4LRDA

Phosphopentomutase 4h11 variant
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSIGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYKVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase 4H11 variant
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 144
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrdA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrdA01
4YR1A 4LRCA 4UOOA 1EI6A 5DLTA 3TWZA 3BDGA 5LRNA 1E3CP 2W8SA 2GSUA 1KHLA 1KHJA 1URAA 1AJAA 5DLWA 1HQAA 2W5QA 1ALKA 2G9YA 2RH6A 1KH9A 4LREA 3M8WA 3BDHA 1N2LA 1ZEFA 3TG0A 3NKPA 5GOVA 1SHNA 3UN3A 1O99A 3MK1A 4TN0A 4GTZA 4KAYA 1AJDA 3UN5A 3KD8A 1EQJA 1ANIA 4LRAA 4UPKA 4LRDA 3NKOA 1P49A 3UO0A 4GTYA 4KJGA 3ED4A 5TJ3A 1SHQA 1K7HA 1HDHA 1KH5A 2W5SA 3E2DA 3IDDA 3LXQA 4B56A 1URBA 1KH7A 2QZUA 3MK2A 1KHNA 4LQYA 4ZG7A 1ED8A 4FDIA 5L0EA 3UNYA 3M7VA 2IUCB 5HRTA 5EGHA 3CMRA 4ZG6A 2VQRA 3DPCA 1Y6VA 2W5WA 4UORA 5LIAA 2XRGA 4CYRA 1E2SP 2XR9A 4CXUA 4ZGAA 1AJCA 5AJ9A 2D1GA 3IGZB 2IUCA 5INHA 3M8ZA 1AJBA 5L0BA 1ALIA 3MK0A 1ZEBA 1EW9A 3BDFA 4LR7A 3NVLA 1ALJA 3Q3QA 3WBHA 1ZEDA 2GSNA 4N7TA 1ELZA 4GTWA 4QAXA 2ZKTA 3NKNA 1ALHA 3B5QA 4UOPA 4UPHA 5LRMA 3WAVA 3OT9A 3WAXA 4CXKA 3T01A 3T00A 4LRFA 3WAYA 1E33P 5EGEA 3SZYA 4KJDA 2GLQA 5C66A 1ELXA 2X98A 4UPIA 5IJQA 4LR9A 2W5XA 2W5TA 2W8DA 4NWJA 3M8YA 1N2KA 4MHXA 3NKRA 1B8JA 5GRRA 5L0KA 4KAVA 2ANHA 1KHKA 1O98A 1KH4A 1EJJA 4UPLA 2GA3A 1EW2A 3IGYB 4MIVA 4NWXA 5LQQA 3NKQA 4ZG9A 5K4PA 1HJKA 1FSUA 1ELYA 1ED9A 1ANJA 4MY4A 2GSOA 3A52A 5KXAA 2W5VA 2IFYA 4KM4A 3TX0A 4GTXA 4LR8A 4LRBA 4CXSA 4FDJA 4LR2A 3DYCA 1E1ZP 3UN2A 1AUKA 4CYSA 3SZZA 3NKMA 5DLVA 1EW8A 3BDGB 5IJSA 3T02A 2W5RA 3WAWA 1Y7AA
chains in the Genus database with same CATH superfamily
2P9EA 5EN1A 1E3CP 1PCAA 1KOOA 1LK7A 4WE1B 2G0JA 1SJ4P 2WAQD 1FKPB 2NZ4A 4A8FA 3AA9A 2UXBJ 2G1DA 2KVQE 1S76D 2EFQA 1S1WA 4I69A 1VJQA 2GX8A 2R7SA 1N34F 2L41A 4LQYA 3H8YA 2PDAA 4NYZA 3DYAB 2ZOFA 3IAS9 4P2FA 4U67Q 3FBBA 4IH6A 4CQ1A 2OD6A 1EP4B 3AQPA 1S9EB 5LMNF 4Q5VA 2HW3A 3KK3B 4MT1A 4H4MA 5DGBA 5I3PA 4WKRA 3NNAA 5BXIA 1NKEA 4UPIA 2QFJA 2AV5A 3KLHB 1D09B 4OZ0A 4P10A 4NWXA 2UV8A 1VR6A 4F04B 5E41A 3PIPQ 3CIZA 1NK8A 2YWGA 2J6UA 3MAAB 2G2ZA 3PFEA 3RAXA 1OJ4A 4NZ6A 1AROP 1T05B 3QRRA 5HQ8A 4LF9F 3W5ZA 1I3OB 1YBUA 3EXYA 4I2PB 2W7OA 1KHJA 1SJQA 2DRBA 5DDQC 2VZ9A 2JFDA 1YIJS 2XM3A 3EUNA 4H4OB 3Q86A 4Y2CA 2OFGX 5DZ6A 2EK6A 2NREA 3MK2A 2DD8S 4FDIA 4LF4F 3C6TB 4JI2F 4QQBA 1H2UX 2PC6A 3IR6B 1M5HA 2V8GA 3B4MA 2J7WA 5GADI 1FX4A 1NH8A 2AGOA 3WIUA 4OJ3A 3WDOA 4EBEA 2HG4A 2GZOA 2RD5C 5C24A 1YLXA 5G4DA 2D1CA 1RAFB 4XAKA 2DXFA 1YJ7A 3M9NB 1N56A 2Q79A 4EZ9A 2D74B 4UPLA 4I56A 2PFFB 3Q8UA 2C2NA 2XZTB 4DJBA 5L38A 2IJRA 3POTB 3AQOA 2WBRA 4ERDA 3GPAA 4NYPA 3TO8A 3CGIA 3NGDA 1FJGF 2V50A 4LSNA 4B9VA 2ZH3A 4RW8A 4RL1A 2RUGA 3LP1B 1VQ9S 3GILA 2CNKB 3GFYA 2ZH1A 5DETA 1PJ6A 1J2VA 3KLGB 2XMWA 4DQIA 4Y28C 3A3PB 2Y0BB 2UXCJ 5DQGA 4CNYA 5LL6d 5E3PA 3EGNA 1HW8A 5H9EJ 1XQIA 1HL6A 1NB2A 1RBLA 5H9EK 5KFOA 5GAHU 1UZHA 1CBKA 5B0EA 3DRPA 3G9CA 1DAXA 2FC9A 2F5GA 2ASYA 3IWLA 1NK6A 1RA7A 5AE3A 1U45A 1IKXA 4H54A 1JLGA 1U1QA 2HFOA 4DCJB 2FY1A 3HVTA 4FKYA 3ZTRA 2XS5A 4K4XA 2WW4A 4RBUA 2ZZMA 1FRLA 4Q45A 1VC6A 2BYCA 5C42B 3THVA 2FVRA 2W5VA 4KM4A 4CO5A 3FMBA 3ILOA 3RBDA 3SZZA 1RADB 3LF0A 2DEIA 3NGRA 1KS2A 4ID8A 4WK3A 1S6QA 3AXMA 3LGHA 1S57A 3PYDA 3KJVB 1Y5LB 2H48B 4NI2B 1G1XA 2ALYB 2HBQB 1DTTA 3EMTA 1EQJA 1X4FA 2FJBB 2GAGC 2WK4A 3H7HB 2BMBA 2DGOA 4USWA 2JC1A 3DLEA 1CQMA 1Y6VA 3AJDA 5J2PA 1PG5B 2CQBA 4PWDB 3R6GB 1MMLA 4F7VA 3T1HF 1N5SA 3CIMA 5EWFA 3QJPA 1BQMA 4B3SF 5B0FA 1UEUA 2XO6A 1KFDA 1D9FA 2Z4PA 3AHPA 5C7PA 1YX2A 3QJLA 2EFGA 5B0BA 4DR3F 1Q8KA 2SXLA 3K5NA 2HAFA 2VB6A 4AL6A 4ZPVR 3IP0A 3NAHA 3J81j 5F8HA 2WOMB 1M5PC 2OSQA 1Q8LA 2MGZA 2CJAA 1F1BB 1P9QC 1TL1A 1VI7A 4DQPA 1N52B 1LXNA 1HBNA 3MFIA 2QO3A 4ER8A 3BKUA 1NK9A 1SI9A 4NCGB 5KFPA 4FKXA 1NLKL 1NB7A 4PG4A 4O3NA 4TN0A 1IBLJ 3QRQA 2FQQB 1RTJA 5LJ3Y 2QZUA 3P45B 2HFSA 1FJEB 2P6TA 1NU4A 1JQGA 3HO1A 2BW2A 2C2OB 4PWWA 2CADA 4ZKAA 1D3WA 4UOHA 8ATCB 3T1YJ 2B5JB 5KFDA 2C2DA 4Y6IA 3CCSS 1NMEB 2BJ9A 5E3RA 4TQSA 2VG5B 1A0OB 1LKZA 4ECSA 2R7WA 3LGNA 2B3TB 3FBEA 4OI1A 2BKPA 4RKUC 2Y8YA 2HURA 2HS4A 2EKYA 3IGYB 4CLSA 4IDKA 2FJWA 3BGOP 2QL9B 1F2GA 2WZ1A 3OPKA 2K2PA 1KRPA 2GQ2A 5K8PA 1J5EF 5F41A 5HSPA 2R7UA 1VQ5S 1VCTA 2NXJA 3D67A 4YOEA 4ELVA 3IBCB 2MKKA 3N0VA 3H2UB 3NKPA 4C8ZA 4GO7X 4PPZA 4KR0B 3UDCA 4LRDA 3ENAA 4QR0A 3T41A 1WJ9A 2V69A 4DV4F 1KVJA 1HD1A 4LSLB 4O44B 1WG1A 2GV1A 2UUCF 2GIFA 4K4SA 4NLQA 2J9DE 1U2RA 3LWLA 4UPHA 2F9DA 3PG9A 1XNQJ 1K44A 2K7JA 3UPFA 3WAYA 4N47A 1KHWA 2YX1A 3DI6A 1EJ7L 3PYGA 5KFAA 1TKXA 5ETKA 2UVRA 3J80Y 3KXDA 3KK1B 3AD9C 1VRUA 4E0DA 1YJVA 3DLLQ 4M1KA 5A6PA 2CJQA 2IDEA 1TVRA 2ZNZA 3NCQA 4UQGA 1TV6B 1X5OA 1IN0A 1Q95G 4Z7CA 3FMWA 3N5FA 2ZE2A 1FRJA 1JX4A 4JI7J 3ELHA 5THWA 4CIOA 1X0FA 4ELTA 3CMAS 3CJ4A 2WONB 3R1LA 2GHPA 5LXRA 1VGYA 4CYRA 1E2SP 2L9WA 4WU3A 5SUHA 1LFPA 3DOLB 4RUHA 1XR5A 3DMJA 5IWAF 3VGSA 3FEXB 1WHWA 3I55S 2W9BA 2VJUA 4URQU 4F0MA 3K8VA 4CCHA 4EEYA 3FKBA 4LIWA 5EGEA 4DV7F 3A8KA 3OTOJ 2W4DA 2HWTA 4U8YA 3OR2B 1KHKA 3NCRA 2Z2MA 1MROA 4R8UB 2HVDA 4OX9J 3H2VE 1HBOB 1U0SA 4M5MA 1UFLA 1Q8BA 3M8QB 3IS9B 4BCAA 2W2OP 4N41A 3P49B 1RHMB 2HQGA 5E7OB 5ETSA 1SQFA 3OFGA 3V6DB 1RWOB 2CUYA 2DNZA 3H5YA 5JVGQ 4ZJQA 1UEVA 1VLYA 1PYTA 2DISA 1CLFA 3E51A 4JI1F 1OY6A 2YNHB 3KD8A 1IXKA 3TEGA 4BLGA 1UTAA 2R3VA 5CYMB 3JB9k 2CG8A 1S1XB 4FPRA 4FVCA 3BZQA 2BQRA 2VKZG 2VL1A 5KFUA 3ZTPA 1EW9A 4ATNA 4K4UA 3I87A 5J1PA 2M8DB 1N34J 1WKJA 4NLYA 1TUWA 1OSDA 2H5JB 4ZCIA 1U1OA 3OTBA 3I56S 2JOQA 2J0QD 4A8QA 1HJKA 1WF2A 3KLHA 1ED9A 3RRHA 1Z4UA 5LMNJ 5D4NA 2KYXA 3NAIA 4ZS6A 2J8SA 4WP3A 3EZUA 1JLEB 5CHCB 2XYPB 3Q2TC 2IIHA 2ATLA 1BGXT 1JXVA 2DGXA 1RHRB 2ZUAA 2FJEB 4HL9A 1T05A 3D2WA 3BYRA 5CZXA 1UPMB 1C0TB 2X1FA 4NLTA 1KWMA 3NOGA 1G3OA 3MR3A 1KLMB 4H4OA 4ZVEA 4LF9J 3C19A 3IRXA 3LXQA 5AT1B 1ROFA 2VG7B 2BJEA 1U8SA 1NO8A 3A4TA 3Q2SC 3ZO7A 4EO6A 3W9JA 2D1GA 4F3OA 4DSIA 2N4CA 1NPRA 4X4UA 4A8YA 5IZHA 2FDNA 2EFVA 2I0XA 1ZEDA 2B4VA 2HQDA 1JLAB 4UOPA 5C5JA 2IJNA 3LTOA 3W61A 2GVZB 2GQQA 3X1LB 4E8UA 1JLBA 1XEZA 3BR9A 4NWBA 1M1KT 3I96A 1ANJA 1N33F 4TY9A 4HHHA 3CF5Q 2B9YA 3OL9A 2HWHA 1PILA 1Q5YA 2F4FA 4F67A 3CDEA 1WHYA 2N7CA 3POTA 2JSXA 1DBDA 2RVJA 2OJ3A 4G1IA 4WJBA 1JXLA 3EJMA 2A10A 1TKZB 1RHUB 2W4PA 1HBUB 3TNVA 1ZEFA 3N6NA 4DXLA 3MAHA 2YBVA 1MWQA 1SJ3P 4CLFA 4ANCA 2MTLA 1UKUA 1VRTB 4P6QA 3HULA 2QEXS 3PW4A 3ILIA 4TLRA 2OMLA 4USHA 5F8NA 5EGHA 3FCVA 4DG1B 4DV5F 2I38A 2VICA 2JDJA 4DSLA 2R2RA 1X31C 1RAOA 4P75A 3HK2A 1IQTA 2DRDA 4FZVA 3PW5A 3WC0A 2Z30B 4JB8B 2IFXA 4A47A 4CO3A 2FHJA 2V8PA 1T95A 4NXMJ 1KKHA 3DLHA 4DCOB 1C1CB 5KOWA 4FDJA 4KGXB 2O5DA 4WPAA 4DMZA 3MTKA 4WFAQ 2PE8A 4ES1A 4C48A 2H9ZA 4I4BA 4DFKA 4DX8H 1FNOA 2ZZTA 3LP2B 3FCHA 2MYFA 4DF4A 3M32A 2CNNB 1VQSA 3EXCX 3AH6A 2RIJA 4NI2A 4ECVA 3OXFA 1KHNA 4DLEA 2ZBIA 2V6AA 3LANA 1FE0A 4ZA1A 2DHSA 3PJXA 1S1VA 1GAOA 1H73A 1BWEA 4YN3B 1RAHB 4O4GA 4DL6A 4RR5A 2UVWA 2JJ4D 2IRYA 2MKYA 5BYRA 2ANHA 3BO4A 3T1HJ 2DCUB 2O3DA 3PW2A 3ILLA 1GMUA 4B3SJ 4F3QA 1F60B 3AB2B 3KJQB 4NPOA 4QU7A 3HCXA 3T02A 4K4TA 1CJTB 1TR0A 4I7FA 2WOMA 3J80U 4MYUA 2NCKL 1TELA 4UOCA 1YJ9S 1IKWB 3GZ7A 3H59A 4OHZA 1OYDA 2HK2A 1S1TB 3UN3A 2VKRA 4U96A 3AXKA 4GTYA 1JKHB 5DM7Q 3H40A 3KLIA 1UMJA 1HR0F 2KG1A 4ZLNA 2OPQA 4EZ6A 4OZ3A 2DNHA 1CS4B 4DV6J 2YKMB 4X4PA 3M8RA 2GFFA 3CC4S 3O3LA 5HI7A 3W5XA 2B5JA 4HDGA 3CC2S 3C6UB 5CA5A 3HVAA 1S6OA 2VQEF 2E5JA 1JWWA 4NZ7A 5ETLA 1VC5A 4OHVA 5L46A 3H0PA 3D3CJ 5AXKA 2XTJP 5L8RC 2Q3PA 1RWNB 3MM5B 4ZCLA 2HNYB 4WK1A 4B08A 1B0PA 2J9EA 4DU7A 3OFFA 1S9FA 4ZHRA 1EW8A 1H74A 2NSCA 5HVFA 3O5TB 1YG0A 4Y34A 3QRPA 1HNWF 4QJVA 3HD2A 2POKA 2BQ3A 2DNRA 4KY3A 4QWAA 5GOVA 4ECTA 3HHLC 1J5EJ 2B7BB 2MEWA 2W9AA 2MDAA 2VOPA 5DLGA 3QWPA 1T0TV 4NEYA 3P96A 2XB2D 2XYGB 3MZIA 3R9LA 4PKDB 1AJCA 3DDNA 2XNQA 2KRRA 2OUGA 2UU9J 2KT2A 2HFNA 3WBHA 2B9EA 2VOOA 4OV1A 5LOQA 1D8ZA 5IM0B 4KC5A 3KMSA 2UUCJ 1S5ZA 5M2PA 1B3TA 2CWKA 3TQ1A 3D68A 3ZNUA 4P7TA 1TL7B 4FF1A 4DZDA 4GKJF 1KDNA 2FVQA 4LR8A 1Q4RA 3MUMP 3QGIA 4CYSA 2LXUA 3BBBA 2VG6B 1YZ7A 2BE2B 1AYEA 1CPZA 2F9JA 3A1YG 3MEKA 3N4WA 3D6FB 2UXDF 5D0HA 2PI5A 1ALKA 5HL7Q 3GFXA 3M8WA 5AXNA 4Y3CA 2DNYA 4AXIA 1R6VA 2MKCA 4YR2A 2BDPA 3M8PB 3DOKB 3C16B 4BDPA 1TK8A 4FYXB 3T5JA 5HROA 2EC0A 1FEHA 5A8RA 2WONA 1FNXH 3MUTP 4UOFA 1M5VC 2F65A 1L5UA 4PXCA 3R2CJ 3C46A 3HD1A 3DOLA 2B8QA 4GKKF 2RAQA 3WAVA 4IO1A 2FHMA 1P6TA 3VZHA 2M70A 4M5KA 2GLQA 3W9HA 3HF5A 1ZA1B 3MM6B 3FSXA 4NRTA 1N32J 1Y5NB 3G6YA 5IWAJ 2V34A 3HFVA 1Y10A 2RDIA 1VQYA 2ZJRQ 3VVUA 3Q8RB 1EX8A 4DV7J 3PV8A 1JNRB 1MNEA 3M8QA 2H65B 1S49A 3IS9A 5ADZA 2MKSA 2MJUA 2Y3YA 2NXEA 5GAGU 1KONA 4EWTA 2XO7A 4JUZA 4YB5A 3NMRA 3V6DA 2QT7A 3RRGA 3GIKA 4ECYA 2CPEA 1RXOB 4J9KA 4FXVA 4ZG6A 3DPCA 2W5WA 4P9SA 1XIQA 1XR6A 5RUBA 1S1XA 1RI7A 1O6XA 3JYTA 1UETA 2V67A 1NXIA 3TX8A 3CMES 3NVLA 3MMAB 3QSYB 3LAKA 2W8KA 1ZPVA 3ENQA 1R0AB 1U1NA 4EFAC 4TU8A 3UW1A 2LU2A 2APOA 2X51A 2PD1A 4DR4F 1GMWA 1LWEA 3LQVA 4QU6A 4LBIA 2AX1A 1UVKA 4IYQA 3TJ9A 4XDDA 1VIXA 3NLCA 2BE9B 1F6TA 4HYKA 1R31A 5A0YA 4ID5A 4D3HA 2OKQA 2GJ2A 5IJSA 1NPKA 1RWWB 2PMZD 5J2NB 2RKIA 1RT2B 1DTQB 2WTFA 4OYAA 5I42B 4OLOA 5GMEA 2VFSA 3L7PA 3S01A 3JQKA 2KDOA 3EGZA 1C0TA 1SL2A 3C15B 4MYTA 1TKTB 1T03B 2QSWA 2BBEA 2YPYA 1KLMA 3D6HB 1VQ6S 4OX7A 5IC4B 4P71A 2RQMA 2RS2A 2I1RA 4C8LA 2QA1A 5GAEU 3G82B 3SIPB 3CD5A 5JJBA 4G65A 1NRKA 4AUKA 3VZIA 3TP2A 4ZPCA 1T8EA 3U1LA 2VBZA 4GVLA 1SVDA 4N8NA 1U8WA 2DK2A 2V2QA 3D1OA 1GT8A 4GC7A 1KNZA 2GVZA 2ZKUA 1HI0P 4B9SA 2F4VF 2R7VA 7FDRA 1SJRA 1SC6A 2MQLA 1AZSB 1AUKA 1QDUB 4NLXA 4K4VA 2UUWA 5DQIA 3QQCD 5KFZA 1FEEA 4LRCA 4ZK7M 4V19X 3QATA 3A8IA 2CZ9A 2KFYA 3R5JB 2HAIA 4F4KA 1N33J 4ED6A 3Q89A 2CQCA 1M90T 2CFXA 1HARA 3OV7A 1TKZA 3KUGA 4YB6A 3MEEB 4F4AA 1SQGA 4G1QA 1OPZA 5K14B 2XMJA 3Q83A 1QD1A 1CEZA 1YDLA 4CLLA 2FJXA 4B3TF 1LW2B 2VASA 3K59A 1IBMF 5KFBA 2MY7A 1WDDA 3IRWP 4ECZA 1UVMA 1Q1KA 4LR7A 5EHHA 4DG1A 3QZ7A 4EYHB 2VDIA 5L1LA 2NYHA 2HHWA 1HNVA 2G4BA 2J76E 2WVCA 3M8YA 3GFZA 2XULA 1PBAA 2W2NP 4MIVA 1ELYA 2CPDA 2BANB 2WB4A 5ETQA 3LUYA 2R2UA 2W8LA 1FK9B 4C11A 4MIAA 3P8BB 2E1AA 1VQKS 1C1CA 4JI4F 1IWAA 1SC1B 3J7AN 3R5AA 2K3KA 3NP5A 4ZIWA 3DFEA 3CO0P 1FI4A 3P5TL 1FVQA 4CTAB 1W2IA 2RH3A 4X4SA 2R7TA 4KGVB 2H3EB 2WCXA 4F02A 2BJ7A 4PQAA 4LF1A 2AYMA 1N8RT 5HK4A 2AYBA 1C1BA 2FLPA 1UP1A 4RW4A 4CYUA 4P72A 1S12A 2HIQA 3HHLB 3CXCR 3GCXP 4G3IA 2HNDA 2C3UA 1S0VA 5JUMA 4OZ1A 1XR7A 3S7RA 3DRRB 2HZAA 4OHYA 2MZQA 1RTHB 4C8KA 2L9DA 3D3BJ 3TZWA 3PX4A 2CPIA 2IYIA 2QL7B 4P7VA 4JYAF 5J1NA 3QWUA 3SSRA 2P9GA 3MECB 3V81B 4YB7A 3UCUP 4OX6A 2NXCA 3ISNC 5I3UA 1T9UA 4ZCMA 1S7HA 3M30A 4IFVB 1HNZJ 3DOMB 3BQ0A 2XMVA 3UD5A 5HP1A 1MWZA 1FA0A 1DRZA 3R5GA 1UVIA 3SEOA 4NE9C 2YNFB 2ACYA 3VWSA 2VA3A 1IKWA 4NMLA 2QJ3A 2H5IB 4B02A 3C66A 3SSSA 3TUIC 4F4WA 5J2QB 4W92B 3OJUA 1S1TA 3O8WA 4HR2A 2PO4A 3G8SA 2MSTA 4Q7AA 1UW4A 2ZHOA 2RHSB 1X8DA 1X4DA 3LW5C 1JKHA 2CNOB 1Y7PA 2KU7A 1DJ0A 2KT5A 1P9YA 4QWBA 1RABB 2V4JB 4K8RA 3R7BB 5DDOC 4HLBA 3RZAA 1CS4A 4DUZJ 4NLVA 4ZPTR 4AD6A 1HR0J 1WG5A 3DRYA 2YWKA 2W5XA 2W8DA 5HJXA 1E6VB 2ZUGA 1HIYA 4ZIVA 1SH3A 4IQXA 4ED5A 3W63A 2DITA 3CC7S 3W9IA 1WSRA 1RTDA 2X3DA 5KT4A 3OHBA 3TZYA 1Q81T 2O01C 2A2CA 5D8HB 4LR2A 1WI8A 4G6VB 2HNYA 5IQQA 3TZZA 1RE1B 4DI6A 2XY6A 3K89A 2DGQA 1G4CA 4MIBA 2HHSA 4ED7A 4UY85 3A13A 2E7XA 2RH6A 1HQUA 1BE4A 3CT9A 5F3ZA 4OI0A 1GFWB 4ANEA 2MXYA 3NBPA 1HNIB 3TAMB 4EYIB 1RU1A 1HWUA 2K8GA 2XI3A 5TJ3A 1WEZA 4USJC 3PW0A 3MM9A 1HNWJ 3M8SA 1Y9OA 1U1LA 2V4RA 1JJ4A 2XMMA 4B3RF 3K5LA 1RT6B 1FNMA 3UD3P 3V4IA 1SQEA 2P6SA 1IKYA 2MZSA 2JFKA 1O5JA 4DQRA 1UAWA 3I0RA 3B78A 4B9LA 2MHNA 2VPZB 4DQQA 4JI0F 3UCGA 2HFUA 1N36F 5IC6B 2MQMA 3T5KA 5K4PA 5GADU 4NLRA 3QIPB 1FT8A 4O4RA 2UZAA 1V6HA 4U6PA 4K59A 3Q8PB 1U2FA 1T9WA 3FSYA 2GC8A 1U48A 3C2PA 1T7PA 3N01A 2W8SA 4QIFA 4B9TA 2VG6A 4GKJJ 3BBCA 1BY9A 2BE2A 4IH5A 2KZMA 1R8CA 1D8YA 4WBFA 1RP5A 2BVZA 2EI5A 1UJ4A 3THTA 2RT3A 3QFHA 4KRWA 2DXDA 3NKYA 2UV8G 2B7CB 4DPUA 2UXDJ 3EE3A 3AOBA 5IV3A 5L1JA 2VU5A 3DOKA 3C16A 3OTEA 1BMQB 2J7UA 3BGRA 4WFBQ 4F2RA 4I2QA 3WX8A 2LP4A 1EQ0A 4WYLA 3VAGA 3CCQS 2FVSA 3CD6S 1SB6A 3QLHA 2D9OA 4G1PA 4OYPA 3BGFA 4K7QA 1CC7A 1RAGB 4YMEA 3MM6A 5AE1A 1R8AA 4NOHA 3W66A 2VIHA 3M2UA 3NNHA 5KFQA 3PACA 2XBPA 3GE9A 3TWZA 1C4CA 1X0PA 2HZCA 6FDRA 2V8DA 3D1HA 3KFWX 2A6MA 2BJ3A 1L3TA 3ULHA 3FNNA 2D3ZA 1URNA 2W9CB 2AX0A 2XS7A 2CYYA 3K5PA 1I6JA 2BR0A 2HVZA 2XC9A 1JLFA 5C24B 4HTIA 3M05A 3NKOA 1S48A 4L3KA 3UO0A 1LWCB 4QPXA 5KFGA 4CH0S 1S59A 3LGMA 3TI0A 2J0WA 2AW0A 2QIFA 2FIUA 2OPPB 2DNKA 1X4EA 2GW8A 4I1TA 2H1YA 4J9QA 4B9MA 2O67A 3HX9A 2HRTA 5IT9Y 2XZDB 1R0AA 2VONA 4WFXA 3PDNA 4RW8B 2HGNA 5M2RA 3BS9A 3ZTOA 3JSRA 4OX8A 1GMVA 2BACA 5KFRA 2JX2A 2IYGA 4J9NA 1KEKA 4K50A 2AJ0A 3PW7A 2GJIA 2HIYA 4RX6A 3GIMA 4DR4J 4FS2A 2QRRA 1KHLA 2KJVA 4F2SA 3H4BA 1CJUA 3BO2A 3IWXA 3DRPB 3PRVA 1DTQA 2HHUA 4MH8A 5I42A 2QLXA 4KAYA 4HH0A 4ZJLA 3FZ2A 1U1MA 1HWLA 2JHEA 4DFMA 4ZMMA 1KH7A 1TKTA 1N4LA 2OAUA 1BLUA 1PIEA 4TQRA 3TVYA 3HVTB 2U2FA 1SBRA 1K0TA 4PEOA 3RTVA 1VQ7S 3BDFA 5KG2A 1SC4B 1G7CB 2BV3A 4PG7A 3I5CA 1APSA 1DY3A 1FD8A 4XO0A 5ETMA 3G82A 3JTNA 3PXGa 3P3DA 3H25A 4X4VA 1ELOA 3TRGA 3CCLS 2RUSA 3KG1A 3MM8A 1HPZB 4U7UD 5E3CA 3CD7A 3WBZA 5BYSA 4LQ3A 4J9OA 5K8NA 2CQ1A 1HQEB 2W7AA 4RBVA 2M5YA 3LH2S 4FF4A 4RUAA 2GMLA 4CXSA 3Q23A 1UCNA 4J9VA 2B9XA 5L1KA 3T9ZA 1AZSA 2E7WA 3DLEB 1NPPA 1N5YA 3M2RA 2QTWA 3QIDA 3QAEA 3IO1A 1EARA 1O99A 3VQSA 4F36A 1BQMB 4OYXA 2D7SA 4M95A 3MEEA 5BYQA 2CNLB 3ZZUA 1ZZNA 3IA0A 5K14A 1MG7A 1ED8A 3PRBA 1A9NB 5K8MA 3ZZZA 2M0GB 1ZA2B 1FJCA 3GSIA 1N6QA 1YJRA 3ENVA 2M9KA 4QAXA 1WF1A 2R8KA 4B3TJ 1QVFR 4WP9A 3FFIA 3DU6A 1NDPA 2WB1D 2CQIA 4UOGA 4WF9Q 5AE2A 2DXEA 4OV6A 1IBMJ 4KPCA 4FXDA 3RBEA 1IBLF 1HBNB 1F5AA 5HANA 1N5VA 3MGJA 3WX4A 4ZITA 4DCPB 2RU3A 3MF5A 2CG4A 1S0OA 4QZVB 2G0CA 4BC7A 3VGVA 2C2MB 1Y7AA 5EX3A 5E3AA 1ITPA 3H5XA 5F0WA 4KB7A 3DKDA 3W65A 2YXLA 1Y3JA 1R0BG 5B0CA 1TMJA 2PMWA 2RRAA 2QA2A 1N2LA 2RQCA 1SC3B 3GG0A 2G2OA 4IFYB 2NYIA 5KG6A 1R43A 1RLCL 3FZBA 4B56A 4EUVA 1R89A 3V6KA 2AEJA 4JI3F 2JC0A 2DBBA 2DT9A 2DH9A 1P1LA 3M1VB 4GVBA 3KJFB 3HDSA 2MY8A 3OFEA 3KHGA 1U24A 2Q43A 3B8HA 4P2MA 3VAIA 2ZBPA 2R7XA 4K5SA 2EXUA 2VODA 4ES3A 1SUQA 5LRMA 3OT9A 3DRRA 5F0UA 2PEBA 3W2WA 1RTHA 1YBAA 4L74A 4DL3A 1ZAVA 3GMGA 1WG4A 4ZVQB 5LM7E 1SL1A 3TX0A 4M94A 1HQ2A 3T6BA 4F26A 2A6OA 1NDLA 1WSVA 1L3SA 4IFVA 3OD2A 1EI6A 2G9OA 3NL0A 4QR2A 4DQSA 4NA2A 1ZS6A 2QC3A 5IS2A 4R5PB 3NG8A 1T9XA 5EX0A 4FYVB 4HACB 4KO0A 2ZBQA 4HEA9 5J2QA 3ISZA 4NA1A 3OQ2A 4V1Ak 2R8GA 2VD3A 4ECRA 1K47A 5H9FJ 5HLFA 3A3NB 5I4MA 1RWXB 4PWUA 2ZM6F 3CCWA 1VRUB 5DGAA 2K06A 5H9FK 2V4JA 3B5QA 1ZM9A 1TK0A 2YQ0A 3T00A 3EPIA 5HATA 1NCLA 5LXYA 5DDPC 4AL5A 4OYOA 1CVJA 4LBPA 1Y4ZB 5J2MB 3ISND 4OZ5A 3GFHA 2E1RA 3DN9A 4C8YA 5KT5A 2VC0A 3DGPB 4X66J 4PUOA 1URAA 4NL5A 2JEIA 2OI2A 3HKWA 3TUJC 4YDDB 2BRLA 3X3UA 4DN0A 2W2PP 1RWPB 1WC0A 3DMJB 2CQ0A 2W9BB 1ICEB 2V63A 1FXDA 3PJ9A 1CC8A 2VPYB 2EK1A 1HNXF 3N79A 4ZPDA 1O0PA 3CJ5A 3TAMA 4L73A 2IVYA 1EKRA 1U26A 4C8NA 4YR3A 1VQLS 1LW0A 1MROB 5LSRA 1X4GA 1YHQS 4IG0B 2KXNB 2IM2A 4RUBA 1RT6A 3NY0A 2E5LJ 1MLAA 4WZMA 3O1LA 4OJGA 1U4BA 2MQQA 4WKYA 4B3RJ 3OTCA 4OZNA 3FRZA 4AFFA 1EW2A 1Y3KA 4M5NA 2N3OA 4DR7J 4GRSA 3KTQA 5IT9U 5FDLA 3VF0B 4LFBF 3QIPA 2AZ1A 4EI2A 3W1YC 4DV3J 4JI0J 2CPJA 1N36J 3AODA 4GMKA 2YWFA 3I5AA 4BWJA 1L3VA 2ASLA 4P2SA 3TG0A 5KFMA 3M6XA 1W7WA 2NXUA 1DLOA 3R97A 4DX7A 1SCJB 2AYEA 2BOPA 3G8QA 4C7QA 3SV3A 3HSGA 2MZJA 4DWIA 1OIAA 1BUXA 1Q0NA 4KFBA 5HVHA 1KBRA 2J9DA 3GR1A 2WHOA 2HQCA 3SCIE 2IAJA 2GMHA 2M2BA 2QA4S 2DR8A 1URRA 4OZ2A 5CABA 4DL5A 1D9AA 3IM8A 1EJJA 1VISA 2HWIA 1VC0A 2IBKA 1NK7A 1FDNA 4C97A 4YQWA 1M0SA 1FFWB 3ZFVA 3IC1A 4R25A 2Q66A 2ZNYA 3J7ZT 2ACMA 3IRXB 3LPEA 4B3OA 3I9V9 1FX2A 1OSCA 2C22A 1FDBA 4BWMA 5LRNA 3HSZA 3N9UC 3L4BC 3D66A 1GH8A 3CJ3A 1WF0A 2YNGA 2V8VA 3KHRA 1LXJA 1T9YA 2Z56B 2MSSA 5KOXA 3CDUA 2AEMA 2W9CA 2NLWA 3I4PA 2Q1LA 4RNOA 1IR2A 3VAFA 5T14A 1AT1B 4EO8A 5B0DA 3CTRA 5HRTA 1Q86T 1JJCB 2IMOA 4NZ0A 1LWCA 4Q43A 1JLBB 5AJ9A 3L7UA 2IVFB 4Y2MA 1YJUA 4B3MJ 1NSKL 3GV7B 2NR0A 2OPPA 2FJDB 3TYTA 3FDSA 2BUNA 3F56A 1SKWA 2YTCA 1X5SA 2UVVA 1XN9A 4EBDA 4J9LA 2LECA 1S4EA 3VAKA 4QIEA 5EWGA 4KHRA 4X62F 3WQPA 2B4OA 1FWPA 1RWUA 2PT0A 1W25A 2VDHA 4DDFA 4DR5J 3B54A 3K0JA 1JXEA 2Y1LB 2AJ4A 4PXDA 1FRMA 2GGPB 1HFEL 2IPOB 5LMUF 3H5UA 4OFZA 1F5BA 2Z2LA 2DJWA 2DNMA 3A8JA 1TUVA 1AJAA 4RZRA 2EG2A 3D6TB 2DTJA 2PA8D 2XNRA 1KH9A 2NPFA 2CQ3A 4LF8J 1F9HA 3KUEA 2XS2A 1WEXA 1WNEA 4NXMF 3OLAA 1MU2B 4OIXA 4MKYA 3MEDA 3ILJA 4KJIA 4UZBA 2ZBCA 3M2VA 2ZD1B 2V9KA 4KPYA 3P6YC 1KFSA 5MAOA 2MZ1A 1JB0C 3RAQA 4UT4A 3GJQB 4OHWA 1LOUA 3AY0A 4C3MA 2J5AA 2M4MA 4IUFA 1DQAA 1N5TA 5F8GA 3GV8B 2IA6A 4F4ZA 5GMDA 3VCDA 4B17A 1HPZA 4PYDA 5KFVA 4MTPA 3PEJA 4WTYA 5DJBA 3BO3A 3M32B 2CZ4A 1HWKA 1JIHA 1HQEA 3TANA 2H51B 4E2FB 2QYCA 3RBXA 2N4DA 4FYYB 3TARA 1VBYA 4NA3A 4K0KJ 3MURP 2NSBA 3BPSP 4LBHA 1HKAA 3ZZYA 4M5DA 2W1BA 1RTIA 2QMUB 1YSJA 3W7BA 1S1VB 1OWXA 1B70B 4A8OA 1U6BA 4EU0A 2CXEA 2QG9B 4O4GB 3S6EA 2LA6A 2MKIA 5T41A 1KTQA 3MMJA 5DZ7A 1KVKA 1IM4A 4KKOA 3CPWR 2K1RB 5L0EA 4J9RA 4I6AA 1AXQA 1XJWB 2HK3A 2DGVA 3IG1A 2MLYA 1C2PA 5F3TA 3OVSA 2KM8B 2CJXB 1MMNA 4CLWA 1Q7LB 1T02A 1IKVA 2VFTA 2W01A 3PVXA 4I7FB 3G6XA 2P2CB 4DV1F 4FBTA 4LF7J 3RYLA 1YQHA 2UUAF 2B43A 2JNJA 2LA4A 4ZVSB 4F25A 2AWZA 3NEKA 1H3DA 2BM1A 1WOSA 3DDKA 4PRFA 3UN2A 4DV6F 5FLXY 5KG1A 1HMVB 2B4UA 3KLIB 4CO1A 3CCVS 1PAEX 2OPQB 1R8BA 5CCLA 1KHVA 2ZJQQ 2EBGA 3GYGA 1RYRA 2LDIA 5KG5A 1OYEA 5B0GA 1IUJA 1PC4A 4IFYA 4DEZA 2C2ZB 4HI1A 4FBUA 3I82A 4J9PA 3BN7A 1RQ0A 3QBCA 2KB2A 3ZZPA 2AU0A 4QIWD 1FKOA 3M1VA 2QGFB 1F0XA 1A6LA 2JLFA 1IBKF 2M7SA 4QCLA 4ZHRB 3CW2C 4JI3J 1XWLA 1SIWB 2HZVA 3V2UC 3UDEA 3SYZA 2ZZNA 4IOBA 3PX0A 1S79A 2PEHA 1IWGA 2IHR1 4BC9A 1A7GE 2BJ1A 2D3OR 2OIHA 2UU9F 2E29A 1BD6A 2AHOB 4WFZA 5A8WB 2M88A 2ZH4A 3K5MA 3GSDA 1REGX 2HHTA 1NZAA 1X4CA 2HQIA 3GJRB 2FPHX 5HBMA 4ES2A 3TJ8A 5KFIA 4FF2A 2PIIA 2KO1A 4CLKA 1U47A 1Q53A 2JVRA 5HN0A 4R5PA 4NLWA 1JJ2R 4IG3B 3R1HA 4C8MA 3FGVA 1RBOB 4RNFA 5CAAA 4HACA 4K4YA 1F9EB 2B6AB 2RNEA 2HHQA 3HFZB 1UVNA 3IR5B 1ALIA 4X4OA 4J90A 2FZGB 3TUZC 1WOPA 1S99A 3OXGA 3G6VA 3UR0A 4WIIA 1L3UA 4A8WA 1U7LA 1CSJA 4W98A 4XK8C 4WCEQ 3UVJA 3PHEA 4DPTA 2VFUA 3CEDA 2ZM6J 1QAXA 2KN4A 3GIJA 3W8GA 2Y9HA 4TXSA 4KHMA 5J2MA 2DYAA 3D1QA 2LKZA 1QTNB 4HVZA 5GMKa 1RKIA 1TQLA 1KD1T 4X4RA 5HROB 5DM6Q 2EVZA 4URGA 1IQZA 5A8RB 3DGPA 3M9MB 1GTHA 2DEJA 1ZYQA 2E7VA 1GQEA 2QE5A 3E2EA 3CCRS 1HWJA 3HT0A 1N32F 2FHKA 3MFHA 3D0HE 1NJZA 4USKA 5F8MA 3TA1A 4RPFA 5G0RB 3GB0A 1X9SA 4K5RA 2J9CA 2E1MC 2LYVA 1HHQA 5CYQB 2Y1JA 1HNXJ 2W7PA 5E0OA 5DQHA 2ZVIA 3EM1A 4IG0A 1F5CA 3Q8YA 1KOHA 5IJQA 1I5OB 1TAQA 4I68A 3QO9B 3KMQA 5F9LA 2G13A 3HHDA 1QLNA 1RISA 2OP5A 3BKFA 3MMBB 3EPGA 3CJKB 3R8YA 1U1PA 2RJZA 3TJAA 3VHQA 3D0IE 4WIQA 3SQGA 3NKMA 2JWNA 2FD2A 4HKQA 4QYZJ 1I1GA 5KFSA 3EGVA 3OL8A 4FN5A 4AE5A 5T7LA 4GC6A 1EAYC 4QYZK 4FXWA 2JEFA 2E9TA 3JYTB 2OPRA 3AD7C 4Y65A 4LFBJ 3JQMA 4FYWB 1SV5A 3D7SB 2P9CA 2F8MA 1LEOA 3PTWA 1LWEB 1S1UB 2YH0A 3D9BA 3T5HA 3EVMA 2V0NA 4TN2A 2KL8A 2ROEA 2GA7A 1VQMS 5E33A 5A0YB 3G96A 4ID5B 3PM9A 3DHWC 4CXKA 3FBCA 4DU8A 2GJFA 1FF2A 1GTEA 2MKHA 2YKAA 1EB0A 2KVIA 2RKIB 3BPDA 5KFTA 4Z37A 2DO4A 1B0TA 2DVIA 2QLBB 3QGGA 1BC6A 3K57A 4DSJA 1WORA 1AFIA 5KG7A 4GTXA 4CZCA 2DNQA 4MIWA 2QL5B 4Z7YA 4DX6A 4J7CA 2QN6B 2A0FB 3TZXA 4W4MA 1VDHA 1VJWA 5KFXA 1AW0A 2VQFF 3RB3A 4NCAA 2YWHA 4NASA 1VHFA 4N5SA 2RHQB 4L72B 1SJFA 1LWFB 4IOCQ 4U7UK 4HT7A 1HDHA 3PCOB 1YJWS 3PEHA 4ZDNA 1HW9A 4R0JA 2C3PA 1RT3A 2AIRB 4ZLPA 2W2QP 5KFWA 3BQ1A 2AQ4A 3LA0A 2PGCA 2LQ5A 3M4XA 2AMCB 1ALJA 3VAHA 1WC3A 3KKFA 3BB5A 3IGNA 3NGKA 4ECUA 4PR6A 2FC8A 4IOAQ 5CXTA 1ELXA 5IT0A 2W5TA 4ZVHA 1SL0A 4ZVGA 1O98A 3QFWA 4CP5A 3JTOA 2OEJA 4OLPA 2J0XA 2GVDB 4MJKA 1QM9A 1TP7A 3M6UA 3BM7A 4G1QB 5ETRA 4DN9A 4JI8F 3OBIA 2FGOA 4NLDA 5HVGA 1VK8A 2JEJA 2VJVA 4X62J 2GGPA 3BGUA 2GIQA 2MQOA 2B9WA 3DRXA 1HQAA 2QLFB 2LXFA 2W5QA 1RWVB 4OZJA 5AXMA 4OL8A 1O51A 2WVBA 4YDXA 2CQDA 3CWJA 4X65F 4QWCA 3SMZA 1HNVB 4XIUA 1VBXA 5LMUJ 1C0UA 2OMOA 4AYBD 2NQPA 1MU2A 1BQNA 2R8JA 1VMBA 1AJBA 4TU7A 2ZD1A 1IBCB 4KH1B 2J7KA 2V2ZA 2GO9A 3JSMA 4DHVA 4X64F 4N7TA 4C11B 2J8AA 3NKNA 1XMQJ 2XI2A 4IR9A 2LQBA 3GYXB 5CQGA 1RT5B 1FWLA 1J5OB 3N6LA 4J9UE 2LDYA 4F8RA 5DLFA 2QYGA 1KH4A 2ZH7A 3HHKA 4ITSA 3BREA 4XTTA 4JI5F 1X9WA 4URSA 2ABYA 2H4WB 2ZOGA 4F4YA 4DR2F 4MKVA 1OQ3A 4C98A 2E5HA 3BDPA 5KG4A 1C1BB 5HJYA 1G6BA 3PIOQ 4RW4B 2L9NA 2KHDA 4K4ZA 1KSPA 4CYUB 1LQ9A 3TW0A 1HD0A 2OEMA 3VTIA 5CZVA 2IM1A 3HM9A 2HNDB 4LUBA 4N56A 4UZCA 2WVDA 3MUVP 1RYSA 2DH8A 2MPUA 2NS1B 2RQ4A 3UN5A 3DC2A 2KXFA 1OY8A 1NH7A 1P1TA 1URBA 4LVNP 4UW2A 2WRMA 2WVEA 5LIAA 3W3SA 2YX7A 1ZTTA 4Q0BA 1HNZF 3MCOA 2EPIA 2K1RA 2LVWA 1ZETA 5A2QY 5I3UB 1H0HB 3DGVA 2HLTA 2KXHA 1ELZA 1RACB 3M30B 1DARA 2AD9A 3T5LA 1SPBP 3DLJA 4LR9A 4EMDA 3TUPA 5HP1B 1RT7A 3MWBA 4JV1A 1S6UA 4DPXA 4ED4A 2Q6BA 4ZVRB 5KFFA 4UUXA 3W5YA 2U1AA 3CUNA 2QLWA 4LF6J 2ILYA 1K9MT 3W62A 4DV1J 3KLFB 2RSQA 3GG1A 2UUAJ 1NK0A 4NX9A 4DUZF 2CDRB 3EWGA 1HMVA 2FB0A 5K9FA 2FHOB 2HGMA 1BXNA 2ZDOA 2Z58B 2V68A 1WHXA 3PFOA 2DNOA 4CLYA 2L08A 2ZH8A 4DSKA 4XDCA 3JS9A 4BS2A 2VA2A 3V5RA 5K5MA 2VFRA 4RO0A 3PRDA 2CJBA 4LT6A 1MMDA 1VQNS 3ETMA 2BOAA 1NDCA 1Y5IB 3R7NB 5D15A 4Y00A 1AB8A 3SBMA 1PBUA 1RDRA 2CJYB 2OH2A 3G4SS 1RTDB 1VBKA 3AA8A 2FUG9 1QE1A 1TZ0A 1PGZA 3TVZA 1NK5A 1NJIT 4LFCF 3FSIA 1B7YB 4EK2A 5CD4A 2HFZA 3R6LB 5C66A 3Q8VA 1T11A 1U1KA 1HQUB 1IBKJ 1FDAA 3DLGB 4KYZA 4O3PA 2R2SA 3LO3A 4PXBA 4ZVTB 3NBPB 2F63A 3DYCA 3CJSA 5DLVA 3CCMS 1RCOB 2FJAB 3MMCA 4QOTA 3MM9B 2DIVA 2AKWB 5JXSA 1EZZB 5A8WA 1WACA 3RB0A 2P5VA 3ITHA 2ZH2A 3V4IB 4RBTA 3KJNB 1ZZFA 1IKYB 3TAQA 1UPPA 2B56A 5B7WA 1ZM3A 2YWEA 3I0RB 1H7WA 3G87A 4IG3A 3RRKA 5ETNA 1B0VA 1BWVA 2B6AA 3BV8A 2NPIA 2OHDA 4H4KC 4ZP9A 3HVRA 1QSSA 2AJ1A 4C0BA 1XTZA 5KFKA 1TL5A 4O3QA 5DG9A 4HDHA 4F50A 1N48A 3R7SB 3QYYA 4M5JA 3ZNJ1 3ENWA 2X98A 5J1EB 4MK8A 2RQKA 2E44A 1NHVA 3ZC4A 2ALZA 4D3GA 5AXLA 2YKNB 4NXNF 3GJSB 3QT5A 3EVWA 4DZ6A 1YITS 1TKDA 2FY8A 4NMXA 1WOOA 4M5GA 4Z2XA 1KP6A 2ZDPA 3KNGA 1QVGR 2I5JA 2LQ8A 3ZZTA 1YTYA 5IFMA 3BGRB 4J5OA 4I2QB 3OLBA 2HPUA 5AJ3F 4DR1F 2HBRB 2NZCA 1KTVA 5IT4A 3KDNA 3MCSA 5KTQA 1S0NA 3R27A 1FESA 3DNCA 1J27A 4J91A 1YI2S 3IDDA 3QLHB 5I3QA 4DV2J 4ZP6A 4TYAA 3QGHA 2FZCB 2IC3A 3WHIA 3A12A 3VALA 2V5HG 1XC9A 4K2JA 5G0RA 4DS4A 3GONA 3H90A 3M2UB 4KGMA 4DF8A 5CYQA 2XG8A 3CCJS 1FTRA 2XHWA 4IRKA 2XSJA 4RW9A 1GX5A 4NWJA 4RW6B 2DGTA 4BBYA 3GR0A 2F3JA 2GCFA 3L95X 3QO9A 3T6JA 4RW7B 2IM0A 5DDRC 4ZJOA 3SDEB 4KTQA 1RK8A 1JLFB 4MK9A 3ZZRA 4O3RA 4TLQA 4NLUA 4KT0C 3MMBA 3CJKA 2W5RA 4C6AA 2CVIA 4C0HA 3M9OB 2MZTA 3CO9A 4ZVUB 4XPCA 2DCLA 2QZ8A 1REVA 2NUUG 1GEHA 2CIMA 5KG0A 5LSOA 1W26A 4HI2A 1HHSA 3T9NA 4C0OC 2Q6CA 2IMWP 2J0SD 2C3MA 3JAMY 5ETPA 1YZ6A 3UD4P 1QAIA 3AD8C 4RNMA 2V2VA 3JTPA 3QNWB 1S1UA 1FE4A 5D4PA 2D41A 4KV8B 1PSDA 3D54A 2UP1A 4YY3F 4DPYA 1JLCB 2KFZA 7AT1B 1CJUB 1ULRA 3DM2B 1FHTA 4LQ9A 3MPYA 3HFKA 2EW9A 5HMZA 2EFNA 2EKNA 4N77A 2HMIA 3MR5A 1QJHA 1ANIA 4Q2MA 3MM7B 4C9DA 3G71S 3HP6A 7FD1A 3L7OA 3UWTA 3N5BA 1JMTA 4LREA 3MCNA 2A2DA 1WD6A 2YQ1A 1I94J 3RR7A 1P27B 2XHCA 1ZBTA 3K17A 4NYOA 3MM8B 4M5LA 1LWFA 1CJVA 2VQFJ 5A76A 2IJFA 3CVKA 5KFEA 3UQSA 5C2GA 4AT1B 2EEYA 2VHGA 4ZN1A 2ZKTA 4QIGA 4EGLA 2C2EA 3GIIA 1VK3A 4ZLJA 2OD4A 1N5YB 1B8JA 3M2RB 1FFSB 1ZOTA 4DL4A 5A2QU 1RZMA 4FNIA 4DFPA 1RT1B 2GHVC 1TAUA 2GVDA 2HFVA 1TL3A 2N82B 1ZAWA 4DUYJ 1B7FA 3NXZA 3NS7B 2CRLA 4ANDA 1X4AA 3HHEA 4CLZA 3G6ES 1T9TA 2YPZA 1LNQA 3AOCA 3MEGA 4I6WA 1N6QB 1RGVA 4JI8J 1N0VC 3MK1A 2CDQA 3FFIB 3RBZA 2IDLA 2HVIA 3IBWA 1DQ8A 1C4AA 1CJKA 4WTOB 3UNGC 3UNYA 3EVOA 1IR0A 3EZ5A 4UORA 5KFCA 2XRGA 3K5OA 3FQKA 3CNQP 4KGZB 1YKWA 4X65J 4CNZA 3MK0A 1G2EA 3Q8QB 1Y0HA 2V94A 1Q8IA 4ECQA 3OUYB 3QGPA 1NSPA 1QAJA 2ADCA 3NS6A 1RAEB 4Q44A 2EBEA 1KN6A 1XNRJ 1RT5A 3CJ2A 3J7A1 2FYXA 4O0NA 1VFJA 2LEAA 3IM9A 1J5OA 2GA3A 4TY8A 1KQKA 4X64J 3IR7B 2HRYA 3KUHA 1MSWD 2CPYA 3A52A 4IH7A 3RGIA 2CPXA 1SH2A 1RT4A 1X5TA 2MHEA 3DRSB 2DY1A 3OHAA 5EWEA 4JI5J 4GVBB 4MFBB 1XMOF 2GSUA 3A8EA 2IY5B 1O8BA 4DR2J 3BKTA 1KC8T 3OR1B 2COLA 1R8PA 3GYNA 4ILRA 3B6BA 3N28A 5A8KB 1SUQB 4GTZA 2B51A 5EUHA 3GQCA 1N5QA 2ZEJA 3W2WB 1LFWA 1SHQA 4YEAA 2Z0GA 3AFGA 2F40A 2HNZB 2IRXA 3ETOA 2HBYB 3IWNC 4WE1A 1FKPA 2CQHA 1PYOB 2KYZA 2XMAA 2QFIA 1TMMA 1K0VA 2NXNA 2WBMA 3RUBL 3PHTA 1D9DA 2YQ3A 3ICLA 3JQJA 2CJ9A 5D0EA 3DYAA 3CDAA 1F2HA 9ATCB 3J81Y 1FRXA 2MJNA 1WC4A 4USIA 1Z2ZA 4QPTA 2KRBA 3H42A 2IM3A 1EP4A 2IFYA 3D0GE 1S9EA 4CM0A 4KO0B 3OSNA 4B9NA 3HJFA 1EETB 3KK3A 1Y11A 2C3YA 5DLTA 5KT6A 1R3NA 3NMAA 3KLFA 1VRQC 5HQMA 3E01B 5HLFB 4P73A 4ZP8A 1WC5A 2VPXB 3MTJA 3BDHA 5D4OA 3MAAA 1YJTA 1YRXA 3NGSA 4S0MA 2QX0A 1RHKB 2ZWOA 2W5SA 3EDQB 3Q0AA 1PO6A 2IUCB 5D3GB 3I5BA 1R7IA 2MKJA 4I2PA 1UVLA 2B8PA 4OZLA 4X66F 3CCZA 4WFYA 5L0BA 4MKAA 1S6PB 3CE8A 2LQJA 4U7CA 3TOQA 3T3FA 4TU9A 2EWHA 2AJFE 3HSJA 2KZZA 1XMBA 1ZM4A 3I32A 4PUOB 4Y2KA 3C6TA 1VS3A 3PJWA 1VQPS 1HBMB 3C3LA 4OI4A 4CRJA 2CKWA 3VR1A 1RU2A 1RLDA 3U7JA 2DB1A 2OTLS 4LFCJ 4LF4J 1TFYA 3DLGA 4JI2J 1RWKB 3CCUS 2ZFHA 3KDOA 2DR9A 3PYEA 2E1PA 2VPWB 3IFEA 5F8JA 2E5LF 1LW0B 2KKHA 3R5BA 3HXMA 3L09A 1B64A 2OLWA 1WKKA 2QSFA 3EICA 1OY9A 2BZ2A 1NKCA 2N3LA 1Q78A 1SIZA 3MPDA 2JLEA 2D3UA 2HRUA 2ZVSA 1S77D 2AZ3A 2MZRA 4DR7F 3DHXA 2AT1B 3O2IA 2JVOA 3BR8A 3LP1A 1HLWA 1UFKA 2AF6A 3PYFA 4MK7A 3L3CA 2LCWA 4DV3F 5SZTA 2HS3A 4AL7A 3KLGA 1FJGJ 4OMFG 4JBCA 5FDLB 1WC1A 2XLIA 5IV4A 4HHJA 3RU0A 1QAYA 3JAMU 2FGCA 2XGQA 1NJXA 1FD2A 2PI4A 5J1EA 1NAQA 2CQGA 1WHVA 2OSRA 3W2VB 2YNIB 1WEYA 4X4TA 3IMQJ 2YKNA 2Z2ZA 1YRUA 1DLOB 3HHLD 4ZPBA 4IR1A 2ZBRA 4OI6A 4KE5A 2DR6A 3MDFA 3WAWA 2BXJA 4IO9Q 4OI3A 2IA0A 3TQEA 1RSCA 4LJMA 1HI1A 2V9WA 5A6WA 4NXNJ 1DHMA 2G9YA 2WW8A 4KFBB 4LFAF 4TKTA 4IRCA 5C42A 1KR4A 2JZ5A 2X1AA 1M5SA 2IAJB 2BM0A 4DPWA 3E2DA 1S9GB 4YFUA 4FYDA 4QWDA 2LU1A 5AJ3J 3UE2A 4DR1J 4CI0B 4QWEA 3M8ZA 2IRUA 4CT9A 2CPHA 3TAPA 3Q3QA 3KJVA 3KG4A 3CJTA 2RMLA 1XBWA 2RE1A 3FK4A 3VGTA 2R42A 3S1TA 2ZHAA 4B3OB 5FIIA 1PAUB 4KAVA 2R8IA 4LVOP 4RW6A 3NKQA 2YNGB 4PWDA 3RB4A 1NKBA 2GSOA 3K58A 2AJQA 4DV0F 3EYZA 3MOJB 3KLEB 4DBQA 4TVAB 4RW7A 2KI2A 4B3MF 3SDEA 3Q8SB 1S97A 4QW9A 3FCWA 5LSLA 3TA2A 3HPOA 1FXLA 5GAHI 4A8MP 4CO2A 2QMWA 3PR5B 5F8LA 2ERRA 2BE7D 2H4YB 3PZPA 1DQ9A 2NUHA 2XY7A 1SH0A 4YB1P 4IKAA 4N76A 4DR5F 3CJQA 1V5VA 2GHWA 4DR3J 3ZTQA 3FVYA 4WXOA 1GXTA 4ENOA 5LJ5Y 1FERA 4DFJA 4M63A 2R9LA 2UUBF 3B4DA 4NCGA 2CJKA 3K7RA 3CJ8A 2XWYA 4UQTA 2XYHB 1M5OC 1V3RA 1IJEB 2V8HA 3HI9A 4KV8A 3KYLA 2CQ4A 2R7RA 4LF8F 2DHAA 1FRHA 2KT3A 5D0RA 1JLCA 4ZG9A 2RILA 4R0EA 8RUCA 3CD0A 1ZM2A 2DNLA 2H54B 2X7IA 1RHJB 3U02A 4YY3J 2KFNA 1TU0B 5DRKA 3DM2A 1SKUB 3MPVA 3ZZ0A 1MWYA 2VG5A 5D6GA 3SCKE 2C42A 3MEDB 5HMXA 2X3GA 3SXLA 2ILZA 9RUBA 1K1SA 1HA1A 3F0NA 1LK5A 3M2VB 4ZLLA 4ZPWR 4WP8A 4PG8A 3MM7A 2L3MA 3N6MA 1EHWA 5IQ6A 4WXWA 3JXOA 3CMQA 4DLGA 1V9OA 2BJ8A 4Y0FA 1D1UA 2MQNA 4MAKA 2JEGA 2V4QA 4F0KA 1KH5A 2E5IA 4FPIA 2AJ2A 2DPJA 3IGVA 1UWBB 2FLNA 4ED2A 3NGTA 1K1QA 3CJRA 1RAIB 2MB0B 1TL4A 4K0KF 1UWAA 1Q5VA 3HHNB 3QAUA 1U6FA 4PG5A 4KJDA 3QT6A 3BSAA 2C2KB 4M5DB 5C25B 1ZPWX 2G0IA 4LSLA 4O44A 1RTIB 2GNKA 3HMJG 2DO0A 3GWCA 3D4JA 3P4UB 4DV4J 1CULB 3FC9A 2Y0SD 4KIAA 4O3SA 3MHYA 4L76A 2L48A 3RJMB 2XMKA 1RT1A 1Q79A 5KT7A 4CLPA 4ZN3A 3AT1B 4KKOB 4L75A 3J81U 1WDTA 3NWGA 1S72S 3H2LA 1WTFA 3KK1A 1U02A 3IG1B 1FXRA 1SXLA 2AGPA 4ZP7A 4LF7F 2HVEA 4M8LA 3PKMA 2PA3A 1IKVB 2W4CA 1IJFB 2E9RX 5GVQA 3LWMA 1TV6A 1GXUA 1JLQB 3BBFA 4HT5A 2BW7A 3GV5B 2MQ8A 2GSNA 3O44A 4B9UA 2H5EA 1T3OA 4WYWA 2XGPA 2XLJA 3PR4A 3OUYA 3T01A 3HJVA 2Y8WA 3SFGA 1W2BR 3KHHA 1UZDA 2D69A 2O66A 2JH3A 2Z57B 2XCPA 3MR7A 4PCQA 4UUWA 1UVJA 3W64A 1AUSL 4CT8A 4YUDA 4ZPAA 4KHPF 3NCPA 3OW2R 4RU9A 4J37A 3HZGA 3MXHP 3H98A 2HHVA 4UOOA 3C14B 3OR2A 2OO4A 3DRSA 2IVMA 4PAAA 4C2MA 3V6JA 4OYZA 1WI6A 2ROPA 3RR8A 1FKOB 4QBUA 4MFBA 4R8UA 3F44A 2LEBA 4A8XA 3U1NA 3HZEA 1HBOA 3OR1A 1NHKL 2ZHBA 5A8KA 1NHUA 1XMOJ 3EGWB 4OQJA 3ZZOA 4Q8EA 4AXJA 3D5MA 2LFVA 3AOAA 3NS5A 2HNZA 1R27B 1ZEBA 2G2YA 4LF2A 4LMZA 2HKEA 2RRBA 1SKRA 4OYMA 2XEXA 2YNHA 3DXBA 1RCXB 4ETXA 4JI1J 5CYMA 2YKPA 2Y1RI 4RNHA 2KTQA 3FQLA 5HBMB 2HVHA 4IRDA 1CQNA 4WU2A 3ONQA 4NEZA 4FDFA 3CCES 3AJ2A 1E6YB 3JSBA 1BQXA 3DXSX 5KFYA 4ZVFA 3WC2A 3AB4B 4C4WA 5U47A 2FTRA 3SFUA 5KFJA 3LOUA 2DY9A 3BGLA 1YWXA 4NCBA 4FNHA 3MD3A 1EETA 1R8HA 4BHQA 5D4LA 2KM8C 3U27A 2A1BA 4U95A 4X2BA 2HYIB 2I2YA 1OPIA 4UTGA 1U1RA 2E5GA 2C2RA 2HEKA 4FS1A 4P52A 3E01A 3FUYA 2BKOA 2FLLA 3EDRB 1P49A 5HO4A 2CZVC 1JLEA 3LAMA 2HSEB 3FRYA 2PSZA 3UVJB 1ACMB 2PFDA 4I6YA 3OL7A 3KWMA 5M2UA 3BH7B 2BKNA 1RB0A 2IUCA 5D3GA 4CLUA 1YRTA 4CH1A 2C1EB 2ROGA 4CWBA 3R5CA 4QYRA 5BJRA 1S6PA 4DL7A 1ALHA 3CSKA 4KAIA 1NZ8A 5F9NA 2XMUA 4PXEA 3T19A 1Q7YT 2HHPA 2VG7A 2YVSA 2BEFA 4ETZA 2GS8A 3GJTB 5ETTA 5LQQA 4DX5A 1RUSA 4ILLA 1HBMA 1TUGB 2UVUA 2BABA 2KJWA 1U0HB 5E5NA 5KXAA 3U1MA 1JLAA 2WSEC 3BDGB 3CJ0A 3OVAA 2J6TA 1H2VZ 1S10A 3KK2B 1IR1A 4F0HA 4JV5F 2CVEA 1X7VA 4P2XA 2X1BA 5MLCV 5DLWA 3PKYA 3E3XA 2VBXA 3QPIA 2W2MP 2RDJA 4UY8T 4ZVOB 4O0IA 3MPWA 2UUTA 4P74A 3AJ1A 2ZWPA 3K2YA 2K7KA 4U8VA 3HVWA 4ECXA 2AEFA 4PQUB 1RWMB 2B0GA 3Q24A 1U6ZA 1K73T 4M5IA 4A8SA 1HBUA 2HS0A 2ZH5A 2JL9A 2DH7A 5IXUA 4KQZA 2BQUA 3BF4A 3SQGB 4C3LA 2MQPA 3FEYB 2XMTA 2HHHF 3Q22A 1QUPA 2MLXA 1AUDA 1UW9A 2LXIA 3KG0A 5BR8F 1VRTA 3ET6B 2DNNA 5T7LB 4IQMA 4JP8A 2F1FA 3LP0B 2OPRB 1B4SA 1NNDA 1NJYA 1SV5B 2LEPA 2GAHC 3KNAA 3W2VA 1U25A 2YNIA 3R5DA 2EG1A 3DLKB 4DV5J 3NRBA 2WVFA 3VQTA 3GIRA 2N7YA 3RW6A 1BHNA 2M52A 2I8EA 3GCWP 1UJ5A 4Y2AA 3UDVA 2QLJB 2DGWA 1GXLA 1YBTA 5K8OA 4M5HA 5ETOA 3TR5A 5KFNA 1K7HA 4EBCA 2RS8A 2JRSA 3KLVA 1AFJA 2EFPA 3VGUA 1S9GA 4LFAJ 4I67A 3LP2A 8AT1B 3IAM9 1YK9A 2YKOA 2WSFC 4DUTA 4MMOA 1SKSA 4J9SA 4RUCA 3QT8A 2LMIA 3PY8A 3HSDA 4FVMA 1EQMA 4C3KA 4YHHF 2GIRA 1T3NA 1KLNA 3US5A 3H4DA 4RNNA 2ZJPQ 1HYSB 5E3QA 1PJ5A 2MLZA 4ED1A 1MN7A 3BH6B 3W60A 4YR0A 2AGQA 3KLEA 3H5SA 1RT3B 1GNKA 2R8HA 1P8GA 2P8IA 3BQ2A 4DV0J 2VC1A 5KAKA 3PO5A 3CB4A 3KOAA 1RHQB 4DSFA 1WWHA 3I0SB 5DG8A 2HLUA 2CQPA 3QT7A 3SI8A 3FEZA 1CJTA 4OI2A 2CA9A 2RF2B 4KSEB 3J7YU 1S7IA 1PC5A 2XLKA 5KFHA 1IVZA 3FBFA 1MW7A 2J6SA 2OGUA 3WIVA 1F3VA 3NNCA 3EZOA 1IM6A 3A3OB 4AQYF 1L3KA 5H1SV 3DDIA 4LF5F 5EGYA 5L0KA 4LIRA 1V3SA 4ICLB 2FJVA 2UUBJ 1NEEA 1FSUA 2R2TA 2YKMA 4RWWA 1EIYB 3SCJE 2DRAA 1C0UB 5DS7A 1VLOA 3NWRA 3C6UA 1ZAXA 1U49A 3FJ2A 1GK8A 4YR1A 3OJSA 1BQNB 4FP9A 3I31A 1XMQF 4DR6F 3UDLA 1LV5A 2YX4A 2VQEJ 2OPSB 4W90B 3MM5A 3JSMB 1SHNA 4U9RA 2A18A 3UFCX 5K20B 1M1HA 3BSNA 4F3MA 4TNOA 1VOMA 2RU9A 4JI6F 3CMRA 2VQRA 2G1HA 2XR9A 1S0MA 1UWBA 2AYGA 3R3TA 2XZWA 1H6KX 2DR7A 5HAOA 2A3JA 3WAXA 4CLTA 1VQOS 3BSOA 4X4QA 1KVIA 3BEGB 4PYAA 3VVTA 3GTYX 5C25A 4OYBA 2DGSA 3JSYA 1SJ1A 3K8WA 5ITHA 4NLSA 3MAQA 2R7QA 4WFNQ 1CULA 1MN9A 2UXBF 3UCZP 1RTZA 2KG0A 5IM0A 3ADAC 2DGUA 1QY7A 2DHXA 3UR3C 4Q0BB 2CWXA 3M6VA 1X4BA 1S1WB 5KT3A 5CD4H 4O3OA 5JMNA 1TL7A 2DNPA 4A46A 3BN4A 4HH1A 4UPKA 2VH7A 1JK9B 3C8YA 4DSEA 4ALZA 2D3O1 1NSQA 3CCTA 1RT7B 1FVSA 1XERA 1NM2A 4LF6F 2X1GA 1JLQA 3MR2A 2FVPA 3OTDA 1JNZB 1N0UA 4RJVA 2OEKA 2DIUA 3RAMA 4H4MB 1QTMA 1EKSA 3M8PA 3F73A 2PN6A 1YVFA 4NLOA 3IN5A 5E2QA 4OHXA 2ADBA 1N2KA 3NKRA 4ZVPB 3MPUB 3J7Z5 2HHXA 2Y1IA 3O6QA 3KHLA 2QV6A 2CAJA 2RRNA 4PABA 2DR5A 3VAMA 4I0WA 1FTCA 2YWWA 1AA1B 3E8OA 5B09A 2ZH9A 3RB6A 3VAJA 3G8TA 4V19J 2ASDA 4RLEA 2BJDA 4YS2A 2HBZB 3OXLA 4PZVA 2C3OA 4GKKJ 3DU5A 3C14A 4NLGA 4K2XA 2E9ZA 3UI3A 2HQFA 3BSCA 5EDWA 4ELUA 3DCAA 1QE1B 4KHPJ 5D78A 5DO2A 1WKLA 1VQ4S 4CDIA 2I9SA 1PYSB 3QSIA 1UL3A 3L9ZA 1N88A 3VV2B 4JOUA 5CCMA 2VV5A 6AT1B 4CH7A 1VQ8S 2GMJA 4PPDA 1NJWA 1GX6A 1FDDA 1Q82T 3W8PA 1XK8A 3RG6A 4A8KA 3RW7A 5HMYA 2XWXA 4USMA 5JVHQ 3MMCB 1RAAB 3M6WA 5F8IA 1H72C 1PKUA 1M1GA 2RB7A 2ZH6A 3GLJA 4USVA 4ED3A 3LALA 3V6HA 3ITHB 1I51B 1FWKA 2CQ2A 1H7XA 1NBEB 1TFWA 3MMAA 2C28A 1E6YA 2FHJD 4LSNB 4QIVA 4A4JA 2YH1A 1HWIA 2UXCF 1VHIA 4DPOA 2AP6A 4ECWA 3MR6A 2EC2A 2KHCA 2V2KA 3BYPA 1QSLA 2OTJS 2DNGA 1OQ6A 3I9ZA 1OMSA 2WSCC 3V4MA 4L3NA 2GQCA 3SSQA 4KGKA 5B0AA 4ZG7A 2F8HA 3M7VA 5C2CA 2VBWA 5J2NA 1RT2A 1LWXA 1S4FA 3B82A 4ILMA 5B08A 3OSPA 4UF4A 4KBIA 1M5KC 1RKJA 1IKXB 2LQ9A 2JLGA 2OELA 1JLGB 3MCMA 3C15A 1RJJA 1T03A 1H38A 2QMXA 3LPYA 2I5JB 4YP3A 5GRRA 5GAGI 3CDWA 3TEHB 2FVCA 3IXQA 2R4FA 4DV2F 3I4HX 2VBYA 1U0HA 1UA1A 1X60A 3F41A 3P5BP 2Z8QA 1ZH5A 2MMYA 3CDBA 4GO5X 2XCAA 3D28A 3MI7X 1S6QB 2FZKB 3CULA 3BDGA 3HT3A 4XPEA 3MD1A 3S8SA 2IBOA 3KK2A 2IC3B 4ZOSA 1DTTB 3HLUA 4Q2LA 4A48A 5L1IA 4F4XA 1WTBA 1VYAA 4ED0A 4LRAA 3I6PA 2DHGA 2YY3A 4KJGA 2XSJB 4JV5J 3H20A 4RW9B 2F4VJ 2GO8A 5J2PB 1JJHA 1CG2A 3NOCA 3PNIA 4I64A 4CM2A 1HI8A 4CXUA 4ZGAA 1F3FA 3IGZB 5INHA 1QSYA 1FCAA 3IBFB 4PQUA 2DHHA 1T9VA 2B4PA 1ZTWA 2F8EX 2ZOMA 4KH0B 2K3IA 5ETVA 4MHXA 1LW2A 2O1PA 4X4NA 3SCLE 2EFOA 2VUGA 3ET6A 2YKQA 4CO0A 1REVB 1NDKA 4NRUA 3LP0A 5KT2A 2HHHJ 2MGZB 4HTJA 1TL1B 5BR8J 2VF3A 5KG3A 2PMHA 3HKZD 3DLKA 3THPA 1X9MA 5L9XA 1FRKA 4RU2A 5GAEI 1FFGB 2BRKA 2DKOB 1KQSR 3MOZA 1UEKA 3OL6A 2BANA 1RTJB 2M8HA 3T1YF 1WC6A 1UJ6A 1AJDA 1FK9A 1Q16B 1TK5A 5FJ4A 1U09A 5L39A 4DOZA 1K8AT 4USUA 4K4WA 2XY5A 4JI4J 1D0EA 4CTAA 3GU0A 4OJHA 2BA9A 3SQOP 2HMIB 4TYBA 3D6MB 2KH9A 4GTWA 1QUVA 2OFHX 1FJ7A 4LRFA 3SZYA 3TVKA 1WUUA 5HQLA 1I94F 4RWXA 4OYWA 4HHUA 3OFHA 4Q8FA 4IDKB 3HHLA 1RAJA 1DURA 5LT5A 1H2TZ 3ZTSA 4MY4A 4LSZB 3G2XA 1X4HA 1E1ZP 2E1CA 1Y00A 4ZCKA 5D77A 1HYSA 2RDDA 5HMWA 4YHHJ 1CJVB 4PG6A 2Z2YB 2VFVA 2F7VA 3BJYA 3MECA 3V81A 3QMQA 1PJ7A 4C8OA 1V3ZA 4L6V3 3SV4A 5CH7B 4JYAJ 1N54B 1NK4A 1V5IB 2HQ3A 1TTHB 3WZ0A 1FKAF 1NUEA 1UFWA 5FD1A 2CPZA 5IOLA 4H4KA 4J9MA 4FF3A 3DOMA 3I0SA 1XNQF 4WZQA 2W25A 1F9FA 1YGYA 2ZC4A 4E98A 1OO0B 2BX6A 2RF2A 4NLPA 2DPIA 1RA6A 4ED8A 2YNFA 4DUYF 5KFLA 3EX7B 3QJJA 2XQCA 1X5PA 1TL3B 4CO4A 3AAWB 3DI6B 1T94A 4DS5A 1TKXB 4Y2IA 4JV0A 3SZ2A 1B99A 4QW8A 5CYJA 4USTA 3ZXWA 3DLBA 3MEGB 4ICLA 6FD1A 1Z1ZA 1OS5A 4MKBA 2D9PA 1U2CA 4AQYJ 3OVBA 4OYIA 4N8OA 4JV2A 1TVRB 4LRBA 4JI7F 1R6YA 2HGLA 4LF5J 2W24A 3TA0A 5FLXU 1CJKB 5D0GA 4O23A 2XSFA 2CPFA 2ZE2B 1RBAA 2ASJA 1E6VA 1VBZA 4DL2A 1VIOA 1KQFB 2E66A 1XNRF 2ZC3A 1Z2LA 2OPSA 2ATCB 5L9NA 1YJNS 5DG7A 3ED4A 2M3DA 4DR6J 1H98A 1HHTP 3NGUA 1UA0A 3OTOF 2LLZA 4TY8B 3BDEA 1FRIA 1FO1A 3GP9A 2ZITA 3G86A 4OX9F 1RT4B 4QR1A 1HNIA 1WELA 2FLOA 4JI6J 1NSAA 1E33P 3T1AA 2R7OA 4OJ1A 1R0CB 4X84A 3J7YI 3PO4A 1DFDA 2QA4G 3PX6A 4WWSA 3QZ8A 1KQGB 1DZ5A 3R2DJ 1GMWD 2I6WA 4DL0C
chains in the Genus database with same CATH topology
4YR1A 4LRCA 4UOOA 1EI6A 5DLTA 3TWZA 3BDGA 5LRNA 1E3CP 2W8SA 2GSUA 1KHLA 1KHJA 1URAA 1AJAA 5DLWA 1HQAA 2W5QA 1ALKA 2G9YA 2RH6A 1KH9A 4LREA 3M8WA 3BDHA 1N2LA 1ZEFA 3TG0A 3NKPA 5GOVA 1SHNA 3UN3A 1O99A 3MK1A 4TN0A 4GTZA 4KAYA 1AJDA 3UN5A 3KD8A 1EQJA 1ANIA 4LRAA 4UPKA 4LRDA 3NKOA 1P49A 3UO0A 4GTYA 4KJGA 3ED4A 5TJ3A 1SHQA 1K7HA 1HDHA 1KH5A 2W5SA 3E2DA 3IDDA 3LXQA 4B56A 1URBA 1KH7A 2QZUA 3MK2A 1KHNA 4LQYA 4ZG7A 1ED8A 4FDIA 5L0EA 3UNYA 3M7VA 2IUCB 5HRTA 5EGHA 3CMRA 4ZG6A 2VQRA 3DPCA 1Y6VA 2W5WA 4UORA 5LIAA 2XRGA 4CYRA 1E2SP 2XR9A 4CXUA 4ZGAA 1AJCA 5AJ9A 2D1GA 3IGZB 2IUCA 5INHA 3M8ZA 1AJBA 5L0BA 1ALIA 3MK0A 1ZEBA 1EW9A 3BDFA 4LR7A 3NVLA 1ALJA 3Q3QA 3WBHA 1ZEDA 2GSNA 4N7TA 1ELZA 4GTWA 4QAXA 2ZKTA 3NKNA 1ALHA 3B5QA 4UOPA 4UPHA 5LRMA 3WAVA 3OT9A 3WAXA 4CXKA 3T01A 3T00A 4LRFA 3WAYA 1E33P 5EGEA 3SZYA 4KJDA 2GLQA 5C66A 1ELXA 2X98A 4UPIA 5IJQA 4LR9A 2W5XA 2W5TA 2W8DA 4NWJA 3M8YA 1N2KA 4MHXA 3NKRA 1B8JA 5GRRA 5L0KA 4KAVA 2ANHA 1KHKA 1O98A 1KH4A 1EJJA 4UPLA 2GA3A 1EW2A 3IGYB 4MIVA 4NWXA 5LQQA 3NKQA 4ZG9A 5K4PA 1HJKA 1FSUA 1ELYA 1ED9A 1ANJA 4MY4A 2GSOA 3A52A 5KXAA 2W5VA 2IFYA 4KM4A 3TX0A 4GTXA 4LR8A 4LRBA 4CXSA 4FDJA 4LR2A 3DYCA 1E1ZP 3UN2A 1AUKA 4CYSA 3SZZA 3NKMA 5DLVA 1EW8A 3BDGB 5IJSA 3T02A 2W5RA 3WAWA 1Y7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YR1 A;  4LRC A;  4UOO A;  1EI6 A;  5DLT A;  3TWZ A;  3BDG A;  5LRN A;  1E3C P;  2W8S A;  2GSU A;  1KHL A;  1KHJ A;  1URA A;  1AJA A;  5DLW A;  1HQA A;  2W5Q A;  1ALK A;  2G9Y A;  2RH6 A;  1KH9 A;  4LRE A;  3M8W A;  3BDH A;  1N2L A;  1ZEF A;  3TG0 A;  3NKP A;  5GOV A;  1SHN A;  3UN3 A;  1O99 A;  3MK1 A;  4TN0 A;  4GTZ A;  4KAY A;  1AJD A;  3UN5 A;  3KD8 A;  1EQJ A;  1ANI A;  4LRA A;  4UPK A;  4LRD A;  3NKO A;  1P49 A;  3UO0 A;  4GTY A;  4KJG A;  3ED4 A;  5TJ3 A;  1SHQ A;  1K7H A;  1HDH A;  1KH5 A;  2W5S A;  3E2D A;  3IDD A;  3LXQ A;  4B56 A;  1URB A;  1KH7 A;  2QZU A;  3MK2 A;  1KHN A;  4LQY A;  4ZG7 A;  1ED8 A;  4FDI A;  5L0E A;  3UNY A;  3M7V A;  2IUC B;  5HRT A;  5EGH A;  3CMR A;  4ZG6 A;  2VQR A;  3DPC A;  1Y6V A;  2W5W A;  4UOR A;  5LIA A;  2XRG A;  4CYR A;  1E2S P;  2XR9 A;  4CXU A;  4ZGA A;  1AJC A;  5AJ9 A;  2D1G A;  3IGZ B;  2IUC A;  5INH A;  3M8Z A;  1AJB A;  5L0B A;  1ALI A;  3MK0 A;  1ZEB A;  1EW9 A;  3BDF A;  4LR7 A;  3NVL A;  1ALJ A;  3Q3Q A;  3WBH A;  1ZED A;  2GSN A;  4N7T A;  1ELZ A;  4GTW A;  4QAX A;  2ZKT A;  3NKN A;  1ALH A;  3B5Q A;  4UOP A;  4UPH A;  5LRM A;  3WAV A;  3OT9 A;  3WAX A;  4CXK A;  3T01 A;  3T00 A;  4LRF A;  3WAY A;  1E33 P;  5EGE A;  3SZY A;  4KJD A;  2GLQ A;  5C66 A;  1ELX A;  2X98 A;  4UPI A;  5IJQ A;  4LR9 A;  2W5X A;  2W5T A;  2W8D A;  4NWJ A;  3M8Y A;  1N2K A;  4MHX A;  3NKR A;  1B8J A;  5GRR A;  5L0K A;  4KAV A;  2ANH A;  1KHK A;  1O98 A;  1KH4 A;  1EJJ A;  4UPL A;  2GA3 A;  1EW2 A;  3IGY B;  4MIV A;  4NWX A;  5LQQ A;  3NKQ A;  4ZG9 A;  5K4P A;  1HJK A;  1FSU A;  1ELY A;  1ED9 A;  1ANJ A;  4MY4 A;  2GSO A;  3A52 A;  5KXA A;  2W5V A;  2IFY A;  4KM4 A;  3TX0 A;  4GTX A;  4LR8 A;  4LRB A;  4CXS A;  4FDJ A;  4LR2 A;  3DYC A;  1E1Z P;  3UN2 A;  1AUK A;  4CYS A;  3SZZ A;  3NKM A;  5DLV A;  1EW8 A;  3BDG B;  5IJS A;  3T02 A;  2W5R A;  3WAW A;  1Y7A A; 
#chains in the Genus database with same CATH topology
 2P9E A;  5EN1 A;  1E3C P;  1PCA A;  1KOO A;  1LK7 A;  4WE1 B;  2G0J A;  1SJ4 P;  2WAQ D;  1FKP B;  2NZ4 A;  4A8F A;  3AA9 A;  2UXB J;  2G1D A;  2KVQ E;  1S76 D;  2EFQ A;  1S1W A;  4I69 A;  1VJQ A;  2GX8 A;  2R7S A;  1N34 F;  2L41 A;  4LQY A;  3H8Y A;  2PDA A;  4NYZ A;  3DYA B;  2ZOF A;  3IAS 9;  4P2F A;  4U67 Q;  3FBB A;  4IH6 A;  4CQ1 A;  2OD6 A;  1EP4 B;  3AQP A;  1S9E B;  5LMN F;  4Q5V A;  2HW3 A;  3KK3 B;  4MT1 A;  4H4M A;  5DGB A;  5I3P A;  4WKR A;  3NNA A;  5BXI A;  1NKE A;  4UPI A;  2QFJ A;  2AV5 A;  3KLH B;  1D09 B;  4OZ0 A;  4P10 A;  4NWX A;  2UV8 A;  1VR6 A;  4F04 B;  5E41 A;  3PIP Q;  3CIZ A;  1NK8 A;  2YWG A;  2J6U A;  3MAA B;  2G2Z A;  3PFE A;  3RAX A;  1OJ4 A;  4NZ6 A;  1ARO P;  1T05 B;  3QRR A;  5HQ8 A;  4LF9 F;  3W5Z A;  1I3O B;  1YBU A;  3EXY A;  4I2P B;  2W7O A;  1KHJ A;  1SJQ A;  2DRB A;  5DDQ C;  2VZ9 A;  2JFD A;  1YIJ S;  2XM3 A;  3EUN A;  4H4O B;  3Q86 A;  4Y2C A;  2OFG X;  5DZ6 A;  2EK6 A;  2NRE A;  3MK2 A;  2DD8 S;  4FDI A;  4LF4 F;  3C6T B;  4JI2 F;  4QQB A;  1H2U X;  2PC6 A;  3IR6 B;  1M5H A;  2V8G A;  3B4M A;  2J7W A;  5GAD I;  1FX4 A;  1NH8 A;  2AGO A;  3WIU A;  4OJ3 A;  3WDO A;  4EBE A;  2HG4 A;  2GZO A;  2RD5 C;  5C24 A;  1YLX A;  5G4D A;  2D1C A;  1RAF B;  4XAK A;  2DXF A;  1YJ7 A;  3M9N B;  1N56 A;  2Q79 A;  4EZ9 A;  2D74 B;  4UPL A;  4I56 A;  2PFF B;  3Q8U A;  2C2N A;  2XZT B;  4DJB A;  5L38 A;  2IJR A;  3POT B;  3AQO A;  2WBR A;  4ERD A;  3GPA A;  4NYP A;  3TO8 A;  3CGI A;  3NGD A;  1FJG F;  2V50 A;  4LSN A;  4B9V A;  2ZH3 A;  4RW8 A;  4RL1 A;  2RUG A;  3LP1 B;  1VQ9 S;  3GIL A;  2CNK B;  3GFY A;  2ZH1 A;  5DET A;  1PJ6 A;  1J2V A;  3KLG B;  2XMW A;  4DQI A;  4Y28 C;  3A3P B;  2Y0B B;  2UXC J;  5DQG A;  4CNY A;  5LL6 d;  5E3P A;  3EGN A;  1HW8 A;  5H9E J;  1XQI A;  1HL6 A;  1NB2 A;  1RBL A;  5H9E K;  5KFO A;  5GAH U;  1UZH A;  1CBK A;  5B0E A;  3DRP A;  3G9C A;  1DAX A;  2FC9 A;  2F5G A;  2ASY A;  3IWL A;  1NK6 A;  1RA7 A;  5AE3 A;  1U45 A;  1IKX A;  4H54 A;  1JLG A;  1U1Q A;  2HFO A;  4DCJ B;  2FY1 A;  3HVT A;  4FKY A;  3ZTR A;  2XS5 A;  4K4X A;  2WW4 A;  4RBU A;  2ZZM A;  1FRL A;  4Q45 A;  1VC6 A;  2BYC A;  5C42 B;  3THV A;  2FVR A;  2W5V A;  4KM4 A;  4CO5 A;  3FMB A;  3ILO A;  3RBD A;  3SZZ A;  1RAD B;  3LF0 A;  2DEI A;  3NGR A;  1KS2 A;  4ID8 A;  4WK3 A;  1S6Q A;  3AXM A;  3LGH A;  1S57 A;  3PYD A;  3KJV B;  1Y5L B;  2H48 B;  4NI2 B;  1G1X A;  2ALY B;  2HBQ B;  1DTT A;  3EMT A;  1EQJ A;  1X4F A;  2FJB B;  2GAG C;  2WK4 A;  3H7H B;  2BMB A;  2DGO A;  4USW A;  2JC1 A;  3DLE A;  1CQM A;  1Y6V A;  3AJD A;  5J2P A;  1PG5 B;  2CQB A;  4PWD B;  3R6G B;  1MML A;  4F7V A;  3T1H F;  1N5S A;  3CIM A;  5EWF A;  3QJP A;  1BQM A;  4B3S F;  5B0F A;  1UEU A;  2XO6 A;  1KFD A;  1D9F A;  2Z4P A;  3AHP A;  5C7P A;  1YX2 A;  3QJL A;  2EFG A;  5B0B A;  4DR3 F;  1Q8K A;  2SXL A;  3K5N A;  2HAF A;  2VB6 A;  4AL6 A;  4ZPV R;  3IP0 A;  3NAH A;  3J81 j;  5F8H A;  2WOM B;  1M5P C;  2OSQ A;  1Q8L A;  2MGZ A;  2CJA A;  1F1B B;  1P9Q C;  1TL1 A;  1VI7 A;  4DQP A;  1N52 B;  1LXN A;  1HBN A;  3MFI A;  2QO3 A;  4ER8 A;  3BKU A;  1NK9 A;  1SI9 A;  4NCG B;  5KFP A;  4FKX A;  1NLK L;  1NB7 A;  4PG4 A;  4O3N A;  4TN0 A;  1IBL J;  3QRQ A;  2FQQ B;  1RTJ A;  5LJ3 Y;  2QZU A;  3P45 B;  2HFS A;  1FJE B;  2P6T A;  1NU4 A;  1JQG A;  3HO1 A;  2BW2 A;  2C2O B;  4PWW A;  2CAD A;  4ZKA A;  1D3W A;  4UOH A;  8ATC B;  3T1Y J;  2B5J B;  5KFD A;  2C2D A;  4Y6I A;  3CCS S;  1NME B;  2BJ9 A;  5E3R A;  4TQS A;  2VG5 B;  1A0O B;  1LKZ A;  4ECS A;  2R7W A;  3LGN A;  2B3T B;  3FBE A;  4OI1 A;  2BKP A;  4RKU C;  2Y8Y A;  2HUR A;  2HS4 A;  2EKY A;  3IGY B;  4CLS A;  4IDK A;  2FJW A;  3BGO P;  2QL9 B;  1F2G A;  2WZ1 A;  3OPK A;  2K2P A;  1KRP A;  2GQ2 A;  5K8P A;  1J5E F;  5F41 A;  5HSP A;  2R7U A;  1VQ5 S;  1VCT A;  2NXJ A;  3D67 A;  4YOE A;  4ELV A;  3IBC B;  2MKK A;  3N0V A;  3H2U B;  3NKP A;  4C8Z A;  4GO7 X;  4PPZ A;  4KR0 B;  3UDC A;  4LRD A;  3ENA A;  4QR0 A;  3T41 A;  1WJ9 A;  2V69 A;  4DV4 F;  1KVJ A;  1HD1 A;  4LSL B;  4O44 B;  1WG1 A;  2GV1 A;  2UUC F;  2GIF A;  4K4S A;  4NLQ A;  2J9D E;  1U2R A;  3LWL A;  4UPH A;  2F9D A;  3PG9 A;  1XNQ J;  1K44 A;  2K7J A;  3UPF A;  3WAY A;  4N47 A;  1KHW A;  2YX1 A;  3DI6 A;  1EJ7 L;  3PYG A;  5KFA A;  1TKX A;  5ETK A;  2UVR A;  3J80 Y;  3KXD A;  3KK1 B;  3AD9 C;  1VRU A;  4E0D A;  1YJV A;  3DLL Q;  4M1K A;  5A6P A;  2CJQ A;  2IDE A;  1TVR A;  2ZNZ A;  3NCQ A;  4UQG A;  1TV6 B;  1X5O A;  1IN0 A;  1Q95 G;  4Z7C A;  3FMW A;  3N5F A;  2ZE2 A;  1FRJ A;  1JX4 A;  4JI7 J;  3ELH A;  5THW A;  4CIO A;  1X0F A;  4ELT A;  3CMA S;  3CJ4 A;  2WON B;  3R1L A;  2GHP A;  5LXR A;  1VGY A;  4CYR A;  1E2S P;  2L9W A;  4WU3 A;  5SUH A;  1LFP A;  3DOL B;  4RUH A;  1XR5 A;  3DMJ A;  5IWA F;  3VGS A;  3FEX B;  1WHW A;  3I55 S;  2W9B A;  2VJU A;  4URQ U;  4F0M A;  3K8V A;  4CCH A;  4EEY A;  3FKB A;  4LIW A;  5EGE A;  4DV7 F;  3A8K A;  3OTO J;  2W4D A;  2HWT A;  4U8Y A;  3OR2 B;  1KHK A;  3NCR A;  2Z2M A;  1MRO A;  4R8U B;  2HVD A;  4OX9 J;  3H2V E;  1HBO B;  1U0S A;  4M5M A;  1UFL A;  1Q8B A;  3M8Q B;  3IS9 B;  4BCA A;  2W2O P;  4N41 A;  3P49 B;  1RHM B;  2HQG A;  5E7O B;  5ETS A;  1SQF A;  3OFG A;  3V6D B;  1RWO B;  2CUY A;  2DNZ A;  3H5Y A;  5JVG Q;  4ZJQ A;  1UEV A;  1VLY A;  1PYT A;  2DIS A;  1CLF A;  3E51 A;  4JI1 F;  1OY6 A;  2YNH B;  3KD8 A;  1IXK A;  3TEG A;  4BLG A;  1UTA A;  2R3V A;  5CYM B;  3JB9 k;  2CG8 A;  1S1X B;  4FPR A;  4FVC A;  3BZQ A;  2BQR A;  2VKZ G;  2VL1 A;  5KFU A;  3ZTP A;  1EW9 A;  4ATN A;  4K4U A;  3I87 A;  5J1P A;  2M8D B;  1N34 J;  1WKJ A;  4NLY A;  1TUW A;  1OSD A;  2H5J B;  4ZCI A;  1U1O A;  3OTB A;  3I56 S;  2JOQ A;  2J0Q D;  4A8Q A;  1HJK A;  1WF2 A;  3KLH A;  1ED9 A;  3RRH A;  1Z4U A;  5LMN J;  5D4N A;  2KYX A;  3NAI A;  4ZS6 A;  2J8S A;  4WP3 A;  3EZU A;  1JLE B;  5CHC B;  2XYP B;  3Q2T C;  2IIH A;  2ATL A;  1BGX T;  1JXV A;  2DGX A;  1RHR B;  2ZUA A;  2FJE B;  4HL9 A;  1T05 A;  3D2W A;  3BYR A;  5CZX A;  1UPM B;  1C0T B;  2X1F A;  4NLT A;  1KWM A;  3NOG A;  1G3O A;  3MR3 A;  1KLM B;  4H4O A;  4ZVE A;  4LF9 J;  3C19 A;  3IRX A;  3LXQ A;  5AT1 B;  1ROF A;  2VG7 B;  2BJE A;  1U8S A;  1NO8 A;  3A4T A;  3Q2S C;  3ZO7 A;  4EO6 A;  3W9J A;  2D1G A;  4F3O A;  4DSI A;  2N4C A;  1NPR A;  4X4U A;  4A8Y A;  5IZH A;  2FDN A;  2EFV A;  2I0X A;  1ZED A;  2B4V A;  2HQD A;  1JLA B;  4UOP A;  5C5J A;  2IJN A;  3LTO A;  3W61 A;  2GVZ B;  2GQQ A;  3X1L B;  4E8U A;  1JLB A;  1XEZ A;  3BR9 A;  4NWB A;  1M1K T;  3I96 A;  1ANJ A;  1N33 F;  4TY9 A;  4HHH A;  3CF5 Q;  2B9Y A;  3OL9 A;  2HWH A;  1PIL A;  1Q5Y A;  2F4F A;  4F67 A;  3CDE A;  1WHY A;  2N7C A;  3POT A;  2JSX A;  1DBD A;  2RVJ A;  2OJ3 A;  4G1I A;  4WJB A;  1JXL A;  3EJM A;  2A10 A;  1TKZ B;  1RHU B;  2W4P A;  1HBU B;  3TNV A;  1ZEF A;  3N6N A;  4DXL A;  3MAH A;  2YBV A;  1MWQ A;  1SJ3 P;  4CLF A;  4ANC A;  2MTL A;  1UKU A;  1VRT B;  4P6Q A;  3HUL A;  2QEX S;  3PW4 A;  3ILI A;  4TLR A;  2OML A;  4USH A;  5F8N A;  5EGH A;  3FCV A;  4DG1 B;  4DV5 F;  2I38 A;  2VIC A;  2JDJ A;  4DSL A;  2R2R A;  1X31 C;  1RAO A;  4P75 A;  3HK2 A;  1IQT A;  2DRD A;  4FZV A;  3PW5 A;  3WC0 A;  2Z30 B;  4JB8 B;  2IFX A;  4A47 A;  4CO3 A;  2FHJ A;  2V8P A;  1T95 A;  4NXM J;  1KKH A;  3DLH A;  4DCO B;  1C1C B;  5KOW A;  4FDJ A;  4KGX B;  2O5D A;  4WPA A;  4DMZ A;  3MTK A;  4WFA Q;  2PE8 A;  4ES1 A;  4C48 A;  2H9Z A;  4I4B A;  4DFK A;  4DX8 H;  1FNO A;  2ZZT A;  3LP2 B;  3FCH A;  2MYF A;  4DF4 A;  3M32 A;  2CNN B;  1VQS A;  3EXC X;  3AH6 A;  2RIJ A;  4NI2 A;  4ECV A;  3OXF A;  1KHN A;  4DLE A;  2ZBI A;  2V6A A;  3LAN A;  1FE0 A;  4ZA1 A;  2DHS A;  3PJX A;  1S1V A;  1GAO A;  1H73 A;  1BWE A;  4YN3 B;  1RAH B;  4O4G A;  4DL6 A;  4RR5 A;  2UVW A;  2JJ4 D;  2IRY A;  2MKY A;  5BYR A;  2ANH A;  3BO4 A;  3T1H J;  2DCU B;  2O3D A;  3PW2 A;  3ILL A;  1GMU A;  4B3S J;  4F3Q A;  1F60 B;  3AB2 B;  3KJQ B;  4NPO A;  4QU7 A;  3HCX A;  3T02 A;  4K4T A;  1CJT B;  1TR0 A;  4I7F A;  2WOM A;  3J80 U;  4MYU A;  2NCK L;  1TEL A;  4UOC A;  1YJ9 S;  1IKW B;  3GZ7 A;  3H59 A;  4OHZ A;  1OYD A;  2HK2 A;  1S1T B;  3UN3 A;  2VKR A;  4U96 A;  3AXK A;  4GTY A;  1JKH B;  5DM7 Q;  3H40 A;  3KLI A;  1UMJ A;  1HR0 F;  2KG1 A;  4ZLN A;  2OPQ A;  4EZ6 A;  4OZ3 A;  2DNH A;  1CS4 B;  4DV6 J;  2YKM B;  4X4P A;  3M8R A;  2GFF A;  3CC4 S;  3O3L A;  5HI7 A;  3W5X A;  2B5J A;  4HDG A;  3CC2 S;  3C6U B;  5CA5 A;  3HVA A;  1S6O A;  2VQE F;  2E5J A;  1JWW A;  4NZ7 A;  5ETL A;  1VC5 A;  4OHV A;  5L46 A;  3H0P A;  3D3C J;  5AXK A;  2XTJ P;  5L8R C;  2Q3P A;  1RWN B;  3MM5 B;  4ZCL A;  2HNY B;  4WK1 A;  4B08 A;  1B0P A;  2J9E A;  4DU7 A;  3OFF A;  1S9F A;  4ZHR A;  1EW8 A;  1H74 A;  2NSC A;  5HVF A;  3O5T B;  1YG0 A;  4Y34 A;  3QRP A;  1HNW F;  4QJV A;  3HD2 A;  2POK A;  2BQ3 A;  2DNR A;  4KY3 A;  4QWA A;  5GOV A;  4ECT A;  3HHL C;  1J5E J;  2B7B B;  2MEW A;  2W9A A;  2MDA A;  2VOP A;  5DLG A;  3QWP A;  1T0T V;  4NEY A;  3P96 A;  2XB2 D;  2XYG B;  3MZI A;  3R9L A;  4PKD B;  1AJC A;  3DDN A;  2XNQ A;  2KRR A;  2OUG A;  2UU9 J;  2KT2 A;  2HFN A;  3WBH A;  2B9E A;  2VOO A;  4OV1 A;  5LOQ A;  1D8Z A;  5IM0 B;  4KC5 A;  3KMS A;  2UUC J;  1S5Z A;  5M2P A;  1B3T A;  2CWK A;  3TQ1 A;  3D68 A;  3ZNU A;  4P7T A;  1TL7 B;  4FF1 A;  4DZD A;  4GKJ F;  1KDN A;  2FVQ A;  4LR8 A;  1Q4R A;  3MUM P;  3QGI A;  4CYS A;  2LXU A;  3BBB A;  2VG6 B;  1YZ7 A;  2BE2 B;  1AYE A;  1CPZ A;  2F9J A;  3A1Y G;  3MEK A;  3N4W A;  3D6F B;  2UXD F;  5D0H A;  2PI5 A;  1ALK A;  5HL7 Q;  3GFX A;  3M8W A;  5AXN A;  4Y3C A;  2DNY A;  4AXI A;  1R6V A;  2MKC A;  4YR2 A;  2BDP A;  3M8P B;  3DOK B;  3C16 B;  4BDP A;  1TK8 A;  4FYX B;  3T5J A;  5HRO A;  2EC0 A;  1FEH A;  5A8R A;  2WON A;  1FNX H;  3MUT P;  4UOF A;  1M5V C;  2F65 A;  1L5U A;  4PXC A;  3R2C J;  3C46 A;  3HD1 A;  3DOL A;  2B8Q A;  4GKK F;  2RAQ A;  3WAV A;  4IO1 A;  2FHM A;  1P6T A;  3VZH A;  2M70 A;  4M5K A;  2GLQ A;  3W9H A;  3HF5 A;  1ZA1 B;  3MM6 B;  3FSX A;  4NRT A;  1N32 J;  1Y5N B;  3G6Y A;  5IWA J;  2V34 A;  3HFV A;  1Y10 A;  2RDI A;  1VQY A;  2ZJR Q;  3VVU A;  3Q8R B;  1EX8 A;  4DV7 J;  3PV8 A;  1JNR B;  1MNE A;  3M8Q A;  2H65 B;  1S49 A;  3IS9 A;  5ADZ A;  2MKS A;  2MJU A;  2Y3Y A;  2NXE A;  5GAG U;  1KON A;  4EWT A;  2XO7 A;  4JUZ A;  4YB5 A;  3NMR A;  3V6D A;  2QT7 A;  3RRG A;  3GIK A;  4ECY A;  2CPE A;  1RXO B;  4J9K A;  4FXV A;  4ZG6 A;  3DPC A;  2W5W A;  4P9S A;  1XIQ A;  1XR6 A;  5RUB A;  1S1X A;  1RI7 A;  1O6X A;  3JYT A;  1UET A;  2V67 A;  1NXI A;  3TX8 A;  3CME S;  3NVL A;  3MMA B;  3QSY B;  3LAK A;  2W8K A;  1ZPV A;  3ENQ A;  1R0A B;  1U1N A;  4EFA C;  4TU8 A;  3UW1 A;  2LU2 A;  2APO A;  2X51 A;  2PD1 A;  4DR4 F;  1GMW A;  1LWE A;  3LQV A;  4QU6 A;  4LBI A;  2AX1 A;  1UVK A;  4IYQ A;  3TJ9 A;  4XDD A;  1VIX A;  3NLC A;  2BE9 B;  1F6T A;  4HYK A;  1R31 A;  5A0Y A;  4ID5 A;  4D3H A;  2OKQ A;  2GJ2 A;  5IJS A;  1NPK A;  1RWW B;  2PMZ D;  5J2N B;  2RKI A;  1RT2 B;  1DTQ B;  2WTF A;  4OYA A;  5I42 B;  4OLO A;  5GME A;  2VFS A;  3L7P A;  3S01 A;  3JQK A;  2KDO A;  3EGZ A;  1C0T A;  1SL2 A;  3C15 B;  4MYT A;  1TKT B;  1T03 B;  2QSW A;  2BBE A;  2YPY A;  1KLM A;  3D6H B;  1VQ6 S;  4OX7 A;  5IC4 B;  4P71 A;  2RQM A;  2RS2 A;  2I1R A;  4C8L A;  2QA1 A;  5GAE U;  3G82 B;  3SIP B;  3CD5 A;  5JJB A;  4G65 A;  1NRK A;  4AUK A;  3VZI A;  3TP2 A;  4ZPC A;  1T8E A;  3U1L A;  2VBZ A;  4GVL A;  1SVD A;  4N8N A;  1U8W A;  2DK2 A;  2V2Q A;  3D1O A;  1GT8 A;  4GC7 A;  1KNZ A;  2GVZ A;  2ZKU A;  1HI0 P;  4B9S A;  2F4V F;  2R7V A;  7FDR A;  1SJR A;  1SC6 A;  2MQL A;  1AZS B;  1AUK A;  1QDU B;  4NLX A;  4K4V A;  2UUW A;  5DQI A;  3QQC D;  5KFZ A;  1FEE A;  4LRC A;  4ZK7 M;  4V19 X;  3QAT A;  3A8I A;  2CZ9 A;  2KFY A;  3R5J B;  2HAI A;  4F4K A;  1N33 J;  4ED6 A;  3Q89 A;  2CQC A;  1M90 T;  2CFX A;  1HAR A;  3OV7 A;  1TKZ A;  3KUG A;  4YB6 A;  3MEE B;  4F4A A;  1SQG A;  4G1Q A;  1OPZ A;  5K14 B;  2XMJ A;  3Q83 A;  1QD1 A;  1CEZ A;  1YDL A;  4CLL A;  2FJX A;  4B3T F;  1LW2 B;  2VAS A;  3K59 A;  1IBM F;  5KFB A;  2MY7 A;  1WDD A;  3IRW P;  4ECZ A;  1UVM A;  1Q1K A;  4LR7 A;  5EHH A;  4DG1 A;  3QZ7 A;  4EYH B;  2VDI A;  5L1L A;  2NYH A;  2HHW A;  1HNV A;  2G4B A;  2J76 E;  2WVC A;  3M8Y A;  3GFZ A;  2XUL A;  1PBA A;  2W2N P;  4MIV A;  1ELY A;  2CPD A;  2BAN B;  2WB4 A;  5ETQ A;  3LUY A;  2R2U A;  2W8L A;  1FK9 B;  4C11 A;  4MIA A;  3P8B B;  2E1A A;  1VQK S;  1C1C A;  4JI4 F;  1IWA A;  1SC1 B;  3J7A N;  3R5A A;  2K3K A;  3NP5 A;  4ZIW A;  3DFE A;  3CO0 P;  1FI4 A;  3P5T L;  1FVQ A;  4CTA B;  1W2I A;  2RH3 A;  4X4S A;  2R7T A;  4KGV B;  2H3E B;  2WCX A;  4F02 A;  2BJ7 A;  4PQA A;  4LF1 A;  2AYM A;  1N8R T;  5HK4 A;  2AYB A;  1C1B A;  2FLP A;  1UP1 A;  4RW4 A;  4CYU A;  4P72 A;  1S12 A;  2HIQ A;  3HHL B;  3CXC R;  3GCX P;  4G3I A;  2HND A;  2C3U A;  1S0V A;  5JUM A;  4OZ1 A;  1XR7 A;  3S7R A;  3DRR B;  2HZA A;  4OHY A;  2MZQ A;  1RTH B;  4C8K A;  2L9D A;  3D3B J;  3TZW A;  3PX4 A;  2CPI A;  2IYI A;  2QL7 B;  4P7V A;  4JYA F;  5J1N A;  3QWU A;  3SSR A;  2P9G A;  3MEC B;  3V81 B;  4YB7 A;  3UCU P;  4OX6 A;  2NXC A;  3ISN C;  5I3U A;  1T9U A;  4ZCM A;  1S7H A;  3M30 A;  4IFV B;  1HNZ J;  3DOM B;  3BQ0 A;  2XMV A;  3UD5 A;  5HP1 A;  1MWZ A;  1FA0 A;  1DRZ A;  3R5G A;  1UVI A;  3SEO A;  4NE9 C;  2YNF B;  2ACY A;  3VWS A;  2VA3 A;  1IKW A;  4NML A;  2QJ3 A;  2H5I B;  4B02 A;  3C66 A;  3SSS A;  3TUI C;  4F4W A;  5J2Q B;  4W92 B;  3OJU A;  1S1T A;  3O8W A;  4HR2 A;  2PO4 A;  3G8S A;  2MST A;  4Q7A A;  1UW4 A;  2ZHO A;  2RHS B;  1X8D A;  1X4D A;  3LW5 C;  1JKH A;  2CNO B;  1Y7P A;  2KU7 A;  1DJ0 A;  2KT5 A;  1P9Y A;  4QWB A;  1RAB B;  2V4J B;  4K8R A;  3R7B B;  5DDO C;  4HLB A;  3RZA A;  1CS4 A;  4DUZ J;  4NLV A;  4ZPT R;  4AD6 A;  1HR0 J;  1WG5 A;  3DRY A;  2YWK A;  2W5X A;  2W8D A;  5HJX A;  1E6V B;  2ZUG A;  1HIY A;  4ZIV A;  1SH3 A;  4IQX A;  4ED5 A;  3W63 A;  2DIT A;  3CC7 S;  3W9I A;  1WSR A;  1RTD A;  2X3D A;  5KT4 A;  3OHB A;  3TZY A;  1Q81 T;  2O01 C;  2A2C A;  5D8H B;  4LR2 A;  1WI8 A;  4G6V B;  2HNY A;  5IQQ A;  3TZZ A;  1RE1 B;  4DI6 A;  2XY6 A;  3K89 A;  2DGQ A;  1G4C A;  4MIB A;  2HHS A;  4ED7 A;  4UY8 5;  3A13 A;  2E7X A;  2RH6 A;  1HQU A;  1BE4 A;  3CT9 A;  5F3Z A;  4OI0 A;  1GFW B;  4ANE A;  2MXY A;  3NBP A;  1HNI B;  3TAM B;  4EYI B;  1RU1 A;  1HWU A;  2K8G A;  2XI3 A;  5TJ3 A;  1WEZ A;  4USJ C;  3PW0 A;  3MM9 A;  1HNW J;  3M8S A;  1Y9O A;  1U1L A;  2V4R A;  1JJ4 A;  2XMM A;  4B3R F;  3K5L A;  1RT6 B;  1FNM A;  3UD3 P;  3V4I A;  1SQE A;  2P6S A;  1IKY A;  2MZS A;  2JFK A;  1O5J A;  4DQR A;  1UAW A;  3I0R A;  3B78 A;  4B9L A;  2MHN A;  2VPZ B;  4DQQ A;  4JI0 F;  3UCG A;  2HFU A;  1N36 F;  5IC6 B;  2MQM A;  3T5K A;  5K4P A;  5GAD U;  4NLR A;  3QIP B;  1FT8 A;  4O4R A;  2UZA A;  1V6H A;  4U6P A;  4K59 A;  3Q8P B;  1U2F A;  1T9W A;  3FSY A;  2GC8 A;  1U48 A;  3C2P A;  1T7P A;  3N01 A;  2W8S A;  4QIF A;  4B9T A;  2VG6 A;  4GKJ J;  3BBC A;  1BY9 A;  2BE2 A;  4IH5 A;  2KZM A;  1R8C A;  1D8Y A;  4WBF A;  1RP5 A;  2BVZ A;  2EI5 A;  1UJ4 A;  3THT A;  2RT3 A;  3QFH A;  4KRW A;  2DXD A;  3NKY A;  2UV8 G;  2B7C B;  4DPU A;  2UXD J;  3EE3 A;  3AOB A;  5IV3 A;  5L1J A;  2VU5 A;  3DOK A;  3C16 A;  3OTE A;  1BMQ B;  2J7U A;  3BGR A;  4WFB Q;  4F2R A;  4I2Q A;  3WX8 A;  2LP4 A;  1EQ0 A;  4WYL A;  3VAG A;  3CCQ S;  2FVS A;  3CD6 S;  1SB6 A;  3QLH A;  2D9O A;  4G1P A;  4OYP A;  3BGF A;  4K7Q A;  1CC7 A;  1RAG B;  4YME A;  3MM6 A;  5AE1 A;  1R8A A;  4NOH A;  3W66 A;  2VIH A;  3M2U A;  3NNH A;  5KFQ A;  3PAC A;  2XBP A;  3GE9 A;  3TWZ A;  1C4C A;  1X0P A;  2HZC A;  6FDR A;  2V8D A;  3D1H A;  3KFW X;  2A6M A;  2BJ3 A;  1L3T A;  3ULH A;  3FNN A;  2D3Z A;  1URN A;  2W9C B;  2AX0 A;  2XS7 A;  2CYY A;  3K5P A;  1I6J A;  2BR0 A;  2HVZ A;  2XC9 A;  1JLF A;  5C24 B;  4HTI A;  3M05 A;  3NKO A;  1S48 A;  4L3K A;  3UO0 A;  1LWC B;  4QPX A;  5KFG A;  4CH0 S;  1S59 A;  3LGM A;  3TI0 A;  2J0W A;  2AW0 A;  2QIF A;  2FIU A;  2OPP B;  2DNK A;  1X4E A;  2GW8 A;  4I1T A;  2H1Y A;  4J9Q A;  4B9M A;  2O67 A;  3HX9 A;  2HRT A;  5IT9 Y;  2XZD B;  1R0A A;  2VON A;  4WFX A;  3PDN A;  4RW8 B;  2HGN A;  5M2R A;  3BS9 A;  3ZTO A;  3JSR A;  4OX8 A;  1GMV A;  2BAC A;  5KFR A;  2JX2 A;  2IYG A;  4J9N A;  1KEK A;  4K50 A;  2AJ0 A;  3PW7 A;  2GJI A;  2HIY A;  4RX6 A;  3GIM A;  4DR4 J;  4FS2 A;  2QRR A;  1KHL A;  2KJV A;  4F2S A;  3H4B A;  1CJU A;  3BO2 A;  3IWX A;  3DRP B;  3PRV A;  1DTQ A;  2HHU A;  4MH8 A;  5I42 A;  2QLX A;  4KAY A;  4HH0 A;  4ZJL A;  3FZ2 A;  1U1M A;  1HWL A;  2JHE A;  4DFM A;  4ZMM A;  1KH7 A;  1TKT A;  1N4L A;  2OAU A;  1BLU A;  1PIE A;  4TQR A;  3TVY A;  3HVT B;  2U2F A;  1SBR A;  1K0T A;  4PEO A;  3RTV A;  1VQ7 S;  3BDF A;  5KG2 A;  1SC4 B;  1G7C B;  2BV3 A;  4PG7 A;  3I5C A;  1APS A;  1DY3 A;  1FD8 A;  4XO0 A;  5ETM A;  3G82 A;  3JTN A;  3PXG a;  3P3D A;  3H25 A;  4X4V A;  1ELO A;  3TRG A;  3CCL S;  2RUS A;  3KG1 A;  3MM8 A;  1HPZ B;  4U7U D;  5E3C A;  3CD7 A;  3WBZ A;  5BYS A;  4LQ3 A;  4J9O A;  5K8N A;  2CQ1 A;  1HQE B;  2W7A A;  4RBV A;  2M5Y A;  3LH2 S;  4FF4 A;  4RUA A;  2GML A;  4CXS A;  3Q23 A;  1UCN A;  4J9V A;  2B9X A;  5L1K A;  3T9Z A;  1AZS A;  2E7W A;  3DLE B;  1NPP A;  1N5Y A;  3M2R A;  2QTW A;  3QID A;  3QAE A;  3IO1 A;  1EAR A;  1O99 A;  3VQS A;  4F36 A;  1BQM B;  4OYX A;  2D7S A;  4M95 A;  3MEE A;  5BYQ A;  2CNL B;  3ZZU A;  1ZZN A;  3IA0 A;  5K14 A;  1MG7 A;  1ED8 A;  3PRB A;  1A9N B;  5K8M A;  3ZZZ A;  2M0G B;  1ZA2 B;  1FJC A;  3GSI A;  1N6Q A;  1YJR A;  3ENV A;  2M9K A;  4QAX A;  1WF1 A;  2R8K A;  4B3T J;  1QVF R;  4WP9 A;  3FFI A;  3DU6 A;  1NDP A;  2WB1 D;  2CQI A;  4UOG A;  4WF9 Q;  5AE2 A;  2DXE A;  4OV6 A;  1IBM J;  4KPC A;  4FXD A;  3RBE A;  1IBL F;  1HBN B;  1F5A A;  5HAN A;  1N5V A;  3MGJ A;  3WX4 A;  4ZIT A;  4DCP B;  2RU3 A;  3MF5 A;  2CG4 A;  1S0O A;  4QZV B;  2G0C A;  4BC7 A;  3VGV A;  2C2M B;  1Y7A A;  5EX3 A;  5E3A A;  1ITP A;  3H5X A;  5F0W A;  4KB7 A;  3DKD A;  3W65 A;  2YXL A;  1Y3J A;  1R0B G;  5B0C A;  1TMJ A;  2PMW A;  2RRA A;  2QA2 A;  1N2L A;  2RQC A;  1SC3 B;  3GG0 A;  2G2O A;  4IFY B;  2NYI A;  5KG6 A;  1R43 A;  1RLC L;  3FZB A;  4B56 A;  4EUV A;  1R89 A;  3V6K A;  2AEJ A;  4JI3 F;  2JC0 A;  2DBB A;  2DT9 A;  2DH9 A;  1P1L A;  3M1V B;  4GVB A;  3KJF B;  3HDS A;  2MY8 A;  3OFE A;  3KHG A;  1U24 A;  2Q43 A;  3B8H A;  4P2M A;  3VAI A;  2ZBP A;  2R7X A;  4K5S A;  2EXU A;  2VOD A;  4ES3 A;  1SUQ A;  5LRM A;  3OT9 A;  3DRR A;  5F0U A;  2PEB A;  3W2W A;  1RTH A;  1YBA A;  4L74 A;  4DL3 A;  1ZAV A;  3GMG A;  1WG4 A;  4ZVQ B;  5LM7 E;  1SL1 A;  3TX0 A;  4M94 A;  1HQ2 A;  3T6B A;  4F26 A;  2A6O A;  1NDL A;  1WSV A;  1L3S A;  4IFV A;  3OD2 A;  1EI6 A;  2G9O A;  3NL0 A;  4QR2 A;  4DQS A;  4NA2 A;  1ZS6 A;  2QC3 A;  5IS2 A;  4R5P B;  3NG8 A;  1T9X A;  5EX0 A;  4FYV B;  4HAC B;  4KO0 A;  2ZBQ A;  4HEA 9;  5J2Q A;  3ISZ A;  4NA1 A;  3OQ2 A;  4V1A k;  2R8G A;  2VD3 A;  4ECR A;  1K47 A;  5H9F J;  5HLF A;  3A3N B;  5I4M A;  1RWX B;  4PWU A;  2ZM6 F;  3CCW A;  1VRU B;  5DGA A;  2K06 A;  5H9F K;  2V4J A;  3B5Q A;  1ZM9 A;  1TK0 A;  2YQ0 A;  3T00 A;  3EPI A;  5HAT A;  1NCL A;  5LXY A;  5DDP C;  4AL5 A;  4OYO A;  1CVJ A;  4LBP A;  1Y4Z B;  5J2M B;  3ISN D;  4OZ5 A;  3GFH A;  2E1R A;  3DN9 A;  4C8Y A;  5KT5 A;  2VC0 A;  3DGP B;  4X66 J;  4PUO A;  1URA A;  4NL5 A;  2JEI A;  2OI2 A;  3HKW A;  3TUJ C;  4YDD B;  2BRL A;  3X3U A;  4DN0 A;  2W2P P;  1RWP B;  1WC0 A;  3DMJ B;  2CQ0 A;  2W9B B;  1ICE B;  2V63 A;  1FXD A;  3PJ9 A;  1CC8 A;  2VPY B;  2EK1 A;  1HNX F;  3N79 A;  4ZPD A;  1O0P A;  3CJ5 A;  3TAM A;  4L73 A;  2IVY A;  1EKR A;  1U26 A;  4C8N A;  4YR3 A;  1VQL S;  1LW0 A;  1MRO B;  5LSR A;  1X4G A;  1YHQ S;  4IG0 B;  2KXN B;  2IM2 A;  4RUB A;  1RT6 A;  3NY0 A;  2E5L J;  1MLA A;  4WZM A;  3O1L A;  4OJG A;  1U4B A;  2MQQ A;  4WKY A;  4B3R J;  3OTC A;  4OZN A;  3FRZ A;  4AFF A;  1EW2 A;  1Y3K A;  4M5N A;  2N3O A;  4DR7 J;  4GRS A;  3KTQ A;  5IT9 U;  5FDL A;  3VF0 B;  4LFB F;  3QIP A;  2AZ1 A;  4EI2 A;  3W1Y C;  4DV3 J;  4JI0 J;  2CPJ A;  1N36 J;  3AOD A;  4GMK A;  2YWF A;  3I5A A;  4BWJ A;  1L3V A;  2ASL A;  4P2S A;  3TG0 A;  5KFM A;  3M6X A;  1W7W A;  2NXU A;  1DLO A;  3R97 A;  4DX7 A;  1SCJ B;  2AYE A;  2BOP A;  3G8Q A;  4C7Q A;  3SV3 A;  3HSG A;  2MZJ A;  4DWI A;  1OIA A;  1BUX A;  1Q0N A;  4KFB A;  5HVH A;  1KBR A;  2J9D A;  3GR1 A;  2WHO A;  2HQC A;  3SCI E;  2IAJ A;  2GMH A;  2M2B A;  2QA4 S;  2DR8 A;  1URR A;  4OZ2 A;  5CAB A;  4DL5 A;  1D9A A;  3IM8 A;  1EJJ A;  1VIS A;  2HWI A;  1VC0 A;  2IBK A;  1NK7 A;  1FDN A;  4C97 A;  4YQW A;  1M0S A;  1FFW B;  3ZFV A;  3IC1 A;  4R25 A;  2Q66 A;  2ZNY A;  3J7Z T;  2ACM A;  3IRX B;  3LPE A;  4B3O A;  3I9V 9;  1FX2 A;  1OSC A;  2C22 A;  1FDB A;  4BWM A;  5LRN A;  3HSZ A;  3N9U C;  3L4B C;  3D66 A;  1GH8 A;  3CJ3 A;  1WF0 A;  2YNG A;  2V8V A;  3KHR A;  1LXJ A;  1T9Y A;  2Z56 B;  2MSS A;  5KOX A;  3CDU A;  2AEM A;  2W9C A;  2NLW A;  3I4P A;  2Q1L A;  4RNO A;  1IR2 A;  3VAF A;  5T14 A;  1AT1 B;  4EO8 A;  5B0D A;  3CTR A;  5HRT A;  1Q86 T;  1JJC B;  2IMO A;  4NZ0 A;  1LWC A;  4Q43 A;  1JLB B;  5AJ9 A;  3L7U A;  2IVF B;  4Y2M A;  1YJU A;  4B3M J;  1NSK L;  3GV7 B;  2NR0 A;  2OPP A;  2FJD B;  3TYT A;  3FDS A;  2BUN A;  3F56 A;  1SKW A;  2YTC A;  1X5S A;  2UVV A;  1XN9 A;  4EBD A;  4J9L A;  2LEC A;  1S4E A;  3VAK A;  4QIE A;  5EWG A;  4KHR A;  4X62 F;  3WQP A;  2B4O A;  1FWP A;  1RWU A;  2PT0 A;  1W25 A;  2VDH A;  4DDF A;  4DR5 J;  3B54 A;  3K0J A;  1JXE A;  2Y1L B;  2AJ4 A;  4PXD A;  1FRM A;  2GGP B;  1HFE L;  2IPO B;  5LMU F;  3H5U A;  4OFZ A;  1F5B A;  2Z2L A;  2DJW A;  2DNM A;  3A8J A;  1TUV A;  1AJA A;  4RZR A;  2EG2 A;  3D6T B;  2DTJ A;  2PA8 D;  2XNR A;  1KH9 A;  2NPF A;  2CQ3 A;  4LF8 J;  1F9H A;  3KUE A;  2XS2 A;  1WEX A;  1WNE A;  4NXM F;  3OLA A;  1MU2 B;  4OIX A;  4MKY A;  3MED A;  3ILJ A;  4KJI A;  4UZB A;  2ZBC A;  3M2V A;  2ZD1 B;  2V9K A;  4KPY A;  3P6Y C;  1KFS A;  5MAO A;  2MZ1 A;  1JB0 C;  3RAQ A;  4UT4 A;  3GJQ B;  4OHW A;  1LOU A;  3AY0 A;  4C3M A;  2J5A A;  2M4M A;  4IUF A;  1DQA A;  1N5T A;  5F8G A;  3GV8 B;  2IA6 A;  4F4Z A;  5GMD A;  3VCD A;  4B17 A;  1HPZ A;  4PYD A;  5KFV A;  4MTP A;  3PEJ A;  4WTY A;  5DJB A;  3BO3 A;  3M32 B;  2CZ4 A;  1HWK A;  1JIH A;  1HQE A;  3TAN A;  2H51 B;  4E2F B;  2QYC A;  3RBX A;  2N4D A;  4FYY B;  3TAR A;  1VBY A;  4NA3 A;  4K0K J;  3MUR P;  2NSB A;  3BPS P;  4LBH A;  1HKA A;  3ZZY A;  4M5D A;  2W1B A;  1RTI A;  2QMU B;  1YSJ A;  3W7B A;  1S1V B;  1OWX A;  1B70 B;  4A8O A;  1U6B A;  4EU0 A;  2CXE A;  2QG9 B;  4O4G B;  3S6E A;  2LA6 A;  2MKI A;  5T41 A;  1KTQ A;  3MMJ A;  5DZ7 A;  1KVK A;  1IM4 A;  4KKO A;  3CPW R;  2K1R B;  5L0E A;  4J9R A;  4I6A A;  1AXQ A;  1XJW B;  2HK3 A;  2DGV A;  3IG1 A;  2MLY A;  1C2P A;  5F3T A;  3OVS A;  2KM8 B;  2CJX B;  1MMN A;  4CLW A;  1Q7L B;  1T02 A;  1IKV A;  2VFT A;  2W01 A;  3PVX A;  4I7F B;  3G6X A;  2P2C B;  4DV1 F;  4FBT A;  4LF7 J;  3RYL A;  1YQH A;  2UUA F;  2B43 A;  2JNJ A;  2LA4 A;  4ZVS B;  4F25 A;  2AWZ A;  3NEK A;  1H3D A;  2BM1 A;  1WOS A;  3DDK A;  4PRF A;  3UN2 A;  4DV6 F;  5FLX Y;  5KG1 A;  1HMV B;  2B4U A;  3KLI B;  4CO1 A;  3CCV S;  1PAE X;  2OPQ B;  1R8B A;  5CCL A;  1KHV A;  2ZJQ Q;  2EBG A;  3GYG A;  1RYR A;  2LDI A;  5KG5 A;  1OYE A;  5B0G A;  1IUJ A;  1PC4 A;  4IFY A;  4DEZ A;  2C2Z B;  4HI1 A;  4FBU A;  3I82 A;  4J9P A;  3BN7 A;  1RQ0 A;  3QBC A;  2KB2 A;  3ZZP A;  2AU0 A;  4QIW D;  1FKO A;  3M1V A;  2QGF B;  1F0X A;  1A6L A;  2JLF A;  1IBK F;  2M7S A;  4QCL A;  4ZHR B;  3CW2 C;  4JI3 J;  1XWL A;  1SIW B;  2HZV A;  3V2U C;  3UDE A;  3SYZ A;  2ZZN A;  4IOB A;  3PX0 A;  1S79 A;  2PEH A;  1IWG A;  2IHR 1;  4BC9 A;  1A7G E;  2BJ1 A;  2D3O R;  2OIH A;  2UU9 F;  2E29 A;  1BD6 A;  2AHO B;  4WFZ A;  5A8W B;  2M88 A;  2ZH4 A;  3K5M A;  3GSD A;  1REG X;  2HHT A;  1NZA A;  1X4C A;  2HQI A;  3GJR B;  2FPH X;  5HBM A;  4ES2 A;  3TJ8 A;  5KFI A;  4FF2 A;  2PII A;  2KO1 A;  4CLK A;  1U47 A;  1Q53 A;  2JVR A;  5HN0 A;  4R5P A;  4NLW A;  1JJ2 R;  4IG3 B;  3R1H A;  4C8M A;  3FGV A;  1RBO B;  4RNF A;  5CAA A;  4HAC A;  4K4Y A;  1F9E B;  2B6A B;  2RNE A;  2HHQ A;  3HFZ B;  1UVN A;  3IR5 B;  1ALI A;  4X4O A;  4J90 A;  2FZG B;  3TUZ C;  1WOP A;  1S99 A;  3OXG A;  3G6V A;  3UR0 A;  4WII A;  1L3U A;  4A8W A;  1U7L A;  1CSJ A;  4W98 A;  4XK8 C;  4WCE Q;  3UVJ A;  3PHE A;  4DPT A;  2VFU A;  3CED A;  2ZM6 J;  1QAX A;  2KN4 A;  3GIJ A;  3W8G A;  2Y9H A;  4TXS A;  4KHM A;  5J2M A;  2DYA A;  3D1Q A;  2LKZ A;  1QTN B;  4HVZ A;  5GMK a;  1RKI A;  1TQL A;  1KD1 T;  4X4R A;  5HRO B;  5DM6 Q;  2EVZ A;  4URG A;  1IQZ A;  5A8R B;  3DGP A;  3M9M B;  1GTH A;  2DEJ A;  1ZYQ A;  2E7V A;  1GQE A;  2QE5 A;  3E2E A;  3CCR S;  1HWJ A;  3HT0 A;  1N32 F;  2FHK A;  3MFH A;  3D0H E;  1NJZ A;  4USK A;  5F8M A;  3TA1 A;  4RPF A;  5G0R B;  3GB0 A;  1X9S A;  4K5R A;  2J9C A;  2E1M C;  2LYV A;  1HHQ A;  5CYQ B;  2Y1J A;  1HNX J;  2W7P A;  5E0O A;  5DQH A;  2ZVI A;  3EM1 A;  4IG0 A;  1F5C A;  3Q8Y A;  1KOH A;  5IJQ A;  1I5O B;  1TAQ A;  4I68 A;  3QO9 B;  3KMQ A;  5F9L A;  2G13 A;  3HHD A;  1QLN A;  1RIS A;  2OP5 A;  3BKF A;  3MMB B;  3EPG A;  3CJK B;  3R8Y A;  1U1P A;  2RJZ A;  3TJA A;  3VHQ A;  3D0I E;  4WIQ A;  3SQG A;  3NKM A;  2JWN A;  2FD2 A;  4HKQ A;  4QYZ J;  1I1G A;  5KFS A;  3EGV A;  3OL8 A;  4FN5 A;  4AE5 A;  5T7L A;  4GC6 A;  1EAY C;  4QYZ K;  4FXW A;  2JEF A;  2E9T A;  3JYT B;  2OPR A;  3AD7 C;  4Y65 A;  4LFB J;  3JQM A;  4FYW B;  1SV5 A;  3D7S B;  2P9C A;  2F8M A;  1LEO A;  3PTW A;  1LWE B;  1S1U B;  2YH0 A;  3D9B A;  3T5H A;  3EVM A;  2V0N A;  4TN2 A;  2KL8 A;  2ROE A;  2GA7 A;  1VQM S;  5E33 A;  5A0Y B;  3G96 A;  4ID5 B;  3PM9 A;  3DHW C;  4CXK A;  3FBC A;  4DU8 A;  2GJF A;  1FF2 A;  1GTE A;  2MKH A;  2YKA A;  1EB0 A;  2KVI A;  2RKI B;  3BPD A;  5KFT A;  4Z37 A;  2DO4 A;  1B0T A;  2DVI A;  2QLB B;  3QGG A;  1BC6 A;  3K57 A;  4DSJ A;  1WOR A;  1AFI A;  5KG7 A;  4GTX A;  4CZC A;  2DNQ A;  4MIW A;  2QL5 B;  4Z7Y A;  4DX6 A;  4J7C A;  2QN6 B;  2A0F B;  3TZX A;  4W4M A;  1VDH A;  1VJW A;  5KFX A;  1AW0 A;  2VQF F;  3RB3 A;  4NCA A;  2YWH A;  4NAS A;  1VHF A;  4N5S A;  2RHQ B;  4L72 B;  1SJF A;  1LWF B;  4IOC Q;  4U7U K;  4HT7 A;  1HDH A;  3PCO B;  1YJW S;  3PEH A;  4ZDN A;  1HW9 A;  4R0J A;  2C3P A;  1RT3 A;  2AIR B;  4ZLP A;  2W2Q P;  5KFW A;  3BQ1 A;  2AQ4 A;  3LA0 A;  2PGC A;  2LQ5 A;  3M4X A;  2AMC B;  1ALJ A;  3VAH A;  1WC3 A;  3KKF A;  3BB5 A;  3IGN A;  3NGK A;  4ECU A;  4PR6 A;  2FC8 A;  4IOA Q;  5CXT A;  1ELX A;  5IT0 A;  2W5T A;  4ZVH A;  1SL0 A;  4ZVG A;  1O98 A;  3QFW A;  4CP5 A;  3JTO A;  2OEJ A;  4OLP A;  2J0X A;  2GVD B;  4MJK A;  1QM9 A;  1TP7 A;  3M6U A;  3BM7 A;  4G1Q B;  5ETR A;  4DN9 A;  4JI8 F;  3OBI A;  2FGO A;  4NLD A;  5HVG A;  1VK8 A;  2JEJ A;  2VJV A;  4X62 J;  2GGP A;  3BGU A;  2GIQ A;  2MQO A;  2B9W A;  3DRX A;  1HQA A;  2QLF B;  2LXF A;  2W5Q A;  1RWV B;  4OZJ A;  5AXM A;  4OL8 A;  1O51 A;  2WVB A;  4YDX A;  2CQD A;  3CWJ A;  4X65 F;  4QWC A;  3SMZ A;  1HNV B;  4XIU A;  1VBX A;  5LMU J;  1C0U A;  2OMO A;  4AYB D;  2NQP A;  1MU2 A;  1BQN A;  2R8J A;  1VMB A;  1AJB A;  4TU7 A;  2ZD1 A;  1IBC B;  4KH1 B;  2J7K A;  2V2Z A;  2GO9 A;  3JSM A;  4DHV A;  4X64 F;  4N7T A;  4C11 B;  2J8A A;  3NKN A;  1XMQ J;  2XI2 A;  4IR9 A;  2LQB A;  3GYX B;  5CQG A;  1RT5 B;  1FWL A;  1J5O B;  3N6L A;  4J9U E;  2LDY A;  4F8R A;  5DLF A;  2QYG A;  1KH4 A;  2ZH7 A;  3HHK A;  4ITS A;  3BRE A;  4XTT A;  4JI5 F;  1X9W A;  4URS A;  2ABY A;  2H4W B;  2ZOG A;  4F4Y A;  4DR2 F;  4MKV A;  1OQ3 A;  4C98 A;  2E5H A;  3BDP A;  5KG4 A;  1C1B B;  5HJY A;  1G6B A;  3PIO Q;  4RW4 B;  2L9N A;  2KHD A;  4K4Z A;  1KSP A;  4CYU B;  1LQ9 A;  3TW0 A;  1HD0 A;  2OEM A;  3VTI A;  5CZV A;  2IM1 A;  3HM9 A;  2HND B;  4LUB A;  4N56 A;  4UZC A;  2WVD A;  3MUV P;  1RYS A;  2DH8 A;  2MPU A;  2NS1 B;  2RQ4 A;  3UN5 A;  3DC2 A;  2KXF A;  1OY8 A;  1NH7 A;  1P1T A;  1URB A;  4LVN P;  4UW2 A;  2WRM A;  2WVE A;  5LIA A;  3W3S A;  2YX7 A;  1ZTT A;  4Q0B A;  1HNZ F;  3MCO A;  2EPI A;  2K1R A;  2LVW A;  1ZET A;  5A2Q Y;  5I3U B;  1H0H B;  3DGV A;  2HLT A;  2KXH A;  1ELZ A;  1RAC B;  3M30 B;  1DAR A;  2AD9 A;  3T5L A;  1SPB P;  3DLJ A;  4LR9 A;  4EMD A;  3TUP A;  5HP1 B;  1RT7 A;  3MWB A;  4JV1 A;  1S6U A;  4DPX A;  4ED4 A;  2Q6B A;  4ZVR B;  5KFF A;  4UUX A;  3W5Y A;  2U1A A;  3CUN A;  2QLW A;  4LF6 J;  2ILY A;  1K9M T;  3W62 A;  4DV1 J;  3KLF B;  2RSQ A;  3GG1 A;  2UUA J;  1NK0 A;  4NX9 A;  4DUZ F;  2CDR B;  3EWG A;  1HMV A;  2FB0 A;  5K9F A;  2FHO B;  2HGM A;  1BXN A;  2ZDO A;  2Z58 B;  2V68 A;  1WHX A;  3PFO A;  2DNO A;  4CLY A;  2L08 A;  2ZH8 A;  4DSK A;  4XDC A;  3JS9 A;  4BS2 A;  2VA2 A;  3V5R A;  5K5M A;  2VFR A;  4RO0 A;  3PRD A;  2CJB A;  4LT6 A;  1MMD A;  1VQN S;  3ETM A;  2BOA A;  1NDC A;  1Y5I B;  3R7N B;  5D15 A;  4Y00 A;  1AB8 A;  3SBM A;  1PBU A;  1RDR A;  2CJY B;  2OH2 A;  3G4S S;  1RTD B;  1VBK A;  3AA8 A;  2FUG 9;  1QE1 A;  1TZ0 A;  1PGZ A;  3TVZ A;  1NK5 A;  1NJI T;  4LFC F;  3FSI A;  1B7Y B;  4EK2 A;  5CD4 A;  2HFZ A;  3R6L B;  5C66 A;  3Q8V A;  1T11 A;  1U1K A;  1HQU B;  1IBK J;  1FDA A;  3DLG B;  4KYZ A;  4O3P A;  2R2S A;  3LO3 A;  4PXB A;  4ZVT B;  3NBP B;  2F63 A;  3DYC A;  3CJS A;  5DLV A;  3CCM S;  1RCO B;  2FJA B;  3MMC A;  4QOT A;  3MM9 B;  2DIV A;  2AKW B;  5JXS A;  1EZZ B;  5A8W A;  1WAC A;  3RB0 A;  2P5V A;  3ITH A;  2ZH2 A;  3V4I B;  4RBT A;  3KJN B;  1ZZF A;  1IKY B;  3TAQ A;  1UPP A;  2B56 A;  5B7W A;  1ZM3 A;  2YWE A;  3I0R B;  1H7W A;  3G87 A;  4IG3 A;  3RRK A;  5ETN A;  1B0V A;  1BWV A;  2B6A A;  3BV8 A;  2NPI A;  2OHD A;  4H4K C;  4ZP9 A;  3HVR A;  1QSS A;  2AJ1 A;  4C0B A;  1XTZ A;  5KFK A;  1TL5 A;  4O3Q A;  5DG9 A;  4HDH A;  4F50 A;  1N48 A;  3R7S B;  3QYY A;  4M5J A;  3ZNJ 1;  3ENW A;  2X98 A;  5J1E B;  4MK8 A;  2RQK A;  2E44 A;  1NHV A;  3ZC4 A;  2ALZ A;  4D3G A;  5AXL A;  2YKN B;  4NXN F;  3GJS B;  3QT5 A;  3EVW A;  4DZ6 A;  1YIT S;  1TKD A;  2FY8 A;  4NMX A;  1WOO A;  4M5G A;  4Z2X A;  1KP6 A;  2ZDP A;  3KNG A;  1QVG R;  2I5J A;  2LQ8 A;  3ZZT A;  1YTY A;  5IFM A;  3BGR B;  4J5O A;  4I2Q B;  3OLB A;  2HPU A;  5AJ3 F;  4DR1 F;  2HBR B;  2NZC A;  1KTV A;  5IT4 A;  3KDN A;  3MCS A;  5KTQ A;  1S0N A;  3R27 A;  1FES A;  3DNC A;  1J27 A;  4J91 A;  1YI2 S;  3IDD A;  3QLH B;  5I3Q A;  4DV2 J;  4ZP6 A;  4TYA A;  3QGH A;  2FZC B;  2IC3 A;  3WHI A;  3A12 A;  3VAL A;  2V5H G;  1XC9 A;  4K2J A;  5G0R A;  4DS4 A;  3GON A;  3H90 A;  3M2U B;  4KGM A;  4DF8 A;  5CYQ A;  2XG8 A;  3CCJ S;  1FTR A;  2XHW A;  4IRK A;  2XSJ A;  4RW9 A;  1GX5 A;  4NWJ A;  4RW6 B;  2DGT A;  4BBY A;  3GR0 A;  2F3J A;  2GCF A;  3L95 X;  3QO9 A;  3T6J A;  4RW7 B;  2IM0 A;  5DDR C;  4ZJO A;  3SDE B;  4KTQ A;  1RK8 A;  1JLF B;  4MK9 A;  3ZZR A;  4O3R A;  4TLQ A;  4NLU A;  4KT0 C;  3MMB A;  3CJK A;  2W5R A;  4C6A A;  2CVI A;  4C0H A;  3M9O B;  2MZT A;  3CO9 A;  4ZVU B;  4XPC A;  2DCL A;  2QZ8 A;  1REV A;  2NUU G;  1GEH A;  2CIM A;  5KG0 A;  5LSO A;  1W26 A;  4HI2 A;  1HHS A;  3T9N A;  4C0O C;  2Q6C A;  2IMW P;  2J0S D;  2C3M A;  3JAM Y;  5ETP A;  1YZ6 A;  3UD4 P;  1QAI A;  3AD8 C;  4RNM A;  2V2V A;  3JTP A;  3QNW B;  1S1U A;  1FE4 A;  5D4P A;  2D41 A;  4KV8 B;  1PSD A;  3D54 A;  2UP1 A;  4YY3 F;  4DPY A;  1JLC B;  2KFZ A;  7AT1 B;  1CJU B;  1ULR A;  3DM2 B;  1FHT A;  4LQ9 A;  3MPY A;  3HFK A;  2EW9 A;  5HMZ A;  2EFN A;  2EKN A;  4N77 A;  2HMI A;  3MR5 A;  1QJH A;  1ANI A;  4Q2M A;  3MM7 B;  4C9D A;  3G71 S;  3HP6 A;  7FD1 A;  3L7O A;  3UWT A;  3N5B A;  1JMT A;  4LRE A;  3MCN A;  2A2D A;  1WD6 A;  2YQ1 A;  1I94 J;  3RR7 A;  1P27 B;  2XHC A;  1ZBT A;  3K17 A;  4NYO A;  3MM8 B;  4M5L A;  1LWF A;  1CJV A;  2VQF J;  5A76 A;  2IJF A;  3CVK A;  5KFE A;  3UQS A;  5C2G A;  4AT1 B;  2EEY A;  2VHG A;  4ZN1 A;  2ZKT A;  4QIG A;  4EGL A;  2C2E A;  3GII A;  1VK3 A;  4ZLJ A;  2OD4 A;  1N5Y B;  1B8J A;  3M2R B;  1FFS B;  1ZOT A;  4DL4 A;  5A2Q U;  1RZM A;  4FNI A;  4DFP A;  1RT1 B;  2GHV C;  1TAU A;  2GVD A;  2HFV A;  1TL3 A;  2N82 B;  1ZAW A;  4DUY J;  1B7F A;  3NXZ A;  3NS7 B;  2CRL A;  4AND A;  1X4A A;  3HHE A;  4CLZ A;  3G6E S;  1T9T A;  2YPZ A;  1LNQ A;  3AOC A;  3MEG A;  4I6W A;  1N6Q B;  1RGV A;  4JI8 J;  1N0V C;  3MK1 A;  2CDQ A;  3FFI B;  3RBZ A;  2IDL A;  2HVI A;  3IBW A;  1DQ8 A;  1C4A A;  1CJK A;  4WTO B;  3UNG C;  3UNY A;  3EVO A;  1IR0 A;  3EZ5 A;  4UOR A;  5KFC A;  2XRG A;  3K5O A;  3FQK A;  3CNQ P;  4KGZ B;  1YKW A;  4X65 J;  4CNZ A;  3MK0 A;  1G2E A;  3Q8Q B;  1Y0H A;  2V94 A;  1Q8I A;  4ECQ A;  3OUY B;  3QGP A;  1NSP A;  1QAJ A;  2ADC A;  3NS6 A;  1RAE B;  4Q44 A;  2EBE A;  1KN6 A;  1XNR J;  1RT5 A;  3CJ2 A;  3J7A 1;  2FYX A;  4O0N A;  1VFJ A;  2LEA A;  3IM9 A;  1J5O A;  2GA3 A;  4TY8 A;  1KQK A;  4X64 J;  3IR7 B;  2HRY A;  3KUH A;  1MSW D;  2CPY A;  3A52 A;  4IH7 A;  3RGI A;  2CPX A;  1SH2 A;  1RT4 A;  1X5T A;  2MHE A;  3DRS B;  2DY1 A;  3OHA A;  5EWE A;  4JI5 J;  4GVB B;  4MFB B;  1XMO F;  2GSU A;  3A8E A;  2IY5 B;  1O8B A;  4DR2 J;  3BKT A;  1KC8 T;  3OR1 B;  2COL A;  1R8P A;  3GYN A;  4ILR A;  3B6B A;  3N28 A;  5A8K B;  1SUQ B;  4GTZ A;  2B51 A;  5EUH A;  3GQC A;  1N5Q A;  2ZEJ A;  3W2W B;  1LFW A;  1SHQ A;  4YEA A;  2Z0G A;  3AFG A;  2F40 A;  2HNZ B;  2IRX A;  3ETO A;  2HBY B;  3IWN C;  4WE1 A;  1FKP A;  2CQH A;  1PYO B;  2KYZ A;  2XMA A;  2QFI A;  1TMM A;  1K0V A;  2NXN A;  2WBM A;  3RUB L;  3PHT A;  1D9D A;  2YQ3 A;  3ICL A;  3JQJ A;  2CJ9 A;  5D0E A;  3DYA A;  3CDA A;  1F2H A;  9ATC B;  3J81 Y;  1FRX A;  2MJN A;  1WC4 A;  4USI A;  1Z2Z A;  4QPT A;  2KRB A;  3H42 A;  2IM3 A;  1EP4 A;  2IFY A;  3D0G E;  1S9E A;  4CM0 A;  4KO0 B;  3OSN A;  4B9N A;  3HJF A;  1EET B;  3KK3 A;  1Y11 A;  2C3Y A;  5DLT A;  5KT6 A;  1R3N A;  3NMA A;  3KLF A;  1VRQ C;  5HQM A;  3E01 B;  5HLF B;  4P73 A;  4ZP8 A;  1WC5 A;  2VPX B;  3MTJ A;  3BDH A;  5D4O A;  3MAA A;  1YJT A;  1YRX A;  3NGS A;  4S0M A;  2QX0 A;  1RHK B;  2ZWO A;  2W5S A;  3EDQ B;  3Q0A A;  1PO6 A;  2IUC B;  5D3G B;  3I5B A;  1R7I A;  2MKJ A;  4I2P A;  1UVL A;  2B8P A;  4OZL A;  4X66 F;  3CCZ A;  4WFY A;  5L0B A;  4MKA A;  1S6P B;  3CE8 A;  2LQJ A;  4U7C A;  3TOQ A;  3T3F A;  4TU9 A;  2EWH A;  2AJF E;  3HSJ A;  2KZZ A;  1XMB A;  1ZM4 A;  3I32 A;  4PUO B;  4Y2K A;  3C6T A;  1VS3 A;  3PJW A;  1VQP S;  1HBM B;  3C3L A;  4OI4 A;  4CRJ A;  2CKW A;  3VR1 A;  1RU2 A;  1RLD A;  3U7J A;  2DB1 A;  2OTL S;  4LFC J;  4LF4 J;  1TFY A;  3DLG A;  4JI2 J;  1RWK B;  3CCU S;  2ZFH A;  3KDO A;  2DR9 A;  3PYE A;  2E1P A;  2VPW B;  3IFE A;  5F8J A;  2E5L F;  1LW0 B;  2KKH A;  3R5B A;  3HXM A;  3L09 A;  1B64 A;  2OLW A;  1WKK A;  2QSF A;  3EIC A;  1OY9 A;  2BZ2 A;  1NKC A;  2N3L A;  1Q78 A;  1SIZ A;  3MPD A;  2JLE A;  2D3U A;  2HRU A;  2ZVS A;  1S77 D;  2AZ3 A;  2MZR A;  4DR7 F;  3DHX A;  2AT1 B;  3O2I A;  2JVO A;  3BR8 A;  3LP1 A;  1HLW A;  1UFK A;  2AF6 A;  3PYF A;  4MK7 A;  3L3C A;  2LCW A;  4DV3 F;  5SZT A;  2HS3 A;  4AL7 A;  3KLG A;  1FJG J;  4OMF G;  4JBC A;  5FDL B;  1WC1 A;  2XLI A;  5IV4 A;  4HHJ A;  3RU0 A;  1QAY A;  3JAM U;  2FGC A;  2XGQ A;  1NJX A;  1FD2 A;  2PI4 A;  5J1E A;  1NAQ A;  2CQG A;  1WHV A;  2OSR A;  3W2V B;  2YNI B;  1WEY A;  4X4T A;  3IMQ J;  2YKN A;  2Z2Z A;  1YRU A;  1DLO B;  3HHL D;  4ZPB A;  4IR1 A;  2ZBR A;  4OI6 A;  4KE5 A;  2DR6 A;  3MDF A;  3WAW A;  2BXJ A;  4IO9 Q;  4OI3 A;  2IA0 A;  3TQE A;  1RSC A;  4LJM A;  1HI1 A;  2V9W A;  5A6W A;  4NXN J;  1DHM A;  2G9Y A;  2WW8 A;  4KFB B;  4LFA F;  4TKT A;  4IRC A;  5C42 A;  1KR4 A;  2JZ5 A;  2X1A A;  1M5S A;  2IAJ B;  2BM0 A;  4DPW A;  3E2D A;  1S9G B;  4YFU A;  4FYD A;  4QWD A;  2LU1 A;  5AJ3 J;  3UE2 A;  4DR1 J;  4CI0 B;  4QWE A;  3M8Z A;  2IRU A;  4CT9 A;  2CPH A;  3TAP A;  3Q3Q A;  3KJV A;  3KG4 A;  3CJT A;  2RML A;  1XBW A;  2RE1 A;  3FK4 A;  3VGT A;  2R42 A;  3S1T A;  2ZHA A;  4B3O B;  5FII A;  1PAU B;  4KAV A;  2R8I A;  4LVO P;  4RW6 A;  3NKQ A;  2YNG B;  4PWD A;  3RB4 A;  1NKB A;  2GSO A;  3K58 A;  2AJQ A;  4DV0 F;  3EYZ A;  3MOJ B;  3KLE B;  4DBQ A;  4TVA B;  4RW7 A;  2KI2 A;  4B3M F;  3SDE A;  3Q8S B;  1S97 A;  4QW9 A;  3FCW A;  5LSL A;  3TA2 A;  3HPO A;  1FXL A;  5GAH I;  4A8M P;  4CO2 A;  2QMW A;  3PR5 B;  5F8L A;  2ERR A;  2BE7 D;  2H4Y B;  3PZP A;  1DQ9 A;  2NUH A;  2XY7 A;  1SH0 A;  4YB1 P;  4IKA A;  4N76 A;  4DR5 F;  3CJQ A;  1V5V A;  2GHW A;  4DR3 J;  3ZTQ A;  3FVY A;  4WXO A;  1GXT A;  4ENO A;  5LJ5 Y;  1FER A;  4DFJ A;  4M63 A;  2R9L A;  2UUB F;  3B4D A;  4NCG A;  2CJK A;  3K7R A;  3CJ8 A;  2XWY A;  4UQT A;  2XYH B;  1M5O C;  1V3R A;  1IJE B;  2V8H A;  3HI9 A;  4KV8 A;  3KYL A;  2CQ4 A;  2R7R A;  4LF8 F;  2DHA A;  1FRH A;  2KT3 A;  5D0R A;  1JLC A;  4ZG9 A;  2RIL A;  4R0E A;  8RUC A;  3CD0 A;  1ZM2 A;  2DNL A;  2H54 B;  2X7I A;  1RHJ B;  3U02 A;  4YY3 J;  2KFN A;  1TU0 B;  5DRK A;  3DM2 A;  1SKU B;  3MPV A;  3ZZ0 A;  1MWY A;  2VG5 A;  5D6G A;  3SCK E;  2C42 A;  3MED B;  5HMX A;  2X3G A;  3SXL A;  2ILZ A;  9RUB A;  1K1S A;  1HA1 A;  3F0N A;  1LK5 A;  3M2V B;  4ZLL A;  4ZPW R;  4WP8 A;  4PG8 A;  3MM7 A;  2L3M A;  3N6M A;  1EHW A;  5IQ6 A;  4WXW A;  3JXO A;  3CMQ A;  4DLG A;  1V9O A;  2BJ8 A;  4Y0F A;  1D1U A;  2MQN A;  4MAK A;  2JEG A;  2V4Q A;  4F0K A;  1KH5 A;  2E5I A;  4FPI A;  2AJ2 A;  2DPJ A;  3IGV A;  1UWB B;  2FLN A;  4ED2 A;  3NGT A;  1K1Q A;  3CJR A;  1RAI B;  2MB0 B;  1TL4 A;  4K0K F;  1UWA A;  1Q5V A;  3HHN B;  3QAU A;  1U6F A;  4PG5 A;  4KJD A;  3QT6 A;  3BSA A;  2C2K B;  4M5D B;  5C25 B;  1ZPW X;  2G0I A;  4LSL A;  4O44 A;  1RTI B;  2GNK A;  3HMJ G;  2DO0 A;  3GWC A;  3D4J A;  3P4U B;  4DV4 J;  1CUL B;  3FC9 A;  2Y0S D;  4KIA A;  4O3S A;  3MHY A;  4L76 A;  2L48 A;  3RJM B;  2XMK A;  1RT1 A;  1Q79 A;  5KT7 A;  4CLP A;  4ZN3 A;  3AT1 B;  4KKO B;  4L75 A;  3J81 U;  1WDT A;  3NWG A;  1S72 S;  3H2L A;  1WTF A;  3KK1 A;  1U02 A;  3IG1 B;  1FXR A;  1SXL A;  2AGP A;  4ZP7 A;  4LF7 F;  2HVE A;  4M8L A;  3PKM A;  2PA3 A;  1IKV B;  2W4C A;  1IJF B;  2E9R X;  5GVQ A;  3LWM A;  1TV6 A;  1GXU A;  1JLQ B;  3BBF A;  4HT5 A;  2BW7 A;  3GV5 B;  2MQ8 A;  2GSN A;  3O44 A;  4B9U A;  2H5E A;  1T3O A;  4WYW A;  2XGP A;  2XLJ A;  3PR4 A;  3OUY A;  3T01 A;  3HJV A;  2Y8W A;  3SFG A;  1W2B R;  3KHH A;  1UZD A;  2D69 A;  2O66 A;  2JH3 A;  2Z57 B;  2XCP A;  3MR7 A;  4PCQ A;  4UUW A;  1UVJ A;  3W64 A;  1AUS L;  4CT8 A;  4YUD A;  4ZPA A;  4KHP F;  3NCP A;  3OW2 R;  4RU9 A;  4J37 A;  3HZG A;  3MXH P;  3H98 A;  2HHV A;  4UOO A;  3C14 B;  3OR2 A;  2OO4 A;  3DRS A;  2IVM A;  4PAA A;  4C2M A;  3V6J A;  4OYZ A;  1WI6 A;  2ROP A;  3RR8 A;  1FKO B;  4QBU A;  4MFB A;  4R8U A;  3F44 A;  2LEB A;  4A8X A;  3U1N A;  3HZE A;  1HBO A;  3OR1 A;  1NHK L;  2ZHB A;  5A8K A;  1NHU A;  1XMO J;  3EGW B;  4OQJ A;  3ZZO A;  4Q8E A;  4AXJ A;  3D5M A;  2LFV A;  3AOA A;  3NS5 A;  2HNZ A;  1R27 B;  1ZEB A;  2G2Y A;  4LF2 A;  4LMZ A;  2HKE A;  2RRB A;  1SKR A;  4OYM A;  2XEX A;  2YNH A;  3DXB A;  1RCX B;  4ETX A;  4JI1 J;  5CYM A;  2YKP A;  2Y1R I;  4RNH A;  2KTQ A;  3FQL A;  5HBM B;  2HVH A;  4IRD A;  1CQN A;  4WU2 A;  3ONQ A;  4NEZ A;  4FDF A;  3CCE S;  3AJ2 A;  1E6Y B;  3JSB A;  1BQX A;  3DXS X;  5KFY A;  4ZVF A;  3WC2 A;  3AB4 B;  4C4W A;  5U47 A;  2FTR A;  3SFU A;  5KFJ A;  3LOU A;  2DY9 A;  3BGL A;  1YWX A;  4NCB A;  4FNH A;  3MD3 A;  1EET A;  1R8H A;  4BHQ A;  5D4L A;  2KM8 C;  3U27 A;  2A1B A;  4U95 A;  4X2B A;  2HYI B;  2I2Y A;  1OPI A;  4UTG A;  1U1R A;  2E5G A;  2C2R A;  2HEK A;  4FS1 A;  4P52 A;  3E01 A;  3FUY A;  2BKO A;  2FLL A;  3EDR B;  1P49 A;  5HO4 A;  2CZV C;  1JLE A;  3LAM A;  2HSE B;  3FRY A;  2PSZ A;  3UVJ B;  1ACM B;  2PFD A;  4I6Y A;  3OL7 A;  3KWM A;  5M2U A;  3BH7 B;  2BKN A;  1RB0 A;  2IUC A;  5D3G A;  4CLU A;  1YRT A;  4CH1 A;  2C1E B;  2ROG A;  4CWB A;  3R5C A;  4QYR A;  5BJR A;  1S6P A;  4DL7 A;  1ALH A;  3CSK A;  4KAI A;  1NZ8 A;  5F9N A;  2XMU A;  4PXE A;  3T19 A;  1Q7Y T;  2HHP A;  2VG7 A;  2YVS A;  2BEF A;  4ETZ A;  2GS8 A;  3GJT B;  5ETT A;  5LQQ A;  4DX5 A;  1RUS A;  4ILL A;  1HBM A;  1TUG B;  2UVU A;  2BAB A;  2KJW A;  1U0H B;  5E5N A;  5KXA A;  3U1M A;  1JLA A;  2WSE C;  3BDG B;  3CJ0 A;  3OVA A;  2J6T A;  1H2V Z;  1S10 A;  3KK2 B;  1IR1 A;  4F0H A;  4JV5 F;  2CVE A;  1X7V A;  4P2X A;  2X1B A;  5MLC V;  5DLW A;  3PKY A;  3E3X A;  2VBX A;  3QPI A;  2W2M P;  2RDJ A;  4UY8 T;  4ZVO B;  4O0I A;  3MPW A;  2UUT A;  4P74 A;  3AJ1 A;  2ZWP A;  3K2Y A;  2K7K A;  4U8V A;  3HVW A;  4ECX A;  2AEF A;  4PQU B;  1RWM B;  2B0G A;  3Q24 A;  1U6Z A;  1K73 T;  4M5I A;  4A8S A;  1HBU A;  2HS0 A;  2ZH5 A;  2JL9 A;  2DH7 A;  5IXU A;  4KQZ A;  2BQU A;  3BF4 A;  3SQG B;  4C3L A;  2MQP A;  3FEY B;  2XMT A;  2HHH F;  3Q22 A;  1QUP A;  2MLX A;  1AUD A;  1UW9 A;  2LXI A;  3KG0 A;  5BR8 F;  1VRT A;  3ET6 B;  2DNN A;  5T7L B;  4IQM A;  4JP8 A;  2F1F A;  3LP0 B;  2OPR B;  1B4S A;  1NND A;  1NJY A;  1SV5 B;  2LEP A;  2GAH C;  3KNA A;  3W2V A;  1U25 A;  2YNI A;  3R5D A;  2EG1 A;  3DLK B;  4DV5 J;  3NRB A;  2WVF A;  3VQT A;  3GIR A;  2N7Y A;  3RW6 A;  1BHN A;  2M52 A;  2I8E A;  3GCW P;  1UJ5 A;  4Y2A A;  3UDV A;  2QLJ B;  2DGW A;  1GXL A;  1YBT A;  5K8O A;  4M5H A;  5ETO A;  3TR5 A;  5KFN A;  1K7H A;  4EBC A;  2RS8 A;  2JRS A;  3KLV A;  1AFJ A;  2EFP A;  3VGU A;  1S9G A;  4LFA J;  4I67 A;  3LP2 A;  8AT1 B;  3IAM 9;  1YK9 A;  2YKO A;  2WSF C;  4DUT A;  4MMO A;  1SKS A;  4J9S A;  4RUC A;  3QT8 A;  2LMI A;  3PY8 A;  3HSD A;  4FVM A;  1EQM A;  4C3K A;  4YHH F;  2GIR A;  1T3N A;  1KLN A;  3US5 A;  3H4D A;  4RNN A;  2ZJP Q;  1HYS B;  5E3Q A;  1PJ5 A;  2MLZ A;  4ED1 A;  1MN7 A;  3BH6 B;  3W60 A;  4YR0 A;  2AGQ A;  3KLE A;  3H5S A;  1RT3 B;  1GNK A;  2R8H A;  1P8G A;  2P8I A;  3BQ2 A;  4DV0 J;  2VC1 A;  5KAK A;  3PO5 A;  3CB4 A;  3KOA A;  1RHQ B;  4DSF A;  1WWH A;  3I0S B;  5DG8 A;  2HLU A;  2CQP A;  3QT7 A;  3SI8 A;  3FEZ A;  1CJT A;  4OI2 A;  2CA9 A;  2RF2 B;  4KSE B;  3J7Y U;  1S7I A;  1PC5 A;  2XLK A;  5KFH A;  1IVZ A;  3FBF A;  1MW7 A;  2J6S A;  2OGU A;  3WIV A;  1F3V A;  3NNC A;  3EZO A;  1IM6 A;  3A3O B;  4AQY F;  1L3K A;  5H1S V;  3DDI A;  4LF5 F;  5EGY A;  5L0K A;  4LIR A;  1V3S A;  4ICL B;  2FJV A;  2UUB J;  1NEE A;  1FSU A;  2R2T A;  2YKM A;  4RWW A;  1EIY B;  3SCJ E;  2DRA A;  1C0U B;  5DS7 A;  1VLO A;  3NWR A;  3C6U A;  1ZAX A;  1U49 A;  3FJ2 A;  1GK8 A;  4YR1 A;  3OJS A;  1BQN B;  4FP9 A;  3I31 A;  1XMQ F;  4DR6 F;  3UDL A;  1LV5 A;  2YX4 A;  2VQE J;  2OPS B;  4W90 B;  3MM5 A;  3JSM B;  1SHN A;  4U9R A;  2A18 A;  3UFC X;  5K20 B;  1M1H A;  3BSN A;  4F3M A;  4TNO A;  1VOM A;  2RU9 A;  4JI6 F;  3CMR A;  2VQR A;  2G1H A;  2XR9 A;  1S0M A;  1UWB A;  2AYG A;  3R3T A;  2XZW A;  1H6K X;  2DR7 A;  5HAO A;  2A3J A;  3WAX A;  4CLT A;  1VQO S;  3BSO A;  4X4Q A;  1KVI A;  3BEG B;  4PYA A;  3VVT A;  3GTY X;  5C25 A;  4OYB A;  2DGS A;  3JSY A;  1SJ1 A;  3K8W A;  5ITH A;  4NLS A;  3MAQ A;  2R7Q A;  4WFN Q;  1CUL A;  1MN9 A;  2UXB F;  3UCZ P;  1RTZ A;  2KG0 A;  5IM0 A;  3ADA C;  2DGU A;  1QY7 A;  2DHX A;  3UR3 C;  4Q0B B;  2CWX A;  3M6V A;  1X4B A;  1S1W B;  5KT3 A;  5CD4 H;  4O3O A;  5JMN A;  1TL7 A;  2DNP A;  4A46 A;  3BN4 A;  4HH1 A;  4UPK A;  2VH7 A;  1JK9 B;  3C8Y A;  4DSE A;  4ALZ A;  2D3O 1;  1NSQ A;  3CCT A;  1RT7 B;  1FVS A;  1XER A;  1NM2 A;  4LF6 F;  2X1G A;  1JLQ A;  3MR2 A;  2FVP A;  3OTD A;  1JNZ B;  1N0U A;  4RJV A;  2OEK A;  2DIU A;  3RAM A;  4H4M B;  1QTM A;  1EKS A;  3M8P A;  3F73 A;  2PN6 A;  1YVF A;  4NLO A;  3IN5 A;  5E2Q A;  4OHX A;  2ADB A;  1N2K A;  3NKR A;  4ZVP B;  3MPU B;  3J7Z 5;  2HHX A;  2Y1I A;  3O6Q A;  3KHL A;  2QV6 A;  2CAJ A;  2RRN A;  4PAB A;  2DR5 A;  3VAM A;  4I0W A;  1FTC A;  2YWW A;  1AA1 B;  3E8O A;  5B09 A;  2ZH9 A;  3RB6 A;  3VAJ A;  3G8T A;  4V19 J;  2ASD A;  4RLE A;  2BJD A;  4YS2 A;  2HBZ B;  3OXL A;  4PZV A;  2C3O A;  4GKK J;  3DU5 A;  3C14 A;  4NLG A;  4K2X A;  2E9Z A;  3UI3 A;  2HQF A;  3BSC A;  5EDW A;  4ELU A;  3DCA A;  1QE1 B;  4KHP J;  5D78 A;  5DO2 A;  1WKL A;  1VQ4 S;  4CDI A;  2I9S A;  1PYS B;  3QSI A;  1UL3 A;  3L9Z A;  1N88 A;  3VV2 B;  4JOU A;  5CCM A;  2VV5 A;  6AT1 B;  4CH7 A;  1VQ8 S;  2GMJ A;  4PPD A;  1NJW A;  1GX6 A;  1FDD A;  1Q82 T;  3W8P A;  1XK8 A;  3RG6 A;  4A8K A;  3RW7 A;  5HMY A;  2XWX A;  4USM A;  5JVH Q;  3MMC B;  1RAA B;  3M6W A;  5F8I A;  1H72 C;  1PKU A;  1M1G A;  2RB7 A;  2ZH6 A;  3GLJ A;  4USV A;  4ED3 A;  3LAL A;  3V6H A;  3ITH B;  1I51 B;  1FWK A;  2CQ2 A;  1H7X A;  1NBE B;  1TFW A;  3MMA A;  2C28 A;  1E6Y A;  2FHJ D;  4LSN B;  4QIV A;  4A4J A;  2YH1 A;  1HWI A;  2UXC F;  1VHI A;  4DPO A;  2AP6 A;  4ECW A;  3MR6 A;  2EC2 A;  2KHC A;  2V2K A;  3BYP A;  1QSL A;  2OTJ S;  2DNG A;  1OQ6 A;  3I9Z A;  1OMS A;  2WSC C;  3V4M A;  4L3N A;  2GQC A;  3SSQ A;  4KGK A;  5B0A A;  4ZG7 A;  2F8H A;  3M7V A;  5C2C A;  2VBW A;  5J2N A;  1RT2 A;  1LWX A;  1S4F A;  3B82 A;  4ILM A;  5B08 A;  3OSP A;  4UF4 A;  4KBI A;  1M5K C;  1RKJ A;  1IKX B;  2LQ9 A;  2JLG A;  2OEL A;  1JLG B;  3MCM A;  3C15 A;  1RJJ A;  1T03 A;  1H38 A;  2QMX A;  3LPY A;  2I5J B;  4YP3 A;  5GRR A;  5GAG I;  3CDW A;  3TEH B;  2FVC A;  3IXQ A;  2R4F A;  4DV2 F;  3I4H X;  2VBY A;  1U0H A;  1UA1 A;  1X60 A;  3F41 A;  3P5B P;  2Z8Q A;  1ZH5 A;  2MMY A;  3CDB A;  4GO5 X;  2XCA A;  3D28 A;  3MI7 X;  1S6Q B;  2FZK B;  3CUL A;  3BDG A;  3HT3 A;  4XPE A;  3MD1 A;  3S8S A;  2IBO A;  3KK2 A;  2IC3 B;  4ZOS A;  1DTT B;  3HLU A;  4Q2L A;  4A48 A;  5L1I A;  4F4X A;  1WTB A;  1VYA A;  4ED0 A;  4LRA A;  3I6P A;  2DHG A;  2YY3 A;  4KJG A;  2XSJ B;  4JV5 J;  3H20 A;  4RW9 B;  2F4V J;  2GO8 A;  5J2P B;  1JJH A;  1CG2 A;  3NOC A;  3PNI A;  4I64 A;  4CM2 A;  1HI8 A;  4CXU A;  4ZGA A;  1F3F A;  3IGZ B;  5INH A;  1QSY A;  1FCA A;  3IBF B;  4PQU A;  2DHH A;  1T9V A;  2B4P A;  1ZTW A;  2F8E X;  2ZOM A;  4KH0 B;  2K3I A;  5ETV A;  4MHX A;  1LW2 A;  2O1P A;  4X4N A;  3SCL E;  2EFO A;  2VUG A;  3ET6 A;  2YKQ A;  4CO0 A;  1REV B;  1NDK A;  4NRU A;  3LP0 A;  5KT2 A;  2HHH J;  2MGZ B;  4HTJ A;  1TL1 B;  5BR8 J;  2VF3 A;  5KG3 A;  2PMH A;  3HKZ D;  3DLK A;  3THP A;  1X9M A;  5L9X A;  1FRK A;  4RU2 A;  5GAE I;  1FFG B;  2BRK A;  2DKO B;  1KQS R;  3MOZ A;  1UEK A;  3OL6 A;  2BAN A;  1RTJ B;  2M8H A;  3T1Y F;  1WC6 A;  1UJ6 A;  1AJD A;  1FK9 A;  1Q16 B;  1TK5 A;  5FJ4 A;  1U09 A;  5L39 A;  4DOZ A;  1K8A T;  4USU A;  4K4W A;  2XY5 A;  4JI4 J;  1D0E A;  4CTA A;  3GU0 A;  4OJH A;  2BA9 A;  3SQO P;  2HMI B;  4TYB A;  3D6M B;  2KH9 A;  4GTW A;  1QUV A;  2OFH X;  1FJ7 A;  4LRF A;  3SZY A;  3TVK A;  1WUU A;  5HQL A;  1I94 F;  4RWX A;  4OYW A;  4HHU A;  3OFH A;  4Q8F A;  4IDK B;  3HHL A;  1RAJ A;  1DUR A;  5LT5 A;  1H2T Z;  3ZTS A;  4MY4 A;  4LSZ B;  3G2X A;  1X4H A;  1E1Z P;  2E1C A;  1Y00 A;  4ZCK A;  5D77 A;  1HYS A;  2RDD A;  5HMW A;  4YHH J;  1CJV B;  4PG6 A;  2Z2Y B;  2VFV A;  2F7V A;  3BJY A;  3MEC A;  3V81 A;  3QMQ A;  1PJ7 A;  4C8O A;  1V3Z A;  4L6V 3;  3SV4 A;  5CH7 B;  4JYA J;  1N54 B;  1NK4 A;  1V5I B;  2HQ3 A;  1TTH B;  3WZ0 A;  1FKA F;  1NUE A;  1UFW A;  5FD1 A;  2CPZ A;  5IOL A;  4H4K A;  4J9M A;  4FF3 A;  3DOM A;  3I0S A;  1XNQ F;  4WZQ A;  2W25 A;  1F9F A;  1YGY A;  2ZC4 A;  4E98 A;  1OO0 B;  2BX6 A;  2RF2 A;  4NLP A;  2DPI A;  1RA6 A;  4ED8 A;  2YNF A;  4DUY F;  5KFL A;  3EX7 B;  3QJJ A;  2XQC A;  1X5P A;  1TL3 B;  4CO4 A;  3AAW B;  3DI6 B;  1T94 A;  4DS5 A;  1TKX B;  4Y2I A;  4JV0 A;  3SZ2 A;  1B99 A;  4QW8 A;  5CYJ A;  4UST A;  3ZXW A;  3DLB A;  3MEG B;  4ICL A;  6FD1 A;  1Z1Z A;  1OS5 A;  4MKB A;  2D9P A;  1U2C A;  4AQY J;  3OVB A;  4OYI A;  4N8O A;  4JV2 A;  1TVR B;  4LRB A;  4JI7 F;  1R6Y A;  2HGL A;  4LF5 J;  2W24 A;  3TA0 A;  5FLX U;  1CJK B;  5D0G A;  4O23 A;  2XSF A;  2CPF A;  2ZE2 B;  1RBA A;  2ASJ A;  1E6V A;  1VBZ A;  4DL2 A;  1VIO A;  1KQF B;  2E66 A;  1XNR F;  2ZC3 A;  1Z2L A;  2OPS A;  2ATC B;  5L9N A;  1YJN S;  5DG7 A;  3ED4 A;  2M3D A;  4DR6 J;  1H98 A;  1HHT P;  3NGU A;  1UA0 A;  3OTO F;  2LLZ A;  4TY8 B;  3BDE A;  1FRI A;  1FO1 A;  3GP9 A;  2ZIT A;  3G86 A;  4OX9 F;  1RT4 B;  4QR1 A;  1HNI A;  1WEL A;  2FLO A;  4JI6 J;  1NSA A;  1E33 P;  3T1A A;  2R7O A;  4OJ1 A;  1R0C B;  4X84 A;  3J7Y I;  3PO4 A;  1DFD A;  2QA4 G;  3PX6 A;  4WWS A;  3QZ8 A;  1KQG B;  1DZ5 A;  3R2D J;  1GMW D;  2I6W A;  4DL0 C; 
#chains in the Genus database with same CATH homology
 4YR1 A;  4LRC A;  4UOO A;  1EI6 A;  5DLT A;  3TWZ A;  3BDG A;  5LRN A;  1E3C P;  2W8S A;  2GSU A;  1KHL A;  1KHJ A;  1URA A;  1AJA A;  5DLW A;  1HQA A;  2W5Q A;  1ALK A;  2G9Y A;  2RH6 A;  1KH9 A;  4LRE A;  3M8W A;  3BDH A;  1N2L A;  1ZEF A;  3TG0 A;  3NKP A;  5GOV A;  1SHN A;  3UN3 A;  1O99 A;  3MK1 A;  4TN0 A;  4GTZ A;  4KAY A;  1AJD A;  3UN5 A;  3KD8 A;  1EQJ A;  1ANI A;  4LRA A;  4UPK A;  4LRD A;  3NKO A;  1P49 A;  3UO0 A;  4GTY A;  4KJG A;  3ED4 A;  5TJ3 A;  1SHQ A;  1K7H A;  1HDH A;  1KH5 A;  2W5S A;  3E2D A;  3IDD A;  3LXQ A;  4B56 A;  1URB A;  1KH7 A;  2QZU A;  3MK2 A;  1KHN A;  4LQY A;  4ZG7 A;  1ED8 A;  4FDI A;  5L0E A;  3UNY A;  3M7V A;  2IUC B;  5HRT A;  5EGH A;  3CMR A;  4ZG6 A;  2VQR A;  3DPC A;  1Y6V A;  2W5W A;  4UOR A;  5LIA A;  2XRG A;  4CYR A;  1E2S P;  2XR9 A;  4CXU A;  4ZGA A;  1AJC A;  5AJ9 A;  2D1G A;  3IGZ B;  2IUC A;  5INH A;  3M8Z A;  1AJB A;  5L0B A;  1ALI A;  3MK0 A;  1ZEB A;  1EW9 A;  3BDF A;  4LR7 A;  3NVL A;  1ALJ A;  3Q3Q A;  3WBH A;  1ZED A;  2GSN A;  4N7T A;  1ELZ A;  4GTW A;  4QAX A;  2ZKT A;  3NKN A;  1ALH A;  3B5Q A;  4UOP A;  4UPH A;  5LRM A;  3WAV A;  3OT9 A;  3WAX A;  4CXK A;  3T01 A;  3T00 A;  4LRF A;  3WAY A;  1E33 P;  5EGE A;  3SZY A;  4KJD A;  2GLQ A;  5C66 A;  1ELX A;  2X98 A;  4UPI A;  5IJQ A;  4LR9 A;  2W5X A;  2W5T A;  2W8D A;  4NWJ A;  3M8Y A;  1N2K A;  4MHX A;  3NKR A;  1B8J A;  5GRR A;  5L0K A;  4KAV A;  2ANH A;  1KHK A;  1O98 A;  1KH4 A;  1EJJ A;  4UPL A;  2GA3 A;  1EW2 A;  3IGY B;  4MIV A;  4NWX A;  5LQQ A;  3NKQ A;  4ZG9 A;  5K4P A;  1HJK A;  1FSU A;  1ELY A;  1ED9 A;  1ANJ A;  4MY4 A;  2GSO A;  3A52 A;  5KXA A;  2W5V A;  2IFY A;  4KM4 A;  3TX0 A;  4GTX A;  4LR8 A;  4LRB A;  4CXS A;  4FDJ A;  4LR2 A;  3DYC A;  1E1Z P;  3UN2 A;  1AUK A;  4CYS A;  3SZZ A;  3NKM A;  5DLV A;  1EW8 A;  3BDG B;  5IJS A;  3T02 A;  2W5R A;  3WAW A;  1Y7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...