RBO B;  4USU A;  4DV3 F;  2R2R A;  3HFZ B;  2Y1J A;  5A8K A;  3G82 B;  5LM7 E;  1YRT A;  1UWB B;  3UWT A;  3SZ2 A;  3CCS S;  4X84 A;  2XI2 A;  5DG7 A;  3PYE A;  3CED A;  3D0G E;  5L8R C;  5KG3 A;  1EP4 B;  1JLQ A;  1U1Q A;  1VJW A;  2QJ3 A;  4AND A;  3HDS A;  2AJ2 A;  4DL7 A;  3R2D J;  5FLX Y;  5EGY A;  4ECU A;  1RTH B;  4QYR A;  3NGD A;  5LXR A;  1B3T A;  1TL7 A;  2J9C A;  4HDG A;  1GMU A;  3UCU P;  2XC9 A;  3HKW A;  3TNV A;  4A8S A;  2W4P A;  3JSB A;  5C2G A;  1NJW A;  3TG0 A;  4O3N A;  5KT4 A;  5H1S V;  2ROE A;  1G2E A;  2O1P A;  3T6J A;  3F73 A;  1Z2Z A;  5I3U B;  2A2C A;  1SQE A;  1MN7 A;  1U49 A;  4ED1 A;  1P1T A;  3W5X A;  2BJE A;  2W2Q P;  2ZM6 J;  2C2Z B;  3LO3 A;  3P4U B;  4M5N A;  1HBM A;  4H4K A;  4R25 A;  3UDV A;  2J7K A;  4LQ3 A;  1PBU A;  2BV3 A;  1O51 A;  4WKR A;  2O5D A;  3P8B B;  2OPR A;  3TUJ C;  4DMZ A;  4IFY B;  2ZH7 A;  1EIY B;  4JI5 F;  2U2F A;  3NEK A;  1GXL A;  2LYV A;  2N82 B;  1N34 J;  2AZ3 A;  1CJT A;  1JB0 C;  4F3Q A;  1UZH A;  4KQZ A;  1NKB A;  3CD6 S;  2ADC A;  4I64 A;  1ZOT A;  1N5V A;  4G1Q A;  1P1L A;  3MM9 B;  3PRD A;  2WBM A;  3R6G B;  2HHQ A;  4B3M J;  2ASY A;  1NKC A;  2POK A;  4PXE A;  1YRU A;  2XY7 A;  1K47 A;  1KH5 A;  2GIQ A;  1XMQ J;  3DYA A;  3MCM A;  2YNH B;  4KPY A;  1SV5 A;  2JSX A;  2I9S A;  3PIO Q;  1PJ5 A;  3I4H X;  4L72 B;  3TVZ A;  4I69 A;  4TN0 A;  4BWM A;  2YNI A;  1OY9 A;  2F8H A;  2J9D A;  3HVW A;  3OR2 A;  2IDL A;  2C2D A;  4FF4 A;  1W2I A;  2GW8 A;  2ZD1 B;  4RU9 A;  2EBG A;  3HT0 A;  5KT3 A;  1RT2 B;  1S6P B;  4RO0 A;  4IDK B;  1E6V B;  3BKU A;  4OYB A;  5EGE A;  4DF4 A;  1KLM B;  2DNR A;  2E5L F;  4B56 A;  1PJ6 A;  2AJ0 A;  1V5I B;  3SSS A;  1ARO P;  1MWY A;  3EGV A;  3KK1 B;  1WG4 A;  1U4B A;  4MK8 A;  2I1R A;  2P2C B;  2DJW A;  2ZEJ A;  3FQL A;  3GZ7 A;  4QU6 A;  4ZIV A;  2UUB F;  1WD6 A;  4UPL A;  4LF5 F;  4HYK A;  3EVM A;  1RTZ A;  2DB1 A;  3BRE A;  5A6P A;  5EDW A;  3B4M A;  1JK9 B;  3MD3 A;  2IA6 A;  2CNO B;  2CPI A;  2V2Z A;  2V8G A;  4I6Y A;  3SMZ A;  2MKI A;  4NCG B;  4IOC Q;  1T03 A;  4KGM A;  2LXF A;  4LFC J;  2J76 E;  2DTJ A;  2NYI A;  4O4G A;  3MR5 A;  1F5C A;  3V6J A;  3QWU A;  1MWZ A;  5HK4 A;  2HYI B;  1HL6 A;  4B17 A;  2EWH A;  1U6Z A;  4ETZ A;  4PXD A;  4GTW A;  4M5D A;  2OGU A;  1X60 A;  2PT0 A;  2VB6 A;  3H90 A;  4ZVH A;  1HA1 A;  1NU4 A;  2W7A A;  3D6F B;  1SHQ A;  3OTO J;  3DRP A;  2E44 A;  1X9S A;  3HHN B;  4IRD A;  1DQ9 A;  2VDH A;  4LVN P;  2ZDO A;  4J37 A;  4C97 A;  1C1C A;  3BGR A;  2IA0 A;  3FVY A;  2V0N A;  4LFC F;  2GJF A;  2G9Y A;  4DR5 J;  3DHW C;  4AFF A;  4K59 A;  5A8W B;  4N5S A;  1UVN A;  1AJD A;  3MPW A;  2D74 B;  3FDS A;  4OYX A;  1VBY A;  4I6W A;  1UVL A;  4ECQ A;  2VFR A;  4MIA A;  3EZ5 A;  4UY8 5;  1FSU A;  2MQM A;  3R5J B;  1QVG R;  4OYI A;  2HIQ A;  3H4B A;  2LEB A;  1W2B R;  2OAU A;  5A0Y B;  3MM7 B;  1DTT B;  5IV4 A;  1HMV B;  2AV5 A;  1BC6 A;  4TY9 A;  4GO5 X;  1VQ7 S;  1QDU B;  3BSN A;  2F8M A;  1ED9 A;  1OPI A;  3TZZ A;  4LSN A;  1FVS A;  2YXL A;  3ZXW A;  2P6S A;  3OTC A;  4CRJ A;  2HW3 A;  1U2F A;  3O44 A;  1P8G A;  3CDE A;  2QEX S;  2QC3 A;  3MMA B;  2IY5 B;  5E3Q A;  3C15 B;  5F8G A;  3O8W A;  1QAY A;  3SCK E;  2LEC A;  2CZ4 A;  2FJV A;  5D3G A;  1JXV A;  1KON A;  2B6A B;  5GAE I;  2VOO A;  5DLT A;  1SC1 B;  1Y5N B;  5ETT A;  3ZTO A;  5C42 A;  4G1I A;  2RDJ A;  1V3S A;  3MMC B;  4AQY J;  3MDF A;  2MQN A;  2P9G A;  3PXG a;  5J2P B;  2OO4 A;  2RF2 B;  2AWZ A;  3MR7 A;  4QOT A;  4PG6 A;  5F3Z A;  5HMW A;  5EHH A;  2IHR 1;  1JLG B;  3CMA S;  2KI2 A;  4HHH A;  2A6O A;  2D1C A;  3TJ8 A;  4N41 A;  3W2W A;  5DZ7 A;  4DL3 A;  3VV2 B;  1RT1 B;  3EDR B;  5KTQ A;  2F65 A;  3NGS A;  1FEE A;  3GV5 B;  3GYG A;  2MDA A;  4GC6 A;  4DL5 A;  4MK7 A;  2DCL A;  1GX6 A;  3PX4 A;  4Z7Y A;  1HR0 F;  1WHY A;  2BKN A;  3A1Y G;  4C6A A;  4OI4 A;  3Q0A A;  1KQF B;  4AUK A;  3ZTP A;  4UY8 T;  2BJD A;  2GO9 A;  4ZP6 A;  3DXS X;  3ZNJ 1;  1TUV A;  2VDI A;  4NLV A;  1GTH A;  2CRL A;  4A8F A;  1TTH B;  2ZM6 F;  2FZK B;  1JLE A;  1ZA2 B;  4FBT A;  1IR0 A;  3ZZZ A;  4UOH A;  1EQ0 A;  1J5E F;  1X5T A;  2WVB A;  2JL9 A;  1LOU A;  2IYG A;  3BR9 A;  1VR6 A;  4FKY A;  3UDL A;  4F4Y A;  2R8J A;  2CJA A;  5L1I A;  2XBP A;  2W01 A;  1ELX A;  2K7K A;  3DYC A;  4ZCI A;  1B0P A;  5CQG A;  2UP1 A;  1H72 C;  7FDR A;  1U8S A;  2HFS A;  1RYS A;  2DIT A;  2EXU A;  4Q0B B;  2YKO A;  2YWK A;  4TXS A;  3IFE A;  4PAA A;  1FX2 A;  3HHL B;  2DNL A;  2LXU A;  3IWN C;  4DPY A;  4F02 A;  2AJF E;  5E3P A;  2BOP A;  1Q78 A;  3G8S A;  4ERD A;  1ED8 A;  4MHX A;  5CYQ B;  1CC8 A;  1S1X B;  4OZ3 A;  5CHC B;  1ZEF A;  1Y7P A;  2FQQ B;  3AOC A;  2DHA A;  1Z4U A;  2DK2 A;  4HTI A;  2GMH A;  3SQO P;  2FY1 A;  4Y0F A;  3Q3Q A;  3CTR A;  2GGP A;  1TEL A;  3OTE A;  4ZK7 M;  1HQU A;  1IKY B;  3M2U A;  1YBA A;  2DEI A;  5M2P A;  1TP7 A;  2X1A A;  3DRY A;  1MWQ A;  3CIM A;  1HBN B;  1AZS A;  5F41 A;  2NXC A;  4WP9 A;  3P49 B;  1EQM A;  2VQF J;  3JYT B;  2ZH4 A;  2X1B A;  2K1R A;  1PIL A;  4NRU A;  1CJV A;  2KT5 A;  2QMX A;  4CLY A;  3S7R A;  3PKY A;  4NOH A;  2F3J A;  3K89 A;  3N6N A;  1UP1 A;  3N6M A;  4KHR A;  3EYZ A;  4DR7 F;  4DCP B;  2H48 B;  2E1P A;  1JNR B;  1O0P A;  3MED A;  1KOH A;  1SBR A;  2ABY A;  3W2V B;  4B08 A;  4ZVO B;  5HMY A;  4P2X A;  4WFA Q;  2HLT A;  1YI2 S;  4BCA A;  3A3O B;  5CYM A;  2EFG A;  3HHD A;  2NUH A;  1KBR A;  2BJ1 A;  1IBL F;  3NGU A;  4YR3 A;  4QWC A;  2DBB A;  3BJY A;  1SJF A;  1FXL A;  1HD1 A;  1IKW B;  1RWP B;  1EZZ B;  1KC8 T;  2YTC A;  4DV6 J;  3DI6 B;  5B7W A;  1V3Z A;  5KT5 A;  1DTQ B;  1FWP A;  2FB0 A;  4KHP J;  2R7W A;  4L75 A;  2PMW A;  2P9C A;  2XZD B;  4IQM A;  1U1M A;  4WFN Q;  2A18 A;  3MMB B;  5J2M A;  1WDD A;  3CMR A;  4IQX A;  1S76 D;  3GON A;  2BYC A;  4TLR A;  2HVH A;  2HQI A;  2X3G A;  4AT1 B;  5HN0 A;  4XTT A;  3NKN A;  3FMW A;  3NLC A;  4LR7 A;  4WBF A;  2MKJ A;  3RG6 A;  4PQA A;  3FSX A;  3CD0 A;  4F0M A;  5DET A;  2DY9 A;  3SQG A;  3TAQ A;  2FHK A;  1AUS L;  3PV8 A;  4DUY F;  1JLF A;  2FDN A;  4NRT A;  1U7L A;  1M1G A;  1XMB A;  4ZLP A;  3JAM U;  2M7S A;  2OH2 A;  1VJQ A;  1ZAV A;  2JOQ A;  3QGH A;  1KN6 A;  3CUN A;  2DIU A;  2NLW A;  4CH7 A;  4KR0 B;  3AD9 C;  3SDE A;  3QNW B;  3CJT A;  1RAB B;  2CJY B;  3GTY X;  4DV1 J;  3V4I A;  4HT5 A;  1LW2 B;  4ZP8 A;  3LAL A;  1RZM A;  1WEL A;  5F0U A;  4KM4 A;  4ZOS A;  1B4S A;  1FTC A;  9RUB A;  4KAI A;  1GT8 A;  4X4P A;  3IR7 B;  3NKP A;  1FES A;  1UWB A;  2YKN B;  3LGM A;  4TYB A;  3GCX P;  4IKA A;  4N8N A;  1IWG A;  3U1M A;  5C2C A;  2F4V F;  3L09 A;  1FWK A;  1RU2 A;  1WJ9 A;  4DS4 A;  3CC2 S;  4X62 J;  2FHJ D;  1IBK J;  4F4K A;  1RTH A;  2M4M A;  4C8K A;  3HX9 A;  1HDH A;  2GX8 A;  2YVS A;  4NLO A;  2ZE2 B;  5I42 B;  1VRT B;  4ZVR B;  1YHQ S;  2B9X A;  2EBE A;  4WE1 B;  5IXU A;  5KFH A;  2O66 A;  4ED3 A;  2W2M P;  2YKM A;  2CWK A;  4PWD B;  1XBW A;  3D0I E;  4I6A A;  2HFV A;  5EGH A;  2Z58 B;  1ALK A;  4UPI A;  2OPS A;  1U1O A;  2NXJ A;  1R8A A;  1UVJ A;  2HHV A;  1XEZ A;  1E33 P;  1GTE A;  2VJU A;  1Y7A A;  2NUU G;  5HL7 Q;  5HRO B;  2FUG 9;  1VQK S;  3QZ7 A;  1PO6 A;  3LOU A;  3IGV A;  4ED4 A;  3R2C J;  2KRR A;  3F41 A;  2LA4 A;  1QLN A;  1GNK A;  4ECW A;  4EI2 A;  4ECT A;  4R0J A;  2G2Z A;  3GIK A;  4A47 A;  1K1S A;  1CJT B;  2ASJ A;  2X1F A;  4A8Q A;  2JFD A;  3H5X A;  4PG5 A;  3EPI A;  4DV2 F;  2V8D A;  1UEU A;  2XHW A;  2C2K B;  2XYH B;  3RYL A;  3VVU A;  1VCT A;  2EPI A;  1H3D A;  4MAK A;  2ALZ A;  3NMA A;  2XO7 A;  2KN4 A;  2ZOG A;  1IBK F;  3DYA B;  2DNH A;  2EFV A;  5L1J A;  3W8G A;  1SV5 B;  2AT1 B;  3CW2 C;  1FER A;  3KG0 A;  5IC6 B;  4YEA A;  3M8Q A;  4ED0 A;  3J7Z T;  1LWF B;  4FS2 A;  3OD2 A;  2FGO A;  3OR2 B;  3UN5 A;  4CWB A;  3QT7 A;  3WQP A;  2R8G A;  3KK2 A;  3B6B A;  3BO4 A;  1C1B B;  1UA0 A;  2KG1 A;  1QE1 A;  3PHE A;  3AH6 A;  3PR5 B;  2PGC A;  1QVF R;  4KPC A;  4YP3 A;  5B0D A;  1CSJ A;  2CZ9 A;  1FNO A;  3OPK A;  2DGU A;  3KXD A;  2W1B A;  3LGN A;  2XZW A;  1RHJ B;  3THT A;  5IJS A;  2VC1 A;  2GFF A;  5KFL A;  3RJM B;  5KFE A;  1S9G B;  3L7O A;  1OYE A;  1HNW J;  1URN A;  1S1V B;  2IM3 A;  3V81 B;  2W9C A;  1ZPV A;  3VGU A;  2MQL A;  1ELO A;  3KHH A;  5KFF A;  3N79 A;  2L41 A;  4C4W A;  5H9F J;  2QL9 B;  4ZS6 A;  3ITH A;  1RWW B;  4LF9 F;  3I5A A;  1S10 A;  4O0N A;  3RR7 A;  1NZA A;  1NSP A;  2BEF A;  1D3W A;  2R3V A;  2Y1R I;  4P75 A;  4PWU A;  4ZCK A;  3I87 A;  4RW9 A;  3MCO A;  1JXL A;  2HWH A;  1YJU A;  1AW0 A;  4PQU A;  2EK6 A;  2Z4P A;  2KHD A;  1F3F A;  2R7Q A;  4E98 A;  1IM4 A;  3GLJ A;  3CJ0 A;  3AOA A;  3NNC A;  2H54 B;  5K14 B;  3DLH A;  2QLF B;  5EN1 A;  4MMO A;  5F8J A;  2R8K A;  1NHU A;  4I56 A;  3RU0 A;  3X1L B;  1I6J A;  4OI0 A;  4DSF A;  1VQM S;  3QIP B;  1IN0 A;  2CPX A;  3BR8 A;  3R97 A;  3RBD A;  1BQM A;  4OX9 J;  3T01 A;  1X5P A;  5HP1 A;  3QFW A;  3BPS P;  4TY8 A;  2V9W A;  3TQ1 A;  4B9M A;  1IM6 A;  4Y28 C;  3N0V A;  4DLG A;  4O3R A;  1MSW D;  2AU0 A;  4F4X A;  2BE2 B;  4USM A;  4B3R J;  3TQE A;  3IG1 B;  3D7S B;  2WW8 A;  3G87 A;  4K5R A;  2CNK B;  4RW7 A;  5F8M A;  3KJN B;  3EE3 A;  1H38 A;  3Q83 A;  4DPT A;  3SYZ A;  4A8W A;  3W60 A;  1ULR A;  4DR6 F;  1JMT A;  3NKY A;  2R9L A;  1E1Z P;  4GVL A;  2X98 A;  3DOL A;  5F8L A;  1JXE A;  3SFU A;  2B6A A;  1XTZ A;  1Y9O A;  1WKL A;  3P3D A;  4QIW D;  7FD1 A;  2GJ2 A;  2GS8 A;  4P2S A;  4URQ U;  1GXT A;  5KFR A;  4Y00 A;  3J81 U;  3NOG A;  3IO1 A;  5HLF A;  2NQP A;  2YWG A;  3LAK A;  2GNK A;  4MKV A;  5I3P A;  3G6X A;  4J9P A;  4B9T A;  1NRK A;  2GVD A;  4GVB A;  4DCO B;  1NSQ A;  4ZKA A;  2ZC4 A;  2J8A A;  2WOM A;  1JLG A;  3MCS A;  2AF6 A;  3BYP A;  3NGK A;  5D77 A;  4C11 A;  3M9N B;  2PMH A;  2WVE A;  4OMF G;  3KMS A;  4PWW A;  3H5U A;  3CJK B;  1KSP A;  1RHR B;  4RX6 A;  4URG A;  1N2K A;  1HQE B;  2HHT A;  1TL3 B;  4O44 A;  2B4U A;  5DDQ C;  5KFG A;  2B8Q A;  2GSU A;  2KFY A;  2IJN A;  4DL6 A;  4K4Z A;  3AJ1 A;  1RI7 A;  1VBX A;  3FEY B;  5C24 A;  4K4V A;  2W5S A;  2LEA A;  4DPX A;  3CUL A;  1C4C A;  2WON A;  2FVP A;  2WSE C;  1R3N A;  3HT3 A;  4QAX A;  1VHF A;  3MM5 B;  2VC0 A;  4DEZ A;  4UST A;  3QWP A;  3W9H A;  3JSR A;  3CJ3 A;  2IVY A;  5E3R A;  3G8T A;  4C8M A;  2M5Y A;  4JV5 F;  5K4P A;  1FKO A;  3JS9 A;  1XNR J;  4UOO A;  3DFE A;  3M8P A;  4DR3 J;  2KL8 A;  3RGI A;  3MAA A;  2OPQ A;  3M1V A;  2V50 A;  4IFV B;  4LSZ B;  4OJ1 A;  3C6T A;  4V1A k;  2ZBC A;  2DVI A;  4NXN F;  4AXJ A;  1S6Q A;  1O5J A;  1QUP A;  2RSQ A;  4M95 A;  5GAD U;  3SV4 A;  3E2D A;  3FRY A;  2HS0 A;  2CQ3 A;  2LCW A;  2CPZ A;  2ZH9 A;  4ECZ A;  1LEO A;  2RAQ A;  2HBZ B;  3UD5 A;  3T3F A;  1LV5 A;  5MLC V;  2WRM A;  2MYF A;  4L6V 3;  1ZZN A;  2UV8 G;  1WG5 A;  4OYO A;  3DDN A;  3GV8 B;  2WK4 A;  1NJZ A;  5LMU J;  2R7V A;  2VH7 A;  1FRI A;  3FBF A;  3P45 B;  1ZM9 A;  2CJB A;  4UPH A;  1U47 A;  2BW7 A;  2V94 A;  2ZDP A;  4RNF A;  3G71 S;  3GV7 B;  1WSV A;  2K1R B;  2LKZ A;  3O5T B;  3CPW R;  2XS2 A;  4K50 A;  1CJV B;  1SIZ A;  2DH7 A;  4BHQ A;  2R2U A;  2FVQ A;  2K3K A;  3W7B A;  2E7V A;  2GA3 A;  3UDC A;  4F50 A;  4NXM F;  1RLD A;  1CQM A;  1FFW B;  2OJ3 A;  3MED B;  4J90 A;  4QWB A;  3LP2 B;  2K3I A;  2J9E A;  3MAH A;  1F9F A;  3W2V A;  2HHU A;  4B9N A;  1NLK L;  2J0X A;  5EUH A;  1JLA B;  4IO9 Q;  1HNZ J;  1R0B G;  4K4W A;  2UXD J;  1HQ2 A;  3CT9 A;  1RSC A;  1K0T A;  2HGN A;  5A6W A;  2YKA A;  3DXB A;  4YY3 J;  1CUL B;  1HNZ F;  4K4X A;  4EBE A;  2DNM A;  1PC4 A;  2HQ3 A;  4CLL A;  2BAB A;  1SJ3 P;  4Z7C A;  4C3K A;  2RKI A;  1Q4R A;  1S72 S;  4EZ6 A;  1NB7 A;  5I3Q A;  1URA A;  4TLQ A;  3DI6 A;  3CCE S;  3KJF B;  4KFB B;  3MEE B;  5AJ3 F;  1YLX A;  4K2X A;  2Z2Z A;  2DGT A;  3D67 A;  3BO2 A;  2V69 A;  5TJ3 A;  4WTO B;  3KLI B;  1Q81 T;  1FRK A;  3TWZ A;  1FVQ A;  3TP2 A;  5J2M B;  2CQB A;  4FF2 A;  1ZEB A;  1ZYQ A;  1RKJ A;  2H65 B;  1G1X A;  1HNI A;  1K0V A;  2VHG A;  4ECY A;  5J2Q A;  3GMG A;  3DDI A;  2HZC A;  5L39 A;  2V68 A;  1QAJ A;  4RW8 A;  1RWV B;  3UCG A;  2HRU A;  3T41 A;  1JLF B;  3SSQ A;  2H5J B;  5KOW A;  2BA9 A;  2VIH A;  4RNN A;  1IJF B;  3H2L A;  3P96 A;  1H2T Z;  1Q86 T;  5EWE A;  1YVF A;  1CLF A;  5GRR A;  1T9Y A;  2HVE A;  1RT6 B;  2MXY A;  1RT5 B;  2XNR A;  3IA0 A;  4IO1 A;  1I51 B;  2N7C A;  2BJ9 A;  2G9O A;  2YPZ A;  3G96 A;  5H9F K;  3OSP A;  2JVO A;  2LMI A;  1Q0N A;  3GG1 A;  4Y2K A;  4YUD A;  4YB6 A;  1B7Y B;  2MQ8 A;  2C3O A;  4NLD A;  2MZ1 A;  2ZZN A;  3BDG A;  4DSL A;  3WX4 A;  2YKN A;  3FBB A;  4DFK A;  1FX4 A;  3NBP B;  1VRQ C;  3MEC A;  1Y5I B;  2B3T B;  2L9D A;  4J5O A;  4DL4 A;  2KRB A;  3K58 A;  2ZH8 A;  3ZZT A;  4CLT A;  4RNH A;  1KFS A;  1N6Q B;  1SIW B;  1RJJ A;  1S1U B;  3I6P A;  2CYY A;  4MKA A;  5IQ6 A;  1D9A A;  1HHT P;  2VA2 A;  3L95 X;  2X3D A;  3KLF B;  1WKK A;  3HO1 A;  3TW0 A;  1KWM A;  2A10 A;  2YKM B;  1XC9 A;  3DLL Q;  4PWD A;  1TMJ A;  4UOC A;  1TMM A;  1LW0 A;  1YSJ A;  1ZBT A;  1X4D A;  3HSD A;  3IBW A;  3WX8 A;  1N34 F;  2I5J A;  3MF5 A;  5DDP C;  2ZH5 A;  3UD4 P;  3SI8 A;  1S57 A;  5HRO A;  2PD1 A;  2H3E B;  4WP3 A;  3BS9 A;  2WVF A;  2Z0G A;  3W62 A;  2DRB A;  4ELV A;  2GZO A;  5E7O B;  3I55 S;  1TV6 A;  4NEZ A;  1OWX A;  3NWR A;  4U67 Q;  4DCJ B;  1X9M A;  2UXD F;  2AYG A;  4KAY A;  1FT8 A;  4NEY A;  3DLG B;  3CF5 Q;  4ELT A;  2MHE A;  3M32 A;  3OBI A;  4USI A;  5DO2 A;  3NCQ A;  3V2U C;  4AL7 A;  2RD5 C;  1NDL A;  3T6B A;  4DR6 J;  3IAS 9;  4ILR A;  4JI3 F;  4ATN A;  2RUG A;  4HI1 A;  3M6W A;  1Y3J A;  4K4U A;  3N28 A;  1VQS A;  2UUA J;  5J1E B;  3HI9 A;  4DQI A;  4QR1 A;  5IS2 A;  4F2S A;  3HHK A;  2QLB B;  1J27 A;  3UNY A;  2JEI A;  3ISZ A;  2AGQ A;  3QGP A;  1F5B A;  2FZG B;  2RU3 A;  1DHM A;  1QJH A;  1FNM A;  4YDD B;  4QIV A;  2A3J A;  4DX7 A;  1S7H A;  3CC7 S;  1LWF A;  1KNZ A;  2DHH A;  1EX8 A;  1SKU B;  2V67 A;  2V63 A;  2VQE F;  4CLK A;  2QX0 A;  4KSE B;  2I2Y A;  2ZNY A;  1ZAW A;  5MAO A;  2W5Q A;  2CQ0 A;  3P5T L;  1O98 A;  3TA0 A;  3EUN A;  1HNX J;  3ILO A;  4C48 A;  3OVB A;  4NXN J;  2DHG A;  4BDP A;  4FBU A;  4WFB Q;  1JKH A;  1RE1 B;  3C16 A;  4OZL A;  3V6D A;  3AD7 C;  4OJ3 A;  4FXD A;  1F2H A;  1GQE A;  5IT0 A;  1NO8 A;  3CB4 A;  3G6E S;  1X4G A;  1XN9 A;  3VGS A;  2UVU A;  5DLF A;  1S9E B;  2G1H A;  3EWG A;  2C2R A;  1S9G A;  3ILL A;  4CNZ A;  4JV5 J;  5FJ4 A;  2W9B B;  2EG1 A;  3BDE A;  1I94 F;  3OFE A;  1HBO B;  2GHW A;  4QIG A;  2W9C B;  4B3T J;  5D78 A;  2NSC A;  2CQ4 A;  4KYZ A;  1YJT A;  3HHE A;  3LW5 C;  1FI4 A;  3A3N B;  3AD8 C;  1SJ4 P;  5GMK a;  3BGU A;  2YQ1 A;  1GFW B;  3HKZ D;  3ITH B;  2AX0 A;  1UAW A;  4KC5 A;  3BO3 A;  3IR6 B;  4AD6 A;  5IV3 A;  4IH5 A;  1TFW A;  3BV8 A;  2D3U A;  4EEY A;  2DNN A;  4FYX B;  2ZVS A;  5DGB A;  4OYP A;  1TK8 A;  1M5V C;  3E8O A;  3EDQ B;  2E1R A;  1IBC B;  2WBR A;  4DI6 A;  3HFK A;  1PSD A;  2BXJ A;  2L48 A;  3NCR A;  5KFJ A;  2BKP A;  3KJV A;  1J5O A;  3JQK A;  3ENW A;  2B4P A;  2IC3 B;  4KH0 B;  2BW2 A;  1R0C B;  3TRG A;  5L9X A;  1NCL A;  3U1N A;  3WAV A;  2OLW A;  1ZA1 B;  2UVR A;  2OFH X;  1B0T A;  5FD1 A;  3VGT A;  3ZZ0 A;  5A8K B;  4I2P B;  5ETN A;  3QJL A;  2I8E A;  2QA4 G;  3OVS A;  4LF8 F;  3QIP A;  1RHM B;  1MLA A;  2AMC B;  3GSD A;  1M5O C;  1T3O A;  1SUQ B;  1JLQ B;  3H7H B;  1U1K A;  4KE5 A;  3T02 A;  1C0U B;  1IWA A;  2R7S A;  3E2E A;  2H1Y A;  3IN5 A;  1IUJ A;  2QO3 A;  3IG1 A;  4M5H A;  2VKZ G;  2VG5 B;  1TL7 B;  2B8P A;  5D4O A;  3KHL A;  2RUS A;  2HSE B;  4J9K A;  4JUZ A;  4Z2X A;  2YNF B;  2IUC B;  3QT6 A;  1JJC B;  2M70 A;  4CH1 A;  2DGS A;  3MGJ A;  4A8Y A;  2MST A;  5F8N A;  3PR4 A;  1GEH A;  1N54 B;  5IZH A;  2FVR A;  1OY8 A;  2XGQ A;  1T9V A;  2CDQ A;  2XMW A;  3MAQ A;  2QFI A;  2VOD A;  1BMQ B;  5DM7 Q;  3KK3 A;  1VQ8 S;  2UXB J;  1RT7 B;  2ALY B;  1RQ0 A;  1RWK B;  2HVZ A;  3Q86 A;  2XUL A;  4FNI A;  4J9Q A;  5HLF B;  3U02 A;  2C3U A;  4D3H A;  1S7I A;  4YN3 B;  4DWI A;  4GVB B;  2HFZ A;  1UEK A;  3D4J A;  2AZ1 A;  4M5I A;  4OZJ A;  4URS A;  2WOM B;  3HP6 A;  3V81 A;  1L3U A;  4UW2 A;  2NXU A;  2FLO A;  4NWB A;  4C7Q A;  2BDP A;  2XSJ B;  1LWX A;  1Q8I A;  1VRU A;  3KG4 A;  5IOL A;  5L38 A;  1SJR A;  4F2R A;  1PBA A;  2FLP A;  2UXC F;  1D9F A;  2UXC J;  3JAM Y;  3WHI A;  2C3P A;  3JQJ A;  4LF2 A;  1T05 A;  3FQK A;  1H73 A;  2GMJ A;  1SJ1 A;  4QR2 A;  1UJ6 A;  3J81 Y;  4FS1 A;  4IRK A;  2FIU A;  3LQV A;  3E3X A;  1XWL A;  2EW9 A;  2XMJ A;  3OXL A;  1KH7 A;  3NNH A;  1BWE A;  1K8A T;  2YNH A;  4PAB A;  4P52 A;  4GKK J;  1Q7L B;  1REG X;  4X62 F;  1KLN A;  2UXB F;  4O3Q A;  3MR2 A;  1ELZ A;  1KH4 A;  4B9U A;  3I0R A;  1HWL A;  4WTY A;  2VG6 B;  4DR1 F;  1FRJ A;  2F8E X;  4DSE A;  2DNP A;  3KUH A;  2K06 A;  3LPY A;  4CLP A;  2ILZ A;  2KHC A;  1S6P A;  4ES2 A;  4KGV B;  4DUT A;  4H4O B;  2AD9 A;  2HNZ B;  1E6V A;  2FJA B;  3M8P B;  3OTB A;  4H4M A;  4ICL B;  5KFT A;  3TZX A;  3M1V B;  3J80 Y;  1R0A A;  1RLC L;  3KLG B;  2CIM A;  3C6T B;  3FEX B;  4LBP A;  1RAH B;  5ETV A;  1FKP A;  3RBE A;  2MB0 B;  1QSY A;  2K7J A;  1S6Q B;  1FK9 B;  3R5B A;  5EX3 A;  2V4Q A;  4KIA A;  1ZAX A;  2YNG B;  3GJR B;  3OXG A;  1UW9 A;  2DKO B;  4CM0 A;  5HVG A;  3Q8P B;  1VC5 A;  4X4S A;  2JEF A;  1VIX A;  4AYB D;  1WHV A;  3T5H A;  2YBV A;  3DMJ B;  2UUT A;  2KT3 A;  1AB8 A;  4DV4 J;  1PJ7 A;  2VFV A;  3KKF A;  5HAO A;  4GKK F;  3N4W A;  1M5K C;  1MW7 A;  4NCG A;  3QGI A;  5GAD I;  4I2Q A;  4ZG9 A;  3H2U B;  2PO4 A;  1FTR A;  2R8I A;  2R7O A;  3AAW B;  4Q44 A;  1VK8 A;  3SBM A;  4DFP A;  2IVM A;  2QA2 A;  3FFI B;  2GA7 A;  5KFV A;  1D8Y A;  2HVI A;  2E5I A;  5BYQ A;  5F8H A;  2FC9 A;  2LVW A;  4PUO A;  3DRP B;  4HI2 A;  2HRY A;  4LUB A;  3LP2 A;  4L76 A;  3UR3 C;  1SQF A;  5CH7 B;  3CCV S;  2FJW A;  2J0S D;  1IQT A;  1ALI A;  2XR9 A;  3HXM A;  1JLA A;  4ES3 A;  3DLE B;  2ATL A;  2WSC C;  1BGX T;  2W4D A;  2WHO A;  1Q95 G;  1UVI A;  1EAR A;  4B3T F;  4A4J A;  1ANJ A;  1RA7 A;  2AYE A;  2FTR A;  1GX5 A;  1M1K T;  3ET6 B;  2XMT A;  5CZV A;  2R8H A;  2JRS A;  3CCT A;  1M90 T;  4DXL A;  3FSI A;  4MIB A;  3PZP A;  2MLZ A;  3MM7 A;  4DL0 C;  5DG8 A;  1TU0 B;  1HMV A;  2J7W A;  3AJ2 A;  4N77 A;  1A0O B;  2P6T A;  2VUG A;  3MEE A;  4Y2A A;  5BJR A;  1NZ8 A;  1D1U A;  2V4J A;  1DLO A;  4Y2C A;  1SKS A;  4IOA Q;  3PCO B;  4TU8 A;  5DLV A;  1RCX B;  3KLI A;  5CZX A;  3PDN A;  3W5Y A;  4ZVG A;  1FJG J;  3BBC A;  3AB2 B;  1NH7 A;  4U7U K;  3NAI A;  2HHX A;  1HNI B;  4U9R A;  5GAH U;  3JTO A;  1VIS A;  4A8K A;  4LF6 J;  1HFE L;  4XAK A;  4XK8 C;  4NZ0 A;  2PEH A;  2AJ1 A;  3MPV A;  3ILI A;  1DZ5 A;  2DY1 A;  4LF8 J;  5HAN A;  4K7Q A;  1C4A A;  5T7L A;  3I31 A;  4DV7 F;  5J1P A;  2DIS A;  1VQO S;  1QAX A;  3BGO P;  4UUW A;  3TAN A;  2W7O A;  2HS3 A;  4DR4 F;  4X4T A;  2DCU B;  2FGC A;  4O0I A;  1HIY A;  1KRP A;  4JYA J;  2DR7 A;  1NAQ A;  1RT5 A;  4UTG A;  4ZCM A;  2HQG A;  2BAN B;  2LP4 A;  1RHK B;  5EWF A;  1LK5 A;  3S6E A;  2DIV A;  1M0S A;  4WIQ A;  3RB4 A;  2HBR B;  4I7F A;  3AA8 A;  4CYR A;  3BN7 A;  4OI6 A;  4BC9 A;  2XGP A;  2XRG A;  4LFA J;  3B78 A;  2R7R A;  3W63 A;  1WOS A;  2AEF A;  4YDX A;  2GC8 A;  3BDG B;  4FYW B;  2EC2 A;  1JJH A;  1Q53 A;  2RS8 A;  2P5V A;  2E29 A;  2W25 A;  4G1P A;  5ETQ A;  4AXI A;  1ZTW A;  2IMW P;  2Y3Y A;  2GAG C;  4DV5 F;  2HBQ B;  2W5V A;  3GIR A;  2Z2M A;  4TU9 A;  1JLE B;  4P74 A;  4BC7 A;  4N47 A;  5KFM A;  2YPY A;  3MOJ B;  4K5S A;  1NBE B;  4C98 A;  4KT0 C;  2PEB A;  1EHW A;  1HR0 J;  3G2X A;  3MM8 B;  2Q3P A;  1DAX A;  1DUR A;  1X31 C;  5DLG A;  3VAJ A;  4CLZ A;  5JMN A;  3DKD A;  4IOB A;  1HJK A;  4NL5 A;  3Q8Y A;  4FPR A;  1FHT A;  5DLW A;  4DR7 J;  4ZVT B;  4KO0 B;  1RAF B;  4C2M A;  4DF8 A;  1SJQ A;  3WIV A;  3DLB A;  5HSP A;  4MFB A;  1S1X A;  2Q66 A;  5LOQ A;  1EJ7 L;  2IMO A;  1WC4 A;  3DLG A;  3TJ9 A;  4IR9 A;  2O67 A;  2KZZ A;  2BZ2 A;  4OZ0 A;  4DSK A;  1HQU B;  3M2U B;  4FVC A;  4OLO A;  2B9Y A;  4BBY A;  5AE3 A;  1SKR A;  4U7U D;  1AZS B;  2AHO B;  2HND A;  1URR A;  1RUS A;  5F8I A;  2QGF B;  1FJC A;  4UOF A;  4ZG6 A;  1RGV A;  1OY6 A;  4QIF A;  3TUP A;  1RHQ B;  4ED2 A;  4YY3 F;  1UFL A;  3CCU S;  4PR6 A;  1S77 D;  4LSL A;  2HK2 A;  2EVZ A;  3RAM A;  1N0U A;  1B8J A;  2YWH A;  1F1B B;  2D9P A;  3T9Z A;  1Y6V A;  4CO1 A;  3EXY A;  4ECR A;  3T5J A;  4OJG A;  4P71 A;  2Y8W A;  3D68 A;  4EBC A;  3NKQ A;  1AUK A;  3PFO A;  1B0V A;  4DR5 F;  2LDI A;  5CA5 A;  4ILL A;  1HNV B;  2E7W A;  3MTK A;  1WKJ A;  5M2R A;  4B9V A;  2KJV A;  3NS7 B;  3ZFV A;  3CO9 A;  2YX4 A;  1RT3 A;  1N33 F;  3KNA A;  4R0E A;  1T9U A;  1U1N A;  3J7A N;  1JQG A;  3C16 B;  3CCJ S;  4F4W A;  4JI1 J;  4OHY A;  1WTF A;  2OML A;  2Q1L A;  3UNG C;  1U09 A;  4ED8 A;  3QRQ A;  3FKB A;  4UUX A;  2V4R A;  4EYI B;  4NLY A;  1WF0 A;  1JLB B;  2HEK A;  1M1H A;  4RKU C;  1Q7Y T;  4LFB F;  4LBI A;  1HBO A;  3VAM A;  2LFV A;  1IKV B;  3HZG A;  1H7X A;  2KU7 A;  4NA3 A;  2W24 A;  1VC6 A;  2DHS A;  5BR8 J;  2GIF A;  1PKU A;  2OSQ A;  4OHV A;  3IGY B;  3TEG A;  1NJY A;  1F2G A;  3F44 A;  1MRO A;  1EW8 A;  3AQP A;  2R2T A;  2R7X A;  1TKT A;  4NE9 C;  5G4D A;  3PFE A;  3SQG B;  2AJQ A;  2QTW A;  4L73 A;  2QN6 B;  3SSR A;  1FA0 A;  3K57 A;  1NK8 A;  3BGL A;  1NDK A;  3GYX B;  2KDO A;  3L7U A;  4ZCL A;  3WIU A;  4P72 A;  3H42 A;  3TI0 A;  3D1H A;  4NXM J;  1HI0 P;  4KJD A;  2R4F A;  4QWD A;  3PJW A;  2B9W A;  3SDE B;  2CDR B;  2Z57 B;  4C8N A;  3FBC A;  4UOG A;  5D6G A;  1BHN A;  3KJV B;  2BVZ A;  2CPH A;  2MY8 A;  3D2W A;  2FLL A;  1V5V A;  2CG4 A;  2JLG A;  3AA9 A;  4F8R A;  2AJ4 A;  3ED4 A;  3ICL A;  4NWJ A;  3NG8 A;  4K4S A;  1KD1 T;  1F5A A;  3LWL A;  4CLF A;  2LXI A;  1NM2 A;  2VBZ A;  3ETO A;  3TAM A;  4AQY F;  2JEG A;  1VIO A;  1GXU A;  1UZD A;  3ETM A;  4I2P A;  4HEA 9;  4PG4 A;  4F4Z A;  3T00 A;  1S1W B;  4FF1 A;  4Y2I A;  1B70 B;  4NAS A;  2HQF A;  1SUQ A;  2GHV C;  4UQT A;  1ZTT A;  3VAI A;  3NL0 A;  1XMQ F;  1TKD A;  2BAC A;  2DNK A;  2JWN A;  3GWC A;  3K5N A;  1RTD A;  4ZP7 A;  4DQP A;  3ZNU A;  1RAG B;  2CFX A;  2VG5 A;  3Q89 A;  5I42 A;  2DNQ A;  2XO6 A;  1RWX B;  3BEG B;  4CLW A;  7AT1 B;  2IUC A;  4RUB A;  4BS2 A;  3RW7 A;  3U27 A;  3KDO A;  4RW6 B;  4UZB A;  1XNR F;  3HCX A;  2J9D E;  4EYH B;  1U2C A;  2GQC A;  2E66 A;  4NLW A;  6AT1 B;  5ITH A;  3JB9 k;  1S48 A;  3W66 A;  2OPS B;  1APS A;  5K8N A;  1ZED A;  4J9U E;  1HWJ A;  1JIH A;  2OKQ A;  4ZHR A;  3BF4 A;  3NKR A;  2CPJ A;  3OUY A;  2VD3 A;  2F7V A;  1Y00 A;  1YDL A;  1RT7 A;  4CLS A;  3GYN A;  2B4V A;  5E3C A;  4F0H A;  2DPI A;  2BQR A;  3US5 A;  2EFN A;  2HAF A;  4XDC A;  5HVF A;  2A2D A;  3KLH A;  2DR9 A;  2GIR A;  1RWU A;  3OTO F;  3HD1 A;  1CS4 B;  1SHN A;  1T9W A;  1AYE A;  2DGW A;  1S4F A;  1TL1 B;  4RNM A;  4N56 A;  2JZ5 A;  3VCD A;  3SZY A;  2OPP B;  2ZBQ A;  1F9E B;  3MK2 A;  4C8Y A;  1T05 B;  4P10 A;  1EET A;  3Q8U A;  2W5R A;  5L9N A;  1GH8 A;  4X4R A;  3OQ2 A;  4HHJ A;  2G13 A;  2DXF A;  1WC1 A;  2AEM A;  1ICE B;  1RBL A;  4ZVS B;  3TR5 A;  3DOK B;  4ID8 A;  3SIP B;  3K17 A;  1KKH A;  2AEJ A;  3M8Q B;  1E6Y A;  4MK9 A;  1N32 F;  3DM2 B;  3M2R A;  3J7Z 5;  4K4T A;  1HKA A;  1FFG B;  4A48 A;  3KK2 B;  3W8P A;  5E5N A;  2F40 A;  4HH1 A;  1OSC A;  1TUG B;  2BE7 D;  2CVE A;  3DRX A;  3I0S A;  3M9O B;  1QE1 B;  1VGY A;  2H4Y B;  1VQL S;  3IMQ J;  4DOZ A;  1RIS A;  2HNZ A;  1HW8 A;  1H2V Z;  2DH8 A;  1VLY A;  4Q7A A;  4HAC B;  3BDP A;  2KVQ E;  3X3U A;  2E5L J;  5K8M A;  5GAH I;  3KLG A;  3VAG A;  2L9W A;  5AXK A;  4CO2 A;  2ERR A;  2CNN B;  4NYP A;  5LSO A;  3C66 A;  2JVR A;  2X1G A;  4G65 A;  4NLU A;  1YJR A;  4JV0 A;  2LA6 A;  3GCW P;  4DBQ A;  1YBT A;  1WC5 A;  1W25 A;  2HQC A;  1Q8K A;  1YJN S;  3MXH P;  3NKM A;  2YWF A;  2FHO B;  4MTP A;  1WSR A;  2G0C A;  4R8U A;  3PO4 A;  4MH8 A;  3VHQ A;  1SPB P;  1X4F A;  2CJQ A;  1YZ7 A;  4I2Q B;  2OFG X;  2MTL A;  4X64 F;  3W1Y C;  4XIU A;  5AE2 A;  2QLX A;  3O2I A;  4LQ9 A;  4J91 A;  3RAQ A;  2E9Z A;  1KHK A;  2RRB A;  1XK8 A;  1MML A;  1HPZ A;  2V8H A;  1YTY A;  2AP6 A;  1SXL A;  4PQU B;  1WAC A;  1HNX F;  2F4F A;  1N88 A;  5D0R A;  5KFY A;  1RB0 A;  1YGY A;  2PC6 A;  2V2K A;  3DHX A;  3LP1 A;  5FDL B;  5K14 A;  3DLE A;  3ZZP A;  2MGZ B;  3HPO A;  4ZPB A;  5J1N A;  3BH7 B;  1F60 B;  3M2V A;  4O4R A;  4OZ2 A;  3WDO A;  5C5J A;  2FD2 A;  2D9O A;  3NRB A;  3M6X A;  3GR0 A;  2GO8 A;  5C25 B;  3PKM A;  1QAI A;  3MD1 A;  1K7H A;  3VF0 B;  1OMS A;  3ET6 A;  3R27 A;  4TY8 B;  3PX6 A;  3IGZ B;  3ENA A;  3ZC4 A;  1MU2 B;  3CMQ A;  4KBI A;  2FJE B;  1T02 A;  2CJX B;  2HGM A;  2QT7 A;  2CQC A;  3NGT A;  4Z37 A;  4QQB A;  2ZH2 A;  1TL4 A;  2ZJQ Q;  2CKW A;  5B0F A;  2V4J B;  1DLO B;  2FYX A;  3R5C A;  3PHT A;  2IRU A;  2Q79 A;  5KG7 A;  3M7V A;  5B0E A;  1XJW B;  2KKH A;  3D3C J;  2NYH A;  1UFK A;  3GB0 A;  1N56 A;  3ENV A;  1V9O A;  3GG0 A;  4OI2 A;  4F04 B;  4ED6 A;  2RML A;  2MZQ A;  3PW0 A;  4DR1 J;  1F9H A;  4LRA A;  5DQH A;  2XB2 D;  4B9S A;  5T7L B;  1R89 A;  4LF6 F;  2W8K A;  5LXY A;  3GPA A;  4PG8 A;  1NUE A;  4X4Q A;  8AT1 B;  2A0F B;  2UUC J;  4ZGA A;  1UTA A;  2V5H G;  3H40 A;  4OYM A;  1SL2 A;  2OEL A;  2AX1 A;  4TU7 A;  2BAN A;  3QLH B;  2XMU A;  2HVD A;  1ZS6 A;  3DGP B;  5DRK A;  1U02 A;  1YWX A;  3PAC A;  5KG4 A;  4J9R A;  3GE9 A;  3J81 j;  3MUV P;  1TL3 A;  1RWN B;  4O44 B;  4M5G A;  3MFH A;  5KG5 A;  4TNO A;  3HVR A;  1JLC B;  2RHS B;  4OV6 A;  4DPO A;  1CEZ A;  1U24 A;  5KFK A;  3D28 A;  1FKA F;  1S6U A;  3F0N A;  5HJY A;  4LF9 J;  2UV8 A;  5C24 B;  1NK9 A;  1NXI A;  4C8O A;  5LMN J;  1SC4 B;  1XNQ J;  1EW2 A;  3T1H F;  3UFC X;  4P9S A;  3PJ9 A;  3MM5 A;  2MQO A;  1B7F A;  2PII A;  1FFS B;  1TUW A;  4GRS A;  2FJB B;  5LSR A;  4WF9 Q;  3NXZ A;  4NML A;  1HNW F;  4YB1 P;  2PMZ D;  2Y9H A;  1EAY C;  1NK4 A;  1FKO B;  1UJ5 A;  3OTD A;  4OZ1 A;  4A8O A;  4CLU A;  5B08 A;  4LF4 F;  1Q8B A;  2HWT A;  1R8C A;  2OPQ B;  3MAA B;  4LRB A;  2H9Z A;  2VBX A;  4U95 A;  3EX7 B;  4IFV A;  5L1K A;  4JI7 J;  5JXS A;  4EO8 A;  3OHB A;  4DN0 A;  1FNX H;  3C6U B;  5G0R B;  2IVF B;  5HBM A;  5KOX A;  4M1K A;  3TAP A;  4DV4 F;  1TR0 A;  3CGI A;  1X9W A;  4QWE A;  3T1Y J;  2B51 A;  2G1D A;  1N52 B;  3MM6 B;  1KTQ A;  2IM2 A;  1NEE A;  2VU5 A;  2RH3 A;  3PYF A;  2DR8 A;  2VFU A;  3QGG A;  1VYA A;  2VPZ B;  3ZTR A;  3C14 A;  1NH8 A;  3OXF A;  3AY0 A;  4DV1 F;  4PUO B;  4V19 J;  3LH2 S;  5HVH A;  2F63 A;  3FRZ A;  3OLA A;  3G6Y A;  4K0K F;  4YR0 A;  4PXB A;  4TN2 A;  1HHQ A;  1LWC A;  4DV2 J;  1YIT S;  4AE5 A;  1U45 A;  4IYQ A;  4LSL B;  2GHP A;  1S0M A;  4ED5 A;  4EZ9 A;  4GTZ A;  2CQI A;  2HHS A;  3GFY A;  3T19 A;  1UA1 A;  5E2Q A;  2O3D A;  1WEZ A;  4OV1 A;  1HAR A;  3EJM A;  3THV A;  1C0T B;  5ETO A;  3D9B A;  3IP0 A;  3QAT A;  3T1H J;  2CPY A;  1HNV A;  1RTJ A;  1X4A A;  1CUL A;  3K5L A;  4WFY A;  4ZLL A;  3CDA A;  3G6V A;  1RT3 B;  1VFJ A;  1ZPW X;  3CWJ A;  3MUR P;  1D09 B;  2IM1 A;  2RKI B;  1U26 A;  4M94 A;  3LXQ A;  2CQP A;  2MJN A;  2KH9 A;  4DSI A;  4KHP F;  4IH6 A;  4DR2 F;  2IPO B;  2XSF A;  3A8J A;  3FZ2 A;  4FP9 A;  4KKO A;  3D5M A;  4Q2L A;  4S0M A;  2K2P A;  4C0B A;  4L74 A;  5L0K A;  2LEP A;  1JLB A;  3ZO7 A;  1UWA A;  2I6W A;  4F3M A;  4EO6 A;  5A8R B;  3KHR A;  2OTJ S;  1H74 A;  2B5J A;  4NZ7 A;  2NSB A;  3QBC A;  1E3C P;  3NKO A;  3OV7 A;  2UUC F;  2J0Q D;  1WNE A;  1VQ6 S;  4QYZ K;  4N7T A;  2KM8 C;  4JI2 J;  3TUI C;  3MMJ A;  4F67 A;  5DM6 Q;  1URB A;  3SFG A;  3V5R A;  1ACM B;  1SL1 A;  2F4V J;  1MRO B;  3R9L A;  4LQY A;  4I67 A;  1TKT B;  4KY3 A;  1YJV A;  3PYD A;  4LRD A;  3ZTQ A;  2ZVI A;  3ZZY A;  3KMQ A;  1A9N B;  2LQJ A;  1Q79 A;  1ZET A;  3GR1 A;  4NCB A;  3MHY A;  3R5G A;  5JUM A;  2C3Y A;  3TO8 A;  4CDI A;  1PGZ A;  4UOP A;  3QPI A;  1R27 B;  2RQM A;  2OSR A;  2YKP A;  3PNI A;  2NR0 A;  4PPZ A;  4O23 A;  1RT6 A;  2C2O B;  3DNC A;  4WK3 A;  2K8G A;  2W5T A;  5BYS A;  4DX8 H;  5KG2 A;  2Y1I A;  2QYG A;  4F26 A;  3PX0 A;  2QG9 B;  4ZVQ B;  3B82 A;  4DUY J;  1L5U A;  3V4M A;  3KHG A;  3LWM A;  4G3I A;  2ZUA A;  1QSL A;  4OZN A;  2J0W A;  3OFG A;  1S1W A;  2DRA A;  1N4L A;  3MEC B;  4CXK A;  1SKW A;  1HYS B;  2J6S A;  4IR1 A;  2M3D A;  1HW9 A;  1Y4Z B;  4OFZ A;  2VIC A;  4WXW A;  1T8E A;  3PTW A;  2XMA A;  1N6Q A;  4LJM A;  1TZ0 A;  2AGO A;  1CJK B;  2XMK A;  4I68 A;  2FVS A;  1RK8 A;  2BUN A;  3GIL A;  5E41 A;  4KRW A;  1U8W A;  1CPZ A;  4ZN1 A;  3OL8 A;  4RW6 A;  2F9D A;  2JH3 A;  4USW A;  4USJ C;  4EMD A;  1TL5 A;  3L9Z A;  1YX2 A;  2CVI A;  1RAI B;  2KXH A;  2LQ5 A;  3R3T A;  1NK6 A;  4N76 A;  3HJF A;  3M05 A;  5B0A A;  1NND A;  3PYG A;  4XPC A;  3VAF A;  2ZKU A;  3GJS B;  3DGV A;  3AXK A;  1VLO A;  4LT6 A;  4Y2M A;  4ZIW A;  3RRH A;  5C66 A;  1K9M T;  1SH2 A;  3QJJ A;  2QL7 B;  3AJD A;  4RBV A;  4ZLN A;  3C2P A;  3HHL C;  1QY7 A;  3AOD A;  4DPU A;  2CZV C;  2MKH A;  3M32 B;  3BQ0 A;  1KHV A;  1I94 J;  1T94 A;  2DGQ A;  3DU5 A;  3ADA C;  1CS4 A;  3F56 A;  3CXC R;  2D3O 1;  3PRV A;  3CJQ A;  5H9E J;  1TL1 A;  2B7B B;  4OYA A;  3JSM A;  3NAH A;  1B99 A;  1XQI A;  1EQJ A;  3KD8 A;  2QA1 A;  5J1E A;  2VG7 A;  4YS2 A;  1EET B;  2XCP A;  3R1L A;  4CP5 A;  4RW4 A;  4U8V A;  1YQH A;  1OJ4 A;  3IR5 B;  5FII A;  3RB0 A;  5LSL A;  4LF1 A;  5LJ5 Y;  4CTA A;  4J9M A;  1M5S A;  2F5G A;  1WOR A;  3D0H E;  4IG3 A;  2ZBP A;  1E6Y B;  1PIE A;  2J6U A;  1WEY A;  3DM2 A;  2VZ9 A;  3M2R B;  3LTO A;  2CQD A;  5RUB A;  5HP1 B;  3GFZ A;  3FJ2 A;  2IJR A;  3QYY A;  4OQJ A;  4M8L A;  4DG1 A;  2VPW B;  4WYW A;  1N32 J;  2KYZ A;  3R5D A;  5ETK A;  4X65 F;  3R6L B;  4M5L A;  3J80 U;  2XS5 A;  2EEY A;  2Y0S D;  1XR6 A;  4C9D A;  2HHW A;  4HAC A;  2W9A A;  1M5H A;  2GVZ B;  2OP5 A;  1U0H A;  5KFA A;  3QJP A;  2NXE A;  3WAY A;  2ROG A;  4ZIT A;  3M4X A;  5AJ3 J;  2EG2 A;  4JI3 J;  1TKZ B;  1S9E A;  4B02 A;  2AQ4 A;  2J8S A;  1VOM A;  1C2P A;  3A4T A;  2RDD A;  3B8H A;  5JJB A;  3D6H B;  4J7C A;  2BJ3 A;  2ZHB A;  3C46 A;  2MKY A;  3AFG A;  4ZVE A;  3Q24 A;  2SXL A;  1WDT A;  4R8U B;  4DQR A;  1HBU A;  3CE8 A;  2Z2Y B;  3DN9 A;  1VQP S;  2CQ1 A;  1S97 A;  2I38 A;  2DO0 A;  2J7U A;  2BM1 A;  3QO9 B;  1GMV A;  4RBT A;  3A8I A;  2ACM A;  3O6Q A;  5E3A A;  2ACY A;  6FD1 A;  2OTL S;  4M63 A;  2E9T A;  1HLW A;  1RHU B;  3DLK A;  3U7J A;  2EC0 A;  4YQW A;  4H54 A;  2RH6 A;  3CCQ S;  2JC1 A;  3BQ2 A;  3K7R A;  3W61 A;  4PYA A;  4DQQ A;  2PN6 A;  1HPZ B;  3BQ1 A;  4J9L A;  3AHP A;  1RT4 A;  3KTQ A;  2MZT A;  3R7N B;  3HFV A;  1FCA A;  2RIJ A;  2W2O P;  3EPG A;  3PRB A;  3LP1 B;  4PYD A;  5FDL A;  2MGZ A;  3K2Y A;  3TZW A;  5HQ8 A;  1ALJ A;  2R42 A;  3M2V B;  3C19 A;  3IWX A;  5E0O A;  4LF7 F;  3UPF A;  4K8R A;  3OW2 R;  1CVJ A;  2X7I A;  4J9N A;  5C25 A;  3IS9 B;  3PG9 A;  5D0G A;  1ZZF A;  2E1A A;  3UVJ A;  4Y3C A;  2UUB J;  2M88 A;  5D4P A;  2UVW A;  1NB2 A;  2GJI A;  1C0U A;  1N5Y B;  1MU2 A;  5I4M A;  1AFI A;  2G2O A;  1NSK L;  1G4C A;  1RDR A;  1KHJ A;  2ASL A;  2IJF A;  4WZQ A;  4GO7 X;  2YNF A;  3WAW A;  2C42 A;  3RRK A;  4MYT A;  4DU7 A;  4LBH A;  2XY5 A;  4GKJ J;  2OHD A;  3KG1 A;  4PCQ A;  5LIA A;  3BSA A;  3SZZ A;  4DL2 A;  4M5K A;  3A8K A;  1RWO B;  5KFW A;  3KK3 B;  2NPI A;  2BBE A;  4WK1 A;  4PRF A;  3FCV A;  4TYA A;  2HQD A;  1WOO A;  3D3B J;  4USH A;  3D54 A;  3ZZO A;  2QMW A;  4NLQ A;  1XIQ A;  4DQS A;  2XEX A;  3HVT B;  3I5C A;  4NLT A;  4LFB J;  4ZA1 A;  3L4B C;  4QJV A;  3BKT A;  5AXL A;  1XMO F;  4ILM A;  1V3R A;  3BSO A;  1OS5 A;  2XSJ A;  1VRU B;  2C2M B;  5ETM A;  3DGP A;  3L7P A;  4XDD A;  3CD5 A;  3S01 A;  4OL8 A;  3N9U C;  2R7T A;  1GMW D;  1JLC A;  2V6A A;  3H59 A;  3G8Q A;  3PY8 A;  3H2V E;  2D69 A;  3DC2 A;  4RR5 A;  4JI4 F;  3K5O A;  3IBC B;  1U25 A;  1GMW A;  3MOZ A;  4QR0 A;  1N33 J;  2LLZ A;  2BOA A;  2QLW A;  5D0E A;  4DN9 A;  1SC6 A;  1FRM A;  5IQQ A;  4UQG A;  4J9O A;  2CJK A;  3OR1 B;  2XY6 A;  2DPJ A;  1FF2 A;  1AXQ A;  1Q16 B;  3I0R B;  2DEJ A;  4QIE A;  4GC7 A;  4KV8 A;  4DFM A;  4JV1 A;  2BE9 B;  2VG6 A;  2XZT B;  3VZI A;  2KG0 A;  4KAV A;  2JHE A;  4P7T A;  5KXA A;  4XPE A;  3UW1 A;  4ALZ A;  1U1R A;  4W98 A;  1RTI B;  1B64 A;  4DDF A;  1EJJ A;  3QQC D;  4H4O A;  1FEH A;  2M8H A;  3HSJ A;  4FYV B;  4OIX A;  3VWS A;  4H4M B;  4ICL A;  2AKW B;  2GLQ A;  1R0A B;  4CYU A;  2KXN B;  2MKS A;  2Q6B A;  5L1L A;  1FKP B;  4LRE A;  2UZA A;  1FJE B;  1VQN S;  4B3R F;  4AL6 A;  1FK9 A;  4B9L A;  3DCA A;  3RW6 A;  4JBC A;  3C6U A;  5G0R A;  4KJI A;  2YNG A;  2VBW A;  4DHV A;  4QPX A;  4OX8 A;  2RVJ A;  2APO A;  4OX9 F;  3G82 A;  1I5O B;  2WW4 A;  3GSI A;  4J9V A;  2FLN A;  3IC1 A;  1RYR A;  2RDI A;  3DMJ A;  3IXQ A;  1DRZ A;  2OEK A;  3MUT P;  2VON A;  3GIJ A;  2OMO A;  3H98 A;  4DV3 J;  1U6B A;  3PEH A;  1GK8 A;  3O1L A;  4XO0 A;  1UW4 A;  4NI2 B;  3C14 B;  2ZH3 A;  2BRL A;  5F9N A;  1FDD A;  1OPZ A;  3CD7 A;  3JTP A;  4OHW A;  3VAK A;  1RA6 A;  3MFI A;  1A7G E;  2Z56 B;  2QSF A;  2D3O R;  2LU1 A;  3W65 A;  4B3M F;  3FFI A;  3WBH A;  1YBU A;  3AOB A;  1LWC B;  1L3S A;  3TEH B;  3R5A A;  3SCL E;  3KLE A;  1KVJ A;  1ZM3 A;  1R6Y A;  3QRR A;  3NS5 A;  4KTQ A;  1LNQ A;  5I3U A;  5EX0 A;  1HI8 A;  2B43 A;  1IVZ A;  5H9E K;  3GIM A;  4EUV A;  1C0T A;  4ES1 A;  5KFQ A;  3CC4 S;  1HWK A;  1ZM4 A;  1HBM B;  3LPE A;  4JOU A;  5F3T A;  2XLJ A;  1QSS A;  2DXE A;  3R7S B;  1DFD A;  2OPR B;  4QU7 A;  5JVG Q;  3DRS A;  3U1L A;  2VV5 A;  4MYU A;  2QSW A;  5KT7 A;  2DRD A;  4ZJQ A;  4X66 F;  1KHW A;  2MJU A;  1KQG B;  4Q2M A;  5KFD A;  2V9K A;  3W9J A;  3G4S S;  5M2U A;  1REV B;  2RQK A;  5A2Q U;  1RAD B;  4G1Q B;  4DJB A;  4RPF A;  5ETR A;  5F0W A;  1OIA A;  2MSS A;  4JYA F;  4GTY A;  5A8R A;  4ZPD A;  5IT4 A;  1TVR A;  1LWE B;  5KG0 A;  4C0H A;  3RAX A;  5E33 A;  5D0H A;  1Y5L B;  3MEG B;  4DV7 J;  1WC0 A;  4CO0 A;  2HAI A;  2QZ8 A;  2VAS A;  1DBD A;  1RCO B;  1S59 A;  3EIC A;  3JQM A;  4ENO A;  3Q8Q B;  2N3L A;  4CO5 A;  2ZD1 A;  4NPO A;  1FXD A;  3CCZ A;  2QYC A;  5KFO A;  4AL5 A;  5THW A;  3HVA A;  1K73 T;  2ZZM A;  2IBO A;  1Q5Y A;  3BBB A;  1RT2 A;  2V8V A;  3BDH A;  5IWA F;  2ZBI A;  1U2R A;  3IRX A;  2XCA A;  1VQ4 S;  1FJG F;  1KLM A;  4X4N A;  3HJV A;  4U8Y A;  4CO4 A;  2Q6C A;  1NDP A;  3W5Z A;  4DUZ J;  3GII A;  2UU9 F;  1HQA A;  1J2V A;  3H8Y A;  4MT1 A;  4I7F B;  1X4C A;  2H4W B;  2OIH A;  2WSF C;  3UCZ P;  2HFN A;  4UT4 A;  2KXF A;  3Q22 A;  5B09 A;  1X0F A;  1U6F A;  1GAO A;  1SC3 B;  3G9C A;  3OT9 A;  4QW9 A;  2IAJ B;  4CO3 A;  4CNY A;  3FSY A;  4Y6I A;  4WPA A;  1QUV A;  4ID5 A;  4TQR A;  1HYS A;  1PYO B;  1X8D A;  1T03 B;  1CJU B;  1T9X A;  2RRN A;  1X4H A;  2BX6 A;  4O4G B;  4F4A A;  2PDA A;  3J7Y U;  3RUB L;  1UJ4 A;  5AJ9 A;  1F0X A;  3UE2 A;  3JXO A;  3MM8 A;  2E5J A;  1S6O A;  4PG7 A;  4NCA A;  4M5D B;  4NZ6 A;  3BDF A;  1L3K A;  2A1B A;  4ITS A;  3MK0 A;  3S8S A;  1FE4 A;  1R8B A;  3I82 A;  4ANC A;  3GQC A;  3EZO A;  5K8O A;  3Q23 A;  2UVV A;  3IGN A;  2LQ8 A;  4OHZ A;  3VZH A;  4QBU A;  3WBZ A;  2PFD A;  2ZWO A;  3E01 B;  4I1T A;  1X7V A;  3PW4 A;  4Q8F A;  5IJQ A;  4B3O B;  5L0E A;  4FXW A;  5HO4 A;  3IAM 9;  1KH9 A;  4KO0 A;  5GME A;  4P6Q A;  1KHN A;  2W5X A;  3MI7 X;  4B3S F;  4Q5V A;  1UET A;  3JSY A;  2HNY B;  2WVC A;  3A13 A;  4K2J A;  5KT6 A;  5A8W A;  4MFB B;  4QCL A;  1NPP A;  1LK7 A;  3BKF A;  1N0V C;  3FCH A;  3CO0 P;  2PA8 D;  1VS3 A;  2IYI A;  3KUG A;  1DY3 A;  3UR0 A;  4KGZ B;  2FPH X;  4KJG A;  4OYZ A;  4DSJ A;  3M8S A;  3HMJ G;  3GFX A;  2YKQ A;  4YR2 A;  2OD6 A;  1DTT A;  4LIR A;  2HND B;  5CD4 H;  2ZUG A;  2DH9 A;  3SV3 A;  2D7S A;  2VG7 B;  3CJ2 A;  5D15 A;  1N36 J;  3TYT A;  1W26 A;  2HFO A;  2MHN A;  3BB5 A;  3DLJ A;  4LSN B;  1N36 F;  2R2S A;  2DD8 S;  2JNJ A;  1VQY A;  1WF2 A;  2DHX A;  2QIF A;  3QSY B;  2YQ0 A;  3NNA A;  2MLX A;  2KFN A;  3MMA A;  1ALH A;  2XG8 A;  2RT3 A;  3D6T B;  4IG3 B;  1YZ6 A;  4LIW A;  5KFX A;  4DZD A;  2KM8 B;  1JWW A;  3MCN A;  1S9F A;  1FRH A;  2XLK A;  2NZC A;  1UPM B;  4DZ6 A;  5C42 B;  2PSZ A;  3PW7 A;  3BM7 A;  4DV0 F;  2VQR A;  2ILY A;  1N5Q A;  1H7W A;  4FDI A;  1RAJ A;  2BRK A;  1V6H A;  2QV6 A;  1WF1 A;  3K8W A;  2KT2 A;  1H2U X;  1R43 A;  2MMY A;  4NMX A;  1VI7 A;  4ER8 A;  1VK3 A;  3NP5 A;  2GVZ A;  4TVA B;  1YJW S;  4JI7 F;  3MZI A;  1U0H B;  2P8I A;  5ADZ A;  1IKX B;  3HF5 A;  4IG0 B;  3K59 A;  4RZR A;  2HMI B;  3AB4 B;  2J6T A;  1N2L A;  5DDR C;  3I96 A;  2N4D A;  4FXV A;  2CQH A;  4EK2 A;  4DV6 F;  1VQ5 S;  5LT5 A;  2HGL A;  1WHX A;  5CD4 A;  3MEK A;  3D1Q A;  2WTF A;  2MZR A;  4MKY A;  2CG8 A;  1BY9 A;  1IKV A;  2RU9 A;  2DO4 A;  1O99 A;  2KFZ A;  4LRC A;  2GML A;  4F25 A;  1HBU B;  1RKI A;  3EGW B;  5AXM A;  5LMN F;  2C1E B;  2FJX A;  1FRL A;  2VKR A;  3FEZ A;  4FZV A;  4UF4 A;  4YB5 A;  4USK A;  3K8V A;  4F0K A;  4CCH A;  2E9R X; 
#chains in the Genus database with same CATH homology
 5LQQ A;  4GTX A;  3WAX A;  1ALJ A;  4NWX A;  4LRF A;  2IUC B;  3BDG A;  4GTY A;  3M7V A;  1E2S P;  3T00 A;  1AJC A;  3MK1 A;  4UOP A;  5EGH A;  4UPI A;  1E33 P;  1Y7A A;  2W5T A;  5HRT A;  5L0E A;  4LRA A;  1N2K A;  5LRN A;  4CYR A;  3UO0 A;  2XRG A;  1KHJ A;  2GSU A;  2IUC A;  3BDG B;  3BDH A;  4ZGA A;  1KH5 A;  3WAW A;  1ELX A;  2W8D A;  3DYC A;  2W5S A;  3NVL A;  3B5Q A;  4CXS A;  4CXK A;  2QZU A;  4TN0 A;  1ZED A;  1KH4 A;  2W5V A;  5LIA A;  1HQA A;  5INH A;  3SZZ A;  4FDJ A;  3NKR A;  1ED8 A;  3M8W A;  4MHX A;  4KAY A;  4CXU A;  1ZEF A;  4MIV A;  5K4P A;  4UOO A;  1KH7 A;  5EGE A;  3Q3Q A;  4ZG7 A;  4UPK A;  1HJK A;  1EW2 A;  3OT9 A;  3TX0 A;  2GSN A;  4B56 A;  1EW9 A;  3M8Z A;  5DLW A;  1SHN A;  1ELZ A;  4YR1 A;  3UN5 A;  3MK2 A;  5AJ9 A;  1ANI A;  3E2D A;  5C66 A;  2GSO A;  2W5R A;  3UN2 A;  3A52 A;  3BDF A;  4MY4 A;  4UPL A;  3UNY A;  3MK0 A;  1KHL A;  1ALK A;  4LRB A;  3M8Y A;  5IJQ A;  5IJS A;  2W5X A;  1KH9 A;  1KHN A;  4UPH A;  3KD8 A;  1EQJ A;  2W5W A;  2ZKT A;  2W5Q A;  4KAV A;  4QAX A;  5KXA A;  1O98 A;  4GTW A;  4ZG6 A;  2GA3 A;  4LR8 A;  1EJJ A;  2GLQ A;  5LRM A;  1SHQ A;  2IFY A;  1B8J A;  4KJG A;  1Y6V A;  4LRE A;  5GOV A;  4ZG9 A;  3NKQ A;  1EI6 A;  1ELY A;  1AUK A;  2G9Y A;  2D1G A;  3IDD A;  4LR9 A;  1AJD A;  1AJB A;  1FSU A;  3CMR A;  2ANH A;  1ALH A;  3NKM A;  2W8S A;  4GTZ A;  1ALI A;  3NKN A;  4LR7 A;  1URA A;  2XR9 A;  3WAY A;  3UN3 A;  2VQR A;  1ED9 A;  4FDI A;  3WBH A;  5TJ3 A;  1ZEB A;  3TWZ A;  1KHK A;  1ANJ A;  3T01 A;  3IGY B;  3LXQ A;  4CYS A;  1N2L A;  1EW8 A;  4KM4 A;  5DLT A;  3WAV A;  3DPC A;  3SZY A;  5L0K A;  5DLV A;  3NKP A;  1E3C P;  2RH6 A;  3NKO A;  4KJD A;  4UOR A;  3TG0 A;  5L0B A;  4N7T A;  1E1Z P;  1K7H A;  1O99 A;  5GRR A;  4LRC A;  4LR2 A;  2X98 A;  1URB A;  3IGZ B;  3T02 A;  3ED4 A;  4NWJ A;  4LQY A;  4LRD A;  1AJA A;  1HDH A;  1P49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...