3UO0A

Phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3uo0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3uo0A01
1EQJA 1HJKA 1O98A 2GLQA 2G9YA 2IFYA 3IGYB 2D1GA 3WAXA 1KHLA 1EW2A 2IUCB 5IJQA 4UOPA 3UN3A 3NKQA 3WAYA 3MK1A 1ALIA 5LQQA 1EW9A 5DLWA 1N2KA 2IUCA 1ED8A 1KH5A 1E33P 2W5TA 2XRGA 3ED4A 1ELXA 4LQYA 4UPIA 4KAYA 4LRBA 4UORA 5GOVA 1ANJA 3Q3QA 1ZEFA 4NWXA 4ZG7A 5L0KA 5L0EA 3WAWA 4LRFA 4LRCA 1ELZA 2GSNA 4TN0A 3DYCA 2GA3A 4MHXA 1FSUA 2RH6A 1ALKA 1KH7A 5EGEA 1AUKA 4ZG6A 4UPLA 3BDHA 4MIVA 3NKNA 1KH4A 3CMRA 4GTXA 4KJDA 3SZZA 5IJSA 5LRMA 2W8SA 1EJJA 4MY4A 1E1ZP 3M7VA 2VQRA 5DLTA 5TJ3A 1URBA 4GTZA 3NKPA 3MK2A 5EGHA 3DPCA 1ZEDA 4CYSA 3T02A 3BDFA 1KHNA 3E2DA 4KJGA 1ZEBA 2ANHA 2W5QA 3NVLA 1AJDA 2X98A 4CXSA 5LRNA 3TG0A 2W5VA 4FDJA 1URAA 3IGZB 3T01A 3M8YA 1AJBA 2W5WA 4GTWA 4B56A 1ED9A 3UNYA 4LREA 4UOOA 2ZKTA 3UN5A 3UN2A 4ZG9A 5DLVA 1B8JA 3M8ZA 3SZYA 4GTYA 5K4PA 1E2SP 2QZUA 3LXQA 4LR9A 4CXUA 2XR9A 3NKMA 4LR7A 3UO0A 1HQAA 1ANIA 5C66A 3A52A 4QAXA 3M8WA 3T00A 2GSUA 3MK0A 5LIAA 4UPKA 4KAVA 1K7HA 3NKOA 3BDGB 1Y6VA 1SHNA 4FDIA 4CXKA 4CYRA 4LR8A 1ALHA 1KH9A 1EW8A 1O99A 4ZGAA 1AJAA 3WAVA 3WBHA 1ELYA 3BDGA 4NWJA 4N7TA 4UPHA 4YR1A 4LRDA 5INHA 1KHKA 5HRTA 4LRAA 1KHJA 3KD8A 3TX0A 1SHQA 3B5QA 1AJCA 2W8DA 3NKRA 4LR2A 3TWZA 1Y7AA 2W5XA 2W5SA 1HDHA 5L0BA 2W5RA 1N2LA 1ALJA 5GRRA 3OT9A 5KXAA 3IDDA 1P49A 1E3CP 5AJ9A 2GSOA 4KM4A 1EI6A
chains in the Genus database with same CATH superfamily
2IFYA 4OV1A 1WSVA 2FQQB 3Q2TC 5F8IA 2YKNB 4TNOA 4OZ5A 5KFNA 2C2EA 1XMOJ 1PAUB 5KFDA 1S6UA 2GSNA 1RHUB 3JYTB 2N3LA 2H1YA 2V2QA 1KONA 2JNJA 3JSBA 4M5NA 4DL2A 1RU2A 3D2WA 2JRSA 1KTVA 3PKMA 3E2DA 3EVWA 4JOUA 2ZE2A 1AUDA 1YITS 2QFIA 5MAOA 3I32A 4J9KA 3QAUA 4P2MA 2EK1A 4OYMA 4NLYA 3MK0A 4FS2A 2G1DA 2RRNA 2EC2A 3MOZA 3HVWA 3SDEA 5E41A 1T8EA 4ZPBA 1H2UX 2MB0B 2IDEA 4IQXA 1FTCA 1NB7A 2UXDF 2XS5A 3OJSA 5C5JA 2AJQA 1RTHA 4PXBA 1QVFR 2K8GA 4N47A 2LKZA 2CZ4A 1ZM3A 5M2UA 4ED6A 5D6GA 1VQ4S 4DLEA 1PYSB 4DQQA 3SV3A 3QYYA 3J7AN 2CPYA 2HS3A 1R31A 3P4UB 1FFWB 2WCXA 1CS4A 3VVTA 3C6UA 4DPWA 4J90A 2MEWA 3O3LA 3M6XA 5LXYA 3X1LB 1HBUB 4DR7F 4YOEA 5H1SV 4C8KA 2XBPA 1NJIT 1XMBA 5HK4A 3BGUA 4RW4B 3M8YA 2U2FA 1JQGA 2K7JA 4DR1F 4ZK7M 5KFLA 2Y3YA 2KH9A 4JI1F 2JL9A 2F7VA 2KG1A 4QAXA 2DHHA 2ZH3A 5ETQA 1S57A 3G6XA 3W8GA 1KH9A 1ELOA 1XTZA 1RTIA 1VQPS 3QRRA 4LFCF 3RAXA 2F4VJ 3DRXA 4IQMA 2ZWOA 2HHQA 3W65A 2M4MA 2MYFA 1V3RA 2HRYA 1EP4A 1P49A 2DKOB 2RQKA 1IBMF 5A0YA 3GP9A 1SKWA 3I4HX 1UJ5A 3OHBA 3OSNA 4Q8FA 2CUYA 2B4OA 1S0NA 3Q3QA 3C19A 2UP1A 3PW0A 4B3TF 1B70B 2L9DA 2L08A 3LPYA 3EZOA 1NM2A 3AHPA 2DJWA 1YJVA 1SPBP 4FYDA 1RISA 4L74A 2F3JA 4I2QB 4LFBF 3H25A 2R7QA 3IAM9 1Z2ZA 2EC0A 4KRWA 2V0NA 2IBKA 4WTYA 2MKCA 5T7LB 4QU6A 4I6AA 2XR9A 3CCES 1HQUB 2JEGA 1M1HA 4USKA 5DDQC 6AT1B 1R3NA 3OTBA 3PG9A 3LALA 4JB8B 2EFPA 4C8YA 3POTA 2BQUA 3GV8B 1N2LA 1HLWA 1M5PC 1N52B 5G4DA 3GFHA 2GSOA 1FRIA 2CPEA 3NGTA 1IBLF 1HI1A 3MAHA 4LF6F 3MK1A 2ZM6F 4GKJJ 1RAIB 4WIIA 1FDNA 1JWWA 3TO8A 2DGWA 3DRPB 1WC6A 5K8PA 5LJ3Y 2HHHJ 3AXKA 3R9LA 3AY0A 1NHUA 2HBQB 2ZH6A 5EHHA 5THWA 1LWFB 4KKOB 4WWSA 1KHWA 1EX8A 2E44A 4J37A 2G2OA 4PEOA 2CQHA 3VALA 2B3TB 1VMBA 3M2RA 3UN5A 3QATA 1P27B 2XC9A 4CCHA 2Q3PA 1G7CB 2BJ7A 3BR9A 1U1MA 3ZTSA 2FGOA 5F8HA 2W24A 1AUSL 3SSQA 2W9CB 4CLFA 4U7UK 4UZCA 2WSCC 2P6SA 2DH8A 5T14A 2KVIA 3HVAA 3WDOA 4EUVA 2WVDA 2AT1B 1VC5A 2J7KA 4PWWA 5FDLB 1VBYA 5DG8A 3WC0A 4Y2CA 1UVJA 4FXWA 3GFZA 3QO9B 4D3HA 3KLIA 1HI0P 4OQJA 5CH7B 4FZVA 3TJAA 3HSGA 3ZZUA 2ZOGA 3PFEA 3T19A 1GXUA 4B17A 5T7LA 4DR3J 2BRKA 3H4BA 2BW7A 3LP0B 2KB2A 2VFUA 3DOMB 4QR1A 4OHXA 3ZTQA 2QZ8A 3DHXA 2BANB 3MWBA 3F44A 3SZYA 1XN9A 4LF5J 3OV7A 2ADCA 2RDDA 2XI3A 1T95A 3PX4A 1PG5B 2Y0BB 1FRKA 2K1RB 2DGVA 2QSFA 4F2SA 2J9DE 3T1YF 2UVRA 2BBEA 2AX1A 3AJDA 4K5RA 5L0BA 1FT8A 4DQPA 3AOAA 1C4CA 3CGIA 4N8NA 4DU7A 1NJWA 1QLNA 1SUQB 2D1GA 3WAXA 2KI2A 2DR5A 2WW4A 1U2CA 3GR1A 1TKTB 1G4CA 5L0EA 1LWFA 4UZBA 3PYEA 4YFUA 1Q81T 2NSBA 1Q0NA 1TKXB 2OO4A 1OJ4A 3W2WA 1ZBTA 1L3UA 2IYGA 4K7QA 3M8QA 2XGPA 1OIAA 5E5NA 2F9DA 1HWJA 2KO1A 2KFYA 1VQ8S 2NPFA 2MZTA 4WP9A 2HBYB 4CT8A 2YWEA 3HVRA 4C6AA 1U24A 3CCTA 1S1VB 5A8RB 5FDLA 1Q7YT 5BYQA 3CMES 1SQFA 1HQEB 2IVFB 2AKWB 3QO9A 4NLWA 2G9YA 2X3GA 2XY5A 4IFYA 5FLXU 3W7BA 4DCJB 4HH0A 2DGSA 3PYFA 2J0QD 4PUOA 2XY7A 8AT1B 1NK0A 4LIRA 2UXBJ 3K17A 3DOMA 2BE2B 2IPOB 5GMDA 3M8RA 1R0BG 2FYXA 4GKKF 5CCLA 5IZHA 3N5FA 1VQOS 7FDRA 2VBYA 2H5IB 1S77D 2XZDB 2VQFJ 5F41A 2VF3A 3FNNA 4H4KA 1FDDA 3MGJA 1C0TB 2L3MA 5F3ZA 4EO6A 4ECRA 4M5KA 3IFEA 5HO4A 4MKVA 1QAYA 3OFEA 2WZ1A 2ZEJA 2CRLA 4HHJA 3NS5A 3DNCA 3MF5A 1X4FA 1FK9A 3QT6A 4NMXA 3SSRA 2F8HA 4H54A 9RUBA 3MEKA 1TKTA 4UT4A 4YUDA 4X64J 3KG4A 1U09A 4NZ0A 2KG0A 4QIFA 1WHWA 3BQ0A 4R0JA 4DFMA 4ZG7A 3R6GB 1WWHA 3C8YA 3RR7A 3HPOA 5SUHA 3TAMB 2B4VA 1KH4A 1Q86T 1J5EJ 3VGTA 1I94F 2IM0A 5IXUA 1VQLS 2B8QA 5CYMB 5AE1A 3IBWA 5DM6Q 2E7XA 3QQCD 4X62F 3VR1A 2XLJA 4YB1P 1UZDA 4OV6A 1X4AA 2OFHX 5AXNA 5A8RA 3M4XA 2HKEA 4OX6A 1N34F 3AQPA 5HROA 1HQAA 3BKTA 2C2ZB 2FUG9 4OYPA 3B8HA 3QGGA 3SCIE 3C14B 3Q22A 1GQEA 5FIIA 3GIKA 4PQUB 4DV7F 4TLQA 3L7UA 2XG8A 2F40A 1S72S 1X5SA 4C48A 4B3RJ 2O67A 4DV4F 2MZSA 2PEBA 1Y9OA 2UUBF 3IGYB 5AT1B 3N5BA 1AW0A 4WFYA 4IG3B 2IUCA 5HJXA 4OJ1A 4RW7B 3C66A 1S1TB 2UVUA 2ZFHA 3I9V9 2BQRA 2IJFA 2MZRA 3NOCA 4FDFA 2OMLA 1UFKA 3R2DJ 2AJ0A 5L9XA 3FEXB 1YGYA 1VQ9S 1OSCA 2PI4A 4DL4A 5G0RA 1OPZA 1VK3A 3GPAA 4JYAJ 4IR9A 3ET6A 3DM2B 3EWGA 4QYRA 1FERA 4ELUA 1C0TA 4NLOA 2W8LA 3OTOF 2QMUB 2POKA 1AJBA 1X4CA 4X4OA 1WOOA 1V9OA 3M8ZA 1JKHA 3MMJA 4NLQA 2QFJA 4GVBB 3D68A 2CAJA 1RQ0A 4IR1A 2M7SA 1MN9A 1WOSA 3SCJE 1ITPA 1U7LA 1RU1A 1ZAWA 3MM8B 2M2BA 3D0HE 2UXCF 5IC4B 4MTPA 2YNGA 1SH2A 3R7SB 2SXLA 2VH7A 3CVKA 5DO2A 2VDIA 1U1QA 3PX6A 4QWAA 2P5VA 3K59A 3VAFA 1YJRA 5F0WA 3R8YA 2R7XA 4WIQA 1NEEA 1KEKA 1JLFB 2W2MP 4TU8A 2XSFA 4DF4A 5IT0A 2UZAA 5ETVA 2OPQA 2O01C 5LOQA 1HQ2A 2EVZA 1F9HA 4QOTA 4MK9A 2VKZG 1LKZA 3DYAB 3LQVA 5L0KA 2HG4A 2GA3A 2H48B 2GMHA 3CCVS 1ALKA 5CYMA 2HHWA 4OZ2A 4KY3A 2VG5B 1L3TA 4JI5J 3H0PA 3TZZA 3SI8A 2Z56B 4M95A 3CD7A 3M8SA 2L9NA 1T3NA 3GB0A 2GHPA 1J5OB 4HH1A 3T5HA 3UPFA 4QZVB 3GYXB 3OTEA 4NXMF 3RRHA 3MECB 3GTYX 2HNYA 4ZPWR 3PYGA 2R8HA 2B8PA 2DPIA 2F65A 4PQUA 3VV2B 3FC9A 5DG9A 1FFGB 4ZVRB 1XWLA 4ANCA 2AF6A 4U8VA 1UZHA 1N88A 1HW8A 2AYEA 4ZVTB 3H5UA 4DX6A 4Y65A 1R6YA 4IG3A 3MM7B 3KK1A 2BKNA 3SSSA 4DFPA 3DLKB 1WOPA 1S1TA 1MROB 2FJBB 3QWUA 2E1CA 3UCGA 3KUGA 1JLEB 2IRUA 3NG8A 4CLPA 2XS7A 5E3PA 3OUYB 3D54A 2XNRA 3HK2A 2DITA 2CVEA 3HDSA 4Q45A 1NKBA 3KLVA 3BR8A 4XO0A 4UPLA 1FKPB 3K89A 4TYBA 1KTQA 3G4SS 4JI3F 4F0MA 3G6VA 2XGQA 4FPIA 2PD1A 1EETB 2OP5A 5HVHA 2B5JB 3E01A 1C0UB 2UU9J 2PEHA 1U0SA 1CQNA 4L6V3 3NCQA 1U49A 1K9MT 1R0AA 2QL5B 4ZP6A 1JX4A 1KVIA 1FCAA 3G8SA 3UI3A 2QZUA 4ANDA 3NKMA 2OEKA 4B9SA 4Y28C 4MKAA 2HNZB 2GJFA 5KFQA 4ZGAA 1VLYA 3O2IA 4U7CA 2R7OA 4PG8A 4OYAA 2Z2MA 4LF8J 1PO6A 3BQ2A 1HDHA 4X65F 3DDIA 3I4PA 1KWMA 3FQKA 1I1GA 3DYAA 1NKCA 3W9JA 1AFIA 2UV8G 3DLEB 1FX4A 1NDPA 3JQJA 4FKYA 1IKYA 1NJYA 2XB2D 1H7XA 1OYEA 4ZCLA 4EO8A 3CCWA 2DGQA 4X4VA 3MR3A 1XR5A 1KH7A 3IP0A 4I7FB 5F3TA 4RNHA 3TANA 4Q2LA 3NS7B 3MECA 4R25A 4DI6A 4O3OA 2QC3A 4DR4J 2GFFA 3UD3P 3HSZA 1BWEA 1HYSB 2C2MB 2ZD1A 1VQNS 3MFHA 3PHEA 2HWHA 2MXYA 2N82B 3DLGA 4LBHA 3FSYA 1OY9A 1REVB 4OI2A 3EYZA 2D3O1 2F5GA 3T00A 3N28A 5LJ5Y 2ZDOA 4MYTA 1AA1B 2R3VA 2Z8QA 2HHSA 2E5LF 2YXLA 4ZCMA 3PW7A 1JLEA 5IQ6A 4HHHA 2E1AA 1SC1B 2BJ3A 3OUYA 2JDJA 2LCWA 1HARA 2HHTA 4RPFA 1D8YA 3DKDA 1TK8A 4OJGA 1FKOB 3Q8YA 5HANA 3LP1B 2OGUA 1N6QB 2HLTA 4DPUA 1C0UA 4DQIA 1Q79A 2FC9A 2JEIA 4WU3A 4ZVUB 1UETA 1TK0A 3ZFVA 5H9EK 4USHA 3NNHA 1RE1B 4ILRA 2HHUA 4DFJA 2HS0A 2DHXA 5A76A 2OD6A 1YRXA 4PG4A 3VZIA 2CA9A 4G1IA 3KOAA 3BDFA 5LL6d 1GX5A 1UKUA 1X9WA 2V94A 3HJVA 3VHQA 4MK8A 1JB0C 1SB6A 3B82A 3HFKA 1H74A 2IJRA 4P72A 3DN9A 1WI8A 4FBUA 2DIVA 1NK4A 3FKBA 5LIAA 1KLMB 2CZVC 1SKUB 2V8DA 4XPEA 2GA7A 4P74A 4PRFA 3QWPA 4EZ9A 1NK6A 1NZ8A 4OLOA 3EVMA 3CJ8A 1V5VA 3DLEA 5KFXA 2ATLA 2QIFA 2RNEA 3KHRA 3HT0A 3UFCX 5BR8J 1X9SA 2A1BA 4CM2A 1RTDA 4O0NA 1HR0J 2QLFB 1M90T 4I7FA 5H9FJ 3T1HJ 4DV5F 3NCPA 3MEEB 5L9NA 3N6MA 4JV1A 1EZZB 3IG1A 5K8NA 3EUNA 5HAOA 1XC9A 3F73A 2VFRA 4KFBB 3PY8A 2YH0A 1E6VA 2VU5A 4YHHJ 3R5AA 2P9CA 2ROGA 5C24A 1LQ9A 1S6PA 2CNKB 1O6XA 2XMKA 2GQ2A 2MKYA 1VIOA 2KXHA 4OJHA 1R6VA 4O4GB 1ZH5A 2CJXB 1KQKA 1RADB 3CCSS 4B3OB 3B78A 1HHTP 5EX3A 4ZPTR 4NCGB 3NKOA 2KT5A 1VC0A 4C8ZA 1NDKA 2DT9A 4C8NA 1JJCB 2CVIA 1ZPVA 1X7VA 1IUJA 3OR1B 2DEJA 2KFZA 1S97A 2OFGX 1U25A 5CYJA 1ROFA 5CZVA 1SQGA 1LW2B 2ZBPA 3PR5B 2FJXA 2ZH2A 5KFZA 2M8HA 5FLXY 2ZUAA 2DNNA 4ZCKA 1VQ6S 4I6YA 4X4QA 3FSIA 4KH1B 1Y10A 3BM7A 2V2VA 2MQOA 1D3WA 1JLCA 4NZ6A 5I3PA 4DPOA 3QT8A 5ETNA 1SH3A 4CYUA 4AYBD 5IJSA 1LWXA 4MJKA 3NGDA 3HCXA 2NLWA 3I96A 5C25B 3OFFA 2M8DB 1M5VC 1RT4B 3DPCA 1U6ZA 3FBBA 2ZDPA 4E8UA 2AEJA 1BC6A 1W26A 3BO2A 2QA4S 1VRUA 4ZLPA 4GMKA 1Q95G 3GIJA 1RI7A 2DNQA 3UO0A 8ATCB 4OFZA 4ZN3A 3CIMA 2VOOA 2B9WA 2GSUA 4G1QA 1VI7A 1F5BA 1UEVA 2J9CA 4IRKA 4R8UB 1S0VA 2GC8A 2IHR1 2V6AA 1ZA1B 2ZZMA 1PJ7A 1IM6A 5D0GA 5B0GA 3KMQA 4AUKA 3MFIA 4IO9Q 4IYQA 3HSDA 1NJZA 1UW9A 9ATCB 2GAHC 1FVQA 2O5DA 5ADZA 1WC3A 2CJQA 1JLBA 3FEYB 4KAYA 2QE5A 2ZVIA 1ELZA 4Y00A 2JZ5A 4J91A 4DBQA 1FJGF 3RJMB 3MI7X 1QJHA 4X2BA 3LAKA 2N3OA 1WHVA 3FZ2A 2MLXA 2IAJB 1L5UA 5KFHA 2OHDA 3KJQB 4O4GA 4EBDA 2YWHA 1RAHB 1RXOB 7AT1B 1NMEB 3OQ2A 2ZBQA 2H54B 3ONQA 2W5WA 4GTWA 1HBOB 3BN4A 3CNQP 3H2VE 4B9UA 3L3CA 5DLVA 2VPXB 4CLWA 3FFIA 4B9NA 1RBAA 3M32B 1XNQF 1HNIB 2UUAJ 2HRUA 4ICLA 3KHHA 2C2RA 1NK9A 2ILZA 5D77A 2Z30B 4OYXA 2CQIA 1IXKA 1KQSR 1LW2A 1PCAA 1S1UA 3OXGA 1JNZB 1Q8LA 4DU8A 4W90B 3O1LA 1R8BA 3E51A 2H5JB 1URNA 3Q2SC 1FTRA 1UVMA 1EW2A 1YBAA 4XIUA 4K4SA 3SZ2A 4I56A 3M30A 5KT6A 3H7HB 5C25A 2QYGA 1TR0A 1HKAA 4USMA 2UVVA 4RUHA 2CPZA 4LVNP 2AYBA 2GVZB 4PG5A 4D3GA 1U2FA 2RB7A 2VODA 4HT7A 1HBNA 4NEZA 3UR0A 3BSCA 1XNRJ 1JLGA 4PPZA 3ZTPA 3RTVA 1FNOA 4EGLA 4LF2A 1SJRA 4R8UA 1E2SP 4ED2A 4TQRA 2X1BA 4O3SA 2FJAB 4FF1A 2W2PP 3BDPA 2KRRA 3QMQA 3QT5A 3U7JA 2DNRA 5B0DA 1WDDA 1S49A 3HX9A 1KHKA 2I9SA 1SJQA 4DR5F 2XSJA 3MDFA 3ULHA 3CO0P 3A8KA 4NWBA 2OIHA 3MUVP 2DYAA 4ECTA 3W66A 4CLTA 1YBUA 1RA6A 4DV3J 4EMDA 1AFJA 3D6FB 3M2UB 4CTAB 1WTFA 4XDDA 3NP5A 4RW6B 2HVHA 3K57A 4LSNA 1S7IA 2CZ9A 1DHMA 1H2VZ 3JSMA 2G1HA 1TVRA 4ZIVA 4GC7A 5D8HB 1HBOA 2ZJRQ 4ED1A 4J9UE 1NUEA 1WG4A 3E2EA 4ANEA 4HDGA 4K50A 3A8IA 2PSZA 1O8BA 3KLGA 2GQCA 5HLFB 1CQMA 3BJYA 3IR5B 1RT3A 2LDIA 2Y1RI 1ZA2B 1N4LA 4K4VA 4DJBA 3CUNA 1FFSB 3TQEA 5LSLA 1HNXF 4MIAA 3WBHA 3BH7B 4J9LA 2YX1A 1NH7A 3LGMA 4OJ3A 3NWRA 1D9AA 3CJQA 4F25A 3CDAA 3U1NA 1SL0A 2RRBA 4WFNQ 1D9FA 4PXEA 4JV5F 2ASJA 1RWOB 2QYCA 1T9TA 3H2LA 5DLWA 3NCRA 4QWBA 4BLGA 1XK8A 2GVZA 4KB7A 2HWTA 1BUXA 3H20A 3ETMA 2OLWA 3BSOA 3MAQA 5H9FK 4ZITA 3MEDB 1QUVA 4NLDA 3EPIA 4MY4A 2XCPA 2NXCA 2YX7A 1KQGB 3NRBA 3AB4B 1UVLA 3TW0A 1TL3A 4JI8F 4R5PA 3Q8VA 3FDSA 4AQYJ 3K58A 3R6LB 4UOOA 2VG6A 2DVIA 1R8PA 1DARA 1RSCA 1CULB 1VS3A 3AFGA 1ZZFA 1MSWD 4X4TA 2FZGB 4DSLA 4ES2A 5E2QA 3SV4A 3L7PA 5IOLA 2I38A 3HKZD 3CJTA 3ICLA 3KDNA 1TL4A 3AH6A 5HRTA 3BBFA 3NS6A 3DLJA 2W5SA 1ALJA 3IWNC 1IQZA 1YRUA 1R0CB 1UVNA 4UOHA 4ZJQA 5A6WA 4P10A 4ZVGA 5KFWA 2D9PA 2DRDA 3KJVB 4Q2MA 3IRWP 1SCJB 2W5TA 2NPIA 1CJUA 5MLCV 2ZHAA 3TA1A 4TN0A 3AB2B 4C9DA 1JLQB 2FJVA 2LU1A 4TU9A 1SV5A 4AXIA 4KHPJ 3MR2A 5HLFA 3MPDA 1RWWB 5IM0B 3T02A 2JVOA 2E7WA 3W61A 1GTHA 3JSRA 2JEFA 2R7SA 4PAAA 3TI0A 1URAA 2KFNA 2YWFA 2PC6A 1QAXA 2QV6A 3GSIA 1YQHA 1H7WA 1N5YA 5CHCB 3RRGA 1U45A 1ZYQA 4Z7CA 4CYRA 3L9ZA 5D78A 5C2GA 2V4RA 4OI6A 4ZVPB 2EG1A 2WTFA 2DH9A 1XEZA 4IOCQ 1HW9A 2OPSA 1RZMA 1N5QA 4RW9B 3HHEA 4NEYA 2D69A 2DNOA 4IH5A 3M2VA 3CSKA 1KKHA 4ECZA 3CXCR 2R8IA 1FRJA 1C2PA 1T9VA 3ED4A 1R8CA 4YDDB 2MY8A 3OR2B 2NUUG 2PFDA 5E3AA 2C1EB 2DNYA 3DOLB 4CWBA 4YY3F 3BQ1A 2BE9B 3NKPA 1XR6A 1F2GA 2J6SA 1CULA 2BX6A 2XULA 3TEHB 1Q5YA 5JVHQ 3B6BA 4LQ3A 5ETRA 2QLJB 2DPJA 2ZBIA 2QEXS 2Y9HA 1JMTA 5LXRA 1OQ3A 4LFAJ 4ED5A 1HMVB 2KJVA 1KVJA 4M5IA 3Q8PB 2GQQA 2DH7A 2CADA 3FRZA 1N36J 2NUHA 4CO3A 4FNHA 4PXCA 2W8DA 4F04B 4OL8A 3PO4A 3LWMA 2XZTB 4USVA 3QJJA 1TAQA 4PXDA 2BYCA 3V6HA 1CJVB 4MYUA 2QTWA 2VPWB 2V8GA 3KYLA 2OH2A 1DTQA 4LRBA 3CE8A 2IFXA 3WAWA 2O1PA 5IM0A 4HHUA 4L73A 4TQSA 5T41A 4DV6J 4USIA 1N33J 1RWPB 4KGVB 4LT6A 3HM9A 3QIPA 2V63A 5L1LA 5TJ3A 1S4EA 4O3RA 3DXBA 3OJUA 1S79A 4G1PA 1RHQB 5LMUF 1LWCA 3UNGC 1DQ8A 4DV2F 1QAJA 3KLEB 3WX4A 3NAIA 4CM0A 4PYDA 3AD8C 5LMNJ 2OJ3A 4KV8A 4OYOA 3HHLB 3MR6A 1RYRA 2D3OR 3EVOA 1B7FA 2C42A 3M6UA 4DR6J 3KUHA 5F8NA 2LA4A 4HKQA 2R8KA 1RWMB 2J9EA 1KN6A 5INHA 5C7PA 2LQJA 1IKVB 2BJDA 1DZ5A 1CJTA 2LA6A 3F0NA 4RR5A 5CD4H 3PTWA 3NKYA 5KFYA 1U6BA 2AJ4A 1MN7A 1U48A 3V81A 1YX2A 3KLFA 2Y1IA 1VISA 2MY7A 3A12A 3NBPA 2KVQE 5AXKA 2CDRB 2AX0A 2R2SA 2BJEA 2MSTA 2X7IA 3DLLQ 5DDRC 1BQMB 4ZVOB 4EYHB 4WE1A 1DQ9A 4USUA 1EJJA 3FSXA 1H2TZ 2I5JA 1MU2A 4TLRA 4DHVA 1M1GA 2ANHA 3NVLA 1NRKA 2AZ3A 1YZ6A 3TAQA 1TV6B 1YI2S 1K8AT 3C16A 4JI6F 4HI1A 1S5ZA 1SL1A 3UCUP 4KAVA 4YB6A 5DQHA 3I55S 3BDEA 2W9BB 3FGVA 3FEZA 4RBVA 2CWKA 4IKAA 4M63A 2W5RA 4JI4J 3SIPB 1MWYA 2XTJP 4PCQA 1RUSA 4JI2J 1FX2A 2KHCA 4DEZA 5K20B 2BJ1A 4KGKA 4LF4J 5KOXA 4DS4A 1AZSB 3S1TA 4X66J 1FSUA 3UE2A 2FVPA 1WC4A 1WEZA 1HNWJ 2RSQA 5L1KA 4NXNJ 3FJ2A 3BBCA 2XZWA 4X4SA 1W25A 2KYXA 4NLXA 5LT5A 3HHLA 1QUPA 1EIYB 1IKXA 3Q8QB 2ZBRA 2CJYB 1F9EB 4CLLA 4AT1B 4H4MB 2MQQA 2YPZA 4JI7J 2EEYA 3ITHB 3GJSB 1VR6A 3X3UA 1R27B 5EGYA 2VUGA 5KFCA 4DR2J 1RP5A 2BVZA 4TVAB 5IWAJ 2JFDA 5CQGA 4QPTA 4DUZJ 1T02A 2W2NP 4IUFA 4ID5B 2NSCA 1TK5A 2W2OP 3NGRA 4ZCIA 2DR7A 3KD8A 3SEOA 1UVKA 4URSA 2CQ2A 1CLFA 3LP2B 2ADBA 4ENOA 3G8TA 3BKFA 4Q0BB 3MM9A 4Y34A 2V67A 2E1PA 1VQSA 4A4JA 4B3SJ 3UD5A 4OI0A 2DO4A 5KFOA 1T3OA 3A8EA 3UR3C 2XRGA 3MM5B 1CC7A 1GK8A 4CP5A 2OELA 1BGXT 1RAJA 1YWXA 2AEFA 5J2MA 1LWEA 2MSSA 2BXJA 2Y1LB 2ZKUA 5D3GB 4RBUA 4ZVHA 1F6TA 2ZC4A 4F4XA 3PNIA 1Q8IA 2XQCA 4LF9F 1URBA 5EGHA 3NY0A 1ZEDA 3J80U 1FNMA 5D4NA 4FYYB 4C11B 3J7Z5 3W1YC 5IS2A 2E1RA 3W2VB 2IA6A 1AB8A 2IC3B 5HP1B 1WNEA 3CB4A 2KJWA 5DM7Q 1PC4A 1S7HA 1VDHA 4NLSA 3IWXA 2XCAA 2HIYA 2CPFA 1YVFA 3SYZA 2XO7A 2AGPA 3ZZRA 1Y11A 1UVIA 4DOZA 3JSYA 1GMUA 3EICA 3GV7B 4ELTA 3CC7S 1AZSA 4DN9A 5B09A 4HR2A 3NKQA 2VASA 4F67A 4Y3CA 3DYCA 2I2YA 4FVMA 4M5DA 4RO0A 3GG0A 3OVBA 2UXDJ 5HMWA 1WSRA 1L3KA 5A8WA 2CQ1A 2XMJA 3MMCA 3K7RA 4N56A 5D4PA 1PILA 1KOHA 2D41A 4ECQA 2VOPA 1BE4A 4NASA 4DL3A 1TUVA 3IN5A 4LSLA 5C66A 2FLNA 3OL8A 1RB0A 3MTJA 2BE7D 1C4AA 1ZTTA 1U4BA 4UPHA 2XNQA 4MIBA 4DR7J 1KNZA 1JXVA 1F5AA 1RTHB 3OW2R 4RNMA 2JSXA 3O5TB 3G2XA 1NK5A 4DR1J 4NA1A 3NXZA 5DQGA 3FBCA 5HQ8A 5L46A 3SQGB 4JI1J 3I0RA 3H98A 2E5JA 1Y4ZB 1F2HA 2NXJA 3VGUA 2AJ2A 1YJ9S 4KGMA 1CS4B 4UOGA 2RH6A 3C6UB 4LFCJ 4BS2A 2YWGA 1KDNA 2R7UA 5F8JA 1A0OB 4C97A 2MDAA 4ZP9A 3NKNA 3ZZOA 4OHVA 4O3NA 3HT3A 5C2CA 5B7WA 3UDEA 2KM8B 1U47A 1TL1A 4ED8A 1TUWA 2CDQA 3QGHA 5KAKA 1IBMJ 1K0VA 2CYYA 1N0VC 5E3RA 4DSJA 4JI0F 3BPSP 3KWMA 2JC0A 4PG6A 1FJ7A 4DL5A 2B9EA 4B3TJ 3JTNA 2AMCB 2RKIB 1RTIB 2L48A 1ALHA 4LFBJ 4ZPCA 2HQGA 3BDGA 4ECXA 4K5SA 4WP3A 2J5AA 3A8JA 1FHTA 1EP4B 4EWTA 3HVTA 3N6LA 5A0YB 4ZVEA 2JFKA 3UDVA 3IO1A 2YPYA 3K5LA 5IV4A 1FD8A 2WVBA 3NNAA 3DOKA 4UUWA 3RW7A 2GV1A 1FESA 3MMAB 5HI7A 2JWNA 2NXEA 1S6QA 1G2EA 4K2XA 4L3NA 4GTXA 6FD1A 1KS2A 2DXDA 4UTGA 4ZVQB 4HEA9 1IBLJ 4RNFA 2VB6A 3T6BA 4LF6J 1V3ZA 3WX8A 2ZM6J 1RT7A 2HZAA 2AYMA 1PBAA 4LBPA 3D6TB 5GAHU 4DS5A 1RAOA 3TUPA 4TY9A 3IM8A 2E29A 2IMWP 3AT1B 3ILLA 1VRTA 3KK3A 3POTB 5KFSA 4NRTA 3SQGA 3HHLD 5DZ6A 2A3JA 5LSOA 3C15A 3RB3A 1X60A 1H0HB 1GT8A 2LEBA 3W8PA 3I0SB 1T05A 1EQ0A 2HQFA 1MG7A 2E5GA 4WKRA 2PFFB 4TXSA 2V4JA 1VFJA 4DX8H 1LXJA 3B54A 4LF7F 1N54B 4V19J 1ZM9A 3IBCB 1CJKB 5B0EA 4TU7A 1U1KA 3P5BP 2DBBA 3LW5C 1U6FA 3G82A 3SZZA 4JUZA 2UVWA 2CQBA 4QIEA 3MK2A 3BSNA 1OWXA 1IQTA 2OPRA 1N5SA 3M2RB 4J7CA 1B0PA 3HKWA 3MHYA 4K0KF 1PC5A 3BKUA 3S7RA 1ZEBA 2EXUA 2RKIA 2WBMA 3TRGA 1NPPA 4OI1A 2ZNYA 2IM3A 2HURA 2XY6A 1KQFB 2JLEA 4RL1A 3I82A 2V69A 4DL6A 4YS2A 4CI0B 5HSPA 3GCXP 3LUYA 3I5BA 3IGNA 3MUMP 1RT2A 4N7TA 3CD0A 1BQNB 3OHAA 3FK4A 3D3BJ 4LR2A 5CAAA 4WFAQ 1GFWB 3Q8UA 1RT6B 1E6YA 1KOOA 3ELHA 1B4SA 4ILLA 1U1LA 3GCWP 3MMAA 1HJKA 2BJ8A 3D6HB 3JTOA 2MKSA 4DSKA 3RRKA 1SIZA 3RBEA 3KLIB 1TFWA 1S1WB 3VVUA 1VJWA 3CJKA 1T03A 4PR6A 3DU6A 3T1YJ 3RAQA 2YNFA 3N01A 2KTQA 3BS9A 5AE2A 1RBOB 3O44A 5AJ3F 3H2UB 1W7WA 2BRLA 3U1LA 4ED4A 4RW8A 5F8GA 3BH6B 2GS8A 4OX7A 5DDOC 3IGZB 4C98A 4B56A 3MM6A 4PWUA 5CABA 2VHGA 2XYGB 1QE1B 3NOGA 4USTA 2LLZA 3T3FA 3QFWA 1PYTA 2CJ9A 4F26A 2ZJQQ 2DIUA 5HVGA 3HHNB 4LR8A 3IS9A 2PE8A 3I0SA 1XJWB 4NL5A 2UV8A 1SBRA 2PMWA 2BM1A 3A1YG 4LQ9A 1LV5A 2RVJA 1M5SA 5IT9U 1RJJA 3GYGA 1CJKA 3EZUA 4OHZA 3CWJA 2OSRA 3A3OB 4A8OA 1RAEB 3UN3A 2VA2A 3EE3A 3V6KA 4K4ZA 4DCPB 4ZHRB 4NRUA 3F56A 3E8OA 3IRXA 1S9FA 3W2WB 2DGOA 2C2NA 1FJEB 1RT1A 4ZIWA 4Q5VA 1KD1T 2BJ9A 4B08A 1T9UA 4IO1A 2V9WA 5F8MA 4P6QA 4MIVA 2EKNA 1Z4UA 3M8QB 3TEGA 4Y2KA 4U96A 5DDPC 3PDNA 1LW0A 4O23A 1S1XA 3L4BC 3MTKA 1WC5A 4C3LA 1RKIA 2ZOFA 2HNDA 3CCMS 1APSA 1BQNA 5DS7A 3RBDA 1FDBA 4ZPDA 3M8WA 2RE1A 3D5MA 5HQLA 1RT6A 2DO0A 4LMZA 2CPHA 4ED3A 3TNVA 4GKKJ 3PCOB 3WAVA 1AT1B 4OI3A 5IC6B 4ECYA 5C42B 5RUBA 1S1WA 1TU0B 5AJ9A 4I67A 3P45B 1KBRA 3GJTB 4IFYB 1S9EA 4DSIA 3BV8A 1KVKA 2CG4A 1T9XA 4WBFA 3TZWA 4PUOB 1QTMA 1ELXA 4DV1F 1GMVA 5JVGQ 4F7VA 4KSEB 2R7WA 1DY3A 1VQMS 4IDKA 1XMQF 1LK5A 2RS8A 3ZZ0A 5LRMA 1EQMA 1RT5A 2HLUA 2Z58B 3A13A 3PW5A 1SJ1A 2DY9A 4GTZA 1X4BA 5DGAA 1PAEX 1QE1A 1TKZA 1IM4A 3S8SA 2AW0A 2D3UA 2DR8A 1RAGB 2Z57B 3OVSA 1GMWA 1Q4RA 1REGX 4C7QA 3D9BA 1FO1A 4A8QA 4AFFA 2FHJA 2HFNA 4F36A 1LOUA 1X5TA 4CO1A 3CD6S 2DNHA 1I94J 3KXDA 2ZH8A 1I6JA 3CMQA 1KFSA 3VWSA 3WIVA 3RZAA 1IKWA 1FK9B 3MD1A 2Z4PA 2VV5A 4I68A 5LSRA 1UWBB 4X62J 3PRVA 1ZM4A 1WC1A 4ZHRA 2KL8A 3HMJG 5L38A 3NL0A 1K44A 4UOPA 2PN6A 4AL5A 1U1NA 1N34J 4MAKA 3UVJA 2K7KA 4ZMMA 4ES1A 2ZH5A 2OEJA 5BYSA 1SXLA 3HD1A 2BZ2A 2DXFA 4PG7A 3ZTOA 4DV7J 1WEYA 3BDHA 4O44A 1AYEA 1NJXA 1NU4A 4QIVA 1Q8BA 1F5CA 1U8SA 4DV4J 2BKPA 4JP8A 2MLYA 1HNVA 4P9SA 3GWCA 3H5SA 2UUBJ 3CIZA 1LXNA 2YKAA 4N77A 2AZ1A 1Q82T 2MHNA 4RKUC 1QSYA 4KJIA 5E33A 3J80Y 2MJUA 1GXTA 1XIQA 3DRSA 1F3VA 4IG0B 1EARA 5KFBA 4TY8A 5HROB 4C3MA 4F02A 2HRTA 3NLCA 4ETZA 4OX9F 1DFDA 2V8VA 2MZJA 4F4AA 3BREA 2NS1B 5I3QA 5C42A 4DUYF 4F3MA 2H3EB 4HT5A 3M1VA 4NX9A 6FDRA 2ZNZA 2H4WB 1FJCA 2B4PA 3AODA 4CDIA 3Q0AA 1RCXB 3PJWA 3OTOJ 3KK2A 3PEHA 2AU0A 5EUHA 3TUJC 5AXLA 4NA2A 2IUCB 3OLBA 3PEJA 2DGUA 2Z2ZA 1WF2A 1VJQA 1RABB 2EBGA 2HGMA 5GMEA 3U1MA 5KFJA 1HNZF 4AXJA 5D15A 2VPYB 3LA0A 3VQTA 1M1KT 2UXCJ 2QMWA 1PJ5A 5G0RB 3PYDA 1VHFA 2ASYA 3AD7C 3MCOA 3ET6B 4C3KA 4KJDA 1F0XA 1SJ3P 1XBWA 2QLBB 3PRDA 5DQIA 1K73T 2K3IA 3AAWB 1ZS6A 1O51A 4KJGA 3G87A 4QCLA 3QZ8A 3THTA 4M1KA 3S6EA 1JKHB 5B08A 4HTIA 1ED9A 3Q24A 3TJ9A 3PJ9A 4KIAA 3H5YA 1UWBA 1Y5IB 1JK9B 4OIXA 2YNGB 2R9LA 1UAWA 2VA3A 2YWKA 4Q7AA 1U0HA 1FRXA 4RBTA 5H9EJ 2J7WA 4CH1A 3V6JA 4KC5A 4TYAA 1VRQC 1HIYA 2CJKA 3EDRB 2OPPA 1W2IA 3GYNA 4YB7A 3OL9A 1X0FA 4NLGA 1M0SA 4NXMJ 3A3NB 1BY9A 4KGZB 2OPQB 3TJ8A 2EK6A 3OSPA 2V4QA 1FE4A 1SQEA 3GIRA 1HHSA 4DQSA 2KRBA 5HL7Q 2HGNA 2HPUA 2GJIA 5AE3A 3HFVA 4ECSA 4FF2A 3MCSA 4WYWA 2NXNA 2V68A 1UJ6A 2WOMB 3J7A1 1ACMB 2RF2B 4IG0A 2VQEF 2DB1A 2E7VA 2JC1A 4I0WA 4AE5A 2GVDA 3KG1A 4ALZA 2CQDA 2HNYB 1IBKF 2QLXA 2L41A 1D8ZA 5DLFA 4J9NA 1NH8A 1S99A 3MCMA 3IXQA 1X8DA 4DFKA 3JB9k 1TL5A 3NWGA 5ETKA 2A2DA 4J9PA 4JI3J 1O99A 3WC2A 2HVDA 2JX2A 3KK1B 4NZ7A 2CWXA 3PW4A 5KG6A 4UQTA 3BGLA 3DLHA 2WK4A 3RAMA 4N5SA 4PPDA 3MAAA 2XMAA 3CPWR 2DNLA 2ZWPA 3LTOA 3MEGB 2VG7A 2CPJA 4UPIA 2ZZNA 3CF5Q 4ECVA 2QLWA 1HD0A 3BGRA 1HWUA 5KG1A 2FZKB 3E01B 2EI5A 4X65J 1RWXB 2M0GB 3P3DA 2XYHB 2WHOA 3SCKE 4K4XA 1R0AB 2CJAA 1WHXA 2J0WA 3CO9A 2FZCB 1RWVB 4YR0A 1UFLA 1WI6A 2VZ9A 4XPCA 1AXQA 5ETOA 5A8KA 3TQ1A 4DWIA 2LVWA 2DD8S 1N32F 4HACA 4FP9A 2Z0GA 1BQXA 1UPMB 3BB5A 4DL7A 4C0BA 3RB4A 3H90A 4OX8A 3KLHA 2HHPA 2A6OA 1FRLA 2HAFA 4NPOA 3TX0A 4CO5A 4QW8A 3SXLA 3CTRA 1GMWD 2MQPA 3TA0A 4M5JA 4QWDA 1S0OA 2J76E 1IKYB 5KG5A 2DNKA 3I56S 1MMDA 4KBIA 2XWYA 2WOMA 4LQYA 3EGNA 2RF2A 4FPRA 2QO3A 4CNYA 4DV0F 5D4OA 1D9DA 4B9LA 3TX8A 2E5LJ 3QIDA 4OZJA 2J9DA 5CYQB 4WFXA 2ILYA 3OL6A 4Q43A 3OTCA 2ZD1B 1S9GA 1AJDA 3ENAA 4H4OB 2QA4G 3DLGB 4NLUA 1N56A 2GO9A 1ZAXA 1L3VA 2LQBA 5EX0A 4WTOB 2ACMA 5DGBA 3B4DA 2ACYA 2LU2A 2ZH4A 3DRYA 2RUSA 2F8MA 3R97A 2W5XA 1OY6A 2MHEA 3ZZZA 3MEGA 4UY85 4TN2A 5CCMA 1BLUA 1C1CA 3R5GA 4NYOA 3I87A 3CJSA 1RTJB 2XYPB 4K4WA 1KH5A 2DCUB 2FHOB 5B0AA 3TVZA 2C3PA 2HMIA 1FXLA 1N8RT 2A2CA 2V2ZA 4WFZA 4RWWA 4DG1A 4ZG6A 4Y0FA 2LYVA 4RNNA 3FMWA 1HPZB 1X4DA 1TAUA 1WG5A 1Q5VA 2YY3A 2DHGA 5K14A 3WHIA 4QR2A 3QNWB 4W92B 4DV5J 2UUCF 4F2RA 2YKPA 1Z2LA 3GU0A 3GSDA 3LXQA 5IFMA 3LANA 1IN0A 4IFVA 2QA1A 2QT7A 4L3KA 1IBCB 5BJRA 2CFXA 3PW2A 4CRJA 3UDLA 3CCRS 3LWLA 2YKMA 1ELYA 2XO6A 4B9MA 3KMSA 1SHQA 2WB4A 4FYVB 1RTDB 3UWTA 5IT9Y 5CXTA 3DMJA 1QDUB 4RUAA 4KHRA 5I3UB 3P6YC 4EU0A 5CYQA 3IG1B 4CLYA 5GOVA 1OMSA 5J2QA 4WPAA 1UEUA 1VC6A 5J1EA 3H4DA 1E6VB 4NLVA 3H42A 5C24B 5KG0A 4H4OA 4BDPA 1S6PB 1DURA 3SFGA 3W60A 4C0OC 3TA2A 4DX7A 4QYZJ 5LM7E 1SC6A 3GFXA 3R5DA 2VD3A 2B56A 3LF0A 2R7VA 3ENVA 4FF4A 2RMLA 3R2CJ 1MWZA 1T9YA 2LXFA 2KN4A 3ZNUA 4ZKAA 3GILA 3LGNA 4ATNA 1DBDA 4DZDA 2F63A 2EFOA 2PI5A 3C6TA 1Y6VA 3THVA 2DRAA 1SHNA 4EYIB 2W7AA 2YNIA 2IVMA 5I4MA 1RTJA 5J2NB 1FVSA 2F9JA 3MUTP 5KFFA 2RU3A 2ASDA 4DQRA 4XDCA 4IOBA 4MIWA 2U1AA 3D66A 2FHKA 2GGPA 3M6VA 4C4WA 3VCDA 5L8RC 1RK8A 2ZH9A 1HPZA 4M5MA 3G8QA 2YKNA 2HQCA 4OZ0A 5KT7A 5K9FA 3QSYB 1JLCB 2PGCA 3IWLA 4CYUB 3TVYA 3KJFB 2VBXA 2E5HA 3N6NA 3JYTA 4P75A 4B3MF 1KFDA 3E3XA 3AQOA 3O6QA 2FTRA 5ETTA 1VRUB 1RLDA 1SJ4P 4CXSA 4ECWA 3T01A 1YIJS 1TQLA 4IH6A 5J1PA 2VC1A 2JLFA 3GV5B 4G1QB 2FLPA 3J7ZT 2FVRA 1Y5LB 1FJGJ 5HMXA 1XMOF 1WC0A 2GW8A 3IC1A 1R8AA 2AP6A 4X84A 1NO8A 4U67Q 3MPVA 1EW8A 4ZLJA 1I5OB 2ZZTA 1LFPA 3K5OA 5GAHI 1NK8A 2ZHBA 2G13A 3UDCA 5I3UA 1RYSA 3TUIC 3IBFB 3HLUA 3PR4A 5GRRA 4G3IA 3PZPA 3T9ZA 3J81U 3R5CA 3ZZTA 1EQJA 2NZ4A 2FGCA 1AROP 2GAGC 4S0MA 1KHLA 1VBZA 1JLBB 3WAYA 1XNQJ 1WORA 1RWNB 4KHMA 1ED8A 1Q16B 2RT3A 5J1NA 1MWQA 4EBCA 2PIIA 5GAGU 4DZ6A 4CQ1A 2O66A 2OI2A 1ZAVA 2E5IA 3DFEA 2P6TA 4RZRA 2I1RA 3LPEA 2CXEA 4A46A 3K8VA 1ZTWA 4I2PB 4EFAC 3H8YA 1A7GE 4CZCA 2AYGA 1HBUA 2FLLA 4ETXA 3DDKA 3FFIB 4QQBA 1F9FA 1IWAA 4RW4A 2AGQA 2IY5B 4ICLB 3Q89A 2YTCA 1PJ6A 3ZNJ1 5J2NA 5EDWA 3HULA 4CIOA 4ZJOA 3VAMA 1FXRA 1K7HA 3OBIA 4AD6A 2Q1LA 3DDNA 4WZMA 2PMZD 1S1UB 4YR2A 3GZ7A 1TMMA 2VPZB 3W5YA 3HSJA 2PA3A 1JXEA 1T9WA 1NB2A 4PABA 2AJ1A 4ED0A 4NCAA 4RUBA 4XAKA 2IDLA 5HMYA 2CPDA 3M30B 3T41A 4OZ3A 2KM8C 4Y2AA 3MD3A 4FXVA 3AJ1A 3WQPA 2AGOA 1P8GA 1LFWA 4OLPA 1I3OB 2V34A 3SBMA 3Q86A 4Y6IA 4DR5J 1SC3B 1HWLA 2BQ3A 2HYIB 1HBNB 4I2QA 5KTQA 1H6KX 1JLGB 4X4NA 2F4VF 4ZDNA 4YB5A 5KFTA 4JV2A 1X4GA 2B4UA 2NREA 1FEHA 1HD1A 2J0SD 3RGIA 4ZN1A 3DRRB 2PT0A 5L1JA 3OXFA 3R27A 4NLTA 3JAMU 2CNLB 3HO1A 5KFIA 4OYIA 1HQUA 2CQ4A 3V5RA 4DPXA 3TUZC 4IRCA 1NZAA 2XSJB 1YTYA 4KGXB 2EPIA 3OVAA 2AD9A 5M2RA 1VK8A 4W98A 1UMJA 5EWEA 1UPPA 4K8RA 4U7UD 4RX6A 3CW2C 5D0EA 4A8KA 4YMEA 1NCLA 4LSNB 1N48A 2DNMA 3FVYA 2C2OB 2FPHX 2WRMA 1HNXJ 2ZVSA 2GNKA 3JSMB 4I2PA 4B9VA 3DRPA 1M5KC 1TVRB 3M9OB 3MURP 2HZVA 3C46A 1VBKA 1S76D 2MJNA 1HWIA 2GHVC 4JV5J 3KLGB 3CJ4A 2B9XA 1TMJA 5KFUA 4KKOA 2JHEA 4DX5A 3IR6B 1RT3B 2HBRB 1RLCL 4RU9A 1RGVA 4WK1A 3G86A 4HTJA 1ANIA 1EKSA 4GKJF 2WONB 3BPDA 3MCNA 2MMYA 4P2XA 2GX8A 2GIRA 4G6VB 2HHHF 1S12A 2KXFA 2W9CA 4HVZA 2VFVA 4C0HA 4JI8J 2CJBA 3NKRA 2Z2LA 3KDOA 2ZUGA 1SC4B 1JLAB 2BMBA 3R3TA 2ZC3A 1TKDA 2J8SA 2MZQA 1Y5NB 2G0JA 5KFMA 2A6MA 4K59A 5GVQA 1H73A 4LRCA 2YNHB 3EGZA 3VAKA 1S10A 4J9SA 5KG7A 1TL3B 4R5PB 1U26A 1GEHA 2G4BA 3ADAC 3DRRA 2RQCA 1HBMB 2H65B 4UF4A 2VG6B 3CCLS 4LUBA 3LP0A 5CA5A 2DCLA 4LREA 1LNQA 2W25A 2A0FB 5K4PA 3R5BA 1NBEB 2BANA 5IT4A 4QYZK 4J9VA 3VZHA 2APOA 2DTJA 2YX4A 1WTBA 1RBLA 2HFSA 3MMBB 3AOCA 2K1RA 4XK8C 4UOCA 3OXLA 3AXMA 4F50A 8RUCA 2MGZB 4DR3F 1FD2A 1E3CP 2XLIA 4HI2A 3VTIA 2P2CB 3JXOA 3EXYA 4ZA1A 1PSDA 1CJUB 1SUQA 1FWLA 4GVLA 3G9CA 1S6OA 4DDFA 2NQPA 1NKEA 4LF5F 4C8OA 1OO0B 1NSAA 1SV5B 1WD6A 3VAGA 1TKXA 2JOQA 4I64A 4CO2A 4RWXA 3VGSA 3K5PA 3HFZB 1N5TA 3EJMA 1VGYA 5B0CA 4P2SA 3D7SB 1ZOTA 2WONA 2CQ0A 3GJRB 3PIPQ 2C3MA 5F9LA 2ZKTA 1N5YB 3P5TL 4KTQA 2HFVA 4MMOA 1NDCA 5DJBA 1R7IA 1MW7A 2OAUA 4CLSA 1GXLA 4FN5A 4QR0A 2R2TA 2KYZA 1JLAA 4C2MA 4YY3J 2Z2YB 1EJ7L 1PIEA 2ZHOA 3GMGA 4ITSA 4XTTA 1S1VA 4A8WA 2EBEA 3G71S 5EWGA 2OPSB 3D3CJ 5SZTA 2WVFA 4ZPVR 3TOQA 3M2VB 2BOPA 2DNZA 3CJ2A 1HQEA 2YNHA 1KHVA 3W3SA 3PM9A 2GJ2A 1YK9A 4OYWA 4MKBA 2OTLS 4BHQA 1X31C 2Y8YA 4A8MP 1B0TA 4ZP8A 4L76A 4UQGA 1OPIA 1K0TA 2K3KA 1HBMA 2Q79A 4ZLNA 3NAHA 1OYDA 2YVSA 2OTJS 5DLTA 2BE2A 4K4UA 4V19X 2EFGA 4IOAQ 4HLBA 5GAEI 2ALYB 1XQIA 3DLBA 3D0GE 3Q83A 2WB1D 3MMBA 2Y8WA 1SVDA 1S4FA 2JLGA 3QAEA 5D0HA 3CCUS 2MGZA 1F3FA 1YRTA 2UXBF 4LRDA 2AJFE 1UCNA 3R1LA 5KFVA 1HHQA 4P71A 1ICEB 5LMUJ 1NPKA 3HHDA 4QIGA 4ZOSA 4DV2J 2MQMA 4DSEA 1IVZA 4WK3A 4KM4A 1TFYA 2DISA 3V4IB 1DTQB 2VQFF 4X4PA 3QZ7A 2BABA 2D9OA 4ED7A 3OFGA 3CJ5A 2G2YA 3JS9A 2FHMA 1SI9A 3ENWA 1RHMB 4I69A 3W5ZA 3QIPB 3SCLE 4H4KC 2V8HA 4MFBB 1CC8A 1KSPA 3FQLA 4WU2A 4MT1A 3TAMA 2ZH1A 4ZJLA 2AQ4A 2ZBCA 3DGVA 1WJ9A 1LWCB 1S0MA 2CQ3A 3CJRA 5K8MA 2G0CA 1CEZA 2ERRA 2C28A 5KFEA 4PYAA 1U2RA 2FY1A 1RWKB 4WXOA 2W9AA 1KR4A 4X64F 4KV8B 2N4DA 3AJ2A 2MKJA 4YN3B 5D0RA 4NLRA 1O0PA 4RJVA 3TZYA 5GMKa 3THPA 3VAIA 3C14A 4RLEA 3K5NA 2J6UA 1CJTB 2ATCB 1JIHA 3NGSA 1LK7A 2BW2A 1J5EF 4M5HA 3GONA 4WYLA 5KXAA 4I4BA 1XERA 4U9RA 3V6DB 3V81B 4KPYA 3KLFB 5FD1A 2YQ0A 2DNPA 4U95A 4JI6J 2DNGA 2R2UA 1D0EA 3NBPB 4PZVA 1HWKA 1EW9A 1CSJA 1A6LA 4O0IA 2IRYA 2AWZA 3V2UC 2GHWA 2E9TA 4RW7A 3MPYA 2QJ3A 4WE1B 1MMLA 1ZZNA 3MPWA 3T5KA 2I5JB 1MU2B 1TL7B 3MZIA 1FWPA 2PA8D 3N9UC 4PQAA 4DXLA 5F9NA 1F1BB 2KHDA 1CBKA 3DM2A 3T6JA 4B3RF 1X4HA 2XI2A 2BA9A 3C16B 5ETSA 4IRDA 1FI4A 2RQ4A 4GVBA 1Q8KA 3BGFA 2EFNA 2RJZA 3BBBA 4USJC 2LEAA 4URQU 2DY1A 3MM8A 3V4IA 4LRAA 4F4WA 1AJCA 2F8EX 4JYAF 1Y00A 1UFWA 3FCWA 2XLKA 2BR0A 2HQ3A 3J81Y 2VJVA 4E2FB 1JLFA 4MFBA 3J7YI 2VDHA 3BF4A 2HBZB 4ID8A 4NWXA 1PYOB 2UUTA 4WFBQ 2RHSB 1CVJA 2AIRB 4U6PA 2HS4A 4DMZA 3FBFA 4L75A 3VAHA 2KU7A 1KLNA 4DL0C 4KO0B 1ZM2A 1WG1A 2XEXA 2VG5A 3KTQA 1KP6A 1NSPA 1IKXB 1RHRB 2V5HG 4ERDA 2M5YA 3P96A 1NHVA 1KHNA 2VKRA 1J5OA 1BD6A 4UOFA 2MZ1A 4J9RA 1UWAA 3UNYA 4ELVA 4GTYA 2A10A 2RILA 3CEDA 2C22A 3Q8SB 1S59A 4A8XA 4QBUA 1UEKA 3GG1A 4LF9J 3V6DA 3RB6A 2B51A 4R0EA 2DXEA 1T0TV 2DEIA 3JTPA 3OFHA 3MM9B 1UTAA 3L7OA 2HVZA 1X9MA 4JI5F 3R1HA 3US5A 1YJ7A 5KOWA 1YJNS 4UW2A 3IDDA 1SIWB 2R2RA 3ZO7A 3OLAA 3MM7A 2X3DA 5EN1A 2B7CB 2D3ZA 3MXHP 3DLKA 2I8EA 1IJFB 4ER8A 1MROA 4OI4A 5IV3A 2MTLA 1FRMA 4KPCA 3RBXA 2JEJA 1TL7A 5J2MB 2W01A 1LWEB 5DG7A 2IYIA 1B0VA 3QLHB 1VYAA 2W4DA 2COLA 1KRPA 1TELA 3CULA 2WW8A 4YEAA 2QGFB 1FKPA 2GO8A 3IMQJ 2LEPA 4NYZA 3ILJA 1EETA 3EM1A 1VOMA 4Q44A 2B5JA 4QJVA 4F3QA 3RR8A 4ZS6A 3KNGA 3DC2A 3VGVA 2J6TA 1YKWA 2R8JA 1FRHA 3UD4P 2I0XA 3L95X 2MKHA 1MLAA 3JAMY 4FDIA 3BN7A 3CD5A 3J81j 2HAIA 4EK2A 2HNZA 5KG2A 2YKOA 4URGA 4K4YA 2KKHA 2UU9F 3BEGB 1EI6A 3FCVA 2QMXA 4PWDB 2FJWA 2DHAA 3CDWA 4FYXB 4KO0A 1JJHA 2MKIA 1ANJA 4M5DB 4LRFA 5ETPA 3I5AA 1NNDA 1AUKA 5U47A 2RIJA 2QA2A 2BM0A 1H72C 5A8WB 4CNZA 3VQSA 2LFVA 2W4CA 3F41A 1SJFA 3RG6A 2VQRA 3I5CA 3MMCB 2IM2A 1VQYA 4DUTA 1DLOB 3CCZA 3WIUA 4LF8F 1R89A 3CJ3A 1HYSA 1WEXA 3ILOA 3BO3A 1U1OA 4LSLB 2JH3A 1QSLA 4KAIA 3QT7A 3PJXA 5HBMB 3GJQB 5CD4A 1REVA 2EKYA 5KFGA 1Q78A 3GFYA 1U1PA 1DRZA 3R5JB 4E98A 4X4UA 2XMMA 2FLOA 3Q23A 4WXWA 2MPUA 2QL7B 4JI0J 3WBZA 1DTTB 4DR4F 1X0PA 1O98A 2QL9B 3I0RB 2B9YA 2RRAA 3QLHA 2H4YB 5EWFA 1F60B 2RS2A 4ZLLA 1FKOA 3D1QA 3FBEA 1IR2A 4ILMA 3LP1A 1N6QA 5GADU 1Q1KA 4Y2IA 2B6AB 3CMRA 4WZQA 1TL1B 5ITHA 1ZETA 1WACA 1G3OA 1S48A 2FJEB 2WSEC 1JJ4A 1FXDA 1O5JA 2HWIA 4C8LA 1RA7A 4FYWB 2CKWA 4CXUA 3NMRA 3FZBA 2WBRA 3BDGB 2VL1A 4DPTA 1KLMA 1AJAA 1P6TA 5IQQA 1ZPWX 4FVCA 2HQDA 3HVTB 4A8FA 4LVOP 1UA0A 5ETMA 4PWDA 4NMLA 4K4TA 2B0GA 3DOKB 1NSKL 2GCFA 2CQCA 1WKLA 2G9OA 2A18A 3PIOQ 1JXLA 5DRKA 4UY8T 4Y2MA 3W62A 1S6QB 5KFPA 3MEEA 5BXIA 3DI6B 4DLGA 1DLOA 4MHXA 4OYZA 4A48A 5EGEA 2JJ4D 3ENQA 1VLOA 3M7VA 4KFBA 2FVQA 1EKRA 2KDOA 5HJYA 5GAGI 5HBMA 4DPYA 1RT7B 4EEYA 5LRNA 3LOUA 4LF7J 3HZEA 5BR8F 1CPZA 5DZ7A 2C2KB 4UUXA 1SKSA 3GLJA 1HR0F 4F3OA 3T1HF 1H38A 4P2FA 3KHLA 1MNEA 1OQ6A 1VHIA 3PXGa 5HATA 1VRTB 3KK3B 1RKJA 1R8HA 1IR0A 4U8YA 3NMAA 4B3OA 1DTTA 2PMHA 2NZCA 4NCGA 3CDEA 3TZXA 3C15B 3LH2S 2HSEB 2EW9A 2LXUA 4K0KJ 1T05B 2ZH7A 5KG4A 4YHHF 3OR1A 4O3PA 1T94A 2NR0A 2V4JB 4M5LA 3T9NA 2QN6B 2X51A 3DXSX 4Z7YA 1FWKA 3BYRA 1ALIA 2XMUA 2WSFC 2B6AA 4QWCA 2D74B 2HK3A 3CCQS 2YH1A 3G82B 3EX7B 3KFWX 4BCAA 1D1UA 4BWMA 4DSFA 2X1GA 1NHKL 2HK2A 3PRBA 3M9MB 2OPRB 5AXMA 1DQAA 3BZQA 5KFAA 2E1MC 4OHWA 3D6MB 1RT4A 3PVXA 2HFOA 3DCAA 2DR6A 2XHWA 2HFUA 1L3SA 1X5PA 2BEFA 3OTDA 1RT2B 3ZC4A 3N79A 4A8SA 2XS2A 3T5LA 5AJ3J 1E6YB 3GQCA 3HD2A 4BWJA 1NSQA 4LSZB 4A47A 3OT9A 3HXMA 3L09A 3ISND 5HQMA 3DI6A 1V6HA 2J8AA 2PDAA 1P9QC 4W4MA 3CJKB 4P7VA 1T03B 1IR1A 3CC4S 2BACA 5KT2A 1WKKA 4OZLA 3CDBA 2YNFB 3HP6A 2EWHA 2RUGA 5I42B 1HFEL 4KE5A 1NLKL 4KT0C 3W9HA 2W8SA 3TVKA 3TYTA 5B0FA 3EPGA 5A2QU 4RW8B 1OS5A 4RUCA 2IAJA 2KXNB 1RAFB 2M88A 5HVFA 3AOBA 3NNCA 3IM9A 4F8RA 3MM6B 1UW4A 2HZCA 2X98A 1GX6A 3SMZA 1WELA 2R8GA 4BC7A 4IH7A 4QW9A 1H3DA 2H51B 3KJNB 1B99A 2EFQA 3IS9B 2BDPA 3SQOP 3OD2A 1NPRA 4BBYA 4UPKA 3KG0A 4CLKA 3M32A 1NAQA 1HNIA 1RCOB 1J2VA 1D09B 3FMBA 1OY8A 2OEMA 1IWGA 5E0OA 2CNOB 1Y7AA 4ZPAA 2VFTA 3PKYA 4E0DA 3K5MA 3CT9A 3OPKA 3C3LA 2GLQA 4O4RA 1YJTA 4WKYA 4NLPA 2CG8A 2RD5C 1YG0A 5LQQA 3IRXB 5KT3A 1K1QA 1RT1B 1ZEFA 1B7YB 4MH8A 2W8KA 4YDXA 3PX0A 3MR5A 2UUAF 2IJNA 2N4CA 2G2ZA 4B9TA 3PHTA 1E1ZP 3RYLA 5CZXA 1LW0B 1RHJB 1S1XB 2Y1JA 1JJ2R 3HHKA 3LO3A 3ZXWA 3Q8RB 4QU7A 1QSSA 2HNDB 4DV1J 1SH0A 1U02A 3QJPA 4F4KA 4P73A 3H40A 3QBCA 4HDHA 5K5MA 5E3QA 2XMWA 4NI2B 3P49B 3A52A 1JNRB 1XMQJ 1TTHB 4N76A 3EZ5A 2RH3A 4M94A 4OYBA 2H5EA 2UUWA 3PV8A 2KT2A 2HVIA 3ILIA 3M05A 2LQ9A 4CH7A 2FB0A 1S9EB 2MLZA 2OKQA 1FF2A 4HL9A 4JBCA 1XNRF 5I42A 2AHOB 3KHGA 1P9YA 1QM9A 4RU2A 4GO5X 2V2KA 2B43A 4N8OA 3M2UA 4CTAA 1IJEB 4IDKB 4G65A 3BGOP 1B64A 4RW6A 4OZ1A 1RT5B 2ASLA 4CH0S 2DGXA 2HVEA 1NXIA 2BOAA 4LBIA 1TKZB 2IA0A 3ZTRA 5BYRA 4J9OA 5E7OB 2CQPA 3K0JA 5JUMA 4F0KA 2RDIA 3CCJS 2J0XA 2XHCA 4ZG9A 4DF8A 5K8OA 5ETLA 3ZZPA 2WVEA 4DV3F 4ZVFA 1IKWB 1W2BR 3MPUB 4YR1A 1ULRA 1A9NB 3ZZYA 3IA0A 4Z37A 1GNKA 4WP8A 4N41A 2QG9B 2FVSA 3EMTA 2DGTA 1BMQB 3U27A 2O3DA 3M8PB 3UVJB 2OUGA 4OX9J 4WCEQ 2P9GA 4NA3A 4MK7A 3QGIA 3G96A 3TP2A 4FF3A 4UORA 4DUYJ 2GMJA 3FRYA 3DGPB 1OSDA 3D67A 4O44B 1WUUA 4QIWD 2ROEA 3H5XA 1YSJA 1HNVB 3VAJA 2IRXA 5KT4A 3W9IA 1SL2A 3KUEA 5HN0A 3ISZA 1GTEA 3MEDA 4CYSA 2ZOMA 2Y0SD 3DRSB 2Q6BA 4NI2A 1Y3KA 2BUNA 4TY8B 3TG0A 1UP1A 4FDJA 1YJWS 3TAPA 1HNZJ 4LR9A 4HYKA 2YBVA 2JVRA 1RACB 2W2QP 4NOHA 1BHNA 5J2PB 3M1VB 3GR0A 4CXKA 1GH8A 1WHYA 5HMZA 2E9ZA 1U8WA 1K1SA 3T1AA 3EXCX 3KK2B 4P52A 4J9QA 5F0UA 1YBTA 2HIQA 4GRSA 3GIIA 2HEKA 1H98A 3EGWB 2B7BB 2FIUA 2YQ1A 4AQYF 1R43A 1K47A 1MMNA 3RW6A 1RHKB 2P9EA 2M3DA 4ZP7A 4GO7X 3KJVA 4P7TA 4FXDA 1T7PA 3LGHA 3NGUA 4OHYA 3FCHA 3KNAA 4V1Ak 2EFVA 1JLQA 3I31A 2GZOA 1M5HA 2HHVA 2RDJA 2CPIA 4O3QA 4YR3A 4KYZA 1WF1A 2V50A 2XWXA 1G1XA 2LXIA 2WVCA 2D7SA 3OL7A 4NCBA 4ES3A 1CG2A 2C2DA 2C3UA 3UN2A 2M52A 4M5GA 4LR7A 1U0HB 3HJFA 2FVCA 1EAYC 3A4TA 3D1OA 2K2PA 2OPPB 2VQEJ 1TP7A 3A3PB 3M8PA 1KHJA 3B5QA 4KHPF 1IBKJ 4USWA 1YDLA 2K06A 3RBZA 1VQ7S 2R42A 3PFOA 2LMIA 2MQ8A 3DGPA 5IJQA 1PKUA 2AV5A 1VBXA 1UA1A 4RW9A 1FEEA 3KKFA 4F4ZA 3EGVA 2I6WA 4FS1A 4KR0B 2NYIA 1RWUA 1UJ4A 4AL7A 3OR2A 1WDTA 2GVDB 3M6WA 2E9RX 4L72B 4QWEA 2HW3A 3DOLA 1TUGB 1X5OA 4LIWA 1Z1ZA 2BKOA 3QFHA 3M9NB 2W5VA 5J2PA 2W4PA 5A6PA 3BSAA 1B8JA 2Q43A 1V5IB 3IR7B 3T5JA 3DU5A 2AEMA 2V8PA 3R7NB 4TKTA 5KG3A 5L1IA 1V3SA 3CMAS 1HMVA 2ROPA 3QRQA 2QX0A 1VQ5S 4LF1A 3TWZA 3WZ0A 2HGLA 2IM1A 4EZ6A 2MKKA 2CNNB 2L9WA 2XMVA 5GAEU 3MAAB 4J9MA 3RB0A 2VG7B 2DRBA 1CJVA 1N2KA 1YJUA 3IAS9 1NDLA 3BGRB 1N32J 1EB0A 4FBTA 2LP4A 4KH0B 3K2YA 5DETA 4LFAF 3AD9C 2GIFA 1FNXH 3CC2S 4J5OA 2EG2A 2GMLA 2F1FA 3HI9A 1RDRA 2W7OA 1N36F 2CQGA 3D4JA 2KZMA 5KT5A 4CLUA 2H9ZA 2VC0A 3I9ZA 2VONA 2NCKL 1T11A 2RU9A 1TZ0A 1NK7A 2VFSA 3ETOA 4Q8EA 1N0UA 5A8KB 3KLEA 4DV0J 4HACB 2W7PA 3KLHB 2GIQA 4LJMA 2P8IA 4AL6A 2NXUA 1C1BB 2VBWA 4DV6F 1QVGR 1N33F 3AA8A 3HF5A 3UCZP 1G6BA 3D0IE 2VBZA 1IKVA 1FKAF 3D1HA 2W1BA 3V4MA 2FDNA 1FA0A 5KFRA 4PKDB 2Q6CA 3MOJB 3W5XA 2X1AA 2N7CA 3QSIA 2FD2A 2MQNA 2ZITA 1E33P 4RNOA 2FC8A 2RQMA 3QGPA 5LMNF 2WAQD 2M9KA 1WF0A 3N0VA 2KT3A 4OZNA 3RU0A 1KC8T 1PGZA 2M70A 3GIMA 2OSQA 1S9GB 3N4WA 4DR6F 2V9KA 3K8WA 1BQMA 2FJDB 1EHWA 5JJBA 4DN0A 1Q53A 4I1TA 1DJ0A 3QJLA 1Q7LB 1Y3JA 1Y7PA 2PO4A 5B0BA 2J7UA 1N5VA 2YWWA 2VIHA 2OD4A 1YHQS 2QRRA 1J27A 5F8LA 2CPXA 1TV6A 4X4RA 2D1CA 2C3OA 2CIMA 3H59A 2YKQA 2FY8A 1QAIA 4NWJA 4CO0A 3NGKA 4WJBA 2W9BA 2IIHA 1BWVA 3IGVA 2MQLA 2UUCJ 1U1RA 2IMOA 2RHQB 1C1CB 2KZZA 1FDAA 2IBOA 2HQIA 1I51B 1LEOA 1YLXA 2OMOA 4FKXA 3JQKA 3LAMA 4FNIA 1VQKS 3VF0B 2YQ3A 2HMIB 3QPIA 4CO4A 2ALZA 2ZJPQ 4DG1B 4F0HA 2VICA 4C8MA 4M8LA 4DCOB 2C3YA 2XMTA 3C2PA 3NEKA 3PACA 3RUBL 4GC6A 1Y0HA 2XM3A 5K14B 2DHSA 2LECA 1DAXA 1PBUA 4BC9A 5A2QY 1YZ7A 4OMFG 2DK2A 1P1TA 4EBEA 1B3TA 4JI4F 1SKRA 1HL6A 3P8BB 2LQ5A 3ISNC 2LDYA 2N7YA 2IVYA 3I6PA 3DHWC 1VIXA 4IFVB 3G6ES 3J7YU 4JI2F 4I6WA 3GE9A 1C1BA 1QY7A 4H4MA 2G0IA 5E3CA 3PO5A 4B02A 3R7BB 4LF4F 2RAQA 2YKMB 3ITHA 2HFZA 2ZE2B 2FHJD 2DR9A 3UQSA 4X66F 2QSWA 3FUYA 4JV0A 4YQWA 1HI8A 2HHXA 3HZGA 4ID5A 3S01A 5M2PA 5L39A 2BV3A 1HNWF 4NXNF 4YP3A 3DMJB 4K2JA 1URRA 4ZVSB 3W63A 2E66A 2ABYA 3LP2A 1RTZA 2NYHA 3SDEB 2F4FA 4Q0BA 1QD1A 4WF9Q 3G6YA 3BYPA 4QPXA 5J2QB 3QRPA 3HHLC 1M5OC 3B4MA 5J1EB 1BXNA 3CDUA 3D28A 3MM5A 5JMNA 4JI7F 1RAAB 4CLZA 4DR2F 1XR7A 5IWAF 5D3GA 4DUZF 2Q66A 3U02A 3W64A 1X4EA 3SFUA 1P1LA 2R7TA 1FE0A 2W5QA 1GAOA 5GADI 1UL3A 2VJUA 4C11A 4Z2XA 4ECUA 5KFKA 4F4YA 3BO4A 1HA1A 4B3SF 3W2VA 2R7RA 2IC3A 5FJ4A 3EDQB 3C6TB 4MKYA 3UW1A 2LQ8A 2R4FA 5HP1A 4CT9A 3TR5A 5DLGA 5JXSA 4A8YA 1WKJA 1VCTA 2YNIB 3O8WA 1QTNB 4NYPA 4EI2A 4B3MJ 3TARA 3CJ0A 5D4LA 7FD1A 4NE9C 3JQMA 3AA9A 4KQZA 2GGPB 3MR7A 2X1FA
chains in the Genus database with same CATH topology
1EQJA 1HJKA 1O98A 2GLQA 2G9YA 2IFYA 3IGYB 2D1GA 3WAXA 1KHLA 1EW2A 2IUCB 5IJQA 4UOPA 3UN3A 3NKQA 3WAYA 3MK1A 1ALIA 5LQQA 1EW9A 5DLWA 1N2KA 2IUCA 1ED8A 1KH5A 1E33P 2W5TA 2XRGA 3ED4A 1ELXA 4LQYA 4UPIA 4KAYA 4LRBA 4UORA 5GOVA 1ANJA 3Q3QA 1ZEFA 4NWXA 4ZG7A 5L0KA 5L0EA 3WAWA 4LRFA 4LRCA 1ELZA 2GSNA 4TN0A 3DYCA 2GA3A 4MHXA 1FSUA 2RH6A 1ALKA 1KH7A 5EGEA 1AUKA 4ZG6A 4UPLA 3BDHA 4MIVA 3NKNA 1KH4A 3CMRA 4GTXA 4KJDA 3SZZA 5IJSA 5LRMA 2W8SA 1EJJA 4MY4A 1E1ZP 3M7VA 2VQRA 5DLTA 5TJ3A 1URBA 4GTZA 3NKPA 3MK2A 5EGHA 3DPCA 1ZEDA 4CYSA 3T02A 3BDFA 1KHNA 3E2DA 4KJGA 1ZEBA 2ANHA 2W5QA 3NVLA 1AJDA 2X98A 4CXSA 5LRNA 3TG0A 2W5VA 4FDJA 1URAA 3IGZB 3T01A 3M8YA 1AJBA 2W5WA 4GTWA 4B56A 1ED9A 3UNYA 4LREA 4UOOA 2ZKTA 3UN5A 3UN2A 4ZG9A 5DLVA 1B8JA 3M8ZA 3SZYA 4GTYA 5K4PA 1E2SP 2QZUA 3LXQA 4LR9A 4CXUA 2XR9A 3NKMA 4LR7A 3UO0A 1HQAA 1ANIA 5C66A 3A52A 4QAXA 3M8WA 3T00A 2GSUA 3MK0A 5LIAA 4UPKA 4KAVA 1K7HA 3NKOA 3BDGB 1Y6VA 1SHNA 4FDIA 4CXKA 4CYRA 4LR8A 1ALHA 1KH9A 1EW8A 1O99A 4ZGAA 1AJAA 3WAVA 3WBHA 1ELYA 3BDGA 4NWJA 4N7TA 4UPHA 4YR1A 4LRDA 5INHA 1KHKA 5HRTA 4LRAA 1KHJA 3KD8A 3TX0A 1SHQA 3B5QA 1AJCA 2W8DA 3NKRA 4LR2A 3TWZA 1Y7AA 2W5XA 2W5SA 1HDHA 5L0BA 2W5RA 1N2LA 1ALJA 5GRRA 3OT9A 5KXAA 3IDDA 1P49A 1E3CP 5AJ9A 2GSOA 4KM4A 1EI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQJ A;  1HJK A;  1O98 A;  2GLQ A;  2G9Y A;  2IFY A;  3IGY B;  2D1G A;  3WAX A;  1KHL A;  1EW2 A;  2IUC B;  5IJQ A;  4UOP A;  3UN3 A;  3NKQ A;  3WAY A;  3MK1 A;  1ALI A;  5LQQ A;  1EW9 A;  5DLW A;  1N2K A;  2IUC A;  1ED8 A;  1KH5 A;  1E33 P;  2W5T A;  2XRG A;  3ED4 A;  1ELX A;  4LQY A;  4UPI A;  4KAY A;  4LRB A;  4UOR A;  5GOV A;  1ANJ A;  3Q3Q A;  1ZEF A;  4NWX A;  4ZG7 A;  5L0K A;  5L0E A;  3WAW A;  4LRF A;  4LRC A;  1ELZ A;  2GSN A;  4TN0 A;  3DYC A;  2GA3 A;  4MHX A;  1FSU A;  2RH6 A;  1ALK A;  1KH7 A;  5EGE A;  1AUK A;  4ZG6 A;  4UPL A;  3BDH A;  4MIV A;  3NKN A;  1KH4 A;  3CMR A;  4GTX A;  4KJD A;  3SZZ A;  5IJS A;  5LRM A;  2W8S A;  1EJJ A;  4MY4 A;  1E1Z P;  3M7V A;  2VQR A;  5DLT A;  5TJ3 A;  1URB A;  4GTZ A;  3NKP A;  3MK2 A;  5EGH A;  3DPC A;  1ZED A;  4CYS A;  3T02 A;  3BDF A;  1KHN A;  3E2D A;  4KJG A;  1ZEB A;  2ANH A;  2W5Q A;  3NVL A;  1AJD A;  2X98 A;  4CXS A;  5LRN A;  3TG0 A;  2W5V A;  4FDJ A;  1URA A;  3IGZ B;  3T01 A;  3M8Y A;  1AJB A;  2W5W A;  4GTW A;  4B56 A;  1ED9 A;  3UNY A;  4LRE A;  4UOO A;  2ZKT A;  3UN5 A;  3UN2 A;  4ZG9 A;  5DLV A;  1B8J A;  3M8Z A;  3SZY A;  4GTY A;  5K4P A;  1E2S P;  2QZU A;  3LXQ A;  4LR9 A;  4CXU A;  2XR9 A;  3NKM A;  4LR7 A;  3UO0 A;  1HQA A;  1ANI A;  5C66 A;  3A52 A;  4QAX A;  3M8W A;  3T00 A;  2GSU A;  3MK0 A;  5LIA A;  4UPK A;  4KAV A;  1K7H A;  3NKO A;  3BDG B;  1Y6V A;  1SHN A;  4FDI A;  4CXK A;  4CYR A;  4LR8 A;  1ALH A;  1KH9 A;  1EW8 A;  1O99 A;  4ZGA A;  1AJA A;  3WAV A;  3WBH A;  1ELY A;  3BDG A;  4NWJ A;  4N7T A;  4UPH A;  4YR1 A;  4LRD A;  5INH A;  1KHK A;  5HRT A;  4LRA A;  1KHJ A;  3KD8 A;  3TX0 A;  1SHQ A;  3B5Q A;  1AJC A;  2W8D A;  3NKR A;  4LR2 A;  3TWZ A;  1Y7A A;  2W5X A;  2W5S A;  1HDH A;  5L0B A;  2W5R A;  1N2L A;  1ALJ A;  5GRR A;  3OT9 A;  5KXA A;  3IDD A;  1P49 A;  1E3C P;  5AJ9 A;  2GSO A;  4KM4 A;  1EI6 A; 
#chains in the Genus database with same CATH topology
 2IFY A;  4OV1 A;  1WSV A;  2FQQ B;  3Q2T C;  5F8I A;  2YKN B;  4TNO A;  4OZ5 A;  5KFN A;  2C2E A;  1XMO J;  1PAU B;  5KFD A;  1S6U A;  2GSN A;  1RHU B;  3JYT B;  2N3L A;  2H1Y A;  2V2Q A;  1KON A;  2JNJ A;  3JSB A;  4M5N A;  4DL2 A;  1RU2 A;  3D2W A;  2JRS A;  1KTV A;  3PKM A;  3E2D A;  3EVW A;  4JOU A;  2ZE2 A;  1AUD A;  1YIT S;  2QFI A;  5MAO A;  3I32 A;  4J9K A;  3QAU A;  4P2M A;  2EK1 A;  4OYM A;  4NLY A;  3MK0 A;  4FS2 A;  2G1D A;  2RRN A;  2EC2 A;  3MOZ A;  3HVW A;  3SDE A;  5E41 A;  1T8E A;  4ZPB A;  1H2U X;  2MB0 B;  2IDE A;  4IQX A;  1FTC A;  1NB7 A;  2UXD F;  2XS5 A;  3OJS A;  5C5J A;  2AJQ A;  1RTH A;  4PXB A;  1QVF R;  2K8G A;  4N47 A;  2LKZ A;  2CZ4 A;  1ZM3 A;  5M2U A;  4ED6 A;  5D6G A;  1VQ4 S;  4DLE A;  1PYS B;  4DQQ A;  3SV3 A;  3QYY A;  3J7A N;  2CPY A;  2HS3 A;  1R31 A;  3P4U B;  1FFW B;  2WCX A;  1CS4 A;  3VVT A;  3C6U A;  4DPW A;  4J90 A;  2MEW A;  3O3L A;  3M6X A;  5LXY A;  3X1L B;  1HBU B;  4DR7 F;  4YOE A;  5H1S V;  4C8K A;  2XBP A;  1NJI T;  1XMB A;  5HK4 A;  3BGU A;  4RW4 B;  3M8Y A;  2U2F A;  1JQG A;  2K7J A;  4DR1 F;  4ZK7 M;  5KFL A;  2Y3Y A;  2KH9 A;  4JI1 F;  2JL9 A;  2F7V A;  2KG1 A;  4QAX A;  2DHH A;  2ZH3 A;  5ETQ A;  1S57 A;  3G6X A;  3W8G A;  1KH9 A;  1ELO A;  1XTZ A;  1RTI A;  1VQP S;  3QRR A;  4LFC F;  3RAX A;  2F4V J;  3DRX A;  4IQM A;  2ZWO A;  2HHQ A;  3W65 A;  2M4M A;  2MYF A;  1V3R A;  2HRY A;  1EP4 A;  1P49 A;  2DKO B;  2RQK A;  1IBM F;  5A0Y A;  3GP9 A;  1SKW A;  3I4H X;  1UJ5 A;  3OHB A;  3OSN A;  4Q8F A;  2CUY A;  2B4O A;  1S0N A;  3Q3Q A;  3C19 A;  2UP1 A;  3PW0 A;  4B3T F;  1B70 B;  2L9D A;  2L08 A;  3LPY A;  3EZO A;  1NM2 A;  3AHP A;  2DJW A;  1YJV A;  1SPB P;  4FYD A;  1RIS A;  4L74 A;  2F3J A;  4I2Q B;  4LFB F;  3H25 A;  2R7Q A;  3IAM 9;  1Z2Z A;  2EC0 A;  4KRW A;  2V0N A;  2IBK A;  4WTY A;  2MKC A;  5T7L B;  4QU6 A;  4I6A A;  2XR9 A;  3CCE S;  1HQU B;  2JEG A;  1M1H A;  4USK A;  5DDQ C;  6AT1 B;  1R3N A;  3OTB A;  3PG9 A;  3LAL A;  4JB8 B;  2EFP A;  4C8Y A;  3POT A;  2BQU A;  3GV8 B;  1N2L A;  1HLW A;  1M5P C;  1N52 B;  5G4D A;  3GFH A;  2GSO A;  1FRI A;  2CPE A;  3NGT A;  1IBL F;  1HI1 A;  3MAH A;  4LF6 F;  3MK1 A;  2ZM6 F;  4GKJ J;  1RAI B;  4WII A;  1FDN A;  1JWW A;  3TO8 A;  2DGW A;  3DRP B;  1WC6 A;  5K8P A;  5LJ3 Y;  2HHH J;  3AXK A;  3R9L A;  3AY0 A;  1NHU A;  2HBQ B;  2ZH6 A;  5EHH A;  5THW A;  1LWF B;  4KKO B;  4WWS A;  1KHW A;  1EX8 A;  2E44 A;  4J37 A;  2G2O A;  4PEO A;  2CQH A;  3VAL A;  2B3T B;  1VMB A;  3M2R A;  3UN5 A;  3QAT A;  1P27 B;  2XC9 A;  4CCH A;  2Q3P A;  1G7C B;  2BJ7 A;  3BR9 A;  1U1M A;  3ZTS A;  2FGO A;  5F8H A;  2W24 A;  1AUS L;  3SSQ A;  2W9C B;  4CLF A;  4U7U K;  4UZC A;  2WSC C;  2P6S A;  2DH8 A;  5T14 A;  2KVI A;  3HVA A;  3WDO A;  4EUV A;  2WVD A;  2AT1 B;  1VC5 A;  2J7K A;  4PWW A;  5FDL B;  1VBY A;  5DG8 A;  3WC0 A;  4Y2C A;  1UVJ A;  4FXW A;  3GFZ A;  3QO9 B;  4D3H A;  3KLI A;  1HI0 P;  4OQJ A;  5CH7 B;  4FZV A;  3TJA A;  3HSG A;  3ZZU A;  2ZOG A;  3PFE A;  3T19 A;  1GXU A;  4B17 A;  5T7L A;  4DR3 J;  2BRK A;  3H4B A;  2BW7 A;  3LP0 B;  2KB2 A;  2VFU A;  3DOM B;  4QR1 A;  4OHX A;  3ZTQ A;  2QZ8 A;  3DHX A;  2BAN B;  3MWB A;  3F44 A;  3SZY A;  1XN9 A;  4LF5 J;  3OV7 A;  2ADC A;  2RDD A;  2XI3 A;  1T95 A;  3PX4 A;  1PG5 B;  2Y0B B;  1FRK A;  2K1R B;  2DGV A;  2QSF A;  4F2S A;  2J9D E;  3T1Y F;  2UVR A;  2BBE A;  2AX1 A;  3AJD A;  4K5R A;  5L0B A;  1FT8 A;  4DQP A;  3AOA A;  1C4C A;  3CGI A;  4N8N A;  4DU7 A;  1NJW A;  1QLN A;  1SUQ B;  2D1G A;  3WAX A;  2KI2 A;  2DR5 A;  2WW4 A;  1U2C A;  3GR1 A;  1TKT B;  1G4C A;  5L0E A;  1LWF A;  4UZB A;  3PYE A;  4YFU A;  1Q81 T;  2NSB A;  1Q0N A;  1TKX B;  2OO4 A;  1OJ4 A;  3W2W A;  1ZBT A;  1L3U A;  2IYG A;  4K7Q A;  3M8Q A;  2XGP A;  1OIA A;  5E5N A;  2F9D A;  1HWJ A;  2KO1 A;  2KFY A;  1VQ8 S;  2NPF A;  2MZT A;  4WP9 A;  2HBY B;  4CT8 A;  2YWE A;  3HVR A;  4C6A A;  1U24 A;  3CCT A;  1S1V B;  5A8R B;  5FDL A;  1Q7Y T;  5BYQ A;  3CME S;  1SQF A;  1HQE B;  2IVF B;  2AKW B;  3QO9 A;  4NLW A;  2G9Y A;  2X3G A;  2XY5 A;  4IFY A;  5FLX U;  3W7B A;  4DCJ B;  4HH0 A;  2DGS A;  3PYF A;  2J0Q D;  4PUO A;  2XY7 A;  8AT1 B;  1NK0 A;  4LIR A;  2UXB J;  3K17 A;  3DOM A;  2BE2 B;  2IPO B;  5GMD A;  3M8R A;  1R0B G;  2FYX A;  4GKK F;  5CCL A;  5IZH A;  3N5F A;  1VQO S;  7FDR A;  2VBY A;  2H5I B;  1S77 D;  2XZD B;  2VQF J;  5F41 A;  2VF3 A;  3FNN A;  4H4K A;  1FDD A;  3MGJ A;  1C0T B;  2L3M A;  5F3Z A;  4EO6 A;  4ECR A;  4M5K A;  3IFE A;  5HO4 A;  4MKV A;  1QAY A;  3OFE A;  2WZ1 A;  2ZEJ A;  2CRL A;  4HHJ A;  3NS5 A;  3DNC A;  3MF5 A;  1X4F A;  1FK9 A;  3QT6 A;  4NMX A;  3SSR A;  2F8H A;  4H54 A;  9RUB A;  3MEK A;  1TKT A;  4UT4 A;  4YUD A;  4X64 J;  3KG4 A;  1U09 A;  4NZ0 A;  2KG0 A;  4QIF A;  1WHW A;  3BQ0 A;  4R0J A;  4DFM A;  4ZG7 A;  3R6G B;  1WWH A;  3C8Y A;  3RR7 A;  3HPO A;  5SUH A;  3TAM B;  2B4V A;  1KH4 A;  1Q86 T;  1J5E J;  3VGT A;  1I94 F;  2IM0 A;  5IXU A;  1VQL S;  2B8Q A;  5CYM B;  5AE1 A;  3IBW A;  5DM6 Q;  2E7X A;  3QQC D;  4X62 F;  3VR1 A;  2XLJ A;  4YB1 P;  1UZD A;  4OV6 A;  1X4A A;  2OFH X;  5AXN A;  5A8R A;  3M4X A;  2HKE A;  4OX6 A;  1N34 F;  3AQP A;  5HRO A;  1HQA A;  3BKT A;  2C2Z B;  2FUG 9;  4OYP A;  3B8H A;  3QGG A;  3SCI E;  3C14 B;  3Q22 A;  1GQE A;  5FII A;  3GIK A;  4PQU B;  4DV7 F;  4TLQ A;  3L7U A;  2XG8 A;  2F40 A;  1S72 S;  1X5S A;  4C48 A;  4B3R J;  2O67 A;  4DV4 F;  2MZS A;  2PEB A;  1Y9O A;  2UUB F;  3IGY B;  5AT1 B;  3N5B A;  1AW0 A;  4WFY A;  4IG3 B;  2IUC A;  5HJX A;  4OJ1 A;  4RW7 B;  3C66 A;  1S1T B;  2UVU A;  2ZFH A;  3I9V 9;  2BQR A;  2IJF A;  2MZR A;  3NOC A;  4FDF A;  2OML A;  1UFK A;  3R2D J;  2AJ0 A;  5L9X A;  3FEX B;  1YGY A;  1VQ9 S;  1OSC A;  2PI4 A;  4DL4 A;  5G0R A;  1OPZ A;  1VK3 A;  3GPA A;  4JYA J;  4IR9 A;  3ET6 A;  3DM2 B;  3EWG A;  4QYR A;  1FER A;  4ELU A;  1C0T A;  4NLO A;  2W8L A;  3OTO F;  2QMU B;  2POK A;  1AJB A;  1X4C A;  4X4O A;  1WOO A;  1V9O A;  3M8Z A;  1JKH A;  3MMJ A;  4NLQ A;  2QFJ A;  4GVB B;  3D68 A;  2CAJ A;  1RQ0 A;  4IR1 A;  2M7S A;  1MN9 A;  1WOS A;  3SCJ E;  1ITP A;  1U7L A;  1RU1 A;  1ZAW A;  3MM8 B;  2M2B A;  3D0H E;  2UXC F;  5IC4 B;  4MTP A;  2YNG A;  1SH2 A;  3R7S B;  2SXL A;  2VH7 A;  3CVK A;  5DO2 A;  2VDI A;  1U1Q A;  3PX6 A;  4QWA A;  2P5V A;  3K59 A;  3VAF A;  1YJR A;  5F0W A;  3R8Y A;  2R7X A;  4WIQ A;  1NEE A;  1KEK A;  1JLF B;  2W2M P;  4TU8 A;  2XSF A;  4DF4 A;  5IT0 A;  2UZA A;  5ETV A;  2OPQ A;  2O01 C;  5LOQ A;  1HQ2 A;  2EVZ A;  1F9H A;  4QOT A;  4MK9 A;  2VKZ G;  1LKZ A;  3DYA B;  3LQV A;  5L0K A;  2HG4 A;  2GA3 A;  2H48 B;  2GMH A;  3CCV S;  1ALK A;  5CYM A;  2HHW A;  4OZ2 A;  4KY3 A;  2VG5 B;  1L3T A;  4JI5 J;  3H0P A;  3TZZ A;  3SI8 A;  2Z56 B;  4M95 A;  3CD7 A;  3M8S A;  2L9N A;  1T3N A;  3GB0 A;  2GHP A;  1J5O B;  4HH1 A;  3T5H A;  3UPF A;  4QZV B;  3GYX B;  3OTE A;  4NXM F;  3RRH A;  3MEC B;  3GTY X;  2HNY A;  4ZPW R;  3PYG A;  2R8H A;  2B8P A;  2DPI A;  2F65 A;  4PQU A;  3VV2 B;  3FC9 A;  5DG9 A;  1FFG B;  4ZVR B;  1XWL A;  4ANC A;  2AF6 A;  4U8V A;  1UZH A;  1N88 A;  1HW8 A;  2AYE A;  4ZVT B;  3H5U A;  4DX6 A;  4Y65 A;  1R6Y A;  4IG3 A;  3MM7 B;  3KK1 A;  2BKN A;  3SSS A;  4DFP A;  3DLK B;  1WOP A;  1S1T A;  1MRO B;  2FJB B;  3QWU A;  2E1C A;  3UCG A;  3KUG A;  1JLE B;  2IRU A;  3NG8 A;  4CLP A;  2XS7 A;  5E3P A;  3OUY B;  3D54 A;  2XNR A;  3HK2 A;  2DIT A;  2CVE A;  3HDS A;  4Q45 A;  1NKB A;  3KLV A;  3BR8 A;  4XO0 A;  4UPL A;  1FKP B;  3K89 A;  4TYB A;  1KTQ A;  3G4S S;  4JI3 F;  4F0M A;  3G6V A;  2XGQ A;  4FPI A;  2PD1 A;  1EET B;  2OP5 A;  5HVH A;  2B5J B;  3E01 A;  1C0U B;  2UU9 J;  2PEH A;  1U0S A;  1CQN A;  4L6V 3;  3NCQ A;  1U49 A;  1K9M T;  1R0A A;  2QL5 B;  4ZP6 A;  1JX4 A;  1KVI A;  1FCA A;  3G8S A;  3UI3 A;  2QZU A;  4AND A;  3NKM A;  2OEK A;  4B9S A;  4Y28 C;  4MKA A;  2HNZ B;  2GJF A;  5KFQ A;  4ZGA A;  1VLY A;  3O2I A;  4U7C A;  2R7O A;  4PG8 A;  4OYA A;  2Z2M A;  4LF8 J;  1PO6 A;  3BQ2 A;  1HDH A;  4X65 F;  3DDI A;  3I4P A;  1KWM A;  3FQK A;  1I1G A;  3DYA A;  1NKC A;  3W9J A;  1AFI A;  2UV8 G;  3DLE B;  1FX4 A;  1NDP A;  3JQJ A;  4FKY A;  1IKY A;  1NJY A;  2XB2 D;  1H7X A;  1OYE A;  4ZCL A;  4EO8 A;  3CCW A;  2DGQ A;  4X4V A;  3MR3 A;  1XR5 A;  1KH7 A;  3IP0 A;  4I7F B;  5F3T A;  4RNH A;  3TAN A;  4Q2L A;  3NS7 B;  3MEC A;  4R25 A;  4DI6 A;  4O3O A;  2QC3 A;  4DR4 J;  2GFF A;  3UD3 P;  3HSZ A;  1BWE A;  1HYS B;  2C2M B;  2ZD1 A;  1VQN S;  3MFH A;  3PHE A;  2HWH A;  2MXY A;  2N82 B;  3DLG A;  4LBH A;  3FSY A;  1OY9 A;  1REV B;  4OI2 A;  3EYZ A;  2D3O 1;  2F5G A;  3T00 A;  3N28 A;  5LJ5 Y;  2ZDO A;  4MYT A;  1AA1 B;  2R3V A;  2Z8Q A;  2HHS A;  2E5L F;  2YXL A;  4ZCM A;  3PW7 A;  1JLE A;  5IQ6 A;  4HHH A;  2E1A A;  1SC1 B;  2BJ3 A;  3OUY A;  2JDJ A;  2LCW A;  1HAR A;  2HHT A;  4RPF A;  1D8Y A;  3DKD A;  1TK8 A;  4OJG A;  1FKO B;  3Q8Y A;  5HAN A;  3LP1 B;  2OGU A;  1N6Q B;  2HLT A;  4DPU A;  1C0U A;  4DQI A;  1Q79 A;  2FC9 A;  2JEI A;  4WU3 A;  4ZVU B;  1UET A;  1TK0 A;  3ZFV A;  5H9E K;  4USH A;  3NNH A;  1RE1 B;  4ILR A;  2HHU A;  4DFJ A;  2HS0 A;  2DHX A;  5A76 A;  2OD6 A;  1YRX A;  4PG4 A;  3VZI A;  2CA9 A;  4G1I A;  3KOA A;  3BDF A;  5LL6 d;  1GX5 A;  1UKU A;  1X9W A;  2V94 A;  3HJV A;  3VHQ A;  4MK8 A;  1JB0 C;  1SB6 A;  3B82 A;  3HFK A;  1H74 A;  2IJR A;  4P72 A;  3DN9 A;  1WI8 A;  4FBU A;  2DIV A;  1NK4 A;  3FKB A;  5LIA A;  1KLM B;  2CZV C;  1SKU B;  2V8D A;  4XPE A;  2GA7 A;  4P74 A;  4PRF A;  3QWP A;  4EZ9 A;  1NK6 A;  1NZ8 A;  4OLO A;  3EVM A;  3CJ8 A;  1V5V A;  3DLE A;  5KFX A;  2ATL A;  2QIF A;  2RNE A;  3KHR A;  3HT0 A;  3UFC X;  5BR8 J;  1X9S A;  2A1B A;  4CM2 A;  1RTD A;  4O0N A;  1HR0 J;  2QLF B;  1M90 T;  4I7F A;  5H9F J;  3T1H J;  4DV5 F;  3NCP A;  3MEE B;  5L9N A;  3N6M A;  4JV1 A;  1EZZ B;  3IG1 A;  5K8N A;  3EUN A;  5HAO A;  1XC9 A;  3F73 A;  2VFR A;  4KFB B;  3PY8 A;  2YH0 A;  1E6V A;  2VU5 A;  4YHH J;  3R5A A;  2P9C A;  2ROG A;  5C24 A;  1LQ9 A;  1S6P A;  2CNK B;  1O6X A;  2XMK A;  2GQ2 A;  2MKY A;  1VIO A;  2KXH A;  4OJH A;  1R6V A;  4O4G B;  1ZH5 A;  2CJX B;  1KQK A;  1RAD B;  3CCS S;  4B3O B;  3B78 A;  1HHT P;  5EX3 A;  4ZPT R;  4NCG B;  3NKO A;  2KT5 A;  1VC0 A;  4C8Z A;  1NDK A;  2DT9 A;  4C8N A;  1JJC B;  2CVI A;  1ZPV A;  1X7V A;  1IUJ A;  3OR1 B;  2DEJ A;  2KFZ A;  1S97 A;  2OFG X;  1U25 A;  5CYJ A;  1ROF A;  5CZV A;  1SQG A;  1LW2 B;  2ZBP A;  3PR5 B;  2FJX A;  2ZH2 A;  5KFZ A;  2M8H A;  5FLX Y;  2ZUA A;  2DNN A;  4ZCK A;  1VQ6 S;  4I6Y A;  4X4Q A;  3FSI A;  4KH1 B;  1Y10 A;  3BM7 A;  2V2V A;  2MQO A;  1D3W A;  1JLC A;  4NZ6 A;  5I3P A;  4DPO A;  3QT8 A;  5ETN A;  1SH3 A;  4CYU A;  4AYB D;  5IJS A;  1LWX A;  4MJK A;  3NGD A;  3HCX A;  2NLW A;  3I96 A;  5C25 B;  3OFF A;  2M8D B;  1M5V C;  1RT4 B;  3DPC A;  1U6Z A;  3FBB A;  2ZDP A;  4E8U A;  2AEJ A;  1BC6 A;  1W26 A;  3BO2 A;  2QA4 S;  1VRU A;  4ZLP A;  4GMK A;  1Q95 G;  3GIJ A;  1RI7 A;  2DNQ A;  3UO0 A;  8ATC B;  4OFZ A;  4ZN3 A;  3CIM A;  2VOO A;  2B9W A;  2GSU A;  4G1Q A;  1VI7 A;  1F5B A;  1UEV A;  2J9C A;  4IRK A;  4R8U B;  1S0V A;  2GC8 A;  2IHR 1;  2V6A A;  1ZA1 B;  2ZZM A;  1PJ7 A;  1IM6 A;  5D0G A;  5B0G A;  3KMQ A;  4AUK A;  3MFI A;  4IO9 Q;  4IYQ A;  3HSD A;  1NJZ A;  1UW9 A;  9ATC B;  2GAH C;  1FVQ A;  2O5D A;  5ADZ A;  1WC3 A;  2CJQ A;  1JLB A;  3FEY B;  4KAY A;  2QE5 A;  2ZVI A;  1ELZ A;  4Y00 A;  2JZ5 A;  4J91 A;  4DBQ A;  1FJG F;  3RJM B;  3MI7 X;  1QJH A;  4X2B A;  3LAK A;  2N3O A;  1WHV A;  3FZ2 A;  2MLX A;  2IAJ B;  1L5U A;  5KFH A;  2OHD A;  3KJQ B;  4O4G A;  4EBD A;  2YWH A;  1RAH B;  1RXO B;  7AT1 B;  1NME B;  3OQ2 A;  2ZBQ A;  2H54 B;  3ONQ A;  2W5W A;  4GTW A;  1HBO B;  3BN4 A;  3CNQ P;  3H2V E;  4B9U A;  3L3C A;  5DLV A;  2VPX B;  4CLW A;  3FFI A;  4B9N A;  1RBA A;  3M32 B;  1XNQ F;  1HNI B;  2UUA J;  2HRU A;  4ICL A;  3KHH A;  2C2R A;  1NK9 A;  2ILZ A;  5D77 A;  2Z30 B;  4OYX A;  2CQI A;  1IXK A;  1KQS R;  1LW2 A;  1PCA A;  1S1U A;  3OXG A;  1JNZ B;  1Q8L A;  4DU8 A;  4W90 B;  3O1L A;  1R8B A;  3E51 A;  2H5J B;  1URN A;  3Q2S C;  1FTR A;  1UVM A;  1EW2 A;  1YBA A;  4XIU A;  4K4S A;  3SZ2 A;  4I56 A;  3M30 A;  5KT6 A;  3H7H B;  5C25 A;  2QYG A;  1TR0 A;  1HKA A;  4USM A;  2UVV A;  4RUH A;  2CPZ A;  4LVN P;  2AYB A;  2GVZ B;  4PG5 A;  4D3G A;  1U2F A;  2RB7 A;  2VOD A;  4HT7 A;  1HBN A;  4NEZ A;  3UR0 A;  3BSC A;  1XNR J;  1JLG A;  4PPZ A;  3ZTP A;  3RTV A;  1FNO A;  4EGL A;  4LF2 A;  1SJR A;  4R8U A;  1E2S P;  4ED2 A;  4TQR A;  2X1B A;  4O3S A;  2FJA B;  4FF1 A;  2W2P P;  3BDP A;  2KRR A;  3QMQ A;  3QT5 A;  3U7J A;  2DNR A;  5B0D A;  1WDD A;  1S49 A;  3HX9 A;  1KHK A;  2I9S A;  1SJQ A;  4DR5 F;  2XSJ A;  3MDF A;  3ULH A;  3CO0 P;  3A8K A;  4NWB A;  2OIH A;  3MUV P;  2DYA A;  4ECT A;  3W66 A;  4CLT A;  1YBU A;  1RA6 A;  4DV3 J;  4EMD A;  1AFJ A;  3D6F B;  3M2U B;  4CTA B;  1WTF A;  4XDD A;  3NP5 A;  4RW6 B;  2HVH A;  3K57 A;  4LSN A;  1S7I A;  2CZ9 A;  1DHM A;  1H2V Z;  3JSM A;  2G1H A;  1TVR A;  4ZIV A;  4GC7 A;  5D8H B;  1HBO A;  2ZJR Q;  4ED1 A;  4J9U E;  1NUE A;  1WG4 A;  3E2E A;  4ANE A;  4HDG A;  4K50 A;  3A8I A;  2PSZ A;  1O8B A;  3KLG A;  2GQC A;  5HLF B;  1CQM A;  3BJY A;  3IR5 B;  1RT3 A;  2LDI A;  2Y1R I;  1ZA2 B;  1N4L A;  4K4V A;  4DJB A;  3CUN A;  1FFS B;  3TQE A;  5LSL A;  1HNX F;  4MIA A;  3WBH A;  3BH7 B;  4J9L A;  2YX1 A;  1NH7 A;  3LGM A;  4OJ3 A;  3NWR A;  1D9A A;  3CJQ A;  4F25 A;  3CDA A;  3U1N A;  1SL0 A;  2RRB A;  4WFN Q;  1D9F A;  4PXE A;  4JV5 F;  2ASJ A;  1RWO B;  2QYC A;  1T9T A;  3H2L A;  5DLW A;  3NCR A;  4QWB A;  4BLG A;  1XK8 A;  2GVZ A;  4KB7 A;  2HWT A;  1BUX A;  3H20 A;  3ETM A;  2OLW A;  3BSO A;  3MAQ A;  5H9F K;  4ZIT A;  3MED B;  1QUV A;  4NLD A;  3EPI A;  4MY4 A;  2XCP A;  2NXC A;  2YX7 A;  1KQG B;  3NRB A;  3AB4 B;  1UVL A;  3TW0 A;  1TL3 A;  4JI8 F;  4R5P A;  3Q8V A;  3FDS A;  4AQY J;  3K58 A;  3R6L B;  4UOO A;  2VG6 A;  2DVI A;  1R8P A;  1DAR A;  1RSC A;  1CUL B;  1VS3 A;  3AFG A;  1ZZF A;  1MSW D;  4X4T A;  2FZG B;  4DSL A;  4ES2 A;  5E2Q A;  3SV4 A;  3L7P A;  5IOL A;  2I38 A;  3HKZ D;  3CJT A;  3ICL A;  3KDN A;  1TL4 A;  3AH6 A;  5HRT A;  3BBF A;  3NS6 A;  3DLJ A;  2W5S A;  1ALJ A;  3IWN C;  1IQZ A;  1YRU A;  1R0C B;  1UVN A;  4UOH A;  4ZJQ A;  5A6W A;  4P10 A;  4ZVG A;  5KFW A;  2D9P A;  2DRD A;  3KJV B;  4Q2M A;  3IRW P;  1SCJ B;  2W5T A;  2NPI A;  1CJU A;  5MLC V;  2ZHA A;  3TA1 A;  4TN0 A;  3AB2 B;  4C9D A;  1JLQ B;  2FJV A;  2LU1 A;  4TU9 A;  1SV5 A;  4AXI A;  4KHP J;  3MR2 A;  5HLF A;  3MPD A;  1RWW B;  5IM0 B;  3T02 A;  2JVO A;  2E7W A;  3W61 A;  1GTH A;  3JSR A;  2JEF A;  2R7S A;  4PAA A;  3TI0 A;  1URA A;  2KFN A;  2YWF A;  2PC6 A;  1QAX A;  2QV6 A;  3GSI A;  1YQH A;  1H7W A;  1N5Y A;  5CHC B;  3RRG A;  1U45 A;  1ZYQ A;  4Z7C A;  4CYR A;  3L9Z A;  5D78 A;  5C2G A;  2V4R A;  4OI6 A;  4ZVP B;  2EG1 A;  2WTF A;  2DH9 A;  1XEZ A;  4IOC Q;  1HW9 A;  2OPS A;  1RZM A;  1N5Q A;  4RW9 B;  3HHE A;  4NEY A;  2D69 A;  2DNO A;  4IH5 A;  3M2V A;  3CSK A;  1KKH A;  4ECZ A;  3CXC R;  2R8I A;  1FRJ A;  1C2P A;  1T9V A;  3ED4 A;  1R8C A;  4YDD B;  2MY8 A;  3OR2 B;  2NUU G;  2PFD A;  5E3A A;  2C1E B;  2DNY A;  3DOL B;  4CWB A;  4YY3 F;  3BQ1 A;  2BE9 B;  3NKP A;  1XR6 A;  1F2G A;  2J6S A;  1CUL A;  2BX6 A;  2XUL A;  3TEH B;  1Q5Y A;  5JVH Q;  3B6B A;  4LQ3 A;  5ETR A;  2QLJ B;  2DPJ A;  2ZBI A;  2QEX S;  2Y9H A;  1JMT A;  5LXR A;  1OQ3 A;  4LFA J;  4ED5 A;  1HMV B;  2KJV A;  1KVJ A;  4M5I A;  3Q8P B;  2GQQ A;  2DH7 A;  2CAD A;  3FRZ A;  1N36 J;  2NUH A;  4CO3 A;  4FNH A;  4PXC A;  2W8D A;  4F04 B;  4OL8 A;  3PO4 A;  3LWM A;  2XZT B;  4USV A;  3QJJ A;  1TAQ A;  4PXD A;  2BYC A;  3V6H A;  1CJV B;  4MYU A;  2QTW A;  2VPW B;  2V8G A;  3KYL A;  2OH2 A;  1DTQ A;  4LRB A;  3CE8 A;  2IFX A;  3WAW A;  2O1P A;  5IM0 A;  4HHU A;  4L73 A;  4TQS A;  5T41 A;  4DV6 J;  4USI A;  1N33 J;  1RWP B;  4KGV B;  4LT6 A;  3HM9 A;  3QIP A;  2V63 A;  5L1L A;  5TJ3 A;  1S4E A;  4O3R A;  3DXB A;  3OJU A;  1S79 A;  4G1P A;  1RHQ B;  5LMU F;  1LWC A;  3UNG C;  1DQ8 A;  4DV2 F;  1QAJ A;  3KLE B;  3WX4 A;  3NAI A;  4CM0 A;  4PYD A;  3AD8 C;  5LMN J;  2OJ3 A;  4KV8 A;  4OYO A;  3HHL B;  3MR6 A;  1RYR A;  2D3O R;  3EVO A;  1B7F A;  2C42 A;  3M6U A;  4DR6 J;  3KUH A;  5F8N A;  2LA4 A;  4HKQ A;  2R8K A;  1RWM B;  2J9E A;  1KN6 A;  5INH A;  5C7P A;  2LQJ A;  1IKV B;  2BJD A;  1DZ5 A;  1CJT A;  2LA6 A;  3F0N A;  4RR5 A;  5CD4 H;  3PTW A;  3NKY A;  5KFY A;  1U6B A;  2AJ4 A;  1MN7 A;  1U48 A;  3V81 A;  1YX2 A;  3KLF A;  2Y1I A;  1VIS A;  2MY7 A;  3A12 A;  3NBP A;  2KVQ E;  5AXK A;  2CDR B;  2AX0 A;  2R2S A;  2BJE A;  2MST A;  2X7I A;  3DLL Q;  5DDR C;  1BQM B;  4ZVO B;  4EYH B;  4WE1 A;  1DQ9 A;  4USU A;  1EJJ A;  3FSX A;  1H2T Z;  2I5J A;  1MU2 A;  4TLR A;  4DHV A;  1M1G A;  2ANH A;  3NVL A;  1NRK A;  2AZ3 A;  1YZ6 A;  3TAQ A;  1TV6 B;  1YI2 S;  1K8A T;  3C16 A;  4JI6 F;  4HI1 A;  1S5Z A;  1SL1 A;  3UCU P;  4KAV A;  4YB6 A;  5DQH A;  3I55 S;  3BDE A;  2W9B B;  3FGV A;  3FEZ A;  4RBV A;  2CWK A;  4IKA A;  4M63 A;  2W5R A;  4JI4 J;  3SIP B;  1MWY A;  2XTJ P;  4PCQ A;  1RUS A;  4JI2 J;  1FX2 A;  2KHC A;  4DEZ A;  5K20 B;  2BJ1 A;  4KGK A;  4LF4 J;  5KOX A;  4DS4 A;  1AZS B;  3S1T A;  4X66 J;  1FSU A;  3UE2 A;  2FVP A;  1WC4 A;  1WEZ A;  1HNW J;  2RSQ A;  5L1K A;  4NXN J;  3FJ2 A;  3BBC A;  2XZW A;  4X4S A;  1W25 A;  2KYX A;  4NLX A;  5LT5 A;  3HHL A;  1QUP A;  1EIY B;  1IKX A;  3Q8Q B;  2ZBR A;  2CJY B;  1F9E B;  4CLL A;  4AT1 B;  4H4M B;  2MQQ A;  2YPZ A;  4JI7 J;  2EEY A;  3ITH B;  3GJS B;  1VR6 A;  3X3U A;  1R27 B;  5EGY A;  2VUG A;  5KFC A;  4DR2 J;  1RP5 A;  2BVZ A;  4TVA B;  5IWA J;  2JFD A;  5CQG A;  4QPT A;  4DUZ J;  1T02 A;  2W2N P;  4IUF A;  4ID5 B;  2NSC A;  1TK5 A;  2W2O P;  3NGR A;  4ZCI A;  2DR7 A;  3KD8 A;  3SEO A;  1UVK A;  4URS A;  2CQ2 A;  1CLF A;  3LP2 B;  2ADB A;  4ENO A;  3G8T A;  3BKF A;  4Q0B B;  3MM9 A;  4Y34 A;  2V67 A;  2E1P A;  1VQS A;  4A4J A;  4B3S J;  3UD5 A;  4OI0 A;  2DO4 A;  5KFO A;  1T3O A;  3A8E A;  3UR3 C;  2XRG A;  3MM5 B;  1CC7 A;  1GK8 A;  4CP5 A;  2OEL A;  1BGX T;  1RAJ A;  1YWX A;  2AEF A;  5J2M A;  1LWE A;  2MSS A;  2BXJ A;  2Y1L B;  2ZKU A;  5D3G B;  4RBU A;  4ZVH A;  1F6T A;  2ZC4 A;  4F4X A;  3PNI A;  1Q8I A;  2XQC A;  4LF9 F;  1URB A;  5EGH A;  3NY0 A;  1ZED A;  3J80 U;  1FNM A;  5D4N A;  4FYY B;  4C11 B;  3J7Z 5;  3W1Y C;  5IS2 A;  2E1R A;  3W2V B;  2IA6 A;  1AB8 A;  2IC3 B;  5HP1 B;  1WNE A;  3CB4 A;  2KJW A;  5DM7 Q;  1PC4 A;  1S7H A;  1VDH A;  4NLS A;  3IWX A;  2XCA A;  2HIY A;  2CPF A;  1YVF A;  3SYZ A;  2XO7 A;  2AGP A;  3ZZR A;  1Y11 A;  1UVI A;  4DOZ A;  3JSY A;  1GMU A;  3EIC A;  3GV7 B;  4ELT A;  3CC7 S;  1AZS A;  4DN9 A;  5B09 A;  4HR2 A;  3NKQ A;  2VAS A;  4F67 A;  4Y3C A;  3DYC A;  2I2Y A;  4FVM A;  4M5D A;  4RO0 A;  3GG0 A;  3OVB A;  2UXD J;  5HMW A;  1WSR A;  1L3K A;  5A8W A;  2CQ1 A;  2XMJ A;  3MMC A;  3K7R A;  4N56 A;  5D4P A;  1PIL A;  1KOH A;  2D41 A;  4ECQ A;  2VOP A;  1BE4 A;  4NAS A;  4DL3 A;  1TUV A;  3IN5 A;  4LSL A;  5C66 A;  2FLN A;  3OL8 A;  1RB0 A;  3MTJ A;  2BE7 D;  1C4A A;  1ZTT A;  1U4B A;  4UPH A;  2XNQ A;  4MIB A;  4DR7 J;  1KNZ A;  1JXV A;  1F5A A;  1RTH B;  3OW2 R;  4RNM A;  2JSX A;  3O5T B;  3G2X A;  1NK5 A;  4DR1 J;  4NA1 A;  3NXZ A;  5DQG A;  3FBC A;  5HQ8 A;  5L46 A;  3SQG B;  4JI1 J;  3I0R A;  3H98 A;  2E5J A;  1Y4Z B;  1F2H A;  2NXJ A;  3VGU A;  2AJ2 A;  1YJ9 S;  4KGM A;  1CS4 B;  4UOG A;  2RH6 A;  3C6U B;  4LFC J;  4BS2 A;  2YWG A;  1KDN A;  2R7U A;  5F8J A;  1A0O B;  4C97 A;  2MDA A;  4ZP9 A;  3NKN A;  3ZZO A;  4OHV A;  4O3N A;  3HT3 A;  5C2C A;  5B7W A;  3UDE A;  2KM8 B;  1U47 A;  1TL1 A;  4ED8 A;  1TUW A;  2CDQ A;  3QGH A;  5KAK A;  1IBM J;  1K0V A;  2CYY A;  1N0V C;  5E3R A;  4DSJ A;  4JI0 F;  3BPS P;  3KWM A;  2JC0 A;  4PG6 A;  1FJ7 A;  4DL5 A;  2B9E A;  4B3T J;  3JTN A;  2AMC B;  2RKI B;  1RTI B;  2L48 A;  1ALH A;  4LFB J;  4ZPC A;  2HQG A;  3BDG A;  4ECX A;  4K5S A;  4WP3 A;  2J5A A;  3A8J A;  1FHT A;  1EP4 B;  4EWT A;  3HVT A;  3N6L A;  5A0Y B;  4ZVE A;  2JFK A;  3UDV A;  3IO1 A;  2YPY A;  3K5L A;  5IV4 A;  1FD8 A;  2WVB A;  3NNA A;  3DOK A;  4UUW A;  3RW7 A;  2GV1 A;  1FES A;  3MMA B;  5HI7 A;  2JWN A;  2NXE A;  1S6Q A;  1G2E A;  4K2X A;  4L3N A;  4GTX A;  6FD1 A;  1KS2 A;  2DXD A;  4UTG A;  4ZVQ B;  4HEA 9;  1IBL J;  4RNF A;  2VB6 A;  3T6B A;  4LF6 J;  1V3Z A;  3WX8 A;  2ZM6 J;  1RT7 A;  2HZA A;  2AYM A;  1PBA A;  4LBP A;  3D6T B;  5GAH U;  4DS5 A;  1RAO A;  3TUP A;  4TY9 A;  3IM8 A;  2E29 A;  2IMW P;  3AT1 B;  3ILL A;  1VRT A;  3KK3 A;  3POT B;  5KFS A;  4NRT A;  3SQG A;  3HHL D;  5DZ6 A;  2A3J A;  5LSO A;  3C15 A;  3RB3 A;  1X60 A;  1H0H B;  1GT8 A;  2LEB A;  3W8P A;  3I0S B;  1T05 A;  1EQ0 A;  2HQF A;  1MG7 A;  2E5G A;  4WKR A;  2PFF B;  4TXS A;  2V4J A;  1VFJ A;  4DX8 H;  1LXJ A;  3B54 A;  4LF7 F;  1N54 B;  4V19 J;  1ZM9 A;  3IBC B;  1CJK B;  5B0E A;  4TU7 A;  1U1K A;  3P5B P;  2DBB A;  3LW5 C;  1U6F A;  3G82 A;  3SZZ A;  4JUZ A;  2UVW A;  2CQB A;  4QIE A;  3MK2 A;  3BSN A;  1OWX A;  1IQT A;  2OPR A;  1N5S A;  3M2R B;  4J7C A;  1B0P A;  3HKW A;  3MHY A;  4K0K F;  1PC5 A;  3BKU A;  3S7R A;  1ZEB A;  2EXU A;  2RKI A;  2WBM A;  3TRG A;  1NPP A;  4OI1 A;  2ZNY A;  2IM3 A;  2HUR A;  2XY6 A;  1KQF B;  2JLE A;  4RL1 A;  3I82 A;  2V69 A;  4DL6 A;  4YS2 A;  4CI0 B;  5HSP A;  3GCX P;  3LUY A;  3I5B A;  3IGN A;  3MUM P;  1RT2 A;  4N7T A;  3CD0 A;  1BQN B;  3OHA A;  3FK4 A;  3D3B J;  4LR2 A;  5CAA A;  4WFA Q;  1GFW B;  3Q8U A;  1RT6 B;  1E6Y A;  1KOO A;  3ELH A;  1B4S A;  4ILL A;  1U1L A;  3GCW P;  3MMA A;  1HJK A;  2BJ8 A;  3D6H B;  3JTO A;  2MKS A;  4DSK A;  3RRK A;  1SIZ A;  3RBE A;  3KLI B;  1TFW A;  1S1W B;  3VVU A;  1VJW A;  3CJK A;  1T03 A;  4PR6 A;  3DU6 A;  3T1Y J;  3RAQ A;  2YNF A;  3N01 A;  2KTQ A;  3BS9 A;  5AE2 A;  1RBO B;  3O44 A;  5AJ3 F;  3H2U B;  1W7W A;  2BRL A;  3U1L A;  4ED4 A;  4RW8 A;  5F8G A;  3BH6 B;  2GS8 A;  4OX7 A;  5DDO C;  3IGZ B;  4C98 A;  4B56 A;  3MM6 A;  4PWU A;  5CAB A;  2VHG A;  2XYG B;  1QE1 B;  3NOG A;  4UST A;  2LLZ A;  3T3F A;  3QFW A;  1PYT A;  2CJ9 A;  4F26 A;  2ZJQ Q;  2DIU A;  5HVG A;  3HHN B;  4LR8 A;  3IS9 A;  2PE8 A;  3I0S A;  1XJW B;  4NL5 A;  2UV8 A;  1SBR A;  2PMW A;  2BM1 A;  3A1Y G;  4LQ9 A;  1LV5 A;  2RVJ A;  1M5S A;  5IT9 U;  1RJJ A;  3GYG A;  1CJK A;  3EZU A;  4OHZ A;  3CWJ A;  2OSR A;  3A3O B;  4A8O A;  1RAE B;  3UN3 A;  2VA2 A;  3EE3 A;  3V6K A;  4K4Z A;  4DCP B;  4ZHR B;  4NRU A;  3F56 A;  3E8O A;  3IRX A;  1S9F A;  3W2W B;  2DGO A;  2C2N A;  1FJE B;  1RT1 A;  4ZIW A;  4Q5V A;  1KD1 T;  2BJ9 A;  4B08 A;  1T9U A;  4IO1 A;  2V9W A;  5F8M A;  4P6Q A;  4MIV A;  2EKN A;  1Z4U A;  3M8Q B;  3TEG A;  4Y2K A;  4U96 A;  5DDP C;  3PDN A;  1LW0 A;  4O23 A;  1S1X A;  3L4B C;  3MTK A;  1WC5 A;  4C3L A;  1RKI A;  2ZOF A;  2HND A;  3CCM S;  1APS A;  1BQN A;  5DS7 A;  3RBD A;  1FDB A;  4ZPD A;  3M8W A;  2RE1 A;  3D5M A;  5HQL A;  1RT6 A;  2DO0 A;  4LMZ A;  2CPH A;  4ED3 A;  3TNV A;  4GKK J;  3PCO B;  3WAV A;  1AT1 B;  4OI3 A;  5IC6 B;  4ECY A;  5C42 B;  5RUB A;  1S1W A;  1TU0 B;  5AJ9 A;  4I67 A;  3P45 B;  1KBR A;  3GJT B;  4IFY B;  1S9E A;  4DSI A;  3BV8 A;  1KVK A;  2CG4 A;  1T9X A;  4WBF A;  3TZW A;  4PUO B;  1QTM A;  1ELX A;  4DV1 F;  1GMV A;  5JVG Q;  4F7V A;  4KSE B;  2R7W A;  1DY3 A;  1VQM S;  4IDK A;  1XMQ F;  1LK5 A;  2RS8 A;  3ZZ0 A;  5LRM A;  1EQM A;  1RT5 A;  2HLU A;  2Z58 B;  3A13 A;  3PW5 A;  1SJ1 A;  2DY9 A;  4GTZ A;  1X4B A;  5DGA A;  1PAE X;  1QE1 A;  1TKZ A;  1IM4 A;  3S8S A;  2AW0 A;  2D3U A;  2DR8 A;  1RAG B;  2Z57 B;  3OVS A;  1GMW A;  1Q4R A;  1REG X;  4C7Q A;  3D9B A;  1FO1 A;  4A8Q A;  4AFF A;  2FHJ A;  2HFN A;  4F36 A;  1LOU A;  1X5T A;  4CO1 A;  3CD6 S;  2DNH A;  1I94 J;  3KXD A;  2ZH8 A;  1I6J A;  3CMQ A;  1KFS A;  3VWS A;  3WIV A;  3RZA A;  1IKW A;  1FK9 B;  3MD1 A;  2Z4P A;  2VV5 A;  4I68 A;  5LSR A;  1UWB B;  4X62 J;  3PRV A;  1ZM4 A;  1WC1 A;  4ZHR A;  2KL8 A;  3HMJ G;  5L38 A;  3NL0 A;  1K44 A;  4UOP A;  2PN6 A;  4AL5 A;  1U1N A;  1N34 J;  4MAK A;  3UVJ A;  2K7K A;  4ZMM A;  4ES1 A;  2ZH5 A;  2OEJ A;  5BYS A;  1SXL A;  3HD1 A;  2BZ2 A;  2DXF A;  4PG7 A;  3ZTO A;  4DV7 J;  1WEY A;  3BDH A;  4O44 A;  1AYE A;  1NJX A;  1NU4 A;  4QIV A;  1Q8B A;  1F5C A;  1U8S A;  4DV4 J;  2BKP A;  4JP8 A;  2MLY A;  1HNV A;  4P9S A;  3GWC A;  3H5S A;  2UUB J;  3CIZ A;  1LXN A;  2YKA A;  4N77 A;  2AZ1 A;  1Q82 T;  2MHN A;  4RKU C;  1QSY A;  4KJI A;  5E33 A;  3J80 Y;  2MJU A;  1GXT A;  1XIQ A;  3DRS A;  1F3V A;  4IG0 B;  1EAR A;  5KFB A;  4TY8 A;  5HRO B;  4C3M A;  4F02 A;  2HRT A;  3NLC A;  4ETZ A;  4OX9 F;  1DFD A;  2V8V A;  2MZJ A;  4F4A A;  3BRE A;  2NS1 B;  5I3Q A;  5C42 A;  4DUY F;  4F3M A;  2H3E B;  4HT5 A;  3M1V A;  4NX9 A;  6FDR A;  2ZNZ A;  2H4W B;  1FJC A;  2B4P A;  3AOD A;  4CDI A;  3Q0A A;  1RCX B;  3PJW A;  3OTO J;  3KK2 A;  3PEH A;  2AU0 A;  5EUH A;  3TUJ C;  5AXL A;  4NA2 A;  2IUC B;  3OLB A;  3PEJ A;  2DGU A;  2Z2Z A;  1WF2 A;  1VJQ A;  1RAB B;  2EBG A;  2HGM A;  5GME A;  3U1M A;  5KFJ A;  1HNZ F;  4AXJ A;  5D15 A;  2VPY B;  3LA0 A;  3VQT A;  1M1K T;  2UXC J;  2QMW A;  1PJ5 A;  5G0R B;  3PYD A;  1VHF A;  2ASY A;  3AD7 C;  3MCO A;  3ET6 B;  4C3K A;  4KJD A;  1F0X A;  1SJ3 P;  1XBW A;  2QLB B;  3PRD A;  5DQI A;  1K73 T;  2K3I A;  3AAW B;  1ZS6 A;  1O51 A;  4KJG A;  3G87 A;  4QCL A;  3QZ8 A;  3THT A;  4M1K A;  3S6E A;  1JKH B;  5B08 A;  4HTI A;  1ED9 A;  3Q24 A;  3TJ9 A;  3PJ9 A;  4KIA A;  3H5Y A;  1UWB A;  1Y5I B;  1JK9 B;  4OIX A;  2YNG B;  2R9L A;  1UAW A;  2VA3 A;  2YWK A;  4Q7A A;  1U0H A;  1FRX A;  4RBT A;  5H9E J;  2J7W A;  4CH1 A;  3V6J A;  4KC5 A;  4TYA A;  1VRQ C;  1HIY A;  2CJK A;  3EDR B;  2OPP A;  1W2I A;  3GYN A;  4YB7 A;  3OL9 A;  1X0F A;  4NLG A;  1M0S A;  4NXM J;  3A3N B;  1BY9 A;  4KGZ B;  2OPQ B;  3TJ8 A;  2EK6 A;  3OSP A;  2V4Q A;  1FE4 A;  1SQE A;  3GIR A;  1HHS A;  4DQS A;  2KRB A;  5HL7 Q;  2HGN A;  2HPU A;  2GJI A;  5AE3 A;  3HFV A;  4ECS A;  4FF2 A;  3MCS A;  4WYW A;  2NXN A;  2V68 A;  1UJ6 A;  2WOM B;  3J7A 1;  1ACM B;  2RF2 B;  4IG0 A;  2VQE F;  2DB1 A;  2E7V A;  2JC1 A;  4I0W A;  4AE5 A;  2GVD A;  3KG1 A;  4ALZ A;  2CQD A;  2HNY B;  1IBK F;  2QLX A;  2L41 A;  1D8Z A;  5DLF A;  4J9N A;  1NH8 A;  1S99 A;  3MCM A;  3IXQ A;  1X8D A;  4DFK A;  3JB9 k;  1TL5 A;  3NWG A;  5ETK A;  2A2D A;  4J9P A;  4JI3 J;  1O99 A;  3WC2 A;  2HVD A;  2JX2 A;  3KK1 B;  4NZ7 A;  2CWX A;  3PW4 A;  5KG6 A;  4UQT A;  3BGL A;  3DLH A;  2WK4 A;  3RAM A;  4N5S A;  4PPD A;  3MAA A;  2XMA A;  3CPW R;  2DNL A;  2ZWP A;  3LTO A;  3MEG B;  2VG7 A;  2CPJ A;  4UPI A;  2ZZN A;  3CF5 Q;  4ECV A;  2QLW A;  1HD0 A;  3BGR A;  1HWU A;  5KG1 A;  2FZK B;  3E01 B;  2EI5 A;  4X65 J;  1RWX B;  2M0G B;  3P3D A;  2XYH B;  2WHO A;  3SCK E;  4K4X A;  1R0A B;  2CJA A;  1WHX A;  2J0W A;  3CO9 A;  2FZC B;  1RWV B;  4YR0 A;  1UFL A;  1WI6 A;  2VZ9 A;  4XPC A;  1AXQ A;  5ETO A;  5A8K A;  3TQ1 A;  4DWI A;  2LVW A;  2DD8 S;  1N32 F;  4HAC A;  4FP9 A;  2Z0G A;  1BQX A;  1UPM B;  3BB5 A;  4DL7 A;  4C0B A;  3RB4 A;  3H90 A;  4OX8 A;  3KLH A;  2HHP A;  2A6O A;  1FRL A;  2HAF A;  4NPO A;  3TX0 A;  4CO5 A;  4QW8 A;  3SXL A;  3CTR A;  1GMW D;  2MQP A;  3TA0 A;  4M5J A;  4QWD A;  1S0O A;  2J76 E;  1IKY B;  5KG5 A;  2DNK A;  3I56 S;  1MMD A;  4KBI A;  2XWY A;  2WOM A;  4LQY A;  3EGN A;  2RF2 A;  4FPR A;  2QO3 A;  4CNY A;  4DV0 F;  5D4O A;  1D9D A;  4B9L A;  3TX8 A;  2E5L J;  3QID A;  4OZJ A;  2J9D A;  5CYQ B;  4WFX A;  2ILY A;  3OL6 A;  4Q43 A;  3OTC A;  2ZD1 B;  1S9G A;  1AJD A;  3ENA A;  4H4O B;  2QA4 G;  3DLG B;  4NLU A;  1N56 A;  2GO9 A;  1ZAX A;  1L3V A;  2LQB A;  5EX0 A;  4WTO B;  2ACM A;  5DGB A;  3B4D A;  2ACY A;  2LU2 A;  2ZH4 A;  3DRY A;  2RUS A;  2F8M A;  3R97 A;  2W5X A;  1OY6 A;  2MHE A;  3ZZZ A;  3MEG A;  4UY8 5;  4TN2 A;  5CCM A;  1BLU A;  1C1C A;  3R5G A;  4NYO A;  3I87 A;  3CJS A;  1RTJ B;  2XYP B;  4K4W A;  1KH5 A;  2DCU B;  2FHO B;  5B0A A;  3TVZ A;  2C3P A;  2HMI A;  1FXL A;  1N8R T;  2A2C A;  2V2Z A;  4WFZ A;  4RWW A;  4DG1 A;  4ZG6 A;  4Y0F A;  2LYV A;  4RNN A;  3FMW A;  1HPZ B;  1X4D A;  1TAU A;  1WG5 A;  1Q5V A;  2YY3 A;  2DHG A;  5K14 A;  3WHI A;  4QR2 A;  3QNW B;  4W92 B;  4DV5 J;  2UUC F;  4F2R A;  2YKP A;  1Z2L A;  3GU0 A;  3GSD A;  3LXQ A;  5IFM A;  3LAN A;  1IN0 A;  4IFV A;  2QA1 A;  2QT7 A;  4L3K A;  1IBC B;  5BJR A;  2CFX A;  3PW2 A;  4CRJ A;  3UDL A;  3CCR S;  3LWL A;  2YKM A;  1ELY A;  2XO6 A;  4B9M A;  3KMS A;  1SHQ A;  2WB4 A;  4FYV B;  1RTD B;  3UWT A;  5IT9 Y;  5CXT A;  3DMJ A;  1QDU B;  4RUA A;  4KHR A;  5I3U B;  3P6Y C;  4EU0 A;  5CYQ A;  3IG1 B;  4CLY A;  5GOV A;  1OMS A;  5J2Q A;  4WPA A;  1UEU A;  1VC6 A;  5J1E A;  3H4D A;  1E6V B;  4NLV A;  3H42 A;  5C24 B;  5KG0 A;  4H4O A;  4BDP A;  1S6P B;  1DUR A;  3SFG A;  3W60 A;  4C0O C;  3TA2 A;  4DX7 A;  4QYZ J;  5LM7 E;  1SC6 A;  3GFX A;  3R5D A;  2VD3 A;  2B56 A;  3LF0 A;  2R7V A;  3ENV A;  4FF4 A;  2RML A;  3R2C J;  1MWZ A;  1T9Y A;  2LXF A;  2KN4 A;  3ZNU A;  4ZKA A;  3GIL A;  3LGN A;  4ATN A;  1DBD A;  4DZD A;  2F63 A;  2EFO A;  2PI5 A;  3C6T A;  1Y6V A;  3THV A;  2DRA A;  1SHN A;  4EYI B;  2W7A A;  2YNI A;  2IVM A;  5I4M A;  1RTJ A;  5J2N B;  1FVS A;  2F9J A;  3MUT P;  5KFF A;  2RU3 A;  2ASD A;  4DQR A;  4XDC A;  4IOB A;  4MIW A;  2U1A A;  3D66 A;  2FHK A;  2GGP A;  3M6V A;  4C4W A;  3VCD A;  5L8R C;  1RK8 A;  2ZH9 A;  1HPZ A;  4M5M A;  3G8Q A;  2YKN A;  2HQC A;  4OZ0 A;  5KT7 A;  5K9F A;  3QSY B;  1JLC B;  2PGC A;  3IWL A;  4CYU B;  3TVY A;  3KJF B;  2VBX A;  2E5H A;  3N6N A;  3JYT A;  4P75 A;  4B3M F;  1KFD A;  3E3X A;  3AQO A;  3O6Q A;  2FTR A;  5ETT A;  1VRU B;  1RLD A;  1SJ4 P;  4CXS A;  4ECW A;  3T01 A;  1YIJ S;  1TQL A;  4IH6 A;  5J1P A;  2VC1 A;  2JLF A;  3GV5 B;  4G1Q B;  2FLP A;  3J7Z T;  2FVR A;  1Y5L B;  1FJG J;  5HMX A;  1XMO F;  1WC0 A;  2GW8 A;  3IC1 A;  1R8A A;  2AP6 A;  4X84 A;  1NO8 A;  4U67 Q;  3MPV A;  1EW8 A;  4ZLJ A;  1I5O B;  2ZZT A;  1LFP A;  3K5O A;  5GAH I;  1NK8 A;  2ZHB A;  2G13 A;  3UDC A;  5I3U A;  1RYS A;  3TUI C;  3IBF B;  3HLU A;  3PR4 A;  5GRR A;  4G3I A;  3PZP A;  3T9Z A;  3J81 U;  3R5C A;  3ZZT A;  1EQJ A;  2NZ4 A;  2FGC A;  1ARO P;  2GAG C;  4S0M A;  1KHL A;  1VBZ A;  1JLB B;  3WAY A;  1XNQ J;  1WOR A;  1RWN B;  4KHM A;  1ED8 A;  1Q16 B;  2RT3 A;  5J1N A;  1MWQ A;  4EBC A;  2PII A;  5GAG U;  4DZ6 A;  4CQ1 A;  2O66 A;  2OI2 A;  1ZAV A;  2E5I A;  3DFE A;  2P6T A;  4RZR A;  2I1R A;  3LPE A;  2CXE A;  4A46 A;  3K8V A;  1ZTW A;  4I2P B;  4EFA C;  3H8Y A;  1A7G E;  4CZC A;  2AYG A;  1HBU A;  2FLL A;  4ETX A;  3DDK A;  3FFI B;  4QQB A;  1F9F A;  1IWA A;  4RW4 A;  2AGQ A;  2IY5 B;  4ICL B;  3Q89 A;  2YTC A;  1PJ6 A;  3ZNJ 1;  5J2N A;  5EDW A;  3HUL A;  4CIO A;  4ZJO A;  3VAM A;  1FXR A;  1K7H A;  3OBI A;  4AD6 A;  2Q1L A;  3DDN A;  4WZM A;  2PMZ D;  1S1U B;  4YR2 A;  3GZ7 A;  1TMM A;  2VPZ B;  3W5Y A;  3HSJ A;  2PA3 A;  1JXE A;  1T9W A;  1NB2 A;  4PAB A;  2AJ1 A;  4ED0 A;  4NCA A;  4RUB A;  4XAK A;  2IDL A;  5HMY A;  2CPD A;  3M30 B;  3T41 A;  4OZ3 A;  2KM8 C;  4Y2A A;  3MD3 A;  4FXV A;  3AJ1 A;  3WQP A;  2AGO A;  1P8G A;  1LFW A;  4OLP A;  1I3O B;  2V34 A;  3SBM A;  3Q86 A;  4Y6I A;  4DR5 J;  1SC3 B;  1HWL A;  2BQ3 A;  2HYI B;  1HBN B;  4I2Q A;  5KTQ A;  1H6K X;  1JLG B;  4X4N A;  2F4V F;  4ZDN A;  4YB5 A;  5KFT A;  4JV2 A;  1X4G A;  2B4U A;  2NRE A;  1FEH A;  1HD1 A;  2J0S D;  3RGI A;  4ZN1 A;  3DRR B;  2PT0 A;  5L1J A;  3OXF A;  3R27 A;  4NLT A;  3JAM U;  2CNL B;  3HO1 A;  5KFI A;  4OYI A;  1HQU A;  2CQ4 A;  3V5R A;  4DPX A;  3TUZ C;  4IRC A;  1NZA A;  2XSJ B;  1YTY A;  4KGX B;  2EPI A;  3OVA A;  2AD9 A;  5M2R A;  1VK8 A;  4W98 A;  1UMJ A;  5EWE A;  1UPP A;  4K8R A;  4U7U D;  4RX6 A;  3CW2 C;  5D0E A;  4A8K A;  4YME A;  1NCL A;  4LSN B;  1N48 A;  2DNM A;  3FVY A;  2C2O B;  2FPH X;  2WRM A;  1HNX J;  2ZVS A;  2GNK A;  3JSM B;  4I2P A;  4B9V A;  3DRP A;  1M5K C;  1TVR B;  3M9O B;  3MUR P;  2HZV A;  3C46 A;  1VBK A;  1S76 D;  2MJN A;  1HWI A;  2GHV C;  4JV5 J;  3KLG B;  3CJ4 A;  2B9X A;  1TMJ A;  5KFU A;  4KKO A;  2JHE A;  4DX5 A;  3IR6 B;  1RT3 B;  2HBR B;  1RLC L;  4RU9 A;  1RGV A;  4WK1 A;  3G86 A;  4HTJ A;  1ANI A;  1EKS A;  4GKJ F;  2WON B;  3BPD A;  3MCN A;  2MMY A;  4P2X A;  2GX8 A;  2GIR A;  4G6V B;  2HHH F;  1S12 A;  2KXF A;  2W9C A;  4HVZ A;  2VFV A;  4C0H A;  4JI8 J;  2CJB A;  3NKR A;  2Z2L A;  3KDO A;  2ZUG A;  1SC4 B;  1JLA B;  2BMB A;  3R3T A;  2ZC3 A;  1TKD A;  2J8S A;  2MZQ A;  1Y5N B;  2G0J A;  5KFM A;  2A6M A;  4K59 A;  5GVQ A;  1H73 A;  4LRC A;  2YNH B;  3EGZ A;  3VAK A;  1S10 A;  4J9S A;  5KG7 A;  1TL3 B;  4R5P B;  1U26 A;  1GEH A;  2G4B A;  3ADA C;  3DRR A;  2RQC A;  1HBM B;  2H65 B;  4UF4 A;  2VG6 B;  3CCL S;  4LUB A;  3LP0 A;  5CA5 A;  2DCL A;  4LRE A;  1LNQ A;  2W25 A;  2A0F B;  5K4P A;  3R5B A;  1NBE B;  2BAN A;  5IT4 A;  4QYZ K;  4J9V A;  3VZH A;  2APO A;  2DTJ A;  2YX4 A;  1WTB A;  1RBL A;  2HFS A;  3MMB B;  3AOC A;  2K1R A;  4XK8 C;  4UOC A;  3OXL A;  3AXM A;  4F50 A;  8RUC A;  2MGZ B;  4DR3 F;  1FD2 A;  1E3C P;  2XLI A;  4HI2 A;  3VTI A;  2P2C B;  3JXO A;  3EXY A;  4ZA1 A;  1PSD A;  1CJU B;  1SUQ A;  1FWL A;  4GVL A;  3G9C A;  1S6O A;  4DDF A;  2NQP A;  1NKE A;  4LF5 F;  4C8O A;  1OO0 B;  1NSA A;  1SV5 B;  1WD6 A;  3VAG A;  1TKX A;  2JOQ A;  4I64 A;  4CO2 A;  4RWX A;  3VGS A;  3K5P A;  3HFZ B;  1N5T A;  3EJM A;  1VGY A;  5B0C A;  4P2S A;  3D7S B;  1ZOT A;  2WON A;  2CQ0 A;  3GJR B;  3PIP Q;  2C3M A;  5F9L A;  2ZKT A;  1N5Y B;  3P5T L;  4KTQ A;  2HFV A;  4MMO A;  1NDC A;  5DJB A;  1R7I A;  1MW7 A;  2OAU A;  4CLS A;  1GXL A;  4FN5 A;  4QR0 A;  2R2T A;  2KYZ A;  1JLA A;  4C2M A;  4YY3 J;  2Z2Y B;  1EJ7 L;  1PIE A;  2ZHO A;  3GMG A;  4ITS A;  4XTT A;  1S1V A;  4A8W A;  2EBE A;  3G71 S;  5EWG A;  2OPS B;  3D3C J;  5SZT A;  2WVF A;  4ZPV R;  3TOQ A;  3M2V B;  2BOP A;  2DNZ A;  3CJ2 A;  1HQE A;  2YNH A;  1KHV A;  3W3S A;  3PM9 A;  2GJ2 A;  1YK9 A;  4OYW A;  4MKB A;  2OTL S;  4BHQ A;  1X31 C;  2Y8Y A;  4A8M P;  1B0T A;  4ZP8 A;  4L76 A;  4UQG A;  1OPI A;  1K0T A;  2K3K A;  1HBM A;  2Q79 A;  4ZLN A;  3NAH A;  1OYD A;  2YVS A;  2OTJ S;  5DLT A;  2BE2 A;  4K4U A;  4V19 X;  2EFG A;  4IOA Q;  4HLB A;  5GAE I;  2ALY B;  1XQI A;  3DLB A;  3D0G E;  3Q83 A;  2WB1 D;  3MMB A;  2Y8W A;  1SVD A;  1S4F A;  2JLG A;  3QAE A;  5D0H A;  3CCU S;  2MGZ A;  1F3F A;  1YRT A;  2UXB F;  4LRD A;  2AJF E;  1UCN A;  3R1L A;  5KFV A;  1HHQ A;  4P71 A;  1ICE B;  5LMU J;  1NPK A;  3HHD A;  4QIG A;  4ZOS A;  4DV2 J;  2MQM A;  4DSE A;  1IVZ A;  4WK3 A;  4KM4 A;  1TFY A;  2DIS A;  3V4I B;  1DTQ B;  2VQF F;  4X4P A;  3QZ7 A;  2BAB A;  2D9O A;  4ED7 A;  3OFG A;  3CJ5 A;  2G2Y A;  3JS9 A;  2FHM A;  1SI9 A;  3ENW A;  1RHM B;  4I69 A;  3W5Z A;  3QIP B;  3SCL E;  4H4K C;  2V8H A;  4MFB B;  1CC8 A;  1KSP A;  3FQL A;  4WU2 A;  4MT1 A;  3TAM A;  2ZH1 A;  4ZJL A;  2AQ4 A;  2ZBC A;  3DGV A;  1WJ9 A;  1LWC B;  1S0M A;  2CQ3 A;  3CJR A;  5K8M A;  2G0C A;  1CEZ A;  2ERR A;  2C28 A;  5KFE A;  4PYA A;  1U2R A;  2FY1 A;  1RWK B;  4WXO A;  2W9A A;  1KR4 A;  4X64 F;  4KV8 B;  2N4D A;  3AJ2 A;  2MKJ A;  4YN3 B;  5D0R A;  4NLR A;  1O0P A;  4RJV A;  3TZY A;  5GMK a;  3THP A;  3VAI A;  3C14 A;  4RLE A;  3K5N A;  2J6U A;  1CJT B;  2ATC B;  1JIH A;  3NGS A;  1LK7 A;  2BW2 A;  1J5E F;  4M5H A;  3GON A;  4WYL A;  5KXA A;  4I4B A;  1XER A;  4U9R A;  3V6D B;  3V81 B;  4KPY A;  3KLF B;  5FD1 A;  2YQ0 A;  2DNP A;  4U95 A;  4JI6 J;  2DNG A;  2R2U A;  1D0E A;  3NBP B;  4PZV A;  1HWK A;  1EW9 A;  1CSJ A;  1A6L A;  4O0I A;  2IRY A;  2AWZ A;  3V2U C;  2GHW A;  2E9T A;  4RW7 A;  3MPY A;  2QJ3 A;  4WE1 B;  1MML A;  1ZZN A;  3MPW A;  3T5K A;  2I5J B;  1MU2 B;  1TL7 B;  3MZI A;  1FWP A;  2PA8 D;  3N9U C;  4PQA A;  4DXL A;  5F9N A;  1F1B B;  2KHD A;  1CBK A;  3DM2 A;  3T6J A;  4B3R F;  1X4H A;  2XI2 A;  2BA9 A;  3C16 B;  5ETS A;  4IRD A;  1FI4 A;  2RQ4 A;  4GVB A;  1Q8K A;  3BGF A;  2EFN A;  2RJZ A;  3BBB A;  4USJ C;  2LEA A;  4URQ U;  2DY1 A;  3MM8 A;  3V4I A;  4LRA A;  4F4W A;  1AJC A;  2F8E X;  4JYA F;  1Y00 A;  1UFW A;  3FCW A;  2XLK A;  2BR0 A;  2HQ3 A;  3J81 Y;  2VJV A;  4E2F B;  1JLF A;  4MFB A;  3J7Y I;  2VDH A;  3BF4 A;  2HBZ B;  4ID8 A;  4NWX A;  1PYO B;  2UUT A;  4WFB Q;  2RHS B;  1CVJ A;  2AIR B;  4U6P A;  2HS4 A;  4DMZ A;  3FBF A;  4L75 A;  3VAH A;  2KU7 A;  1KLN A;  4DL0 C;  4KO0 B;  1ZM2 A;  1WG1 A;  2XEX A;  2VG5 A;  3KTQ A;  1KP6 A;  1NSP A;  1IKX B;  1RHR B;  2V5H G;  4ERD A;  2M5Y A;  3P96 A;  1NHV A;  1KHN A;  2VKR A;  1J5O A;  1BD6 A;  4UOF A;  2MZ1 A;  4J9R A;  1UWA A;  3UNY A;  4ELV A;  4GTY A;  2A10 A;  2RIL A;  3CED A;  2C22 A;  3Q8S B;  1S59 A;  4A8X A;  4QBU A;  1UEK A;  3GG1 A;  4LF9 J;  3V6D A;  3RB6 A;  2B51 A;  4R0E A;  2DXE A;  1T0T V;  2DEI A;  3JTP A;  3OFH A;  3MM9 B;  1UTA A;  3L7O A;  2HVZ A;  1X9M A;  4JI5 F;  3R1H A;  3US5 A;  1YJ7 A;  5KOW A;  1YJN S;  4UW2 A;  3IDD A;  1SIW B;  2R2R A;  3ZO7 A;  3OLA A;  3MM7 A;  2X3D A;  5EN1 A;  2B7C B;  2D3Z A;  3MXH P;  3DLK A;  2I8E A;  1IJF B;  4ER8 A;  1MRO A;  4OI4 A;  5IV3 A;  2MTL A;  1FRM A;  4KPC A;  3RBX A;  2JEJ A;  1TL7 A;  5J2M B;  2W01 A;  1LWE B;  5DG7 A;  2IYI A;  1B0V A;  3QLH B;  1VYA A;  2W4D A;  2COL A;  1KRP A;  1TEL A;  3CUL A;  2WW8 A;  4YEA A;  2QGF B;  1FKP A;  2GO8 A;  3IMQ J;  2LEP A;  4NYZ A;  3ILJ A;  1EET A;  3EM1 A;  1VOM A;  4Q44 A;  2B5J A;  4QJV A;  4F3Q A;  3RR8 A;  4ZS6 A;  3KNG A;  3DC2 A;  3VGV A;  2J6T A;  1YKW A;  2R8J A;  1FRH A;  3UD4 P;  2I0X A;  3L95 X;  2MKH A;  1MLA A;  3JAM Y;  4FDI A;  3BN7 A;  3CD5 A;  3J81 j;  2HAI A;  4EK2 A;  2HNZ A;  5KG2 A;  2YKO A;  4URG A;  4K4Y A;  2KKH A;  2UU9 F;  3BEG B;  1EI6 A;  3FCV A;  2QMX A;  4PWD B;  2FJW A;  2DHA A;  3CDW A;  4FYX B;  4KO0 A;  1JJH A;  2MKI A;  1ANJ A;  4M5D B;  4LRF A;  5ETP A;  3I5A A;  1NND A;  1AUK A;  5U47 A;  2RIJ A;  2QA2 A;  2BM0 A;  1H72 C;  5A8W B;  4CNZ A;  3VQS A;  2LFV A;  2W4C A;  3F41 A;  1SJF A;  3RG6 A;  2VQR A;  3I5C A;  3MMC B;  2IM2 A;  1VQY A;  4DUT A;  1DLO B;  3CCZ A;  3WIU A;  4LF8 F;  1R89 A;  3CJ3 A;  1HYS A;  1WEX A;  3ILO A;  3BO3 A;  1U1O A;  4LSL B;  2JH3 A;  1QSL A;  4KAI A;  3QT7 A;  3PJX A;  5HBM B;  3GJQ B;  5CD4 A;  1REV A;  2EKY A;  5KFG A;  1Q78 A;  3GFY A;  1U1P A;  1DRZ A;  3R5J B;  4E98 A;  4X4U A;  2XMM A;  2FLO A;  3Q23 A;  4WXW A;  2MPU A;  2QL7 B;  4JI0 J;  3WBZ A;  1DTT B;  4DR4 F;  1X0P A;  1O98 A;  2QL9 B;  3I0R B;  2B9Y A;  2RRA A;  3QLH A;  2H4Y B;  5EWF A;  1F60 B;  2RS2 A;  4ZLL A;  1FKO A;  3D1Q A;  3FBE A;  1IR2 A;  4ILM A;  3LP1 A;  1N6Q A;  5GAD U;  1Q1K A;  4Y2I A;  2B6A B;  3CMR A;  4WZQ A;  1TL1 B;  5ITH A;  1ZET A;  1WAC A;  1G3O A;  1S48 A;  2FJE B;  2WSE C;  1JJ4 A;  1FXD A;  1O5J A;  2HWI A;  4C8L A;  1RA7 A;  4FYW B;  2CKW A;  4CXU A;  3NMR A;  3FZB A;  2WBR A;  3BDG B;  2VL1 A;  4DPT A;  1KLM A;  1AJA A;  1P6T A;  5IQQ A;  1ZPW X;  4FVC A;  2HQD A;  3HVT B;  4A8F A;  4LVO P;  1UA0 A;  5ETM A;  4PWD A;  4NML A;  4K4T A;  2B0G A;  3DOK B;  1NSK L;  2GCF A;  2CQC A;  1WKL A;  2G9O A;  2A18 A;  3PIO Q;  1JXL A;  5DRK A;  4UY8 T;  4Y2M A;  3W62 A;  1S6Q B;  5KFP A;  3MEE A;  5BXI A;  3DI6 B;  4DLG A;  1DLO A;  4MHX A;  4OYZ A;  4A48 A;  5EGE A;  2JJ4 D;  3ENQ A;  1VLO A;  3M7V A;  4KFB A;  2FVQ A;  1EKR A;  2KDO A;  5HJY A;  5GAG I;  5HBM A;  4DPY A;  1RT7 B;  4EEY A;  5LRN A;  3LOU A;  4LF7 J;  3HZE A;  5BR8 F;  1CPZ A;  5DZ7 A;  2C2K B;  4UUX A;  1SKS A;  3GLJ A;  1HR0 F;  4F3O A;  3T1H F;  1H38 A;  4P2F A;  3KHL A;  1MNE A;  1OQ6 A;  1VHI A;  3PXG a;  5HAT A;  1VRT B;  3KK3 B;  1RKJ A;  1R8H A;  1IR0 A;  4U8Y A;  3NMA A;  4B3O A;  1DTT A;  2PMH A;  2NZC A;  4NCG A;  3CDE A;  3TZX A;  3C15 B;  3LH2 S;  2HSE B;  2EW9 A;  2LXU A;  4K0K J;  1T05 B;  2ZH7 A;  5KG4 A;  4YHH F;  3OR1 A;  4O3P A;  1T94 A;  2NR0 A;  2V4J B;  4M5L A;  3T9N A;  2QN6 B;  2X51 A;  3DXS X;  4Z7Y A;  1FWK A;  3BYR A;  1ALI A;  2XMU A;  2WSF C;  2B6A A;  4QWC A;  2D74 B;  2HK3 A;  3CCQ S;  2YH1 A;  3G82 B;  3EX7 B;  3KFW X;  4BCA A;  1D1U A;  4BWM A;  4DSF A;  2X1G A;  1NHK L;  2HK2 A;  3PRB A;  3M9M B;  2OPR B;  5AXM A;  1DQA A;  3BZQ A;  5KFA A;  2E1M C;  4OHW A;  3D6M B;  1RT4 A;  3PVX A;  2HFO A;  3DCA A;  2DR6 A;  2XHW A;  2HFU A;  1L3S A;  1X5P A;  2BEF A;  3OTD A;  1RT2 B;  3ZC4 A;  3N79 A;  4A8S A;  2XS2 A;  3T5L A;  5AJ3 J;  1E6Y B;  3GQC A;  3HD2 A;  4BWJ A;  1NSQ A;  4LSZ B;  4A47 A;  3OT9 A;  3HXM A;  3L09 A;  3ISN D;  5HQM A;  3DI6 A;  1V6H A;  2J8A A;  2PDA A;  1P9Q C;  4W4M A;  3CJK B;  4P7V A;  1T03 B;  1IR1 A;  3CC4 S;  2BAC A;  5KT2 A;  1WKK A;  4OZL A;  3CDB A;  2YNF B;  3HP6 A;  2EWH A;  2RUG A;  5I42 B;  1HFE L;  4KE5 A;  1NLK L;  4KT0 C;  3W9H A;  2W8S A;  3TVK A;  3TYT A;  5B0F A;  3EPG A;  5A2Q U;  4RW8 B;  1OS5 A;  4RUC A;  2IAJ A;  2KXN B;  1RAF B;  2M88 A;  5HVF A;  3AOB A;  3NNC A;  3IM9 A;  4F8R A;  3MM6 B;  1UW4 A;  2HZC A;  2X98 A;  1GX6 A;  3SMZ A;  1WEL A;  2R8G A;  4BC7 A;  4IH7 A;  4QW9 A;  1H3D A;  2H51 B;  3KJN B;  1B99 A;  2EFQ A;  3IS9 B;  2BDP A;  3SQO P;  3OD2 A;  1NPR A;  4BBY A;  4UPK A;  3KG0 A;  4CLK A;  3M32 A;  1NAQ A;  1HNI A;  1RCO B;  1J2V A;  1D09 B;  3FMB A;  1OY8 A;  2OEM A;  1IWG A;  5E0O A;  2CNO B;  1Y7A A;  4ZPA A;  2VFT A;  3PKY A;  4E0D A;  3K5M A;  3CT9 A;  3OPK A;  3C3L A;  2GLQ A;  4O4R A;  1YJT A;  4WKY A;  4NLP A;  2CG8 A;  2RD5 C;  1YG0 A;  5LQQ A;  3IRX B;  5KT3 A;  1K1Q A;  1RT1 B;  1ZEF A;  1B7Y B;  4MH8 A;  2W8K A;  4YDX A;  3PX0 A;  3MR5 A;  2UUA F;  2IJN A;  2N4C A;  2G2Z A;  4B9T A;  3PHT A;  1E1Z P;  3RYL A;  5CZX A;  1LW0 B;  1RHJ B;  1S1X B;  2Y1J A;  1JJ2 R;  3HHK A;  3LO3 A;  3ZXW A;  3Q8R B;  4QU7 A;  1QSS A;  2HND B;  4DV1 J;  1SH0 A;  1U02 A;  3QJP A;  4F4K A;  4P73 A;  3H40 A;  3QBC A;  4HDH A;  5K5M A;  5E3Q A;  2XMW A;  4NI2 B;  3P49 B;  3A52 A;  1JNR B;  1XMQ J;  1TTH B;  4N76 A;  3EZ5 A;  2RH3 A;  4M94 A;  4OYB A;  2H5E A;  2UUW A;  3PV8 A;  2KT2 A;  2HVI A;  3ILI A;  3M05 A;  2LQ9 A;  4CH7 A;  2FB0 A;  1S9E B;  2MLZ A;  2OKQ A;  1FF2 A;  4HL9 A;  4JBC A;  1XNR F;  5I42 A;  2AHO B;  3KHG A;  1P9Y A;  1QM9 A;  4RU2 A;  4GO5 X;  2V2K A;  2B43 A;  4N8O A;  3M2U A;  4CTA A;  1IJE B;  4IDK B;  4G65 A;  3BGO P;  1B64 A;  4RW6 A;  4OZ1 A;  1RT5 B;  2ASL A;  4CH0 S;  2DGX A;  2HVE A;  1NXI A;  2BOA A;  4LBI A;  1TKZ B;  2IA0 A;  3ZTR A;  5BYR A;  4J9O A;  5E7O B;  2CQP A;  3K0J A;  5JUM A;  4F0K A;  2RDI A;  3CCJ S;  2J0X A;  2XHC A;  4ZG9 A;  4DF8 A;  5K8O A;  5ETL A;  3ZZP A;  2WVE A;  4DV3 F;  4ZVF A;  1IKW B;  1W2B R;  3MPU B;  4YR1 A;  1ULR A;  1A9N B;  3ZZY A;  3IA0 A;  4Z37 A;  1GNK A;  4WP8 A;  4N41 A;  2QG9 B;  2FVS A;  3EMT A;  2DGT A;  1BMQ B;  3U27 A;  2O3D A;  3M8P B;  3UVJ B;  2OUG A;  4OX9 J;  4WCE Q;  2P9G A;  4NA3 A;  4MK7 A;  3QGI A;  3G96 A;  3TP2 A;  4FF3 A;  4UOR A;  4DUY J;  2GMJ A;  3FRY A;  3DGP B;  1OSD A;  3D67 A;  4O44 B;  1WUU A;  4QIW D;  2ROE A;  3H5X A;  1YSJ A;  1HNV B;  3VAJ A;  2IRX A;  5KT4 A;  3W9I A;  1SL2 A;  3KUE A;  5HN0 A;  3ISZ A;  1GTE A;  3MED A;  4CYS A;  2ZOM A;  2Y0S D;  3DRS B;  2Q6B A;  4NI2 A;  1Y3K A;  2BUN A;  4TY8 B;  3TG0 A;  1UP1 A;  4FDJ A;  1YJW S;  3TAP A;  1HNZ J;  4LR9 A;  4HYK A;  2YBV A;  2JVR A;  1RAC B;  2W2Q P;  4NOH A;  1BHN A;  5J2P B;  3M1V B;  3GR0 A;  4CXK A;  1GH8 A;  1WHY A;  5HMZ A;  2E9Z A;  1U8W A;  1K1S A;  3T1A A;  3EXC X;  3KK2 B;  4P52 A;  4J9Q A;  5F0U A;  1YBT A;  2HIQ A;  4GRS A;  3GII A;  2HEK A;  1H98 A;  3EGW B;  2B7B B;  2FIU A;  2YQ1 A;  4AQY F;  1R43 A;  1K47 A;  1MMN A;  3RW6 A;  1RHK B;  2P9E A;  2M3D A;  4ZP7 A;  4GO7 X;  3KJV A;  4P7T A;  4FXD A;  1T7P A;  3LGH A;  3NGU A;  4OHY A;  3FCH A;  3KNA A;  4V1A k;  2EFV A;  1JLQ A;  3I31 A;  2GZO A;  1M5H A;  2HHV A;  2RDJ A;  2CPI A;  4O3Q A;  4YR3 A;  4KYZ A;  1WF1 A;  2V50 A;  2XWX A;  1G1X A;  2LXI A;  2WVC A;  2D7S A;  3OL7 A;  4NCB A;  4ES3 A;  1CG2 A;  2C2D A;  2C3U A;  3UN2 A;  2M52 A;  4M5G A;  4LR7 A;  1U0H B;  3HJF A;  2FVC A;  1EAY C;  3A4T A;  3D1O A;  2K2P A;  2OPP B;  2VQE J;  1TP7 A;  3A3P B;  3M8P A;  1KHJ A;  3B5Q A;  4KHP F;  1IBK J;  4USW A;  1YDL A;  2K06 A;  3RBZ A;  1VQ7 S;  2R42 A;  3PFO A;  2LMI A;  2MQ8 A;  3DGP A;  5IJQ A;  1PKU A;  2AV5 A;  1VBX A;  1UA1 A;  4RW9 A;  1FEE A;  3KKF A;  4F4Z A;  3EGV A;  2I6W A;  4FS1 A;  4KR0 B;  2NYI A;  1RWU A;  1UJ4 A;  4AL7 A;  3OR2 A;  1WDT A;  2GVD B;  3M6W A;  2E9R X;  4L72 B;  4QWE A;  2HW3 A;  3DOL A;  1TUG B;  1X5O A;  4LIW A;  1Z1Z A;  2BKO A;  3QFH A;  3M9N B;  2W5V A;  5J2P A;  2W4P A;  5A6P A;  3BSA A;  1B8J A;  2Q43 A;  1V5I B;  3IR7 B;  3T5J A;  3DU5 A;  2AEM A;  2V8P A;  3R7N B;  4TKT A;  5KG3 A;  5L1I A;  1V3S A;  3CMA S;  1HMV A;  2ROP A;  3QRQ A;  2QX0 A;  1VQ5 S;  4LF1 A;  3TWZ A;  3WZ0 A;  2HGL A;  2IM1 A;  4EZ6 A;  2MKK A;  2CNN B;  2L9W A;  2XMV A;  5GAE U;  3MAA B;  4J9M A;  3RB0 A;  2VG7 B;  2DRB A;  1CJV A;  1N2K A;  1YJU A;  3IAS 9;  1NDL A;  3BGR B;  1N32 J;  1EB0 A;  4FBT A;  2LP4 A;  4KH0 B;  3K2Y A;  5DET A;  4LFA F;  3AD9 C;  2GIF A;  1FNX H;  3CC2 S;  4J5O A;  2EG2 A;  2GML A;  2F1F A;  3HI9 A;  1RDR A;  2W7O A;  1N36 F;  2CQG A;  3D4J A;  2KZM A;  5KT5 A;  4CLU A;  2H9Z A;  2VC0 A;  3I9Z A;  2VON A;  2NCK L;  1T11 A;  2RU9 A;  1TZ0 A;  1NK7 A;  2VFS A;  3ETO A;  4Q8E A;  1N0U A;  5A8K B;  3KLE A;  4DV0 J;  4HAC B;  2W7P A;  3KLH B;  2GIQ A;  4LJM A;  2P8I A;  4AL6 A;  2NXU A;  1C1B B;  2VBW A;  4DV6 F;  1QVG R;  1N33 F;  3AA8 A;  3HF5 A;  3UCZ P;  1G6B A;  3D0I E;  2VBZ A;  1IKV A;  1FKA F;  3D1H A;  2W1B A;  3V4M A;  2FDN A;  1FA0 A;  5KFR A;  4PKD B;  2Q6C A;  3MOJ B;  3W5X A;  2X1A A;  2N7C A;  3QSI A;  2FD2 A;  2MQN A;  2ZIT A;  1E33 P;  4RNO A;  2FC8 A;  2RQM A;  3QGP A;  5LMN F;  2WAQ D;  2M9K A;  1WF0 A;  3N0V A;  2KT3 A;  4OZN A;  3RU0 A;  1KC8 T;  1PGZ A;  2M70 A;  3GIM A;  2OSQ A;  1S9G B;  3N4W A;  4DR6 F;  2V9K A;  3K8W A;  1BQM A;  2FJD B;  1EHW A;  5JJB A;  4DN0 A;  1Q53 A;  4I1T A;  1DJ0 A;  3QJL A;  1Q7L B;  1Y3J A;  1Y7P A;  2PO4 A;  5B0B A;  2J7U A;  1N5V A;  2YWW A;  2VIH A;  2OD4 A;  1YHQ S;  2QRR A;  1J27 A;  5F8L A;  2CPX A;  1TV6 A;  4X4R A;  2D1C A;  2C3O A;  2CIM A;  3H59 A;  2YKQ A;  2FY8 A;  1QAI A;  4NWJ A;  4CO0 A;  3NGK A;  4WJB A;  2W9B A;  2IIH A;  1BWV A;  3IGV A;  2MQL A;  2UUC J;  1U1R A;  2IMO A;  2RHQ B;  1C1C B;  2KZZ A;  1FDA A;  2IBO A;  2HQI A;  1I51 B;  1LEO A;  1YLX A;  2OMO A;  4FKX A;  3JQK A;  3LAM A;  4FNI A;  1VQK S;  3VF0 B;  2YQ3 A;  2HMI B;  3QPI A;  4CO4 A;  2ALZ A;  2ZJP Q;  4DG1 B;  4F0H A;  2VIC A;  4C8M A;  4M8L A;  4DCO B;  2C3Y A;  2XMT A;  3C2P A;  3NEK A;  3PAC A;  3RUB L;  4GC6 A;  1Y0H A;  2XM3 A;  5K14 B;  2DHS A;  2LEC A;  1DAX A;  1PBU A;  4BC9 A;  5A2Q Y;  1YZ7 A;  4OMF G;  2DK2 A;  1P1T A;  4EBE A;  1B3T A;  4JI4 F;  1SKR A;  1HL6 A;  3P8B B;  2LQ5 A;  3ISN C;  2LDY A;  2N7Y A;  2IVY A;  3I6P A;  3DHW C;  1VIX A;  4IFV B;  3G6E S;  3J7Y U;  4JI2 F;  4I6W A;  3GE9 A;  1C1B A;  1QY7 A;  4H4M A;  2G0I A;  5E3C A;  3PO5 A;  4B02 A;  3R7B B;  4LF4 F;  2RAQ A;  2YKM B;  3ITH A;  2HFZ A;  2ZE2 B;  2FHJ D;  2DR9 A;  3UQS A;  4X66 F;  2QSW A;  3FUY A;  4JV0 A;  4YQW A;  1HI8 A;  2HHX A;  3HZG A;  4ID5 A;  3S01 A;  5M2P A;  5L39 A;  2BV3 A;  1HNW F;  4NXN F;  4YP3 A;  3DMJ B;  4K2J A;  1URR A;  4ZVS B;  3W63 A;  2E66 A;  2ABY A;  3LP2 A;  1RTZ A;  2NYH A;  3SDE B;  2F4F A;  4Q0B A;  1QD1 A;  4WF9 Q;  3G6Y A;  3BYP A;  4QPX A;  5J2Q B;  3QRP A;  3HHL C;  1M5O C;  3B4M A;  5J1E B;  1BXN A;  3CDU A;  3D28 A;  3MM5 A;  5JMN A;  4JI7 F;  1RAA B;  4CLZ A;  4DR2 F;  1XR7 A;  5IWA F;  5D3G A;  4DUZ F;  2Q66 A;  3U02 A;  3W64 A;  1X4E A;  3SFU A;  1P1L A;  2R7T A;  1FE0 A;  2W5Q A;  1GAO A;  5GAD I;  1UL3 A;  2VJU A;  4C11 A;  4Z2X A;  4ECU A;  5KFK A;  4F4Y A;  3BO4 A;  1HA1 A;  4B3S F;  3W2V A;  2R7R A;  2IC3 A;  5FJ4 A;  3EDQ B;  3C6T B;  4MKY A;  3UW1 A;  2LQ8 A;  2R4F A;  5HP1 A;  4CT9 A;  3TR5 A;  5DLG A;  5JXS A;  4A8Y A;  1WKJ A;  1VCT A;  2YNI B;  3O8W A;  1QTN B;  4NYP A;  4EI2 A;  4B3M J;  3TAR A;  3CJ0 A;  5D4L A;  7FD1 A;  4NE9 C;  3JQM A;  3AA9 A;  4KQZ A;  2GGP B;  3MR7 A;  2X1F A; 
#chains in the Genus database with same CATH homology
 1EQJ A;  1HJK A;  1O98 A;  2GLQ A;  2G9Y A;  2IFY A;  3IGY B;  2D1G A;  3WAX A;  1KHL A;  1EW2 A;  2IUC B;  5IJQ A;  4UOP A;  3UN3 A;  3NKQ A;  3WAY A;  3MK1 A;  1ALI A;  5LQQ A;  1EW9 A;  5DLW A;  1N2K A;  2IUC A;  1ED8 A;  1KH5 A;  1E33 P;  2W5T A;  2XRG A;  3ED4 A;  1ELX A;  4LQY A;  4UPI A;  4KAY A;  4LRB A;  4UOR A;  5GOV A;  1ANJ A;  3Q3Q A;  1ZEF A;  4NWX A;  4ZG7 A;  5L0K A;  5L0E A;  3WAW A;  4LRF A;  4LRC A;  1ELZ A;  2GSN A;  4TN0 A;  3DYC A;  2GA3 A;  4MHX A;  1FSU A;  2RH6 A;  1ALK A;  1KH7 A;  5EGE A;  1AUK A;  4ZG6 A;  4UPL A;  3BDH A;  4MIV A;  3NKN A;  1KH4 A;  3CMR A;  4GTX A;  4KJD A;  3SZZ A;  5IJS A;  5LRM A;  2W8S A;  1EJJ A;  4MY4 A;  1E1Z P;  3M7V A;  2VQR A;  5DLT A;  5TJ3 A;  1URB A;  4GTZ A;  3NKP A;  3MK2 A;  5EGH A;  3DPC A;  1ZED A;  4CYS A;  3T02 A;  3BDF A;  1KHN A;  3E2D A;  4KJG A;  1ZEB A;  2ANH A;  2W5Q A;  3NVL A;  1AJD A;  2X98 A;  4CXS A;  5LRN A;  3TG0 A;  2W5V A;  4FDJ A;  1URA A;  3IGZ B;  3T01 A;  3M8Y A;  1AJB A;  2W5W A;  4GTW A;  4B56 A;  1ED9 A;  3UNY A;  4LRE A;  4UOO A;  2ZKT A;  3UN5 A;  3UN2 A;  4ZG9 A;  5DLV A;  1B8J A;  3M8Z A;  3SZY A;  4GTY A;  5K4P A;  1E2S P;  2QZU A;  3LXQ A;  4LR9 A;  4CXU A;  2XR9 A;  3NKM A;  4LR7 A;  3UO0 A;  1HQA A;  1ANI A;  5C66 A;  3A52 A;  4QAX A;  3M8W A;  3T00 A;  2GSU A;  3MK0 A;  5LIA A;  4UPK A;  4KAV A;  1K7H A;  3NKO A;  3BDG B;  1Y6V A;  1SHN A;  4FDI A;  4CXK A;  4CYR A;  4LR8 A;  1ALH A;  1KH9 A;  1EW8 A;  1O99 A;  4ZGA A;  1AJA A;  3WAV A;  3WBH A;  1ELY A;  3BDG A;  4NWJ A;  4N7T A;  4UPH A;  4YR1 A;  4LRD A;  5INH A;  1KHK A;  5HRT A;  4LRA A;  1KHJ A;  3KD8 A;  3TX0 A;  1SHQ A;  3B5Q A;  1AJC A;  2W8D A;  3NKR A;  4LR2 A;  3TWZ A;  1Y7A A;  2W5X A;  2W5S A;  1HDH A;  5L0B A;  2W5R A;  1N2L A;  1ALJ A;  5GRR A;  3OT9 A;  5KXA A;  3IDD A;  1P49 A;  1E3C P;  5AJ9 A;  2GSO A;  4KM4 A;  1EI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...