4LRDA

Phosphopentomutase 4h11 variant
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSIGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYKVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase 4H11 variant
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 144
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrdA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrdA01
4CXSA 4LRBA 4LRAA 1KH4A 3WAVA 4CXUA 3M7VA 3LXQA 4CYSA 1EI6A 4LR8A 1ED9A 1EW2A 1URAA 3UN2A 2W5WA 2W5SA 3NKMA 5DLTA 2XR9A 3WAWA 5IJSA 5HRTA 1ANJA 2XRGA 1HJKA 2W8SA 4NWJA 3TG0A 5INHA 1KH9A 1HDHA 2G9YA 4UOPA 4UOOA 1KHLA 1ELXA 4LREA 3UNYA 3DYCA 4KAYA 3TX0A 3M8WA 5LRNA 2D1GA 2ANHA 3T00A 1EW9A 3CMRA 3NKNA 4GTYA 1ED8A 4FDJA 3T02A 3UO0A 4ZG6A 4B56A 4LRCA 5GOVA 1ANIA 4LQYA 1KH5A 1ZEFA 3M8YA 5C66A 2QZUA 3M8ZA 1EW8A 1P49A 4KJDA 5L0BA 3SZYA 3NKRA 4TN0A 5AJ9A 4LR7A 1SHNA 5GRRA 4LRFA 1ALHA 3T01A 4KM4A 3DPCA 3NKQA 2W5VA 3TWZA 1K7HA 2X98A 5LIAA 4UORA 4NWXA 1KHKA 1E33P 1ELYA 4GTZA 1N2KA 4MIVA 1E2SP 3E2DA 5LQQA 1AJBA 5KXAA 3WAYA 5LRMA 1B8JA 1FSUA 3A52A 4UPHA 3BDGA 1O99A 4FDIA 2IFYA 4ZG7A 2W5XA 2GSNA 3BDGB 4QAXA 1HQAA 3BDHA 4KAVA 5EGEA 4MHXA 3SZZA 2RH6A 1ALKA 5IJQA 1SHQA 2ZKTA 5DLVA 1AJCA 3BDFA 3IDDA 2IUCA 1Y7AA 3OT9A 3NVLA 4UPKA 2IUCB 5K4PA 4N7TA 1KH7A 3NKPA 3ED4A 5DLWA 1ALIA 1EJJA 4CYRA 4CXKA 4ZGAA 4LR9A 3MK0A 1URBA 1ALJA 3B5QA 3UN5A 5EGHA 1KHJA 4KJGA 1KHNA 4UPLA 5L0KA 3UN3A 3WAXA 4YR1A 1AJDA 1N2LA 3MK2A 4LR2A 3Q3QA 1Y6VA 1AJAA 3NKOA 4GTXA 4MY4A 3WBHA 2GSOA 3MK1A 1ZEBA 4ZG9A 1ZEDA 2W8DA 1AUKA 2GLQA 2W5RA 4UPIA 2GSUA 2VQRA 1ELZA 2W5TA 4LRDA 4GTWA 2GA3A 1O98A 1E3CP 3IGYB 1E1ZP 5TJ3A 3KD8A 2W5QA 3IGZB 1EQJA 5L0EA
chains in the Genus database with same CATH superfamily
2RQKA 1Q5YA 3KMQA 4PCQA 1VQ7S 2YWKA 4B9LA 4LJMA 4ZLJA 1S9FA 1P9YA 4BDPA 2CQBA 4DUYJ 2B56A 4L73A 1H7XA 1N32F 5GAHI 1FXDA 3TWZA 1PAUB 3BGOP 4J5OA 5E3AA 2XCAA 1U09A 5IWAJ 4JV1A 3FBFA 1G1XA 1X4BA 3CCZA 1FTCA 3BSNA 1FWLA 1FRMA 4CLPA 1H0HB 1CS4A 4DQIA 3HKZD 2VONA 2AGQA 2FY1A 1IQTA 3ED4A 2JEFA 2GFFA 2J8SA 3OJUA 4PUOB 4F4WA 2Y8WA 1C0TB 3N6NA 4ZVFA 3NS7B 1FRHA 5K14B 2B8PA 2MJUA 4Q43A 1LXJA 4CH1A 2VQRA 3NGKA 2J7UA 1XIQA 3TP2A 4DV6J 4KV8A 2FJVA 1V5VA 3QZ8A 2J6SA 1S4EA 1FE4A 1QE1B 3J7AN 2FZGB 4RW7B 2EFPA 2QA4S 1VC0A 5CCMA 5DLTA 2XYHB 1T7PA 4USUA 2DXFA 2WOMB 2UXBF 4DV5F 4JI8J 1YRTA 2W25A 1IBMF 3PX4A 4LFCJ 4RU2A 2Q1LA 1K7HA 3OV7A 5D8HB 4BCAA 1GTEA 4U7UK 1FO1A 1J27A 3AQPA 4OIXA 3C14A 4O3OA 1PCAA 2BE9B 3O44A 3CDUA 2DIVA 3DOMB 3H8YA 4B3OA 2JL9A 3DCAA 3MAQA 3N5BA 3TUIC 1NBEB 4RW6A 4K4XA 3KUEA 2HHXA 3V4IB 4PR6A 2CQ1A 1KTQA 3K5PA 3H90A 2GIFA 3GCXP 1QAJA 4NLUA 3LPYA 3C16A 4DL3A 2XYGB 1SBRA 1ED9A 2PD1A 1X4AA 4WK1A 4JI7F 3F44A 3W66A 4LQ3A 5D3GB 4YR2A 1XNRJ 3MDFA 4K59A 1KQFB 4DV4F 2EWHA 2O01C 1WKLA 1O8BA 3RJMB 3ZFVA 1U2FA 2M4MA 2LEAA 1V3ZA 2PGCA 1MU2B 1KFDA 2CPEA 4FXVA 1YX2A 1R6VA 3W9IA 4J9LA 2W5XA 1FWKA 2CDQA 3JSMA 4IKAA 1Z1ZA 3SZZA 4U7UD 2ZD1A 4OYBA 3U1LA 3UFCX 3EPGA 1R89A 3BO3A 1RT4B 2MLXA 2CPFA 4GMKA 4CTAA 3P6YC 3DLJA 3ILOA 4DX8H 2V4JA 3D54A 3FFIA 2KJWA 1TQLA 2K1RA 3Q2SC 3BGFA 4QR2A 4X66J 1UPMB 2F63A 4AL6A 1Q4RA 2VICA 3SEOA 1KLMA 1EETB 1T9XA 2W7OA 4DX6A 4U9RA 2RQ4A 4LRBA 1LW2B 4F4ZA 2CFXA 2AYBA 3EE3A 1UEVA 3G8TA 1HD1A 1YSJA 5CZVA 4NWBA 4I0WA 5CA5A 3DI6B 2MY8A 1UWAA 3EPIA 3L7OA 2HNZB 2CJQA 3MM5A 2AKWB 2VB6A 4ECXA 2QLWA 3SBMA 2KXHA 1VJQA 2G9OA 2JC0A 2DEJA 2BJ8A 4ZJLA 4K4UA 3MOZA 3PRDA 4DL5A 2KU7A 2EI5A 3I5BA 2OELA 2DTJA 1NSPA 1GXTA 4D3HA 4H4OB 2KVQE 2Z2LA 2ZOFA 3SSRA 2M8DB 2GC8A 2E5IA 5E3QA 4X62F 1RWWB 2YKNA 1JJCB 1HR0J 2QMXA 1TKZA 1R7IA 2I38A 4MAKA 2GJFA 1R0BG 1HNIA 4I7FA 3GFZA 4J37A 3BO2A 3NAIA 4DR7F 4NL5A 4DFKA 2ROPA 3BN7A 5HROB 1UKUA 4DF8A 1SUQA 3AD8C 1E3CP 4LIWA 4TKTA 1WC4A 2KH9A 3P49B 1JLEB 1XMOF 1L3TA 3KLVA 1WF0A 2UU9F 5I3QA 3FBCA 3TW0A 4Q5VA 3D6HB 2IMOA 3RB6A 3W2WB 3G86A 4AL7A 1SI9A 4U8YA 4LR7A 1JX4A 3NKQA 4H4MB 4LFAF 3QO9A 1RKJA 1X0PA 4P73A 1L3UA 2B6AB 5A0YA 1UW9A 2HFOA 2MZRA 1PYOB 3DNCA 1JKHA 3MCNA 2XWXA 2ZH8A 4EYIB 3CJQA 5ETKA 3TZZA 1SKSA 1Y0HA 2XLKA 2KFNA 5BYRA 1YK9A 4QWDA 3J7Z5 4QWBA 1SPBP 1L3KA 2K8GA 5CABA 3FMBA 2A6OA 2EFNA 2UXCJ 3K8VA 4RX6A 2VU5A 1FEEA 3IBWA 2FHJA 1SJ3P 2QA1A 1DRZA 2Z57B 3PX6A 1RAFB 4PG6A 2IVYA 3QIPB 5SZTA 4EEYA 5KG3A 2GQQA 4YOEA 4HR2A 3KNGA 3OTBA 1FJGJ 5HSPA 5GAGI 5AJ3F 4CRJA 1DJ0A 1FHTA 3C8YA 2MY7A 1HJKA 5J2MB 2I5JB 4E8UA 4IR9A 4AT1B 3UO0A 4LRCA 4JV2A 1DTQA 2UUAF 3RTVA 1TKTB 1RAHB 2CQ0A 4JI6F 4O23A 4OZLA 1LNQA 3SXLA 2ILZA 1ZH5A 2MSTA 1S48A 2HVHA 1VCTA 2UXDJ 2V2VA 1DBDA 3PXGa 4N76A 4DEZA 2DNYA 2AWZA 2P6TA 3M8PA 2ZM6J 1NK7A 1Y4ZB 3HSJA 5GMEA 4LF5F 3ICLA 1C1CB 3LH2S 3AXKA 4X65F 3PM9A 3G2XA 3OTOF 3FMWA 1RHKB 3NBPB 3M2RB 4N8OA 4AUKA 1S1VA 3K59A 3PYFA 4C8MA 5B7WA 1SIWB 2CPJA 4IFYB 3M8SA 2DGXA 2YWFA 3V5RA 3CJKB 1BQNA 1PC5A 4DLEA 1IKYA 1XQIA 4ZLNA 2HKEA 2VFRA 5F9NA 3Q8UA 5L46A 4LF6F 3IR7B 1S6PB 3L7PA 2PMHA 4DQPA 3OQ2A 3K5OA 2J5AA 1N5QA 1M90T 1YBUA 1FD2A 4WTYA 5F0WA 4KPCA 2CAJA 1O6XA 4OQJA 4DR1J 2C2DA 1T11A 2MHNA 2I1RA 2C2ZB 1FX2A 2Z8QA 4LF4J 3BSAA 5C5JA 2Y1IA 1S1UB 4IRKA 2UXBJ 1H98A 5ETRA 4DV5J 5H1SV 3HULA 4DR2F 1IBMJ 2C2OB 4M5LA 2ZVIA 2AMCB 2CVEA 4NEZA 1TL3B 2GVZA 3TANA 5EGHA 1HWIA 1XK8A 3FSYA 3SYZA 1CJTA 1VFJA 2XCPA 1TUGB 1NNDA 4ZPDA 2ZE2B 1AUKA 1PC4A 2ADBA 3MEGB 4IDKA 4RBTA 1CBKA 2HHUA 3PJXA 3CDBA 3DYAA 1Y9OA 5D4NA 3AQOA 2DKOB 2EK1A 3PYEA 3FNNA 1R43A 4ECWA 2CQ2A 1FFSB 4UOPA 3EUNA 2GVDB 1UA0A 2IAJB 2JWNA 3T00A 3JQJA 3NKNA 1VHIA 3OR1A 3M1VA 2K7JA 4PG5A 2M2BA 2MXYA 4K50A 2JOQA 1NSQA 5T7LB 1LK5A 2KRBA 1TAQA 1KHWA 1NAQA 1YJ7A 4WE1A 3RBDA 3VAKA 3SQOP 5T14A 4JI7J 3SIPB 2ZBPA 3NY0A 3KLFA 1U0HB 5KFRA 2FY8A 4DV4J 4QYZJ 2UVRA 5FLXU 1NMEB 1BLUA 3S7RA 2H48B 2IUCB 4N41A 5B0DA 3HFKA 3VCDA 4ANDA 4RW4A 3BB5A 2ZJQQ 2G0IA 5B0CA 4L72B 1U7LA 2AD9A 1J5OB 4QYZK 2OPQA 3TR5A 2WK4A 1ZPVA 2VG6B 4FZVA 5FLXY 2CJAA 1IBLF 5DG8A 3W3SA 3GSDA 2B4PA 1Y10A 2HHVA 3HKWA 4ZIVA 1D9AA 2KJVA 4Q44A 2E9ZA 5DGBA 3KJQB 2NXJA 1U2RA 4Q7AA 4FYYB 2F9JA 2J0WA 2XRGA 4X2BA 1UVJA 4C8KA 4UOOA 2C2KB 5T41A 3K7RA 2DGWA 3HHKA 5J2PB 4Y2CA 2QZUA 4DSKA 4O3RA 4NCAA 4CT8A 4W4MA 2H65B 1MG7A 4UZBA 1BXNA 3H2VE 2D3OR 1TUWA 2HNDB 5EX0A 5SUHA 5K8MA 4C0OC 1JQGA 3E01B 3PEJA 1A7GE 3KTQA 2ZDPA 4ECQA 4PUOA 1C0TA 2HVDA 2P5VA 5K14A 5EN1A 3FKBA 1C4CA 5ETQA 2KKHA 3R5JB 4YY3F 4WFNQ 1M5KC 4X62J 5F8JA 2GQCA 2ZH6A 3MAHA 4GVLA 2QJ3A 2B4VA 1QE1A 3FCWA 4RW7A 2R7TA 4F26A 3G6ES 2VQEF 4B3SF 3UN2A 5ADZA 3DLEB 4ZVUB 3K5LA 1AYEA 2WOMA 1NCLA 4N5SA 3MR6A 4HI2A 2OEMA 1HWJA 2ASJA 4FBTA 2X1FA 1U24A 1PG5B 1NDCA 1XMOJ 2CG8A 2RVJA 3CB4A 1EKRA 1G2EA 1EIYB 4ED0A 2RMLA 2UVWA 4YR3A 2A2CA 2C3PA 2RHSB 3R5AA 3OLAA 1FK9B 1NK8A 2YKPA 1NK9A 5DDOC 2HEKA 2MEWA 4XDCA 3L4BC 2DT9A 2K2PA 4XPCA 1FDBA 1N5YB 2V9KA 1O51A 3DOMA 4RZRA 3CJ2A 3P5BP 3IP0A 2MJNA 2N3OA 4X4RA 1RE1B 4LFAJ 4UUWA 2CQ4A 2XM3A 4ZN3A 1PAEX 1T03A 3V4IA 2DRDA 4E2FB 1LFWA 4ZP9A 1RISA 1TL7B 5KT3A 5DQHA 4G1PA 5KFUA 5KFJA 3KJFB 2H5EA 4KPYA 1O98A 4ZIWA 1S49A 3M7VA 3SSSA 2OSRA 2HG4A 4NWJA 1X5PA 5D3GA 2FVRA 4GTYA 2DR5A 5D6GA 4QOTA 2LQJA 5DLFA 1TVRB 1BHNA 1P49A 2MGZB 1Q82T 1MU2A 3ADAC 3OL9A 1VRTB 5LT5A 3A3PB 2GIRA 5KT5A 1RWVB 3W61A 1YJVA 4RBVA 4PXEA 3TVYA 2OTLS 2VOPA 4V19X 8ATCB 4ES1A 2P6SA 3SMZA 1SH3A 2UUAJ 1NM2A 2Z0GA 4V19J 2AZ1A 2E5GA 5C25B 1NSAA 2IJNA 1RT4A 5BYQA 1ALIA 5CH7B 1U1PA 3PHEA 1KNZA 2D3UA 1TMJA 1DQ8A 4WFAQ 1BMQB 2RDJA 4RNNA 2J9DA 4KGKA 1MMNA 2DRAA 3MM6B 4LF5J 1EETA 1KTVA 2JRSA 5GVQA 2XULA 1NKEA 1RHJB 4X65J 4BBYA 2CA9A 2QX0A 2CYYA 4ZVTB 2YH1A 1LW2A 2IYIA 1XEZA 1D8ZA 2XS2A 3DI6A 3ONQA 4HH0A 1ITPA 4FPRA 4ICLB 2ILYA 2VBZA 4EI2A 1HKAA 2HNZA 1F5AA 3OTCA 4LF6J 3EGNA 2BM1A 2X1BA 3CC4S 2R8HA 1M5SA 3OBIA 5JJBA 5KFIA 2Z30B 1VBZA 2KHCA 3ZZYA 2C3YA 3BM7A 4I69A 1Q5VA 3AFGA 4WJBA 4TVAB 3JQMA 1GH8A 4YFUA 3QSYB 1N8RT 5IT9U 4MK9A 3D68A 4NRTA 5K9FA 2V2QA 1S1XB 3N4WA 4DR2J 4JI5J 5HROA 4QPTA 2H4YB 4ECYA 4F0HA 1KOOA 1JLEA 4ED6A 1KVJA 3W5ZA 1ZM3A 3C66A 2W5WA 4ZPAA 4LF7F 3TEGA 3UNYA 3W2WA 2PSZA 1D9DA 3ISZA 1VQLS 1UFKA 4PWWA 1J5EF 2RB7A 3W62A 3N6LA 3Q86A 2B6AA 3S01A 1BUXA 2ROEA 3UD5A 4K4ZA 3HVTB 4A8MP 4NLXA 4X4OA 3LTOA 1I1GA 2BJ1A 5KFXA 4DUTA 5GAEU 4ECZA 2YBVA 4HEA9 9ATCB 4F0MA 1F5BA 3UD4P 4ITSA 2V6AA 4X4TA 4HL9A 4EBDA 2W8DA 3QIPA 1RU1A 1XTZA 2DISA 4KSEB 5CYMB 2D3O1 4EO8A 4NLTA 4G1QB 3UR0A 2XG8A 1NZ8A 1MWYA 4ZITA 3WAWA 3M4XA 1UWBB 5J2MA 4F3QA 2I5JA 4K5SA 2PFDA 3PFOA 2H5JB 3FQLA 1VLOA 1TKTA 5HBMB 5IT4A 5HAOA 1UJ6A 5KFOA 1WEXA 2XGPA 3HXMA 2L08A 4CLKA 1CJVB 5ETTA 6FD1A 1WG1A 4CLTA 1V6HA 4I56A 5AE3A 1WSVA 1NHKL 4EBCA 1OMSA 3NBPA 3M2RA 3SI8A 2CNNB 1VDHA 3G8SA 1PO6A 4DL6A 5G4DA 2R7WA 1QVGR 5K8PA 4IFYA 4IQMA 2NR0A 1U48A 1KSPA 3JYTB 3CJKA 4DHVA 1U26A 2CQPA 1FF2A 2JH3A 1VQ9S 1Q78A 1S6PA 4L6V3 1S12A 1RP5A 3JSYA 3NKMA 4Y3CA 4TYBA 3OL7A 4YY3J 2R7RA 3P4UB 3V6JA 3M9NB 3GWCA 4JI1F 1W26A 2FJXA 1WC6A 2YNHB 2EG1A 2VQEJ 4B3SJ 2M0GB 2EFOA 1S1UA 4M5KA 3AA9A 3THTA 4Z7YA 3ZTQA 3NMAA 3I55S 2HBQB 4DBQA 3DXSX 2BXJA 1MROB 4O3NA 1FA0A 4UZCA 4RUAA 4CO1A 1TL3A 1SC3B 5HL7Q 4QU7A 3NAHA 3NXZA 1RTZA 3RW7A 4ED7A 4NYOA 2ZE2A 4BHQA 3MEGA 1AW0A 4B3RF 3EGZA 3IGYB 4OYPA 2CVIA 8RUCA 1NDKA 4MKBA 4HKQA 2IJFA 1XR6A 3PJ9A 1OYDA 4K2XA 2JEJA 3PV8A 3W1YC 2GVDA 2MQ8A 3IWNC 2WVEA 2IAJA 2D1GA 3EVOA 1UMJA 1OJ4A 5T7LA 2YXLA 4P9SA 3BS9A 4AL5A 2ZDOA 4HACB 4Y0FA 2RIJA 1HNZJ 4HH1A 1HNVB 2HVIA 3H40A 3VQSA 4K4WA 2GS8A 2PI5A 2MB0B 1O99A 2B3TB 1U0HA 3IAS9 3BDFA 2HFVA 3EX7B 1N36J 2IUCA 1R8CA 1FVQA 1CQNA 1RSCA 2ASYA 3HPOA 4C48A 1J5OA 3WIUA 3GU0A 2VG6A 2W4PA 1UVIA 2CPYA 1RHQB 3TJAA 2F8EX 3AJ2A 3MEEB 3JTPA 3VAGA 4C3LA 2GJ2A 4KHMA 4PYDA 1U1KA 1U1NA 4RU9A 4MT1A 3N9UC 2X1GA 2CNOB 3GTYX 7AT1B 1N5TA 3NOGA 3AJ1A 2IMWP 1U2CA 1VIXA 4CIOA 1ED8A 5J2PA 3LUYA 1F9EB 1RT2B 1U6FA 2KT2A 1VQKS 4YS2A 3N01A 3HM9A 4IG3B 2F5GA 4YR0A 1HHQA 5HVFA 3WDOA 1SJ1A 1WHXA 1SJ4P 5AE1A 1P6TA 2V8DA 1X31C 3PTWA 4DSIA 1YI2S 1OO0B 1FNMA 2HNDA 1KVKA 4PABA 3ZTSA 1X4DA 2XI3A 1J2VA 4N77A 2Y8YA 1GFWB 1DARA 2PEBA 4DCOB 3E01A 2C2RA 2O66A 4FYWB 4RNMA 4ZP6A 5DO2A 2DHXA 1TKXB 4YEAA 1PILA 2LFVA 2HHPA 4ZVSB 3MK1A 4UUXA 2P9EA 1ROFA 3NNHA 3ZTRA 1S5ZA 5F8IA 3VAFA 4G3IA 5TJ3A 4C8ZA 5HQLA 4YB1P 3LPEA 3L09A 5IXUA 5J2NB 3WAVA 2M9KA 5DDRC 1TK0A 1VISA 4OMFG 1S7HA 1OYEA 3J7ZT 4FPIA 2ZWOA 3T41A 3R1LA 3DGVA 3HD2A 3DLEA 4FXWA 4FF3A 4DR5F 2E29A 1ELXA 2XBPA 2DNRA 5IM0B 3AODA 3TVKA 5LSLA 4WU3A 2OPPB 3US5A 2FC8A 3MTJA 1RAJA 3JQKA 3DN9A 4WP8A 4F8RA 5IV4A 1YDLA 3BPDA 5AE2A 4DS4A 1N2KA 1FK9A 2HZVA 3M9OB 1FNXH 5F8LA 1GNKA 1U49A 1N5YA 1YVFA 3PIPQ 1GTHA 1QSYA 2W9CB 3T1YF 1XN9A 4N7TA 2XLJA 1BWVA 5H9FJ 2ZZNA 3EGVA 5CQGA 2P9CA 1XBWA 4BC9A 3R5CA 2QC3A 4KJGA 4HI1A 3DXBA 1TL7A 2DNOA 1MMLA 2QLXA 4V1Ak 1QAYA 1ACMB 1M1GA 5H9FK 3MCMA 1OY8A 2AJ0A 3OFHA 1NK4A 5LXYA 3KG4A 3PVXA 4DPTA 4ANEA 4M94A 1TK8A 1S79A 1NK0A 3CCQS 2W2PP 2YQ3A 5DDPC 2GNKA 4XDDA 5EGYA 1YG0A 2DVIA 1RAGB 3MMJA 4MK7A 4UQGA 4DR3F 1K8AT 4ZA1A 3CJ0A 1TVRA 2XSJB 2WZ1A 4FNIA 2OIHA 1JLQB 3MMAB 2MGZA 1T0TV 2YWEA 2ATLA 1VQSA 1VRTA 1W2IA 3VALA 4DFMA 2Y0SD 2RF2B 4DOZA 2IM1A 3QFWA 2BE7D 2EC2A 1Z4UA 4FF2A 3CD7A 1FXLA 3PW0A 1B8JA 4P2FA 5JMNA 2Z56B 5L1LA 3HX9A 1ALKA 5AXNA 1CJUB 3RRGA 1SCJB 3GIKA 1D0EA 5C25A 4MKAA 2YX7A 1HQEB 4W90B 4LF1A 1KDNA 5CHCB 3BGLA 2LMIA 5KFZA 3ILLA 1HI8A 1IJFB 2R7QA 2X1AA 1RBLA 1Q0NA 1Z2ZA 4MYUA 3V6DB 3MM6A 2IDEA 2GGPB 1YJRA 4GTWA 3MFIA 1X4FA 2D41A 2QYCA 1X4GA 4LSLB 2DCLA 1R8PA 3QFHA 2LVWA 4YB5A 4UF4A 2W5SA 3NP5A 4WFBQ 2DGOA 2EFQA 3S8SA 2CNLB 2ZBCA 5LRNA 1RXOB 1Y5NB 5GAGU 2DR7A 3WIVA 4ICLA 3AA8A 1VBXA 2AP6A 2JLEA 2PI4A 1NB2A 4M63A 3QJPA 5MAOA 4OHWA 1HWUA 2V50A 3MI7X 2JNJA 1HW9A 3ENAA 5LSOA 4LBHA 2MYFA 1JNZB 4Q45A 4IOBA 2GV1A 2DR9A 4KO0B 2MQOA 3Q8VA 1VIOA 1W2BR 1YWXA 2EK6A 2F3JA 4L3NA 3NS6A 3IM9A 2BZ2A 1AUDA 1URBA 4L75A 2RAQA 2BRKA 1F1BB 4M5NA 4EO6A 1TV6B 4WYWA 4K0KF 2W7AA 1S1XA 1RABB 1S9EB 2HQ3A 4OZNA 2QE5A 4UOFA 3AOAA 4ZG9A 1G6BA 3MR5A 1QSLA 3J7YI 2W5TA 3K2YA 2JVOA 5DETA 5KFBA 4P74A 4O4RA 1UW4A 4OZ5A 4ZVEA 1U8SA 3RGIA 1DHMA 1NSKL 2M7SA 3ILJA 4CI0B 4CP5A 3RAMA 2XR9A 5KT2A 3GZ7A 3I4PA 1P1LA 4BWMA 4B3RJ 2HRYA 4OYXA 1S9GB 2DITA 4FYDA 1IR0A 2RRNA 3B82A 2HRTA 3OJSA 4ZVPB 2YKQA 2C2EA 1BE4A 3MR2A 2CXEA 2A3JA 1LXNA 2M3DA 1TZ0A 2XMWA 3F56A 3HVTA 2CPIA 1OQ3A 4TYAA 1N54B 4Y34A 1ULRA 3NVLA 4TU9A 4ID8A 4WP9A 5HLFB 3FSIA 2DNMA 1V9OA 2DNPA 2YVSA 3T6BA 4KHPF 2ZFHA 2B9WA 1Q7LB 2DH9A 4CO4A 2VC1A 2W5RA 2IPOB 5CYMA 1VBKA 5DM6Q 4G1QA 3TZYA 1ZM4A 1DTTB 4Y65A 3T1AA 2LU1A 4CLUA 2W8KA 4OHYA 2OLWA 1FDDA 3JS9A 2RRBA 2YKAA 5HBMA 3FDSA 4R8UB 1X60A 1B0PA 5DS7A 1HA1A 4PXCA 3K5MA 1EKSA 4ETXA 2AW0A 1CJVA 5LMNJ 2R8KA 3PR5B 3T5HA 5E2QA 1MLAA 2AX1A 4ALZA 4PAAA 2IFYA 4F3MA 2BACA 3AHPA 2BKPA 3SDEB 3KLHB 6AT1B 4J9KA 3ZZ0A 4NA1A 2W9BB 1S72S 4Y2MA 4ZN1A 4USTA 4ED2A 1VRUB 2ZNYA 1R31A 3FVYA 3W9HA 3KJNB 3KYLA 3EYZA 3KK2B 4J9PA 2E7VA 1FFGB 2ZOGA 3JYTA 3M6UA 1U1LA 3AY0A 4ELUA 1Y5LB 1OY6A 2H51B 3R7NB 3VAIA 1T8EA 1GEHA 2FD2A 5EX3A 2PA3A 4CO0A 2DGQA 5D0RA 1N48A 5D15A 3C19A 1N56A 1JXLA 4DU8A 2YKOA 3HT0A 3RU0A 2R2UA 2RE1A 2OEKA 1G7CB 1YBAA 2RU9A 3SSQA 2DO4A 2VFVA 1RLDA 2YNHA 4QIEA 4DI6A 3GPAA 3OVSA 2POKA 4ZHRB 4DFPA 3UNGC 4JB8B 2R42A 3KDNA 3KWMA 3GMGA 5L1JA 5HMYA 4LQ9A 3EXYA 4FYVB 4QR0A 2K7KA 3IWXA 2H5IB 1MROA 1UPPA 4J9SA 2A18A 4ZCIA 5DLWA 3FBEA 1EJJA 3OTEA 3UDCA 3PRBA 4DWIA 1VYAA 3RB0A 2MHEA 1KHJA 4FN5A 5HANA 4KQZA 1AFJA 2KYZA 1WHYA 1NJWA 2VH7A 1O0PA 5IQQA 3CEDA 2F9DA 5A6WA 4JV5F 3OSNA 2BJDA 3GR0A 4K4SA 1QSSA 2DCUB 3RW6A 2VKRA 4WXWA 4N8NA 1WI6A 3OFGA 3T19A 2XS7A 1CC8A 4LMZA 4OYMA 3H0PA 1AB8A 2VOOA 5KFYA 4LREA 5CCLA 1VQMS 3TZXA 2BMBA 4TU7A 3TQ1A 1WORA 5LOQA 2CADA 1FKAF 4HACA 1ALHA 2MLYA 1HNVA 1HHSA 2FJEB 5E7OB 3TZWA 1MMDA 4CM0A 4U67Q 2EPIA 1YTYA 1GX6A 4FDIA 1RYSA 2XC9A 1MW7A 1SHQA 2O1PA 2NSBA 1UCNA 1XNRF 1Y7PA 5AXLA 1PGZA 3L95X 3ZZTA 1SVDA 3HHNB 1TUVA 4DL0C 2BX6A 4B3TF 3MK2A 2QYGA 2HLUA 2ZH3A 2KZMA 2V2ZA 1T05B 2CPHA 3NKYA 1WOOA 3MEEA 3HZEA 2HHSA 1SH0A 3UDEA 3UCUP 4DN9A 2BA9A 4CWBA 5KG6A 3D0IE 1CULB 4NLPA 4EZ9A 4ZVRB 3KHHA 4ZCKA 1LOUA 4RKUC 1CLFA 5D4PA 1MN9A 1N34F 1RT2A 4P52A 3GFHA 4ED8A 1WACA 4IG3A 1RTIB 4P2XA 1SB6A 4O3QA 4MH8A 3MAAB 2GA7A 2XO7A 2XMJA 4B9SA 3FEZA 3QSIA 2OMLA 1KHKA 3CJTA 3CCLS 4WKYA 1WOPA 3BR8A 5GADI 2PFFB 2QFJA 1B4SA 1JLAB 4OX8A 4Y28C 1RT3B 4ED3A 4X64J 1LWFB 3Q2TC 1KLNA 3QBCA 4LF9J 1KH7A 1TKXA 4DMZA 2DHSA 3Q22A 5U47A 3PW7A 2PC6A 1JMTA 4JBCA 4ID5B 5A6PA 4MIBA 3TA2A 2J9DE 5HJYA 4O44A 4P2SA 4QIWD 2OPSB 2RH3A 3H2LA 3R7BB 3FCHA 2FLNA 3R97A 5I4MA 1T3NA 3SCJE 5J2NA 2AU0A 3CSKA 2Y3YA 4P2MA 5HMXA 1M5VC 4OV1A 4TU8A 3CXCR 5IM0A 1S6OA 1NKBA 5GAEI 4F4XA 4ZDNA 5H9EJ 2OPPA 3RBXA 3ISNC 2R2SA 3QMQA 3X3UA 1RZMA 3HCXA 1HWKA 5H9EK 3BV8A 4DJBA 2WSFC 2HRUA 4QAXA 1HQAA 2HHTA 4KFBB 2D7SA 1F9FA 2HQFA 3VGVA 4K4YA 2ZKTA 2DRBA 3I9ZA 2W9CA 3TQEA 2PT0A 5KFMA 3MK0A 3TOQA 1Y00A 2O67A 4OI1A 3DOLB 6FDRA 3FGVA 3P45B 1N0UA 3I0SB 3T6JA 3A12A 3WBHA 4OJ1A 3MGJA 1QTMA 3EM1A 3SQGB 1KRPA 4FVCA 1LV5A 4RW9B 2AHOB 2ZH5A 2IIHA 3F41A 1WELA 5E3RA 3IC1A 2OPRB 5IC4B 1CC7A 2J9CA 1RKIA 1GK8A 1OY9A 1IKWA 3OSPA 3H5YA 1F5CA 2YY3A 4RNFA 3NGRA 2C1EB 2GJIA 4U8VA 2C28A 2XSJA 1JLQA 2HIQA 3MMAA 4I68A 1UJ4A 1V3SA 2HGLA 2VG7B 3AOCA 5AJ9A 3HSGA 4NXMF 1DFDA 2RF2A 2C2NA 1APSA 1YJWS 3AD9C 1U6ZA 4ZPBA 3ET6B 4DCJB 3BH7B 4K4VA 2VPXB 5KFVA 4ECUA 1ZPWX 3IN5A 3GONA 5DLVA 4P7VA 1Y7AA 3ITHB 1HQEA 1YHQS 1PKUA 4O0IA 1WC0A 3E51A 1U1OA 5IFMA 1KHVA 1LEOA 3UN3A 1VOMA 4OI0A 2BW7A 4MY4A 3TO8A 3M2VB 1RU2A 3MUVP 3V6DA 1QUVA 2IA6A 2UXDF 2GGPA 4MMOA 4LSLA 2KDOA 3VGUA 2E66A 3KD8A 5THWA 2XI2A 2ZM6F 4LVOP 4DZ6A 5HMZA 4A4JA 2DR8A 4F4YA 2AF6A 5DGAA 4O0NA 3EDQB 1AFIA 4B02A 4DX5A 2A2DA 1NLKL 5KFWA 5KG1A 3JSRA 2CJBA 3M8YA 3IBFB 4EU0A 2OH2A 5GRRA 5CAAA 4ZLPA 4CO5A 4CO2A 4QU6A 3H4BA 3FEXB 3E3XA 3IGVA 4IOCQ 4KO0A 3VR1A 2FVSA 2MLZA 1Z2LA 5LMUF 4NXNF 1HWLA 5ETPA 3DLBA 4B08A 4NX9A 3THVA 1B0TA 3H59A 2F4VF 4QWCA 3NKPA 2R7XA 4USVA 1ZA1B 3UN5A 1UJ5A 4QBUA 1TV6A 4USIA 5K8OA 4DR1F 1HYSA 3QYYA 1S9EA 4LF4F 3D6FB 2NXUA 2ROGA 1RAOA 1RWKB 3ZXWA 3TEHB 4UTGA 3I31A 3V4MA 2W8SA 4XK8C 4E98A 3PFEA 2YQ1A 2MZTA 3MPVA 2HFNA 4JV5J 2DH7A 1RT6B 2YWHA 3GJTB 1S9GA 4KJDA 4B9TA 3EXCX 3QT7A 3LQVA 3W5XA 1QD1A 5AXMA 3CJRA 2HFZA 4MK8A 2XZDB 3T9ZA 1TL1B 3KLEB 3A52A 1Q8KA 3EVMA 4QYRA 1S7IA 4WFXA 3KMSA 4GC6A 3CCES 1GX5A 3M30B 4USWA 5CXTA 1TAUA 1RCOB 2IM2A 2RNEA 5HLFA 1X4HA 1SJFA 2A6MA 4C9DA 4KKOB 2E1RA 1KHNA 3D6TB 4EBEA 1WDTA 2C42A 4NZ7A 4A8OA 5EUHA 5KG0A 1RYRA 3R5BA 2BM0A 3P8BB 5M2UA 4ZLLA 1RT1B 2DHGA 3B4MA 5E41A 1DTTA 4ZVQB 4Q2MA 2ZH4A 3B78A 4PZVA 1K1SA 4OYZA 1QJHA 4RW8B 3BKTA 4B3TJ 2YNFB 4M5IA 2VQFF 4Y00A 2IHR1 1X9MA 4R8UA 2HLTA 4Q8EA 1EW8A 1SKRA 5C7PA 2AIRB 3LO3A 2B8QA 3RRHA 3UCGA 4KM4A 2V69A 2W5VA 1UEKA 1HBNB 3R5DA 1P27B 1N34J 1W7WA 3SDEA 3KLHA 4N47A 7FDRA 2W9BA 3I4HX 3QIDA 4OZ2A 2VJUA 1VRUA 1VQ6S 4NLYA 3WZ0A 1WOSA 3KK2A 4GRSA 1N2LA 2H3EB 2OHDA 3EMTA 5LL6d 1WD6A 3W5YA 1N0VC 2XS5A 4R5PB 3NGTA 2LXFA 4MIAA 3BBCA 1JNRB 3TVZA 2W7PA 3CCVS 4A8WA 2HGNA 1KVIA 2M88A 1NZAA 3PIOQ 4NEYA 5EWGA 1T9WA 4IFVB 2NXNA 3H2UB 3DOKB 4USJC 3FZ2A 1YRXA 1O5JA 3Q8PB 3LP2B 5DM7Q 1RWNB 1N52B 3CDEA 2B5JB 2B51A 3PKMA 3NS5A 2LCWA 2UZAA 4ZHRA 3PG9A 2JLFA 5LQQA 5KXAA 4UOGA 4ZG7A 3QZ7A 3G4SS 1K1QA 2VFUA 4PG4A 3R8YA 4PQAA 1HQUB 3OL6A 4A8KA 3QWUA 3HLUA 3H5SA 1RQ0A 4KHRA 1JLBB 3OFEA 3B5QA 4OYIA 3WC2A 1VR6A 3V81B 2ASLA 2Q79A 5ITHA 2OTJS 4LVNP 4A47A 2NUUG 4J9UE 2BQUA 5L1IA 3Q0AA 1BQXA 1ZAXA 4OX6A 4LRAA 4DU7A 1M1HA 4KGXB 2DYAA 1HBUB 3W2VB 1Q95G 3MECB 4WP3A 5IS2A 4GO7X 4ER8A 1YJUA 1IKVB 2MKKA 2U2FA 4PQUB 5D4OA 4CQ1A 3T02A 3A8EA 1FKPB 3NRBA 4YDXA 1UP1A 4CLFA 3FK4A 5HK4A 2Z2ZA 3B4DA 3PJWA 1H72C 1GT8A 1ZAVA 2FZKB 2BE2B 4Y2KA 2FVCA 3JAMU 2JZ5A 3LW5C 1N5SA 2D9PA 2V34A 3PX0A 5F8NA 1RA7A 3VVTA 4OHZA 4ECSA 2MDAA 5B0FA 4NLRA 3RBZA 1LK7A 4NXMJ 3T1HF 5D0HA 1Q7YT 2LU2A 3JAMY 1K47A 4RPFA 2VC0A 4M1KA 4NLSA 2Q66A 2XMTA 1AJDA 4A48A 2LECA 2VPZB 5D77A 1T05A 3QGGA 4YB7A 1WI8A 3NEKA 1XMQF 5KFSA 4BC7A 1RT5B 3SCLE 4IYQA 2V5HG 3QGPA 3DRRB 1PSDA 1FKOB 2DPJA 2ZZMA 1CULA 2UUCF 5ETNA 1F2HA 3GLJA 3CD5A 3QRRA 1KFSA 2W4CA 3HVAA 2IRYA 2MMYA 2YX1A 2VF3A 4JI3F 9RUBA 2E1CA 3MF5A 4FF1A 5ETVA 1WNEA 1RTIA 5F3TA 4K7QA 3MAAA 3IR6B 1S99A 2JX2A 1ZTTA 5GMDA 2ZBQA 3HFZB 5IOLA 1HMVB 2KB2A 2GSNA 1JLAA 1RT3A 3BBBA 2YKMB 2CJKA 1FERA 1FJ7A 1RTDB 2ZEJA 5HO4A 4CYRA 4LR9A 4C0HA 1S1WB 1S6QB 4ID5A 2E1PA 2OPSA 2COLA 5LXRA 2HS4A 5LMUJ 1IJEB 2AX0A 4NXNJ 2DXDA 2F4VJ 3O8WA 2BANB 3DDIA 2ZHOA 1WDDA 5A8KB 2DHAA 4QIVA 5IJSA 1HBOB 3HHDA 3ZTPA 2VIHA 4OLPA 3OW2R 2D1CA 5IC6B 1NJIT 1PYSB 5L0BA 2CQDA 2DBBA 4CNZA 4DV1J 1JXEA 4JI5F 3PY8A 1LFPA 3IA0A 3UD3P 1Y11A 2DK2A 1A6LA 2RT3A 3HD1A 4MJKA 4MYTA 1MNEA 1SL2A 1S6UA 4PWDA 1NRKA 3ZNJ1 4J9QA 4F4KA 1TP7A 4ZCMA 3BZQA 4YB6A 4PG7A 3LOUA 2XMMA 4ZCLA 4CZCA 3DOLA 2KN4A 3HHLD 1DLOB 3I0SA 3MM7B 3T3FA 2VG5B 4C8YA 1ZZFA 3FZBA 2OGUA 3SQGA 2XO6A 1U0SA 1ZEBA 3GP9A 4RW9A 3ZZRA 1T9VA 1WC3A 2G0CA 4DFJA 5DRKA 4Q8FA 2JLGA 2KRRA 4BLGA 4HT5A 2OPRA 3PR4A 2ASDA 2JEGA 4USMA 3J7YU 4FNHA 4NMXA 3WC0A 5LJ5Y 2DGTA 3EGWB 1IR2A 3TX0A 1WJ9A 2NCKL 4F25A 2IM3A 3CMQA 4FDJA 3M6WA 3G8QA 2KYXA 4RWWA 2R8JA 2VG7A 5ETSA 1SJQA 2R9LA 3NKRA 2G4BA 3VQTA 1D9FA 3BYPA 3SFGA 4LRFA 2LYVA 2HW3A 4HT7A 4YHHF 4IRDA 2FGCA 3Q8RB 2WCXA 2VQFJ 1EARA 2CQIA 4QW8A 4X4QA 3EWGA 1VI7A 3BGUA 4JI4F 1G3OA 4ENOA 3HFVA 4U96A 3ITHA 2IM0A 1PJ6A 2IC3B 1JLFB 3OUYB 4O3SA 2FC9A 4ZPVR 1T9UA 4P10A 2HK3A 3M2VA 2H1YA 1RBAA 5IT0A 5HN0A 2PEHA 4DR4F 1K0VA 1M5HA 3N5FA 3GQCA 3R1HA 3TYTA 1VQYA 3NMRA 3G6VA 1AXQA 3MPDA 3AT1B 2WSCC 2GW8A 4C0BA 3C2PA 1QDUB 3JXOA 4X4SA 3QWPA 1ZETA 4WIQA 4F36A 4CH0S 2LQ5A 3WBZA 1N6QB 4B9UA 2Y1JA 3MD3A 5KFCA 2EKYA 5GOVA 4RNHA 2JDJA 1L5UA 1PIEA 4K4TA 3D6MB 3MM8B 3GG0A 2BUNA 3MPUB 5HATA 3LAKA 4OHXA 2IJRA 2HHHJ 4MKYA 2FVPA 3HDSA 4JOUA 1GXLA 2CPDA 2GAGC 2EVZA 2V4QA 2XY7A 1REVB 1RBOB 1D09B 2PDAA 3GG1A 3KLGB 2GMLA 2BQ3A 3K58A 2W4DA 5A8RB 5KFPA 3DC2A 3CCMS 1REGX 5F41A 3GV5B 2V9WA 3EZ5A 4LR2A 1QAIA 3UR3C 5CD4H 3K89A 4ZVGA 2NQPA 2K3KA 5JXSA 1KC8T 3D7SB 2AQ4A 3BH6B 2GA3A 1E1ZP 4RBUA 3OFFA 3BSCA 1EQJA 3CJ5A 2BBEA 1T94A 4TY9A 1TK5A 4Q2LA 4KY3A 3ZZZA 3W8PA 1NHVA 2LA6A 4IH7A 3D2WA 3BJYA 2IFXA 4O3PA 1RT6A 1UVMA 1XMBA 2V8GA 3BYRA 1AZSB 2MZSA 3W8GA 3A3NB 3K17A 4B9NA 1KOHA 2AGOA 3MXHP 2KL8A 1N4LA 1Y3JA 1JXVA 4WXOA 1TL1A 1HPZB 2NS1B 4J9RA 1E6YB 3TA1A 5HI7A 3CW2C 3M30A 3ETOA 1AJCA 2WBMA 2UUTA 4I2QB 4EGLA 2EC0A 1EQMA 4C11B 3I56S 1V3RA 1W25A 1RWMB 2HNYB 3EICA 4KKOA 2L9NA 2EBEA 5L0KA 1HNZF 1DQAA 2FIUA 4PPZA 1JJ2R 1XR5A 4C6AA 4HTJA 2AJQA 3N0VA 2GHWA 3R6GB 1VLYA 1E6VB 1OQ6A 3TUPA 3IRXB 1RT1A 1EZZB 3T1HJ 1F3VA 4WU2A 4WK3A 5CYQB 1OSDA 4O4GB 1N36F 4RW8A 2BJ7A 2YNFA 2YWGA 2BJ9A 1YLXA 3PEHA 1KHLA 1FXRA 2ZWPA 4Z2XA 1CJKB 1C4AA 1XMQJ 3HHLB 2V8PA 2FLPA 1PYTA 5KFFA 1GMWA 3SZYA 4UY85 2KXFA 3HF5A 1LQ9A 4NE9C 2UUCJ 2R7VA 4S0MA 1HBNA 1OSCA 1OPIA 3PNIA 5KG4A 4C7QA 3TI0A 1WTFA 1IKXB 4XTTA 3WHIA 3W9JA 1VQOS 3R2CJ 3GYNA 4JI3J 4WF9Q 1WEZA 2BRLA 2J0XA 4PYAA 1RLCL 1U4BA 2BEFA 4WCEQ 5JVGQ 5FIIA 3R27A 5CD4A 3PO5A 3BQ0A 2DNKA 4DZDA 4G1IA 3WAXA 1X5SA 2GSOA 2QSFA 3GE9A 3QGHA 4R5PA 3MEDB 2B7CB 1ELZA 3R6LB 2FJBB 2HQCA 2Z58B 4IH5A 3VAHA 2ZVSA 4IO9Q 1V5IB 4IFVA 3DOKA 2M70A 2X7IA 2MPUA 2XNQA 4CLSA 4AQYF 2ZBIA 4TXSA 1AROP 5BR8J 3LP2A 5F3ZA 2B5JA 2OAUA 5L8RC 5C66A 1BD6A 1AUSL 4H4OA 2NSCA 5KT6A 2CPZA 2ZUGA 1GAOA 1RDRA 2DR6A 2ZITA 1TR0A 4A8FA 3MFHA 2BOAA 3MPYA 2GCFA 4NMLA 3KG0A 2V67A 3O5TB 3ZTOA 5B0GA 2BJEA 3LWMA 3NCRA 3IG1B 1HQUA 2ZUAA 4ECTA 3IRWP 4J9NA 1RB0A 1JLBA 5GADU 2J7KA 1VRQC 3AOBA 4CLLA 3I0RB 3J80U 1MN7A 4PXBA 2QLBB 5D0GA 1A9NB 3V81A 3MWBA 2D74B 3AAWB 2CJ9A 4WZQA 4UOCA 1F6TA 1HHTP 4WPAA 4GO5X 1RWUA 1VBYA 1TFYA 1LWCB 2FQQB 2G13A 3W65A 4Y2IA 3P5TL 1RHRB 3J80Y 1T03B 1FJCA 4CXSA 2W8LA 1KH4A 3HSDA 1FRLA 4H4MA 1HBUA 2QIFA 3W2VA 3MECA 4FDFA 2B9EA 1IKVA 4X4VA 3TA0A 2QTWA 3M8WA 1YITS 4PQUA 1FKPA 1NXIA 3BBFA 7FD1A 1VQNS 2CDRB 3FSXA 3HHEA 2EFGA 3WQPA 4RL1A 4K8RA 4NLQA 3NNCA 2HWIA 4AXJA 3RAQA 2BE2A 3THPA 4YUDA 5KFGA 2IRUA 4N56A 2YNIB 4EUVA 5K5MA 1HBMB 1LWEB 3GILA 2J8AA 4BS2A 2OD4A 4LBPA 4NASA 3NGDA 3PO4A 2IVFB 2HGMA 3H42A 1TTHB 4HTIA 2E9RX 2XHWA 3GYXB 4F7VA 4YHHJ 1EB0A 2JEIA 1XC9A 3KHGA 3VGTA 2Z2YB 4DR6J 1SIZA 3LANA 4JYAJ 2RILA 1ZBTA 2ZKUA 3KJVB 4JI4J 1G4CA 4RUBA 4USHA 1RT5A 4AYBD 1UETA 5KFLA 5B0BA 3HZGA 3DRRA 2MKIA 1TELA 2VBYA 1FKOA 5KOXA 4WYLA 1PJ5A 2CKWA 4ETZA 1VHFA 3LWLA 5ETOA 4ES2A 5I42B 2N4CA 4DR4J 1ANIA 2DNGA 4AE5A 1Q16B 3DLGB 4DV3F 1X4EA 4LF8F 1NDPA 2A0FB 1C1CA 1ZA2B 5L9XA 4ED1A 2YNGB 2APOA 1NH8A 2CZ9A 2HQIA 5B09A 1HMVA 2EFVA 4Q0BB 4DL7A 1SL0A 2RH6A 3W64A 2YKMA 4J7CA 4NZ6A 2F40A 5K20B 1RTDA 2OEJA 1U1MA 4USKA 1SH2A 3MURP 5B0EA 3EVWA 1S1WA 1S6QA 4KC5A 3MCSA 3CGIA 5HMWA 4J91A 2JSXA 3OTDA 2O5DA 4ZP8A 3N28A 3U7JA 4WFZA 1U02A 2R8GA 2QL9B 1WHWA 2BANA 3MM9B 5A8KA 2XY5A 2R3VA 5D0EA 3DRSB 3TAQA 2QFIA 3FJ2A 1URAA 4ED4A 3PW4A 1RWOB 1GMUA 1HBOA 2Y1RI 1FVSA 3BN4A 1RADB 1NK6A 4F2RA 1IBKJ 1RGVA 1YIJS 2AJ1A 2OD6A 3T01A 5G0RB 3G9CA 3G6XA 3BO4A 4TLRA 2DD8S 2KVIA 3CD6S 1HI0P 4KB7A 4F67A 5FJ4A 3UVJB 5I3PA 2LLZA 5I3UB 1S1TB 3IDDA 2QL5B 2Y1LB 3CJSA 3NG8A 1Q86T 4MIWA 2AJ2A 4WWSA 2ZH7A 2FHMA 1IBCB 3E2EA 3CO9A 1C0UB 1DLOA 2JFDA 3C3LA 3MM7A 2VG5A 2MKSA 3NKOA 2G2YA 5KT7A 1UZHA 2I2YA 4OJHA 2FLLA 1H74A 2XMKA 3LAMA 4NLGA 4M95A 3HHLC 4JP8A 2X3GA 2I0XA 1HFEL 4J9OA 4DSLA 3FRYA 1LKZA 4KJIA 1JWWA 1RAAB 2YPYA 1YRUA 1KQSR 3M32B 2VA2A 5E3CA 5EDWA 3G71S 4A8SA 3DDNA 5DG9A 2XTJP 4A8XA 1I94F 3GIJA 1IQZA 3KK3B 5FD1A 2C3OA 2HMIB 4MKVA 1C2PA 4DPUA 3R2DJ 1BQMB 3GR1A 1RA6A 3FRZA 4P6QA 3JB9k 4PRFA 2VUGA 3BDGB 5KFNA 3I82A 2G1HA 3OT9A 2IC3A 1JLFA 4FBUA 4CXKA 4ZPCA 4E0DA 3OUYA 1UVKA 5F8HA 3HT3A 4M5DB 2EBGA 3BPSP 2OSQA 5LMNF 5GMKa 4NCGB 3G87A 2HPUA 2AGPA 3BKUA 1IXKA 1KP6A 1N32J 2MKCA 4ERDA 3CF5Q 3RR8A 1EAYC 2OKQA 2LQBA 2R4FA 2IBKA 1MWQA 5CYJA 4ATNA 3HO1A 2HFUA 1F3FA 4RO0A 4X4UA 2FPHX 4C8OA 3AJDA 1CPZA 2EXUA 1N6QA 5IV3A 2SXLA 3EDRB 2E5LF 2F8MA 2I6WA 2WRMA 4Y2AA 1B64A 3T5JA 4DL2A 4AD6A 2VD3A 1YJ9S 3L9ZA 3MM8A 2BKNA 2PIIA 3AH6A 1E33P 3I9V9 4F02A 4AQYJ 3CC2S 3KFWX 3HK2A 4KT0C 3NWRA 3FUYA 3CCSS 5E3PA 3QLHB 1FDAA 1REVA 2KM8B 4DPXA 1R8HA 1HI1A 4YMEA 3SZ2A 3KLGA 3IM8A 2X3DA 5A8RA 2R8IA 4QQBA 1RCXB 4LIRA 4TNOA 3ISND 3KOAA 3NNAA 4NLOA 2VDHA 2RQCA 3D1OA 4DSJA 2C3UA 4FVMA 4I6YA 3BF4A 2AYEA 3DLLQ 3ZO7A 1NDLA 4GKKF 4IG0B 3OHBA 2GX8A 4M5JA 4OI6A 3D1HA 4RUHA 4W92B 4BWJA 4DSEA 1VMBA 2DHHA 2GIQA 2WONB 2ZNZA 1ANJA 8AT1B 3TJ8A 3IWLA 4RLEA 5DJBA 4OI4A 4WTOB 4X84A 1CQMA 3KK1B 2JC1A 2RU3A 1AZSA 2H54B 1GMVA 4F4AA 4A46A 4TN0A 2KFZA 1QUPA 4ZMMA 3LF0A 2HZCA 5LIAA 3GJRB 1HPZA 1ZZNA 2ZZTA 1E6YA 4TY8B 3WX4A 3FCVA 3HVWA 2FUG9 3CC7S 5IZHA 4I2QA 4I1TA 2MZJA 4C11A 3KHLA 4CCHA 4NZ0A 2PN6A 2FYXA 3A8KA 1F60B 2E7XA 3P3DA 3SV4A 2HNYA 3HSZA 4Z7CA 5DG7A 5E0OA 1IWAA 1S4FA 3RBEA 3SCIE 1KN6A 4KH1B 1VJWA 4QW9A 3BQ1A 2CWXA 1E6VA 1WUUA 4KGZB 3IRXA 2N4DA 2W1BA 1SKWA 1YJNS 1U25A 1WF2A 4ILRA 4OJGA 5CYQA 4O4GA 2MQNA 1FRKA 2DNNA 2RUGA 2O3DA 1NB7A 5F0UA 1X9WA 1FJEB 2BV3A 1HDHA 2J7WA 1CJKA 3HHLA 3OXFA 4EYHB 4B3MF 3DLKB 1RT7B 4I6AA 4RWXA 1VQ8S 3CD0A 1SQGA 1JB0C 3DRPB 3HI9A 2XGQA 1IKXA 4EMDA 3HMJG 3MTKA 1BWEA 2RSQA 3OD2A 1VC6A 2E9TA 1ZYQA 1Q8IA 1T3OA 4DG1B 4DV3J 4LF8J 2WVCA 3C15B 2YPZA 3KKFA 2W2QP 4DQRA 1RACB 2B7BB 3CCWA 5F9LA 2W24A 4TN2A 4URGA 4KE5A 1B7FA 1BY9A 2ZJRQ 3MEDA 2HAFA 4CDIA 2XMUA 2G0JA 3HJFA 5ETLA 4FS2A 2VV5A 2BQRA 3Q23A 4X64F 2N7CA 1EI6A 4LF9F 1OS5A 4DV2F 4C98A 3KLIB 2V8HA 3M8QB 2KT3A 4U7CA 4M5MA 5KTQA 3D0GE 4P75A 3MR3A 4OYAA 5KFTA 2RD5C 2PE8A 1B7YB 2NYIA 3WX8A 3VHQA 1WEYA 4DR7J 5DDQC 4WFYA 2A10A 2UUBF 1A0OB 2WVDA 3UDLA 3OL8A 2VZ9A 4UPHA 3MUMP 3VV2B 2QLJB 3J81j 1RTJB 3OR2B 3IG1A 4ZKAA 4AXIA 2F7VA 3AXMA 1U45A 2UU9J 2M8HA 2VPWB 1VQ5S 1WC5A 3I0RA 3H7HB 3UW1A 1WKKA 1X4CA 3A8JA 1U47A 1U8WA 2IRXA 4K5RA 3VVUA 4PKDB 4R0JA 3V6KA 1RHMB 2CQGA 1ZEDA 2EW9A 1PBAA 1QM9A 2MZ1A 1RWXB 3LP1B 2QZ8A 1LWCA 4C2MA 5FDLB 4B9VA 3BGRB 2DNLA 2J0SD 4F0KA 1FT8A 4TQSA 2J6TA 4ZG6A 1ZEFA 2CQ3A 3TARA 2A1BA 4OFZA 2VASA 2HWTA 1QLNA 4PPDA 2HBZB 1T02A 1S0NA 1FFWB 2V63A 4NLDA 2ATCB 2YNIA 4KAIA 1B99A 3DGPB 1H3DA 5E33A 3G6YA 1HBMA 3KUHA 1LWEA 3JTNA 1X8DA 4WIIA 4URQU 2OJ3A 1M0SA 4PEOA 5DLGA 4QZVB 1I94J 1H2UX 3GYGA 5AJ3J 4G6VB 2QG9B 4KH0B 2Y0BB 2UP1A 5B0AA 1RJJA 1RUSA 2RKIB 2I8EA 2V8VA 3EJMA 3OPKA 1UWBA 3KJVA 3IO1A 2WW4A 1R8AA 3VAJA 2LA4A 4JI6J 3D1QA 3CJ3A 1NPPA 2AZ3A 2DJWA 2W2MP 3T5KA 2KHDA 5HRTA 4QIGA 3IS9B 1VGYA 2DNHA 5I42A 2G9YA 3J81U 1EP4B 4C4WA 3BSOA 1VK8A 3NL0A 3M2UB 3A1YG 3CMRA 2RS2A 3OTOJ 1ZOTA 1KH5A 3DLGA 3F0NA 4NPOA 3PDNA 1FRIA 4DX7A 3M9MB 2QMUB 2Q3PA 1TFWA 2KM8C 4NYPA 2YNGA 2AEFA 3J81Y 4OX9F 1IM4A 3RRKA 3D28A 2OFHX 3MR7A 2E5LJ 4Q0BA 2V4RA 2CRLA 2B0GA 5KAKA 5D78A 1FTRA 3JSBA 4KAVA 2ACMA 3L3CA 4UOHA 2HBRB 3LALA 2GO8A 3CE8A 1NJYA 1YZ7A 1N5VA 3O2IA 4NRUA 5BYSA 4DSFA 3SCKE 3ZZUA 3QQCD 2D3ZA 3IMQJ 3KHRA 1U6BA 1LW0B 3MM9A 3D4JA 5AXKA 1X7VA 2K06A 5E5NA 3DRSA 3QPIA 2CPXA 3X1LB 2CQCA 3MEKA 1UFLA 2GZOA 4GKKJ 3VF0B 5IT9Y 4ZOSA 1ZM2A 4DV0F 4GC7A 1WKJA 5G0RA 4NYZA 4UW2A 1CVJA 4C3KA 2X98A 1Y5IB 3ULHA 3MOJB 2MKYA 2WB4A 3PYDA 2P8IA 5A76A 1X5OA 4CYUB 1EX8A 5K8NA 3UVJA 5J1PA 5I3UA 1S1TA 3BDHA 4OJ3A 2ACYA 1SQEA 5KG5A 3BQ2A 1NKCA 2J6UA 2BDPA 3RG6A 5K4PA 2E1AA 1ZM9A 1NUEA 1C0UA 1X9SA 3GIMA 3GSIA 4UY8T 3IGNA 2D69A 3IXQA 4XIUA 2LXUA 2OUGA 4DCPB 5KG2A 2ZC4A 1H7WA 3HVRA 4OX7A 4C8NA 5J2QB 1FX4A 1Q1KA 5C24B 2FDNA 1GQEA 4NI2B 3C46A 4OI2A 2RDIA 2UVUA 2GAHC 2RS8A 1JLCB 3PRVA 1PJ7A 3R7SB 1SC1B 4RNOA 3M32A 2ANHA 2OFGX 4EZ6A 3TAMB 3M6XA 4UT4A 3KK3A 3HP6A 1DAXA 2HMIA 3JTOA 4I2PB 4ZJOA 1BQMA 4JI2F 4IH6A 1IBLJ 2HSEB 5KT4A 2HIYA 1S59A 4CM2A 1NU4A 3BDGA 1IM6A 1SC6A 4U6PA 4DN0A 3R9LA 3QJJA 3NGSA 4B3MJ 4ELTA 3Q83A 5C42B 3A4TA 1CG2A 4U95A 3M6VA 4QPXA 3TAPA 4M5DA 3C6TB 1KS2A 3TUJC 3Q24A 3DM2B 4NCGA 4HHUA 3UWTA 1R3NA 2QSWA 3K8WA 1EJ7L 3I6PA 2L9DA 3NLCA 3L7UA 5HJXA 5KFAA 2VBXA 4J90A 2F1FA 4LR8A 2P9GA 2DY1A 1JIHA 4YQWA 2U1AA 2AEJA 2IA0A 4WKRA 5KG7A 1JLGB 2NREA 1UAWA 1KEKA 3PKYA 2OP5A 2JJ4D 1VQPS 3FBBA 2MQLA 1FI4A 3TUZC 4DV2J 3PW2A 3PCOB 2QA4G 4B9MA 4F3OA 3LP0B 3RR7A 3QLHA 5EHHA 3W63A 3AD7C 3NGUA 4OZ1A 1BC6A 2FJAB 4RJVA 1LWXA 3CDAA 5GAHU 4YDDB 2UUBJ 2NPFA 4I67A 4F04B 2LQ9A 3QT8A 2J0QD 2ALYB 1HW8A 2JHEA 3BKFA 1M5PC 3DMJB 1RK8A 4DF4A 1UA1A 4IG0A 2WTFA 1WG5A 2ALZA 2RHQB 5C2GA 1ZTWA 2XNRA 2WONA 5A8WB 1KONA 4NCBA 3LXQA 2DB1A 2LQ8A 4LBIA 5IQ6A 1QVFR 1TL5A 1KR4A 1WSRA 2DXEA 4L3KA 3KK1A 3N6MA 2CUYA 1SHNA 4YN3B 2HZAA 2WBRA 1SQFA 2CJYB 3O1LA 2FHKA 1RHUB 1K73T 4TY8A 1FSUA 2BR0A 3PACA 2XLIA 4MHXA 2ZHAA 1GMWD 3CMES 3VAMA 4MTPA 3GFXA 1OPZA 3CIMA 5L39A 3SV3A 2HYIB 3PYGA 4OZ3A 2RJZA 4NA3A 1Y6VA 4CLYA 1B3TA 4LSNB 3KG1A 2FJDB 2N82B 3N79A 3HJVA 2FHOB 1AT1B 1HQ2A 2AT1B 2B9XA 3IGZB 2N7YA 3CJ8A 1HIYA 4CXUA 1EW2A 3BREA 2NPIA 3K57A 2E5HA 5L9NA 2RUSA 5L1KA 4KAYA 3ILIA 2GO9A 3D3CJ 3V2UC 4OYWA 2D9OA 4DV7F 1FRXA 3DLKA 1RT7A 3D0HE 2KO1A 5C2CA 1Q8LA 2M5YA 1ZS6A 1L3VA 1CJUA 3RUBL 2KI2A 3DRPA 3CCJS 5EWEA 4GKJF 1FDNA 3VGSA 4NWXA 1RI7A 3WAYA 1NPRA 2BKOA 3MZIA 4DG1A 5KFHA 2QGFB 2OI2A 5ETMA 2VODA 3C15A 3FEYB 2XZTB 2QRRA 1FCAA 3QATA 1HNWF 4ILMA 4OX9J 4QWEA 3KXDA 3GB0A 3MPWA 3DU6A 5A2QU 3U1MA 1R8BA 2PA8D 4FKXA 3R3TA 3UCZP 4F2SA 3TRGA 2E44A 4CO3A 4CYSA 2W2OP 2JFKA 1EQ0A 2HS3A 2FGOA 5HP1B 2QO3A 3KLIA 4O44B 2Q6BA 5A2QY 3ELHA 4KGVB 3MUTP 3CIZA 3M8QA 2DY9A 4DQSA 3G96A 4QWAA 4HDHA 3RZAA 3DLHA 1S77D 1CEZA 5RUBA 3MD1A 4G65A 4M8LA 3OVBA 3UE2A 3ZZOA 1H2VZ 4CLZA 4C3MA 3MMCB 2XY6A 2BABA 4D3GA 4NA2A 4ELVA 5LM7E 3K5NA 2CJXB 2KG1A 2ZH1A 3DU5A 1RTJA 1SXLA 3D3BJ 3OR2A 3DRXA 1C1BB 1NK5A 4DV0J 2YQ0A 2GMJA 3P96A 3CUNA 4DLGA 3B54A 3G82B 2BOPA 4LF7J 4DV1F 2MKHA 2MQQA 5M2RA 2VA3A 3MMBB 1S76D 2F4FA 4KBIA 4XPEA 2GSUA 5D4LA 3QT5A 3QT6A 1M1KT 3LP1A 3QAUA 1J5EJ 5AT1B 1R0AB 1KQGB 1QAXA 3POTB 5L0EA 4GVBB 5MLCV 2DPIA 5FDLA 2B43A 2PO4A 3CMAS 3V6HA 3BGRA 5BXIA 4A8QA 2LDIA 4R0EA 3C6UB 2FTRA 4CH7A 1RTHB 4FF4A 4B56A 2V2KA 4ES3A 3M8ZA 4L76A 1I51B 2YWWA 3M05A 2DEIA 2HAIA 2DNZA 3KUGA 4DQQA 3FC9A 3B6BA 1IKWB 3DGPA 1WF1A 3BR9A 4IR1A 1SV5B 4DS5A 2H9ZA 5BJRA 4X4NA 1K9MT 4ZPTR 2H4WB 5J1EB 2RDDA 5KFKA 3I87A 4JI0F 5LSRA 3S6EA 4EK2A 4ED5A 2RQMA 4WZMA 4ZGAA 2RKIA 2KZZA 4JI2J 3Q8SB 4MFBB 3U1NA 5DQIA 1XJWB 3Q3QA 1AJAA 4GTXA 4X4PA 1UZDA 4UQTA 2L9WA 4ZVOB 2ZHBA 2IDLA 2GLQA 1UL3A 4LRDA 1VK3A 2R7OA 2QMWA 2EKNA 1ZAWA 4ZVHA 1RAEB 5KFEA 3GIIA 2IY5B 1KQKA 2MKJA 1URRA 3IS9A 1XNQF 5INHA 4DPWA 1EP4A 4H4KC 4LSZB 3J7A1 3M2UA 2VFSA 4LFBF 4ECRA 4A8YA 4W98A 3AB4B 3QGIA 4CLWA 2NYHA 2DNQA 3Q8QB 2LKZA 3NCPA 1IWGA 1DY3A 4UORA 1IVZA 4OZJA 3LGMA 4IRCA 3EZUA 1SJRA 3I5CA 3T5LA 5IJQA 4JUZA 1CS4B 5KFDA 2X51A 2DO0A 2GHVC 2PMWA 1I6JA 4LUBA 5L38A 1YZ6A 3IFEA 2HHHF 3A13A 4JI1J 4ZPWR 3W7BA 1N33F 1S10A 1WTBA 3H5UA 4IQXA 1CSJA 3R5GA 4RR5A 1LW0A 1DZ5A 2LDYA 4KV8B 1D3WA 3DHXA 4HVZA 2KFYA 2W5QA 3VTIA 2CG4A 3KDOA 2NLWA 2C2MB 2WVBA 5HQMA 3NCQA 3H4DA 1HYSB 1FWPA 3ENWA 1MSWD 1VQ4S 1Q79A 1P9QC 1EW9A 2HURA 1FESA 1HNXF 1FD8A 4LQYA 2CZ4A 2Z2MA 1SL1A 3AB2B 3IBCB 2ZJPQ 2FHJD 3DPCA 3UQSA 5DQGA 4FXDA 2V0NA 1OWXA 3QJLA 4CYUA 1U1QA 4QR1A 4HLBA 2XYPB 5EGEA 3C14B 2Q6CA 1VS3A 2FLOA 2KG0A 2KXNB 3O3LA 5DZ7A 2C22A 3CCTA 2VKZG 4B3OB 4IUFA 2WVFA 4FYXB 1UTAA 3OHAA 4RW6B 4YR1A 3LGNA 2JVRA 2J9EA 3CULA 1S0VA 1RWPB 5J2QA 1Q53A 3Q8YA 5C24A 4M5HA 3ENQA 4NI2A 1TKDA 2W01A 3C16B 2LP4A 2QT7A 1R27B 2HQGA 1JLCA 3QRQA 1KKHA 2DIUA 5LJ3Y 2FB0A 3CCRS 1WHVA 5J1NA 2N3LA 1S0OA 2CWKA 2K3IA 2QV6A 4OHVA 3TAMA 3A3OB 2MTLA 1YGYA 2EEYA 2I9SA 2XHCA 2L3MA 4DUZF 3CWJA 1T9TA 4I2PA 3D67A 3RYLA 1H73A 4B17A 2XB2D 2AEMA 4PXDA 3IR5B 1E2SP 2CIMA 5LRMA 2IYGA 3TX8A 2YX4A 4DV7J 3JSMB 1S0MA 2B4OA 2ABYA 4QIFA 2CZVC 1HD0A 2ZD1B 3QAEA 4QJVA 2E5JA 2XWYA 5C42A 2WAQD 2R2TA 2GMHA 4GKJJ 4CTAB 3C6TA 1DQ9A 2NZ4A 3Q89A 2V4JB 2P2CB 1YJTA 3FFIB 1YKWA 2K1RB 2HK2A 2MSSA 3DM2A 2ZH2A 1F9HA 4UPIA 4C97A 4H54A 3D9BA 4NLWA 1KLMB 4DUYF 3DDKA 3ZNUA 3M8RA 1Q8BA 1HNWJ 2R2RA 2VPYB 3CT9A 3VZHA 4KTQA 2V94A 2VDIA 2EG2A 2G2ZA 4XAKA 2W9AA 3RB4A 4OLOA 1YBTA 5IWAF 1JLGA 2AJ4A 1M5OC 5HVGA 1KBRA 1PBUA 1FNOA 2HBYB 2W2NP 1LWFA 4DPOA 4H4KA 2F8HA 1F0XA 3W60A 2V68A 3MM5B 1IUJA 4J9MA 4ZS6A 2G1DA 3GV7B 1SC4B 3H98A 3LP0A 4OL8A 1HLWA 2GHPA 3RAXA 1UFWA 2QEXS 5BR8F 4OZ0A 3D66A 3UI3A 4UPKA 4DV6F 3H5XA 3NOCA 1WG4A 3GJQB 2YKNB 4HHHA 2HS0A 2Z4PA 1VC5A 4DR5J 4M5GA 1TKZB 4UPLA 4CNYA 1TU0B 3BEGB 1P8GA 1HNIB 3LA0A 4I7FB 2CQHA 3DMJA 3CJ4A 2PMZD 5CZXA 1UVNA 3O6QA 4JI8F 2IVMA 3OXGA 1SUQB 5HQ8A 2OO4A 4FKYA 5B08A 2XMVA 1ICEB 5A8WA 1K44A 5F8MA 4LFCF 4ILLA 3MCOA 4L74A 4FS1A 3TG0A 2Y9HA 3S1TA 2UVVA 3RB3A 3T1YJ 2HVZA 2HQDA 2FVQA 4KIAA 3NWGA 4KFBA 5JUMA 2BJ3A 2DGUA 3GFYA 1NO8A 3QO9B 2G2OA 4TLQA 2R7UA 1HARA 2VHGA 5A0YB 2NXCA 3ZZPA 3GJSB 3MHYA 3SFUA 4WBFA 2HHQA 1JKHB 2NZCA 1L3SA 3F73A 2M52A 2YTCA 2WW8A 2UUWA 3CTRA 4F50A 2VJVA 3CO0P 2LEPA 1D1UA 2AYMA 4CT9A 2HFSA 4DR3J 1ELOA 2VFTA 4LSNA 5KOWA 1EHWA 4ZK7M 4IO1A 2AV5A 1XERA 2C3MA 2DGSA 2HVEA 3CNQP 2R7SA 1NHUA 4JI0J 4AFFA 5JVHQ 4KRWA 3UPFA 3QRPA 1H2TZ 3U02A 1H6KX 3CVKA 3BDPA 1R0CB 2UV8G 2B9YA 1KH9A 3ET6A 4DR6F 2BYCA 2QLFB 1Y3KA 3DYCA 4EFAC 4JYAF 1DTQB 2AYGA 1DURA 4ZJQA 4DPYA 5M2PA 1Q81T 1N88A 2BW2A 4P72A 2DH8A 4OYOA 2L41A 1XNQJ 4QCLA 1URNA 3ETMA 1NPKA 1ELYA 2XQCA 1R6YA 4K2JA 2ZC3A 4X66F 2WB1D 4PWUA 4OI3A 4LFBJ 2XZWA 5F8GA 3K0JA 3B8HA 3QNWB 4KYZA 1RAIB 2LXIA 2MQMA 3M8PB 3DFEA 3H20A 4I4BA 2NUHA 1XWLA 3U27A 4LF2A 1KD1T 4R25A 3PW5A 2BVZA 1S1VB 1GXUA 3PZPA 1T95A 1UVLA 4P7TA 3D5MA 1T9YA 1K0TA 2DGVA 2MZQA 2ERRA 3I96A 2E1MC 1FRJA 1XR7A 3OVAA 3LGHA 1B70B 1BQNB 3I5AA 1WWHA 1IKYB 1AA1B 2RRAA 3ENVA 2QN6B 2HHWA 2ZH9A 3TNVA 2ADCA 2UV8A 5HP1A 1KWMA 2E7WA 4DXLA 4ZP7A 2XEXA 3PHTA 2FJWA 2CNKB 3OLBA 4TQRA 1N33J 5HVHA 1OIAA 3GIRA 4URSA 3E8OA 1QTNB 1NH7A 2LEBA 4OV6A 2VL1A 3EZOA 5EWFA 4K0KJ 4I64A 1FEHA 2ZBRA 1HR0F 2HWHA 1P1TA 3BDEA 3MMCA 2WSEC 3UDVA 4MIVA 3DRYA 1NEEA 4JV0A 3VWSA 4EWTA 1HNXJ 3IAM9 1C1BA 1I5OB 4C8LA 3CPWR 3G82A 3GCWP 1IR1A 4YP3A 1IBKF 1I3OB 4HYKA 1ALJA 4HDGA 2IBOA 4DDFA 3H25A 1X5TA 2GVZB 1S97A 3MMBA 1SKUB 2AJFE 2J76E 4PWDB 4ECVA 4J9VA 1F2GA 2NXEA 1CJTB 2YH0A 1TL4A 4IDKB 2KT5A 4LT6A 4P71A 1R0AA 4FP9A 3POTA 3DYAB 4GVBA 4XO0A 4KR0B 2QL7B 2FZCB 1FE0A 2KTQA 2XSFA 2XMAA 3VZIA 3C6UA 3A8IA 3GV8B 3TJ9A 4DL4A 1RTHA 3KLEA 2OMOA 4RUCA 3OR1B 3M1VB 1UEUA 2B4UA 2MQPA 2VBWA 2Q43A 4KHPJ 4ANCA 4WE1B 4IOAQ 1JJ4A 4KGMA 3ZC4A 3T9NA 2WHOA 5DZ6A 4GTZA 3E2DA 1AJBA 2UXCF 1NJXA 4NLVA 3KNAA 4Y6IA 2ZOMA 1SV5A 3KLFB 5J1EA 3FQKA 4Z37A 2L48A 4DUZJ 1D8YA 1MWZA 1X0FA 1BGXT 1FJGF 4PG8A 4RW4B 1S57A 4NOHA 1JJHA 3DKDA 4MFBA 1NJZA 2OPQB 3CCUS 1YQHA 1TMMA 1HL6A 1QY7A 3DHWC 2QA2A 3OXLA 1B0VA 1JK9B 1H38A 1U1RA 5KFQA 3CDWA 4HHJA 3I32A 4I6WA 2GQ2A 1IN0A 2F65A 1WC1A
chains in the Genus database with same CATH topology
4CXSA 4LRBA 4LRAA 1KH4A 3WAVA 4CXUA 3M7VA 3LXQA 4CYSA 1EI6A 4LR8A 1ED9A 1EW2A 1URAA 3UN2A 2W5WA 2W5SA 3NKMA 5DLTA 2XR9A 3WAWA 5IJSA 5HRTA 1ANJA 2XRGA 1HJKA 2W8SA 4NWJA 3TG0A 5INHA 1KH9A 1HDHA 2G9YA 4UOPA 4UOOA 1KHLA 1ELXA 4LREA 3UNYA 3DYCA 4KAYA 3TX0A 3M8WA 5LRNA 2D1GA 2ANHA 3T00A 1EW9A 3CMRA 3NKNA 4GTYA 1ED8A 4FDJA 3T02A 3UO0A 4ZG6A 4B56A 4LRCA 5GOVA 1ANIA 4LQYA 1KH5A 1ZEFA 3M8YA 5C66A 2QZUA 3M8ZA 1EW8A 1P49A 4KJDA 5L0BA 3SZYA 3NKRA 4TN0A 5AJ9A 4LR7A 1SHNA 5GRRA 4LRFA 1ALHA 3T01A 4KM4A 3DPCA 3NKQA 2W5VA 3TWZA 1K7HA 2X98A 5LIAA 4UORA 4NWXA 1KHKA 1E33P 1ELYA 4GTZA 1N2KA 4MIVA 1E2SP 3E2DA 5LQQA 1AJBA 5KXAA 3WAYA 5LRMA 1B8JA 1FSUA 3A52A 4UPHA 3BDGA 1O99A 4FDIA 2IFYA 4ZG7A 2W5XA 2GSNA 3BDGB 4QAXA 1HQAA 3BDHA 4KAVA 5EGEA 4MHXA 3SZZA 2RH6A 1ALKA 5IJQA 1SHQA 2ZKTA 5DLVA 1AJCA 3BDFA 3IDDA 2IUCA 1Y7AA 3OT9A 3NVLA 4UPKA 2IUCB 5K4PA 4N7TA 1KH7A 3NKPA 3ED4A 5DLWA 1ALIA 1EJJA 4CYRA 4CXKA 4ZGAA 4LR9A 3MK0A 1URBA 1ALJA 3B5QA 3UN5A 5EGHA 1KHJA 4KJGA 1KHNA 4UPLA 5L0KA 3UN3A 3WAXA 4YR1A 1AJDA 1N2LA 3MK2A 4LR2A 3Q3QA 1Y6VA 1AJAA 3NKOA 4GTXA 4MY4A 3WBHA 2GSOA 3MK1A 1ZEBA 4ZG9A 1ZEDA 2W8DA 1AUKA 2GLQA 2W5RA 4UPIA 2GSUA 2VQRA 1ELZA 2W5TA 4LRDA 4GTWA 2GA3A 1O98A 1E3CP 3IGYB 1E1ZP 5TJ3A 3KD8A 2W5QA 3IGZB 1EQJA 5L0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXS A;  4LRB A;  4LRA A;  1KH4 A;  3WAV A;  4CXU A;  3M7V A;  3LXQ A;  4CYS A;  1EI6 A;  4LR8 A;  1ED9 A;  1EW2 A;  1URA A;  3UN2 A;  2W5W A;  2W5S A;  3NKM A;  5DLT A;  2XR9 A;  3WAW A;  5IJS A;  5HRT A;  1ANJ A;  2XRG A;  1HJK A;  2W8S A;  4NWJ A;  3TG0 A;  5INH A;  1KH9 A;  1HDH A;  2G9Y A;  4UOP A;  4UOO A;  1KHL A;  1ELX A;  4LRE A;  3UNY A;  3DYC A;  4KAY A;  3TX0 A;  3M8W A;  5LRN A;  2D1G A;  2ANH A;  3T00 A;  1EW9 A;  3CMR A;  3NKN A;  4GTY A;  1ED8 A;  4FDJ A;  3T02 A;  3UO0 A;  4ZG6 A;  4B56 A;  4LRC A;  5GOV A;  1ANI A;  4LQY A;  1KH5 A;  1ZEF A;  3M8Y A;  5C66 A;  2QZU A;  3M8Z A;  1EW8 A;  1P49 A;  4KJD A;  5L0B A;  3SZY A;  3NKR A;  4TN0 A;  5AJ9 A;  4LR7 A;  1SHN A;  5GRR A;  4LRF A;  1ALH A;  3T01 A;  4KM4 A;  3DPC A;  3NKQ A;  2W5V A;  3TWZ A;  1K7H A;  2X98 A;  5LIA A;  4UOR A;  4NWX A;  1KHK A;  1E33 P;  1ELY A;  4GTZ A;  1N2K A;  4MIV A;  1E2S P;  3E2D A;  5LQQ A;  1AJB A;  5KXA A;  3WAY A;  5LRM A;  1B8J A;  1FSU A;  3A52 A;  4UPH A;  3BDG A;  1O99 A;  4FDI A;  2IFY A;  4ZG7 A;  2W5X A;  2GSN A;  3BDG B;  4QAX A;  1HQA A;  3BDH A;  4KAV A;  5EGE A;  4MHX A;  3SZZ A;  2RH6 A;  1ALK A;  5IJQ A;  1SHQ A;  2ZKT A;  5DLV A;  1AJC A;  3BDF A;  3IDD A;  2IUC A;  1Y7A A;  3OT9 A;  3NVL A;  4UPK A;  2IUC B;  5K4P A;  4N7T A;  1KH7 A;  3NKP A;  3ED4 A;  5DLW A;  1ALI A;  1EJJ A;  4CYR A;  4CXK A;  4ZGA A;  4LR9 A;  3MK0 A;  1URB A;  1ALJ A;  3B5Q A;  3UN5 A;  5EGH A;  1KHJ A;  4KJG A;  1KHN A;  4UPL A;  5L0K A;  3UN3 A;  3WAX A;  4YR1 A;  1AJD A;  1N2L A;  3MK2 A;  4LR2 A;  3Q3Q A;  1Y6V A;  1AJA A;  3NKO A;  4GTX A;  4MY4 A;  3WBH A;  2GSO A;  3MK1 A;  1ZEB A;  4ZG9 A;  1ZED A;  2W8D A;  1AUK A;  2GLQ A;  2W5R A;  4UPI A;  2GSU A;  2VQR A;  1ELZ A;  2W5T A;  4LRD A;  4GTW A;  2GA3 A;  1O98 A;  1E3C P;  3IGY B;  1E1Z P;  5TJ3 A;  3KD8 A;  2W5Q A;  3IGZ B;  1EQJ A;  5L0E A; 
#chains in the Genus database with same CATH topology
 2RQK A;  1Q5Y A;  3KMQ A;  4PCQ A;  1VQ7 S;  2YWK A;  4B9L A;  4LJM A;  4ZLJ A;  1S9F A;  1P9Y A;  4BDP A;  2CQB A;  4DUY J;  2B56 A;  4L73 A;  1H7X A;  1N32 F;  5GAH I;  1FXD A;  3TWZ A;  1PAU B;  3BGO P;  4J5O A;  5E3A A;  2XCA A;  1U09 A;  5IWA J;  4JV1 A;  3FBF A;  1G1X A;  1X4B A;  3CCZ A;  1FTC A;  3BSN A;  1FWL A;  1FRM A;  4CLP A;  1H0H B;  1CS4 A;  4DQI A;  3HKZ D;  2VON A;  2AGQ A;  2FY1 A;  1IQT A;  3ED4 A;  2JEF A;  2GFF A;  2J8S A;  3OJU A;  4PUO B;  4F4W A;  2Y8W A;  1C0T B;  3N6N A;  4ZVF A;  3NS7 B;  1FRH A;  5K14 B;  2B8P A;  2MJU A;  4Q43 A;  1LXJ A;  4CH1 A;  2VQR A;  3NGK A;  2J7U A;  1XIQ A;  3TP2 A;  4DV6 J;  4KV8 A;  2FJV A;  1V5V A;  3QZ8 A;  2J6S A;  1S4E A;  1FE4 A;  1QE1 B;  3J7A N;  2FZG B;  4RW7 B;  2EFP A;  2QA4 S;  1VC0 A;  5CCM A;  5DLT A;  2XYH B;  1T7P A;  4USU A;  2DXF A;  2WOM B;  2UXB F;  4DV5 F;  4JI8 J;  1YRT A;  2W25 A;  1IBM F;  3PX4 A;  4LFC J;  4RU2 A;  2Q1L A;  1K7H A;  3OV7 A;  5D8H B;  4BCA A;  1GTE A;  4U7U K;  1FO1 A;  1J27 A;  3AQP A;  4OIX A;  3C14 A;  4O3O A;  1PCA A;  2BE9 B;  3O44 A;  3CDU A;  2DIV A;  3DOM B;  3H8Y A;  4B3O A;  2JL9 A;  3DCA A;  3MAQ A;  3N5B A;  3TUI C;  1NBE B;  4RW6 A;  4K4X A;  3KUE A;  2HHX A;  3V4I B;  4PR6 A;  2CQ1 A;  1KTQ A;  3K5P A;  3H90 A;  2GIF A;  3GCX P;  1QAJ A;  4NLU A;  3LPY A;  3C16 A;  4DL3 A;  2XYG B;  1SBR A;  1ED9 A;  2PD1 A;  1X4A A;  4WK1 A;  4JI7 F;  3F44 A;  3W66 A;  4LQ3 A;  5D3G B;  4YR2 A;  1XNR J;  3MDF A;  4K59 A;  1KQF B;  4DV4 F;  2EWH A;  2O01 C;  1WKL A;  1O8B A;  3RJM B;  3ZFV A;  1U2F A;  2M4M A;  2LEA A;  1V3Z A;  2PGC A;  1MU2 B;  1KFD A;  2CPE A;  4FXV A;  1YX2 A;  1R6V A;  3W9I A;  4J9L A;  2W5X A;  1FWK A;  2CDQ A;  3JSM A;  4IKA A;  1Z1Z A;  3SZZ A;  4U7U D;  2ZD1 A;  4OYB A;  3U1L A;  3UFC X;  3EPG A;  1R89 A;  3BO3 A;  1RT4 B;  2MLX A;  2CPF A;  4GMK A;  4CTA A;  3P6Y C;  3DLJ A;  3ILO A;  4DX8 H;  2V4J A;  3D54 A;  3FFI A;  2KJW A;  1TQL A;  2K1R A;  3Q2S C;  3BGF A;  4QR2 A;  4X66 J;  1UPM B;  2F63 A;  4AL6 A;  1Q4R A;  2VIC A;  3SEO A;  1KLM A;  1EET B;  1T9X A;  2W7O A;  4DX6 A;  4U9R A;  2RQ4 A;  4LRB A;  1LW2 B;  4F4Z A;  2CFX A;  2AYB A;  3EE3 A;  1UEV A;  3G8T A;  1HD1 A;  1YSJ A;  5CZV A;  4NWB A;  4I0W A;  5CA5 A;  3DI6 B;  2MY8 A;  1UWA A;  3EPI A;  3L7O A;  2HNZ B;  2CJQ A;  3MM5 A;  2AKW B;  2VB6 A;  4ECX A;  2QLW A;  3SBM A;  2KXH A;  1VJQ A;  2G9O A;  2JC0 A;  2DEJ A;  2BJ8 A;  4ZJL A;  4K4U A;  3MOZ A;  3PRD A;  4DL5 A;  2KU7 A;  2EI5 A;  3I5B A;  2OEL A;  2DTJ A;  1NSP A;  1GXT A;  4D3H A;  4H4O B;  2KVQ E;  2Z2L A;  2ZOF A;  3SSR A;  2M8D B;  2GC8 A;  2E5I A;  5E3Q A;  4X62 F;  1RWW B;  2YKN A;  1JJC B;  1HR0 J;  2QMX A;  1TKZ A;  1R7I A;  2I38 A;  4MAK A;  2GJF A;  1R0B G;  1HNI A;  4I7F A;  3GFZ A;  4J37 A;  3BO2 A;  3NAI A;  4DR7 F;  4NL5 A;  4DFK A;  2ROP A;  3BN7 A;  5HRO B;  1UKU A;  4DF8 A;  1SUQ A;  3AD8 C;  1E3C P;  4LIW A;  4TKT A;  1WC4 A;  2KH9 A;  3P49 B;  1JLE B;  1XMO F;  1L3T A;  3KLV A;  1WF0 A;  2UU9 F;  5I3Q A;  3FBC A;  3TW0 A;  4Q5V A;  3D6H B;  2IMO A;  3RB6 A;  3W2W B;  3G86 A;  4AL7 A;  1SI9 A;  4U8Y A;  4LR7 A;  1JX4 A;  3NKQ A;  4H4M B;  4LFA F;  3QO9 A;  1RKJ A;  1X0P A;  4P73 A;  1L3U A;  2B6A B;  5A0Y A;  1UW9 A;  2HFO A;  2MZR A;  1PYO B;  3DNC A;  1JKH A;  3MCN A;  2XWX A;  2ZH8 A;  4EYI B;  3CJQ A;  5ETK A;  3TZZ A;  1SKS A;  1Y0H A;  2XLK A;  2KFN A;  5BYR A;  1YK9 A;  4QWD A;  3J7Z 5;  4QWB A;  1SPB P;  1L3K A;  2K8G A;  5CAB A;  3FMB A;  2A6O A;  2EFN A;  2UXC J;  3K8V A;  4RX6 A;  2VU5 A;  1FEE A;  3IBW A;  2FHJ A;  1SJ3 P;  2QA1 A;  1DRZ A;  2Z57 B;  3PX6 A;  1RAF B;  4PG6 A;  2IVY A;  3QIP B;  5SZT A;  4EEY A;  5KG3 A;  2GQQ A;  4YOE A;  4HR2 A;  3KNG A;  3OTB A;  1FJG J;  5HSP A;  5GAG I;  5AJ3 F;  4CRJ A;  1DJ0 A;  1FHT A;  3C8Y A;  2MY7 A;  1HJK A;  5J2M B;  2I5J B;  4E8U A;  4IR9 A;  4AT1 B;  3UO0 A;  4LRC A;  4JV2 A;  1DTQ A;  2UUA F;  3RTV A;  1TKT B;  1RAH B;  2CQ0 A;  4JI6 F;  4O23 A;  4OZL A;  1LNQ A;  3SXL A;  2ILZ A;  1ZH5 A;  2MST A;  1S48 A;  2HVH A;  1VCT A;  2UXD J;  2V2V A;  1DBD A;  3PXG a;  4N76 A;  4DEZ A;  2DNY A;  2AWZ A;  2P6T A;  3M8P A;  2ZM6 J;  1NK7 A;  1Y4Z B;  3HSJ A;  5GME A;  4LF5 F;  3ICL A;  1C1C B;  3LH2 S;  3AXK A;  4X65 F;  3PM9 A;  3G2X A;  3OTO F;  3FMW A;  1RHK B;  3NBP B;  3M2R B;  4N8O A;  4AUK A;  1S1V A;  3K59 A;  3PYF A;  4C8M A;  5B7W A;  1SIW B;  2CPJ A;  4IFY B;  3M8S A;  2DGX A;  2YWF A;  3V5R A;  3CJK B;  1BQN A;  1PC5 A;  4DLE A;  1IKY A;  1XQI A;  4ZLN A;  2HKE A;  2VFR A;  5F9N A;  3Q8U A;  5L46 A;  4LF6 F;  3IR7 B;  1S6P B;  3L7P A;  2PMH A;  4DQP A;  3OQ2 A;  3K5O A;  2J5A A;  1N5Q A;  1M90 T;  1YBU A;  1FD2 A;  4WTY A;  5F0W A;  4KPC A;  2CAJ A;  1O6X A;  4OQJ A;  4DR1 J;  2C2D A;  1T11 A;  2MHN A;  2I1R A;  2C2Z B;  1FX2 A;  2Z8Q A;  4LF4 J;  3BSA A;  5C5J A;  2Y1I A;  1S1U B;  4IRK A;  2UXB J;  1H98 A;  5ETR A;  4DV5 J;  5H1S V;  3HUL A;  4DR2 F;  1IBM J;  2C2O B;  4M5L A;  2ZVI A;  2AMC B;  2CVE A;  4NEZ A;  1TL3 B;  2GVZ A;  3TAN A;  5EGH A;  1HWI A;  1XK8 A;  3FSY A;  3SYZ A;  1CJT A;  1VFJ A;  2XCP A;  1TUG B;  1NND A;  4ZPD A;  2ZE2 B;  1AUK A;  1PC4 A;  2ADB A;  3MEG B;  4IDK A;  4RBT A;  1CBK A;  2HHU A;  3PJX A;  3CDB A;  3DYA A;  1Y9O A;  5D4N A;  3AQO A;  2DKO B;  2EK1 A;  3PYE A;  3FNN A;  1R43 A;  4ECW A;  2CQ2 A;  1FFS B;  4UOP A;  3EUN A;  2GVD B;  1UA0 A;  2IAJ B;  2JWN A;  3T00 A;  3JQJ A;  3NKN A;  1VHI A;  3OR1 A;  3M1V A;  2K7J A;  4PG5 A;  2M2B A;  2MXY A;  4K50 A;  2JOQ A;  1NSQ A;  5T7L B;  1LK5 A;  2KRB A;  1TAQ A;  1KHW A;  1NAQ A;  1YJ7 A;  4WE1 A;  3RBD A;  3VAK A;  3SQO P;  5T14 A;  4JI7 J;  3SIP B;  2ZBP A;  3NY0 A;  3KLF A;  1U0H B;  5KFR A;  2FY8 A;  4DV4 J;  4QYZ J;  2UVR A;  5FLX U;  1NME B;  1BLU A;  3S7R A;  2H48 B;  2IUC B;  4N41 A;  5B0D A;  3HFK A;  3VCD A;  4AND A;  4RW4 A;  3BB5 A;  2ZJQ Q;  2G0I A;  5B0C A;  4L72 B;  1U7L A;  2AD9 A;  1J5O B;  4QYZ K;  2OPQ A;  3TR5 A;  2WK4 A;  1ZPV A;  2VG6 B;  4FZV A;  5FLX Y;  2CJA A;  1IBL F;  5DG8 A;  3W3S A;  3GSD A;  2B4P A;  1Y10 A;  2HHV A;  3HKW A;  4ZIV A;  1D9A A;  2KJV A;  4Q44 A;  2E9Z A;  5DGB A;  3KJQ B;  2NXJ A;  1U2R A;  4Q7A A;  4FYY B;  2F9J A;  2J0W A;  2XRG A;  4X2B A;  1UVJ A;  4C8K A;  4UOO A;  2C2K B;  5T41 A;  3K7R A;  2DGW A;  3HHK A;  5J2P B;  4Y2C A;  2QZU A;  4DSK A;  4O3R A;  4NCA A;  4CT8 A;  4W4M A;  2H65 B;  1MG7 A;  4UZB A;  1BXN A;  3H2V E;  2D3O R;  1TUW A;  2HND B;  5EX0 A;  5SUH A;  5K8M A;  4C0O C;  1JQG A;  3E01 B;  3PEJ A;  1A7G E;  3KTQ A;  2ZDP A;  4ECQ A;  4PUO A;  1C0T A;  2HVD A;  2P5V A;  5K14 A;  5EN1 A;  3FKB A;  1C4C A;  5ETQ A;  2KKH A;  3R5J B;  4YY3 F;  4WFN Q;  1M5K C;  4X62 J;  5F8J A;  2GQC A;  2ZH6 A;  3MAH A;  4GVL A;  2QJ3 A;  2B4V A;  1QE1 A;  3FCW A;  4RW7 A;  2R7T A;  4F26 A;  3G6E S;  2VQE F;  4B3S F;  3UN2 A;  5ADZ A;  3DLE B;  4ZVU B;  3K5L A;  1AYE A;  2WOM A;  1NCL A;  4N5S A;  3MR6 A;  4HI2 A;  2OEM A;  1HWJ A;  2ASJ A;  4FBT A;  2X1F A;  1U24 A;  1PG5 B;  1NDC A;  1XMO J;  2CG8 A;  2RVJ A;  3CB4 A;  1EKR A;  1G2E A;  1EIY B;  4ED0 A;  2RML A;  2UVW A;  4YR3 A;  2A2C A;  2C3P A;  2RHS B;  3R5A A;  3OLA A;  1FK9 B;  1NK8 A;  2YKP A;  1NK9 A;  5DDO C;  2HEK A;  2MEW A;  4XDC A;  3L4B C;  2DT9 A;  2K2P A;  4XPC A;  1FDB A;  1N5Y B;  2V9K A;  1O51 A;  3DOM A;  4RZR A;  3CJ2 A;  3P5B P;  3IP0 A;  2MJN A;  2N3O A;  4X4R A;  1RE1 B;  4LFA J;  4UUW A;  2CQ4 A;  2XM3 A;  4ZN3 A;  1PAE X;  1T03 A;  3V4I A;  2DRD A;  4E2F B;  1LFW A;  4ZP9 A;  1RIS A;  1TL7 B;  5KT3 A;  5DQH A;  4G1P A;  5KFU A;  5KFJ A;  3KJF B;  2H5E A;  4KPY A;  1O98 A;  4ZIW A;  1S49 A;  3M7V A;  3SSS A;  2OSR A;  2HG4 A;  4NWJ A;  1X5P A;  5D3G A;  2FVR A;  4GTY A;  2DR5 A;  5D6G A;  4QOT A;  2LQJ A;  5DLF A;  1TVR B;  1BHN A;  1P49 A;  2MGZ B;  1Q82 T;  1MU2 A;  3ADA C;  3OL9 A;  1VRT B;  5LT5 A;  3A3P B;  2GIR A;  5KT5 A;  1RWV B;  3W61 A;  1YJV A;  4RBV A;  4PXE A;  3TVY A;  2OTL S;  2VOP A;  4V19 X;  8ATC B;  4ES1 A;  2P6S A;  3SMZ A;  1SH3 A;  2UUA J;  1NM2 A;  2Z0G A;  4V19 J;  2AZ1 A;  2E5G A;  5C25 B;  1NSA A;  2IJN A;  1RT4 A;  5BYQ A;  1ALI A;  5CH7 B;  1U1P A;  3PHE A;  1KNZ A;  2D3U A;  1TMJ A;  1DQ8 A;  4WFA Q;  1BMQ B;  2RDJ A;  4RNN A;  2J9D A;  4KGK A;  1MMN A;  2DRA A;  3MM6 B;  4LF5 J;  1EET A;  1KTV A;  2JRS A;  5GVQ A;  2XUL A;  1NKE A;  1RHJ B;  4X65 J;  4BBY A;  2CA9 A;  2QX0 A;  2CYY A;  4ZVT B;  2YH1 A;  1LW2 A;  2IYI A;  1XEZ A;  1D8Z A;  2XS2 A;  3DI6 A;  3ONQ A;  4HH0 A;  1ITP A;  4FPR A;  4ICL B;  2ILY A;  2VBZ A;  4EI2 A;  1HKA A;  2HNZ A;  1F5A A;  3OTC A;  4LF6 J;  3EGN A;  2BM1 A;  2X1B A;  3CC4 S;  2R8H A;  1M5S A;  3OBI A;  5JJB A;  5KFI A;  2Z30 B;  1VBZ A;  2KHC A;  3ZZY A;  2C3Y A;  3BM7 A;  4I69 A;  1Q5V A;  3AFG A;  4WJB A;  4TVA B;  3JQM A;  1GH8 A;  4YFU A;  3QSY B;  1N8R T;  5IT9 U;  4MK9 A;  3D68 A;  4NRT A;  5K9F A;  2V2Q A;  1S1X B;  3N4W A;  4DR2 J;  4JI5 J;  5HRO A;  4QPT A;  2H4Y B;  4ECY A;  4F0H A;  1KOO A;  1JLE A;  4ED6 A;  1KVJ A;  3W5Z A;  1ZM3 A;  3C66 A;  2W5W A;  4ZPA A;  4LF7 F;  3TEG A;  3UNY A;  3W2W A;  2PSZ A;  1D9D A;  3ISZ A;  1VQL S;  1UFK A;  4PWW A;  1J5E F;  2RB7 A;  3W62 A;  3N6L A;  3Q86 A;  2B6A A;  3S01 A;  1BUX A;  2ROE A;  3UD5 A;  4K4Z A;  3HVT B;  4A8M P;  4NLX A;  4X4O A;  3LTO A;  1I1G A;  2BJ1 A;  5KFX A;  4DUT A;  5GAE U;  4ECZ A;  2YBV A;  4HEA 9;  9ATC B;  4F0M A;  1F5B A;  3UD4 P;  4ITS A;  2V6A A;  4X4T A;  4HL9 A;  4EBD A;  2W8D A;  3QIP A;  1RU1 A;  1XTZ A;  2DIS A;  4KSE B;  5CYM B;  2D3O 1;  4EO8 A;  4NLT A;  4G1Q B;  3UR0 A;  2XG8 A;  1NZ8 A;  1MWY A;  4ZIT A;  3WAW A;  3M4X A;  1UWB B;  5J2M A;  4F3Q A;  2I5J A;  4K5S A;  2PFD A;  3PFO A;  2H5J B;  3FQL A;  1VLO A;  1TKT A;  5HBM B;  5IT4 A;  5HAO A;  1UJ6 A;  5KFO A;  1WEX A;  2XGP A;  3HXM A;  2L08 A;  4CLK A;  1CJV B;  5ETT A;  6FD1 A;  1WG1 A;  4CLT A;  1V6H A;  4I56 A;  5AE3 A;  1WSV A;  1NHK L;  4EBC A;  1OMS A;  3NBP A;  3M2R A;  3SI8 A;  2CNN B;  1VDH A;  3G8S A;  1PO6 A;  4DL6 A;  5G4D A;  2R7W A;  1QVG R;  5K8P A;  4IFY A;  4IQM A;  2NR0 A;  1U48 A;  1KSP A;  3JYT B;  3CJK A;  4DHV A;  1U26 A;  2CQP A;  1FF2 A;  2JH3 A;  1VQ9 S;  1Q78 A;  1S6P A;  4L6V 3;  1S12 A;  1RP5 A;  3JSY A;  3NKM A;  4Y3C A;  4TYB A;  3OL7 A;  4YY3 J;  2R7R A;  3P4U B;  3V6J A;  3M9N B;  3GWC A;  4JI1 F;  1W26 A;  2FJX A;  1WC6 A;  2YNH B;  2EG1 A;  2VQE J;  4B3S J;  2M0G B;  2EFO A;  1S1U A;  4M5K A;  3AA9 A;  3THT A;  4Z7Y A;  3ZTQ A;  3NMA A;  3I55 S;  2HBQ B;  4DBQ A;  3DXS X;  2BXJ A;  1MRO B;  4O3N A;  1FA0 A;  4UZC A;  4RUA A;  4CO1 A;  1TL3 A;  1SC3 B;  5HL7 Q;  4QU7 A;  3NAH A;  3NXZ A;  1RTZ A;  3RW7 A;  4ED7 A;  4NYO A;  2ZE2 A;  4BHQ A;  3MEG A;  1AW0 A;  4B3R F;  3EGZ A;  3IGY B;  4OYP A;  2CVI A;  8RUC A;  1NDK A;  4MKB A;  4HKQ A;  2IJF A;  1XR6 A;  3PJ9 A;  1OYD A;  4K2X A;  2JEJ A;  3PV8 A;  3W1Y C;  2GVD A;  2MQ8 A;  3IWN C;  2WVE A;  2IAJ A;  2D1G A;  3EVO A;  1UMJ A;  1OJ4 A;  5T7L A;  2YXL A;  4P9S A;  3BS9 A;  4AL5 A;  2ZDO A;  4HAC B;  4Y0F A;  2RIJ A;  1HNZ J;  4HH1 A;  1HNV B;  2HVI A;  3H40 A;  3VQS A;  4K4W A;  2GS8 A;  2PI5 A;  2MB0 B;  1O99 A;  2B3T B;  1U0H A;  3IAS 9;  3BDF A;  2HFV A;  3EX7 B;  1N36 J;  2IUC A;  1R8C A;  1FVQ A;  1CQN A;  1RSC A;  2ASY A;  3HPO A;  4C48 A;  1J5O A;  3WIU A;  3GU0 A;  2VG6 A;  2W4P A;  1UVI A;  2CPY A;  1RHQ B;  3TJA A;  2F8E X;  3AJ2 A;  3MEE B;  3JTP A;  3VAG A;  4C3L A;  2GJ2 A;  4KHM A;  4PYD A;  1U1K A;  1U1N A;  4RU9 A;  4MT1 A;  3N9U C;  2X1G A;  2CNO B;  3GTY X;  7AT1 B;  1N5T A;  3NOG A;  3AJ1 A;  2IMW P;  1U2C A;  1VIX A;  4CIO A;  1ED8 A;  5J2P A;  3LUY A;  1F9E B;  1RT2 B;  1U6F A;  2KT2 A;  1VQK S;  4YS2 A;  3N01 A;  3HM9 A;  4IG3 B;  2F5G A;  4YR0 A;  1HHQ A;  5HVF A;  3WDO A;  1SJ1 A;  1WHX A;  1SJ4 P;  5AE1 A;  1P6T A;  2V8D A;  1X31 C;  3PTW A;  4DSI A;  1YI2 S;  1OO0 B;  1FNM A;  2HND A;  1KVK A;  4PAB A;  3ZTS A;  1X4D A;  2XI3 A;  1J2V A;  4N77 A;  2Y8Y A;  1GFW B;  1DAR A;  2PEB A;  4DCO B;  3E01 A;  2C2R A;  2O66 A;  4FYW B;  4RNM A;  4ZP6 A;  5DO2 A;  2DHX A;  1TKX B;  4YEA A;  1PIL A;  2LFV A;  2HHP A;  4ZVS B;  3MK1 A;  4UUX A;  2P9E A;  1ROF A;  3NNH A;  3ZTR A;  1S5Z A;  5F8I A;  3VAF A;  4G3I A;  5TJ3 A;  4C8Z A;  5HQL A;  4YB1 P;  3LPE A;  3L09 A;  5IXU A;  5J2N B;  3WAV A;  2M9K A;  5DDR C;  1TK0 A;  1VIS A;  4OMF G;  1S7H A;  1OYE A;  3J7Z T;  4FPI A;  2ZWO A;  3T41 A;  3R1L A;  3DGV A;  3HD2 A;  3DLE A;  4FXW A;  4FF3 A;  4DR5 F;  2E29 A;  1ELX A;  2XBP A;  2DNR A;  5IM0 B;  3AOD A;  3TVK A;  5LSL A;  4WU3 A;  2OPP B;  3US5 A;  2FC8 A;  3MTJ A;  1RAJ A;  3JQK A;  3DN9 A;  4WP8 A;  4F8R A;  5IV4 A;  1YDL A;  3BPD A;  5AE2 A;  4DS4 A;  1N2K A;  1FK9 A;  2HZV A;  3M9O B;  1FNX H;  5F8L A;  1GNK A;  1U49 A;  1N5Y A;  1YVF A;  3PIP Q;  1GTH A;  1QSY A;  2W9C B;  3T1Y F;  1XN9 A;  4N7T A;  2XLJ A;  1BWV A;  5H9F J;  2ZZN A;  3EGV A;  5CQG A;  2P9C A;  1XBW A;  4BC9 A;  3R5C A;  2QC3 A;  4KJG A;  4HI1 A;  3DXB A;  1TL7 A;  2DNO A;  1MML A;  2QLX A;  4V1A k;  1QAY A;  1ACM B;  1M1G A;  5H9F K;  3MCM A;  1OY8 A;  2AJ0 A;  3OFH A;  1NK4 A;  5LXY A;  3KG4 A;  3PVX A;  4DPT A;  4ANE A;  4M94 A;  1TK8 A;  1S79 A;  1NK0 A;  3CCQ S;  2W2P P;  2YQ3 A;  5DDP C;  2GNK A;  4XDD A;  5EGY A;  1YG0 A;  2DVI A;  1RAG B;  3MMJ A;  4MK7 A;  4UQG A;  4DR3 F;  1K8A T;  4ZA1 A;  3CJ0 A;  1TVR A;  2XSJ B;  2WZ1 A;  4FNI A;  2OIH A;  1JLQ B;  3MMA B;  2MGZ A;  1T0T V;  2YWE A;  2ATL A;  1VQS A;  1VRT A;  1W2I A;  3VAL A;  4DFM A;  2Y0S D;  2RF2 B;  4DOZ A;  2IM1 A;  3QFW A;  2BE7 D;  2EC2 A;  1Z4U A;  4FF2 A;  3CD7 A;  1FXL A;  3PW0 A;  1B8J A;  4P2F A;  5JMN A;  2Z56 B;  5L1L A;  3HX9 A;  1ALK A;  5AXN A;  1CJU B;  3RRG A;  1SCJ B;  3GIK A;  1D0E A;  5C25 A;  4MKA A;  2YX7 A;  1HQE B;  4W90 B;  4LF1 A;  1KDN A;  5CHC B;  3BGL A;  2LMI A;  5KFZ A;  3ILL A;  1HI8 A;  1IJF B;  2R7Q A;  2X1A A;  1RBL A;  1Q0N A;  1Z2Z A;  4MYU A;  3V6D B;  3MM6 A;  2IDE A;  2GGP B;  1YJR A;  4GTW A;  3MFI A;  1X4F A;  2D41 A;  2QYC A;  1X4G A;  4LSL B;  2DCL A;  1R8P A;  3QFH A;  2LVW A;  4YB5 A;  4UF4 A;  2W5S A;  3NP5 A;  4WFB Q;  2DGO A;  2EFQ A;  3S8S A;  2CNL B;  2ZBC A;  5LRN A;  1RXO B;  1Y5N B;  5GAG U;  2DR7 A;  3WIV A;  4ICL A;  3AA8 A;  1VBX A;  2AP6 A;  2JLE A;  2PI4 A;  1NB2 A;  4M63 A;  3QJP A;  5MAO A;  4OHW A;  1HWU A;  2V50 A;  3MI7 X;  2JNJ A;  1HW9 A;  3ENA A;  5LSO A;  4LBH A;  2MYF A;  1JNZ B;  4Q45 A;  4IOB A;  2GV1 A;  2DR9 A;  4KO0 B;  2MQO A;  3Q8V A;  1VIO A;  1W2B R;  1YWX A;  2EK6 A;  2F3J A;  4L3N A;  3NS6 A;  3IM9 A;  2BZ2 A;  1AUD A;  1URB A;  4L75 A;  2RAQ A;  2BRK A;  1F1B B;  4M5N A;  4EO6 A;  1TV6 B;  4WYW A;  4K0K F;  2W7A A;  1S1X A;  1RAB B;  1S9E B;  2HQ3 A;  4OZN A;  2QE5 A;  4UOF A;  3AOA A;  4ZG9 A;  1G6B A;  3MR5 A;  1QSL A;  3J7Y I;  2W5T A;  3K2Y A;  2JVO A;  5DET A;  5KFB A;  4P74 A;  4O4R A;  1UW4 A;  4OZ5 A;  4ZVE A;  1U8S A;  3RGI A;  1DHM A;  1NSK L;  2M7S A;  3ILJ A;  4CI0 B;  4CP5 A;  3RAM A;  2XR9 A;  5KT2 A;  3GZ7 A;  3I4P A;  1P1L A;  4BWM A;  4B3R J;  2HRY A;  4OYX A;  1S9G B;  2DIT A;  4FYD A;  1IR0 A;  2RRN A;  3B82 A;  2HRT A;  3OJS A;  4ZVP B;  2YKQ A;  2C2E A;  1BE4 A;  3MR2 A;  2CXE A;  2A3J A;  1LXN A;  2M3D A;  1TZ0 A;  2XMW A;  3F56 A;  3HVT A;  2CPI A;  1OQ3 A;  4TYA A;  1N54 B;  4Y34 A;  1ULR A;  3NVL A;  4TU9 A;  4ID8 A;  4WP9 A;  5HLF B;  3FSI A;  2DNM A;  1V9O A;  2DNP A;  2YVS A;  3T6B A;  4KHP F;  2ZFH A;  2B9W A;  1Q7L B;  2DH9 A;  4CO4 A;  2VC1 A;  2W5R A;  2IPO B;  5CYM A;  1VBK A;  5DM6 Q;  4G1Q A;  3TZY A;  1ZM4 A;  1DTT B;  4Y65 A;  3T1A A;  2LU1 A;  4CLU A;  2W8K A;  4OHY A;  2OLW A;  1FDD A;  3JS9 A;  2RRB A;  2YKA A;  5HBM A;  3FDS A;  4R8U B;  1X60 A;  1B0P A;  5DS7 A;  1HA1 A;  4PXC A;  3K5M A;  1EKS A;  4ETX A;  2AW0 A;  1CJV A;  5LMN J;  2R8K A;  3PR5 B;  3T5H A;  5E2Q A;  1MLA A;  2AX1 A;  4ALZ A;  4PAA A;  2IFY A;  4F3M A;  2BAC A;  3AHP A;  2BKP A;  3SDE B;  3KLH B;  6AT1 B;  4J9K A;  3ZZ0 A;  4NA1 A;  2W9B B;  1S72 S;  4Y2M A;  4ZN1 A;  4UST A;  4ED2 A;  1VRU B;  2ZNY A;  1R31 A;  3FVY A;  3W9H A;  3KJN B;  3KYL A;  3EYZ A;  3KK2 B;  4J9P A;  2E7V A;  1FFG B;  2ZOG A;  3JYT A;  3M6U A;  1U1L A;  3AY0 A;  4ELU A;  1Y5L B;  1OY6 A;  2H51 B;  3R7N B;  3VAI A;  1T8E A;  1GEH A;  2FD2 A;  5EX3 A;  2PA3 A;  4CO0 A;  2DGQ A;  5D0R A;  1N48 A;  5D15 A;  3C19 A;  1N56 A;  1JXL A;  4DU8 A;  2YKO A;  3HT0 A;  3RU0 A;  2R2U A;  2RE1 A;  2OEK A;  1G7C B;  1YBA A;  2RU9 A;  3SSQ A;  2DO4 A;  2VFV A;  1RLD A;  2YNH A;  4QIE A;  4DI6 A;  3GPA A;  3OVS A;  2POK A;  4ZHR B;  4DFP A;  3UNG C;  4JB8 B;  2R42 A;  3KDN A;  3KWM A;  3GMG A;  5L1J A;  5HMY A;  4LQ9 A;  3EXY A;  4FYV B;  4QR0 A;  2K7K A;  3IWX A;  2H5I B;  1MRO A;  1UPP A;  4J9S A;  2A18 A;  4ZCI A;  5DLW A;  3FBE A;  1EJJ A;  3OTE A;  3UDC A;  3PRB A;  4DWI A;  1VYA A;  3RB0 A;  2MHE A;  1KHJ A;  4FN5 A;  5HAN A;  4KQZ A;  1AFJ A;  2KYZ A;  1WHY A;  1NJW A;  2VH7 A;  1O0P A;  5IQQ A;  3CED A;  2F9D A;  5A6W A;  4JV5 F;  3OSN A;  2BJD A;  3GR0 A;  4K4S A;  1QSS A;  2DCU B;  3RW6 A;  2VKR A;  4WXW A;  4N8N A;  1WI6 A;  3OFG A;  3T19 A;  2XS7 A;  1CC8 A;  4LMZ A;  4OYM A;  3H0P A;  1AB8 A;  2VOO A;  5KFY A;  4LRE A;  5CCL A;  1VQM S;  3TZX A;  2BMB A;  4TU7 A;  3TQ1 A;  1WOR A;  5LOQ A;  2CAD A;  1FKA F;  4HAC A;  1ALH A;  2MLY A;  1HNV A;  1HHS A;  2FJE B;  5E7O B;  3TZW A;  1MMD A;  4CM0 A;  4U67 Q;  2EPI A;  1YTY A;  1GX6 A;  4FDI A;  1RYS A;  2XC9 A;  1MW7 A;  1SHQ A;  2O1P A;  2NSB A;  1UCN A;  1XNR F;  1Y7P A;  5AXL A;  1PGZ A;  3L95 X;  3ZZT A;  1SVD A;  3HHN B;  1TUV A;  4DL0 C;  2BX6 A;  4B3T F;  3MK2 A;  2QYG A;  2HLU A;  2ZH3 A;  2KZM A;  2V2Z A;  1T05 B;  2CPH A;  3NKY A;  1WOO A;  3MEE A;  3HZE A;  2HHS A;  1SH0 A;  3UDE A;  3UCU P;  4DN9 A;  2BA9 A;  4CWB A;  5KG6 A;  3D0I E;  1CUL B;  4NLP A;  4EZ9 A;  4ZVR B;  3KHH A;  4ZCK A;  1LOU A;  4RKU C;  1CLF A;  5D4P A;  1MN9 A;  1N34 F;  1RT2 A;  4P52 A;  3GFH A;  4ED8 A;  1WAC A;  4IG3 A;  1RTI B;  4P2X A;  1SB6 A;  4O3Q A;  4MH8 A;  3MAA B;  2GA7 A;  2XO7 A;  2XMJ A;  4B9S A;  3FEZ A;  3QSI A;  2OML A;  1KHK A;  3CJT A;  3CCL S;  4WKY A;  1WOP A;  3BR8 A;  5GAD I;  2PFF B;  2QFJ A;  1B4S A;  1JLA B;  4OX8 A;  4Y28 C;  1RT3 B;  4ED3 A;  4X64 J;  1LWF B;  3Q2T C;  1KLN A;  3QBC A;  4LF9 J;  1KH7 A;  1TKX A;  4DMZ A;  2DHS A;  3Q22 A;  5U47 A;  3PW7 A;  2PC6 A;  1JMT A;  4JBC A;  4ID5 B;  5A6P A;  4MIB A;  3TA2 A;  2J9D E;  5HJY A;  4O44 A;  4P2S A;  4QIW D;  2OPS B;  2RH3 A;  3H2L A;  3R7B B;  3FCH A;  2FLN A;  3R97 A;  5I4M A;  1T3N A;  3SCJ E;  5J2N A;  2AU0 A;  3CSK A;  2Y3Y A;  4P2M A;  5HMX A;  1M5V C;  4OV1 A;  4TU8 A;  3CXC R;  5IM0 A;  1S6O A;  1NKB A;  5GAE I;  4F4X A;  4ZDN A;  5H9E J;  2OPP A;  3RBX A;  3ISN C;  2R2S A;  3QMQ A;  3X3U A;  1RZM A;  3HCX A;  1HWK A;  5H9E K;  3BV8 A;  4DJB A;  2WSF C;  2HRU A;  4QAX A;  1HQA A;  2HHT A;  4KFB B;  2D7S A;  1F9F A;  2HQF A;  3VGV A;  4K4Y A;  2ZKT A;  2DRB A;  3I9Z A;  2W9C A;  3TQE A;  2PT0 A;  5KFM A;  3MK0 A;  3TOQ A;  1Y00 A;  2O67 A;  4OI1 A;  3DOL B;  6FDR A;  3FGV A;  3P45 B;  1N0U A;  3I0S B;  3T6J A;  3A12 A;  3WBH A;  4OJ1 A;  3MGJ A;  1QTM A;  3EM1 A;  3SQG B;  1KRP A;  4FVC A;  1LV5 A;  4RW9 B;  2AHO B;  2ZH5 A;  2IIH A;  3F41 A;  1WEL A;  5E3R A;  3IC1 A;  2OPR B;  5IC4 B;  1CC7 A;  2J9C A;  1RKI A;  1GK8 A;  1OY9 A;  1IKW A;  3OSP A;  3H5Y A;  1F5C A;  2YY3 A;  4RNF A;  3NGR A;  2C1E B;  2GJI A;  4U8V A;  2C28 A;  2XSJ A;  1JLQ A;  2HIQ A;  3MMA A;  4I68 A;  1UJ4 A;  1V3S A;  2HGL A;  2VG7 B;  3AOC A;  5AJ9 A;  3HSG A;  4NXM F;  1DFD A;  2RF2 A;  2C2N A;  1APS A;  1YJW S;  3AD9 C;  1U6Z A;  4ZPB A;  3ET6 B;  4DCJ B;  3BH7 B;  4K4V A;  2VPX B;  5KFV A;  4ECU A;  1ZPW X;  3IN5 A;  3GON A;  5DLV A;  4P7V A;  1Y7A A;  3ITH B;  1HQE A;  1YHQ S;  1PKU A;  4O0I A;  1WC0 A;  3E51 A;  1U1O A;  5IFM A;  1KHV A;  1LEO A;  3UN3 A;  1VOM A;  4OI0 A;  2BW7 A;  4MY4 A;  3TO8 A;  3M2V B;  1RU2 A;  3MUV P;  3V6D A;  1QUV A;  2IA6 A;  2UXD F;  2GGP A;  4MMO A;  4LSL A;  2KDO A;  3VGU A;  2E66 A;  3KD8 A;  5THW A;  2XI2 A;  2ZM6 F;  4LVO P;  4DZ6 A;  5HMZ A;  4A4J A;  2DR8 A;  4F4Y A;  2AF6 A;  5DGA A;  4O0N A;  3EDQ B;  1AFI A;  4B02 A;  4DX5 A;  2A2D A;  1NLK L;  5KFW A;  5KG1 A;  3JSR A;  2CJB A;  3M8Y A;  3IBF B;  4EU0 A;  2OH2 A;  5GRR A;  5CAA A;  4ZLP A;  4CO5 A;  4CO2 A;  4QU6 A;  3H4B A;  3FEX B;  3E3X A;  3IGV A;  4IOC Q;  4KO0 A;  3VR1 A;  2FVS A;  2MLZ A;  1Z2L A;  5LMU F;  4NXN F;  1HWL A;  5ETP A;  3DLB A;  4B08 A;  4NX9 A;  3THV A;  1B0T A;  3H59 A;  2F4V F;  4QWC A;  3NKP A;  2R7X A;  4USV A;  1ZA1 B;  3UN5 A;  1UJ5 A;  4QBU A;  1TV6 A;  4USI A;  5K8O A;  4DR1 F;  1HYS A;  3QYY A;  1S9E A;  4LF4 F;  3D6F B;  2NXU A;  2ROG A;  1RAO A;  1RWK B;  3ZXW A;  3TEH B;  4UTG A;  3I31 A;  3V4M A;  2W8S A;  4XK8 C;  4E98 A;  3PFE A;  2YQ1 A;  2MZT A;  3MPV A;  2HFN A;  4JV5 J;  2DH7 A;  1RT6 B;  2YWH A;  3GJT B;  1S9G A;  4KJD A;  4B9T A;  3EXC X;  3QT7 A;  3LQV A;  3W5X A;  1QD1 A;  5AXM A;  3CJR A;  2HFZ A;  4MK8 A;  2XZD B;  3T9Z A;  1TL1 B;  3KLE B;  3A52 A;  1Q8K A;  3EVM A;  4QYR A;  1S7I A;  4WFX A;  3KMS A;  4GC6 A;  3CCE S;  1GX5 A;  3M30 B;  4USW A;  5CXT A;  1TAU A;  1RCO B;  2IM2 A;  2RNE A;  5HLF A;  1X4H A;  1SJF A;  2A6M A;  4C9D A;  4KKO B;  2E1R A;  1KHN A;  3D6T B;  4EBE A;  1WDT A;  2C42 A;  4NZ7 A;  4A8O A;  5EUH A;  5KG0 A;  1RYR A;  3R5B A;  2BM0 A;  3P8B B;  5M2U A;  4ZLL A;  1RT1 B;  2DHG A;  3B4M A;  5E41 A;  1DTT A;  4ZVQ B;  4Q2M A;  2ZH4 A;  3B78 A;  4PZV A;  1K1S A;  4OYZ A;  1QJH A;  4RW8 B;  3BKT A;  4B3T J;  2YNF B;  4M5I A;  2VQF F;  4Y00 A;  2IHR 1;  1X9M A;  4R8U A;  2HLT A;  4Q8E A;  1EW8 A;  1SKR A;  5C7P A;  2AIR B;  3LO3 A;  2B8Q A;  3RRH A;  3UCG A;  4KM4 A;  2V69 A;  2W5V A;  1UEK A;  1HBN B;  3R5D A;  1P27 B;  1N34 J;  1W7W A;  3SDE A;  3KLH A;  4N47 A;  7FDR A;  2W9B A;  3I4H X;  3QID A;  4OZ2 A;  2VJU A;  1VRU A;  1VQ6 S;  4NLY A;  3WZ0 A;  1WOS A;  3KK2 A;  4GRS A;  1N2L A;  2H3E B;  2OHD A;  3EMT A;  5LL6 d;  1WD6 A;  3W5Y A;  1N0V C;  2XS5 A;  4R5P B;  3NGT A;  2LXF A;  4MIA A;  3BBC A;  1JNR B;  3TVZ A;  2W7P A;  3CCV S;  4A8W A;  2HGN A;  1KVI A;  2M88 A;  1NZA A;  3PIO Q;  4NEY A;  5EWG A;  1T9W A;  4IFV B;  2NXN A;  3H2U B;  3DOK B;  4USJ C;  3FZ2 A;  1YRX A;  1O5J A;  3Q8P B;  3LP2 B;  5DM7 Q;  1RWN B;  1N52 B;  3CDE A;  2B5J B;  2B51 A;  3PKM A;  3NS5 A;  2LCW A;  2UZA A;  4ZHR A;  3PG9 A;  2JLF A;  5LQQ A;  5KXA A;  4UOG A;  4ZG7 A;  3QZ7 A;  3G4S S;  1K1Q A;  2VFU A;  4PG4 A;  3R8Y A;  4PQA A;  1HQU B;  3OL6 A;  4A8K A;  3QWU A;  3HLU A;  3H5S A;  1RQ0 A;  4KHR A;  1JLB B;  3OFE A;  3B5Q A;  4OYI A;  3WC2 A;  1VR6 A;  3V81 B;  2ASL A;  2Q79 A;  5ITH A;  2OTJ S;  4LVN P;  4A47 A;  2NUU G;  4J9U E;  2BQU A;  5L1I A;  3Q0A A;  1BQX A;  1ZAX A;  4OX6 A;  4LRA A;  4DU7 A;  1M1H A;  4KGX B;  2DYA A;  1HBU B;  3W2V B;  1Q95 G;  3MEC B;  4WP3 A;  5IS2 A;  4GO7 X;  4ER8 A;  1YJU A;  1IKV B;  2MKK A;  2U2F A;  4PQU B;  5D4O A;  4CQ1 A;  3T02 A;  3A8E A;  1FKP B;  3NRB A;  4YDX A;  1UP1 A;  4CLF A;  3FK4 A;  5HK4 A;  2Z2Z A;  3B4D A;  3PJW A;  1H72 C;  1GT8 A;  1ZAV A;  2FZK B;  2BE2 B;  4Y2K A;  2FVC A;  3JAM U;  2JZ5 A;  3LW5 C;  1N5S A;  2D9P A;  2V34 A;  3PX0 A;  5F8N A;  1RA7 A;  3VVT A;  4OHZ A;  4ECS A;  2MDA A;  5B0F A;  4NLR A;  3RBZ A;  1LK7 A;  4NXM J;  3T1H F;  5D0H A;  1Q7Y T;  2LU2 A;  3JAM Y;  1K47 A;  4RPF A;  2VC0 A;  4M1K A;  4NLS A;  2Q66 A;  2XMT A;  1AJD A;  4A48 A;  2LEC A;  2VPZ B;  5D77 A;  1T05 A;  3QGG A;  4YB7 A;  1WI8 A;  3NEK A;  1XMQ F;  5KFS A;  4BC7 A;  1RT5 B;  3SCL E;  4IYQ A;  2V5H G;  3QGP A;  3DRR B;  1PSD A;  1FKO B;  2DPJ A;  2ZZM A;  1CUL A;  2UUC F;  5ETN A;  1F2H A;  3GLJ A;  3CD5 A;  3QRR A;  1KFS A;  2W4C A;  3HVA A;  2IRY A;  2MMY A;  2YX1 A;  2VF3 A;  4JI3 F;  9RUB A;  2E1C A;  3MF5 A;  4FF1 A;  5ETV A;  1WNE A;  1RTI A;  5F3T A;  4K7Q A;  3MAA A;  3IR6 B;  1S99 A;  2JX2 A;  1ZTT A;  5GMD A;  2ZBQ A;  3HFZ B;  5IOL A;  1HMV B;  2KB2 A;  2GSN A;  1JLA A;  1RT3 A;  3BBB A;  2YKM B;  2CJK A;  1FER A;  1FJ7 A;  1RTD B;  2ZEJ A;  5HO4 A;  4CYR A;  4LR9 A;  4C0H A;  1S1W B;  1S6Q B;  4ID5 A;  2E1P A;  2OPS A;  2COL A;  5LXR A;  2HS4 A;  5LMU J;  1IJE B;  2AX0 A;  4NXN J;  2DXD A;  2F4V J;  3O8W A;  2BAN B;  3DDI A;  2ZHO A;  1WDD A;  5A8K B;  2DHA A;  4QIV A;  5IJS A;  1HBO B;  3HHD A;  3ZTP A;  2VIH A;  4OLP A;  3OW2 R;  2D1C A;  5IC6 B;  1NJI T;  1PYS B;  5L0B A;  2CQD A;  2DBB A;  4CNZ A;  4DV1 J;  1JXE A;  4JI5 F;  3PY8 A;  1LFP A;  3IA0 A;  3UD3 P;  1Y11 A;  2DK2 A;  1A6L A;  2RT3 A;  3HD1 A;  4MJK A;  4MYT A;  1MNE A;  1SL2 A;  1S6U A;  4PWD A;  1NRK A;  3ZNJ 1;  4J9Q A;  4F4K A;  1TP7 A;  4ZCM A;  3BZQ A;  4YB6 A;  4PG7 A;  3LOU A;  2XMM A;  4ZCL A;  4CZC A;  3DOL A;  2KN4 A;  3HHL D;  1DLO B;  3I0S A;  3MM7 B;  3T3F A;  2VG5 B;  4C8Y A;  1ZZF A;  3FZB A;  2OGU A;  3SQG A;  2XO6 A;  1U0S A;  1ZEB A;  3GP9 A;  4RW9 A;  3ZZR A;  1T9V A;  1WC3 A;  2G0C A;  4DFJ A;  5DRK A;  4Q8F A;  2JLG A;  2KRR A;  4BLG A;  4HT5 A;  2OPR A;  3PR4 A;  2ASD A;  2JEG A;  4USM A;  3J7Y U;  4FNH A;  4NMX A;  3WC0 A;  5LJ5 Y;  2DGT A;  3EGW B;  1IR2 A;  3TX0 A;  1WJ9 A;  2NCK L;  4F25 A;  2IM3 A;  3CMQ A;  4FDJ A;  3M6W A;  3G8Q A;  2KYX A;  4RWW A;  2R8J A;  2VG7 A;  5ETS A;  1SJQ A;  2R9L A;  3NKR A;  2G4B A;  3VQT A;  1D9F A;  3BYP A;  3SFG A;  4LRF A;  2LYV A;  2HW3 A;  4HT7 A;  4YHH F;  4IRD A;  2FGC A;  3Q8R B;  2WCX A;  2VQF J;  1EAR A;  2CQI A;  4QW8 A;  4X4Q A;  3EWG A;  1VI7 A;  3BGU A;  4JI4 F;  1G3O A;  4ENO A;  3HFV A;  4U96 A;  3ITH A;  2IM0 A;  1PJ6 A;  2IC3 B;  1JLF B;  3OUY B;  4O3S A;  2FC9 A;  4ZPV R;  1T9U A;  4P10 A;  2HK3 A;  3M2V A;  2H1Y A;  1RBA A;  5IT0 A;  5HN0 A;  2PEH A;  4DR4 F;  1K0V A;  1M5H A;  3N5F A;  3GQC A;  3R1H A;  3TYT A;  1VQY A;  3NMR A;  3G6V A;  1AXQ A;  3MPD A;  3AT1 B;  2WSC C;  2GW8 A;  4C0B A;  3C2P A;  1QDU B;  3JXO A;  4X4S A;  3QWP A;  1ZET A;  4WIQ A;  4F36 A;  4CH0 S;  2LQ5 A;  3WBZ A;  1N6Q B;  4B9U A;  2Y1J A;  3MD3 A;  5KFC A;  2EKY A;  5GOV A;  4RNH A;  2JDJ A;  1L5U A;  1PIE A;  4K4T A;  3D6M B;  3MM8 B;  3GG0 A;  2BUN A;  3MPU B;  5HAT A;  3LAK A;  4OHX A;  2IJR A;  2HHH J;  4MKY A;  2FVP A;  3HDS A;  4JOU A;  1GXL A;  2CPD A;  2GAG C;  2EVZ A;  2V4Q A;  2XY7 A;  1REV B;  1RBO B;  1D09 B;  2PDA A;  3GG1 A;  3KLG B;  2GML A;  2BQ3 A;  3K58 A;  2W4D A;  5A8R B;  5KFP A;  3DC2 A;  3CCM S;  1REG X;  5F41 A;  3GV5 B;  2V9W A;  3EZ5 A;  4LR2 A;  1QAI A;  3UR3 C;  5CD4 H;  3K89 A;  4ZVG A;  2NQP A;  2K3K A;  5JXS A;  1KC8 T;  3D7S B;  2AQ4 A;  3BH6 B;  2GA3 A;  1E1Z P;  4RBU A;  3OFF A;  3BSC A;  1EQJ A;  3CJ5 A;  2BBE A;  1T94 A;  4TY9 A;  1TK5 A;  4Q2L A;  4KY3 A;  3ZZZ A;  3W8P A;  1NHV A;  2LA6 A;  4IH7 A;  3D2W A;  3BJY A;  2IFX A;  4O3P A;  1RT6 A;  1UVM A;  1XMB A;  2V8G A;  3BYR A;  1AZS B;  2MZS A;  3W8G A;  3A3N B;  3K17 A;  4B9N A;  1KOH A;  2AGO A;  3MXH P;  2KL8 A;  1N4L A;  1Y3J A;  1JXV A;  4WXO A;  1TL1 A;  1HPZ B;  2NS1 B;  4J9R A;  1E6Y B;  3TA1 A;  5HI7 A;  3CW2 C;  3M30 A;  3ETO A;  1AJC A;  2WBM A;  2UUT A;  4I2Q B;  4EGL A;  2EC0 A;  1EQM A;  4C11 B;  3I56 S;  1V3R A;  1W25 A;  1RWM B;  2HNY B;  3EIC A;  4KKO A;  2L9N A;  2EBE A;  5L0K A;  1HNZ F;  1DQA A;  2FIU A;  4PPZ A;  1JJ2 R;  1XR5 A;  4C6A A;  4HTJ A;  2AJQ A;  3N0V A;  2GHW A;  3R6G B;  1VLY A;  1E6V B;  1OQ6 A;  3TUP A;  3IRX B;  1RT1 A;  1EZZ B;  3T1H J;  1F3V A;  4WU2 A;  4WK3 A;  5CYQ B;  1OSD A;  4O4G B;  1N36 F;  4RW8 A;  2BJ7 A;  2YNF A;  2YWG A;  2BJ9 A;  1YLX A;  3PEH A;  1KHL A;  1FXR A;  2ZWP A;  4Z2X A;  1CJK B;  1C4A A;  1XMQ J;  3HHL B;  2V8P A;  2FLP A;  1PYT A;  5KFF A;  1GMW A;  3SZY A;  4UY8 5;  2KXF A;  3HF5 A;  1LQ9 A;  4NE9 C;  2UUC J;  2R7V A;  4S0M A;  1HBN A;  1OSC A;  1OPI A;  3PNI A;  5KG4 A;  4C7Q A;  3TI0 A;  1WTF A;  1IKX B;  4XTT A;  3WHI A;  3W9J A;  1VQO S;  3R2C J;  3GYN A;  4JI3 J;  4WF9 Q;  1WEZ A;  2BRL A;  2J0X A;  4PYA A;  1RLC L;  1U4B A;  2BEF A;  4WCE Q;  5JVG Q;  5FII A;  3R27 A;  5CD4 A;  3PO5 A;  3BQ0 A;  2DNK A;  4DZD A;  4G1I A;  3WAX A;  1X5S A;  2GSO A;  2QSF A;  3GE9 A;  3QGH A;  4R5P A;  3MED B;  2B7C B;  1ELZ A;  3R6L B;  2FJB B;  2HQC A;  2Z58 B;  4IH5 A;  3VAH A;  2ZVS A;  4IO9 Q;  1V5I B;  4IFV A;  3DOK A;  2M70 A;  2X7I A;  2MPU A;  2XNQ A;  4CLS A;  4AQY F;  2ZBI A;  4TXS A;  1ARO P;  5BR8 J;  3LP2 A;  5F3Z A;  2B5J A;  2OAU A;  5L8R C;  5C66 A;  1BD6 A;  1AUS L;  4H4O A;  2NSC A;  5KT6 A;  2CPZ A;  2ZUG A;  1GAO A;  1RDR A;  2DR6 A;  2ZIT A;  1TR0 A;  4A8F A;  3MFH A;  2BOA A;  3MPY A;  2GCF A;  4NML A;  3KG0 A;  2V67 A;  3O5T B;  3ZTO A;  5B0G A;  2BJE A;  3LWM A;  3NCR A;  3IG1 B;  1HQU A;  2ZUA A;  4ECT A;  3IRW P;  4J9N A;  1RB0 A;  1JLB A;  5GAD U;  2J7K A;  1VRQ C;  3AOB A;  4CLL A;  3I0R B;  3J80 U;  1MN7 A;  4PXB A;  2QLB B;  5D0G A;  1A9N B;  3V81 A;  3MWB A;  2D74 B;  3AAW B;  2CJ9 A;  4WZQ A;  4UOC A;  1F6T A;  1HHT P;  4WPA A;  4GO5 X;  1RWU A;  1VBY A;  1TFY A;  1LWC B;  2FQQ B;  2G13 A;  3W65 A;  4Y2I A;  3P5T L;  1RHR B;  3J80 Y;  1T03 B;  1FJC A;  4CXS A;  2W8L A;  1KH4 A;  3HSD A;  1FRL A;  4H4M A;  1HBU A;  2QIF A;  3W2V A;  3MEC A;  4FDF A;  2B9E A;  1IKV A;  4X4V A;  3TA0 A;  2QTW A;  3M8W A;  1YIT S;  4PQU A;  1FKP A;  1NXI A;  3BBF A;  7FD1 A;  1VQN S;  2CDR B;  3FSX A;  3HHE A;  2EFG A;  3WQP A;  4RL1 A;  4K8R A;  4NLQ A;  3NNC A;  2HWI A;  4AXJ A;  3RAQ A;  2BE2 A;  3THP A;  4YUD A;  5KFG A;  2IRU A;  4N56 A;  2YNI B;  4EUV A;  5K5M A;  1HBM B;  1LWE B;  3GIL A;  2J8A A;  4BS2 A;  2OD4 A;  4LBP A;  4NAS A;  3NGD A;  3PO4 A;  2IVF B;  2HGM A;  3H42 A;  1TTH B;  4HTI A;  2E9R X;  2XHW A;  3GYX B;  4F7V A;  4YHH J;  1EB0 A;  2JEI A;  1XC9 A;  3KHG A;  3VGT A;  2Z2Y B;  4DR6 J;  1SIZ A;  3LAN A;  4JYA J;  2RIL A;  1ZBT A;  2ZKU A;  3KJV B;  4JI4 J;  1G4C A;  4RUB A;  4USH A;  1RT5 A;  4AYB D;  1UET A;  5KFL A;  5B0B A;  3HZG A;  3DRR A;  2MKI A;  1TEL A;  2VBY A;  1FKO A;  5KOX A;  4WYL A;  1PJ5 A;  2CKW A;  4ETZ A;  1VHF A;  3LWL A;  5ETO A;  4ES2 A;  5I42 B;  2N4C A;  4DR4 J;  1ANI A;  2DNG A;  4AE5 A;  1Q16 B;  3DLG B;  4DV3 F;  1X4E A;  4LF8 F;  1NDP A;  2A0F B;  1C1C A;  1ZA2 B;  5L9X A;  4ED1 A;  2YNG B;  2APO A;  1NH8 A;  2CZ9 A;  2HQI A;  5B09 A;  1HMV A;  2EFV A;  4Q0B B;  4DL7 A;  1SL0 A;  2RH6 A;  3W64 A;  2YKM A;  4J7C A;  4NZ6 A;  2F40 A;  5K20 B;  1RTD A;  2OEJ A;  1U1M A;  4USK A;  1SH2 A;  3MUR P;  5B0E A;  3EVW A;  1S1W A;  1S6Q A;  4KC5 A;  3MCS A;  3CGI A;  5HMW A;  4J91 A;  2JSX A;  3OTD A;  2O5D A;  4ZP8 A;  3N28 A;  3U7J A;  4WFZ A;  1U02 A;  2R8G A;  2QL9 B;  1WHW A;  2BAN A;  3MM9 B;  5A8K A;  2XY5 A;  2R3V A;  5D0E A;  3DRS B;  3TAQ A;  2QFI A;  3FJ2 A;  1URA A;  4ED4 A;  3PW4 A;  1RWO B;  1GMU A;  1HBO A;  2Y1R I;  1FVS A;  3BN4 A;  1RAD B;  1NK6 A;  4F2R A;  1IBK J;  1RGV A;  1YIJ S;  2AJ1 A;  2OD6 A;  3T01 A;  5G0R B;  3G9C A;  3G6X A;  3BO4 A;  4TLR A;  2DD8 S;  2KVI A;  3CD6 S;  1HI0 P;  4KB7 A;  4F67 A;  5FJ4 A;  3UVJ B;  5I3P A;  2LLZ A;  5I3U B;  1S1T B;  3IDD A;  2QL5 B;  2Y1L B;  3CJS A;  3NG8 A;  1Q86 T;  4MIW A;  2AJ2 A;  4WWS A;  2ZH7 A;  2FHM A;  1IBC B;  3E2E A;  3CO9 A;  1C0U B;  1DLO A;  2JFD A;  3C3L A;  3MM7 A;  2VG5 A;  2MKS A;  3NKO A;  2G2Y A;  5KT7 A;  1UZH A;  2I2Y A;  4OJH A;  2FLL A;  1H74 A;  2XMK A;  3LAM A;  4NLG A;  4M95 A;  3HHL C;  4JP8 A;  2X3G A;  2I0X A;  1HFE L;  4J9O A;  4DSL A;  3FRY A;  1LKZ A;  4KJI A;  1JWW A;  1RAA B;  2YPY A;  1YRU A;  1KQS R;  3M32 B;  2VA2 A;  5E3C A;  5EDW A;  3G71 S;  4A8S A;  3DDN A;  5DG9 A;  2XTJ P;  4A8X A;  1I94 F;  3GIJ A;  1IQZ A;  3KK3 B;  5FD1 A;  2C3O A;  2HMI B;  4MKV A;  1C2P A;  4DPU A;  3R2D J;  1BQM B;  3GR1 A;  1RA6 A;  3FRZ A;  4P6Q A;  3JB9 k;  4PRF A;  2VUG A;  3BDG B;  5KFN A;  3I82 A;  2G1H A;  3OT9 A;  2IC3 A;  1JLF A;  4FBU A;  4CXK A;  4ZPC A;  4E0D A;  3OUY A;  1UVK A;  5F8H A;  3HT3 A;  4M5D B;  2EBG A;  3BPS P;  2OSQ A;  5LMN F;  5GMK a;  4NCG B;  3G87 A;  2HPU A;  2AGP A;  3BKU A;  1IXK A;  1KP6 A;  1N32 J;  2MKC A;  4ERD A;  3CF5 Q;  3RR8 A;  1EAY C;  2OKQ A;  2LQB A;  2R4F A;  2IBK A;  1MWQ A;  5CYJ A;  4ATN A;  3HO1 A;  2HFU A;  1F3F A;  4RO0 A;  4X4U A;  2FPH X;  4C8O A;  3AJD A;  1CPZ A;  2EXU A;  1N6Q A;  5IV3 A;  2SXL A;  3EDR B;  2E5L F;  2F8M A;  2I6W A;  2WRM A;  4Y2A A;  1B64 A;  3T5J A;  4DL2 A;  4AD6 A;  2VD3 A;  1YJ9 S;  3L9Z A;  3MM8 A;  2BKN A;  2PII A;  3AH6 A;  1E33 P;  3I9V 9;  4F02 A;  4AQY J;  3CC2 S;  3KFW X;  3HK2 A;  4KT0 C;  3NWR A;  3FUY A;  3CCS S;  5E3P A;  3QLH B;  1FDA A;  1REV A;  2KM8 B;  4DPX A;  1R8H A;  1HI1 A;  4YME A;  3SZ2 A;  3KLG A;  3IM8 A;  2X3D A;  5A8R A;  2R8I A;  4QQB A;  1RCX B;  4LIR A;  4TNO A;  3ISN D;  3KOA A;  3NNA A;  4NLO A;  2VDH A;  2RQC A;  3D1O A;  4DSJ A;  2C3U A;  4FVM A;  4I6Y A;  3BF4 A;  2AYE A;  3DLL Q;  3ZO7 A;  1NDL A;  4GKK F;  4IG0 B;  3OHB A;  2GX8 A;  4M5J A;  4OI6 A;  3D1H A;  4RUH A;  4W92 B;  4BWJ A;  4DSE A;  1VMB A;  2DHH A;  2GIQ A;  2WON B;  2ZNZ A;  1ANJ A;  8AT1 B;  3TJ8 A;  3IWL A;  4RLE A;  5DJB A;  4OI4 A;  4WTO B;  4X84 A;  1CQM A;  3KK1 B;  2JC1 A;  2RU3 A;  1AZS A;  2H54 B;  1GMV A;  4F4A A;  4A46 A;  4TN0 A;  2KFZ A;  1QUP A;  4ZMM A;  3LF0 A;  2HZC A;  5LIA A;  3GJR B;  1HPZ A;  1ZZN A;  2ZZT A;  1E6Y A;  4TY8 B;  3WX4 A;  3FCV A;  3HVW A;  2FUG 9;  3CC7 S;  5IZH A;  4I2Q A;  4I1T A;  2MZJ A;  4C11 A;  3KHL A;  4CCH A;  4NZ0 A;  2PN6 A;  2FYX A;  3A8K A;  1F60 B;  2E7X A;  3P3D A;  3SV4 A;  2HNY A;  3HSZ A;  4Z7C A;  5DG7 A;  5E0O A;  1IWA A;  1S4F A;  3RBE A;  3SCI E;  1KN6 A;  4KH1 B;  1VJW A;  4QW9 A;  3BQ1 A;  2CWX A;  1E6V A;  1WUU A;  4KGZ B;  3IRX A;  2N4D A;  2W1B A;  1SKW A;  1YJN S;  1U25 A;  1WF2 A;  4ILR A;  4OJG A;  5CYQ A;  4O4G A;  2MQN A;  1FRK A;  2DNN A;  2RUG A;  2O3D A;  1NB7 A;  5F0U A;  1X9W A;  1FJE B;  2BV3 A;  1HDH A;  2J7W A;  1CJK A;  3HHL A;  3OXF A;  4EYH B;  4B3M F;  3DLK B;  1RT7 B;  4I6A A;  4RWX A;  1VQ8 S;  3CD0 A;  1SQG A;  1JB0 C;  3DRP B;  3HI9 A;  2XGQ A;  1IKX A;  4EMD A;  3HMJ G;  3MTK A;  1BWE A;  2RSQ A;  3OD2 A;  1VC6 A;  2E9T A;  1ZYQ A;  1Q8I A;  1T3O A;  4DG1 B;  4DV3 J;  4LF8 J;  2WVC A;  3C15 B;  2YPZ A;  3KKF A;  2W2Q P;  4DQR A;  1RAC B;  2B7B B;  3CCW A;  5F9L A;  2W24 A;  4TN2 A;  4URG A;  4KE5 A;  1B7F A;  1BY9 A;  2ZJR Q;  3MED A;  2HAF A;  4CDI A;  2XMU A;  2G0J A;  3HJF A;  5ETL A;  4FS2 A;  2VV5 A;  2BQR A;  3Q23 A;  4X64 F;  2N7C A;  1EI6 A;  4LF9 F;  1OS5 A;  4DV2 F;  4C98 A;  3KLI B;  2V8H A;  3M8Q B;  2KT3 A;  4U7C A;  4M5M A;  5KTQ A;  3D0G E;  4P75 A;  3MR3 A;  4OYA A;  5KFT A;  2RD5 C;  2PE8 A;  1B7Y B;  2NYI A;  3WX8 A;  3VHQ A;  1WEY A;  4DR7 J;  5DDQ C;  4WFY A;  2A10 A;  2UUB F;  1A0O B;  2WVD A;  3UDL A;  3OL8 A;  2VZ9 A;  4UPH A;  3MUM P;  3VV2 B;  2QLJ B;  3J81 j;  1RTJ B;  3OR2 B;  3IG1 A;  4ZKA A;  4AXI A;  2F7V A;  3AXM A;  1U45 A;  2UU9 J;  2M8H A;  2VPW B;  1VQ5 S;  1WC5 A;  3I0R A;  3H7H B;  3UW1 A;  1WKK A;  1X4C A;  3A8J A;  1U47 A;  1U8W A;  2IRX A;  4K5R A;  3VVU A;  4PKD B;  4R0J A;  3V6K A;  1RHM B;  2CQG A;  1ZED A;  2EW9 A;  1PBA A;  1QM9 A;  2MZ1 A;  1RWX B;  3LP1 B;  2QZ8 A;  1LWC A;  4C2M A;  5FDL B;  4B9V A;  3BGR B;  2DNL A;  2J0S D;  4F0K A;  1FT8 A;  4TQS A;  2J6T A;  4ZG6 A;  1ZEF A;  2CQ3 A;  3TAR A;  2A1B A;  4OFZ A;  2VAS A;  2HWT A;  1QLN A;  4PPD A;  2HBZ B;  1T02 A;  1S0N A;  1FFW B;  2V63 A;  4NLD A;  2ATC B;  2YNI A;  4KAI A;  1B99 A;  3DGP B;  1H3D A;  5E33 A;  3G6Y A;  1HBM A;  3KUH A;  1LWE A;  3JTN A;  1X8D A;  4WII A;  4URQ U;  2OJ3 A;  1M0S A;  4PEO A;  5DLG A;  4QZV B;  1I94 J;  1H2U X;  3GYG A;  5AJ3 J;  4G6V B;  2QG9 B;  4KH0 B;  2Y0B B;  2UP1 A;  5B0A A;  1RJJ A;  1RUS A;  2RKI B;  2I8E A;  2V8V A;  3EJM A;  3OPK A;  1UWB A;  3KJV A;  3IO1 A;  2WW4 A;  1R8A A;  3VAJ A;  2LA4 A;  4JI6 J;  3D1Q A;  3CJ3 A;  1NPP A;  2AZ3 A;  2DJW A;  2W2M P;  3T5K A;  2KHD A;  5HRT A;  4QIG A;  3IS9 B;  1VGY A;  2DNH A;  5I42 A;  2G9Y A;  3J81 U;  1EP4 B;  4C4W A;  3BSO A;  1VK8 A;  3NL0 A;  3M2U B;  3A1Y G;  3CMR A;  2RS2 A;  3OTO J;  1ZOT A;  1KH5 A;  3DLG A;  3F0N A;  4NPO A;  3PDN A;  1FRI A;  4DX7 A;  3M9M B;  2QMU B;  2Q3P A;  1TFW A;  2KM8 C;  4NYP A;  2YNG A;  2AEF A;  3J81 Y;  4OX9 F;  1IM4 A;  3RRK A;  3D28 A;  2OFH X;  3MR7 A;  2E5L J;  4Q0B A;  2V4R A;  2CRL A;  2B0G A;  5KAK A;  5D78 A;  1FTR A;  3JSB A;  4KAV A;  2ACM A;  3L3C A;  4UOH A;  2HBR B;  3LAL A;  2GO8 A;  3CE8 A;  1NJY A;  1YZ7 A;  1N5V A;  3O2I A;  4NRU A;  5BYS A;  4DSF A;  3SCK E;  3ZZU A;  3QQC D;  2D3Z A;  3IMQ J;  3KHR A;  1U6B A;  1LW0 B;  3MM9 A;  3D4J A;  5AXK A;  1X7V A;  2K06 A;  5E5N A;  3DRS A;  3QPI A;  2CPX A;  3X1L B;  2CQC A;  3MEK A;  1UFL A;  2GZO A;  4GKK J;  3VF0 B;  5IT9 Y;  4ZOS A;  1ZM2 A;  4DV0 F;  4GC7 A;  1WKJ A;  5G0R A;  4NYZ A;  4UW2 A;  1CVJ A;  4C3K A;  2X98 A;  1Y5I B;  3ULH A;  3MOJ B;  2MKY A;  2WB4 A;  3PYD A;  2P8I A;  5A76 A;  1X5O A;  4CYU B;  1EX8 A;  5K8N A;  3UVJ A;  5J1P A;  5I3U A;  1S1T A;  3BDH A;  4OJ3 A;  2ACY A;  1SQE A;  5KG5 A;  3BQ2 A;  1NKC A;  2J6U A;  2BDP A;  3RG6 A;  5K4P A;  2E1A A;  1ZM9 A;  1NUE A;  1C0U A;  1X9S A;  3GIM A;  3GSI A;  4UY8 T;  3IGN A;  2D69 A;  3IXQ A;  4XIU A;  2LXU A;  2OUG A;  4DCP B;  5KG2 A;  2ZC4 A;  1H7W A;  3HVR A;  4OX7 A;  4C8N A;  5J2Q B;  1FX4 A;  1Q1K A;  5C24 B;  2FDN A;  1GQE A;  4NI2 B;  3C46 A;  4OI2 A;  2RDI A;  2UVU A;  2GAH C;  2RS8 A;  1JLC B;  3PRV A;  1PJ7 A;  3R7S B;  1SC1 B;  4RNO A;  3M32 A;  2ANH A;  2OFG X;  4EZ6 A;  3TAM B;  3M6X A;  4UT4 A;  3KK3 A;  3HP6 A;  1DAX A;  2HMI A;  3JTO A;  4I2P B;  4ZJO A;  1BQM A;  4JI2 F;  4IH6 A;  1IBL J;  2HSE B;  5KT4 A;  2HIY A;  1S59 A;  4CM2 A;  1NU4 A;  3BDG A;  1IM6 A;  1SC6 A;  4U6P A;  4DN0 A;  3R9L A;  3QJJ A;  3NGS A;  4B3M J;  4ELT A;  3Q83 A;  5C42 B;  3A4T A;  1CG2 A;  4U95 A;  3M6V A;  4QPX A;  3TAP A;  4M5D A;  3C6T B;  1KS2 A;  3TUJ C;  3Q24 A;  3DM2 B;  4NCG A;  4HHU A;  3UWT A;  1R3N A;  2QSW A;  3K8W A;  1EJ7 L;  3I6P A;  2L9D A;  3NLC A;  3L7U A;  5HJX A;  5KFA A;  2VBX A;  4J90 A;  2F1F A;  4LR8 A;  2P9G A;  2DY1 A;  1JIH A;  4YQW A;  2U1A A;  2AEJ A;  2IA0 A;  4WKR A;  5KG7 A;  1JLG B;  2NRE A;  1UAW A;  1KEK A;  3PKY A;  2OP5 A;  2JJ4 D;  1VQP S;  3FBB A;  2MQL A;  1FI4 A;  3TUZ C;  4DV2 J;  3PW2 A;  3PCO B;  2QA4 G;  4B9M A;  4F3O A;  3LP0 B;  3RR7 A;  3QLH A;  5EHH A;  3W63 A;  3AD7 C;  3NGU A;  4OZ1 A;  1BC6 A;  2FJA B;  4RJV A;  1LWX A;  3CDA A;  5GAH U;  4YDD B;  2UUB J;  2NPF A;  4I67 A;  4F04 B;  2LQ9 A;  3QT8 A;  2J0Q D;  2ALY B;  1HW8 A;  2JHE A;  3BKF A;  1M5P C;  3DMJ B;  1RK8 A;  4DF4 A;  1UA1 A;  4IG0 A;  2WTF A;  1WG5 A;  2ALZ A;  2RHQ B;  5C2G A;  1ZTW A;  2XNR A;  2WON A;  5A8W B;  1KON A;  4NCB A;  3LXQ A;  2DB1 A;  2LQ8 A;  4LBI A;  5IQ6 A;  1QVF R;  1TL5 A;  1KR4 A;  1WSR A;  2DXE A;  4L3K A;  3KK1 A;  3N6M A;  2CUY A;  1SHN A;  4YN3 B;  2HZA A;  2WBR A;  1SQF A;  2CJY B;  3O1L A;  2FHK A;  1RHU B;  1K73 T;  4TY8 A;  1FSU A;  2BR0 A;  3PAC A;  2XLI A;  4MHX A;  2ZHA A;  1GMW D;  3CME S;  3VAM A;  4MTP A;  3GFX A;  1OPZ A;  3CIM A;  5L39 A;  3SV3 A;  2HYI B;  3PYG A;  4OZ3 A;  2RJZ A;  4NA3 A;  1Y6V A;  4CLY A;  1B3T A;  4LSN B;  3KG1 A;  2FJD B;  2N82 B;  3N79 A;  3HJV A;  2FHO B;  1AT1 B;  1HQ2 A;  2AT1 B;  2B9X A;  3IGZ B;  2N7Y A;  3CJ8 A;  1HIY A;  4CXU A;  1EW2 A;  3BRE A;  2NPI A;  3K57 A;  2E5H A;  5L9N A;  2RUS A;  5L1K A;  4KAY A;  3ILI A;  2GO9 A;  3D3C J;  3V2U C;  4OYW A;  2D9O A;  4DV7 F;  1FRX A;  3DLK A;  1RT7 A;  3D0H E;  2KO1 A;  5C2C A;  1Q8L A;  2M5Y A;  1ZS6 A;  1L3V A;  1CJU A;  3RUB L;  2KI2 A;  3DRP A;  3CCJ S;  5EWE A;  4GKJ F;  1FDN A;  3VGS A;  4NWX A;  1RI7 A;  3WAY A;  1NPR A;  2BKO A;  3MZI A;  4DG1 A;  5KFH A;  2QGF B;  2OI2 A;  5ETM A;  2VOD A;  3C15 A;  3FEY B;  2XZT B;  2QRR A;  1FCA A;  3QAT A;  1HNW F;  4ILM A;  4OX9 J;  4QWE A;  3KXD A;  3GB0 A;  3MPW A;  3DU6 A;  5A2Q U;  3U1M A;  1R8B A;  2PA8 D;  4FKX A;  3R3T A;  3UCZ P;  4F2S A;  3TRG A;  2E44 A;  4CO3 A;  4CYS A;  2W2O P;  2JFK A;  1EQ0 A;  2HS3 A;  2FGO A;  5HP1 B;  2QO3 A;  3KLI A;  4O44 B;  2Q6B A;  5A2Q Y;  3ELH A;  4KGV B;  3MUT P;  3CIZ A;  3M8Q A;  2DY9 A;  4DQS A;  3G96 A;  4QWA A;  4HDH A;  3RZA A;  3DLH A;  1S77 D;  1CEZ A;  5RUB A;  3MD1 A;  4G65 A;  4M8L A;  3OVB A;  3UE2 A;  3ZZO A;  1H2V Z;  4CLZ A;  4C3M A;  3MMC B;  2XY6 A;  2BAB A;  4D3G A;  4NA2 A;  4ELV A;  5LM7 E;  3K5N A;  2CJX B;  2KG1 A;  2ZH1 A;  3DU5 A;  1RTJ A;  1SXL A;  3D3B J;  3OR2 A;  3DRX A;  1C1B B;  1NK5 A;  4DV0 J;  2YQ0 A;  2GMJ A;  3P96 A;  3CUN A;  4DLG A;  3B54 A;  3G82 B;  2BOP A;  4LF7 J;  4DV1 F;  2MKH A;  2MQQ A;  5M2R A;  2VA3 A;  3MMB B;  1S76 D;  2F4F A;  4KBI A;  4XPE A;  2GSU A;  5D4L A;  3QT5 A;  3QT6 A;  1M1K T;  3LP1 A;  3QAU A;  1J5E J;  5AT1 B;  1R0A B;  1KQG B;  1QAX A;  3POT B;  5L0E A;  4GVB B;  5MLC V;  2DPI A;  5FDL A;  2B43 A;  2PO4 A;  3CMA S;  3V6H A;  3BGR A;  5BXI A;  4A8Q A;  2LDI A;  4R0E A;  3C6U B;  2FTR A;  4CH7 A;  1RTH B;  4FF4 A;  4B56 A;  2V2K A;  4ES3 A;  3M8Z A;  4L76 A;  1I51 B;  2YWW A;  3M05 A;  2DEI A;  2HAI A;  2DNZ A;  3KUG A;  4DQQ A;  3FC9 A;  3B6B A;  1IKW B;  3DGP A;  1WF1 A;  3BR9 A;  4IR1 A;  1SV5 B;  4DS5 A;  2H9Z A;  5BJR A;  4X4N A;  1K9M T;  4ZPT R;  2H4W B;  5J1E B;  2RDD A;  5KFK A;  3I87 A;  4JI0 F;  5LSR A;  3S6E A;  4EK2 A;  4ED5 A;  2RQM A;  4WZM A;  4ZGA A;  2RKI A;  2KZZ A;  4JI2 J;  3Q8S B;  4MFB B;  3U1N A;  5DQI A;  1XJW B;  3Q3Q A;  1AJA A;  4GTX A;  4X4P A;  1UZD A;  4UQT A;  2L9W A;  4ZVO B;  2ZHB A;  2IDL A;  2GLQ A;  1UL3 A;  4LRD A;  1VK3 A;  2R7O A;  2QMW A;  2EKN A;  1ZAW A;  4ZVH A;  1RAE B;  5KFE A;  3GII A;  2IY5 B;  1KQK A;  2MKJ A;  1URR A;  3IS9 A;  1XNQ F;  5INH A;  4DPW A;  1EP4 A;  4H4K C;  4LSZ B;  3J7A 1;  3M2U A;  2VFS A;  4LFB F;  4ECR A;  4A8Y A;  4W98 A;  3AB4 B;  3QGI A;  4CLW A;  2NYH A;  2DNQ A;  3Q8Q B;  2LKZ A;  3NCP A;  1IWG A;  1DY3 A;  4UOR A;  1IVZ A;  4OZJ A;  3LGM A;  4IRC A;  3EZU A;  1SJR A;  3I5C A;  3T5L A;  5IJQ A;  4JUZ A;  1CS4 B;  5KFD A;  2X51 A;  2DO0 A;  2GHV C;  2PMW A;  1I6J A;  4LUB A;  5L38 A;  1YZ6 A;  3IFE A;  2HHH F;  3A13 A;  4JI1 J;  4ZPW R;  3W7B A;  1N33 F;  1S10 A;  1WTB A;  3H5U A;  4IQX A;  1CSJ A;  3R5G A;  4RR5 A;  1LW0 A;  1DZ5 A;  2LDY A;  4KV8 B;  1D3W A;  3DHX A;  4HVZ A;  2KFY A;  2W5Q A;  3VTI A;  2CG4 A;  3KDO A;  2NLW A;  2C2M B;  2WVB A;  5HQM A;  3NCQ A;  3H4D A;  1HYS B;  1FWP A;  3ENW A;  1MSW D;  1VQ4 S;  1Q79 A;  1P9Q C;  1EW9 A;  2HUR A;  1FES A;  1HNX F;  1FD8 A;  4LQY A;  2CZ4 A;  2Z2M A;  1SL1 A;  3AB2 B;  3IBC B;  2ZJP Q;  2FHJ D;  3DPC A;  3UQS A;  5DQG A;  4FXD A;  2V0N A;  1OWX A;  3QJL A;  4CYU A;  1U1Q A;  4QR1 A;  4HLB A;  2XYP B;  5EGE A;  3C14 B;  2Q6C A;  1VS3 A;  2FLO A;  2KG0 A;  2KXN B;  3O3L A;  5DZ7 A;  2C22 A;  3CCT A;  2VKZ G;  4B3O B;  4IUF A;  2WVF A;  4FYX B;  1UTA A;  3OHA A;  4RW6 B;  4YR1 A;  3LGN A;  2JVR A;  2J9E A;  3CUL A;  1S0V A;  1RWP B;  5J2Q A;  1Q53 A;  3Q8Y A;  5C24 A;  4M5H A;  3ENQ A;  4NI2 A;  1TKD A;  2W01 A;  3C16 B;  2LP4 A;  2QT7 A;  1R27 B;  2HQG A;  1JLC A;  3QRQ A;  1KKH A;  2DIU A;  5LJ3 Y;  2FB0 A;  3CCR S;  1WHV A;  5J1N A;  2N3L A;  1S0O A;  2CWK A;  2K3I A;  2QV6 A;  4OHV A;  3TAM A;  3A3O B;  2MTL A;  1YGY A;  2EEY A;  2I9S A;  2XHC A;  2L3M A;  4DUZ F;  3CWJ A;  1T9T A;  4I2P A;  3D67 A;  3RYL A;  1H73 A;  4B17 A;  2XB2 D;  2AEM A;  4PXD A;  3IR5 B;  1E2S P;  2CIM A;  5LRM A;  2IYG A;  3TX8 A;  2YX4 A;  4DV7 J;  3JSM B;  1S0M A;  2B4O A;  2ABY A;  4QIF A;  2CZV C;  1HD0 A;  2ZD1 B;  3QAE A;  4QJV A;  2E5J A;  2XWY A;  5C42 A;  2WAQ D;  2R2T A;  2GMH A;  4GKJ J;  4CTA B;  3C6T A;  1DQ9 A;  2NZ4 A;  3Q89 A;  2V4J B;  2P2C B;  1YJT A;  3FFI B;  1YKW A;  2K1R B;  2HK2 A;  2MSS A;  3DM2 A;  2ZH2 A;  1F9H A;  4UPI A;  4C97 A;  4H54 A;  3D9B A;  4NLW A;  1KLM B;  4DUY F;  3DDK A;  3ZNU A;  3M8R A;  1Q8B A;  1HNW J;  2R2R A;  2VPY B;  3CT9 A;  3VZH A;  4KTQ A;  2V94 A;  2VDI A;  2EG2 A;  2G2Z A;  4XAK A;  2W9A A;  3RB4 A;  4OLO A;  1YBT A;  5IWA F;  1JLG A;  2AJ4 A;  1M5O C;  5HVG A;  1KBR A;  1PBU A;  1FNO A;  2HBY B;  2W2N P;  1LWF A;  4DPO A;  4H4K A;  2F8H A;  1F0X A;  3W60 A;  2V68 A;  3MM5 B;  1IUJ A;  4J9M A;  4ZS6 A;  2G1D A;  3GV7 B;  1SC4 B;  3H98 A;  3LP0 A;  4OL8 A;  1HLW A;  2GHP A;  3RAX A;  1UFW A;  2QEX S;  5BR8 F;  4OZ0 A;  3D66 A;  3UI3 A;  4UPK A;  4DV6 F;  3H5X A;  3NOC A;  1WG4 A;  3GJQ B;  2YKN B;  4HHH A;  2HS0 A;  2Z4P A;  1VC5 A;  4DR5 J;  4M5G A;  1TKZ B;  4UPL A;  4CNY A;  1TU0 B;  3BEG B;  1P8G A;  1HNI B;  3LA0 A;  4I7F B;  2CQH A;  3DMJ A;  3CJ4 A;  2PMZ D;  5CZX A;  1UVN A;  3O6Q A;  4JI8 F;  2IVM A;  3OXG A;  1SUQ B;  5HQ8 A;  2OO4 A;  4FKY A;  5B08 A;  2XMV A;  1ICE B;  5A8W A;  1K44 A;  5F8M A;  4LFC F;  4ILL A;  3MCO A;  4L74 A;  4FS1 A;  3TG0 A;  2Y9H A;  3S1T A;  2UVV A;  3RB3 A;  3T1Y J;  2HVZ A;  2HQD A;  2FVQ A;  4KIA A;  3NWG A;  4KFB A;  5JUM A;  2BJ3 A;  2DGU A;  3GFY A;  1NO8 A;  3QO9 B;  2G2O A;  4TLQ A;  2R7U A;  1HAR A;  2VHG A;  5A0Y B;  2NXC A;  3ZZP A;  3GJS B;  3MHY A;  3SFU A;  4WBF A;  2HHQ A;  1JKH B;  2NZC A;  1L3S A;  3F73 A;  2M52 A;  2YTC A;  2WW8 A;  2UUW A;  3CTR A;  4F50 A;  2VJV A;  3CO0 P;  2LEP A;  1D1U A;  2AYM A;  4CT9 A;  2HFS A;  4DR3 J;  1ELO A;  2VFT A;  4LSN A;  5KOW A;  1EHW A;  4ZK7 M;  4IO1 A;  2AV5 A;  1XER A;  2C3M A;  2DGS A;  2HVE A;  3CNQ P;  2R7S A;  1NHU A;  4JI0 J;  4AFF A;  5JVH Q;  4KRW A;  3UPF A;  3QRP A;  1H2T Z;  3U02 A;  1H6K X;  3CVK A;  3BDP A;  1R0C B;  2UV8 G;  2B9Y A;  1KH9 A;  3ET6 A;  4DR6 F;  2BYC A;  2QLF B;  1Y3K A;  3DYC A;  4EFA C;  4JYA F;  1DTQ B;  2AYG A;  1DUR A;  4ZJQ A;  4DPY A;  5M2P A;  1Q81 T;  1N88 A;  2BW2 A;  4P72 A;  2DH8 A;  4OYO A;  2L41 A;  1XNQ J;  4QCL A;  1URN A;  3ETM A;  1NPK A;  1ELY A;  2XQC A;  1R6Y A;  4K2J A;  2ZC3 A;  4X66 F;  2WB1 D;  4PWU A;  4OI3 A;  4LFB J;  2XZW A;  5F8G A;  3K0J A;  3B8H A;  3QNW B;  4KYZ A;  1RAI B;  2LXI A;  2MQM A;  3M8P B;  3DFE A;  3H20 A;  4I4B A;  2NUH A;  1XWL A;  3U27 A;  4LF2 A;  1KD1 T;  4R25 A;  3PW5 A;  2BVZ A;  1S1V B;  1GXU A;  3PZP A;  1T95 A;  1UVL A;  4P7T A;  3D5M A;  1T9Y A;  1K0T A;  2DGV A;  2MZQ A;  2ERR A;  3I96 A;  2E1M C;  1FRJ A;  1XR7 A;  3OVA A;  3LGH A;  1B70 B;  1BQN B;  3I5A A;  1WWH A;  1IKY B;  1AA1 B;  2RRA A;  3ENV A;  2QN6 B;  2HHW A;  2ZH9 A;  3TNV A;  2ADC A;  2UV8 A;  5HP1 A;  1KWM A;  2E7W A;  4DXL A;  4ZP7 A;  2XEX A;  3PHT A;  2FJW A;  2CNK B;  3OLB A;  4TQR A;  1N33 J;  5HVH A;  1OIA A;  3GIR A;  4URS A;  3E8O A;  1QTN B;  1NH7 A;  2LEB A;  4OV6 A;  2VL1 A;  3EZO A;  5EWF A;  4K0K J;  4I64 A;  1FEH A;  2ZBR A;  1HR0 F;  2HWH A;  1P1T A;  3BDE A;  3MMC A;  2WSE C;  3UDV A;  4MIV A;  3DRY A;  1NEE A;  4JV0 A;  3VWS A;  4EWT A;  1HNX J;  3IAM 9;  1C1B A;  1I5O B;  4C8L A;  3CPW R;  3G82 A;  3GCW P;  1IR1 A;  4YP3 A;  1IBK F;  1I3O B;  4HYK A;  1ALJ A;  4HDG A;  2IBO A;  4DDF A;  3H25 A;  1X5T A;  2GVZ B;  1S97 A;  3MMB A;  1SKU B;  2AJF E;  2J76 E;  4PWD B;  4ECV A;  4J9V A;  1F2G A;  2NXE A;  1CJT B;  2YH0 A;  1TL4 A;  4IDK B;  2KT5 A;  4LT6 A;  4P71 A;  1R0A A;  4FP9 A;  3POT A;  3DYA B;  4GVB A;  4XO0 A;  4KR0 B;  2QL7 B;  2FZC B;  1FE0 A;  2KTQ A;  2XSF A;  2XMA A;  3VZI A;  3C6U A;  3A8I A;  3GV8 B;  3TJ9 A;  4DL4 A;  1RTH A;  3KLE A;  2OMO A;  4RUC A;  3OR1 B;  3M1V B;  1UEU A;  2B4U A;  2MQP A;  2VBW A;  2Q43 A;  4KHP J;  4ANC A;  4WE1 B;  4IOA Q;  1JJ4 A;  4KGM A;  3ZC4 A;  3T9N A;  2WHO A;  5DZ6 A;  4GTZ A;  3E2D A;  1AJB A;  2UXC F;  1NJX A;  4NLV A;  3KNA A;  4Y6I A;  2ZOM A;  1SV5 A;  3KLF B;  5J1E A;  3FQK A;  4Z37 A;  2L48 A;  4DUZ J;  1D8Y A;  1MWZ A;  1X0F A;  1BGX T;  1FJG F;  4PG8 A;  4RW4 B;  1S57 A;  4NOH A;  1JJH A;  3DKD A;  4MFB A;  1NJZ A;  2OPQ B;  3CCU S;  1YQH A;  1TMM A;  1HL6 A;  1QY7 A;  3DHW C;  2QA2 A;  3OXL A;  1B0V A;  1JK9 B;  1H38 A;  1U1R A;  5KFQ A;  3CDW A;  4HHJ A;  3I32 A;  4I6W A;  2GQ2 A;  1IN0 A;  2F65 A;  1WC1 A; 
#chains in the Genus database with same CATH homology
 4CXS A;  4LRB A;  4LRA A;  1KH4 A;  3WAV A;  4CXU A;  3M7V A;  3LXQ A;  4CYS A;  1EI6 A;  4LR8 A;  1ED9 A;  1EW2 A;  1URA A;  3UN2 A;  2W5W A;  2W5S A;  3NKM A;  5DLT A;  2XR9 A;  3WAW A;  5IJS A;  5HRT A;  1ANJ A;  2XRG A;  1HJK A;  2W8S A;  4NWJ A;  3TG0 A;  5INH A;  1KH9 A;  1HDH A;  2G9Y A;  4UOP A;  4UOO A;  1KHL A;  1ELX A;  4LRE A;  3UNY A;  3DYC A;  4KAY A;  3TX0 A;  3M8W A;  5LRN A;  2D1G A;  2ANH A;  3T00 A;  1EW9 A;  3CMR A;  3NKN A;  4GTY A;  1ED8 A;  4FDJ A;  3T02 A;  3UO0 A;  4ZG6 A;  4B56 A;  4LRC A;  5GOV A;  1ANI A;  4LQY A;  1KH5 A;  1ZEF A;  3M8Y A;  5C66 A;  2QZU A;  3M8Z A;  1EW8 A;  1P49 A;  4KJD A;  5L0B A;  3SZY A;  3NKR A;  4TN0 A;  5AJ9 A;  4LR7 A;  1SHN A;  5GRR A;  4LRF A;  1ALH A;  3T01 A;  4KM4 A;  3DPC A;  3NKQ A;  2W5V A;  3TWZ A;  1K7H A;  2X98 A;  5LIA A;  4UOR A;  4NWX A;  1KHK A;  1E33 P;  1ELY A;  4GTZ A;  1N2K A;  4MIV A;  1E2S P;  3E2D A;  5LQQ A;  1AJB A;  5KXA A;  3WAY A;  5LRM A;  1B8J A;  1FSU A;  3A52 A;  4UPH A;  3BDG A;  1O99 A;  4FDI A;  2IFY A;  4ZG7 A;  2W5X A;  2GSN A;  3BDG B;  4QAX A;  1HQA A;  3BDH A;  4KAV A;  5EGE A;  4MHX A;  3SZZ A;  2RH6 A;  1ALK A;  5IJQ A;  1SHQ A;  2ZKT A;  5DLV A;  1AJC A;  3BDF A;  3IDD A;  2IUC A;  1Y7A A;  3OT9 A;  3NVL A;  4UPK A;  2IUC B;  5K4P A;  4N7T A;  1KH7 A;  3NKP A;  3ED4 A;  5DLW A;  1ALI A;  1EJJ A;  4CYR A;  4CXK A;  4ZGA A;  4LR9 A;  3MK0 A;  1URB A;  1ALJ A;  3B5Q A;  3UN5 A;  5EGH A;  1KHJ A;  4KJG A;  1KHN A;  4UPL A;  5L0K A;  3UN3 A;  3WAX A;  4YR1 A;  1AJD A;  1N2L A;  3MK2 A;  4LR2 A;  3Q3Q A;  1Y6V A;  1AJA A;  3NKO A;  4GTX A;  4MY4 A;  3WBH A;  2GSO A;  3MK1 A;  1ZEB A;  4ZG9 A;  1ZED A;  2W8D A;  1AUK A;  2GLQ A;  2W5R A;  4UPI A;  2GSU A;  2VQR A;  1ELZ A;  2W5T A;  4LRD A;  4GTW A;  2GA3 A;  1O98 A;  1E3C P;  3IGY B;  1E1Z P;  5TJ3 A;  3KD8 A;  2W5Q A;  3IGZ B;  1EQJ A;  5L0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...