4LRDA

Phosphopentomutase 4h11 variant
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSIGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYKVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase 4H11 variant
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
total genus 144
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrdA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrdA01
3TWZA 5IJQA 5L0EA 1KH7A 1KHLA 3DYCA 1SHQA 3WAYA 3M8ZA 1ELZA 4GTXA 1E1ZP 4B56A 2RH6A 4GTZA 1N2LA 4LRCA 2X98A 4QAXA 5EGHA 3SZYA 4MIVA 5DLWA 4LRBA 3M7VA 3B5QA 1E3CP 1URAA 1ANIA 4FDJA 5L0KA 3DPCA 1AJBA 1EI6A 5L0BA 3NVLA 3MK0A 4LRFA 4CXSA 4LRDA 2VQRA 5GRRA 4MY4A 2GLQA 4LR7A 2QZUA 3LXQA 5TJ3A 4GTWA 1KH5A 4KAVA 1URBA 1AUKA 4UORA 5IJSA 5LRMA 1KHKA 1ZEDA 1B8JA 1HQAA 3IGYB 1K7HA 3BDGA 1SHNA 5LQQA 4LREA 5LRNA 2IUCA 3BDFA 5AJ9A 4LR2A 3NKOA 4CYRA 2ANHA 1P49A 4TN0A 1ELXA 2GSOA 5INHA 3M8YA 3SZZA 1E33P 3MK1A 3UO0A 3TG0A 3KD8A 4YR1A 1KHNA 2W5SA 1KHJA 2W5VA 4NWXA 5DLVA 1KH4A 1HDHA 1O98A 1EW2A 5LIAA 1O99A 1ELYA 2GSNA 3BDGB 1ED9A 4LRAA 4UPIA 4ZGAA 5GOVA 4LQYA 2IUCB 5EGEA 1EQJA 5HRTA 4NWJA 3NKQA 3IGZB 1ALHA 3OT9A 3NKRA 1ALIA 1HJKA 2GA3A 3IDDA 3Q3QA 2XRGA 4MHXA 3M8WA 3T01A 3E2DA 4CXUA 4LR8A 2IFYA 3UNYA 1EW9A 4N7TA 1N2KA 4KJGA 2GSUA 4UPHA 3ED4A 3MK2A 4CYSA 4ZG6A 1FSUA 1ALJA 3WAWA 1AJCA 3NKMA 3WBHA 2G9YA 1EW8A 1ANJA 3NKNA 3NKPA 5K4PA 1ED8A 2W5TA 4KAYA 3UN5A 2W5RA 1ZEBA 3A52A 2D1GA 3BDHA 5KXAA 4UOPA 1ZEFA 2W5WA 4UPKA 2W8SA 1ALKA 2ZKTA 5DLTA 2XR9A 3T02A 3WAXA 3UN3A 3WAVA 5C66A 1E2SP 3CMRA 4GTYA 2W5XA 1AJAA 3TX0A 4ZG7A 1Y7AA 4KJDA 4UPLA 4ZG9A 2W8DA 3T00A 4CXKA 4UOOA 4LR9A 4FDIA 3UN2A 4KM4A 1AJDA 1KH9A 2W5QA 1EJJA 1Y6VA
chains in the Genus database with same CATH superfamily
7FD1A 1Q79A 1UKUA 3JB9k 3JXOA 2RH6A 4HR2A 3G87A 3CJRA 4J9PA 2VIHA 3HVAA 3J81Y 2JEJA 3W2WA 2Z4PA 1ANIA 3PEHA 1AJBA 1EI6A 3BKTA 4I56A 3KLGA 3GYNA 4Y3CA 4CT8A 1U1KA 4K5RA 5CA5A 3EYZA 1HNVA 1H7WA 2ADBA 4DUYJ 3OXFA 2VUGA 4RNMA 1QAIA 3K5NA 1IKVB 5LRNA 2DR7A 2DH8A 5KFWA 2F1FA 4YR1A 4K4TA 3MR5A 5I3UB 3AT1B 5ADZA 5EDWA 4X4RA 1NHKL 2KT5A 5B0DA 1HQ2A 1QUVA 1TUGB 2HVZA 3LTOA 2Z56B 4NEZA 1W25A 1N32F 3N6NA 1MROB 5KFGA 3T01A 4ZG6A 2A10A 4GMKA 3HKZD 2ZZNA 3NKPA 4X62J 5J1PA 4DQRA 4MFBA 3M6XA 2V2VA 2M8DB 1F5CA 4I68A 3ZNUA 1U6ZA 1FF2A 1FESA 4X66J 3BGUA 2CFXA 4DX8H 1UFWA 2BABA 2QYCA 3GR0A 3TA2A 4AUKA 2FB0A 5L0KA 4BC7A 3CJ3A 3AY0A 4WE1A 4E2FB 3LGHA 2ADCA 1IJEB 1PGZA 3JQJA 2KVIA 4E8UA 3D28A 8ATCB 1NK8A 3M4XA 3W7BA 1ELXA 1OY6A 2DK2A 3LAKA 3MECA 1YJRA 2L9WA 2LMIA 5CZVA 2XGPA 1FDNA 1E6YA 3TUZC 2CQDA 5B0EA 4ZVFA 2MZRA 1K0TA 2CQBA 4KKOA 2AX0A 4DX6A 4LQYA 3IS9A 1KHWA 3L95X 3MEDA 1M5PC 2CVIA 4GO5X 2G2OA 2C2KB 2FZGB 1BQMB 2EKYA 2RVJA 1HBOA 2B56A 4NMXA 2DEIA 3OVSA 1N5YA 3B6BA 3NAHA 1H98A 4LQ3A 2HAIA 3BB5A 3T02A 5J1NA 1NB2A 2YNHB 4X2BA 5GAHU 4IRDA 2BRKA 3NY0A 4O3QA 4O4GA 2DB1A 4LUBA 4O3OA 3V81A 2XS2A 4HI2A 4QU6A 4DUZJ 4F0MA 3EJMA 4F4XA 1NKBA 3KLHB 5D15A 4CO4A 3TZZA 5IJSA 2QMUB 4R5PA 2RE1A 2G0JA 2KO1A 3V4MA 4IDKA 2V0NA 3KXDA 3DHXA 5L1IA 3T1HF 2YVSA 5KFFA 3BDPA 2D3ZA 1S0MA 1H2VZ 2PDAA 2AGQA 3NMRA 1FJEB 3BDGB 1TKTA 3DC2A 3W1YC 1SJQA 2LA6A 1K0VA 1NH7A 2VG6A 2C2NA 2CPIA 2HNZB 3GV7B 3MD3A 3W2VB 3NGUA 1K9MT 3R6LB 2FVRA 1XNQJ 1YQHA 2JFDA 3K89A 3S6EA 3RU0A 1WC3A 3NWRA 3ETOA 2JZ5A 4DJBA 5C25B 3T3FA 4QIFA 3TA0A 2RRNA 4CM0A 1FXDA 3IG1A 2UUAF 1TKZB 1RWXB 4JI6J 3SZ2A 4RWWA 5LT5A 1TV6A 3FMBA 3M6UA 4B3TF 3T5JA 1E6VA 2VBWA 1OWXA 1B0VA 1BLUA 2HWTA 5AE3A 2YQ3A 2CJ9A 2WVCA 3IAM9 2J7UA 2W5SA 4JYAJ 4ES1A 2V2ZA 1FXLA 1R6YA 1HI1A 3MF5A 3CJKB 4IOAQ 1M5HA 2AEFA 4WXOA 4UUWA 4QR2A 4NLVA 1OQ3A 5GVQA 1FCAA 2IFYA 5HLFB 2VDIA 4KJGA 4IFVA 4UOCA 4LF8F 3FEXB 4ZVHA 3D4JA 1ZZFA 4YB6A 3DYAA 1KKHA 1IXKA 2Y3YA 4LSLB 5D4LA 3RGIA 4CO0A 2ZWOA 5A6WA 2BM1A 1S9EB 1V3RA 2DO4A 4QR1A 3R8YA 1UWBB 1Q86T 2VONA 2GJIA 2AF6A 5KOWA 2R8HA 2H5EA 4NXNF 2VBZA 1SHQA 2VG7A 4X65F 2HBYB 2XMJA 5CYQA 3B5QA 2ROEA 4ITSA 1GX6A 1C0TA 4DBQA 4OI1A 2H5IB 2DNNA 3IR7B 3DU5A 2XGQA 2E5IA 1FT8A 3ISZA 4HLBA 2H5JB 2E7VA 5EN1A 1N5SA 1B70B 4HDHA 5IQ6A 2Q6CA 4CLZA 3S01A 4AQYF 3LPEA 3C3LA 1H6KX 2XI3A 1C0UA 4YY3J 1JLQB 5F0UA 4F3QA 1JLAA 4P2XA 4C3MA 1NDLA 2VPWB 4CO5A 3GIJA 5ETLA 2ZH1A 3HMJG 5DG9A 4CI0B 3OT9A 1VQSA 1YJ7A 1N54B 1R43A 2A2CA 2FJVA 1XR7A 4ZS6A 2FIUA 1NB7A 3HZEA 3AH6A 3EZOA 1QE1B 2GV1A 1RAIB 1BWVA 4DF4A 3GJQB 2CQ1A 4A8YA 2Z0GA 2E7WA 5KFIA 1WC5A 5KFBA 3A8JA 2Q1LA 1X60A 3TR5A 4DU7A 5LMNF 3TUIC 2DVIA 3OTEA 4RZRA 1EP4B 2JL9A 3I0SB 1PBUA 1HFEL 2R7TA 2MSSA 1J27A 1RSCA 1UFKA 5KFHA 4DX7A 2MTLA 2MGZA 2HPUA 3HX9A 3SEOA 1G4CA 1YHQS 4KAVA 5D3GA 1G7CB 4DXLA 1C1BB 1GK8A 2JSXA 2LYVA 3HT3A 1F2HA 4GVBB 2GGPA 4XTTA 4Z7CA 2DGOA 3H4DA 3KFWX 4YFUA 3JTPA 1S6PA 1RAHB 1FKOA 1L3SA 1KC8T 4H54A 4K5SA 4DR1F 2CVEA 3DU6A 5IFMA 2MEWA 1UCNA 1R0AB 3OFGA 1X4DA 4EYHB 4E0DA 3DDKA 3CSKA 1KN6A 2MMYA 1OJ4A 4MJKA 5KFTA 2ZH3A 4DV6F 3WQPA 3WBHA 3PX6A 3CCLS 3JTOA 2XY5A 4WFYA 4X4OA 3PKYA 3KLVA 4WFBQ 3TEGA 3N6MA 1S0OA 2UVUA 2W9BA 2R7WA 2ZH4A 4QWEA 1KOHA 5C5JA 4EO8A 1ZPWX 1X4FA 1QY7A 1VGYA 3U27A 2IFXA 3L09A 3BGRA 4ZMMA 5DLWA 4HHHA 5J2QB 3H4BA 2HS3A 1CS4B 2L3MA 4AFFA 1M5VC 2FGOA 4HEA9 1RABB 4UOFA 2Z30B 1FKPB 2QFIA 2OPSB 2BEFA 1VQPS 3QQCD 2ZKUA 4EK2A 4F4KA 2KFYA 2I6WA 3DM2B 3CD6S 3NNHA 3TG0A 3A3NB 1KHNA 1WKJA 1FRKA 3AQPA 3PXGa 1EARA 4M5NA 2HEKA 2BANA 6AT1B 4KGXB 2DNZA 1I94J 4LF7F 4X4UA 2FC8A 3W9HA 1XMQF 5HVHA 3QT7A 3LALA 4URSA 3V6JA 1EW9A 5SZTA 4ZHRB 1S0NA 4C11B 3I56S 1IKWA 3NKMA 3TZXA 1Q8IA 5E3PA 2EKNA 4WJBA 1FFWB 3MMAA 4J7CA 2PEBA 1RTHB 1KHVA 4YMEA 5GAGU 4LBHA 1Y4ZB 2KRBA 2BJ3A 2VJVA 1Y6VA 3KWMA 2JWNA 1ELZA 2YKPA 4B56A 4ZVOB 2DXEA 5D0EA 3PW2A 3QMQA 4LSZB 4UTGA 2RRBA 4EEYA 4P75A 1RWOB 2J9EA 4K4XA 4UORA 2KFZA 1IBLJ 3M9MB 5C7PA 3D7SB 3C15A 2WRMA 4KV8A 2UXCF 5KT3A 2JLEA 2GO8A 3RR7A 5DJBA 1RT7B 4OYIA 1XK8A 5FJ4A 3WIVA 4B9NA 5A8RB 1OQ6A 2WVBA 1VJQA 1GMVA 4YR3A 4UPIA 4U96A 1G2EA 4RW6B 4M5MA 2ZITA 3K8WA 3MEGA 1LWEA 4DV0J 3KUEA 4DV7F 4XO0A 2XZTB 1HR0F 2W4PA 2MQ8A 2ILYA 5D6GA 2W7PA 1RAEB 4I6WA 4A8SA 3DXSX 2ZJPQ 2YQ0A 3A52A 1HNIA 5DLTA 5M2RA 2R8IA 1XEZA 2OAUA 4A8WA 1LXJA 3DYCA 4ERDA 4IH6A 5ETSA 2BOAA 2MJUA 5IT9Y 4W92B 1N2LA 3TYTA 3I82A 2ZE2A 4MY4A 3BDEA 1RAGB 4G1PA 4M5IA 4ECTA 1HIYA 4RUBA 4QW9A 1K7HA 4DHVA 5KG0A 1GMUA 3IXQA 5FLXU 4P72A 3RB6A 2RDDA 2G13A 4LT6A 1YDLA 1NPPA 3MXHP 1RWVB 3M2UA 2IUCB 2E9TA 2J7WA 3X3UA 2LKZA 3UQSA 1FDBA 3DLJA 1IBMF 3P6YC 1VRUB 4MK9A 3CXCR 1QTMA 1NNDA 2V4RA 1Q5VA 1RWPB 2HIQA 4HKQA 4IFYA 3W65A 1CC8A 4O23A 4WBFA 2H4YB 4UY8T 2QJ3A 3DDNA 3DRYA 3PACA 3EVMA 1UZDA 4ECZA 4RW8A 2Z2MA 1QTNB 3OXLA 2H48B 3MCNA 3PG9A 1RTJA 5KFAA 2GMJA 5KG1A 4ID5B 4CO3A 3MMCA 3HHLA 1RCOB 2WOMA 5IM0A 2NPFA 3W9JA 3JYTA 2J6TA 1ZA2B 4U6PA 1RWNB 1HWIA 4NL5A 3OL6A 3P3DA 2B4OA 4LFCF 1T9VA 5LL6d 3R1HA 1HQEA 4NRTA 1JLGA 3KD8A 2HFSA 2DHAA 3DKDA 1LOUA 1NMEB 1ULRA 2F9DA 2UUBF 1UVLA 1JJ4A 3DGVA 1NJWA 1SC3B 3BO4A 2VODA 2AKWB 3HKWA 3FMWA 2RU9A 1U1RA 2FHJA 2BX6A 3LWLA 1LKZA 1S77D 3U1NA 3H42A 1NU4A 2G1DA 1ZEBA 2OELA 4FF3A 1O6XA 4ZCLA 1CBKA 1MU2A 2M88A 3OXGA 3T1YJ 4DV2F 2PI4A 5ETRA 5L46A 4G1QB 3TAMA 4K4YA 4LR9A 3BREA 2H65B 4O44A 3GJSB 1JXVA 4YEAA 4Y34A 4DCPB 5AXKA 3M8QB 2B4UA 1VC6A 1V5IB 4OZ3A 1VRTB 3W5XA 3BBBA 1HYSB 2F4VJ 3O3LA 4F02A 4X4SA 1KSPA 3NGKA 1RAFB 4OLPA 2UZAA 5EWGA 3QO9A 5DRKA 2OPQA 1WG1A 4CO1A 3KJNB 1X0FA 2CWKA 5DQIA 3HSGA 2DIUA 1RTDA 3NCQA 2KN4A 2O1PA 3CVKA 1PJ5A 2WCXA 2DH9A 1N0UA 5DQGA 3Q3QA 2DGSA 4LFAF 2B5JB 3EGNA 2VFSA 5HK4A 3JQMA 2DNRA 2QA1A 2HAFA 4B02A 4ES3A 1SCJB 2XMMA 3FSIA 1TKDA 3VZIA 2DCLA 3TJ9A 5IS2A 4NLUA 3NBPA 4RW9A 3MM8B 3V4IA 4C8LA 4LIRA 4WYLA 4IQMA 3BBFA 2PIIA 2MY7A 4CDIA 4U95A 1QVFR 3VAGA 4WP3A 4DV4J 2E7XA 2X98A 2EC0A 1HD0A 2G2ZA 4WF9Q 1XC9A 2CDRB 2WBRA 1KH5A 1TQLA 1S1UB 2UXDJ 1IWGA 3VVTA 1CVJA 2MLYA 1N5TA 4DF8A 3KLIB 2QT7A 4N76A 1RT3B 2VQFF 3NS6A 2RKIA 1JLFA 2YWKA 1RADB 2IM3A 2FD2A 4P7VA 3EDQB 1TP7A 1Y3KA 3MPVA 4A8FA 3FNNA 3MURP 4U8YA 1MROA 4L75A 2ZH7A 3NGDA 2Q6BA 2MYFA 3VVUA 2DGWA 5J2PA 1Q7YT 2HZVA 4KIAA 3NWGA 3G8SA 3KDNA 3QT6A 1YLXA 2D9OA 4BHQA 1ZM2A 5C24B 1IR0A 1WG5A 1SL1A 2VOPA 1KH9A 4F04B 2YY3A 1U1QA 3CE8A 3U02A 5J1EB 3PJWA 1LW0A 2K1RA 1HPZA 2J0SD 3UE2A 4TLQA 1T05A 2G9OA 4LRFA 2M4MA 1N32J 3K7RA 2AWZA 3DGPA 4I2QA 3BQ0A 4ELVA 2FHOB 2AZ1A 2Z2ZA 2RNEA 2L08A 1TL3B 5AXNA 4ENOA 3AB2B 2AJ2A 2NYHA 4FP9A 1S6QB 3EX7B 1UVKA 3CC7S 3C19A 3IO1A 2QL9B 2DH7A 1N48A 2A3JA 4IO1A 1ZH5A 3SQOP 3LP0B 1TTHB 2AYGA 3FRYA 4EU0A 2C2OB 3HFZB 2HQGA 2XMWA 3SQGA 2LU2A 5LJ3Y 1TKXB 2RS2A 4USIA 1DLOB 2XULA 1KLMA 3QPIA 1P6TA 2UUCF 3CC2S 4F3MA 5ETVA 5L9NA 4QIWD 4KHMA 1FD8A 1U6BA 3T9NA 3SCKE 2J0QD 2OD6A 1XJWB 2HNYA 1YX2A 4RU2A 2BBEA 3UR0A 3G6ES 1U2RA 1XMBA 4YS2A 4IR9A 1FWKA 1QD1A 4ALZA 1CULA 4ZLNA 3JSMA 4K4SA 4OHVA 4DR2F 1CJUA 3KLHA 4NCGB 4M5DA 1NDCA 2RH3A 3A8IA 1T11A 3I5BA 5LSOA 1M1KT 1F2GA 4IG0B 3PX4A 4JV0A 2VG5A 3V6KA 2DHSA 4EFAC 5KFCA 5E41A 5D8HB 2RF2B 2MSTA 1PCAA 4QWDA 2ZVSA 2QL5B 2ZC4A 4LF9J 2FYXA 2KJVA 1S9GA 5K8NA 1RGVA 4W4MA 4Q7AA 4DV5F 4ZVPB 2ZJQQ 1DTQB 5CYJA 1N4LA 4M5GA 1QVGR 3J81U 3QGPA 2GMHA 1Y7AA 1HNWF 1YRUA 2FJXA 3R5BA 1W7WA 1JIHA 3TWZA 4DX5A 3ZZYA 3LP2A 3CUNA 2YKNA 4FN5A 4K8RA 4LF4F 3QNWB 2W2OP 2E66A 3LF0A 4HTIA 1RT5A 4G6VB 2V8GA 3DLGA 3CCSS 4G1IA 4CLWA 5E3AA 1EX8A 3KMQA 2IJRA 4RNHA 1SHNA 2PI5A 4GC6A 2HBRB 3NCPA 2ALZA 2GCFA 2VPYB 2V50A 5J2MB 5LSLA 2UP1A 2DYAA 5T14A 1ZAXA 4NE9C 5L39A 2KFNA 2I5JB 1X0PA 3FBCA 2DISA 2X1FA 2RUSA 4Q2LA 5JUMA 3KK3B 2MQOA 2KRRA 1TELA 2OPPA 2I9SA 4EGLA 3HHEA 1NHVA 3FKBA 1RT2A 5HLFA 3LA0A 1Q8LA 3CCJS 2C2RA 4B3TJ 2RRAA 2YX4A 3X1LB 2W8SA 5DLGA 2R7RA 5MAOA 1DARA 2JOQA 3WC0A 1KVIA 2RQ4A 1RU1A 4TNOA 5E3RA 4S0MA 4FKXA 4CIOA 1UWBA 5B0BA 3MEEB 2HNDA 1HMVB 1LK7A 5HJXA 5KFYA 1CJKA 1S76D 2W2PP 1RT1B 1A0OB 1DTTB 5DZ7A 1JX4A 3M30B 1CEZA 2KI2A 3DRXA 3IBCB 1FFSB 2BQUA 4P73A 1URBA 1AXQA 1T0TV 1KOOA 2B43A 1T95A 2HQ3A 4LF8J 1PG5B 3GV8B 1FTCA 2R2RA 1P49A 3SMZA 1VIOA 3MK1A 2DHHA 4DWIA 2H4WB 1Y00A 1MW7A 2CZ4A 2HBZB 4OZ5A 1JLQA 3GILA 4WTOB 1AW0A 3ISND 2GAHC 2Z58B 1ELYA 4IQXA 2IAJB 2NSBA 5HN0A 1SH0A 2HHSA 2XLIA 4OZNA 4X65J 4ZJLA 3NL0A 1S6UA 3CJTA 5F8IA 4L73A 2HLTA 2JVRA 4UW2A 4U7UK 1YZ6A 1JJ2R 3UR3C 5E2QA 3QRPA 5I3PA 1Q1KA 3DOLA 5J2NA 1HBNA 2O67A 3I5CA 4ZCMA 3QSYB 2W24A 4ANCA 4C97A 1GFWB 1TL1B 1ZAVA 4ECSA 1KQSR 4AQYJ 1MSWD 1MMDA 5AXMA 2DKOB 4QWAA 5LSRA 1VQ9S 1RTZA 1Q4RA 1F5AA 3K58A 2EW9A 1RAAB 3HP6A 3H2UB 3FCHA 5HQLA 1RHUB 2G0CA 3MK0A 1VMBA 5GRRA 3D1HA 3D68A 4QW8A 2CQ3A 2KG1A 1JLBB 2J0XA 1SB6A 3TI0A 5HBMB 3Q2TC 4YHHF 2OUGA 4I2PA 2WTFA 3OTOJ 4JI5F 3ITHA 2ANHA 2ZDPA 3RRHA 3KK2A 2AJ0A 5HROA 4DPOA 2NXCA 4OX7A 1P8GA 5KG3A 4Q43A 4QWCA 5LMNJ 1RT4A 2BJ8A 2X51A 3NCRA 3FEYB 3EVWA 2V9KA 4RBTA 4WFAQ 1HJKA 1XTZA 1SKRA 3HHLD 2OD4A 1TZ0A 2KTQA 3PJXA 2GHPA 1EAYC 2IHR1 1AZSA 2WSCC 2VL1A 1UVIA 3GIKA 8AT1B 1SUQA 1RP5A 5DDQC 2ZBPA 1NKCA 1JXLA 2DXFA 3NG8A 3NP5A 1YIJS 4JI7F 4U7CA 4ECXA 2CPYA 3H7HB 4DR1J 4NA1A 1NK4A 4DSKA 1SV5A 1CJVB 2KM8B 1RAOA 2ZFHA 4IOCQ 4V19X 2FHJD 4TQSA 3HDSA 4CLFA 4DV6J 4ZPCA 4C8YA 5HI7A 3C6UA 1LW2B 1NH8A 3SZZA 1FDDA 4I67A 2CPJA 4G65A 3DLBA 3PTWA 3OUYB 3RYLA 1ZA1B 3NRBA 2ACMA 4FVMA 1UMJA 2DRAA 2J8SA 1P9YA 2LEAA 2YNGA 1PJ7A 1YK9A 4BBYA 2PEHA 3ZZPA 4F67A 1MWYA 1NUEA 2LQ8A 4CYSA 3FQKA 3ISNC 4ZHRA 4TKTA 5A8WA 1WHVA 4KGKA 3PKMA 4WWSA 3DLEA 4UZCA 2NZCA 4B9VA 4PWUA 2CNNB 4OYXA 3GG0A 2HBQB 4J9UE 3T1AA 3RG6A 1AJDA 1LEOA 3IWXA 3PW4A 2DR8A 3M32B 3CULA 1S1TB 4ZLLA 2HZCA 4B9SA 4GC7A 1XMQJ 1ITPA 5KT2A 3QATA 4WFXA 2GHWA 3RBEA 4DLEA 1Q5YA 3GSIA 3TVZA 1QDUB 1RWWB 3MM5A 2Z2LA 2KZMA 3K2YA 3KJFB 3GIMA 1NK6A 1NCLA 1F9FA 1ZTWA 4AYBD 4I69A 2VV5A 3E3XA 4Y2MA 2UU9F 1U6FA 3HVTB 4ZPAA 3RB0A 4BCAA 1VK8A 4CM2A 4ED1A 4MIBA 3BR8A 3IWLA 2Y9HA 2VQEF 5A6PA 3NGTA 1WI6A 4OHXA 3KJQB 4RW4B 4RPFA 3SDEB 4PCQA 2QLXA 3EUNA 4QPXA 1X4AA 3HHLC 1FJCA 4ZG9A 1S1WA 5FDLA 1D0EA 4ILLA 1M1GA 4CH0S 4AL7A 5A0YA 2ZH2A 3POTB 2MKKA 2W25A 1S7HA 4EYIB 4DV7J 4JI3F 4PABA 2XLJA 1KHKA 2DTJA 2ZBRA 3G9CA 2IA6A 1MN9A 4WFNQ 3TZWA 4DR6F 4UOHA 4WZQA 2C3UA 1CLFA 4ECYA 3LAMA 3D67A 2F7VA 5B0CA 2MXYA 3HXMA 1O99A 3OFEA 1F0XA 3FFIA 1HBUA 1CC7A 3W66A 1VQNS 3M6VA 2CJKA 2BJ7A 1ALIA 2ZD1A 3RAMA 1RHJB 2IYGA 2V67A 1GAOA 1IM6A 2D41A 4PQAA 1T7PA 2IM0A 2KXHA 1RISA 4OJHA 2OPRB 1EW8A 1QSYA 2DNHA 3C6TA 1O51A 2W5WA 2XI2A 4JI2J 3A3PB 2CA9A 1YBUA 4IKAA 2X1AA 2EK1A 3OLBA 4RL1A 5HP1B 1RLCL 4O4RA 4MK8A 1VQ4S 3IAS9 3MM7B 3WHIA 4RR5A 4RBVA 2CPDA 3IGNA 3GE9A 5G4DA 2MQLA 4DSLA 3RRGA 2YPYA 4ZK7M 2G2YA 1XIQA 5GAEI 5AXLA 4CXSA 2V4QA 2DNPA 4HH0A 3E51A 4Y28C 2HFUA 1Q95G 1ZM9A 3BPSP 1HBMA 1IKXB 3J80Y 4KO0B 3P4UB 2FLOA 3I4HX 2PMHA 2ZOMA 2RUGA 1C1CB 1RT6A 3DMJA 1R27B 1P1TA 2AGPA 3GIIA 1VLYA 3N01A 1IQZA 2BXJA 3T5LA 3ZZUA 4C3KA 3UCGA 5A2QY 3TJ8A 3N28A 2NXUA 3BM7A 1FNOA 3N79A 4DFPA 1Z2ZA 1UJ6A 4BC9A 5JMNA 3EGVA 2GIFA 3UI3A 2GVZB 1FRHA 1WJ9A 4WIIA 1T3NA 3B54A 4IG3A 3FBEA 1HD1A 4Z37A 4OJGA 1HARA 4Q45A 4LFCJ 4LSNB 1JMTA 3RTVA 1PSDA 2FHMA 4ZVRB 5DETA 2W2QP 2HURA 1EKSA 3EGZA 1SQGA 4TN2A 3R97A 2HVHA 2UUBJ 2N4DA 3AB4B 1VRTA 2O5DA 1R0BG 2BRLA 1AYEA 3ZTRA 5E3QA 4CWBA 1LFWA 4CYRA 1VQKS 5KFPA 2NXEA 1VISA 3QT5A 2CG4A 4X64F 2AQ4A 5DS7A 4Q44A 4O3PA 1OYEA 2DNMA 1U2FA 2BKNA 2EBGA 2E9ZA 1FK9A 5F8LA 4GO7X 4YUDA 3M9NB 1KQGB 4GKJF 1SL0A 4F2SA 1FTRA 2AYEA 1K44A 3WAWA 3J7YI 1JJCB 3B82A 2FLLA 3O8WA 4C3LA 4PAAA 4UZBA 2QE5A 2ZHBA 5IT9U 4X4TA 3GMGA 1GQEA 4L3NA 2HQFA 4MTPA 4TY8B 3OTBA 2XCPA 1RTIA 3A13A 1R0CB 1LWCB 2FJWA 1MMNA 3MM8A 4Y2KA 4F4ZA 4CLYA 4BLGA 5KT7A 3WIUA 1XNRF 2EFOA 2HQIA 4NLOA 5B0AA 3MHYA 4DV3F 1VC0A 4QIEA 5B08A 1VBYA 4LFAJ 3OVBA 1S1UA 3NKYA 1BQNB 2RDJA 3D6TB 4F3OA 3AODA 2HHHF 2PSZA 5HVFA 5DGAA 1E33P 3SCIE 4B3MF 1HWKA 3D66A 4HHUA 4MK7A 1R6VA 4ED6A 3PJ9A 3R2CJ 1FNXH 2CQGA 4OYMA 1TK5A 2V94A 1VQOS 2CQ2A 3A12A 4Z7YA 5D4OA 2I2YA 1ED9A 3CWJA 5DDOC 1XMOF 2W9CA 2NR0A 4P10A 4M5LA 2H9ZA 2CPEA 3A8EA 2D74B 3HZGA 3UDLA 1PAEX 1ANJA 2Q43A 2UV8A 3ZZOA 3MM9B 3OTDA 2VFRA 3OJSA 3MI7X 1GT8A 1IBCB 2IRXA 2XMUA 3PYDA 3O2IA 3D6HB 2B9XA 4ES2A 5C24A 1UA1A 3UN2A 1B4SA 2W5QA 4OHYA 1KONA 2BW2A 2KJWA 5IQQA 3FRZA 2HHVA 2VQFJ 5HMXA 2F8MA 4H4OA 2ZVIA 3MOZA 4USTA 3NS7B 3OTCA 1WEZA 1NSKL 2R8GA 1T9XA 2AD9A 1U25A 3CCVS 2CNLB 3IRXB 3T5HA 4OHWA 4ELUA 4BWJA 1BD6A 5EHHA 3TJAA 2R7QA 1ZM3A 1TMJA 5HQ8A 1ZPVA 4DR5F 2CAJA 1B64A 2ACYA 3QZ7A 2IRUA 4ED7A 5LOQA 5LIAA 4EZ9A 2MQPA 2VICA 4X4QA 4N8OA 5DG7A 1UPPA 2P9EA 1UA0A 4JI8J 1S48A 3KG0A 4NLRA 2E1MC 3MCMA 1H38A 3KNAA 2N4CA 3K0JA 1RI7A 3QIDA 1JKHB 1WUUA 3CO9A 2FVPA 4ZP7A 4YB7A 2F8HA 2ZH6A 3MWBA 2ZH5A 2X3DA 4U67Q 2C42A 2NXNA 1D9DA 1PYSB 4DQSA 1S97A 1FE4A 4ZCKA 2CNKB 2DGUA 3TANA 1Z1ZA 3MPWA 2ALYB 3RZAA 2WW4A 2QO3A 4LFBF 5D4NA 3O44A 2C28A 3CIMA 2QC3A 4EUVA 2VU5A 4KHPF 2A1BA 3JTNA 2J6UA 2IDLA 2HQDA 2EC2A 3FZ2A 3BSAA 2ZHOA 2GQQA 4BS2A 3RB3A 1ZBTA 4FXWA 2R7SA 5U47A 5ETOA 2RF2A 4J9LA 1WC4A 2WVFA 4AXIA 2CNOB 3IGZB 1SIWB 3Q8QB 3C14B 3BPDA 4DSFA 2OTJS 1VQ7S 2OJ3A 2Y0SD 4D3HA 4ZVGA 1B7YB 3I4PA 3M2RA 3IM8A 2X1BA 1VYAA 4DFKA 4Y65A 4YB5A 3T41A 2K7KA 3V6HA 5I42B 2ZDOA 3EPIA 3M1VB 2J9DE 2GHVC 4DN9A 3TX8A 5F8HA 3UWTA 2RD5C 2Q3PA 1XN9A 5CQGA 1FDAA 3RW6A 4KPYA 2XS7A 3MUTP 2E5JA 3JAMY 4F0KA 3DFEA 4IOBA 5FD1A 4LF6F 4M63A 5K9FA 3IP0A 1WDTA 1R8BA 3IC1A 2OSRA 3PM9A 4NLSA 5KT6A 3OVAA 1U0HB 4TU7A 3IGYB 1V5VA 3DLKB 4DV5J 5IWAF 1UL3A 1U0SA 2HS4A 4KBIA 4G3IA 3L7OA 3WDOA 3PW5A 1IKYB 2P9GA 1D8YA 3E01A 4NLQA 1OIAA 4NXMJ 4N47A 4WXWA 3BN4A 5AT1B 3M8WA 4LF4J 4QIVA 4PQUA 2NCKL 1DQ9A 2F65A 3R5DA 3UDCA 2OLWA 3IFEA 3DRPA 1D3WA 3M8RA 4R25A 1PAUB 4X4VA 3H59A 2ZOGA 4BDPA 1U8SA 5M2UA 3PFOA 3KK1B 2ZUAA 4JI4F 1X4BA 1HMVA 2DITA 1XR6A 4LRBA 4DG1A 5MLCV 2VDHA 3DPCA 1IN0A 3MM6A 2CJAA 3M30A 1SJ4P 3P5BP 5ETPA 4AE5A 1L3KA 4NOHA 1UEKA 2H3EB 4NLGA 3KLGB 2MZJA 2X3GA 4OZLA 5CABA 1HNVB 1NDKA 4X62F 4A48A 4M95A 2E44A 3I0RA 4NASA 1WEYA 4X66F 3NKQA 2IAJA 5JXSA 1NO8A 1U24A 4P7TA 4DI6A 5IC4B 2BQRA 1YG0A 4B3RJ 4RO0A 3IN5A 2MQNA 1FRMA 2QL7B 2HG4A 1F6TA 4CLUA 2NS1B 3KYLA 4LVNP 2K2PA 1S7IA 3CJ2A 5M2PA 1SIZA 1IWAA 1M1HA 2VZ9A 3S7RA 3GQCA 3LGNA 2RQMA 1VQ5S 3N4WA 5L8RC 4KYZA 3V6DB 5EGHA 3D3CJ 4FDJA 1RQ0A 4LMZA 3A8KA 2NZ4A 1ZZNA 2W4DA 2IJFA 1PC4A 3KHHA 2ZBQA 3VGUA 3I5AA 1AUKA 3HFVA 2HGLA 1R8HA 4QWBA 4ZVTB 3BDFA 2RQCA 4USVA 1PKUA 4WE1B 5F8NA 3KLEB 1DQ8A 1YJVA 4KPCA 4NWXA 2GC8A 3EICA 4FF1A 4LBIA 1FERA 3OQ2A 3TQEA 4NWJA 3C8YA 4KTQA 1Q8KA 3TA1A 1QSLA 1IR2A 3G96A 3MECB 4MHXA 2LA4A 1X4GA 3I6PA 3OD2A 1SJRA 1Q7LB 5FIIA 4KKOB 5F3TA 1K47A 3H5XA 3RUBL 1H0HB 2D1CA 3IS9B 5CZXA 2EFVA 3MEDB 4WCEQ 2XY7A 4JI5J 3G71S 4OX9J 4KJIA 1WTFA 1T3OA 4DOZA 2KU7A 2VD3A 4RUAA 1SKWA 5GAHI 2E29A 1EZZB 3M8ZA 1N5YB 3DI6A 2O66A 3UCUP 1IUJA 4QAXA 1KEKA 2N7YA 2OEMA 4KH1B 3MPUB 2H54B 2UXBJ 4CRJA 3PO4A 4O4GB 4K4ZA 3VHQA 3V81B 2YKMB 4MKBA 1YSJA 5HJYA 2VFVA 3GFYA 4M1KA 3OSNA 1U02A 1XNQF 4FPRA 4WU2A 3BQ1A 2CADA 2WB1D 4Y0FA 4R5PB 5GMDA 2I8EA 4JI7J 3OSPA 4IDKB 1S4FA 1S79A 4ZIWA 2OSQA 3I55S 1RKJA 2APOA 2ZM6F 4LF5F 2FY1A 1N88A 4EZ6A 2XBPA 2EXUA 1SVDA 2JVOA 1TKTB 2XZWA 5T7LA 3QRRA 4TQRA 2VG6B 2LXIA 3NS5A 1NK0A 4ZA1A 5AJ3J 3Q86A 3PY8A 2C2EA 1FEHA 2HZAA 3R3TA 5CYMA 2DEJA 3R5JB 3N5FA 3SBMA 4Q0BA 3E2EA 2WBMA 2V34A 5LM7E 3OL9A 3QGIA 2BE7D 2XSJB 2QV6A 1OSCA 3M32A 3QIPA 2HFOA 2CZVC 2YNFA 4WU3A 4DCOB 2W1BA 3CPWR 4CP5A 3EZ5A 1NSAA 5D0HA 5LXRA 3MAQA 3IG1B 3TAQA 2LXFA 1WF2A 2COLA 3GCXP 1TV6B 3K8VA 3DOMA 1E6VB 5CCMA 4PPZA 2GIRA 1HDHA 1EETA 3IGVA 4OX8A 2XC9A 1BY9A 2JNJA 4Q5VA 2CZ9A 1N6QB 5GOVA 1Q16B 5EGEA 1NZAA 4ZVUB 2JC1A 2EWHA 3H25A 2BMBA 4IH5A 3RBXA 4DPWA 2C22A 3LQVA 4M5KA 1TL5A 1U47A 2DY1A 3V5RA 1CJTA 3IR6B 4JV1A 4RW4A 3SDEA 5F3ZA 2P6SA 4CXKA 4IFVB 2GQCA 1NK7A 2QN6B 5A76A 1N34F 4GVLA 1S4EA 3BSOA 5L0EA 3DYAB 2NXJA 3HK2A 2UVVA 1O0PA 2C3PA 1XBWA 1NZ8A 2YH0A 1ZS6A 4L76A 2IMOA 3C46A 4LF1A 2V8VA 2W2MP 3NLCA 1VS3A 3POTA 2MZSA 3PIPQ 3D2WA 1VIXA 5ETQA 2VG7B 4TY9A 5CYQB 2CYYA 3HSJA 5D4PA 3ZC4A 1BE4A 2J7KA 1YJNS 2CJXB 1B99A 2IYIA 3KLFB 1C0TB 1EJ7L 3GR1A 3SSRA 1KH4A 1D9AA 1SKSA 2BJ9A 1W2BR 2KZZA 2B7CB 3BJYA 1WC1A 3MAAA 2OFGX 1KD1T 4DPUA 1JB0C 4JUZA 1JLAB 2XWYA 5GMEA 1IVZA 3ENWA 1QLNA 1JLEA 2CPHA 4ECRA 2OPRA 4JI3J 4JV2A 3HD1A 2QTWA 4FYDA 4WPAA 3VGSA 4B3OA 1RACB 2W8DA 1U09A 3ILJA 4A47A 1KTQA 3G6XA 3B8HA 4RNOA 4QCLA 3H98A 3R7BB 4ELTA 2F4FA 2QRRA 5KFLA 3LANA 3HJVA 1HNZF 1C4AA 3BKUA 3AXKA 5THWA 2ZH9A 2GZOA 2E1PA 4ZVEA 3QT8A 4KO0A 2MGZB 5L1JA 3RJMB 1D1UA 3ET6A 3CCES 5D3GB 3QGGA 2K3IA 2MKCA 3MTJA 4AL5A 2GGPB 3IDDA 1S6PB 1NK5A 1NEEA 3CJ4A 1FKOB 1N2KA 1T9TA 4HI1A 2ZBCA 1WHYA 2P8IA 1RK8A 2WVDA 4ICLB 3HVRA 3CDEA 2IVMA 1ED8A 5E5NA 1VRQC 4TU9A 1SJFA 4FYVB 4PG5A 1H3DA 2DNLA 5IT4A 1X4HA 1N0VC 3F44A 2XG8A 4NZ6A 4LSNA 4Y6IA 7AT1B 1KHLA 2DNGA 2ZEJA 3I31A 4YP3A 4LBPA 5KFZA 2BE2A 5DM6Q 1DURA 1SL2A 1H74A 2W9BB 1N5QA 2OH2A 5HANA 2D3OR 3LW5C 2C2DA 1VQLS 2KDOA 3OL7A 1K1QA 3BGRB 4WP9A 3Q8YA 1Y5LB 3MFHA 2J0WA 1SI9A 4R8UA 2W7AA 3LP1B 3PEJA 3OBIA 1EB0A 2RSQA 3IBWA 2JHEA 1T03A 4HDGA 1QAXA 3GJRB 1Y9OA 2AEJA 2KYXA 2AGOA 1X31C 4NA3A 3EPGA 4NYOA 1J5EJ 4M8LA 1R31A 4UPLA 2RIJA 1N33J 2XMVA 5GAGI 4TY8A 1VDHA 2PMWA 1JLCB 1IKWB 4X64J 1REVA 4TVAB 1RBLA 3PIOQ 2BE9B 5C2CA 3MMAB 3DOKA 1R3NA 1RKIA 2QA4S 5L0BA 4W90B 4QBUA 4LR7A 4GKJJ 2XO6A 2O01C 3LXQA 4P71A 3M8PA 5LRMA 2W2NP 4X84A 3TW0A 2R2UA 2XQCA 2KKHA 4DV0F 2FZCB 2HWIA 3K5PA 1YRTA 3LUYA 5F8GA 4PR6A 2IC3A 1TL7A 4DUTA 3QJJA 3FSXA 5GMKa 3C15B 1TK8A 4NZ7A 4ZGAA 4USMA 3CDBA 4KV8B 4OFZA 1LWFA 4O3RA 1CPZA 3ELHA 3ILOA 1FWLA 3BYRA 1A9NB 4F2RA 4KR0B 3C16A 3CD5A 3I9V9 4ZITA 2MLXA 4ZDNA 2IBKA 3MEGB 1YVFA 1LWEB 2YTCA 2AEMA 4NCBA 4QZVB 2V4JB 2E9RX 5IC6B 2IA0A 3FCVA 4Z2XA 2PGCA 2MB0B 2P9CA 4UOOA 1NHUA 1R89A 5D0GA 1ACMB 1TK0A 2YBVA 1WKKA 4B3MJ 2AJ4A 1BHNA 2IM2A 1HNIB 1KWMA 3IRWP 2SXLA 3J80U 1XMOJ 3NVLA 2KHCA 3QJPA 3CJ5A 4NLDA 3OHBA 5HQMA 4TYBA 1AFJA 4CTAB 2IVYA 4PUOA 4PWWA 1FFGB 4RKUC 1DJ0A 3EE3A 4OJ1A 5A2QU 2ZE2B 5L9XA 3JS9A 3UO0A 1KQKA 1QJHA 1S6OA 1N36F 2M2BA 2WK4A 4USWA 4DL4A 4FDFA 1UEVA 2VJUA 4NI2A 3AFGA 3IWNC 4OV1A 2OIHA 3AD9C 3UW1A 3TQ1A 3CT9A 2NLWA 3G82B 4KFBA 1ALJA 3AXMA 5ITHA 1BGXT 3FVYA 3M2UB 4DL6A 4ECUA 2FVQA 5CH7B 3PFEA 3WAXA 3UN3A 2HK2A 1ROFA 3KMSA 2FPHX 4K2JA 4XK8C 3KJVA 4H4MA 1QUPA 2LEBA 1HHTP 1OPIA 4DR5J 2B8QA 4IFYB 3VV2B 3GYGA 4RNNA 3RAXA 4FZVA 5C2GA 1HQUA 1FO1A 4OZ2A 1VBZA 3DLLQ 1PC5A 4ATNA 2DHXA 1WORA 3ZTOA 1RTJB 3K17A 2LFVA 2RU3A 3CEDA 2VBXA 1TVRB 4NCAA 3MMCB 3HHLB 2WOMB 2GSOA 1MNEA 5IM0B 3ENQA 3JYTB 3UVJB 2UV8G 3H2VE 5G0RA 5KFNA 1HKAA 4ECVA 1HQEB 4JBCA 1FD2A 2E1RA 4KC5A 4DSEA 1TFYA 1JLGB 3GPAA 1B7FA 3C14A 2OEKA 2DR5A 2XYPB 2M9KA 4CXUA 2DXDA 4LFBJ 4JI0F 1FSUA 2GVDA 4J9SA 4KAYA 2LVWA 1VQ8S 4OI4A 2E5GA 4HACA 2F4VF 2CQPA 4CLKA 4MKYA 1EJJA 4YOEA 1FHTA 3OFFA 3BV8A 2PA3A 5I42A 2X1GA 3MD1A 2BKOA 2R7XA 3R2DJ 2R7UA 1MU2B 2BV3A 3H8YA 1HNXJ 1URAA 3MMBA 3M2VA 2XS5A 3TAMB 2M8HA 5IV3A 1H7XA 3NEKA 4NLTA 1WELA 4O44B 1VCTA 3V2UC 2MKHA 1U0HA 1ELOA 5LQQA 2V8PA 4ED4A 4XDCA 3R7NB 4ZPVR 1YTYA 3HSDA 4DMZA 3W9IA 4J9MA 5C42A 1IKYA 5KFOA 5LMUF 1O98A 4Y2IA 1YI2S 3ZFVA 3B4DA 3SXLA 2XNQA 3QO9B 3PO5A 2OPQB 1VLOA 2YNIA 5B0GA 1M5OC 4K4UA 2B4VA 2PMZD 2XMAA 3H20A 4FPIA 2DR9A 4HT7A 3K5OA 2V63A 2E5LF 1RTDB 2W4CA 4OZ0A 3QLHA 3KHGA 3PYFA 1AJCA 4DV4F 2NUUG 3GTYX 4QYRA 2JLGA 3CCMS 2W5TA 4PPDA 1VQYA 1VC5A 3GWCA 5IWAJ 5HL7Q 3D3BJ 1SJ3P 3SI8A 4QOTA 2CQCA 2UUWA 4PKDB 3BGOP 5SUHA 2F3JA 3NBPB 5DZ6A 4NZ0A 3CJ8A 3V4IB 3TZYA 1H73A 4ER8A 1EIYB 3K59A 3VAKA 4UUXA 1FXRA 2ZHAA 1K73T 1N52B 4RNFA 2OP5A 4YDDB 2HMIA 4FNHA 5K14A 1C2PA 2AJ1A 4AL6A 4PWDA 1B0TA 1CSJA 2RT3A 3DRSB 4CNYA 3ZXWA 4JI4J 3CMAS 3FK4A 3OL8A 3E2DA 3P49B 1OY9A 4Q2MA 3SV4A 2B6AA 2RKIB 1JLFB 1NAQA 2ZJRQ 3TARA 4OI6A 5JJBA 1ALKA 4ECWA 3CMRA 4ZG7A 1VK3A 3IA0A 2C3YA 3PW0A 3AOBA 2LQ5A 4N56A 5J2PB 3PW7A 2KM8C 5IJQA 5D0RA 2DNOA 5CAAA 3GG1A 4CYUB 2DGTA 1A6LA 1IKVA 2LU1A 3V6DA 1Y0HA 1TMMA 4CLSA 3Q8UA 3L4BC 2MKIA 1OYDA 5A8KB 2O3DA 4B17A 2ZZTA 5I3UA 4C0HA 1TUVA 3M9OB 3CJ0A 1U48A 4A8QA 4UQTA 1LW0B 4ZVQB 2K1RB 1HQAA 1HPZB 4Q8EA 4MAKA 1UVNA 1APSA 1X8DA 3IBFB 1T05B 1VJWA 4PG6A 1WOPA 1QM9A 1BC6A 4OMFG 1FJGF 5KG6A 3KLEA 3DGPB 4I2QB 2Y1IA 1YGYA 4DQQA 5BYRA 4ZCIA 2BR0A 2OMLA 4EWTA 1YRXA 1X9MA 1P1LA 1DQAA 3D0IE 3C66A 3KHRA 3SQGB 4IRKA 2QX0A 1C4CA 1MN7A 1FEEA 3N6LA 1KLMB 3JAMU 3MR3A 4PG7A 4PYAA 5F0WA 4OYOA 3BR9A 4DEZA 4RUHA 1T94A 4F4WA 1FVQA 2DT9A 4F0HA 2GMLA 2XB2D 2CQ0A 2ZWPA 5CCLA 2HNYB 4NLWA 2HK3A 4OYBA 4OZJA 2YKOA 2LCWA 4CCHA 3EM1A 4LF9F 5B7WA 2AT1B 5KFRA 2XZDB 1U4BA 3D1OA 1CULB 4OHZA 4LREA 2YKMA 3BZQA 2B7BB 3JSMB 3HSZA 3FSYA 5IV4A 4TN0A 3HVWA 1CJUB 4USKA 4DS5A 4L74A 3KG1A 4IUFA 3Q0AA 4M5DB 4F36A 1BQMA 4J9KA 3LOUA 3FGVA 4PEOA 2YWEA 4W98A 5KFSA 1PJ6A 2VG5B 1AT1B 2HFNA 1WSVA 2YNHA 5IXUA 5HATA 3RBZA 3DLHA 3OR2B 2Z57B 1S9GB 2JDJA 3DHWC 2OO4A 1RHQB 4Q8FA 4WK3A 4JV5F 2XLKA 2JEGA 2C2ZB 3NGRA 5HMWA 4R0EA 2VHGA 2WONB 4PRFA 3AD8C 4LIWA 3G6YA 3AQOA 2DPJA 2HVDA 2XSJA 1BMQB 1DFDA 1OY8A 4N8NA 2DPIA 2ZM6J 3LP2B 5KFKA 4LF5J 1SQEA 2YKNB 4C0BA 1RU2A 2PE8A 3F56A 3BDGA 4DR3F 3MR2A 1ZYQA 3HHKA 4MYTA 4FYYB 2C2MB 6FD1A 1RT5B 2AIRB 2HNZA 3GONA 1CG2A 3W2VA 4P74A 3ZTSA 3DLGB 2KXFA 1LXNA 5KFVA 2PA8D 3WBZA 3MEKA 2BUNA 2M5YA 2QGFB 1FKAF 1JK9B 4ETXA 5LXYA 1N6QA 3UCZP 2EFQA 3FBFA 5KG4A 4O3NA 1U7LA 2NUHA 2DR6A 3T1HJ 3CDWA 4DV1F 5C25A 2R3VA 1KBRA 4GRSA 1D8ZA 3MAHA 2BJ1A 1U1PA 1PYTA 1TKZA 3BH6B 2OPPB 4B3SF 3GIRA 1RT2B 3L3CA 4AXJA 4L3KA 4DL0C 5K20B 2R4FA 3UPFA 5F9NA 3E8OA 4J9OA 1FVSA 2HNDB 3I9ZA 3FEZA 1CJKB 2MKJA 3CJKA 1AA1B 1GMWA 1HW9A 3ZZ0A 2MHEA 1IQTA 1RJJA 2UUAJ 3AOCA 2CIMA 3KLFA 2GAGC 4CZCA 1UZHA 4B9MA 4EBCA 4UQGA 3M8SA 4EMDA 2IY5B 4FXVA 1N34J 1IBKF 2NSCA 3TVYA 3PR5B 4ECQA 4ILRA 5HRTA 1HI8A 2ZBIA 3VQTA 4LSLA 3W3SA 3HFKA 2GFFA 5ETNA 1GH8A 4QPTA 1S9EA 4I6AA 2JRSA 3DN9A 4DLGA 3FCWA 4MKVA 1J5OB 2FJDB 1OO0B 1U8WA 5H1SV 2D1GA 3PYGA 3PX0A 4UOPA 1U49A 3S8SA 1WDDA 3ZZTA 4KT0C 4YR0A 2IIHA 2D3O1 2E1CA 5KAKA 4DPXA 3OTOF 3BO2A 3DOLB 5J2NB 1HBNB 1SC6A 2EEYA 2C3OA 3R27A 3NAIA 3BBCA 1JJHA 1UVMA 3THTA 3D9BA 1Z4UA 3GV5B 3PHTA 2EFGA 4I6YA 4NEYA 1S49A 2WSEC 4XAKA 2EK6A 4NXNJ 4WP8A 1NPRA 1FX2A 5HMZA 1IR1A 3QSIA 2HGNA 4JI1F 4I2PB 1T9YA 1RB0A 3TNVA 1KFSA 1QE1A 3ITHB 3BF4A 2PO4A 3KK2B 1F3FA 5HROB 3P8BB 3C2PA 4KH0B 3MDFA 2V69A 3US5A 3QWUA 1RT4B 2MZTA 2R8KA 1D09B 4WK1A 5CHCB 4M94A 1EP4A 4NLXA 1HNZJ 3I0SA 4ICLA 1LK5A 4OI0A 3SYZA 1ZEFA 1TFWA 4C0OC 2XR9A 2LXUA 4I7FB 5L1LA 2PC6A 2GJFA 3IMQJ 2HRTA 1AZSB 1VQMS 2QIFA 1U45A 1B3TA 1OPZA 3DCAA 2FHKA 3CTRA 1X5TA 1SUQB 4GTZA 1C1BA 2MLZA 1KS2A 1ICEB 4ZPTR 4GVBA 3K5LA 3KTQA 1Q82T 2N7CA 2ZNZA 4KE5A 3SV3A 2DD8S 4GTWA 5ETTA 2W01A 4PXCA 4ED3A 2V8HA 2BA9A 2L48A 1FE0A 1R0AA 2HHTA 1SV5B 2B9YA 4QIGA 3PVXA 3LP1A 1X5PA 3JSYA 4YN3B 1EW2A 4A8MP 5EUHA 1L3TA 1ZOTA 1RDRA 3C6UB 3S1TA 2RHQB 1XWLA 4J91A 1V9OA 4ID8A 2K7JA 3CDAA 3HF5A 2BYCA 2MQMA 2R42A 4H4KA 3TO8A 2GQ2A 4CH7A 2YNGB 3BGLA 3G8QA 2YKAA 4Y2CA 3DRRB 5J2QA 1R8PA 2HHPA 1CS4A 5F9LA 3GCWP 1DZ5A 2XMKA 1FKPA 5E7OB 3VAIA 4DN0A 5A8WB 3ZTQA 1JLCA 2OPSA 3AAWB 3DLEB 8RUCA 3DM2A 1M90T 3R6GB 2P6TA 2QLWA 3CCZA 2XM3A 4MT1A 4DCJB 2RDIA 3BYPA 2N3LA 4XIUA 2I0XA 4NYPA 4DL7A 4AT1B 3OV7A 4CT9A 3UDEA 2QA4G 1F9EB 3R9LA 4ZLPA 3CGIA 4F7VA 4C11A 4ZLJA 3MM5B 1HWJA 1FJ7A 2ASDA 5DDRC 5CXTA 1RTHA 1ZAWA 2OFHX 3D6FB 4TU8A 4ZP8A 3UNYA 2XYHB 3FC9A 2CUYA 4A4JA 1RWMB 1VQ6S 4OZ1A 3MZIA 3UN5A 1EKRA 1NBEB 3VAJA 4LF7J 3FDSA 2V5HG 3FJ2A 1GX5A 3WC2A 2V4JA 3TOQA 3PNIA 1SPBP 4OIXA 4L72B 5BR8F 4GTXA 2BACA 4DPTA 3QYYA 1S72S 2XSFA 1S1WB 4WTYA 3BKFA 2V8DA 1RT7A 5HO4A 4ZOSA 3M05A 2UVRA 4QJVA 5A8RA 2CWXA 5FDLB 4KB7A 3FZBA 2ROGA 4CTAA 2MQQA 2WW8A 2V2QA 2XMTA 4RW6A 4PZVA 4YQWA 1T9WA 5A0YB 2CKWA 1U1MA 1VOMA 2BOPA 3H2LA 2CPZA 1OMSA 4ZJQA 1FRXA 2YPZA 4RW7B 1VHFA 2AYMA 4JI2F 5BYSA 2W9AA 5DDPC 5KT4A 3N5BA 4DQIA 2UXCJ 1RHMB 2VC1A 2B9WA 1T8EA 4E98A 4XPEA 2DNQA 3D5MA 3B4MA 3CCWA 3G82A 3FFIB 4QR0A 1HBUB 2YH1A 5KOXA 3AD7C 2QZ8A 2A2DA 1S99A 1P9QC 4KRWA 1MMLA 2C3MA 4OYWA 2ZD1B 3H5YA 3WAVA 1AJAA 4NA2A 3CW2C 3T6BA 1HR0J 4FYWB 2OI2A 1N36J 5JVGQ 4UY85 3VAFA 3C6TB 5KFMA 1CQMA 1ZETA 5AE2A 4QYZK 3W63A 2CJBA 4I64A 2I38A 2HRYA 1M5SA 3ZTPA 2IRYA 4FNIA 3P45B 3CCQS 1ZEDA 2RILA 3MPDA 3PHEA 9ATCB 2A6MA 5B0FA 2IUCA 2F9JA 2EG2A 4CLPA 3OHAA 1TUWA 1TVRA 2X7IA 3CDUA 2QLJB 5HSPA 3RAQA 3OJUA 3ILLA 1VRUA 4DSJA 1VR6A 3UVJA 4F4AA 1HBMB 1VI7A 5H9FK 2JLFA 1L3UA 2GA7A 1DRZA 2OTLS 3LPYA 2IDEA 1RT6B 1Z2LA 3DMJB 3D0HE 4C8ZA 4RUCA 4HHJA 2EPIA 2LLZA 3BSCA 3O1LA 4FXDA 4OLOA 2DNYA 1YJWS 1E2SP 4ID5A 4K7QA 3H5SA 3R5GA 2DGVA 2RQKA 1IBMJ 1YWXA 2K06A 4IG3B 2POKA 4I1TA 1X9WA 2KHDA 4D3GA 1X5SA 1XR5A 4ZN3A 4IR1A 2ASYA 2AP6A 2VH7A 3TRGA 3BGFA 4KHRA 3TP2A 3D54A 4ANEA 1W2IA 3W8GA 4JI0J 3K57A 1S1XB 1BWEA 5GADI 3NKOA 1KNZA 4PXDA 3THVA 3BEGB 1LWXA 2OGUA 4OI2A 1HA1A 3N9UC 4HVZA 3SFGA 2PFFB 3JSRA 1UJ5A 5RUBA 1DAXA 1YJUA 2CJYB 1MG7A 3W60A 1X9SA 4G1QA 1UPMB 4U9RA 1FK9B 4ZP9A 4OYZA 3GJTB 5IOLA 4YR2A 2R9LA 1HI0P 3M8QA 2U2FA 3HJFA 1LNQA 1RBAA 3ZZZA 1HYSA 4OI3A 4OX6A 5GADU 4NX9A 5LMUJ 3J7AN 5ETKA 1PYOB 3U7JA 3Q8SB 1Q0NA 3WX4A 1RTIB 2GLQA 4B08A 3ICLA 3GLJA 4DV2J 2VFTA 2VKRA 2E5LJ 2J6SA 4DR7F 3EGWB 2FZKB 1KLNA 3SFUA 5KFEA 4CLTA 3CO0P 5KFJA 2MZ1A 4QYZJ 1TAUA 1O5JA 4FKYA 3CNQP 2B5JA 2J76E 3EMTA 3DRSA 2QLFB 1EHWA 1ALHA 5EWFA 4C6AA 3OFHA 2AV5A 2XRGA 3QFHA 5AE1A 4L6V3 2VASA 3ED4A 1KRPA 3QAUA 2VC0A 4C48A 3MOJB 2KG0A 2W9CB 4RX6A 4UPKA 1GMWD 5H9FJ 3Q89A 5H9EK 4NMLA 4K0KF 2FLNA 2HHQA 2F8EX 4O3SA 1O8BA 4IO9Q 1JXEA 4A46A 2M3DA 1KFDA 1Y5IB 3JQKA 1JWWA 2IMWP 3RB4A 1F60B 4CYUA 2AU0A 2MDAA 4IH7A 5KFQA 2XHWA 1S59A 1G1XA 2FVSA 3KLIA 1S1VB 1RT3A 5DO2A 3AOAA 3J7A1 2ZH8A 5A8KA 1B8JA 2EVZA 3HPOA 2MJNA 3VALA 1WI8A 1S57A 2IVFB 4H4OB 4JI8F 4LR2A 2C1EB 3HHNB 5KFUA 4C2MA 2J9CA 5DG8A 2DCUB 1GTHA 2BJEA 1KDNA 3HI9A 3ILIA 1WF1A 1TL4A 2ASJA 1FRIA 3WX8A 1U26A 2LEPA 4J9VA 2V68A 1UJ4A 3AJDA 1G3OA 2BVZA 3NXZA 4XDDA 2M7SA 1GEHA 3PV8A 2KYZA 3A3OB 1U1LA 3MFIA 3NKNA 3G4SS 1X4EA 5J1EA 4I0WA 1DY3A 3UDVA 2FUG9 2I1RA 2ZOFA 1P27B 1VBXA 1UVJA 9RUBA 1NKEA 2R2TA 3Q24A 4HH1A 3A4TA 3SCLE 2OHDA 1FJGJ 2XNRA 5F8MA 3LGMA 1RUSA 1TL3A 1RLDA 1X7VA 1YBAA 2NPIA 4PYDA 1PIEA 3K5MA 2Y0BB 1T02A 5L38A 1S6QA 2WB4A 2R8JA 4PXBA 1LV5A 1LQ9A 4KGZB 2HHWA 3LP0A 2YX7A 3J7Z5 1WC6A 1QAJA 5AJ9A 4J9QA 1KVKA 1TKXA 3CIZA 3J7ZT 1DLOA 5CD4H 3TVKA 1HHSA 1PBAA 2LQBA 2GO9A 1XQIA 4F50A 4ZVSB 2LQJA 1NJYA 3EXCX 3FQLA 1RWKB 1AB8A 2BZ2A 1U1NA 5K8PA 2CQHA 3TEHB 3HHDA 4DL5A 1RHKB 2W7OA 1RWUA 1QAYA 3GYXB 4JB8B 1H2TZ 7FDRA 3CMES 3OR2A 2CPXA 3F73A 3SCJE 2VB6A 3KOAA 4C8MA 4TLRA 3NOCA 3OW2R 4DU8A 2R7VA 4NCGA 4CO2A 1KR4A 3KUHA 2NYIA 3VR1A 2PT0A 2UUCJ 3M2RB 4WKRA 3L9ZA 2WONA 4OYAA 5I3QA 3F0NA 4MIVA 4MYUA 2PFDA 4IG0A 3OR1B 1WOSA 2K8GA 2RB7A 5H9EJ 1BQXA 4HYKA 4NXMF 2HIYA 2F63A 1B0PA 3MGJA 1RBOB 2AHOB 1CQNA 5KT5A 4DL3A 3U1LA 4N5SA 2BQ3A 1WOOA 3D0GE 4B9UA 2ZC3A 3HCXA 1OS5A 1S5ZA 5E33A 1KHJA 3W8PA 2OKQA 4DR2J 3MCSA 1BXNA 3WZ0A 2DJWA 4JV5J 2GX8A 1SBRA 2UVWA 2DY9A 3J81j 4MIAA 2GIQA 2Y1RI 1DTQA 1R8AA 3VGVA 2B4PA 4DZ6A 4A8OA 1NSPA 1F5BA 3T6JA 4N7TA 1WSRA 4M5JA 3E01B 3GSDA 4FF4A 2JFKA 4F25A 4FS1A 3ZNJ1 4FBUA 2ILZA 1KP6A 3SSQA 2QYGA 3AHPA 1EQMA 4OJ3A 4DR3J 2DRDA 2DGQA 2HKEA 1REGX 2GNKA 4PQUB 3QWPA 5DM7Q 2FDNA 2J5AA 3QBCA 4C98A 2HW3A 1SQFA 1RYRA 2VA3A 2NQPA 2FC9A 4WZMA 3DRPB 1I5OB 2JH3A 1HHQA 2KB2A 4DR4F 4DS4A 3H40A 1L5UA 4GKKF 5J2MA 2JEFA 1HNWJ 3QRQA 1U1OA 3CF5Q 4NLYA 6FDRA 2I5JA 4YB1P 4DV1J 1AUDA 4DG1B 2IM1A 3MM6B 4B3RF 2F40A 3KK3A 3RBDA 4P9SA 1GXTA 4K50A 1NJZA 2XHCA 1Q81T 4B3SJ 2XCAA 3T5KA 2OMOA 3KDOA 4P2FA 1GNKA 2KVQE 4KQZA 1M0SA 3T9ZA 4DUYF 2WVEA 2DNKA 1JQGA 3OLAA 4M5HA 1UW4A 2YXLA 3MEEA 3I0RB 2G9YA 5K4PA 1V6HA 4ZKAA 1J5OA 1HWLA 1L3VA 2Q66A 1RT1A 2JEIA 2FQQB 1DTTA 4KGMA 1Y5NB 2R2SA 5E0OA 2BDPA 2V6AA 3Q2SC 1UEUA 1YITS 2VOOA 2FJEB 5E3CA 3W2WB 3HM9A 2H1YA 4CQ1A 2Q79A 1WF0A 3HT0A 1IBKJ 1KQFB 1UAWA 4LQ9A 3TUJC 4PXEA 3UD3P 1YZ7A 2HRUA 3ZZRA 1NLKL 3CC4S 5F8JA 2A0FB 1HL6A 3IM9A 3BH7B 1WC0A 4MKAA 2QMXA 4EI2A 1YJ9S 4H4KC 1A7GE 5KG5A 2V9WA 2XWXA 2FGCA 2GS8A 4OX9F 1TL1A 3DDIA 3CJSA 3MUVP 4QQBA 4DFMA 2VPZB 5DLFA 4HTJA 5K5MA 1IM4A 3VCDA 4MFBB 4OL8A 1SC4B 3QAEA 2HQCA 1S12A 4WKYA 1Q8BA 3OPKA 1WKLA 2UXBF 3THPA 1UTAA 4O0NA 2B9EA 3KHLA 4DQPA 4I7FA 4FDIA 2D69A 1JLBA 5BXIA 5HBMA 5EGYA 3QJLA 1YBTA 3GP9A 3LWMA 5KTQA 1UWAA 4JI1J 3CD0A 5HMYA 1Y3JA 2VQRA 3H0PA 5D77A 2GJ2A 3BQ2A 1NSQA 3DI6B 1NJIT 3Q8VA 4USJC 3D6MB 3O5TB 2FJAB 2CXEA 3M8YA 2AZ3A 3Q23A 2MKSA 5BYQA 1E6YB 1GTEA 2RHSB 1SKUB 2J8AA 4DUZF 2HFVA 5AJ3F 1R7IA 4YHHJ 2JC0A 3P96A 3ULHA 1URRA 4NWBA 1TAQA 1HBOB 3KUGA 3B78A 1T9UA 2DGXA 1HLWA 2W5RA 5IT0A 1IJFB 2F5GA 2KT2A 2YKQA 3DRRA 2BKPA 3DXBA 1CJVA 4TYAA 5ETMA 2GA3A 5KG2A 3Q22A 4B9LA 1I6JA 5T7LB 5IZHA 3UD5A 1E3CP 1LW2A 5CYMB 4LRDA 5KG7A 2WZ1A 3OUYA 4Q0BB 1FA0A 2VFUA 4ED8A 2DHGA 3QIPB 1BUXA 2YNFB 2A18A 2K3KA 4N77A 2EFNA 3GU0A 2ATCB 4NYZA 2YWGA 3VZHA 3IR5B 4JI6F 4FYXB 1WG4A 4LRAA 1WD6A 2L41A 2YWHA 1QSSA 4A8XA 3DOMB 1FRLA 3P5TL 1VFJA 3RW7A 4KAIA 3MK2A 1EETB 4J37A 1YJTA 3O6QA 3R5AA 4JYAF 1Q78A 1S1TA 2CG8A 2MY8A 1K8AT 3VTIA 1FI4A 1KH7A 1CJTB 3EXYA 3U1MA 3HD2A 4J5OA 4K2XA 3M7VA 4FBTA 3NNAA 4EBEA 2AW0A 3MTKA 1JNZB 3PZPA 1RA7A 3HVTA 2H51B 2QG9B 4DDFA 4K59A 5K8OA 5DLVA 3GZ7A 4UF4A 4CNZA 1S9FA 1FNMA 4RW7A 5BR8J 1EQJA 1M5KC 3GFXA 4J90A 2XO7A 4IYQA 2FVCA 2Y1JA 3VQSA 2EFPA 2GSUA 4C9DA 4OQJA 4PG8A 4URGA 3F41A 3R5CA 3MAAB 4B9TA 4YY3F 4KY3A 5KXAA 4XPCA 2UU9J 1EQ0A 3TX0A 3GB0A 2KT3A 2ZUGA 4WFZA 4V19J 1JLEB 3CCRS 2RAQA 4KGVB 3WAYA 1HW8A 2VQEJ 1VHIA 4LRCA 4P6QA 4CH1A 4B3OB 3AJ2A 4P52A 4PG4A 3W64A 3EZUA 2ZNYA 2HFZA 4LJMA 1ZM4A 3KG4A 2QSFA 4F8RA 3NOGA 1PO6A 4Y2AA 2U1AA 2YWFA 1WTBA 1C0UB 3W62A 4KSEB 3HULA 4FS2A 3EVOA 4LVOP 2AJFE 5EX3A 2W5VA 1SH2A 3I87A 4DPYA 2D3UA 3ONQA 4ETZA 1MWQA 2YQ1A 2W8KA 1I1GA 2WHOA 3PRBA 3CMQA 3ET6B 3RR8A 4DR6J 5KFXA 2B0GA 5HP1A 2RJZA 1H72C 4J9NA 1RYSA 1WHXA 2XTJP 2LDIA 3MM7A 1RZMA 2M70A 4X4PA 2ROPA 3AJ1A 4USUA 2E5HA 1I51B 1SH3A 1VBKA 3EWGA 2WSFC 2ZZMA 3NNCA 3VAHA 2QSWA 4WIQA 2CQIA 4ZN1A 5JVHQ 2V2KA 1DBDA 1RE1B 1IKXA 4ZIVA 3AA9A 5GAEU 1WWHA 2WAQD 2YX1A 1LFPA 2GW8A 3JSBA 1N56A 1V3SA 4ZJOA 2G0IA 2BW7A 4U7UD 3FUYA 2QLBB 2VPXB 1C1CA 3W5ZA 2HS0A 2BE2B 1S1XA 2A6OA 1NRKA 1UP1A 2RS8A 2HSEB 4HT5A 1MLAA 4C8NA 1J5EF 2GVZA 4RLEA 3MPYA 5FLXY 1X5OA 3ZO7A 1N33F 4R8UB 3MMJA 2L9NA 2IJNA 2ABYA 4WYWA 1T03B 1NXIA 4K4WA 1D9FA 4DFJA 3PR4A 2VA2A 1DHMA 1I94F 1J2VA 2Z8QA 2FY8A 3SSSA 1SJ1A 3AA8A 4C7QA 1Q53A 2N3OA 4LF2A 1REVB 3DOKB 1KTVA 3N0VA 2G4BA 3CJQA 2HLUA 3UNGC 5LJ5Y 1NK9A 3KKFA 2BANB 3M8PB 4RWXA 1NPKA 3T19A 3PRDA 3D1QA 4UOGA 2IC3B 1TL7B 3CD7A 2HYIB 1IBLF 3J7YU 2B8PA 4NPOA 2EBEA 4NRUA 2VKZG 2Y8YA 1FRJA 1LWCA 5BJRA 3CB4A 4C8OA 1LWFB 4DL2A 3L7UA 1RAJA 5B09A 4DR7J 2W8LA 3MCOA 3DNCA 2KL8A 4U8VA 4KM4A 3C16B 3ENVA 1GXUA 4ZP6A 3VGTA 1BQNA 5KFDA 1NJXA 3GFHA 1TU0B 4FF2A 5L1KA 1HWUA 4I4BA 1UFLA 3R7SB 1S1VA 2FLPA 1U2CA 2Y8WA 3SIPB 2P2CB 1R8CA 1Y11A 2B3TB 3ADAC 3G6VA 2D7SA 4K4VA 2VF3A 1XNRJ 3UD4P 1OSDA 3H5UA 2DIVA 3Q8PB 4RBUA 4J9RA 4K0KJ 1I3OB 4DV3J 4PUOB 2GSNA 4ZPWR 1GXLA 3MM9A 1UW9A 4P2MA 4Y00A 4V1Ak 2AMCB 2HHHJ 4FVCA 4LR8A 1Y10A 2Z2YB 1S0VA 1X4CA 4BWMA 3G86A 1FX4A 2ATLA 5K8MA 4NI2B 1URNA 5HVGA 2M52A 3UFCX 1FWPA 2HHXA 4USHA 3VWSA 4KJDA 3I32A 1RHRB 4KFBB 2IBOA 4YDXA 3IRXA 5DQHA 4ZPBA 2JX2A 1K1SA 1S10A 2HGMA 2MPUA 4R0JA 3KJVB 2M0GB 4H4MB 4A8KA 3EDRB 5F41A 2KH9A 3MR6A 5TJ3A 2LDYA 3NGSA 1HQUB 2ERRA 3A1YG 2QA2A 3PYEA 2AYBA 3KNGA 3BS9A 2J9DA 5T41A 3HLUA 2DBBA 3PRVA 2OEJA 3G2XA 5HAOA 4F4YA 3RRKA 1RXOB 2RMLA 3ENAA 4DSIA 5DGBA 4ED2A 3G8TA 1JKHA 4ILMA 3LH2S 3BSNA 4JP8A 2R7OA 2FTRA 3CCTA 5I4MA 5G0RB 1JNRB 3W61A 3Q8RB 1G6BA 1KVJA 4DZDA 1HNXF 4MMOA 3ETMA 3TAPA 2CPFA 2EI5A 2JJ4D 2XY6A 1TR0A 3TUPA 3BO3A 2AJQA 4RW8B 4ED0A 4JOUA 2NREA 3QGHA 1V3ZA 2GVDB 3Q83A 1UETA 2FJBB 1E1ZP 4HL9A 4HACB 1F9HA 2XYGB 2PD1A 1W26A 3H90A 2CRLA 3OR1A 4X4NA 2E1AA 4C8KA 4UT4A 2QMWA 3T1YF 3W5YA 1N5VA 1F1BB 3MMBB 2QEXS 4P2SA 2BJDA 5INHA 2MZQA 3M2VB 1MWZA 5EWEA 2HVIA 3FBBA 4O0IA 4C4WA 2HVEA 2B51A 2EG1A 2YWWA 2XEXA 1YKWA 2KXNB 1WEXA 2MKYA 5D78A 2LECA 4KHPJ 4QU7A 2ASLA 2N82B 5C42B 4IRCA 2D9PA 1F3VA 3LO3A 1AROP 2CJQA 2LP4A 3CCUS 2UUTA 4MH8A 1H2UX 1ZTTA 2CDQA 2QFJA 3PDNA 3M1VA 3VF0B 3MUMP 1NDPA 1RCXB 2YNIB 4NLPA 3GFZA 2LQ9A 4GTYA 4EO6A 4RU9A 1AFIA 4EBDA 2IPOB 3T00A 3L7PA 3QLHB 3HO1A 2ZKTA 4RJVA 3NMAA 2L9DA 1Y7PA 3BN7A 5EX0A 4N41A 2PN6A 3R1LA 3SZYA 3M6WA 3DLKA 3VAMA 1XERA 4ZPDA 3QZ8A 2QZUA 2Y1LB 2BM0A 1WACA 3PCOB 2CQ4A 3I96A 4URQU 1SXLA 2HWHA 2DRBA 5CD4A 1N8RT 1WHWA 4AD6A 4LF6J 4ANDA 1RA6A 1SC1B 2HHUA 3NKRA 2HMIB 2UXDF 5K14B 2G1HA 4UPHA 4PWDB 4TXSA 3QFWA 3KK1A 4OV6A 4DR4J 4GKKJ 4F26A 1PILA 2VBYA 4CLLA 3MR7A 4MIWA 2P5VA 3BDHA 2MHNA 1WNEA 2DO0A 1AUSL 5C66A 2AX1A 2W5XA 4RW9B 4ED5A 2B6AB 4OYPA 1NM2A
chains in the Genus database with same CATH topology
3TWZA 5IJQA 5L0EA 1KH7A 1KHLA 3DYCA 1SHQA 3WAYA 3M8ZA 1ELZA 4GTXA 1E1ZP 4B56A 2RH6A 4GTZA 1N2LA 4LRCA 2X98A 4QAXA 5EGHA 3SZYA 4MIVA 5DLWA 4LRBA 3M7VA 3B5QA 1E3CP 1URAA 1ANIA 4FDJA 5L0KA 3DPCA 1AJBA 1EI6A 5L0BA 3NVLA 3MK0A 4LRFA 4CXSA 4LRDA 2VQRA 5GRRA 4MY4A 2GLQA 4LR7A 2QZUA 3LXQA 5TJ3A 4GTWA 1KH5A 4KAVA 1URBA 1AUKA 4UORA 5IJSA 5LRMA 1KHKA 1ZEDA 1B8JA 1HQAA 3IGYB 1K7HA 3BDGA 1SHNA 5LQQA 4LREA 5LRNA 2IUCA 3BDFA 5AJ9A 4LR2A 3NKOA 4CYRA 2ANHA 1P49A 4TN0A 1ELXA 2GSOA 5INHA 3M8YA 3SZZA 1E33P 3MK1A 3UO0A 3TG0A 3KD8A 4YR1A 1KHNA 2W5SA 1KHJA 2W5VA 4NWXA 5DLVA 1KH4A 1HDHA 1O98A 1EW2A 5LIAA 1O99A 1ELYA 2GSNA 3BDGB 1ED9A 4LRAA 4UPIA 4ZGAA 5GOVA 4LQYA 2IUCB 5EGEA 1EQJA 5HRTA 4NWJA 3NKQA 3IGZB 1ALHA 3OT9A 3NKRA 1ALIA 1HJKA 2GA3A 3IDDA 3Q3QA 2XRGA 4MHXA 3M8WA 3T01A 3E2DA 4CXUA 4LR8A 2IFYA 3UNYA 1EW9A 4N7TA 1N2KA 4KJGA 2GSUA 4UPHA 3ED4A 3MK2A 4CYSA 4ZG6A 1FSUA 1ALJA 3WAWA 1AJCA 3NKMA 3WBHA 2G9YA 1EW8A 1ANJA 3NKNA 3NKPA 5K4PA 1ED8A 2W5TA 4KAYA 3UN5A 2W5RA 1ZEBA 3A52A 2D1GA 3BDHA 5KXAA 4UOPA 1ZEFA 2W5WA 4UPKA 2W8SA 1ALKA 2ZKTA 5DLTA 2XR9A 3T02A 3WAXA 3UN3A 3WAVA 5C66A 1E2SP 3CMRA 4GTYA 2W5XA 1AJAA 3TX0A 4ZG7A 1Y7AA 4KJDA 4UPLA 4ZG9A 2W8DA 3T00A 4CXKA 4UOOA 4LR9A 4FDIA 3UN2A 4KM4A 1AJDA 1KH9A 2W5QA 1EJJA 1Y6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWZ A;  5IJQ A;  5L0E A;  1KH7 A;  1KHL A;  3DYC A;  1SHQ A;  3WAY A;  3M8Z A;  1ELZ A;  4GTX A;  1E1Z P;  4B56 A;  2RH6 A;  4GTZ A;  1N2L A;  4LRC A;  2X98 A;  4QAX A;  5EGH A;  3SZY A;  4MIV A;  5DLW A;  4LRB A;  3M7V A;  3B5Q A;  1E3C P;  1URA A;  1ANI A;  4FDJ A;  5L0K A;  3DPC A;  1AJB A;  1EI6 A;  5L0B A;  3NVL A;  3MK0 A;  4LRF A;  4CXS A;  4LRD A;  2VQR A;  5GRR A;  4MY4 A;  2GLQ A;  4LR7 A;  2QZU A;  3LXQ A;  5TJ3 A;  4GTW A;  1KH5 A;  4KAV A;  1URB A;  1AUK A;  4UOR A;  5IJS A;  5LRM A;  1KHK A;  1ZED A;  1B8J A;  1HQA A;  3IGY B;  1K7H A;  3BDG A;  1SHN A;  5LQQ A;  4LRE A;  5LRN A;  2IUC A;  3BDF A;  5AJ9 A;  4LR2 A;  3NKO A;  4CYR A;  2ANH A;  1P49 A;  4TN0 A;  1ELX A;  2GSO A;  5INH A;  3M8Y A;  3SZZ A;  1E33 P;  3MK1 A;  3UO0 A;  3TG0 A;  3KD8 A;  4YR1 A;  1KHN A;  2W5S A;  1KHJ A;  2W5V A;  4NWX A;  5DLV A;  1KH4 A;  1HDH A;  1O98 A;  1EW2 A;  5LIA A;  1O99 A;  1ELY A;  2GSN A;  3BDG B;  1ED9 A;  4LRA A;  4UPI A;  4ZGA A;  5GOV A;  4LQY A;  2IUC B;  5EGE A;  1EQJ A;  5HRT A;  4NWJ A;  3NKQ A;  3IGZ B;  1ALH A;  3OT9 A;  3NKR A;  1ALI A;  1HJK A;  2GA3 A;  3IDD A;  3Q3Q A;  2XRG A;  4MHX A;  3M8W A;  3T01 A;  3E2D A;  4CXU A;  4LR8 A;  2IFY A;  3UNY A;  1EW9 A;  4N7T A;  1N2K A;  4KJG A;  2GSU A;  4UPH A;  3ED4 A;  3MK2 A;  4CYS A;  4ZG6 A;  1FSU A;  1ALJ A;  3WAW A;  1AJC A;  3NKM A;  3WBH A;  2G9Y A;  1EW8 A;  1ANJ A;  3NKN A;  3NKP A;  5K4P A;  1ED8 A;  2W5T A;  4KAY A;  3UN5 A;  2W5R A;  1ZEB A;  3A52 A;  2D1G A;  3BDH A;  5KXA A;  4UOP A;  1ZEF A;  2W5W A;  4UPK A;  2W8S A;  1ALK A;  2ZKT A;  5DLT A;  2XR9 A;  3T02 A;  3WAX A;  3UN3 A;  3WAV A;  5C66 A;  1E2S P;  3CMR A;  4GTY A;  2W5X A;  1AJA A;  3TX0 A;  4ZG7 A;  1Y7A A;  4KJD A;  4UPL A;  4ZG9 A;  2W8D A;  3T00 A;  4CXK A;  4UOO A;  4LR9 A;  4FDI A;  3UN2 A;  4KM4 A;  1AJD A;  1KH9 A;  2W5Q A;  1EJJ A;  1Y6V A; 
#chains in the Genus database with same CATH topology
 7FD1 A;  1Q79 A;  1UKU A;  3JB9 k;  3JXO A;  2RH6 A;  4HR2 A;  3G87 A;  3CJR A;  4J9P A;  2VIH A;  3HVA A;  3J81 Y;  2JEJ A;  3W2W A;  2Z4P A;  1ANI A;  3PEH A;  1AJB A;  1EI6 A;  3BKT A;  4I56 A;  3KLG A;  3GYN A;  4Y3C A;  4CT8 A;  1U1K A;  4K5R A;  5CA5 A;  3EYZ A;  1HNV A;  1H7W A;  2ADB A;  4DUY J;  3OXF A;  2VUG A;  4RNM A;  1QAI A;  3K5N A;  1IKV B;  5LRN A;  2DR7 A;  2DH8 A;  5KFW A;  2F1F A;  4YR1 A;  4K4T A;  3MR5 A;  5I3U B;  3AT1 B;  5ADZ A;  5EDW A;  4X4R A;  1NHK L;  2KT5 A;  5B0D A;  1HQ2 A;  1QUV A;  1TUG B;  2HVZ A;  3LTO A;  2Z56 B;  4NEZ A;  1W25 A;  1N32 F;  3N6N A;  1MRO B;  5KFG A;  3T01 A;  4ZG6 A;  2A10 A;  4GMK A;  3HKZ D;  2ZZN A;  3NKP A;  4X62 J;  5J1P A;  4DQR A;  4MFB A;  3M6X A;  2V2V A;  2M8D B;  1F5C A;  4I68 A;  3ZNU A;  1U6Z A;  1FF2 A;  1FES A;  4X66 J;  3BGU A;  2CFX A;  4DX8 H;  1UFW A;  2BAB A;  2QYC A;  3GR0 A;  3TA2 A;  4AUK A;  2FB0 A;  5L0K A;  4BC7 A;  3CJ3 A;  3AY0 A;  4WE1 A;  4E2F B;  3LGH A;  2ADC A;  1IJE B;  1PGZ A;  3JQJ A;  2KVI A;  4E8U A;  3D28 A;  8ATC B;  1NK8 A;  3M4X A;  3W7B A;  1ELX A;  1OY6 A;  2DK2 A;  3LAK A;  3MEC A;  1YJR A;  2L9W A;  2LMI A;  5CZV A;  2XGP A;  1FDN A;  1E6Y A;  3TUZ C;  2CQD A;  5B0E A;  4ZVF A;  2MZR A;  1K0T A;  2CQB A;  4KKO A;  2AX0 A;  4DX6 A;  4LQY A;  3IS9 A;  1KHW A;  3L95 X;  3MED A;  1M5P C;  2CVI A;  4GO5 X;  2G2O A;  2C2K B;  2FZG B;  1BQM B;  2EKY A;  2RVJ A;  1HBO A;  2B56 A;  4NMX A;  2DEI A;  3OVS A;  1N5Y A;  3B6B A;  3NAH A;  1H98 A;  4LQ3 A;  2HAI A;  3BB5 A;  3T02 A;  5J1N A;  1NB2 A;  2YNH B;  4X2B A;  5GAH U;  4IRD A;  2BRK A;  3NY0 A;  4O3Q A;  4O4G A;  2DB1 A;  4LUB A;  4O3O A;  3V81 A;  2XS2 A;  4HI2 A;  4QU6 A;  4DUZ J;  4F0M A;  3EJM A;  4F4X A;  1NKB A;  3KLH B;  5D15 A;  4CO4 A;  3TZZ A;  5IJS A;  2QMU B;  4R5P A;  2RE1 A;  2G0J A;  2KO1 A;  3V4M A;  4IDK A;  2V0N A;  3KXD A;  3DHX A;  5L1I A;  3T1H F;  2YVS A;  5KFF A;  3BDP A;  2D3Z A;  1S0M A;  1H2V Z;  2PDA A;  2AGQ A;  3NMR A;  1FJE B;  3BDG B;  1TKT A;  3DC2 A;  3W1Y C;  1SJQ A;  2LA6 A;  1K0V A;  1NH7 A;  2VG6 A;  2C2N A;  2CPI A;  2HNZ B;  3GV7 B;  3MD3 A;  3W2V B;  3NGU A;  1K9M T;  3R6L B;  2FVR A;  1XNQ J;  1YQH A;  2JFD A;  3K89 A;  3S6E A;  3RU0 A;  1WC3 A;  3NWR A;  3ETO A;  2JZ5 A;  4DJB A;  5C25 B;  3T3F A;  4QIF A;  3TA0 A;  2RRN A;  4CM0 A;  1FXD A;  3IG1 A;  2UUA F;  1TKZ B;  1RWX B;  4JI6 J;  3SZ2 A;  4RWW A;  5LT5 A;  1TV6 A;  3FMB A;  3M6U A;  4B3T F;  3T5J A;  1E6V A;  2VBW A;  1OWX A;  1B0V A;  1BLU A;  2HWT A;  5AE3 A;  2YQ3 A;  2CJ9 A;  2WVC A;  3IAM 9;  2J7U A;  2W5S A;  4JYA J;  4ES1 A;  2V2Z A;  1FXL A;  1R6Y A;  1HI1 A;  3MF5 A;  3CJK B;  4IOA Q;  1M5H A;  2AEF A;  4WXO A;  4UUW A;  4QR2 A;  4NLV A;  1OQ3 A;  5GVQ A;  1FCA A;  2IFY A;  5HLF B;  2VDI A;  4KJG A;  4IFV A;  4UOC A;  4LF8 F;  3FEX B;  4ZVH A;  3D4J A;  1ZZF A;  4YB6 A;  3DYA A;  1KKH A;  1IXK A;  2Y3Y A;  4LSL B;  5D4L A;  3RGI A;  4CO0 A;  2ZWO A;  5A6W A;  2BM1 A;  1S9E B;  1V3R A;  2DO4 A;  4QR1 A;  3R8Y A;  1UWB B;  1Q86 T;  2VON A;  2GJI A;  2AF6 A;  5KOW A;  2R8H A;  2H5E A;  4NXN F;  2VBZ A;  1SHQ A;  2VG7 A;  4X65 F;  2HBY B;  2XMJ A;  5CYQ A;  3B5Q A;  2ROE A;  4ITS A;  1GX6 A;  1C0T A;  4DBQ A;  4OI1 A;  2H5I B;  2DNN A;  3IR7 B;  3DU5 A;  2XGQ A;  2E5I A;  1FT8 A;  3ISZ A;  4HLB A;  2H5J B;  2E7V A;  5EN1 A;  1N5S A;  1B70 B;  4HDH A;  5IQ6 A;  2Q6C A;  4CLZ A;  3S01 A;  4AQY F;  3LPE A;  3C3L A;  1H6K X;  2XI3 A;  1C0U A;  4YY3 J;  1JLQ B;  5F0U A;  4F3Q A;  1JLA A;  4P2X A;  4C3M A;  1NDL A;  2VPW B;  4CO5 A;  3GIJ A;  5ETL A;  2ZH1 A;  3HMJ G;  5DG9 A;  4CI0 B;  3OT9 A;  1VQS A;  1YJ7 A;  1N54 B;  1R43 A;  2A2C A;  2FJV A;  1XR7 A;  4ZS6 A;  2FIU A;  1NB7 A;  3HZE A;  3AH6 A;  3EZO A;  1QE1 B;  2GV1 A;  1RAI B;  1BWV A;  4DF4 A;  3GJQ B;  2CQ1 A;  4A8Y A;  2Z0G A;  2E7W A;  5KFI A;  1WC5 A;  5KFB A;  3A8J A;  2Q1L A;  1X60 A;  3TR5 A;  4DU7 A;  5LMN F;  3TUI C;  2DVI A;  3OTE A;  4RZR A;  1EP4 B;  2JL9 A;  3I0S B;  1PBU A;  1HFE L;  2R7T A;  2MSS A;  1J27 A;  1RSC A;  1UFK A;  5KFH A;  4DX7 A;  2MTL A;  2MGZ A;  2HPU A;  3HX9 A;  3SEO A;  1G4C A;  1YHQ S;  4KAV A;  5D3G A;  1G7C B;  4DXL A;  1C1B B;  1GK8 A;  2JSX A;  2LYV A;  3HT3 A;  1F2H A;  4GVB B;  2GGP A;  4XTT A;  4Z7C A;  2DGO A;  3H4D A;  3KFW X;  4YFU A;  3JTP A;  1S6P A;  1RAH B;  1FKO A;  1L3S A;  1KC8 T;  4H54 A;  4K5S A;  4DR1 F;  2CVE A;  3DU6 A;  5IFM A;  2MEW A;  1UCN A;  1R0A B;  3OFG A;  1X4D A;  4EYH B;  4E0D A;  3DDK A;  3CSK A;  1KN6 A;  2MMY A;  1OJ4 A;  4MJK A;  5KFT A;  2ZH3 A;  4DV6 F;  3WQP A;  3WBH A;  3PX6 A;  3CCL S;  3JTO A;  2XY5 A;  4WFY A;  4X4O A;  3PKY A;  3KLV A;  4WFB Q;  3TEG A;  3N6M A;  1S0O A;  2UVU A;  2W9B A;  2R7W A;  2ZH4 A;  4QWE A;  1KOH A;  5C5J A;  4EO8 A;  1ZPW X;  1X4F A;  1QY7 A;  1VGY A;  3U27 A;  2IFX A;  3L09 A;  3BGR A;  4ZMM A;  5DLW A;  4HHH A;  5J2Q B;  3H4B A;  2HS3 A;  1CS4 B;  2L3M A;  4AFF A;  1M5V C;  2FGO A;  4HEA 9;  1RAB B;  4UOF A;  2Z30 B;  1FKP B;  2QFI A;  2OPS B;  2BEF A;  1VQP S;  3QQC D;  2ZKU A;  4EK2 A;  4F4K A;  2KFY A;  2I6W A;  3DM2 B;  3CD6 S;  3NNH A;  3TG0 A;  3A3N B;  1KHN A;  1WKJ A;  1FRK A;  3AQP A;  3PXG a;  1EAR A;  4M5N A;  2HEK A;  2BAN A;  6AT1 B;  4KGX B;  2DNZ A;  1I94 J;  4LF7 F;  4X4U A;  2FC8 A;  3W9H A;  1XMQ F;  5HVH A;  3QT7 A;  3LAL A;  4URS A;  3V6J A;  1EW9 A;  5SZT A;  4ZHR B;  1S0N A;  4C11 B;  3I56 S;  1IKW A;  3NKM A;  3TZX A;  1Q8I A;  5E3P A;  2EKN A;  4WJB A;  1FFW B;  3MMA A;  4J7C A;  2PEB A;  1RTH B;  1KHV A;  4YME A;  5GAG U;  4LBH A;  1Y4Z B;  2KRB A;  2BJ3 A;  2VJV A;  1Y6V A;  3KWM A;  2JWN A;  1ELZ A;  2YKP A;  4B56 A;  4ZVO B;  2DXE A;  5D0E A;  3PW2 A;  3QMQ A;  4LSZ B;  4UTG A;  2RRB A;  4EEY A;  4P75 A;  1RWO B;  2J9E A;  4K4X A;  4UOR A;  2KFZ A;  1IBL J;  3M9M B;  5C7P A;  3D7S B;  3C15 A;  2WRM A;  4KV8 A;  2UXC F;  5KT3 A;  2JLE A;  2GO8 A;  3RR7 A;  5DJB A;  1RT7 B;  4OYI A;  1XK8 A;  5FJ4 A;  3WIV A;  4B9N A;  5A8R B;  1OQ6 A;  2WVB A;  1VJQ A;  1GMV A;  4YR3 A;  4UPI A;  4U96 A;  1G2E A;  4RW6 B;  4M5M A;  2ZIT A;  3K8W A;  3MEG A;  1LWE A;  4DV0 J;  3KUE A;  4DV7 F;  4XO0 A;  2XZT B;  1HR0 F;  2W4P A;  2MQ8 A;  2ILY A;  5D6G A;  2W7P A;  1RAE B;  4I6W A;  4A8S A;  3DXS X;  2ZJP Q;  2YQ0 A;  3A52 A;  1HNI A;  5DLT A;  5M2R A;  2R8I A;  1XEZ A;  2OAU A;  4A8W A;  1LXJ A;  3DYC A;  4ERD A;  4IH6 A;  5ETS A;  2BOA A;  2MJU A;  5IT9 Y;  4W92 B;  1N2L A;  3TYT A;  3I82 A;  2ZE2 A;  4MY4 A;  3BDE A;  1RAG B;  4G1P A;  4M5I A;  4ECT A;  1HIY A;  4RUB A;  4QW9 A;  1K7H A;  4DHV A;  5KG0 A;  1GMU A;  3IXQ A;  5FLX U;  4P72 A;  3RB6 A;  2RDD A;  2G13 A;  4LT6 A;  1YDL A;  1NPP A;  3MXH P;  1RWV B;  3M2U A;  2IUC B;  2E9T A;  2J7W A;  3X3U A;  2LKZ A;  3UQS A;  1FDB A;  3DLJ A;  1IBM F;  3P6Y C;  1VRU B;  4MK9 A;  3CXC R;  1QTM A;  1NND A;  2V4R A;  1Q5V A;  1RWP B;  2HIQ A;  4HKQ A;  4IFY A;  3W65 A;  1CC8 A;  4O23 A;  4WBF A;  2H4Y B;  4UY8 T;  2QJ3 A;  3DDN A;  3DRY A;  3PAC A;  3EVM A;  1UZD A;  4ECZ A;  4RW8 A;  2Z2M A;  1QTN B;  3OXL A;  2H48 B;  3MCN A;  3PG9 A;  1RTJ A;  5KFA A;  2GMJ A;  5KG1 A;  4ID5 B;  4CO3 A;  3MMC A;  3HHL A;  1RCO B;  2WOM A;  5IM0 A;  2NPF A;  3W9J A;  3JYT A;  2J6T A;  1ZA2 B;  4U6P A;  1RWN B;  1HWI A;  4NL5 A;  3OL6 A;  3P3D A;  2B4O A;  4LFC F;  1T9V A;  5LL6 d;  3R1H A;  1HQE A;  4NRT A;  1JLG A;  3KD8 A;  2HFS A;  2DHA A;  3DKD A;  1LOU A;  1NME B;  1ULR A;  2F9D A;  2UUB F;  1UVL A;  1JJ4 A;  3DGV A;  1NJW A;  1SC3 B;  3BO4 A;  2VOD A;  2AKW B;  3HKW A;  3FMW A;  2RU9 A;  1U1R A;  2FHJ A;  2BX6 A;  3LWL A;  1LKZ A;  1S77 D;  3U1N A;  3H42 A;  1NU4 A;  2G1D A;  1ZEB A;  2OEL A;  4FF3 A;  1O6X A;  4ZCL A;  1CBK A;  1MU2 A;  2M88 A;  3OXG A;  3T1Y J;  4DV2 F;  2PI4 A;  5ETR A;  5L46 A;  4G1Q B;  3TAM A;  4K4Y A;  4LR9 A;  3BRE A;  2H65 B;  4O44 A;  3GJS B;  1JXV A;  4YEA A;  4Y34 A;  4DCP B;  5AXK A;  3M8Q B;  2B4U A;  1VC6 A;  1V5I B;  4OZ3 A;  1VRT B;  3W5X A;  3BBB A;  1HYS B;  2F4V J;  3O3L A;  4F02 A;  4X4S A;  1KSP A;  3NGK A;  1RAF B;  4OLP A;  2UZA A;  5EWG A;  3QO9 A;  5DRK A;  2OPQ A;  1WG1 A;  4CO1 A;  3KJN B;  1X0F A;  2CWK A;  5DQI A;  3HSG A;  2DIU A;  1RTD A;  3NCQ A;  2KN4 A;  2O1P A;  3CVK A;  1PJ5 A;  2WCX A;  2DH9 A;  1N0U A;  5DQG A;  3Q3Q A;  2DGS A;  4LFA F;  2B5J B;  3EGN A;  2VFS A;  5HK4 A;  3JQM A;  2DNR A;  2QA1 A;  2HAF A;  4B02 A;  4ES3 A;  1SCJ B;  2XMM A;  3FSI A;  1TKD A;  3VZI A;  2DCL A;  3TJ9 A;  5IS2 A;  4NLU A;  3NBP A;  4RW9 A;  3MM8 B;  3V4I A;  4C8L A;  4LIR A;  4WYL A;  4IQM A;  3BBF A;  2PII A;  2MY7 A;  4CDI A;  4U95 A;  1QVF R;  3VAG A;  4WP3 A;  4DV4 J;  2E7X A;  2X98 A;  2EC0 A;  1HD0 A;  2G2Z A;  4WF9 Q;  1XC9 A;  2CDR B;  2WBR A;  1KH5 A;  1TQL A;  1S1U B;  2UXD J;  1IWG A;  3VVT A;  1CVJ A;  2MLY A;  1N5T A;  4DF8 A;  3KLI B;  2QT7 A;  4N76 A;  1RT3 B;  2VQF F;  3NS6 A;  2RKI A;  1JLF A;  2YWK A;  1RAD B;  2IM3 A;  2FD2 A;  4P7V A;  3EDQ B;  1TP7 A;  1Y3K A;  3MPV A;  4A8F A;  3FNN A;  3MUR P;  4U8Y A;  1MRO A;  4L75 A;  2ZH7 A;  3NGD A;  2Q6B A;  2MYF A;  3VVU A;  2DGW A;  5J2P A;  1Q7Y T;  2HZV A;  4KIA A;  3NWG A;  3G8S A;  3KDN A;  3QT6 A;  1YLX A;  2D9O A;  4BHQ A;  1ZM2 A;  5C24 B;  1IR0 A;  1WG5 A;  1SL1 A;  2VOP A;  1KH9 A;  4F04 B;  2YY3 A;  1U1Q A;  3CE8 A;  3U02 A;  5J1E B;  3PJW A;  1LW0 A;  2K1R A;  1HPZ A;  2J0S D;  3UE2 A;  4TLQ A;  1T05 A;  2G9O A;  4LRF A;  2M4M A;  1N32 J;  3K7R A;  2AWZ A;  3DGP A;  4I2Q A;  3BQ0 A;  4ELV A;  2FHO B;  2AZ1 A;  2Z2Z A;  2RNE A;  2L08 A;  1TL3 B;  5AXN A;  4ENO A;  3AB2 B;  2AJ2 A;  2NYH A;  4FP9 A;  1S6Q B;  3EX7 B;  1UVK A;  3CC7 S;  3C19 A;  3IO1 A;  2QL9 B;  2DH7 A;  1N48 A;  2A3J A;  4IO1 A;  1ZH5 A;  3SQO P;  3LP0 B;  1TTH B;  2AYG A;  3FRY A;  4EU0 A;  2C2O B;  3HFZ B;  2HQG A;  2XMW A;  3SQG A;  2LU2 A;  5LJ3 Y;  1TKX B;  2RS2 A;  4USI A;  1DLO B;  2XUL A;  1KLM A;  3QPI A;  1P6T A;  2UUC F;  3CC2 S;  4F3M A;  5ETV A;  5L9N A;  4QIW D;  4KHM A;  1FD8 A;  1U6B A;  3T9N A;  3SCK E;  2J0Q D;  2OD6 A;  1XJW B;  2HNY A;  1YX2 A;  4RU2 A;  2BBE A;  3UR0 A;  3G6E S;  1U2R A;  1XMB A;  4YS2 A;  4IR9 A;  1FWK A;  1QD1 A;  4ALZ A;  1CUL A;  4ZLN A;  3JSM A;  4K4S A;  4OHV A;  4DR2 F;  1CJU A;  3KLH A;  4NCG B;  4M5D A;  1NDC A;  2RH3 A;  3A8I A;  1T11 A;  3I5B A;  5LSO A;  1M1K T;  1F2G A;  4IG0 B;  3PX4 A;  4JV0 A;  2VG5 A;  3V6K A;  2DHS A;  4EFA C;  5KFC A;  5E41 A;  5D8H B;  2RF2 B;  2MST A;  1PCA A;  4QWD A;  2ZVS A;  2QL5 B;  2ZC4 A;  4LF9 J;  2FYX A;  2KJV A;  1S9G A;  5K8N A;  1RGV A;  4W4M A;  4Q7A A;  4DV5 F;  4ZVP B;  2ZJQ Q;  1DTQ B;  5CYJ A;  1N4L A;  4M5G A;  1QVG R;  3J81 U;  3QGP A;  2GMH A;  1Y7A A;  1HNW F;  1YRU A;  2FJX A;  3R5B A;  1W7W A;  1JIH A;  3TWZ A;  4DX5 A;  3ZZY A;  3LP2 A;  3CUN A;  2YKN A;  4FN5 A;  4K8R A;  4LF4 F;  3QNW B;  2W2O P;  2E66 A;  3LF0 A;  4HTI A;  1RT5 A;  4G6V B;  2V8G A;  3DLG A;  3CCS S;  4G1I A;  4CLW A;  5E3A A;  1EX8 A;  3KMQ A;  2IJR A;  4RNH A;  1SHN A;  2PI5 A;  4GC6 A;  2HBR B;  3NCP A;  2ALZ A;  2GCF A;  2VPY B;  2V50 A;  5J2M B;  5LSL A;  2UP1 A;  2DYA A;  5T14 A;  1ZAX A;  4NE9 C;  5L39 A;  2KFN A;  2I5J B;  1X0P A;  3FBC A;  2DIS A;  2X1F A;  2RUS A;  4Q2L A;  5JUM A;  3KK3 B;  2MQO A;  2KRR A;  1TEL A;  2OPP A;  2I9S A;  4EGL A;  3HHE A;  1NHV A;  3FKB A;  1RT2 A;  5HLF A;  3LA0 A;  1Q8L A;  3CCJ S;  2C2R A;  4B3T J;  2RRA A;  2YX4 A;  3X1L B;  2W8S A;  5DLG A;  2R7R A;  5MAO A;  1DAR A;  2JOQ A;  3WC0 A;  1KVI A;  2RQ4 A;  1RU1 A;  4TNO A;  5E3R A;  4S0M A;  4FKX A;  4CIO A;  1UWB A;  5B0B A;  3MEE B;  2HND A;  1HMV B;  1LK7 A;  5HJX A;  5KFY A;  1CJK A;  1S76 D;  2W2P P;  1RT1 B;  1A0O B;  1DTT B;  5DZ7 A;  1JX4 A;  3M30 B;  1CEZ A;  2KI2 A;  3DRX A;  3IBC B;  1FFS B;  2BQU A;  4P73 A;  1URB A;  1AXQ A;  1T0T V;  1KOO A;  2B43 A;  1T95 A;  2HQ3 A;  4LF8 J;  1PG5 B;  3GV8 B;  1FTC A;  2R2R A;  1P49 A;  3SMZ A;  1VIO A;  3MK1 A;  2DHH A;  4DWI A;  2H4W B;  1Y00 A;  1MW7 A;  2CZ4 A;  2HBZ B;  4OZ5 A;  1JLQ A;  3GIL A;  4WTO B;  1AW0 A;  3ISN D;  2GAH C;  2Z58 B;  1ELY A;  4IQX A;  2IAJ B;  2NSB A;  5HN0 A;  1SH0 A;  2HHS A;  2XLI A;  4OZN A;  4X65 J;  4ZJL A;  3NL0 A;  1S6U A;  3CJT A;  5F8I A;  4L73 A;  2HLT A;  2JVR A;  4UW2 A;  4U7U K;  1YZ6 A;  1JJ2 R;  3UR3 C;  5E2Q A;  3QRP A;  5I3P A;  1Q1K A;  3DOL A;  5J2N A;  1HBN A;  2O67 A;  3I5C A;  4ZCM A;  3QSY B;  2W24 A;  4ANC A;  4C97 A;  1GFW B;  1TL1 B;  1ZAV A;  4ECS A;  1KQS R;  4AQY J;  1MSW D;  1MMD A;  5AXM A;  2DKO B;  4QWA A;  5LSR A;  1VQ9 S;  1RTZ A;  1Q4R A;  1F5A A;  3K58 A;  2EW9 A;  1RAA B;  3HP6 A;  3H2U B;  3FCH A;  5HQL A;  1RHU B;  2G0C A;  3MK0 A;  1VMB A;  5GRR A;  3D1H A;  3D68 A;  4QW8 A;  2CQ3 A;  2KG1 A;  1JLB B;  2J0X A;  1SB6 A;  3TI0 A;  5HBM B;  3Q2T C;  4YHH F;  2OUG A;  4I2P A;  2WTF A;  3OTO J;  4JI5 F;  3ITH A;  2ANH A;  2ZDP A;  3RRH A;  3KK2 A;  2AJ0 A;  5HRO A;  4DPO A;  2NXC A;  4OX7 A;  1P8G A;  5KG3 A;  4Q43 A;  4QWC A;  5LMN J;  1RT4 A;  2BJ8 A;  2X51 A;  3NCR A;  3FEY B;  3EVW A;  2V9K A;  4RBT A;  4WFA Q;  1HJK A;  1XTZ A;  1SKR A;  3HHL D;  2OD4 A;  1TZ0 A;  2KTQ A;  3PJX A;  2GHP A;  1EAY C;  2IHR 1;  1AZS A;  2WSC C;  2VL1 A;  1UVI A;  3GIK A;  8AT1 B;  1SUQ A;  1RP5 A;  5DDQ C;  2ZBP A;  1NKC A;  1JXL A;  2DXF A;  3NG8 A;  3NP5 A;  1YIJ S;  4JI7 F;  4U7C A;  4ECX A;  2CPY A;  3H7H B;  4DR1 J;  4NA1 A;  1NK4 A;  4DSK A;  1SV5 A;  1CJV B;  2KM8 B;  1RAO A;  2ZFH A;  4IOC Q;  4V19 X;  2FHJ D;  4TQS A;  3HDS A;  4CLF A;  4DV6 J;  4ZPC A;  4C8Y A;  5HI7 A;  3C6U A;  1LW2 B;  1NH8 A;  3SZZ A;  1FDD A;  4I67 A;  2CPJ A;  4G65 A;  3DLB A;  3PTW A;  3OUY B;  3RYL A;  1ZA1 B;  3NRB A;  2ACM A;  4FVM A;  1UMJ A;  2DRA A;  2J8S A;  1P9Y A;  2LEA A;  2YNG A;  1PJ7 A;  1YK9 A;  4BBY A;  2PEH A;  3ZZP A;  4F67 A;  1MWY A;  1NUE A;  2LQ8 A;  4CYS A;  3FQK A;  3ISN C;  4ZHR A;  4TKT A;  5A8W A;  1WHV A;  4KGK A;  3PKM A;  4WWS A;  3DLE A;  4UZC A;  2NZC A;  4B9V A;  4PWU A;  2CNN B;  4OYX A;  3GG0 A;  2HBQ B;  4J9U E;  3T1A A;  3RG6 A;  1AJD A;  1LEO A;  3IWX A;  3PW4 A;  2DR8 A;  3M32 B;  3CUL A;  1S1T B;  4ZLL A;  2HZC A;  4B9S A;  4GC7 A;  1XMQ J;  1ITP A;  5KT2 A;  3QAT A;  4WFX A;  2GHW A;  3RBE A;  4DLE A;  1Q5Y A;  3GSI A;  3TVZ A;  1QDU B;  1RWW B;  3MM5 A;  2Z2L A;  2KZM A;  3K2Y A;  3KJF B;  3GIM A;  1NK6 A;  1NCL A;  1F9F A;  1ZTW A;  4AYB D;  4I69 A;  2VV5 A;  3E3X A;  4Y2M A;  2UU9 F;  1U6F A;  3HVT B;  4ZPA A;  3RB0 A;  4BCA A;  1VK8 A;  4CM2 A;  4ED1 A;  4MIB A;  3BR8 A;  3IWL A;  2Y9H A;  2VQE F;  5A6P A;  3NGT A;  1WI6 A;  4OHX A;  3KJQ B;  4RW4 B;  4RPF A;  3SDE B;  4PCQ A;  2QLX A;  3EUN A;  4QPX A;  1X4A A;  3HHL C;  1FJC A;  4ZG9 A;  1S1W A;  5FDL A;  1D0E A;  4ILL A;  1M1G A;  4CH0 S;  4AL7 A;  5A0Y A;  2ZH2 A;  3POT B;  2MKK A;  2W25 A;  1S7H A;  4EYI B;  4DV7 J;  4JI3 F;  4PAB A;  2XLJ A;  1KHK A;  2DTJ A;  2ZBR A;  3G9C A;  2IA6 A;  1MN9 A;  4WFN Q;  3TZW A;  4DR6 F;  4UOH A;  4WZQ A;  2C3U A;  1CLF A;  4ECY A;  3LAM A;  3D67 A;  2F7V A;  5B0C A;  2MXY A;  3HXM A;  1O99 A;  3OFE A;  1F0X A;  3FFI A;  1HBU A;  1CC7 A;  3W66 A;  1VQN S;  3M6V A;  2CJK A;  2BJ7 A;  1ALI A;  2ZD1 A;  3RAM A;  1RHJ B;  2IYG A;  2V67 A;  1GAO A;  1IM6 A;  2D41 A;  4PQA A;  1T7P A;  2IM0 A;  2KXH A;  1RIS A;  4OJH A;  2OPR B;  1EW8 A;  1QSY A;  2DNH A;  3C6T A;  1O51 A;  2W5W A;  2XI2 A;  4JI2 J;  3A3P B;  2CA9 A;  1YBU A;  4IKA A;  2X1A A;  2EK1 A;  3OLB A;  4RL1 A;  5HP1 B;  1RLC L;  4O4R A;  4MK8 A;  1VQ4 S;  3IAS 9;  3MM7 B;  3WHI A;  4RR5 A;  4RBV A;  2CPD A;  3IGN A;  3GE9 A;  5G4D A;  2MQL A;  4DSL A;  3RRG A;  2YPY A;  4ZK7 M;  2G2Y A;  1XIQ A;  5GAE I;  5AXL A;  4CXS A;  2V4Q A;  2DNP A;  4HH0 A;  3E51 A;  4Y28 C;  2HFU A;  1Q95 G;  1ZM9 A;  3BPS P;  1HBM A;  1IKX B;  3J80 Y;  4KO0 B;  3P4U B;  2FLO A;  3I4H X;  2PMH A;  2ZOM A;  2RUG A;  1C1C B;  1RT6 A;  3DMJ A;  1R27 B;  1P1T A;  2AGP A;  3GII A;  1VLY A;  3N01 A;  1IQZ A;  2BXJ A;  3T5L A;  3ZZU A;  4C3K A;  3UCG A;  5A2Q Y;  3TJ8 A;  3N28 A;  2NXU A;  3BM7 A;  1FNO A;  3N79 A;  4DFP A;  1Z2Z A;  1UJ6 A;  4BC9 A;  5JMN A;  3EGV A;  2GIF A;  3UI3 A;  2GVZ B;  1FRH A;  1WJ9 A;  4WII A;  1T3N A;  3B54 A;  4IG3 A;  3FBE A;  1HD1 A;  4Z37 A;  4OJG A;  1HAR A;  4Q45 A;  4LFC J;  4LSN B;  1JMT A;  3RTV A;  1PSD A;  2FHM A;  4ZVR B;  5DET A;  2W2Q P;  2HUR A;  1EKS A;  3EGZ A;  1SQG A;  4TN2 A;  3R97 A;  2HVH A;  2UUB J;  2N4D A;  3AB4 B;  1VRT A;  2O5D A;  1R0B G;  2BRL A;  1AYE A;  3ZTR A;  5E3Q A;  4CWB A;  1LFW A;  4CYR A;  1VQK S;  5KFP A;  2NXE A;  1VIS A;  3QT5 A;  2CG4 A;  4X64 F;  2AQ4 A;  5DS7 A;  4Q44 A;  4O3P A;  1OYE A;  2DNM A;  1U2F A;  2BKN A;  2EBG A;  2E9Z A;  1FK9 A;  5F8L A;  4GO7 X;  4YUD A;  3M9N B;  1KQG B;  4GKJ F;  1SL0 A;  4F2S A;  1FTR A;  2AYE A;  1K44 A;  3WAW A;  3J7Y I;  1JJC B;  3B82 A;  2FLL A;  3O8W A;  4C3L A;  4PAA A;  4UZB A;  2QE5 A;  2ZHB A;  5IT9 U;  4X4T A;  3GMG A;  1GQE A;  4L3N A;  2HQF A;  4MTP A;  4TY8 B;  3OTB A;  2XCP A;  1RTI A;  3A13 A;  1R0C B;  1LWC B;  2FJW A;  1MMN A;  3MM8 A;  4Y2K A;  4F4Z A;  4CLY A;  4BLG A;  5KT7 A;  3WIU A;  1XNR F;  2EFO A;  2HQI A;  4NLO A;  5B0A A;  3MHY A;  4DV3 F;  1VC0 A;  4QIE A;  5B08 A;  1VBY A;  4LFA J;  3OVB A;  1S1U A;  3NKY A;  1BQN B;  2RDJ A;  3D6T B;  4F3O A;  3AOD A;  2HHH F;  2PSZ A;  5HVF A;  5DGA A;  1E33 P;  3SCI E;  4B3M F;  1HWK A;  3D66 A;  4HHU A;  4MK7 A;  1R6V A;  4ED6 A;  3PJ9 A;  3R2C J;  1FNX H;  2CQG A;  4OYM A;  1TK5 A;  2V94 A;  1VQO S;  2CQ2 A;  3A12 A;  4Z7Y A;  5D4O A;  2I2Y A;  1ED9 A;  3CWJ A;  5DDO C;  1XMO F;  2W9C A;  2NR0 A;  4P10 A;  4M5L A;  2H9Z A;  2CPE A;  3A8E A;  2D74 B;  3HZG A;  3UDL A;  1PAE X;  1ANJ A;  2Q43 A;  2UV8 A;  3ZZO A;  3MM9 B;  3OTD A;  2VFR A;  3OJS A;  3MI7 X;  1GT8 A;  1IBC B;  2IRX A;  2XMU A;  3PYD A;  3O2I A;  3D6H B;  2B9X A;  4ES2 A;  5C24 A;  1UA1 A;  3UN2 A;  1B4S A;  2W5Q A;  4OHY A;  1KON A;  2BW2 A;  2KJW A;  5IQQ A;  3FRZ A;  2HHV A;  2VQF J;  5HMX A;  2F8M A;  4H4O A;  2ZVI A;  3MOZ A;  4UST A;  3NS7 B;  3OTC A;  1WEZ A;  1NSK L;  2R8G A;  1T9X A;  2AD9 A;  1U25 A;  3CCV S;  2CNL B;  3IRX B;  3T5H A;  4OHW A;  4ELU A;  4BWJ A;  1BD6 A;  5EHH A;  3TJA A;  2R7Q A;  1ZM3 A;  1TMJ A;  5HQ8 A;  1ZPV A;  4DR5 F;  2CAJ A;  1B64 A;  2ACY A;  3QZ7 A;  2IRU A;  4ED7 A;  5LOQ A;  5LIA A;  4EZ9 A;  2MQP A;  2VIC A;  4X4Q A;  4N8O A;  5DG7 A;  1UPP A;  2P9E A;  1UA0 A;  4JI8 J;  1S48 A;  3KG0 A;  4NLR A;  2E1M C;  3MCM A;  1H38 A;  3KNA A;  2N4C A;  3K0J A;  1RI7 A;  3QID A;  1JKH B;  1WUU A;  3CO9 A;  2FVP A;  4ZP7 A;  4YB7 A;  2F8H A;  2ZH6 A;  3MWB A;  2ZH5 A;  2X3D A;  4U67 Q;  2C42 A;  2NXN A;  1D9D A;  1PYS B;  4DQS A;  1S97 A;  1FE4 A;  4ZCK A;  2CNK B;  2DGU A;  3TAN A;  1Z1Z A;  3MPW A;  2ALY B;  3RZA A;  2WW4 A;  2QO3 A;  4LFB F;  5D4N A;  3O44 A;  2C28 A;  3CIM A;  2QC3 A;  4EUV A;  2VU5 A;  4KHP F;  2A1B A;  3JTN A;  2J6U A;  2IDL A;  2HQD A;  2EC2 A;  3FZ2 A;  3BSA A;  2ZHO A;  2GQQ A;  4BS2 A;  3RB3 A;  1ZBT A;  4FXW A;  2R7S A;  5U47 A;  5ETO A;  2RF2 A;  4J9L A;  1WC4 A;  2WVF A;  4AXI A;  2CNO B;  3IGZ B;  1SIW B;  3Q8Q B;  3C14 B;  3BPD A;  4DSF A;  2OTJ S;  1VQ7 S;  2OJ3 A;  2Y0S D;  4D3H A;  4ZVG A;  1B7Y B;  3I4P A;  3M2R A;  3IM8 A;  2X1B A;  1VYA A;  4DFK A;  4Y65 A;  4YB5 A;  3T41 A;  2K7K A;  3V6H A;  5I42 B;  2ZDO A;  3EPI A;  3M1V B;  2J9D E;  2GHV C;  4DN9 A;  3TX8 A;  5F8H A;  3UWT A;  2RD5 C;  2Q3P A;  1XN9 A;  5CQG A;  1FDA A;  3RW6 A;  4KPY A;  2XS7 A;  3MUT P;  2E5J A;  3JAM Y;  4F0K A;  3DFE A;  4IOB A;  5FD1 A;  4LF6 F;  4M63 A;  5K9F A;  3IP0 A;  1WDT A;  1R8B A;  3IC1 A;  2OSR A;  3PM9 A;  4NLS A;  5KT6 A;  3OVA A;  1U0H B;  4TU7 A;  3IGY B;  1V5V A;  3DLK B;  4DV5 J;  5IWA F;  1UL3 A;  1U0S A;  2HS4 A;  4KBI A;  4G3I A;  3L7O A;  3WDO A;  3PW5 A;  1IKY B;  2P9G A;  1D8Y A;  3E01 A;  4NLQ A;  1OIA A;  4NXM J;  4N47 A;  4WXW A;  3BN4 A;  5AT1 B;  3M8W A;  4LF4 J;  4QIV A;  4PQU A;  2NCK L;  1DQ9 A;  2F65 A;  3R5D A;  3UDC A;  2OLW A;  3IFE A;  3DRP A;  1D3W A;  3M8R A;  4R25 A;  1PAU B;  4X4V A;  3H59 A;  2ZOG A;  4BDP A;  1U8S A;  5M2U A;  3PFO A;  3KK1 B;  2ZUA A;  4JI4 F;  1X4B A;  1HMV A;  2DIT A;  1XR6 A;  4LRB A;  4DG1 A;  5MLC V;  2VDH A;  3DPC A;  1IN0 A;  3MM6 A;  2CJA A;  3M30 A;  1SJ4 P;  3P5B P;  5ETP A;  4AE5 A;  1L3K A;  4NOH A;  1UEK A;  2H3E B;  4NLG A;  3KLG B;  2MZJ A;  2X3G A;  4OZL A;  5CAB A;  1HNV B;  1NDK A;  4X62 F;  4A48 A;  4M95 A;  2E44 A;  3I0R A;  4NAS A;  1WEY A;  4X66 F;  3NKQ A;  2IAJ A;  5JXS A;  1NO8 A;  1U24 A;  4P7T A;  4DI6 A;  5IC4 B;  2BQR A;  1YG0 A;  4B3R J;  4RO0 A;  3IN5 A;  2MQN A;  1FRM A;  2QL7 B;  2HG4 A;  1F6T A;  4CLU A;  2NS1 B;  3KYL A;  4LVN P;  2K2P A;  1S7I A;  3CJ2 A;  5M2P A;  1SIZ A;  1IWA A;  1M1H A;  2VZ9 A;  3S7R A;  3GQC A;  3LGN A;  2RQM A;  1VQ5 S;  3N4W A;  5L8R C;  4KYZ A;  3V6D B;  5EGH A;  3D3C J;  4FDJ A;  1RQ0 A;  4LMZ A;  3A8K A;  2NZ4 A;  1ZZN A;  2W4D A;  2IJF A;  1PC4 A;  3KHH A;  2ZBQ A;  3VGU A;  3I5A A;  1AUK A;  3HFV A;  2HGL A;  1R8H A;  4QWB A;  4ZVT B;  3BDF A;  2RQC A;  4USV A;  1PKU A;  4WE1 B;  5F8N A;  3KLE B;  1DQ8 A;  1YJV A;  4KPC A;  4NWX A;  2GC8 A;  3EIC A;  4FF1 A;  4LBI A;  1FER A;  3OQ2 A;  3TQE A;  4NWJ A;  3C8Y A;  4KTQ A;  1Q8K A;  3TA1 A;  1QSL A;  1IR2 A;  3G96 A;  3MEC B;  4MHX A;  2LA4 A;  1X4G A;  3I6P A;  3OD2 A;  1SJR A;  1Q7L B;  5FII A;  4KKO B;  5F3T A;  1K47 A;  3H5X A;  3RUB L;  1H0H B;  2D1C A;  3IS9 B;  5CZX A;  2EFV A;  3MED B;  4WCE Q;  2XY7 A;  4JI5 J;  3G71 S;  4OX9 J;  4KJI A;  1WTF A;  1T3O A;  4DOZ A;  2KU7 A;  2VD3 A;  4RUA A;  1SKW A;  5GAH I;  2E29 A;  1EZZ B;  3M8Z A;  1N5Y B;  3DI6 A;  2O66 A;  3UCU P;  1IUJ A;  4QAX A;  1KEK A;  2N7Y A;  2OEM A;  4KH1 B;  3MPU B;  2H54 B;  2UXB J;  4CRJ A;  3PO4 A;  4O4G B;  4K4Z A;  3VHQ A;  3V81 B;  2YKM B;  4MKB A;  1YSJ A;  5HJY A;  2VFV A;  3GFY A;  4M1K A;  3OSN A;  1U02 A;  1XNQ F;  4FPR A;  4WU2 A;  3BQ1 A;  2CAD A;  2WB1 D;  4Y0F A;  4R5P B;  5GMD A;  2I8E A;  4JI7 J;  3OSP A;  4IDK B;  1S4F A;  1S79 A;  4ZIW A;  2OSQ A;  3I55 S;  1RKJ A;  2APO A;  2ZM6 F;  4LF5 F;  2FY1 A;  1N88 A;  4EZ6 A;  2XBP A;  2EXU A;  1SVD A;  2JVO A;  1TKT B;  2XZW A;  5T7L A;  3QRR A;  4TQR A;  2VG6 B;  2LXI A;  3NS5 A;  1NK0 A;  4ZA1 A;  5AJ3 J;  3Q86 A;  3PY8 A;  2C2E A;  1FEH A;  2HZA A;  3R3T A;  5CYM A;  2DEJ A;  3R5J B;  3N5F A;  3SBM A;  4Q0B A;  3E2E A;  2WBM A;  2V34 A;  5LM7 E;  3OL9 A;  3QGI A;  2BE7 D;  2XSJ B;  2QV6 A;  1OSC A;  3M32 A;  3QIP A;  2HFO A;  2CZV C;  2YNF A;  4WU3 A;  4DCO B;  2W1B A;  3CPW R;  4CP5 A;  3EZ5 A;  1NSA A;  5D0H A;  5LXR A;  3MAQ A;  3IG1 B;  3TAQ A;  2LXF A;  1WF2 A;  2COL A;  3GCX P;  1TV6 B;  3K8V A;  3DOM A;  1E6V B;  5CCM A;  4PPZ A;  2GIR A;  1HDH A;  1EET A;  3IGV A;  4OX8 A;  2XC9 A;  1BY9 A;  2JNJ A;  4Q5V A;  2CZ9 A;  1N6Q B;  5GOV A;  1Q16 B;  5EGE A;  1NZA A;  4ZVU B;  2JC1 A;  2EWH A;  3H25 A;  2BMB A;  4IH5 A;  3RBX A;  4DPW A;  2C22 A;  3LQV A;  4M5K A;  1TL5 A;  1U47 A;  2DY1 A;  3V5R A;  1CJT A;  3IR6 B;  4JV1 A;  4RW4 A;  3SDE A;  5F3Z A;  2P6S A;  4CXK A;  4IFV B;  2GQC A;  1NK7 A;  2QN6 B;  5A76 A;  1N34 F;  4GVL A;  1S4E A;  3BSO A;  5L0E A;  3DYA B;  2NXJ A;  3HK2 A;  2UVV A;  1O0P A;  2C3P A;  1XBW A;  1NZ8 A;  2YH0 A;  1ZS6 A;  4L76 A;  2IMO A;  3C46 A;  4LF1 A;  2V8V A;  2W2M P;  3NLC A;  1VS3 A;  3POT A;  2MZS A;  3PIP Q;  3D2W A;  1VIX A;  5ETQ A;  2VG7 B;  4TY9 A;  5CYQ B;  2CYY A;  3HSJ A;  5D4P A;  3ZC4 A;  1BE4 A;  2J7K A;  1YJN S;  2CJX B;  1B99 A;  2IYI A;  3KLF B;  1C0T B;  1EJ7 L;  3GR1 A;  3SSR A;  1KH4 A;  1D9A A;  1SKS A;  2BJ9 A;  1W2B R;  2KZZ A;  2B7C B;  3BJY A;  1WC1 A;  3MAA A;  2OFG X;  1KD1 T;  4DPU A;  1JB0 C;  4JUZ A;  1JLA B;  2XWY A;  5GME A;  1IVZ A;  3ENW A;  1QLN A;  1JLE A;  2CPH A;  4ECR A;  2OPR A;  4JI3 J;  4JV2 A;  3HD1 A;  2QTW A;  4FYD A;  4WPA A;  3VGS A;  4B3O A;  1RAC B;  2W8D A;  1U09 A;  3ILJ A;  4A47 A;  1KTQ A;  3G6X A;  3B8H A;  4RNO A;  4QCL A;  3H98 A;  3R7B B;  4ELT A;  2F4F A;  2QRR A;  5KFL A;  3LAN A;  3HJV A;  1HNZ F;  1C4A A;  3BKU A;  3AXK A;  5THW A;  2ZH9 A;  2GZO A;  2E1P A;  4ZVE A;  3QT8 A;  4KO0 A;  2MGZ B;  5L1J A;  3RJM B;  1D1U A;  3ET6 A;  3CCE S;  5D3G B;  3QGG A;  2K3I A;  2MKC A;  3MTJ A;  4AL5 A;  2GGP B;  3IDD A;  1S6P B;  1NK5 A;  1NEE A;  3CJ4 A;  1FKO B;  1N2K A;  1T9T A;  4HI1 A;  2ZBC A;  1WHY A;  2P8I A;  1RK8 A;  2WVD A;  4ICL B;  3HVR A;  3CDE A;  2IVM A;  1ED8 A;  5E5N A;  1VRQ C;  4TU9 A;  1SJF A;  4FYV B;  4PG5 A;  1H3D A;  2DNL A;  5IT4 A;  1X4H A;  1N0V C;  3F44 A;  2XG8 A;  4NZ6 A;  4LSN A;  4Y6I A;  7AT1 B;  1KHL A;  2DNG A;  2ZEJ A;  3I31 A;  4YP3 A;  4LBP A;  5KFZ A;  2BE2 A;  5DM6 Q;  1DUR A;  1SL2 A;  1H74 A;  2W9B B;  1N5Q A;  2OH2 A;  5HAN A;  2D3O R;  3LW5 C;  2C2D A;  1VQL S;  2KDO A;  3OL7 A;  1K1Q A;  3BGR B;  4WP9 A;  3Q8Y A;  1Y5L B;  3MFH A;  2J0W A;  1SI9 A;  4R8U A;  2W7A A;  3LP1 B;  3PEJ A;  3OBI A;  1EB0 A;  2RSQ A;  3IBW A;  2JHE A;  1T03 A;  4HDG A;  1QAX A;  3GJR B;  1Y9O A;  2AEJ A;  2KYX A;  2AGO A;  1X31 C;  4NA3 A;  3EPG A;  4NYO A;  1J5E J;  4M8L A;  1R31 A;  4UPL A;  2RIJ A;  1N33 J;  2XMV A;  5GAG I;  4TY8 A;  1VDH A;  2PMW A;  1JLC B;  1IKW B;  4X64 J;  1REV A;  4TVA B;  1RBL A;  3PIO Q;  2BE9 B;  5C2C A;  3MMA B;  3DOK A;  1R3N A;  1RKI A;  2QA4 S;  5L0B A;  4W90 B;  4QBU A;  4LR7 A;  4GKJ J;  2XO6 A;  2O01 C;  3LXQ A;  4P71 A;  3M8P A;  5LRM A;  2W2N P;  4X84 A;  3TW0 A;  2R2U A;  2XQC A;  2KKH A;  4DV0 F;  2FZC B;  2HWI A;  3K5P A;  1YRT A;  3LUY A;  5F8G A;  4PR6 A;  2IC3 A;  1TL7 A;  4DUT A;  3QJJ A;  3FSX A;  5GMK a;  3C15 B;  1TK8 A;  4NZ7 A;  4ZGA A;  4USM A;  3CDB A;  4KV8 B;  4OFZ A;  1LWF A;  4O3R A;  1CPZ A;  3ELH A;  3ILO A;  1FWL A;  3BYR A;  1A9N B;  4F2R A;  4KR0 B;  3C16 A;  3CD5 A;  3I9V 9;  4ZIT A;  2MLX A;  4ZDN A;  2IBK A;  3MEG B;  1YVF A;  1LWE B;  2YTC A;  2AEM A;  4NCB A;  4QZV B;  2V4J B;  2E9R X;  5IC6 B;  2IA0 A;  3FCV A;  4Z2X A;  2PGC A;  2MB0 B;  2P9C A;  4UOO A;  1NHU A;  1R89 A;  5D0G A;  1ACM B;  1TK0 A;  2YBV A;  1WKK A;  4B3M J;  2AJ4 A;  1BHN A;  2IM2 A;  1HNI B;  1KWM A;  3IRW P;  2SXL A;  3J80 U;  1XMO J;  3NVL A;  2KHC A;  3QJP A;  3CJ5 A;  4NLD A;  3OHB A;  5HQM A;  4TYB A;  1AFJ A;  4CTA B;  2IVY A;  4PUO A;  4PWW A;  1FFG B;  4RKU C;  1DJ0 A;  3EE3 A;  4OJ1 A;  5A2Q U;  2ZE2 B;  5L9X A;  3JS9 A;  3UO0 A;  1KQK A;  1QJH A;  1S6O A;  1N36 F;  2M2B A;  2WK4 A;  4USW A;  4DL4 A;  4FDF A;  1UEV A;  2VJU A;  4NI2 A;  3AFG A;  3IWN C;  4OV1 A;  2OIH A;  3AD9 C;  3UW1 A;  3TQ1 A;  3CT9 A;  2NLW A;  3G82 B;  4KFB A;  1ALJ A;  3AXM A;  5ITH A;  1BGX T;  3FVY A;  3M2U B;  4DL6 A;  4ECU A;  2FVQ A;  5CH7 B;  3PFE A;  3WAX A;  3UN3 A;  2HK2 A;  1ROF A;  3KMS A;  2FPH X;  4K2J A;  4XK8 C;  3KJV A;  4H4M A;  1QUP A;  2LEB A;  1HHT P;  1OPI A;  4DR5 J;  2B8Q A;  4IFY B;  3VV2 B;  3GYG A;  4RNN A;  3RAX A;  4FZV A;  5C2G A;  1HQU A;  1FO1 A;  4OZ2 A;  1VBZ A;  3DLL Q;  1PC5 A;  4ATN A;  2DHX A;  1WOR A;  3ZTO A;  1RTJ B;  3K17 A;  2LFV A;  2RU3 A;  3CED A;  2VBX A;  1TVR B;  4NCA A;  3MMC B;  3HHL B;  2WOM B;  2GSO A;  1MNE A;  5IM0 B;  3ENQ A;  3JYT B;  3UVJ B;  2UV8 G;  3H2V E;  5G0R A;  5KFN A;  1HKA A;  4ECV A;  1HQE B;  4JBC A;  1FD2 A;  2E1R A;  4KC5 A;  4DSE A;  1TFY A;  1JLG B;  3GPA A;  1B7F A;  3C14 A;  2OEK A;  2DR5 A;  2XYP B;  2M9K A;  4CXU A;  2DXD A;  4LFB J;  4JI0 F;  1FSU A;  2GVD A;  4J9S A;  4KAY A;  2LVW A;  1VQ8 S;  4OI4 A;  2E5G A;  4HAC A;  2F4V F;  2CQP A;  4CLK A;  4MKY A;  1EJJ A;  4YOE A;  1FHT A;  3OFF A;  3BV8 A;  2PA3 A;  5I42 A;  2X1G A;  3MD1 A;  2BKO A;  2R7X A;  3R2D J;  2R7U A;  1MU2 B;  2BV3 A;  3H8Y A;  1HNX J;  1URA A;  3MMB A;  3M2V A;  2XS5 A;  3TAM B;  2M8H A;  5IV3 A;  1H7X A;  3NEK A;  4NLT A;  1WEL A;  4O44 B;  1VCT A;  3V2U C;  2MKH A;  1U0H A;  1ELO A;  5LQQ A;  2V8P A;  4ED4 A;  4XDC A;  3R7N B;  4ZPV R;  1YTY A;  3HSD A;  4DMZ A;  3W9I A;  4J9M A;  5C42 A;  1IKY A;  5KFO A;  5LMU F;  1O98 A;  4Y2I A;  1YI2 S;  3ZFV A;  3B4D A;  3SXL A;  2XNQ A;  3QO9 B;  3PO5 A;  2OPQ B;  1VLO A;  2YNI A;  5B0G A;  1M5O C;  4K4U A;  2B4V A;  2PMZ D;  2XMA A;  3H20 A;  4FPI A;  2DR9 A;  4HT7 A;  3K5O A;  2V63 A;  2E5L F;  1RTD B;  2W4C A;  4OZ0 A;  3QLH A;  3KHG A;  3PYF A;  1AJC A;  4DV4 F;  2NUU G;  3GTY X;  4QYR A;  2JLG A;  3CCM S;  2W5T A;  4PPD A;  1VQY A;  1VC5 A;  3GWC A;  5IWA J;  5HL7 Q;  3D3B J;  1SJ3 P;  3SI8 A;  4QOT A;  2CQC A;  2UUW A;  4PKD B;  3BGO P;  5SUH A;  2F3J A;  3NBP B;  5DZ6 A;  4NZ0 A;  3CJ8 A;  3V4I B;  3TZY A;  1H73 A;  4ER8 A;  1EIY B;  3K59 A;  3VAK A;  4UUX A;  1FXR A;  2ZHA A;  1K73 T;  1N52 B;  4RNF A;  2OP5 A;  4YDD B;  2HMI A;  4FNH A;  5K14 A;  1C2P A;  2AJ1 A;  4AL6 A;  4PWD A;  1B0T A;  1CSJ A;  2RT3 A;  3DRS B;  4CNY A;  3ZXW A;  4JI4 J;  3CMA S;  3FK4 A;  3OL8 A;  3E2D A;  3P49 B;  1OY9 A;  4Q2M A;  3SV4 A;  2B6A A;  2RKI B;  1JLF B;  1NAQ A;  2ZJR Q;  3TAR A;  4OI6 A;  5JJB A;  1ALK A;  4ECW A;  3CMR A;  4ZG7 A;  1VK3 A;  3IA0 A;  2C3Y A;  3PW0 A;  3AOB A;  2LQ5 A;  4N56 A;  5J2P B;  3PW7 A;  2KM8 C;  5IJQ A;  5D0R A;  2DNO A;  5CAA A;  3GG1 A;  4CYU B;  2DGT A;  1A6L A;  1IKV A;  2LU1 A;  3V6D A;  1Y0H A;  1TMM A;  4CLS A;  3Q8U A;  3L4B C;  2MKI A;  1OYD A;  5A8K B;  2O3D A;  4B17 A;  2ZZT A;  5I3U A;  4C0H A;  1TUV A;  3M9O B;  3CJ0 A;  1U48 A;  4A8Q A;  4UQT A;  1LW0 B;  4ZVQ B;  2K1R B;  1HQA A;  1HPZ B;  4Q8E A;  4MAK A;  1UVN A;  1APS A;  1X8D A;  3IBF B;  1T05 B;  1VJW A;  4PG6 A;  1WOP A;  1QM9 A;  1BC6 A;  4OMF G;  1FJG F;  5KG6 A;  3KLE A;  3DGP B;  4I2Q B;  2Y1I A;  1YGY A;  4DQQ A;  5BYR A;  4ZCI A;  2BR0 A;  2OML A;  4EWT A;  1YRX A;  1X9M A;  1P1L A;  1DQA A;  3D0I E;  3C66 A;  3KHR A;  3SQG B;  4IRK A;  2QX0 A;  1C4C A;  1MN7 A;  1FEE A;  3N6L A;  1KLM B;  3JAM U;  3MR3 A;  4PG7 A;  4PYA A;  5F0W A;  4OYO A;  3BR9 A;  4DEZ A;  4RUH A;  1T94 A;  4F4W A;  1FVQ A;  2DT9 A;  4F0H A;  2GML A;  2XB2 D;  2CQ0 A;  2ZWP A;  5CCL A;  2HNY B;  4NLW A;  2HK3 A;  4OYB A;  4OZJ A;  2YKO A;  2LCW A;  4CCH A;  3EM1 A;  4LF9 F;  5B7W A;  2AT1 B;  5KFR A;  2XZD B;  1U4B A;  3D1O A;  1CUL B;  4OHZ A;  4LRE A;  2YKM A;  3BZQ A;  2B7B B;  3JSM B;  3HSZ A;  3FSY A;  5IV4 A;  4TN0 A;  3HVW A;  1CJU B;  4USK A;  4DS5 A;  4L74 A;  3KG1 A;  4IUF A;  3Q0A A;  4M5D B;  4F36 A;  1BQM A;  4J9K A;  3LOU A;  3FGV A;  4PEO A;  2YWE A;  4W98 A;  5KFS A;  1PJ6 A;  2VG5 B;  1AT1 B;  2HFN A;  1WSV A;  2YNH A;  5IXU A;  5HAT A;  3RBZ A;  3DLH A;  3OR2 B;  2Z57 B;  1S9G B;  2JDJ A;  3DHW C;  2OO4 A;  1RHQ B;  4Q8F A;  4WK3 A;  4JV5 F;  2XLK A;  2JEG A;  2C2Z B;  3NGR A;  5HMW A;  4R0E A;  2VHG A;  2WON B;  4PRF A;  3AD8 C;  4LIW A;  3G6Y A;  3AQO A;  2DPJ A;  2HVD A;  2XSJ A;  1BMQ B;  1DFD A;  1OY8 A;  4N8N A;  2DPI A;  2ZM6 J;  3LP2 B;  5KFK A;  4LF5 J;  1SQE A;  2YKN B;  4C0B A;  1RU2 A;  2PE8 A;  3F56 A;  3BDG A;  4DR3 F;  3MR2 A;  1ZYQ A;  3HHK A;  4MYT A;  4FYY B;  2C2M B;  6FD1 A;  1RT5 B;  2AIR B;  2HNZ A;  3GON A;  1CG2 A;  3W2V A;  4P74 A;  3ZTS A;  3DLG B;  2KXF A;  1LXN A;  5KFV A;  2PA8 D;  3WBZ A;  3MEK A;  2BUN A;  2M5Y A;  2QGF B;  1FKA F;  1JK9 B;  4ETX A;  5LXY A;  1N6Q A;  3UCZ P;  2EFQ A;  3FBF A;  5KG4 A;  4O3N A;  1U7L A;  2NUH A;  2DR6 A;  3T1H J;  3CDW A;  4DV1 F;  5C25 A;  2R3V A;  1KBR A;  4GRS A;  1D8Z A;  3MAH A;  2BJ1 A;  1U1P A;  1PYT A;  1TKZ A;  3BH6 B;  2OPP B;  4B3S F;  3GIR A;  1RT2 B;  3L3C A;  4AXJ A;  4L3K A;  4DL0 C;  5K20 B;  2R4F A;  3UPF A;  5F9N A;  3E8O A;  4J9O A;  1FVS A;  2HND B;  3I9Z A;  3FEZ A;  1CJK B;  2MKJ A;  3CJK A;  1AA1 B;  1GMW A;  1HW9 A;  3ZZ0 A;  2MHE A;  1IQT A;  1RJJ A;  2UUA J;  3AOC A;  2CIM A;  3KLF A;  2GAG C;  4CZC A;  1UZH A;  4B9M A;  4EBC A;  4UQG A;  3M8S A;  4EMD A;  2IY5 B;  4FXV A;  1N34 J;  1IBK F;  2NSC A;  3TVY A;  3PR5 B;  4ECQ A;  4ILR A;  5HRT A;  1HI8 A;  2ZBI A;  3VQT A;  4LSL A;  3W3S A;  3HFK A;  2GFF A;  5ETN A;  1GH8 A;  4QPT A;  1S9E A;  4I6A A;  2JRS A;  3DN9 A;  4DLG A;  3FCW A;  4MKV A;  1J5O B;  2FJD B;  1OO0 B;  1U8W A;  5H1S V;  2D1G A;  3PYG A;  3PX0 A;  4UOP A;  1U49 A;  3S8S A;  1WDD A;  3ZZT A;  4KT0 C;  4YR0 A;  2IIH A;  2D3O 1;  2E1C A;  5KAK A;  4DPX A;  3OTO F;  3BO2 A;  3DOL B;  5J2N B;  1HBN B;  1SC6 A;  2EEY A;  2C3O A;  3R27 A;  3NAI A;  3BBC A;  1JJH A;  1UVM A;  3THT A;  3D9B A;  1Z4U A;  3GV5 B;  3PHT A;  2EFG A;  4I6Y A;  4NEY A;  1S49 A;  2WSE C;  4XAK A;  2EK6 A;  4NXN J;  4WP8 A;  1NPR A;  1FX2 A;  5HMZ A;  1IR1 A;  3QSI A;  2HGN A;  4JI1 F;  4I2P B;  1T9Y A;  1RB0 A;  3TNV A;  1KFS A;  1QE1 A;  3ITH B;  3BF4 A;  2PO4 A;  3KK2 B;  1F3F A;  5HRO B;  3P8B B;  3C2P A;  4KH0 B;  3MDF A;  2V69 A;  3US5 A;  3QWU A;  1RT4 B;  2MZT A;  2R8K A;  1D09 B;  4WK1 A;  5CHC B;  4M94 A;  1EP4 A;  4NLX A;  1HNZ J;  3I0S A;  4ICL A;  1LK5 A;  4OI0 A;  3SYZ A;  1ZEF A;  1TFW A;  4C0O C;  2XR9 A;  2LXU A;  4I7F B;  5L1L A;  2PC6 A;  2GJF A;  3IMQ J;  2HRT A;  1AZS B;  1VQM S;  2QIF A;  1U45 A;  1B3T A;  1OPZ A;  3DCA A;  2FHK A;  3CTR A;  1X5T A;  1SUQ B;  4GTZ A;  1C1B A;  2MLZ A;  1KS2 A;  1ICE B;  4ZPT R;  4GVB A;  3K5L A;  3KTQ A;  1Q82 T;  2N7C A;  2ZNZ A;  4KE5 A;  3SV3 A;  2DD8 S;  4GTW A;  5ETT A;  2W01 A;  4PXC A;  4ED3 A;  2V8H A;  2BA9 A;  2L48 A;  1FE0 A;  1R0A A;  2HHT A;  1SV5 B;  2B9Y A;  4QIG A;  3PVX A;  3LP1 A;  1X5P A;  3JSY A;  4YN3 B;  1EW2 A;  4A8M P;  5EUH A;  1L3T A;  1ZOT A;  1RDR A;  3C6U B;  3S1T A;  2RHQ B;  1XWL A;  4J91 A;  1V9O A;  4ID8 A;  2K7J A;  3CDA A;  3HF5 A;  2BYC A;  2MQM A;  2R42 A;  4H4K A;  3TO8 A;  2GQ2 A;  4CH7 A;  2YNG B;  3BGL A;  3G8Q A;  2YKA A;  4Y2C A;  3DRR B;  5J2Q A;  1R8P A;  2HHP A;  1CS4 A;  5F9L A;  3GCW P;  1DZ5 A;  2XMK A;  1FKP A;  5E7O B;  3VAI A;  4DN0 A;  5A8W B;  3ZTQ A;  1JLC A;  2OPS A;  3AAW B;  3DLE B;  8RUC A;  3DM2 A;  1M90 T;  3R6G B;  2P6T A;  2QLW A;  3CCZ A;  2XM3 A;  4MT1 A;  4DCJ B;  2RDI A;  3BYP A;  2N3L A;  4XIU A;  2I0X A;  4NYP A;  4DL7 A;  4AT1 B;  3OV7 A;  4CT9 A;  3UDE A;  2QA4 G;  1F9E B;  3R9L A;  4ZLP A;  3CGI A;  4F7V A;  4C11 A;  4ZLJ A;  3MM5 B;  1HWJ A;  1FJ7 A;  2ASD A;  5DDR C;  5CXT A;  1RTH A;  1ZAW A;  2OFH X;  3D6F B;  4TU8 A;  4ZP8 A;  3UNY A;  2XYH B;  3FC9 A;  2CUY A;  4A4J A;  1RWM B;  1VQ6 S;  4OZ1 A;  3MZI A;  3UN5 A;  1EKR A;  1NBE B;  3VAJ A;  4LF7 J;  3FDS A;  2V5H G;  3FJ2 A;  1GX5 A;  3WC2 A;  2V4J A;  3TOQ A;  3PNI A;  1SPB P;  4OIX A;  4L72 B;  5BR8 F;  4GTX A;  2BAC A;  4DPT A;  3QYY A;  1S72 S;  2XSF A;  1S1W B;  4WTY A;  3BKF A;  2V8D A;  1RT7 A;  5HO4 A;  4ZOS A;  3M05 A;  2UVR A;  4QJV A;  5A8R A;  2CWX A;  5FDL B;  4KB7 A;  3FZB A;  2ROG A;  4CTA A;  2MQQ A;  2WW8 A;  2V2Q A;  2XMT A;  4RW6 A;  4PZV A;  4YQW A;  1T9W A;  5A0Y B;  2CKW A;  1U1M A;  1VOM A;  2BOP A;  3H2L A;  2CPZ A;  1OMS A;  4ZJQ A;  1FRX A;  2YPZ A;  4RW7 B;  1VHF A;  2AYM A;  4JI2 F;  5BYS A;  2W9A A;  5DDP C;  5KT4 A;  3N5B A;  4DQI A;  2UXC J;  1RHM B;  2VC1 A;  2B9W A;  1T8E A;  4E98 A;  4XPE A;  2DNQ A;  3D5M A;  3B4M A;  3CCW A;  3G82 A;  3FFI B;  4QR0 A;  1HBU B;  2YH1 A;  5KOX A;  3AD7 C;  2QZ8 A;  2A2D A;  1S99 A;  1P9Q C;  4KRW A;  1MML A;  2C3M A;  4OYW A;  2ZD1 B;  3H5Y A;  3WAV A;  1AJA A;  4NA2 A;  3CW2 C;  3T6B A;  1HR0 J;  4FYW B;  2OI2 A;  1N36 J;  5JVG Q;  4UY8 5;  3VAF A;  3C6T B;  5KFM A;  1CQM A;  1ZET A;  5AE2 A;  4QYZ K;  3W63 A;  2CJB A;  4I64 A;  2I38 A;  2HRY A;  1M5S A;  3ZTP A;  2IRY A;  4FNI A;  3P45 B;  3CCQ S;  1ZED A;  2RIL A;  3MPD A;  3PHE A;  9ATC B;  2A6M A;  5B0F A;  2IUC A;  2F9J A;  2EG2 A;  4CLP A;  3OHA A;  1TUW A;  1TVR A;  2X7I A;  3CDU A;  2QLJ B;  5HSP A;  3RAQ A;  3OJU A;  3ILL A;  1VRU A;  4DSJ A;  1VR6 A;  3UVJ A;  4F4A A;  1HBM B;  1VI7 A;  5H9F K;  2JLF A;  1L3U A;  2GA7 A;  1DRZ A;  2OTL S;  3LPY A;  2IDE A;  1RT6 B;  1Z2L A;  3DMJ B;  3D0H E;  4C8Z A;  4RUC A;  4HHJ A;  2EPI A;  2LLZ A;  3BSC A;  3O1L A;  4FXD A;  4OLO A;  2DNY A;  1YJW S;  1E2S P;  4ID5 A;  4K7Q A;  3H5S A;  3R5G A;  2DGV A;  2RQK A;  1IBM J;  1YWX A;  2K06 A;  4IG3 B;  2POK A;  4I1T A;  1X9W A;  2KHD A;  4D3G A;  1X5S A;  1XR5 A;  4ZN3 A;  4IR1 A;  2ASY A;  2AP6 A;  2VH7 A;  3TRG A;  3BGF A;  4KHR A;  3TP2 A;  3D54 A;  4ANE A;  1W2I A;  3W8G A;  4JI0 J;  3K57 A;  1S1X B;  1BWE A;  5GAD I;  3NKO A;  1KNZ A;  4PXD A;  3THV A;  3BEG B;  1LWX A;  2OGU A;  4OI2 A;  1HA1 A;  3N9U C;  4HVZ A;  3SFG A;  2PFF B;  3JSR A;  1UJ5 A;  5RUB A;  1DAX A;  1YJU A;  2CJY B;  1MG7 A;  3W60 A;  1X9S A;  4G1Q A;  1UPM B;  4U9R A;  1FK9 B;  4ZP9 A;  4OYZ A;  3GJT B;  5IOL A;  4YR2 A;  2R9L A;  1HI0 P;  3M8Q A;  2U2F A;  3HJF A;  1LNQ A;  1RBA A;  3ZZZ A;  1HYS A;  4OI3 A;  4OX6 A;  5GAD U;  4NX9 A;  5LMU J;  3J7A N;  5ETK A;  1PYO B;  3U7J A;  3Q8S B;  1Q0N A;  3WX4 A;  1RTI B;  2GLQ A;  4B08 A;  3ICL A;  3GLJ A;  4DV2 J;  2VFT A;  2VKR A;  2E5L J;  2J6S A;  4DR7 F;  3EGW B;  2FZK B;  1KLN A;  3SFU A;  5KFE A;  4CLT A;  3CO0 P;  5KFJ A;  2MZ1 A;  4QYZ J;  1TAU A;  1O5J A;  4FKY A;  3CNQ P;  2B5J A;  2J76 E;  3EMT A;  3DRS A;  2QLF B;  1EHW A;  1ALH A;  5EWF A;  4C6A A;  3OFH A;  2AV5 A;  2XRG A;  3QFH A;  5AE1 A;  4L6V 3;  2VAS A;  3ED4 A;  1KRP A;  3QAU A;  2VC0 A;  4C48 A;  3MOJ B;  2KG0 A;  2W9C B;  4RX6 A;  4UPK A;  1GMW D;  5H9F J;  3Q89 A;  5H9E K;  4NML A;  4K0K F;  2FLN A;  2HHQ A;  2F8E X;  4O3S A;  1O8B A;  4IO9 Q;  1JXE A;  4A46 A;  2M3D A;  1KFD A;  1Y5I B;  3JQK A;  1JWW A;  2IMW P;  3RB4 A;  1F60 B;  4CYU A;  2AU0 A;  2MDA A;  4IH7 A;  5KFQ A;  2XHW A;  1S59 A;  1G1X A;  2FVS A;  3KLI A;  1S1V B;  1RT3 A;  5DO2 A;  3AOA A;  3J7A 1;  2ZH8 A;  5A8K A;  1B8J A;  2EVZ A;  3HPO A;  2MJN A;  3VAL A;  1WI8 A;  1S57 A;  2IVF B;  4H4O B;  4JI8 F;  4LR2 A;  2C1E B;  3HHN B;  5KFU A;  4C2M A;  2J9C A;  5DG8 A;  2DCU B;  1GTH A;  2BJE A;  1KDN A;  3HI9 A;  3ILI A;  1WF1 A;  1TL4 A;  2ASJ A;  1FRI A;  3WX8 A;  1U26 A;  2LEP A;  4J9V A;  2V68 A;  1UJ4 A;  3AJD A;  1G3O A;  2BVZ A;  3NXZ A;  4XDD A;  2M7S A;  1GEH A;  3PV8 A;  2KYZ A;  3A3O B;  1U1L A;  3MFI A;  3NKN A;  3G4S S;  1X4E A;  5J1E A;  4I0W A;  1DY3 A;  3UDV A;  2FUG 9;  2I1R A;  2ZOF A;  1P27 B;  1VBX A;  1UVJ A;  9RUB A;  1NKE A;  2R2T A;  3Q24 A;  4HH1 A;  3A4T A;  3SCL E;  2OHD A;  1FJG J;  2XNR A;  5F8M A;  3LGM A;  1RUS A;  1TL3 A;  1RLD A;  1X7V A;  1YBA A;  2NPI A;  4PYD A;  1PIE A;  3K5M A;  2Y0B B;  1T02 A;  5L38 A;  1S6Q A;  2WB4 A;  2R8J A;  4PXB A;  1LV5 A;  1LQ9 A;  4KGZ B;  2HHW A;  3LP0 A;  2YX7 A;  3J7Z 5;  1WC6 A;  1QAJ A;  5AJ9 A;  4J9Q A;  1KVK A;  1TKX A;  3CIZ A;  3J7Z T;  1DLO A;  5CD4 H;  3TVK A;  1HHS A;  1PBA A;  2LQB A;  2GO9 A;  1XQI A;  4F50 A;  4ZVS B;  2LQJ A;  1NJY A;  3EXC X;  3FQL A;  1RWK B;  1AB8 A;  2BZ2 A;  1U1N A;  5K8P A;  2CQH A;  3TEH B;  3HHD A;  4DL5 A;  1RHK B;  2W7O A;  1RWU A;  1QAY A;  3GYX B;  4JB8 B;  1H2T Z;  7FDR A;  3CME S;  3OR2 A;  2CPX A;  3F73 A;  3SCJ E;  2VB6 A;  3KOA A;  4C8M A;  4TLR A;  3NOC A;  3OW2 R;  4DU8 A;  2R7V A;  4NCG A;  4CO2 A;  1KR4 A;  3KUH A;  2NYI A;  3VR1 A;  2PT0 A;  2UUC J;  3M2R B;  4WKR A;  3L9Z A;  2WON A;  4OYA A;  5I3Q A;  3F0N A;  4MIV A;  4MYU A;  2PFD A;  4IG0 A;  3OR1 B;  1WOS A;  2K8G A;  2RB7 A;  5H9E J;  1BQX A;  4HYK A;  4NXM F;  2HIY A;  2F63 A;  1B0P A;  3MGJ A;  1RBO B;  2AHO B;  1CQN A;  5KT5 A;  4DL3 A;  3U1L A;  4N5S A;  2BQ3 A;  1WOO A;  3D0G E;  4B9U A;  2ZC3 A;  3HCX A;  1OS5 A;  1S5Z A;  5E33 A;  1KHJ A;  3W8P A;  2OKQ A;  4DR2 J;  3MCS A;  1BXN A;  3WZ0 A;  2DJW A;  4JV5 J;  2GX8 A;  1SBR A;  2UVW A;  2DY9 A;  3J81 j;  4MIA A;  2GIQ A;  2Y1R I;  1DTQ A;  1R8A A;  3VGV A;  2B4P A;  4DZ6 A;  4A8O A;  1NSP A;  1F5B A;  3T6J A;  4N7T A;  1WSR A;  4M5J A;  3E01 B;  3GSD A;  4FF4 A;  2JFK A;  4F25 A;  4FS1 A;  3ZNJ 1;  4FBU A;  2ILZ A;  1KP6 A;  3SSQ A;  2QYG A;  3AHP A;  1EQM A;  4OJ3 A;  4DR3 J;  2DRD A;  2DGQ A;  2HKE A;  1REG X;  2GNK A;  4PQU B;  3QWP A;  5DM7 Q;  2FDN A;  2J5A A;  3QBC A;  4C98 A;  2HW3 A;  1SQF A;  1RYR A;  2VA3 A;  2NQP A;  2FC9 A;  4WZM A;  3DRP B;  1I5O B;  2JH3 A;  1HHQ A;  2KB2 A;  4DR4 F;  4DS4 A;  3H40 A;  1L5U A;  4GKK F;  5J2M A;  2JEF A;  1HNW J;  3QRQ A;  1U1O A;  3CF5 Q;  4NLY A;  6FDR A;  2I5J A;  4YB1 P;  4DV1 J;  1AUD A;  4DG1 B;  2IM1 A;  3MM6 B;  4B3R F;  2F40 A;  3KK3 A;  3RBD A;  4P9S A;  1GXT A;  4K50 A;  1NJZ A;  2XHC A;  1Q81 T;  4B3S J;  2XCA A;  3T5K A;  2OMO A;  3KDO A;  4P2F A;  1GNK A;  2KVQ E;  4KQZ A;  1M0S A;  3T9Z A;  4DUY F;  2WVE A;  2DNK A;  1JQG A;  3OLA A;  4M5H A;  1UW4 A;  2YXL A;  3MEE A;  3I0R B;  2G9Y A;  5K4P A;  1V6H A;  4ZKA A;  1J5O A;  1HWL A;  1L3V A;  2Q66 A;  1RT1 A;  2JEI A;  2FQQ B;  1DTT A;  4KGM A;  1Y5N B;  2R2S A;  5E0O A;  2BDP A;  2V6A A;  3Q2S C;  1UEU A;  1YIT S;  2VOO A;  2FJE B;  5E3C A;  3W2W B;  3HM9 A;  2H1Y A;  4CQ1 A;  2Q79 A;  1WF0 A;  3HT0 A;  1IBK J;  1KQF B;  1UAW A;  4LQ9 A;  3TUJ C;  4PXE A;  3UD3 P;  1YZ7 A;  2HRU A;  3ZZR A;  1NLK L;  3CC4 S;  5F8J A;  2A0F B;  1HL6 A;  3IM9 A;  3BH7 B;  1WC0 A;  4MKA A;  2QMX A;  4EI2 A;  1YJ9 S;  4H4K C;  1A7G E;  5KG5 A;  2V9W A;  2XWX A;  2FGC A;  2GS8 A;  4OX9 F;  1TL1 A;  3DDI A;  3CJS A;  3MUV P;  4QQB A;  4DFM A;  2VPZ B;  5DLF A;  4HTJ A;  5K5M A;  1IM4 A;  3VCD A;  4MFB B;  4OL8 A;  1SC4 B;  3QAE A;  2HQC A;  1S12 A;  4WKY A;  1Q8B A;  3OPK A;  1WKL A;  2UXB F;  3THP A;  1UTA A;  4O0N A;  2B9E A;  3KHL A;  4DQP A;  4I7F A;  4FDI A;  2D69 A;  1JLB A;  5BXI A;  5HBM A;  5EGY A;  3QJL A;  1YBT A;  3GP9 A;  3LWM A;  5KTQ A;  1UWA A;  4JI1 J;  3CD0 A;  5HMY A;  1Y3J A;  2VQR A;  3H0P A;  5D77 A;  2GJ2 A;  3BQ2 A;  1NSQ A;  3DI6 B;  1NJI T;  3Q8V A;  4USJ C;  3D6M B;  3O5T B;  2FJA B;  2CXE A;  3M8Y A;  2AZ3 A;  3Q23 A;  2MKS A;  5BYQ A;  1E6Y B;  1GTE A;  2RHS B;  1SKU B;  2J8A A;  4DUZ F;  2HFV A;  5AJ3 F;  1R7I A;  4YHH J;  2JC0 A;  3P96 A;  3ULH A;  1URR A;  4NWB A;  1TAQ A;  1HBO B;  3KUG A;  3B78 A;  1T9U A;  2DGX A;  1HLW A;  2W5R A;  5IT0 A;  1IJF B;  2F5G A;  2KT2 A;  2YKQ A;  3DRR A;  2BKP A;  3DXB A;  1CJV A;  4TYA A;  5ETM A;  2GA3 A;  5KG2 A;  3Q22 A;  4B9L A;  1I6J A;  5T7L B;  5IZH A;  3UD5 A;  1E3C P;  1LW2 A;  5CYM B;  4LRD A;  5KG7 A;  2WZ1 A;  3OUY A;  4Q0B B;  1FA0 A;  2VFU A;  4ED8 A;  2DHG A;  3QIP B;  1BUX A;  2YNF B;  2A18 A;  2K3K A;  4N77 A;  2EFN A;  3GU0 A;  2ATC B;  4NYZ A;  2YWG A;  3VZH A;  3IR5 B;  4JI6 F;  4FYX B;  1WG4 A;  4LRA A;  1WD6 A;  2L41 A;  2YWH A;  1QSS A;  4A8X A;  3DOM B;  1FRL A;  3P5T L;  1VFJ A;  3RW7 A;  4KAI A;  3MK2 A;  1EET B;  4J37 A;  1YJT A;  3O6Q A;  3R5A A;  4JYA F;  1Q78 A;  1S1T A;  2CG8 A;  2MY8 A;  1K8A T;  3VTI A;  1FI4 A;  1KH7 A;  1CJT B;  3EXY A;  3U1M A;  3HD2 A;  4J5O A;  4K2X A;  3M7V A;  4FBT A;  3NNA A;  4EBE A;  2AW0 A;  3MTK A;  1JNZ B;  3PZP A;  1RA7 A;  3HVT A;  2H51 B;  2QG9 B;  4DDF A;  4K59 A;  5K8O A;  5DLV A;  3GZ7 A;  4UF4 A;  4CNZ A;  1S9F A;  1FNM A;  4RW7 A;  5BR8 J;  1EQJ A;  1M5K C;  3GFX A;  4J90 A;  2XO7 A;  4IYQ A;  2FVC A;  2Y1J A;  3VQS A;  2EFP A;  2GSU A;  4C9D A;  4OQJ A;  4PG8 A;  4URG A;  3F41 A;  3R5C A;  3MAA B;  4B9T A;  4YY3 F;  4KY3 A;  5KXA A;  4XPC A;  2UU9 J;  1EQ0 A;  3TX0 A;  3GB0 A;  2KT3 A;  2ZUG A;  4WFZ A;  4V19 J;  1JLE B;  3CCR S;  2RAQ A;  4KGV B;  3WAY A;  1HW8 A;  2VQE J;  1VHI A;  4LRC A;  4P6Q A;  4CH1 A;  4B3O B;  3AJ2 A;  4P52 A;  4PG4 A;  3W64 A;  3EZU A;  2ZNY A;  2HFZ A;  4LJM A;  1ZM4 A;  3KG4 A;  2QSF A;  4F8R A;  3NOG A;  1PO6 A;  4Y2A A;  2U1A A;  2YWF A;  1WTB A;  1C0U B;  3W62 A;  4KSE B;  3HUL A;  4FS2 A;  3EVO A;  4LVO P;  2AJF E;  5EX3 A;  2W5V A;  1SH2 A;  3I87 A;  4DPY A;  2D3U A;  3ONQ A;  4ETZ A;  1MWQ A;  2YQ1 A;  2W8K A;  1I1G A;  2WHO A;  3PRB A;  3CMQ A;  3ET6 B;  3RR8 A;  4DR6 J;  5KFX A;  2B0G A;  5HP1 A;  2RJZ A;  1H72 C;  4J9N A;  1RYS A;  1WHX A;  2XTJ P;  2LDI A;  3MM7 A;  1RZM A;  2M70 A;  4X4P A;  2ROP A;  3AJ1 A;  4USU A;  2E5H A;  1I51 B;  1SH3 A;  1VBK A;  3EWG A;  2WSF C;  2ZZM A;  3NNC A;  3VAH A;  2QSW A;  4WIQ A;  2CQI A;  4ZN1 A;  5JVH Q;  2V2K A;  1DBD A;  1RE1 B;  1IKX A;  4ZIV A;  3AA9 A;  5GAE U;  1WWH A;  2WAQ D;  2YX1 A;  1LFP A;  2GW8 A;  3JSB A;  1N56 A;  1V3S A;  4ZJO A;  2G0I A;  2BW7 A;  4U7U D;  3FUY A;  2QLB B;  2VPX B;  1C1C A;  3W5Z A;  2HS0 A;  2BE2 B;  1S1X A;  2A6O A;  1NRK A;  1UP1 A;  2RS8 A;  2HSE B;  4HT5 A;  1MLA A;  4C8N A;  1J5E F;  2GVZ A;  4RLE A;  3MPY A;  5FLX Y;  1X5O A;  3ZO7 A;  1N33 F;  4R8U B;  3MMJ A;  2L9N A;  2IJN A;  2ABY A;  4WYW A;  1T03 B;  1NXI A;  4K4W A;  1D9F A;  4DFJ A;  3PR4 A;  2VA2 A;  1DHM A;  1I94 F;  1J2V A;  2Z8Q A;  2FY8 A;  3SSS A;  1SJ1 A;  3AA8 A;  4C7Q A;  1Q53 A;  2N3O A;  4LF2 A;  1REV B;  3DOK B;  1KTV A;  3N0V A;  2G4B A;  3CJQ A;  2HLU A;  3UNG C;  5LJ5 Y;  1NK9 A;  3KKF A;  2BAN B;  3M8P B;  4RWX A;  1NPK A;  3T19 A;  3PRD A;  3D1Q A;  4UOG A;  2IC3 B;  1TL7 B;  3CD7 A;  2HYI B;  1IBL F;  3J7Y U;  2B8P A;  4NPO A;  2EBE A;  4NRU A;  2VKZ G;  2Y8Y A;  1FRJ A;  1LWC A;  5BJR A;  3CB4 A;  4C8O A;  1LWF B;  4DL2 A;  3L7U A;  1RAJ A;  5B09 A;  4DR7 J;  2W8L A;  3MCO A;  3DNC A;  2KL8 A;  4U8V A;  4KM4 A;  3C16 B;  3ENV A;  1GXU A;  4ZP6 A;  3VGT A;  1BQN A;  5KFD A;  1NJX A;  3GFH A;  1TU0 B;  4FF2 A;  5L1K A;  1HWU A;  4I4B A;  1UFL A;  3R7S B;  1S1V A;  2FLP A;  1U2C A;  2Y8W A;  3SIP B;  2P2C B;  1R8C A;  1Y11 A;  2B3T B;  3ADA C;  3G6V A;  2D7S A;  4K4V A;  2VF3 A;  1XNR J;  3UD4 P;  1OSD A;  3H5U A;  2DIV A;  3Q8P B;  4RBU A;  4J9R A;  4K0K J;  1I3O B;  4DV3 J;  4PUO B;  2GSN A;  4ZPW R;  1GXL A;  3MM9 A;  1UW9 A;  4P2M A;  4Y00 A;  4V1A k;  2AMC B;  2HHH J;  4FVC A;  4LR8 A;  1Y10 A;  2Z2Y B;  1S0V A;  1X4C A;  4BWM A;  3G86 A;  1FX4 A;  2ATL A;  5K8M A;  4NI2 B;  1URN A;  5HVG A;  2M52 A;  3UFC X;  1FWP A;  2HHX A;  4USH A;  3VWS A;  4KJD A;  3I32 A;  1RHR B;  4KFB B;  2IBO A;  4YDX A;  3IRX A;  5DQH A;  4ZPB A;  2JX2 A;  1K1S A;  1S10 A;  2HGM A;  2MPU A;  4R0J A;  3KJV B;  2M0G B;  4H4M B;  4A8K A;  3EDR B;  5F41 A;  2KH9 A;  3MR6 A;  5TJ3 A;  2LDY A;  3NGS A;  1HQU B;  2ERR A;  3A1Y G;  2QA2 A;  3PYE A;  2AYB A;  3KNG A;  3BS9 A;  2J9D A;  5T41 A;  3HLU A;  2DBB A;  3PRV A;  2OEJ A;  3G2X A;  5HAO A;  4F4Y A;  3RRK A;  1RXO B;  2RML A;  3ENA A;  4DSI A;  5DGB A;  4ED2 A;  3G8T A;  1JKH A;  4ILM A;  3LH2 S;  3BSN A;  4JP8 A;  2R7O A;  2FTR A;  3CCT A;  5I4M A;  5G0R B;  1JNR B;  3W61 A;  3Q8R B;  1G6B A;  1KVJ A;  4DZD A;  1HNX F;  4MMO A;  3ETM A;  3TAP A;  2CPF A;  2EI5 A;  2JJ4 D;  2XY6 A;  1TR0 A;  3TUP A;  3BO3 A;  2AJQ A;  4RW8 B;  4ED0 A;  4JOU A;  2NRE A;  3QGH A;  1V3Z A;  2GVD B;  3Q83 A;  1UET A;  2FJB B;  1E1Z P;  4HL9 A;  4HAC B;  1F9H A;  2XYG B;  2PD1 A;  1W26 A;  3H90 A;  2CRL A;  3OR1 A;  4X4N A;  2E1A A;  4C8K A;  4UT4 A;  2QMW A;  3T1Y F;  3W5Y A;  1N5V A;  1F1B B;  3MMB B;  2QEX S;  4P2S A;  2BJD A;  5INH A;  2MZQ A;  3M2V B;  1MWZ A;  5EWE A;  2HVI A;  3FBB A;  4O0I A;  4C4W A;  2HVE A;  2B51 A;  2EG1 A;  2YWW A;  2XEX A;  1YKW A;  2KXN B;  1WEX A;  2MKY A;  5D78 A;  2LEC A;  4KHP J;  4QU7 A;  2ASL A;  2N82 B;  5C42 B;  4IRC A;  2D9P A;  1F3V A;  3LO3 A;  1ARO P;  2CJQ A;  2LP4 A;  3CCU S;  2UUT A;  4MH8 A;  1H2U X;  1ZTT A;  2CDQ A;  2QFJ A;  3PDN A;  3M1V A;  3VF0 B;  3MUM P;  1NDP A;  1RCX B;  2YNI B;  4NLP A;  3GFZ A;  2LQ9 A;  4GTY A;  4EO6 A;  4RU9 A;  1AFI A;  4EBD A;  2IPO B;  3T00 A;  3L7P A;  3QLH B;  3HO1 A;  2ZKT A;  4RJV A;  3NMA A;  2L9D A;  1Y7P A;  3BN7 A;  5EX0 A;  4N41 A;  2PN6 A;  3R1L A;  3SZY A;  3M6W A;  3DLK A;  3VAM A;  1XER A;  4ZPD A;  3QZ8 A;  2QZU A;  2Y1L B;  2BM0 A;  1WAC A;  3PCO B;  2CQ4 A;  3I96 A;  4URQ U;  1SXL A;  2HWH A;  2DRB A;  5CD4 A;  1N8R T;  1WHW A;  4AD6 A;  4LF6 J;  4AND A;  1RA6 A;  1SC1 B;  2HHU A;  3NKR A;  2HMI B;  2UXD F;  5K14 B;  2G1H A;  4UPH A;  4PWD B;  4TXS A;  3QFW A;  3KK1 A;  4OV6 A;  4DR4 J;  4GKK J;  4F26 A;  1PIL A;  2VBY A;  4CLL A;  3MR7 A;  4MIW A;  2P5V A;  3BDH A;  2MHN A;  1WNE A;  2DO0 A;  1AUS L;  5C66 A;  2AX1 A;  2W5X A;  4RW9 B;  4ED5 A;  2B6A B;  4OYP A;  1NM2 A; 
#chains in the Genus database with same CATH homology
 3TWZ A;  5IJQ A;  5L0E A;  1KH7 A;  1KHL A;  3DYC A;  1SHQ A;  3WAY A;  3M8Z A;  1ELZ A;  4GTX A;  1E1Z P;  4B56 A;  2RH6 A;  4GTZ A;  1N2L A;  4LRC A;  2X98 A;  4QAX A;  5EGH A;  3SZY A;  4MIV A;  5DLW A;  4LRB A;  3M7V A;  3B5Q A;  1E3C P;  1URA A;  1ANI A;  4FDJ A;  5L0K A;  3DPC A;  1AJB A;  1EI6 A;  5L0B A;  3NVL A;  3MK0 A;  4LRF A;  4CXS A;  4LRD A;  2VQR A;  5GRR A;  4MY4 A;  2GLQ A;  4LR7 A;  2QZU A;  3LXQ A;  5TJ3 A;  4GTW A;  1KH5 A;  4KAV A;  1URB A;  1AUK A;  4UOR A;  5IJS A;  5LRM A;  1KHK A;  1ZED A;  1B8J A;  1HQA A;  3IGY B;  1K7H A;  3BDG A;  1SHN A;  5LQQ A;  4LRE A;  5LRN A;  2IUC A;  3BDF A;  5AJ9 A;  4LR2 A;  3NKO A;  4CYR A;  2ANH A;  1P49 A;  4TN0 A;  1ELX A;  2GSO A;  5INH A;  3M8Y A;  3SZZ A;  1E33 P;  3MK1 A;  3UO0 A;  3TG0 A;  3KD8 A;  4YR1 A;  1KHN A;  2W5S A;  1KHJ A;  2W5V A;  4NWX A;  5DLV A;  1KH4 A;  1HDH A;  1O98 A;  1EW2 A;  5LIA A;  1O99 A;  1ELY A;  2GSN A;  3BDG B;  1ED9 A;  4LRA A;  4UPI A;  4ZGA A;  5GOV A;  4LQY A;  2IUC B;  5EGE A;  1EQJ A;  5HRT A;  4NWJ A;  3NKQ A;  3IGZ B;  1ALH A;  3OT9 A;  3NKR A;  1ALI A;  1HJK A;  2GA3 A;  3IDD A;  3Q3Q A;  2XRG A;  4MHX A;  3M8W A;  3T01 A;  3E2D A;  4CXU A;  4LR8 A;  2IFY A;  3UNY A;  1EW9 A;  4N7T A;  1N2K A;  4KJG A;  2GSU A;  4UPH A;  3ED4 A;  3MK2 A;  4CYS A;  4ZG6 A;  1FSU A;  1ALJ A;  3WAW A;  1AJC A;  3NKM A;  3WBH A;  2G9Y A;  1EW8 A;  1ANJ A;  3NKN A;  3NKP A;  5K4P A;  1ED8 A;  2W5T A;  4KAY A;  3UN5 A;  2W5R A;  1ZEB A;  3A52 A;  2D1G A;  3BDH A;  5KXA A;  4UOP A;  1ZEF A;  2W5W A;  4UPK A;  2W8S A;  1ALK A;  2ZKT A;  5DLT A;  2XR9 A;  3T02 A;  3WAX A;  3UN3 A;  3WAV A;  5C66 A;  1E2S P;  3CMR A;  4GTY A;  2W5X A;  1AJA A;  3TX0 A;  4ZG7 A;  1Y7A A;  4KJD A;  4UPL A;  4ZG9 A;  2W8D A;  3T00 A;  4CXK A;  4UOO A;  4LR9 A;  4FDI A;  3UN2 A;  4KM4 A;  1AJD A;  1KH9 A;  2W5Q A;  1EJJ A;  1Y6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...