3UO0A

Phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3uo0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3uo0A01
4MHXA 4B56A 2ANHA 3MK1A 2IUCA 3BDFA 1N2KA 5HRTA 4YR1A 5K4PA 1E3CP 3NKOA 1AJCA 3TWZA 4KM4A 3UNYA 3WAWA 1K7HA 1AJDA 5INHA 3IDDA 4UPIA 4MY4A 1FSUA 4LR8A 4N7TA 5L0BA 1ALKA 2G9YA 3NKQA 3UN3A 4LR2A 2W8DA 4LRCA 1E2SP 3BDGB 1KH5A 2D1GA 5IJQA 4CXSA 3M7VA 3A52A 1SHNA 5LIAA 5EGHA 3WBHA 1ELYA 5LRMA 1ZEBA 4LR7A 4LRDA 5LRNA 4KAYA 5L0EA 4GTXA 1ZEDA 1EW9A 2GA3A 4ZG7A 4QAXA 4CXUA 4GTWA 5KXAA 4LQYA 5LQQA 2W5SA 1P49A 4UPLA 2W5VA 1N2LA 1EI6A 5DLWA 4LR9A 3NKPA 4UOPA 3WAVA 4GTYA 3NKMA 5DLTA 3M8WA 5GOVA 5TJ3A 3M8ZA 4FDIA 5AJ9A 4CYSA 3WAYA 1ZEFA 1HJKA 1O98A 3T02A 2W5XA 2ZKTA 5C66A 4UOOA 4MIVA 3BDHA 3ED4A 3NVLA 1HDHA 4CXKA 2IUCB 1O99A 4KAVA 4LRBA 1ALHA 1ELXA 1KHNA 2W8SA 3NKRA 4LRAA 4ZGAA 4NWJA 2X98A 1AJBA 1EW2A 1KH4A 2IFYA 1EQJA 3BDGA 3CMRA 1E1ZP 1URBA 4ZG9A 2VQRA 4KJGA 4LREA 2RH6A 4NWXA 3Q3QA 1KHJA 1KHKA 3OT9A 1ALIA 4GTZA 3T01A 2XRGA 1Y6VA 3KD8A 4UORA 2XR9A 4KJDA 1KH7A 5L0KA 1EW8A 3UN5A 3B5QA 3M8YA 1URAA 1ED8A 1EJJA 3IGYB 4UPHA 1ELZA 5EGEA 1ALJA 1E33P 1KHLA 2GLQA 2GSOA 2QZUA 2W5TA 3MK2A 4FDJA 4ZG6A 5IJSA 3MK0A 1AJAA 1B8JA 3UN2A 3SZYA 3TG0A 2W5WA 4UPKA 3TX0A 5GRRA 4LRFA 1ANJA 2GSNA 3IGZB 3UO0A 4TN0A 3SZZA 4CYRA 1KH9A 2W5RA 1ANIA 5DLVA 1ED9A 1HQAA 3DYCA 3T00A 3NKNA 3WAXA 3E2DA 3LXQA 1AUKA 1SHQA 2GSUA 3DPCA 2W5QA 1Y7AA
chains in the Genus database with same CATH superfamily
5T41A 2XMUA 4DV0F 1S4EA 1WC3A 1KVJA 4P7TA 4P75A 5LMUJ 4Q45A 1NH8A 2NXEA 3OJSA 5H9EJ 3PY8A 1W2BR 3PTWA 1H0HB 4WZMA 2VOOA 4OV1A 1E3CP 4LVOP 2FHJD 4EYHB 4QWEA 4DFKA 1AJCA 1FJ7A 2HK2A 3MURP 1HYSA 1MWZA 5KFDA 1M5SA 2L9WA 2UUBF 4LVNP 5INHA 5IS2A 2MEWA 1SC4B 3I9ZA 3MR5A 3AB4B 3HVWA 3IA0A 2DNGA 4WJBA 2BUNA 3HVTB 3QIPA 4KFBA 4P74A 3HHLC 3US5A 3RBEA 1HNZF 3UN3A 4E0DA 4R25A 3W60A 2OMOA 2AGPA 4Y34A 2BZ2A 2MB0B 4PR6A 5LSLA 2XS7A 2XYHB 3DM2B 1H2VZ 4PCQA 1XTZA 2GVDB 2HVZA 3HJVA 4L72B 4KV8A 2IBOA 1LWCB 4TY8B 4PPDA 4CO1A 3FDSA 3W64A 2WB4A 5CABA 4G6VB 1RT4A 1BWVA 2E29A 2O1PA 4ZVHA 4ZG7A 5KFHA 2EFNA 1PSDA 2YQ1A 4N76A 1VHFA 1OPIA 1ZA1B 3CCZA 3FEYB 3G8QA 4FBTA 1BQNA 1S0VA 1N2LA 1IBMF 1SJ1A 3DRPA 2PFFB 3FJ2A 3QPIA 1R0BG 5HI7A 2MYFA 3RG6A 1RYRA 4Y2AA 2XGPA 3TUPA 3BREA 4Q0BA 4DV6J 4OX8A 2OPQB 1KFDA 1MWQA 4YUDA 1U1QA 2LCWA 2QX0A 1QY7A 3D7SB 1LWEB 3GIRA 3MMAA 4LFAJ 2P8IA 3RAXA 5KG6A 3J7A1 4JOUA 5ETVA 3T02A 1XNQF 4F8RA 4UT4A 2AJ1A 4LUBA 3BDHA 2LDIA 1CJTB 3SFGA 1HMVA 1AA1B 4ICLB 4NCGB 3RB0A 2UVUA 1C0TB 4URGA 2Z2LA 5D78A 4AE5A 4EUVA 4X4RA 4X4SA 4ED4A 3VGVA 5F8LA 4JYAF 1KQFB 2QA4S 1T05A 4PG5A 2IJRA 4LT6A 3UD5A 2F8EX 2F4VJ 3QO9B 2BEFA 4NLSA 1P6TA 2ALZA 4PABA 3I0RB 2YKNA 4CYUA 4IOAQ 5JVHQ 1RDRA 5KFRA 3CPWR 1F6TA 3NS7B 5HP1B 1RE1B 5ETKA 1PBUA 2A6OA 3V6JA 4DQIA 5A8KA 1GTEA 2D3ZA 3PYEA 3W2VB 1T94A 3S7RA 4HYKA 3D0HE 4A8KA 2R42A 2UXBJ 3GMGA 2MKJA 3CCQS 4GTZA 1WOOA 5HMZA 1RABB 5CYJA 4C8MA 2XMWA 4MIBA 1XR7A 4YR2A 1R8HA 4XTTA 3Q8YA 2FDNA 4YQWA 5KT3A 4ZPVR 2HQIA 5ETTA 2MLYA 5KFSA 4ED7A 2C22A 2HHPA 3MMCB 2AT1B 4X65J 1ZPVA 1H38A 2FVSA 4X66J 3DYAB 3JXOA 3IO1A 4F2RA 4P73A 1K0TA 1HL6A 1S10A 3KTQA 5B0FA 4LFCF 3FSXA 2DKOB 3POTA 1G3OA 2CPDA 2I0XA 1S76D 1F3FA 2W5WA 2Y0BB 3IN5A 2W1BA 4OI2A 5KFXA 3NMAA 1XNRF 4K0KJ 1YRXA 3ADAC 1N5YA 2ZWPA 1NK4A 4CLZA 4CYRA 5KTQA 1KH9A 2J6SA 3UPFA 3M8QA 4M5MA 4IUFA 1PYTA 3G9CA 1ED9A 5LL6d 1LWFA 1JLQA 3LGHA 4F67A 2Y0SD 3ZO7A 2IM1A 4F4KA 2L08A 1AUKA 2BOPA 2VDIA 1QE1A 1WJ9A 3PIOQ 3CMAS 1MMNA 2PE8A 3MAAB 3QAUA 4LFBJ 1I51B 3KG1A 2DVIA 1ZM3A 3WDOA 2EFQA 1CULB 1N54B 2W9AA 1KHLA 4ID5B 3H2VE 4M8LA 1J5OA 3GONA 3BQ0A 4ZJQA 3D4JA 3D6HB 3CCSS 2MQOA 5J2MA 3TWZA 2HS4A 1HFEL 3EDQB 1NHKL 3K2YA 4GVBB 4HI1A 4RR5A 5IT4A 3R6LB 4KTQA 1FRMA 1HNWF 4X64J 1C1BA 2GIFA 4MJKA 1XWLA 2GVZA 3SCKE 2IAJB 4IFVA 1WKJA 1GMWD 1X60A 4IFYA 2XNRA 5AJ3J 4ZVTB 2AMCB 2XLJA 2D1GA 1DLOA 3O6QA 1F0XA 2POKA 2VL1A 4YY3F 1LK7A 1KQSR 1ELYA 1J5OB 4ECQA 1Y3KA 2OHDA 3CCTA 1HPZB 2JVRA 3IG1B 4NLVA 1OYEA 4U8YA 1JLBA 4CH1A 3VAHA 2A10A 1TKXA 3D28A 5DZ6A 5CD4A 3G6YA 2GA3A 2R3VA 2CUYA 5IWAJ 2IJNA 1SL0A 3OFEA 4IKAA 2U2FA 4ZLNA 2VJVA 2IA6A 2NPIA 2H9ZA 4OJGA 4JI4F 4I56A 5THWA 4ECTA 3BSAA 2H5IB 1SQGA 2MQNA 1D9AA 2OPRA 3FFIB 4RO0A 2XY6A 3JSMB 2F40A 3I0SA 3UE2A 3KK2B 2UUAJ 2W4PA 3JAMU 2XMJA 2E5GA 3D1HA 2AJ0A 1UZDA 5IQ6A 2A2CA 2WBMA 2ZKTA 3AQOA 4B08A 2BE9B 4ETZA 5KFVA 1AYEA 3JSYA 5B0EA 1YX2A 4DEZA 3NVLA 4M5LA 4GKKF 4QR1A 1YBTA 4MH8A 4QIEA 3LO3A 2EK6A 5AE3A 3S8SA 2R2RA 2ZHAA 3MM7A 1TAQA 1Y9OA 3GG0A 4LRBA 3ISZA 2Q1LA 3LP2B 4M63A 4UQTA 3NKRA 1S97A 1IR0A 3KLGB 2CPEA 4ZVFA 4K4ZA 5ETOA 4W98A 4ZVEA 3K7RA 1S0NA 2MSSA 2IVYA 2YQ0A 5GADI 4DR1J 1VQ8S 3I87A 2DYAA 1RSCA 4B3SJ 1REGX 2DNMA 3OL8A 2D3O1 4C0HA 4YR0A 1WKKA 1B4SA 2CKWA 2QLXA 3CJ4A 2A6MA 4G1QB 2DGOA 4ZP9A 4KSEB 4NWXA 4KBIA 1WG5A 4RW6B 3Q3QA 4EEYA 2V4JB 1BE4A 4B9TA 4C8LA 3R8YA 3NGUA 1S6PA 2DNOA 2M52A 4WTYA 5F3TA 3W62A 5KG5A 1QLNA 1Y6VA 5LMUF 2HFUA 2XI3A 2VDHA 4ED3A 4E8UA 1Q7YT 2PMWA 2ROPA 3N0VA 3PHTA 3M9MB 4GKJF 3B5QA 1U09A 2KJWA 1MG7A 2M5YA 3BN7A 4P6QA 3GV5B 3I32A 2UXDF 2VKZG 1K1SA 1FKOA 2E7XA 2ROEA 3CWJA 3FEZA 3M1VA 3ZZTA 1T3NA 3PKYA 1NDPA 4OZNA 1AFJA 3HD1A 3OJUA 2MZSA 4L76A 5EGHA 3TEHB 1KVKA 2E1CA 1LKZA 1X0PA 2GAHC 1B7FA 1YJVA 3MUMP 2R9LA 4WFAQ 1SQFA 2FGCA 2OFGX 3J80Y 1SL1A 4I0WA 5H9FJ 1RA7A 3GCWP 1ANIA 1VJWA 3AJ2A 3DRXA 5EX3A 3TVZA 4OQJA 1F60B 1N88A 2DGVA 2FYXA 3FMBA 1Q16B 3ILIA 4TNOA 1DTTB 4ER8A 4K8RA 3HHLA 1RWOB 2ZH9A 4B3RF 2J7KA 4OZLA 4M5JA 1OWXA 5ADZA 1U6FA 2GCFA 1P1LA 1WF2A 1FE0A 3VR1A 4UQGA 3I0RA 4CYUB 2UVRA 4PQUA 5KFIA 4FF3A 1KVIA 3Q89A 2K1RA 4K7QA 3QSIA 2DTJA 5F0WA 4CP5A 3IBWA 2VICA 1RT5B 1TL7B 4WBFA 4B9SA 4NXMJ 4TY8A 4ZVUB 4AUKA 3T1YJ 1S1TA 3OFGA 3CMES 5K20B 2QO3A 4ILMA 4TN2A 5JUMA 4QYRA 1H2UX 4F36A 2G0JA 1T0TV 3A8IA 3G6VA 3DDIA 1QD1A 4UOGA 1FX2A 1VOMA 5IQQA 4ECSA 4DSKA 2HVIA 1FX4A 4N7TA 2FC9A 1VK3A 2XTJP 3J81j 3BQ1A 4KC5A 1WDDA 2J8SA 5JJBA 2RB7A 3SDEB 3UI3A 3WBHA 1HQUA 1JLEB 4WE1A 2DH9A 3PJWA 4G1QA 5LRMA 2F1FA 1L3TA 2HVDA 1W25A 1WTBA 1VCTA 3BR8A 3NCQA 2OPSA 3V4MA 3EX7B 2CIMA 4CXUA 1H74A 2PT0A 4A8YA 5KXAA 1HNIA 1TKTB 2B9XA 2W5SA 1NDKA 1R0AA 4Y0FA 2NR0A 1U0HA 4L73A 5CXTA 2UVVA 5DLWA 1LWCA 3LALA 9RUBA 2HHWA 4KAIA 2NUUG 1TR0A 2KDOA 1NK9A 1JJHA 2CJKA 1SUQB 5EWEA 2DT9A 4YHHF 2ASJA 5GAHI 5K8PA 2KT3A 3NKYA 1HBOA 4PG4A 3H5YA 1F9HA 3Q8PB 2D41A 3SDEA 4I64A 3UVJB 1U47A 1S6QA 1VBKA 4FZVA 2C2MB 2DNKA 3B6BA 2BRKA 1UVJA 2BR0A 2J5AA 1UFWA 4DL2A 4Z37A 2DNQA 1B3TA 4FYVB 1C2PA 4A48A 4JI0J 2VV5A 1JB0C 2YY3A 4U8VA 3H2LA 1T9TA 2ZNYA 1P8GA 2F9DA 2XWXA 4WPAA 2NPFA 4DR6J 2UXCJ 1ZM4A 4C97A 2FVPA 3M8PA 1D8YA 3CMRA 4IDKB 4PRFA 1NJYA 2E7WA 2RE1A 4LSLB 4YB6A 4JI7J 2R2TA 4HEA9 1N34F 2XZWA 4O23A 1UVKA 2R2SA 2YH0A 2DGTA 5F8JA 2OPQA 4DOZA 4M1KA 1HBMA 1HD0A 3D3CJ 4NZ7A 1ZPWX 4BWJA 2QA1A 2B9EA 2WVDA 7FD1A 1ALIA 4XAKA 1TK8A 1R27B 4CLFA 1HNXF 3T01A 3KD8A 5CZVA 2FIUA 3DOMB 4DMZA 3IGNA 1NSQA 2CPJA 5JXSA 2NSBA 5CD4H 3T9NA 3OSNA 2FJWA 4NLYA 1ICEB 1X9WA 2ZITA 3KJFB 2UXBF 3M8YA 4NRUA 2WW8A 3DOKB 4CNYA 5CHCB 4ES1A 4OHYA 1S9FA 3CIZA 1SH0A 1VIOA 1QDUB 1RTJA 4L74A 5EGYA 4LF7J 4DV1J 3W9HA 2BW7A 5KFPA 2QZUA 1KLMB 3ZZ0A 1I5OB 2B6AA 4USTA 4OX6A 4F3QA 3EVWA 1J27A 1U8WA 3FBBA 4WTOB 3IRWP 3M6WA 3LWMA 3T5KA 2GFFA 2CG4A 2OPPB 3C14A 3DOLA 1VQ5S 3BGRB 1UMJA 1VQKS 2BDPA 3ENVA 3PEHA 3QMQA 1S59A 2Q43A 2BOAA 2HS3A 5GAHU 2PSZA 3NGDA 3L3CA 3T3FA 1Q8KA 1OO0B 1RWNB 2FJDB 1GMVA 4PEOA 4JI1F 4JV1A 3BPSP 5ETPA 4TKTA 3QATA 3V4IA 4RW8B 4XPEA 2ZC3A 5CYMB 3IC1A 2LXIA 1SHQA 2FHOB 1WC5A 3DCAA 2W01A 5KG0A 3DU6A 1LW2B 1Z2ZA 3CO0P 4IO1A 3DGPA 3DU5A 3KLEB 2MQ8A 2PMZD 3MK1A 5CYQB 2VG7B 4NLRA 2I6WA 4DV3F 2DHGA 4RKUC 2ZH1A 2K8GA 3BH6B 4C0BA 2YKOA 4OYOA 3GJTB 2MLXA 3KKFA 1RYSA 1YRUA 3Q2SC 4I4BA 2B9WA 3HFZB 3UNYA 5DG9A 4WWSA 4CCHA 4M94A 5AJ3F 4DF4A 2KHCA 5B08A 5LXYA 1HA1A 2MJNA 5KT7A 3NY0A 3IDDA 2P5VA 2E5IA 2G1HA 2GHPA 2MHEA 2CYYA 4LR8A 2WZ1A 5DJBA 1NJWA 5GAEU 3J7YI 1TKDA 4I1TA 3PG9A 2G2YA 4IYQA 2WRMA 2P9CA 1YK9A 3GU0A 2HURA 1S1VA 3R5CA 1BQMB 4RLEA 4USIA 2J9EA 3OFHA 5D15A 3FBFA 1X7VA 3NAHA 5B09A 1IKVA 4AQYJ 4LR7A 1FVQA 1RT3A 5L0EA 2OKQA 5L1IA 3K89A 1FKPB 3B4DA 3EVOA 3FK4A 4ZHRA 3QLHB 5AE2A 3D0IE 2IY5B 3M2UA 2B4OA 3U27A 2FJAB 2EFGA 2KXFA 1B70B 1XC9A 1U26A 1Y0HA 4ENOA 1VC0A 4G3IA 1X4HA 3I31A 1HBUA 2EFVA 1PCAA 4A46A 3KJVB 3M2VA 4C8ZA 4E98A 2FVRA 2AZ1A 3M8ZA 1X4CA 4KKOB 3G4SS 5HL7Q 3RBZA 1TV6A 3DLGB 3N79A 4KO0A 3UWTA 2M88A 1S79A 2MTLA 1RAAB 1RWXB 2C2NA 2W2NP 3AAWB 3G6ES 4PPZA 5EX0A 1A9NB 1ULRA 1G2EA 1ITPA 1FRXA 1XR5A 3CNQP 3CJ3A 3H5UA 1PJ5A 5LMNJ 2V9KA 2ZFHA 2C3YA 3FZ2A 4WYWA 1Y4ZB 1KD1T 5C2GA 1LNQA 2CQPA 4PWUA 3W5YA 5EDWA 2HZVA 1TQLA 2ZBCA 2D3OR 2KVIA 3AD7C 1Z4UA 1FESA 3OHAA 2HLTA 3NBPA 3T41A 5L9NA 3SSRA 4U7UD 1UFLA 3K5LA 1AUSL 1RKJA 4F25A 1L5UA 1RT4B 3EJMA 5AXNA 2LECA 4K4UA 1WC4A 2XMMA 3M30B 1RWKB 3MM5B 1G6BA 4G1IA 2WONA 3IR6B 3NBPB 5IZHA 1KR4A 4JB8B 5DM6Q 3ETOA 4Q2LA 4NXNJ 2LXUA 4OZ5A 2H48B 3I5BA 2VQFJ 3N5FA 4A8FA 1EQ0A 4GKJJ 2H5JB 3UCGA 2C2EA 1URRA 2RUSA 5DGBA 2DR9A 4ILLA 2ZDOA 3IBFB 2RDJA 1DRZA 5EWGA 4NLPA 5EWFA 4DZ6A 2ZHOA 4QU7A 3J7AN 4USJC 2JNJA 4PG6A 2FY8A 2YKAA 3PRDA 4ES2A 3NXZA 4IFVB 2Z2YB 2FJBB 4IOBA 2VONA 3JYTB 5L38A 3BKTA 3PYDA 1NKEA 1CS4A 3MEDB 1NH7A 1WOSA 4J91A 4KHPJ 2PEHA 2GSOA 5HQMA 1AJAA 1NKCA 2CJ9A 4CLKA 3H5SA 2HHSA 2ZVSA 2IIHA 3GIKA 2W7OA 5E3AA 2MKSA 3NMRA 3TG0A 2RS2A 4UPKA 4AL5A 1O6XA 2NXUA 3M2UB 4LRFA 1BHNA 3QJJA 2BJ9A 3QRPA 2ADCA 1NPRA 2VFUA 1NK7A 4FVCA 2OPRB 1RZMA 2QL7B 3RZAA 4DX6A 1T7PA 4O0IA 2R8KA 1FJGJ 3M6UA 2L9DA 3W65A 2EC0A 1S9GB 2GMJA 3O3LA 6FD1A 3W2VA 4IRDA 1OSDA 2FHJA 4OJ3A 2QGFB 5KFKA 3SZ2A 1FRJA 1I6JA 3W3SA 4Q2MA 3N28A 3GYXB 4UF4A 1AB8A 1KOOA 2YKNB 3J80U 2B7BB 2WVCA 3R7SB 3PFOA 1AUDA 4X4VA 3LP2A 4NXNF 2QT7A 1TMJA 3DC2A 3DNCA 3JQKA 1U1LA 3NL0A 4ECYA 2KTQA 1WF1A 1YITS 3MPDA 2GV1A 5HO4A 2XLKA 1U1MA 1F9FA 4F0MA 3CJRA 1JJ2R 3VVTA 2QRRA 4I6WA 1T02A 2CPZA 5FIIA 2VOPA 4ZCMA 4LIWA 1FRLA 1FTRA 1Y7PA 2YVSA 3C16A 4PZVA 3M8RA 1RAFB 4ZVGA 4K4YA 1QAIA 2G9YA 5KT5A 2MGZA 3GCXP 1LW0A 2CJYB 3CE8A 3FCHA 3CCRS 1Q82T 3KMQA 1SVDA 2RU9A 4H54A 1RI7A 2AW0A 2EW9A 4QWDA 3E8OA 3CJ2A 4DL3A 2VFSA 3P45B 5F8IA 2QV6A 5LRNA 3CB4A 5E3CA 2CJXB 3SV3A 5F8HA 4JI2F 5HANA 2ZJRQ 4GTXA 2KU7A 4LF9J 2DGXA 5HMXA 2MGZB 2BM1A 3N6LA 4Q8EA 4UUXA 5LQQA 1QE1B 2XI2A 2XSJB 3ZC4A 4HDGA 1Q78A 1TKXB 3NG8A 3TR5A 2EFOA 4ZIWA 1R6VA 3N5BA 4I6YA 4RW7B 2KM8C 3WAVA 1UVNA 4EK2A 1LFPA 3M8WA 2V4RA 1MSWD 4KY3A 3QQCD 4XPCA 4K4SA 4M5GA 4CT8A 2B56A 2HIYA 3UNGC 1RCXB 3KJNB 4NX9A 3ELHA 1LXJA 1HNVA 2R7OA 3R9LA 2GVDA 3PFEA 4PUOB 1MROA 2HIQA 3EVMA 1IKYA 4LF5F 3UDLA 2RKIB 1S4FA 4NE9C 3E51A 5A6WA 4CLYA 4NCAA 2YX1A 2AU0A 3TARA 3LTOA 4NLUA 5DRKA 3P8BB 2V94A 5D4LA 1NRKA 2GNKA 5J2MB 2OH2A 4DUYJ 2R7XA 3K5OA 1FEEA 3HHNB 4DXLA 5D0RA 4NLGA 1S6UA 3T5JA 3H4BA 1RB0A 1KN6A 1WELA 3W7BA 4I2QB 4JV5J 2C28A 2Y1LB 3DXBA 4NWJA 2WSFC 2RMLA 3AB2B 2CQ0A 3M6XA 2XNQA 2AJ2A 1BQNB 1EX8A 5CAAA 2DXEA 1LEOA 3MM9A 3VAKA 1W2IA 3KDOA 3HPOA 2X3GA 2A3JA 4ZPCA 1RWWB 4EMDA 4ED2A 3D68A 3HZGA 4TYBA 2HRYA 5DETA 2CQ1A 4G65A 2V34A 2M70A 1WG4A 1TFWA 2IA0A 2YWEA 3FEXB 4G1PA 3CCES 1FD8A 2IJFA 2BJDA 3AOBA 3BYPA 3MI7X 4EU0A 2JLGA 2MQPA 3W63A 2B4VA 2IYGA 5A8RA 2KH9A 1VI7A 2R8JA 2RAQA 4QYZJ 2KYZA 5KFCA 2JX2A 4CO0A 1I1GA 4RUBA 3TEGA 4AYBD 4UOCA 3K58A 3CSKA 1ROFA 4HHHA 2EG2A 5KOWA 1R3NA 3R27A 3MR3A 3VALA 4K4WA 2UUBJ 2N82B 4MKYA 3R5AA 3FUYA 2KZZA 4IG3A 2HQCA 4ECWA 3MF5A 2O01C 1U0HB 4FVMA 4LBPA 3GFHA 1P9YA 1VFJA 5KG3A 4CM2A 4DV1F 1IBLJ 3KNAA 1HNIB 1TKTA 4KHPF 5FLXU 1ZAXA 3HHLB 4HR2A 1P9QC 3DGPB 4AL7A 4TN0A 2W5RA 4DR4J 1S6OA 1U2FA 1WEZA 2DB1A 2CJQA 3F73A 4MYUA 1YLXA 4QW8A 5LT5A 3EGVA 1S9EB 3CJKA 2W5QA 3R1LA 3GLJA 3TYTA 4Y2IA 3DPCA 4MHXA 2D9OA 1Q8BA 3GIMA 4OHXA 2L48A 2JEIA 2AX1A 3JQJA 4U7CA 3QJLA 4O0NA 4NLOA 5KFLA 4KPYA 4J9PA 3RYLA 4C8OA 1FHTA 1VRQC 5FLXY 1S99A 1TL3B 1MMDA 2CG8A 1HD1A 1CEZA 4A8QA 2CQ4A 2J8AA 2RKIA 2WHOA 3IM8A 4IO9Q 2N3LA 1QTNB 3CT9A 3TA1A 2E44A 2IC3B 5GAEI 3OL6A 4B3MJ 1N8RT 3UQSA 1JMTA 2WVFA 2LQBA 3R5DA 3GJQB 3GQCA 2ZH8A 1C0UA 1R7IA 2CJAA 3B8HA 4ZOSA 5HVHA 3JSBA 3GB0A 3H25A 4LBHA 1QSSA 3C6TB 3KUHA 2XB2D 5LIAA 4JYAJ 5L1KA 2WBRA 3EZ5A 3QZ7A 3HP6A 3A8KA 2IRYA 4DLGA 4H4MB 5I3QA 1PC5A 4P9SA 1KEKA 3W66A 2DH7A 2J7UA 1YJRA 1NSAA 2EG1A 4YEAA 2RHSB 3K57A 3THVA 2BKOA 2PA8D 3VQTA 4OHWA 4DPWA 4X4UA 3OQ2A 2P9GA 1I3OB 2IDEA 4YB7A 3DKDA 4ZKAA 4AQYF 2CQBA 1DZ5A 2JC0A 1ZTTA 4UPLA 2G4BA 3CDBA 3G8SA 1D8ZA 3OR1B 4V19X 2ZUAA 4IR1A 4D3GA 5C2CA 3PW7A 1CC7A 3BH7B 3AOAA 1M5PC 4IRKA 5TJ3A 1D1UA 4JI6F 3MD1A 2VODA 1ZH5A 3O5TB 4CYSA 1AROP 2C1EB 3WBZA 3EYZA 2BX6A 3M2RB 2M8DB 3GIIA 2CNNB 4NLXA 4XO0A 5C66A 2V4QA 2DR7A 1FA0A 1QSLA 2VD3A 4Q8FA 2DNZA 5KFJA 1R8BA 4XIUA 2IBKA 1RKIA 1IKXA 1GX6A 1TL1B 1UPMB 3OLAA 4J9OA 1S1UB 3CF5Q 3NWGA 5G0RB 4DZDA 1RAJA 4ZCKA 1KNZA 1AZSA 2W25A 3BZQA 4K0KF 2NZ4A 1ZA2B 1EQJA 5B0DA 1EW2A 1KH4A 1FTCA 2CQIA 5DQIA 3SCLE 4OX7A 3BO2A 1DBDA 5A6PA 2ZD1A 2MKIA 2JVOA 3T9ZA 3V2UC 2IMOA 2EBEA 4LREA 5IOLA 1PJ6A 1AFIA 2W2MP 1KONA 1T03A 4CH7A 2W2QP 3C46A 4JI3F 1K44A 3QIDA 3G2XA 3DFEA 4O4GB 3VTIA 2ASLA 4P2SA 3W5ZA 5IT0A 2J0WA 2VG6B 1G4CA 2JDJA 3ETMA 5DZ7A 5HQLA 2GO9A 4DCJB 1FJCA 2YBVA 2HK3A 2VQFF 3CD6S 2V2KA 3AJ1A 5CA5A 2R8HA 5L0KA 4KPCA 4OZJA 2E7VA 4TXSA 2GZOA 1Q53A 3AQPA 1KLNA 2OTLS 1NLKL 4DN0A 2Y9HA 4N47A 2HHUA 5CZXA 1J2VA 1SXLA 2QIFA 3HSZA 4X64F 4N5SA 2V2VA 5F8MA 4N8OA 2ZD1B 2DHHA 3RAMA 2DHXA 3U02A 3BB5A 3ZZPA 4NCBA 1SH3A 5LMNF 4ECZA 5M2PA 4DJBA 4RUCA 2OTJS 4K4TA 1RTIA 2M0GB 5F0UA 3LQVA 2YWFA 2JRSA 2C3OA 3M8PB 4DBQA 2DGSA 1U48A 4A8WA 1TKZA 4TLQA 4URQU 3BBCA 2HNZB 1F9EB 1S6PB 4EI2A 5HN0A 3UCZP 4HHJA 2FLNA 3ET6B 5GAGU 5C25B 2QA2A 1SB6A 3LXQA 2HVHA 3AA9A 4DR2F 1Y7AA 4KIAA 1U2RA 2VUGA 2A2DA 1U4BA 1EETA 1NDCA 1MWYA 2K3KA 1VRUA 4J90A 3AXKA 5D0EA 5F9NA 3ZZZA 2OEJA 5SZTA 3BN4A 3KYLA 2Y1JA 1ZM9A 5A2QY 5T7LA 4DPUA 1HBNA 3EE3A 3NGSA 2IRUA 1UA0A 2X3DA 2OO4A 4KM4A 1HBMB 2BE7D 3DN9A 1RT7B 2EEYA 3FZBA 1N5TA 3QAEA 1XIQA 4DL0C 1ALKA 2PMHA 1K47A 2DIUA 4LF6J 2DCLA 3MCNA 1NHUA 4LRCA 2WONB 4PWWA 3ZTRA 5IJQA 3LPEA 3DRRA 3M9OB 4A8MP 1UA1A 4O3OA 3M30A 3SYZA 2W9CB 1VQPS 2Q6BA 2DPJA 3OXGA 2VPYB 3H0PA 2DJWA 2V4JA 4FNIA 1RWVB 4OYPA 4U9RA 4FKYA 3VF0B 4BLGA 3PR5B 4RW6A 5DQHA 1PC4A 3OPKA 3MCSA 2LVWA 5JVGQ 1VBZA 4DR1F 2NZCA 4MFBA 1TELA 2H4YB 1VBXA 3ISNC 1FXRA 3TI0A 2VU5A 3TRGA 2CAJA 1Z1ZA 4CO5A 2W9CA 4OYIA 3CXCR 1T05B 5L39A 3TA2A 4UOPA 1JK9B 2E1AA 3ULHA 4CZCA 1WG1A 1TFYA 3PACA 2OLWA 2Z2MA 3NOCA 5M2RA 1CC8A 4O44A 5GMEA 3W9JA 2L3MA 1U0SA 4BHQA 1VHIA 3TZXA 5KFOA 2AD9A 1B64A 3RUBL 5BJRA 2OFHX 4EBEA 4ANEA 3OSPA 1C4AA 1FNXH 5FDLA 1WD6A 4WK3A 2CPIA 2AEMA 2FB0A 4UOOA 1UPPA 2HQFA 4MIVA 3MECB 4X4PA 2X1FA 3A1YG 3MCOA 2GVZB 3TP2A 1SBRA 4P7VA 2EI5A 1O99A 4HH1A 2QYGA 1VS3A 3BGFA 3BPDA 3RAQA 2B4PA 2FQQB 3IGVA 2VZ9A 1N48A 4WU2A 1XMQF 1F5AA 4CI0B 2UU9F 1HHQA 2QC3A 5A8KB 4QPXA 3HMJG 4ZP8A 4I68A 2YWWA 3ILLA 1BMQB 2SXLA 3QT5A 4WFZA 3GPAA 2CZ4A 1JLAB 3QFWA 2NLWA 3ZTPA 4OYZA 1M5VC 4IG3B 4DR4F 3DXSX 3N4WA 1MMLA 4K5RA 4C0OC 5HMWA 1HWLA 1IWGA 4I6AA 2M7SA 4NLQA 3BKFA 4W90B 2FGOA 2GJFA 2OI2A 2VFTA 3CO9A 4R8UA 4LJMA 4UW2A 5H9EK 1H73A 2VFVA 1SPBP 1X4AA 2LU1A 2VASA 4V1Ak 3OVBA 1C0TA 3FQLA 1D09B 4NXMF 2XRGA 1O5JA 3C66A 3GP9A 2JC1A 5BYRA 5KG1A 4ANDA 1CJTA 4RW4B 4ZVRB 2XO7A 4RX6A 4FPRA 4QWBA 2V8PA 3EDRB 4KRWA 4NLWA 5E7OB 4J9RA 4JI8F 1T9XA 1UVMA 2CPXA 5HBMA 3Q8QB 5CYQA 3UW1A 3KK1A 1GNKA 1JX4A 3J81U 3FC9A 1JLFB 2XULA 4USWA 5B0BA 2DITA 2EVZA 2YX4A 4ITSA 3J7YU 4QQBA 1REVB 1ZAVA 4AFFA 2F7VA 4ELVA 2KKHA 1EP4B 2JEFA 2WAQD 1IBMJ 1QJHA 4X4TA 2MLZA 3NGKA 5HQ8A 1KBRA 4J9MA 1TAUA 3D6TB 2HGNA 2DR6A 4MIAA 3I5CA 4PYDA 4USKA 3TQEA 1A6LA 4DPOA 4C48A 3IAM9 5HK4A 1P27B 3P5BP 5KT2A 1U8SA 1NPKA 4PXEA 5FDLB 3MUTP 2YNIA 1IBLF 3GFXA 3D6MB 3KHHA 2XSFA 3PYGA 1DQAA 1S1UA 4DPXA 1SKRA 2B6AB 3QT7A 2HQGA 4EZ9A 1RTJB 1NBEB 4JI4J 2YPZA 4X84A 5B7WA 3PV8A 4B3RJ 1XK8A 1RHJB 2LU2A 4OYAA 3RB4A 2EKYA 5E3RA 3H98A 1X9MA 3PJXA 2ZH6A 1OPZA 1SJ3P 4KGXB 2MMYA 2NREA 3D54A 3QGGA 4AXIA 2G2ZA 4UZBA 1OY8A 3GYGA 4IR9A 3SQGA 4KGVB 2ZBIA 1MNEA 1OMSA 2WCXA 3FFIA 3K8WA 3M6VA 1SIWB 1X4FA 3WZ0A 2VIHA 4CLSA 1CVJA 4LMZA 4RUHA 4HT5A 4UOHA 4LR2A 1FDNA 3CD7A 1FWKA 5LSOA 4YOEA 1C4CA 4U7UK 3MEGA 4MKBA 4B9MA 1URNA 1KKHA 1RAOA 2VB6A 4Y00A 3MR2A 1RA6A 3WC2A 4UY85 1TK5A 2DNLA 4IG0B 3A8EA 4LSZB 2UP1A 2UVWA 2H65B 3D1QA 2B5JA 3L4BC 2BJ3A 2MKCA 3WIVA 4KAYA 3H20A 1ELOA 3NRBA 4KQZA 3HJFA 3FSYA 4BCAA 4QBUA 1LFWA 2CVIA 3NS5A 3FMWA 3LP0B 2GMHA 1IM4A 3LUYA 3O8WA 4OI4A 3U1LA 3OV7A 2MZ1A 2DH8A 4QW9A 3Q23A 2M2BA 1C1BB 5GOVA 1OJ4A 4PUOA 2V50A 5D4PA 5IV4A 3CVKA 1KLMA 4ZVOB 3EPIA 3DMJB 3QJPA 1DFDA 1PGZA 2BV3A 2JFKA 2DNYA 3MR7A 4DX5A 5IT9Y 1RBAA 4DWIA 4KJIA 2HWHA 3A12A 3VQSA 4R5PA 5KFNA 3HSDA 2J76E 2FZKB 1VQOS 5J2QA 5DDOC 1G7CB 3TAQA 1CLFA 4TU7A 2WTFA 1GT8A 1H7WA 2P9EA 4X4NA 1HDHA 3BJYA 3OD2A 1RT5A 1TL7A 3R7BB 2L41A 3DI6B 2Y3YA 3EWGA 3W61A 1SH2A 3A3NB 2QSFA 3KFWX 5HLFB 1HPZA 2RH3A 2OUGA 4DV5F 1LWFB 1M5HA 2YNFA 4PG7A 4YMEA 4FS2A 4WP8A 3DRSA 4MKVA 3WX4A 5FJ4A 2JHEA 1R31A 2C3PA 2W7AA 1AJBA 1RCOB 4DFJA 2HRTA 4PWDB 1E1ZP 1TL5A 1VLYA 2AGOA 2W2OP 1HQUB 2GAGC 5LOQA 2ZZTA 2VQRA 5K14A 4DV4F 3KDNA 3MM6B 4EBDA 1BD6A 1PKUA 2LLZA 3F56A 4FDFA 2FY1A 2VC1A 4C8KA 2E5HA 2MKYA 4KV8B 1FWLA 1VQ9S 1FRKA 2R4FA 3A4TA 1FXLA 3BO4A 1UCNA 1U2CA 5HATA 3OTOJ 2RQ4A 2ZH2A 5HROA 4UORA 3MCMA 1NZAA 4DV3J 2HNZA 1SJRA 1TL3A 2HFNA 1SC3B 1S6QB 2VH7A 4RW9A 5MLCV 1NK6A 1EW8A 5KG7A 4KHRA 2G9OA 2J6UA 2OJ3A 5DDPC 1FF2A 2HFZA 5C5JA 3DHWC 1WI6A 2GLQA 2W5TA 3MK2A 4KR0B 1NU4A 1Y5IB 3L09A 3MK0A 3QLHA 4ZLPA 3CCWA 1RACB 2X51A 3MHYA 1AW0A 1NM2A 1YBUA 2W8LA 2PI4A 3L7OA 4USVA 2B4UA 2EC2A 1YJWS 1S1VB 4CO3A 2QMUB 3QO9A 1S7HA 4ERDA 4J9UE 2V0NA 4C3KA 4PG8A 1RU1A 1RK8A 2APOA 3HSGA 2DEIA 2L9NA 3DYCA 2D9PA 2F8HA 2HBYB 1UEUA 2VG6A 4LIRA 4ZDNA 1YJUA 3THTA 3KHLA 1BGXT 2QJ3A 4C9DA 3LPYA 1S77D 3G71S 2PFDA 3LH2S 3JYTA 2BE2B 2YWKA 4J9QA 5KFUA 2AYGA 1OSCA 3KMSA 1FKOB 3M1VB 4P71A 4MK7A 1CJUB 2RU3A 2LEBA 3MM7B 2J6TA 4FKXA 1ZAWA 4P72A 4Y65A 3ZFVA 1I94F 5L9XA 1U1NA 1RT1B 2VA2A 2C2KB 1EAYC 2QG9B 3GILA 1H2TZ 1WI8A 3G87A 4NLTA 2MZRA 1AZSB 2HFVA 5AXMA 2R7VA 7FDRA 4Q0BB 5KFGA 4AXJA 2X1AA 3MTJA 4MT1A 3QGPA 1Q0NA 4CWBA 4FF1A 3J7Z5 3DRSB 1XJWB 5C25A 5BYSA 2W8DA 2ZZMA 1H6KX 2K1RB 3O1LA 2B51A 1YJTA 1TKZB 2RUGA 5IM0B 2CQHA 2HHHJ 4DQRA 4LF8F 5BR8F 3QRQA 3NWRA 1N33J 1C0UB 2HLUA 2JH3A 2M9KA 4P2MA 1D9DA 1UWBB 2J7WA 4LF4F 1M5KC 2LQJA 3CGIA 1HHTP 3QWUA 4PYAA 4DR6F 3DLEA 4Y2KA 1JXLA 4WYLA 2X7IA 5E33A 2DXFA 4QAXA 2VKRA 2HHVA 1CQNA 1YZ7A 3LGNA 3CJ5A 3VAIA 2HZAA 3ZZUA 1RT7A 1PAUB 3LP1A 4N8NA 1FI4A 4YN3B 1N34J 4F2SA 2HBZB 2P6TA 2XQCA 2ZH7A 2ASDA 4YP3A 3NKMA 1RHUB 1L3VA 5L46A 1OS5A 2K2PA 4X4QA 4N56A 5LJ5Y 1RHRB 3RRHA 3KUEA 2GIRA 1YWXA 3TO8A 2DNPA 5D0GA 2CPHA 4CTAA 2W5XA 3W5XA 3H59A 4GVBA 3D2WA 3RB6A 2G2OA 2VG7A 4O4RA 2JEGA 2V8GA 3ED4A 5J2NA 4Y2MA 3KLEA 1XMQJ 2UU9J 2Q66A 3VGTA 4B3TF 4MYTA 1FK9B 1TP7A 1V3ZA 1DHMA 5DM7Q 1H72C 1YGYA 2CQGA 4IH5A 4M5HA 2AZ3A 2JJ4D 3Q8VA 4DV2F 2RNEA 2CQ3A 3QNWB 1SIZA 2DGWA 3F0NA 3BQ2A 3AJDA 1GXUA 3K5PA 4ED1A 2RRAA 3Q8RB 1IBKJ 2ZBRA 1BQMA 4KH1B 1RTDA 2VPWB 3I5AA 2FJEB 3AD8C 2DGUA 1S9GA 3S01A 4F50A 1MW7A 3IM9A 1YHQS 4C6AA 1TL1A 3D6FB 3EGZA 4P2XA 2IFYA 2HPUA 1VK8A 1T9UA 2K06A 5A76A 1EKRA 3F44A 1IN0A 1V6HA 2R7QA 5E3QA 3DLHA 2RF2B 1CJUA 3ENAA 2FVCA 4C4WA 2RH6A 4M95A 3ONQA 5F8NA 3PW4A 4O3PA 1JLGB 1IR2A 2MQQA 2CXEA 2YWHA 2R8GA 2BE2A 4P2FA 1KHKA 5F3ZA 1HKAA 3AT1B 4F7VA 2E9TA 1WEYA 1S9EA 5D77A 1Y5LB 4D3HA 3C6UA 2VPZB 3LP0A 2EKNA 3NGRA 4M5DA 4DG1B 2ZHBA 4DL7A 2DBBA 3H5XA 1R8CA 1D0EA 3BSNA 2GQQA 2YNIB 3KNGA 4USMA 1RWMB 2ZVIA 3RU0A 2BJ1A 4I7FA 1T11A 1DQ8A 2XWYA 4BBYA 1Q95G 1PYOB 3P96A 4ALZA 2BQRA 3B78A 1NJIT 1M90T 5EGEA 2DO0A 2FLLA 2MZTA 4ZK7M 2RF2A 1NPPA 1HW8A 2F3JA 4BWMA 3D1OA 3IWLA 3M05A 3PRBA 4HTIA 5ETSA 3ZTQA 5KG4A 4WFNQ 5KFMA 2KM8B 1EKSA 5C24A 3GYNA 4C11B 2XM3A 3HVRA 2QFJA 2GS8A 2WOMA 3ENQA 2VG5B 2BM0A 4WU3A 1VISA 2YKPA 4ZIVA 4TQRA 4EO8A 1T9WA 4K4VA 1JLEA 3KWMA 1GXTA 2HNYA 1SC1B 3I4HX 3SQGB 4B3SF 2GSNA 4U6PA 2ACYA 2W2PP 1ACMB 3PXGa 1F1BB 1WUUA 2PI5A 4IH7A 1Y3JA 3PDNA 3EPGA 2GJIA 4MK8A 1YJ7A 1S0OA 3WAXA 3E2DA 3QGHA 1GH8A 3K17A 4JI2J 3X1LB 4LF9F 1O51A 3HVAA 5I3UA 1HNVB 2AJQA 3QT8A 1YDLA 3WC0A 4OX9J 3CD0A 2V68A 4V19J 4NMLA 4IFYB 3WIUA 4YFUA 4HDHA 2A0FB 4Z2XA 4NI2B 4NA3A 5HMYA 3GSIA 1HQEA 1MU2B 3CW2C 3BDFA 1X4BA 4ETXA 3V6DA 1O0PA 4TYAA 2YKMB 1ZS6A 2WVBA 1N36J 1N6QB 1Q5YA 4CM0A 4DU7A 4GC6A 3GSDA 2E66A 1RHKB 4NYZA 1JLCB 2E1MC 4UZCA 4RNNA 1RGVA 4FXVA 4CLWA 1C1CB 1H7XA 2BABA 4X4OA 3IFEA 1M1GA 4KO0B 3T1HJ 2NQPA 2DNRA 4IG0A 5DO2A 3OLBA 3HULA 2IPOB 2JL9A 2RQCA 1Y5NB 3QT6A 2IDLA 2J0QD 3C2PA 4MY4A 2GGPB 1TTHB 2V8DA 1V3RA 1SC6A 4IDKA 4AL6A 2DPIA 4WKRA 1KH5A 4CXSA 5EHHA 4DUYF 1SHNA 5D3GA 2I9SA 5HVGA 5L1LA 1BY9A 2H3EB 3LA0A 1Q81T 5IM0A 4R5PB 4NI2A 2RHQB 3OTEA 2HHHF 4LF8J 3P3DA 1HR0J 5I3PA 3JS9A 2KFYA 2ZKUA 4K50A 2R7UA 3CTRA 2IC3A 2ZBQA 4R0JA 3D66A 3Q8UA 3TUIC 2YNHB 1ZOTA 1IVZA 4C7QA 1KQGB 2Z4PA 4JI5J 4GTYA 4J7CA 4DV4J 2NYIA 3D0GE 2QZ8A 3GE9A 3LOUA 5GAGI 2LKZA 4KGZB 1HI0P 3W8PA 2EBGA 4ZCLA 4ZLLA 5AJ9A 4DR7F 2NSCA 1S1TB 3PJ9A 2UZAA 2Q79A 3HO1A 1DARA 4DV7J 2WOMB 4MIWA 3W1YC 1HYSB 2CZVC 3HK2A 1LWEA 3MMAB 2Z30B 1XEZA 1SQEA 2V5HG 3BKUA 5C7PA 4X62J 1RT6B 2NS1B 2ZH5A 1BUXA 4DV5J 3CJQA 3BGOP 4CLUA 2KRRA 2ERRA 1XERA 5CCLA 2RJZA 4OYXA 4CDIA 1FKAF 4JV0A 4MAKA 1ALHA 3AHPA 3MAHA 3DRRB 4DFPA 1KHNA 1T95A 2BANA 4WF9Q 3RR7A 4LFCJ 4P10A 1DJ0A 3EZUA 1PAEX 2H5EA 2D3UA 1Z2LA 3JTOA 3R7NB 2PEBA 1OY9A 3KHGA 5HP1A 1RT2A 4DUTA 1SV5A 2IYIA 2XHCA 1FWPA 4ZPAA 5KFWA 1IBKF 4J37A 4ELTA 4DR5J 4OJ1A 3RR8A 4ID8A 1TK0A 3CMQA 2V8VA 4JV5F 4KJGA 2LEPA 4ZP7A 3HT3A 2ZC4A 1ZM2A 2ZEJA 3HKWA 4YDXA 1JQGA 3EGWB 3V6DB 4CLLA 4KHMA 1TU0B 2Y1IA 2KN4A 3A3PB 1JKHA 3PW5A 1KQKA 5A8RB 5A2QU 4F3MA 3H42A 4LFBF 4R8UB 2RVJA 1X5TA 2V2QA 1EB0A 4FPIA 1N56A 2CJBA 1L3SA 1KS2A 3HFKA 2M8HA 4MFBB 4P52A 1SKUB 4RBUA 1B99A 1E6YA 2QMXA 3EICA 2FHKA 4Y3CA 2B8PA 1U25A 1X31C 2UUTA 1CJKA 2DRDA 3BF4A 3N6MA 2FUG9 4R0EA 4DPYA 3O44A 3PKMA 4K4XA 1YJ9S 1ALJA 4FS1A 1EP4A 3AFGA 4YS2A 4F4YA 4WZQA 1SCJB 2YX7A 1VMBA 1FSUA 1HI1A 3RGIA 2GGPA 3H7HB 4GVLA 4AD6A 1JLBB 5K8MA 1NK5A 2CADA 2R7WA 4CTAB 2Y8WA 2I38A 1CJVA 1WKLA 3FRYA 3KLIB 4ANCA 1KTQA 4DS5A 4JI7F 1X8DA 3M4XA 3UO0A 2BACA 5DLGA 3UDCA 1GFWB 1GTHA 2DCUB 2HQ3A 2M3DA 4FYWB 4HACA 4KB7A 4LSLA 4Y28C 3ZNUA 1NJXA 1N5VA 1TMMA 4NEYA 1R8AA 1KHWA 2D69A 3GFZA 2V6AA 1HJKA 2C2DA 3NOGA 4L3KA 4Y6IA 4B56A 5J2QB 2OELA 3CC2S 3VAJA 1IWAA 2N4CA 4Q43A 2HKEA 2VJUA 4J9KA 3OW2R 1KTVA 5I3UB 1SKSA 2AYBA 1RUSA 2PIIA 2VC0A 4OFZA 5GMKa 5KFAA 2FLPA 2D74B 4DU8A 2UUAF 5K4PA 1CULA 2F65A 3CCLS 3IWNC 2EWHA 1FRIA 3MD3A 3WAWA 1R43A 2V69A 3KG4A 4NA2A 4LF5J 2ZE2A 4UTGA 3LANA 4UPIA 2AIRB 3MDFA 1P1TA 1JNRB 2LXFA 3FKBA 4C11A 5C24B 2BQUA 2HNDB 1GXLA 2XMVA 2NYHA 2R7SA 1NMEB 2KHDA 4FBUA 1N5YB 4O3QA 2DHAA 1B7YB 1Q86T 2KO1A 1ZEBA 1RLCL 3MEGB 1Q8LA 1UP1A 2MY7A 2VQEF 3GR1A 1RHMB 3MEEA 3C16B 1EW9A 3MPYA 4QCLA 1N33F 2JZ5A 2QL5B 3HKZD 2FD2A 3BR9A 3M2VB 2CWKA 4I2PB 4WE1B 3S6EA 4IRCA 4KGMA 2MY8A 1SJFA 1J5EJ 3D3BJ 5F9LA 1PYSB 2HG4A 5KFBA 1WNEA 3OHBA 2V67A 2A18A 2D7SA 5DG8A 1U1OA 1ZZNA 4JI3J 3D5MA 2ZBPA 2XS2A 3LP1B 2BYCA 3C15A 2GC8A 2VF3A 4WFXA 5CYMA 2Y8YA 3TNVA 5KOXA 4GO5X 4DV2J 2YKQA 3THPA 2XLIA 1UVLA 2P2CB 4DF8A 5A8WB 1WHYA 1SI9A 3TX8A 1FRHA 1XMOF 4IOCQ 2JSXA 3C3LA 2KFNA 5KAKA 3C15B 1HWIA 5B0CA 3RBXA 1APSA 4TU9A 2V8HA 2OPSB 5K8NA 4OYBA 2QLBB 1CSJA 2J0SD 2A1BA 5HSPA 4ELUA 2C2ZB 3IXQA 4HVZA 3R1HA 5IFMA 3R2CJ 2YXLA 3P5TL 2YQ3A 2CA9A 2DEJA 5T7LB 3BGLA 4DPTA 1WHWA 4DLEA 3POTB 3SI8A 1VGYA 2JLEA 3AA8A 4QR2A 2HFOA 2W24A 5T14A 2F9JA 3AOCA 4NYPA 2Z8QA 5EN1A 5KT6A 1GEHA 4DR5F 2HYIB 2LQ5A 1X4DA 4O3SA 2AYEA 4QYZK 4I69A 2XR9A 2HNDA 3H90A 1RHQB 5KT4A 1ZTWA 3CJKB 1NNDA 3MTKA 4H4OA 3UN5A 2XBPA 5J1PA 1LK5A 3MAAA 2O66A 3G8TA 4RNFA 3T1YF 3HF5A 2KFZA 1EJJA 4FF2A 2AP6A 3FNNA 2HSEB 4CT9A 4DX7A 3FCVA 4CQ1A 1HQEB 1MU2A 3QWPA 4ZN1A 1QVGR 1B8JA 1UWAA 1L3KA 4OHVA 3NCPA 4B3OA 2LYVA 2B43A 3TAMA 3TZZA 1WWHA 1TL4A 5HAOA 2ZJQQ 3VAMA 2HS0A 5GRRA 3NGTA 1CQMA 1YKWA 2J9CA 3DM2A 5IC6B 3KLVA 1NJZA 2RRNA 1HARA 2CWXA 2QYCA 5DLVA 2DISA 1HQAA 2MQLA 5KG2A 3PX4A 3AY0A 4E2FB 2EPIA 3HHLD 4A47A 1FFGB 1HBOB 2AEJA 2BJ7A 1XMBA 1T9YA 2I1RA 1QUPA 3DYAA 4NRTA 2OSRA 4GMKA 1HQ2A 1D3WA 3QBCA 4HACB 5HJXA 2ZM6J 1VDHA 4TVAB 2HEKA 3A3OB 3H40A 1HMVB 4NCGA 4ED6A 4J9VA 3VZHA 1VQYA 2B5JB 2Z2ZA 4DR2J 5LXRA 1RTHA 3TUJC 2B8QA 1Q4RA 4FN5A 4LSNA 4NZ0A 4QPTA 5IXUA 3OVAA 2CQCA 1K1QA 5K14B 3KJVA 3NKOA 4QIVA 2J0XA 4J9NA 1JJCB 1HHSA 4MK9A 4UY8T 3CDAA 4A8XA 3T19A 4OL8A 1DURA 4ECUA 3P4UB 5J1EA 4LF1A 1YG0A 3Q22A 1FJEB 4I2QA 1PG5B 1S48A 5L0BA 1FKPA 2RIJA 3LW5C 4L3NA 3SSSA 3OUYB 3I96A 1R89A 3MM8B 2F4FA 4ZS6A 1M1KT 1UJ6A 1VRTA 5GMDA 2VBZA 1SKWA 3DI6A 2ZZNA 4X2BA 2CRLA 1KWMA 3D9BA 1R6YA 3PCOB 2HMIA 4I2PA 2WB1D 1UZHA 2ZUGA 2B3TB 2IM0A 3BBBA 1B0TA 3W8GA 4GTWA 4LQYA 3FVYA 4WIQA 1QVFR 4ED5A 4DR3J 2B0GA 1SV5B 5E2QA 4PXBA 4LR9A 3HFVA 2VQEJ 3OTBA 4L6V3 3ITHB 2DK2A 4QU6A 3EGNA 2XMKA 1FFSB 4TQSA 4ECVA 2AHOB 2KI2A 1MN9A 2IAJA 4QJVA 1NEEA 4WXWA 3BBFA 4H4KC 1UKUA 1YQHA 3BV8A 1BQXA 5AXKA 2VA3A 5J2NB 4LBIA 4PQUB 4JBCA 4ZJLA 4FYYB 2DO4A 4ZMMA 5D3GB 2C2RA 2C42A 4EWTA 3CJSA 2CPYA 2KB2A 4ECRA 4KGKA 5B0GA 2ZE2B 3I0SB 4BC9A 3BYRA 3KK2A 1DTQA 1RJJA 5IC4B 4HKQA 2HHTA 2AF6A 2CZ9A 1F5BA 3JAMY 2RS8A 3MPUB 3KK1B 4F4ZA 3V4IB 1UW4A 3DDKA 4LF7F 1CJKB 1WORA 4KAVA 2AYMA 1AT1B 2GW8A 2RRBA 3ITHA 4X62F 1RAGB 3Q8SB 2XHWA 2Z57B 1IJEB 1YTYA 4LRAA 4DQPA 2NXJA 3E01A 4NLDA 1ZEDA 1FE4A 4F26A 2AGQA 2G0CA 1W26A 2MZJA 1LV5A 2KT2A 2N7YA 4MMOA 4ZG9A 1PIEA 5K5MA 3AD9C 5E0OA 3QIPB 4GRSA 3V6KA 4XK8C 4JI1J 1VQ7S 3NLCA 4QIWD 4Q44A 1VLOA 3R5JB 2ATCB 3DHXA 3E01B 2KJVA 2Q6CA 3VCDA 3MUVP 2AQ4A 4OZ1A 4ZPBA 3S1TA 4QWCA 2FHMA 2XYGB 3V81B 2W4CA 3L7PA 3SV4A 1S72S 3TOQA 1RT2B 5ETLA 3G96A 4PKDB 3LWLA 1CJVB 2G1DA 3KLIA 3OTDA 2XSJA 4X65F 4OYWA 3PX6A 2OMLA 4X66F 3GIJA 4EGLA 4QZVB 2N7CA 3TVYA 5KFEA 1D9FA 4B02A 2UXCF 3ILOA 2BANB 3KK3A 3BDPA 2BJEA 1U1PA 5ETQA 1Q79A 4ZITA 3SMZA 1B0PA 2R8IA 1KP6A 3MFIA 3KLGA 4B9VA 1VBYA 2F5GA 2HWIA 2BRLA 2LA4A 4OLPA 4ZVPB 4JP8A 1GMUA 3SZYA 1UEKA 3L95X 2W9BB 1T3OA 4DQSA 1QTMA 2ROGA 3ISND 3TAPA 2PO4A 3KXDA 1WC0A 1X9SA 3PVXA 3U7JA 4ZCIA 3MR6A 3MPWA 2WSEC 1WSRA 2KT5A 2ZOGA 4F0KA 4U95A 4TU8A 3RB3A 3V81A 3VGSA 2K7JA 2GJ2A 1DAXA 2NXNA 5I4MA 2XEXA 2YH1A 4EO6A 1NAQA 3QGIA 2ANHA 2ALYB 4ATNA 1FDBA 4DSEA 5A0YA 2OAUA 2IUCA 2W9BA 5GVQA 2VBWA 2AWZA 3J7ZT 4LF6F 1WHXA 3CIMA 1G1XA 2O3DA 2GHVC 1YRTA 2GQCA 5BYQA 1GK8A 5ETMA 1K7HA 4K5SA 3JTPA 4K2JA 1UFKA 3NEKA 2B7CB 2RDIA 3K59A 4NWBA 3QZ8A 2KXHA 3VAFA 3JTNA 1N4LA 2ASYA 3IS9A 1IM6A 2V63A 1WSVA 5E3PA 3X3UA 1S0MA 1KRPA 2GHWA 3UR0A 1JXEA 3BDGB 1CG2A 1IQTA 2JOQA 2HRUA 4F0HA 5CH7B 4ZA1A 3ZNJ1 3MM6A 1RADB 4DHVA 4IQMA 3VZIA 1XQIA 1TUGB 4FF4A 2PA3A 1RXOB 4C8NA 3I9V9 3MOZA 1VRUB 4BDPA 4PWDA 1FD2A 1X5SA 1N0VC 2WW4A 3MECA 2UV8A 1WC6A 3SCJE 4ZLJA 1YBAA 5MAOA 3BS9A 3KLFB 4F02A 2N3OA 1SJQA 1JIHA 1P49A 3MWBA 3TAMB 3IS9B 3KUGA 4HT7A 3UD4P 2IVFB 5DLTA 2FJVA 1UJ5A 4ICLA 5KFYA 3D67A 1IUJA 3VWSA 1RTDB 3HVTA 4KFBB 1FNMA 1OQ6A 3BDEA 3TVKA 5I42A 1S5ZA 1NB2A 3CC7S 1UWBA 3IAS9 3WQPA 5G4DA 3NAIA 2YNGB 4WIIA 2XMTA 2DD8S 3R5BA 1IKWB 1RBLA 4U67Q 1VR6A 4HLBA 5HVFA 3TW0A 3WX8A 1X4GA 4KH0B 4JI8J 5K9FA 4CNZA 4FYDA 1PO6A 1FCAA 7AT1B 2NCKL 5RUBA 3I6PA 1NCLA 1LQ9A 5DDRC 2W8SA 2KVQE 5K8OA 1HWJA 2MKHA 3DLBA 4OZ0A 1TVRB 3AXMA 2DHSA 4ZVSB 5SUHA 1KOHA 2DR8A 4AT1B 3EM1A 3AODA 2XY5A 1HIYA 5F8GA 1NK8A 5IWAF 2ZWOA 2ZH3A 3MMCA 5J2PA 3Q2TC 5D4NA 3R3TA 1RLDA 1E6VA 4WXOA 1FDAA 4HHUA 3VHQA 2ATLA 1HBUB 1RISA 1TUWA 1U7LA 4JI6J 3OT9A 4NA1A 3T6JA 1EETB 3BSOA 1XN9A 3KK3B 1QAYA 4J5OA 1LW2A 1UEVA 1EJ7L 4QIGA 4KJDA 2DIVA 1ZBTA 2WVEA 3PHEA 4PXCA 2IM2A 3M8QB 3E3XA 3N01A 3CDEA 1UW9A 4A4JA 4RW8A 3GV7B 1ELZA 1GMWA 2VBXA 3GJSB 3HDSA 3OTOF 4DSFA 2DRBA 3O2IA 5IJSA 4ED8A 2GQ2A 1HNZJ 5HJYA 3MMJA 1RWPB 1N52B 1FO1A 2C2OB 2JLFA 4TLRA 3KLHA 4IQXA 3E2EA 3VVUA 5ETRA 3H4DA 2HHXA 2VPXB 3FBCA 5AT1B 5CCMA 3CCMS 2Z58B 2W8KA 3K5MA 2N4DA 3B54A 5D4OA 5E41A 3FSIA 4DSIA 2HQDA 4F3OA 2KXNB 1UVIA 2WK4A 1E6VB 2DGQA 3MEKA 3SZZA 2CQDA 5CQGA 4DX8H 3GTYX 4LF4J 3WHIA 3NCRA 1HLWA 3HX9A 2OGUA 3CJ0A 1WC1A 1EIYB 4TY9A 1A0OB 1U1RA 1MLAA 2KRBA 2GSUA 2CFXA 1V5IB 2G0IA 3BEGB 1HNXJ 3DOMA 4B9UA 1X4EA 3A13A 4UOFA 1REVA 1IKYB 2GX8A 2JFDA 4DR3F 1JLFA 3MPVA 3PYFA 4NL5A 2FLOA 5HRTA 1HWKA 1TUVA 2ZM6F 3PIPQ 1HW9A 3HZEA 4ECXA 1T03B 1VQMS 1BLUA 2JWNA 2QFIA 3TUZC 3JSMA 3C6TA 2OEKA 2H1YA 3CEDA 4ZHRB 1U45A 1L3UA 1VQ4S 3NNHA 1FEHA 5DGAA 2RT3A 4CO4A 2X1GA 4N77A 4ZJOA 4JUZA 3BGRA 5A8WA 4YR3A 4OI0A 4GO7X 4HL9A 2FZGB 4URSA 2GO8A 4U96A 4ED0A 4YB5A 1EARA 3IR7B 1E2SP 2JEJA 3CCJS 3M7VA 8RUCA 1VQNS 3MOJB 2BJ8A 2X1BA 2FVQA 4I67A 2OP5A 3OR1A 1NO8A 4L75A 3KLFA 4LRDA 3SQOP 3ZTSA 4PAAA 2QN6B 1NKBA 1RAHB 2RQKA 5L8RC 4DQQA 2MZQA 2W4DA 3MM8A 1DTQB 3VGUA 3HCXA 1WDTA 3M2RA 4M5NA 2E9RX 4YHHJ 4NASA 5J1EB 3SXLA 2HZCA 1SUQA 3NKPA 2CNKB 4ZP6A 1N5SA 2AEFA 3ZZOA 2KG1A 3I82A 3TANA 2R7TA 1FNOA 2C3MA 4FDIA 2BW2A 3PM9A 3OR2A 1NSKL 2DY1A 4CH0S 1PBAA 1S1XB 1Y00A 2K7KA 3MZIA 4LF2A 4CRJA 4J9LA 4HI2A 3I4PA 3IRXA 4OI3A 5I42B 2FPHX 3IR5B 3J81Y 2KG0A 1X5OA 1O8BA 1RWUA 3MMBA 1K73T 2ZNZA 3RBDA 2H54B 5LSRA 2YWGA 1RBOB 2MHNA 2IUCB 1JLQB 1V9OA 2RSQA 2XC9A 2AKWB 3KHRA 2ADBA 2IM3A 1M1HA 3RRGA 4RW9B 2R2UA 1F2GA 2YPYA 4B3TJ 1B0VA 3HSJA 4O3RA 1U1KA 4DFMA 4OJHA 1H3DA 2MSTA 2AJ4A 3BGUA 2HFSA 1R0CB 2HAFA 3HI9A 3EXYA 3OFFA 5ETNA 1URBA 1U24A 1NSPA 2QLFB 4QIFA 2K3IA 1YI2S 1UETA 5AE1A 1EQMA 4NMXA 2UUCJ 2ZDPA 4W92B 3KJQB 2KL8A 2VBYA 3MEEB 1LWXA 1Q7LB 3MM9B 2AV5A 1WACA 4GC7A 1RAIB 4Y2CA 1O98A 4OZ2A 3BSCA 1QUVA 3DLKA 2KYXA 4OI6A 3G82A 5FD1A 4B9LA 1R0AB 4H4OB 2D1CA 3GG1A 2ILZA 3NS6A 2BMBA 4WP3A 2LA6A 4DDFA 1RT6A 1KH7A 1YZ6A 3Q86A 1IJFB 3F41A 8ATCB 2Z56B 1ZYQA 1N36F 2EFPA 1DTTA 2FZCB 1F2HA 4ILRA 2Y1RI 4H4MA 1VC6A 4DCOB 1HBNB 3TJ8A 1KSPA 2HAIA 1FJGF 2I5JB 2KZMA 4FDJA 3TZYA 3C14B 3DOLB 4ZG6A 2CNLB 4JI0F 3T1HF 1X5PA 4F4AA 1S49A 4DS4A 2YTCA 4EYIB 3HHDA 4WCEQ 4OYMA 1WTFA 2E1PA 4O3NA 2YNHA 3SIPB 3T1AA 1U49A 3CDWA 3Q83A 1EHWA 1RU2A 3JQMA 5H1SV 2EXUA 5KFZA 2MDAA 4WK1A 2HWTA 2XCPA 1XR6A 3GWCA 3HD2A 2BQ3A 2O67A 1BC6A 3NKNA 3UD3P 2F63A 2BKNA 4DN9A 1IBCB 1X0FA 4H4KA 1RTIB 5C42B 3RW7A 1RQ0A 1N32F 3I56S 3T00A 3DGVA 3SEOA 3RW6A 3L9ZA 3VAGA 3MGJA 1QAXA 1NHVA 1JLAA 2BBEA 5J1NA 2E5LJ 2VFRA 3IRXB 3LF0A 4UUWA 4OZ3A 5JMNA 1CBKA 2RD5C 3H2UB 4B9NA 1T8EA 1K0VA 4YR1A 1C1CA 3OR2B 2GA7A 4DV0J 2ABYA 1UJ4A 1W7WA 2LDYA 3DDNA 4NYOA 1JNZB 1NB7A 4M5KA 2QL9B 1F3VA 3DRPB 1NZ8A 2YKMA 3A8JA 3IP0A 5HBMB 4RU9A 1WOPA 4WFBQ 2MKKA 2IMWP 4OLOA 1VQSA 3W2WA 1VIXA 1XBWA 2DXDA 2FC8A 5D0HA 3C6UB 2G13A 4RUAA 2MXYA 3GJRB 3FRZA 4OV6A 3NKQA 3GV8B 4FXWA 1PJ7A 1S57A 3GR0A 2COLA 1BXNA 1S1WB 2CVEA 3R97A 2U1AA 2R7RA 4DL4A 3PX0A 4B3MF 4EZ6A 2QEXS 4RW7A 3I55S 3UVJA 3ZZYA 5IV3A 2ZH4A 2MJUA 1FERA 1DY3A 2LMIA 4ES3A 1ZETA 4K59A 3H8YA 1LXNA 2P6SA 2RQMA 3KLHB 4EBCA 4DV6F 4A8OA 4JV2A 2XZTB 3U1MA 2W7PA 4C3MA 1MROB 4DUZJ 1UTAA 2W5VA 4OI1A 5ITHA 4B17A 1XNQJ 1S1XA 2FJXA 2I8EA 3C8YA 3C19A 2AJFE 4WFYA 1LW0B 1T9VA 5LM7E 4C98A 3JB9k 3CDUA 5DG7A 2HHQA 4RPFA 4JI5F 4OHZA 4CLPA 1IXKA 2E5JA 4KE5A 4BC7A 3QFHA 4QOTA 2CDRB 3GFYA 2OEMA 1KFSA 1VJQA 1SJ4P 1RTZA 3PO5A 2PDAA 4ZPWR 4C8YA 4DR7J 2RILA 4LSNB 4NZ6A 4YDDB 8AT1B 4F04B 1CS4B 2J9DA 3MEDA 4DV7F 3KOAA 4CXKA 3B82A 1M5OC 3M32B 3CJ8A 4XDDA 2OD4A 3QSYB 4KT0C 3MXHP 2F8MA 2XG8A 1ELXA 1DLOB 1Q8IA 3CUNA 3PW0A 1YIJS 5EUHA 3VV2B 3ILJA 2EK1A 1GQEA 3U1NA 3EXCX 2MQMA 1IQZA 2QSWA 3G86A 3N6NA 4NPOA 3RJMB 3RRKA 4A8SA 4DL6A 1MN7A 2OPPA 3UFCX 2QE5A 2BXJA 2PGCA 3ZXWA 2NXCA 2OIHA 1BWEA 4RL1A 2HVEA 2QTWA 2LQ8A 3T6BA 2PD1A 2RDDA 4RJVA 1KDNA 3MM5A 3DOKA 1IR1A 2H51B 4OIXA 9ATCB 4EFAC 4USHA 4B3OB 1JWWA 3ICLA 1EZZB 2YNGA 4OX9F 3PR4A 4NEZA 1E6YB 3UDVA 3Q24A 2LFVA 3CC4S 1V3SA 3DRYA 1FXDA 1WF0A 2QLWA 3R5GA 1LOUA 5KFQA 4KYZA 1S7IA 4RBVA 5L1JA 2XCAA 2LP4A 2CNOB 3V6HA 3OL7A 1RTHB 3K0JA 4FYXB 4UPHA 1K8AT 4PXDA 1A7GE 3QYYA 1E33P 1VQ6S 3JSRA 1S12A 1U6ZA 3LAKA 4ZVQB 3P6YC 4RW4A 1N6QA 3UN2A 3P49B 4I7FB 1FVSA 2C3UA 2IFXA 3L7UA 3TX0A 3UR3C 1NXIA 3NNCA 2LQ9A 3TZWA 3FCWA 1HI8A 1Q5VA 1UL3A 4CIOA 4MKAA 4O44B 5GADU 3NP5A 4RNMA 4DG1A 3DLEB 4N41A 3MAQA 1YSJA 2DNNA 1R8PA 4Z7CA 2XYPB 2E1RA 3R6GB 2I2YA 1HR0F 3OVSA 3SCIE 1VRTB 4WKYA 3BO3A 3PO4A 1NUEA 1V5VA 2BVZA 3OUYA 2HBRB 3GZ7A 4C3LA 3MFHA 2DR5A 3SFUA 3CJTA 3DLJA 5LJ3Y 1RT3B 1IKWA 4J9SA 3IWXA 2BA9A 2XGQA 1HNWJ 2AX0A 2VG5A 4RZRA 4CLTA 1N2KA 1GX5A 4F4WA 1N32J 3B4MA 3R2DJ 2CPFA 4RWWA 2HW3A 1JKHB 1WHVA 2PN6A 3SSQA 3ZTOA 5DQGA 1K9MT 4BS2A 3CCVS 3NNAA 2XMAA 3EZOA 3N9UC 1VQLS 4HH0A 3V5RA 1RT1A 1AJDA 4LQ3A 2H4WB 3DLKB 2IHR1 3IG1A 4YY3J 2J9DE 2HGLA 1FK9A 1N5QA 5J2PB 4QWAA 1S1WA 1FFWB 1FT8A 3DLGA 1XMOJ 1H98A 3PEJA 5KFTA 3TJ9A 6AT1B 3TQ1A 2HBQB 3A52A 2ZOMA 3PRVA 4KKOA 1PILA 3CCUS 1TVRA 1CPZA 4OMFG 3AH6A 1QSYA 1F5CA 1AXQA 4DL5A 3HXMA 2V9WA 1JLGA 1HWUA 5BXIA 1U6BA 3ENWA 4RNHA 3TA0A 1Y11A 1VC5A 4LQ9A 3K8VA 2XS5A 3QRRA 4F4XA 3PNIA 4RWXA 5H9FK 3FBEA 2M4MA 1QM9A 2YNFB 4LFAF 2IRXA 4ID5A 1EI6A 3T5HA 2UUCF 3OXFA 1IKVB 5HLFA 3ET6A 3OXLA 5U47A 3UDEA 2DY9A 1I94J 3MMBB 5G0RA 4Z7YA 2QA4G 2ILYA 4DUZF 3PW2A 1U02A 3OBIA 5C42A 4DSJA 1ZEFA 3HHEA 1URAA 3WAYA 2BKPA 1J5EF 2DRAA 5F41A 2XZDB 1QAJA 5A0YB 1SL2A 3G6XA 3IMQJ 4FP9A 3OTCA 4DCPB 3BM7A 5DLFA 1YJNS 4FXDA 1KHVA 2IVMA 4Q5VA 3DMJA 1RP5A 1KC8T 1Q1KA 2QLJB 2F4VF 3LAMA 2ACMA 3M9NB 3T5LA 5BR8J 1M0SA 2GMLA 4CO2A 4ZPDA 3TJAA 3M8SA 2PC6A 2UV8G 4GKKJ 2ZOFA 3PZPA 3DLLQ 4ZGAA 1VYAA 4MTPA 1UAWA 1JXVA 2HNYB 2OSQA 1GAOA 1OY6A 2I5JA 6FDRA 2X98A 2NUHA 3BDGA 1YVFA 4XDCA 1FDDA 4RNOA 2Q3PA 3K5NA 4IH6A 1TV6B 5DDQC 2VHGA 2QMWA 3FQKA 3CULA 1JLCA 3FGVA 1N0UA 2CQ2A 3HT0A 1KHJA 2WSCC 1JJ4A 3SBMA 3IBCB 2E5LF 5E5NA 5D8HB 3RTVA 4Q7AA 1DQ9A 3KG0A 2MPUA 3ZZRA 1IKXB 4PQAA 3EUNA 2HGMA 4M5DB 5DS7A 4YB1P 4RU2A 1ED8A 4ZPTR 5AXLA 3HLUA 3LGMA 4DI6A 3W9IA 3IGYB 1ZZFA 4QR0A 2DNHA 3CD5A 4NOHA 5D6GA 1NK0A 1OYDA 4FNHA 4C2MA 2B9YA 2XY7A 1XNRJ 3OL9A 5IT9U 2OD6A 4WP9A 2HMIB 2GIQA 2V2ZA 2E9ZA 2UUWA 4W4MA 2O5DA 4ZN3A 2XO6A 2UXDJ 4O4GA 4HTJA 1TZ0A 2FTRA 4K2XA 4RBTA 5B0AA 2Z0GA 5HROB 3IGZB 2ZJPQ 5M2UA 1OQ3A 5KFFA 3EMTA 2CDQA 4DSLA 3HM9A 4USUA 3M32A 1WEXA 3UCUP 4M5IA 1OIAA 3W2WB 1ANJA 1Y10A 3G82B 1NDLA 1RAEB 2LEAA 3Q0AA 3HHKA 4S0MA
chains in the Genus database with same CATH topology
4MHXA 4B56A 2ANHA 3MK1A 2IUCA 3BDFA 1N2KA 5HRTA 4YR1A 5K4PA 1E3CP 3NKOA 1AJCA 3TWZA 4KM4A 3UNYA 3WAWA 1K7HA 1AJDA 5INHA 3IDDA 4UPIA 4MY4A 1FSUA 4LR8A 4N7TA 5L0BA 1ALKA 2G9YA 3NKQA 3UN3A 4LR2A 2W8DA 4LRCA 1E2SP 3BDGB 1KH5A 2D1GA 5IJQA 4CXSA 3M7VA 3A52A 1SHNA 5LIAA 5EGHA 3WBHA 1ELYA 5LRMA 1ZEBA 4LR7A 4LRDA 5LRNA 4KAYA 5L0EA 4GTXA 1ZEDA 1EW9A 2GA3A 4ZG7A 4QAXA 4CXUA 4GTWA 5KXAA 4LQYA 5LQQA 2W5SA 1P49A 4UPLA 2W5VA 1N2LA 1EI6A 5DLWA 4LR9A 3NKPA 4UOPA 3WAVA 4GTYA 3NKMA 5DLTA 3M8WA 5GOVA 5TJ3A 3M8ZA 4FDIA 5AJ9A 4CYSA 3WAYA 1ZEFA 1HJKA 1O98A 3T02A 2W5XA 2ZKTA 5C66A 4UOOA 4MIVA 3BDHA 3ED4A 3NVLA 1HDHA 4CXKA 2IUCB 1O99A 4KAVA 4LRBA 1ALHA 1ELXA 1KHNA 2W8SA 3NKRA 4LRAA 4ZGAA 4NWJA 2X98A 1AJBA 1EW2A 1KH4A 2IFYA 1EQJA 3BDGA 3CMRA 1E1ZP 1URBA 4ZG9A 2VQRA 4KJGA 4LREA 2RH6A 4NWXA 3Q3QA 1KHJA 1KHKA 3OT9A 1ALIA 4GTZA 3T01A 2XRGA 1Y6VA 3KD8A 4UORA 2XR9A 4KJDA 1KH7A 5L0KA 1EW8A 3UN5A 3B5QA 3M8YA 1URAA 1ED8A 1EJJA 3IGYB 4UPHA 1ELZA 5EGEA 1ALJA 1E33P 1KHLA 2GLQA 2GSOA 2QZUA 2W5TA 3MK2A 4FDJA 4ZG6A 5IJSA 3MK0A 1AJAA 1B8JA 3UN2A 3SZYA 3TG0A 2W5WA 4UPKA 3TX0A 5GRRA 4LRFA 1ANJA 2GSNA 3IGZB 3UO0A 4TN0A 3SZZA 4CYRA 1KH9A 2W5RA 1ANIA 5DLVA 1ED9A 1HQAA 3DYCA 3T00A 3NKNA 3WAXA 3E2DA 3LXQA 1AUKA 1SHQA 2GSUA 3DPCA 2W5QA 1Y7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHX A;  4B56 A;  2ANH A;  3MK1 A;  2IUC A;  3BDF A;  1N2K A;  5HRT A;  4YR1 A;  5K4P A;  1E3C P;  3NKO A;  1AJC A;  3TWZ A;  4KM4 A;  3UNY A;  3WAW A;  1K7H A;  1AJD A;  5INH A;  3IDD A;  4UPI A;  4MY4 A;  1FSU A;  4LR8 A;  4N7T A;  5L0B A;  1ALK A;  2G9Y A;  3NKQ A;  3UN3 A;  4LR2 A;  2W8D A;  4LRC A;  1E2S P;  3BDG B;  1KH5 A;  2D1G A;  5IJQ A;  4CXS A;  3M7V A;  3A52 A;  1SHN A;  5LIA A;  5EGH A;  3WBH A;  1ELY A;  5LRM A;  1ZEB A;  4LR7 A;  4LRD A;  5LRN A;  4KAY A;  5L0E A;  4GTX A;  1ZED A;  1EW9 A;  2GA3 A;  4ZG7 A;  4QAX A;  4CXU A;  4GTW A;  5KXA A;  4LQY A;  5LQQ A;  2W5S A;  1P49 A;  4UPL A;  2W5V A;  1N2L A;  1EI6 A;  5DLW A;  4LR9 A;  3NKP A;  4UOP A;  3WAV A;  4GTY A;  3NKM A;  5DLT A;  3M8W A;  5GOV A;  5TJ3 A;  3M8Z A;  4FDI A;  5AJ9 A;  4CYS A;  3WAY A;  1ZEF A;  1HJK A;  1O98 A;  3T02 A;  2W5X A;  2ZKT A;  5C66 A;  4UOO A;  4MIV A;  3BDH A;  3ED4 A;  3NVL A;  1HDH A;  4CXK A;  2IUC B;  1O99 A;  4KAV A;  4LRB A;  1ALH A;  1ELX A;  1KHN A;  2W8S A;  3NKR A;  4LRA A;  4ZGA A;  4NWJ A;  2X98 A;  1AJB A;  1EW2 A;  1KH4 A;  2IFY A;  1EQJ A;  3BDG A;  3CMR A;  1E1Z P;  1URB A;  4ZG9 A;  2VQR A;  4KJG A;  4LRE A;  2RH6 A;  4NWX A;  3Q3Q A;  1KHJ A;  1KHK A;  3OT9 A;  1ALI A;  4GTZ A;  3T01 A;  2XRG A;  1Y6V A;  3KD8 A;  4UOR A;  2XR9 A;  4KJD A;  1KH7 A;  5L0K A;  1EW8 A;  3UN5 A;  3B5Q A;  3M8Y A;  1URA A;  1ED8 A;  1EJJ A;  3IGY B;  4UPH A;  1ELZ A;  5EGE A;  1ALJ A;  1E33 P;  1KHL A;  2GLQ A;  2GSO A;  2QZU A;  2W5T A;  3MK2 A;  4FDJ A;  4ZG6 A;  5IJS A;  3MK0 A;  1AJA A;  1B8J A;  3UN2 A;  3SZY A;  3TG0 A;  2W5W A;  4UPK A;  3TX0 A;  5GRR A;  4LRF A;  1ANJ A;  2GSN A;  3IGZ B;  3UO0 A;  4TN0 A;  3SZZ A;  4CYR A;  1KH9 A;  2W5R A;  1ANI A;  5DLV A;  1ED9 A;  1HQA A;  3DYC A;  3T00 A;  3NKN A;  3WAX A;  3E2D A;  3LXQ A;  1AUK A;  1SHQ A;  2GSU A;  3DPC A;  2W5Q A;  1Y7A A; 
#chains in the Genus database with same CATH topology
 5T41 A;  2XMU A;  4DV0 F;  1S4E A;  1WC3 A;  1KVJ A;  4P7T A;  4P75 A;  5LMU J;  4Q45 A;  1NH8 A;  2NXE A;  3OJS A;  5H9E J;  3PY8 A;  1W2B R;  3PTW A;  1H0H B;  4WZM A;  2VOO A;  4OV1 A;  1E3C P;  4LVO P;  2FHJ D;  4EYH B;  4QWE A;  4DFK A;  1AJC A;  1FJ7 A;  2HK2 A;  3MUR P;  1HYS A;  1MWZ A;  5KFD A;  1M5S A;  2L9W A;  2UUB F;  4LVN P;  5INH A;  5IS2 A;  2MEW A;  1SC4 B;  3I9Z A;  3MR5 A;  3AB4 B;  3HVW A;  3IA0 A;  2DNG A;  4WJB A;  2BUN A;  3HVT B;  3QIP A;  4KFB A;  4P74 A;  3HHL C;  3US5 A;  3RBE A;  1HNZ F;  3UN3 A;  4E0D A;  4R25 A;  3W60 A;  2OMO A;  2AGP A;  4Y34 A;  2BZ2 A;  2MB0 B;  4PR6 A;  5LSL A;  2XS7 A;  2XYH B;  3DM2 B;  1H2V Z;  4PCQ A;  1XTZ A;  2GVD B;  2HVZ A;  3HJV A;  4L72 B;  4KV8 A;  2IBO A;  1LWC B;  4TY8 B;  4PPD A;  4CO1 A;  3FDS A;  3W64 A;  2WB4 A;  5CAB A;  4G6V B;  1RT4 A;  1BWV A;  2E29 A;  2O1P A;  4ZVH A;  4ZG7 A;  5KFH A;  2EFN A;  1PSD A;  2YQ1 A;  4N76 A;  1VHF A;  1OPI A;  1ZA1 B;  3CCZ A;  3FEY B;  3G8Q A;  4FBT A;  1BQN A;  1S0V A;  1N2L A;  1IBM F;  1SJ1 A;  3DRP A;  2PFF B;  3FJ2 A;  3QPI A;  1R0B G;  5HI7 A;  2MYF A;  3RG6 A;  1RYR A;  4Y2A A;  2XGP A;  3TUP A;  3BRE A;  4Q0B A;  4DV6 J;  4OX8 A;  2OPQ B;  1KFD A;  1MWQ A;  4YUD A;  1U1Q A;  2LCW A;  2QX0 A;  1QY7 A;  3D7S B;  1LWE B;  3GIR A;  3MMA A;  4LFA J;  2P8I A;  3RAX A;  5KG6 A;  3J7A 1;  4JOU A;  5ETV A;  3T02 A;  1XNQ F;  4F8R A;  4UT4 A;  2AJ1 A;  4LUB A;  3BDH A;  2LDI A;  1CJT B;  3SFG A;  1HMV A;  1AA1 B;  4ICL B;  4NCG B;  3RB0 A;  2UVU A;  1C0T B;  4URG A;  2Z2L A;  5D78 A;  4AE5 A;  4EUV A;  4X4R A;  4X4S A;  4ED4 A;  3VGV A;  5F8L A;  4JYA F;  1KQF B;  2QA4 S;  1T05 A;  4PG5 A;  2IJR A;  4LT6 A;  3UD5 A;  2F8E X;  2F4V J;  3QO9 B;  2BEF A;  4NLS A;  1P6T A;  2ALZ A;  4PAB A;  3I0R B;  2YKN A;  4CYU A;  4IOA Q;  5JVH Q;  1RDR A;  5KFR A;  3CPW R;  1F6T A;  3NS7 B;  5HP1 B;  1RE1 B;  5ETK A;  1PBU A;  2A6O A;  3V6J A;  4DQI A;  5A8K A;  1GTE A;  2D3Z A;  3PYE A;  3W2V B;  1T94 A;  3S7R A;  4HYK A;  3D0H E;  4A8K A;  2R42 A;  2UXB J;  3GMG A;  2MKJ A;  3CCQ S;  4GTZ A;  1WOO A;  5HMZ A;  1RAB B;  5CYJ A;  4C8M A;  2XMW A;  4MIB A;  1XR7 A;  4YR2 A;  1R8H A;  4XTT A;  3Q8Y A;  2FDN A;  4YQW A;  5KT3 A;  4ZPV R;  2HQI A;  5ETT A;  2MLY A;  5KFS A;  4ED7 A;  2C22 A;  2HHP A;  3MMC B;  2AT1 B;  4X65 J;  1ZPV A;  1H38 A;  2FVS A;  4X66 J;  3DYA B;  3JXO A;  3IO1 A;  4F2R A;  4P73 A;  1K0T A;  1HL6 A;  1S10 A;  3KTQ A;  5B0F A;  4LFC F;  3FSX A;  2DKO B;  3POT A;  1G3O A;  2CPD A;  2I0X A;  1S76 D;  1F3F A;  2W5W A;  2Y0B B;  3IN5 A;  2W1B A;  4OI2 A;  5KFX A;  3NMA A;  1XNR F;  4K0K J;  1YRX A;  3ADA C;  1N5Y A;  2ZWP A;  1NK4 A;  4CLZ A;  4CYR A;  5KTQ A;  1KH9 A;  2J6S A;  3UPF A;  3M8Q A;  4M5M A;  4IUF A;  1PYT A;  3G9C A;  1ED9 A;  5LL6 d;  1LWF A;  1JLQ A;  3LGH A;  4F67 A;  2Y0S D;  3ZO7 A;  2IM1 A;  4F4K A;  2L08 A;  1AUK A;  2BOP A;  2VDI A;  1QE1 A;  1WJ9 A;  3PIO Q;  3CMA S;  1MMN A;  2PE8 A;  3MAA B;  3QAU A;  4LFB J;  1I51 B;  3KG1 A;  2DVI A;  1ZM3 A;  3WDO A;  2EFQ A;  1CUL B;  1N54 B;  2W9A A;  1KHL A;  4ID5 B;  3H2V E;  4M8L A;  1J5O A;  3GON A;  3BQ0 A;  4ZJQ A;  3D4J A;  3D6H B;  3CCS S;  2MQO A;  5J2M A;  3TWZ A;  2HS4 A;  1HFE L;  3EDQ B;  1NHK L;  3K2Y A;  4GVB B;  4HI1 A;  4RR5 A;  5IT4 A;  3R6L B;  4KTQ A;  1FRM A;  1HNW F;  4X64 J;  1C1B A;  2GIF A;  4MJK A;  1XWL A;  2GVZ A;  3SCK E;  2IAJ B;  4IFV A;  1WKJ A;  1GMW D;  1X60 A;  4IFY A;  2XNR A;  5AJ3 J;  4ZVT B;  2AMC B;  2XLJ A;  2D1G A;  1DLO A;  3O6Q A;  1F0X A;  2POK A;  2VL1 A;  4YY3 F;  1LK7 A;  1KQS R;  1ELY A;  1J5O B;  4ECQ A;  1Y3K A;  2OHD A;  3CCT A;  1HPZ B;  2JVR A;  3IG1 B;  4NLV A;  1OYE A;  4U8Y A;  1JLB A;  4CH1 A;  3VAH A;  2A10 A;  1TKX A;  3D28 A;  5DZ6 A;  5CD4 A;  3G6Y A;  2GA3 A;  2R3V A;  2CUY A;  5IWA J;  2IJN A;  1SL0 A;  3OFE A;  4IKA A;  2U2F A;  4ZLN A;  2VJV A;  2IA6 A;  2NPI A;  2H9Z A;  4OJG A;  4JI4 F;  4I56 A;  5THW A;  4ECT A;  3BSA A;  2H5I B;  1SQG A;  2MQN A;  1D9A A;  2OPR A;  3FFI B;  4RO0 A;  2XY6 A;  3JSM B;  2F40 A;  3I0S A;  3UE2 A;  3KK2 B;  2UUA J;  2W4P A;  3JAM U;  2XMJ A;  2E5G A;  3D1H A;  2AJ0 A;  1UZD A;  5IQ6 A;  2A2C A;  2WBM A;  2ZKT A;  3AQO A;  4B08 A;  2BE9 B;  4ETZ A;  5KFV A;  1AYE A;  3JSY A;  5B0E A;  1YX2 A;  4DEZ A;  3NVL A;  4M5L A;  4GKK F;  4QR1 A;  1YBT A;  4MH8 A;  4QIE A;  3LO3 A;  2EK6 A;  5AE3 A;  3S8S A;  2R2R A;  2ZHA A;  3MM7 A;  1TAQ A;  1Y9O A;  3GG0 A;  4LRB A;  3ISZ A;  2Q1L A;  3LP2 B;  4M63 A;  4UQT A;  3NKR A;  1S97 A;  1IR0 A;  3KLG B;  2CPE A;  4ZVF A;  4K4Z A;  5ETO A;  4W98 A;  4ZVE A;  3K7R A;  1S0N A;  2MSS A;  2IVY A;  2YQ0 A;  5GAD I;  4DR1 J;  1VQ8 S;  3I87 A;  2DYA A;  1RSC A;  4B3S J;  1REG X;  2DNM A;  3OL8 A;  2D3O 1;  4C0H A;  4YR0 A;  1WKK A;  1B4S A;  2CKW A;  2QLX A;  3CJ4 A;  2A6M A;  4G1Q B;  2DGO A;  4ZP9 A;  4KSE B;  4NWX A;  4KBI A;  1WG5 A;  4RW6 B;  3Q3Q A;  4EEY A;  2V4J B;  1BE4 A;  4B9T A;  4C8L A;  3R8Y A;  3NGU A;  1S6P A;  2DNO A;  2M52 A;  4WTY A;  5F3T A;  3W62 A;  5KG5 A;  1QLN A;  1Y6V A;  5LMU F;  2HFU A;  2XI3 A;  2VDH A;  4ED3 A;  4E8U A;  1Q7Y T;  2PMW A;  2ROP A;  3N0V A;  3PHT A;  3M9M B;  4GKJ F;  3B5Q A;  1U09 A;  2KJW A;  1MG7 A;  2M5Y A;  3BN7 A;  4P6Q A;  3GV5 B;  3I32 A;  2UXD F;  2VKZ G;  1K1S A;  1FKO A;  2E7X A;  2ROE A;  3CWJ A;  3FEZ A;  3M1V A;  3ZZT A;  1T3N A;  3PKY A;  1NDP A;  4OZN A;  1AFJ A;  3HD1 A;  3OJU A;  2MZS A;  4L76 A;  5EGH A;  3TEH B;  1KVK A;  2E1C A;  1LKZ A;  1X0P A;  2GAH C;  1B7F A;  1YJV A;  3MUM P;  2R9L A;  4WFA Q;  1SQF A;  2FGC A;  2OFG X;  3J80 Y;  1SL1 A;  4I0W A;  5H9F J;  1RA7 A;  3GCW P;  1ANI A;  1VJW A;  3AJ2 A;  3DRX A;  5EX3 A;  3TVZ A;  4OQJ A;  1F60 B;  1N88 A;  2DGV A;  2FYX A;  3FMB A;  1Q16 B;  3ILI A;  4TNO A;  1DTT B;  4ER8 A;  4K8R A;  3HHL A;  1RWO B;  2ZH9 A;  4B3R F;  2J7K A;  4OZL A;  4M5J A;  1OWX A;  5ADZ A;  1U6F A;  2GCF A;  1P1L A;  1WF2 A;  1FE0 A;  3VR1 A;  4UQG A;  3I0R A;  4CYU B;  2UVR A;  4PQU A;  5KFI A;  4FF3 A;  1KVI A;  3Q89 A;  2K1R A;  4K7Q A;  3QSI A;  2DTJ A;  5F0W A;  4CP5 A;  3IBW A;  2VIC A;  1RT5 B;  1TL7 B;  4WBF A;  4B9S A;  4NXM J;  4TY8 A;  4ZVU B;  4AUK A;  3T1Y J;  1S1T A;  3OFG A;  3CME S;  5K20 B;  2QO3 A;  4ILM A;  4TN2 A;  5JUM A;  4QYR A;  1H2U X;  4F36 A;  2G0J A;  1T0T V;  3A8I A;  3G6V A;  3DDI A;  1QD1 A;  4UOG A;  1FX2 A;  1VOM A;  5IQQ A;  4ECS A;  4DSK A;  2HVI A;  1FX4 A;  4N7T A;  2FC9 A;  1VK3 A;  2XTJ P;  3J81 j;  3BQ1 A;  4KC5 A;  1WDD A;  2J8S A;  5JJB A;  2RB7 A;  3SDE B;  3UI3 A;  3WBH A;  1HQU A;  1JLE B;  4WE1 A;  2DH9 A;  3PJW A;  4G1Q A;  5LRM A;  2F1F A;  1L3T A;  2HVD A;  1W25 A;  1WTB A;  1VCT A;  3BR8 A;  3NCQ A;  2OPS A;  3V4M A;  3EX7 B;  2CIM A;  4CXU A;  1H74 A;  2PT0 A;  4A8Y A;  5KXA A;  1HNI A;  1TKT B;  2B9X A;  2W5S A;  1NDK A;  1R0A A;  4Y0F A;  2NR0 A;  1U0H A;  4L73 A;  5CXT A;  2UVV A;  5DLW A;  1LWC A;  3LAL A;  9RUB A;  2HHW A;  4KAI A;  2NUU G;  1TR0 A;  2KDO A;  1NK9 A;  1JJH A;  2CJK A;  1SUQ B;  5EWE A;  2DT9 A;  4YHH F;  2ASJ A;  5GAH I;  5K8P A;  2KT3 A;  3NKY A;  1HBO A;  4PG4 A;  3H5Y A;  1F9H A;  3Q8P B;  2D41 A;  3SDE A;  4I64 A;  3UVJ B;  1U47 A;  1S6Q A;  1VBK A;  4FZV A;  2C2M B;  2DNK A;  3B6B A;  2BRK A;  1UVJ A;  2BR0 A;  2J5A A;  1UFW A;  4DL2 A;  4Z37 A;  2DNQ A;  1B3T A;  4FYV B;  1C2P A;  4A48 A;  4JI0 J;  2VV5 A;  1JB0 C;  2YY3 A;  4U8V A;  3H2L A;  1T9T A;  2ZNY A;  1P8G A;  2F9D A;  2XWX A;  4WPA A;  2NPF A;  4DR6 J;  2UXC J;  1ZM4 A;  4C97 A;  2FVP A;  3M8P A;  1D8Y A;  3CMR A;  4IDK B;  4PRF A;  1NJY A;  2E7W A;  2RE1 A;  4LSL B;  4YB6 A;  4JI7 J;  2R2T A;  4HEA 9;  1N34 F;  2XZW A;  4O23 A;  1UVK A;  2R2S A;  2YH0 A;  2DGT A;  5F8J A;  2OPQ A;  4DOZ A;  4M1K A;  1HBM A;  1HD0 A;  3D3C J;  4NZ7 A;  1ZPW X;  4BWJ A;  2QA1 A;  2B9E A;  2WVD A;  7FD1 A;  1ALI A;  4XAK A;  1TK8 A;  1R27 B;  4CLF A;  1HNX F;  3T01 A;  3KD8 A;  5CZV A;  2FIU A;  3DOM B;  4DMZ A;  3IGN A;  1NSQ A;  2CPJ A;  5JXS A;  2NSB A;  5CD4 H;  3T9N A;  3OSN A;  2FJW A;  4NLY A;  1ICE B;  1X9W A;  2ZIT A;  3KJF B;  2UXB F;  3M8Y A;  4NRU A;  2WW8 A;  3DOK B;  4CNY A;  5CHC B;  4ES1 A;  4OHY A;  1S9F A;  3CIZ A;  1SH0 A;  1VIO A;  1QDU B;  1RTJ A;  4L74 A;  5EGY A;  4LF7 J;  4DV1 J;  3W9H A;  2BW7 A;  5KFP A;  2QZU A;  1KLM B;  3ZZ0 A;  1I5O B;  2B6A A;  4UST A;  4OX6 A;  4F3Q A;  3EVW A;  1J27 A;  1U8W A;  3FBB A;  4WTO B;  3IRW P;  3M6W A;  3LWM A;  3T5K A;  2GFF A;  2CG4 A;  2OPP B;  3C14 A;  3DOL A;  1VQ5 S;  3BGR B;  1UMJ A;  1VQK S;  2BDP A;  3ENV A;  3PEH A;  3QMQ A;  1S59 A;  2Q43 A;  2BOA A;  2HS3 A;  5GAH U;  2PSZ A;  3NGD A;  3L3C A;  3T3F A;  1Q8K A;  1OO0 B;  1RWN B;  2FJD B;  1GMV A;  4PEO A;  4JI1 F;  4JV1 A;  3BPS P;  5ETP A;  4TKT A;  3QAT A;  3V4I A;  4RW8 B;  4XPE A;  2ZC3 A;  5CYM B;  3IC1 A;  2LXI A;  1SHQ A;  2FHO B;  1WC5 A;  3DCA A;  2W01 A;  5KG0 A;  3DU6 A;  1LW2 B;  1Z2Z A;  3CO0 P;  4IO1 A;  3DGP A;  3DU5 A;  3KLE B;  2MQ8 A;  2PMZ D;  3MK1 A;  5CYQ B;  2VG7 B;  4NLR A;  2I6W A;  4DV3 F;  2DHG A;  4RKU C;  2ZH1 A;  2K8G A;  3BH6 B;  4C0B A;  2YKO A;  4OYO A;  3GJT B;  2MLX A;  3KKF A;  1RYS A;  1YRU A;  3Q2S C;  4I4B A;  2B9W A;  3HFZ B;  3UNY A;  5DG9 A;  4WWS A;  4CCH A;  4M94 A;  5AJ3 F;  4DF4 A;  2KHC A;  5B08 A;  5LXY A;  1HA1 A;  2MJN A;  5KT7 A;  3NY0 A;  3IDD A;  2P5V A;  2E5I A;  2G1H A;  2GHP A;  2MHE A;  2CYY A;  4LR8 A;  2WZ1 A;  5DJB A;  1NJW A;  5GAE U;  3J7Y I;  1TKD A;  4I1T A;  3PG9 A;  2G2Y A;  4IYQ A;  2WRM A;  2P9C A;  1YK9 A;  3GU0 A;  2HUR A;  1S1V A;  3R5C A;  1BQM B;  4RLE A;  4USI A;  2J9E A;  3OFH A;  5D15 A;  3FBF A;  1X7V A;  3NAH A;  5B09 A;  1IKV A;  4AQY J;  4LR7 A;  1FVQ A;  1RT3 A;  5L0E A;  2OKQ A;  5L1I A;  3K89 A;  1FKP B;  3B4D A;  3EVO A;  3FK4 A;  4ZHR A;  3QLH B;  5AE2 A;  3D0I E;  2IY5 B;  3M2U A;  2B4O A;  3U27 A;  2FJA B;  2EFG A;  2KXF A;  1B70 B;  1XC9 A;  1U26 A;  1Y0H A;  4ENO A;  1VC0 A;  4G3I A;  1X4H A;  3I31 A;  1HBU A;  2EFV A;  1PCA A;  4A46 A;  3KJV B;  3M2V A;  4C8Z A;  4E98 A;  2FVR A;  2AZ1 A;  3M8Z A;  1X4C A;  4KKO B;  3G4S S;  5HL7 Q;  3RBZ A;  1TV6 A;  3DLG B;  3N79 A;  4KO0 A;  3UWT A;  2M88 A;  1S79 A;  2MTL A;  1RAA B;  1RWX B;  2C2N A;  2W2N P;  3AAW B;  3G6E S;  4PPZ A;  5EX0 A;  1A9N B;  1ULR A;  1G2E A;  1ITP A;  1FRX A;  1XR5 A;  3CNQ P;  3CJ3 A;  3H5U A;  1PJ5 A;  5LMN J;  2V9K A;  2ZFH A;  2C3Y A;  3FZ2 A;  4WYW A;  1Y4Z B;  1KD1 T;  5C2G A;  1LNQ A;  2CQP A;  4PWU A;  3W5Y A;  5EDW A;  2HZV A;  1TQL A;  2ZBC A;  2D3O R;  2KVI A;  3AD7 C;  1Z4U A;  1FES A;  3OHA A;  2HLT A;  3NBP A;  3T41 A;  5L9N A;  3SSR A;  4U7U D;  1UFL A;  3K5L A;  1AUS L;  1RKJ A;  4F25 A;  1L5U A;  1RT4 B;  3EJM A;  5AXN A;  2LEC A;  4K4U A;  1WC4 A;  2XMM A;  3M30 B;  1RWK B;  3MM5 B;  1G6B A;  4G1I A;  2WON A;  3IR6 B;  3NBP B;  5IZH A;  1KR4 A;  4JB8 B;  5DM6 Q;  3ETO A;  4Q2L A;  4NXN J;  2LXU A;  4OZ5 A;  2H48 B;  3I5B A;  2VQF J;  3N5F A;  4A8F A;  1EQ0 A;  4GKJ J;  2H5J B;  3UCG A;  2C2E A;  1URR A;  2RUS A;  5DGB A;  2DR9 A;  4ILL A;  2ZDO A;  3IBF B;  2RDJ A;  1DRZ A;  5EWG A;  4NLP A;  5EWF A;  4DZ6 A;  2ZHO A;  4QU7 A;  3J7A N;  4USJ C;  2JNJ A;  4PG6 A;  2FY8 A;  2YKA A;  3PRD A;  4ES2 A;  3NXZ A;  4IFV B;  2Z2Y B;  2FJB B;  4IOB A;  2VON A;  3JYT B;  5L38 A;  3BKT A;  3PYD A;  1NKE A;  1CS4 A;  3MED B;  1NH7 A;  1WOS A;  4J91 A;  4KHP J;  2PEH A;  2GSO A;  5HQM A;  1AJA A;  1NKC A;  2CJ9 A;  4CLK A;  3H5S A;  2HHS A;  2ZVS A;  2IIH A;  3GIK A;  2W7O A;  5E3A A;  2MKS A;  3NMR A;  3TG0 A;  2RS2 A;  4UPK A;  4AL5 A;  1O6X A;  2NXU A;  3M2U B;  4LRF A;  1BHN A;  3QJJ A;  2BJ9 A;  3QRP A;  2ADC A;  1NPR A;  2VFU A;  1NK7 A;  4FVC A;  2OPR B;  1RZM A;  2QL7 B;  3RZA A;  4DX6 A;  1T7P A;  4O0I A;  2R8K A;  1FJG J;  3M6U A;  2L9D A;  3W65 A;  2EC0 A;  1S9G B;  2GMJ A;  3O3L A;  6FD1 A;  3W2V A;  4IRD A;  1OSD A;  2FHJ A;  4OJ3 A;  2QGF B;  5KFK A;  3SZ2 A;  1FRJ A;  1I6J A;  3W3S A;  4Q2M A;  3N28 A;  3GYX B;  4UF4 A;  1AB8 A;  1KOO A;  2YKN B;  3J80 U;  2B7B B;  2WVC A;  3R7S B;  3PFO A;  1AUD A;  4X4V A;  3LP2 A;  4NXN F;  2QT7 A;  1TMJ A;  3DC2 A;  3DNC A;  3JQK A;  1U1L A;  3NL0 A;  4ECY A;  2KTQ A;  1WF1 A;  1YIT S;  3MPD A;  2GV1 A;  5HO4 A;  2XLK A;  1U1M A;  1F9F A;  4F0M A;  3CJR A;  1JJ2 R;  3VVT A;  2QRR A;  4I6W A;  1T02 A;  2CPZ A;  5FII A;  2VOP A;  4ZCM A;  4LIW A;  1FRL A;  1FTR A;  1Y7P A;  2YVS A;  3C16 A;  4PZV A;  3M8R A;  1RAF B;  4ZVG A;  4K4Y A;  1QAI A;  2G9Y A;  5KT5 A;  2MGZ A;  3GCX P;  1LW0 A;  2CJY B;  3CE8 A;  3FCH A;  3CCR S;  1Q82 T;  3KMQ A;  1SVD A;  2RU9 A;  4H54 A;  1RI7 A;  2AW0 A;  2EW9 A;  4QWD A;  3E8O A;  3CJ2 A;  4DL3 A;  2VFS A;  3P45 B;  5F8I A;  2QV6 A;  5LRN A;  3CB4 A;  5E3C A;  2CJX B;  3SV3 A;  5F8H A;  4JI2 F;  5HAN A;  2ZJR Q;  4GTX A;  2KU7 A;  4LF9 J;  2DGX A;  5HMX A;  2MGZ B;  2BM1 A;  3N6L A;  4Q8E A;  4UUX A;  5LQQ A;  1QE1 B;  2XI2 A;  2XSJ B;  3ZC4 A;  4HDG A;  1Q78 A;  1TKX B;  3NG8 A;  3TR5 A;  2EFO A;  4ZIW A;  1R6V A;  3N5B A;  4I6Y A;  4RW7 B;  2KM8 C;  3WAV A;  1UVN A;  4EK2 A;  1LFP A;  3M8W A;  2V4R A;  1MSW D;  4KY3 A;  3QQC D;  4XPC A;  4K4S A;  4M5G A;  4CT8 A;  2B56 A;  2HIY A;  3UNG C;  1RCX B;  3KJN B;  4NX9 A;  3ELH A;  1LXJ A;  1HNV A;  2R7O A;  3R9L A;  2GVD A;  3PFE A;  4PUO B;  1MRO A;  2HIQ A;  3EVM A;  1IKY A;  4LF5 F;  3UDL A;  2RKI B;  1S4F A;  4NE9 C;  3E51 A;  5A6W A;  4CLY A;  4NCA A;  2YX1 A;  2AU0 A;  3TAR A;  3LTO A;  4NLU A;  5DRK A;  3P8B B;  2V94 A;  5D4L A;  1NRK A;  2GNK A;  5J2M B;  2OH2 A;  4DUY J;  2R7X A;  3K5O A;  1FEE A;  3HHN B;  4DXL A;  5D0R A;  4NLG A;  1S6U A;  3T5J A;  3H4B A;  1RB0 A;  1KN6 A;  1WEL A;  3W7B A;  4I2Q B;  4JV5 J;  2C28 A;  2Y1L B;  3DXB A;  4NWJ A;  2WSF C;  2RML A;  3AB2 B;  2CQ0 A;  3M6X A;  2XNQ A;  2AJ2 A;  1BQN B;  1EX8 A;  5CAA A;  2DXE A;  1LEO A;  3MM9 A;  3VAK A;  1W2I A;  3KDO A;  3HPO A;  2X3G A;  2A3J A;  4ZPC A;  1RWW B;  4EMD A;  4ED2 A;  3D68 A;  3HZG A;  4TYB A;  2HRY A;  5DET A;  2CQ1 A;  4G65 A;  2V34 A;  2M70 A;  1WG4 A;  1TFW A;  2IA0 A;  2YWE A;  3FEX B;  4G1P A;  3CCE S;  1FD8 A;  2IJF A;  2BJD A;  3AOB A;  3BYP A;  3MI7 X;  4EU0 A;  2JLG A;  2MQP A;  3W63 A;  2B4V A;  2IYG A;  5A8R A;  2KH9 A;  1VI7 A;  2R8J A;  2RAQ A;  4QYZ J;  2KYZ A;  5KFC A;  2JX2 A;  4CO0 A;  1I1G A;  4RUB A;  3TEG A;  4AYB D;  4UOC A;  3K58 A;  3CSK A;  1ROF A;  4HHH A;  2EG2 A;  5KOW A;  1R3N A;  3R27 A;  3MR3 A;  3VAL A;  4K4W A;  2UUB J;  2N82 B;  4MKY A;  3R5A A;  3FUY A;  2KZZ A;  4IG3 A;  2HQC A;  4ECW A;  3MF5 A;  2O01 C;  1U0H B;  4FVM A;  4LBP A;  3GFH A;  1P9Y A;  1VFJ A;  5KG3 A;  4CM2 A;  4DV1 F;  1IBL J;  3KNA A;  1HNI B;  1TKT A;  4KHP F;  5FLX U;  1ZAX A;  3HHL B;  4HR2 A;  1P9Q C;  3DGP B;  4AL7 A;  4TN0 A;  2W5R A;  4DR4 J;  1S6O A;  1U2F A;  1WEZ A;  2DB1 A;  2CJQ A;  3F73 A;  4MYU A;  1YLX A;  4QW8 A;  5LT5 A;  3EGV A;  1S9E B;  3CJK A;  2W5Q A;  3R1L A;  3GLJ A;  3TYT A;  4Y2I A;  3DPC A;  4MHX A;  2D9O A;  1Q8B A;  3GIM A;  4OHX A;  2L48 A;  2JEI A;  2AX1 A;  3JQJ A;  4U7C A;  3QJL A;  4O0N A;  4NLO A;  5KFL A;  4KPY A;  4J9P A;  3RYL A;  4C8O A;  1FHT A;  1VRQ C;  5FLX Y;  1S99 A;  1TL3 B;  1MMD A;  2CG8 A;  1HD1 A;  1CEZ A;  4A8Q A;  2CQ4 A;  2J8A A;  2RKI A;  2WHO A;  3IM8 A;  4IO9 Q;  2N3L A;  1QTN B;  3CT9 A;  3TA1 A;  2E44 A;  2IC3 B;  5GAE I;  3OL6 A;  4B3M J;  1N8R T;  3UQS A;  1JMT A;  2WVF A;  2LQB A;  3R5D A;  3GJQ B;  3GQC A;  2ZH8 A;  1C0U A;  1R7I A;  2CJA A;  3B8H A;  4ZOS A;  5HVH A;  3JSB A;  3GB0 A;  3H25 A;  4LBH A;  1QSS A;  3C6T B;  3KUH A;  2XB2 D;  5LIA A;  4JYA J;  5L1K A;  2WBR A;  3EZ5 A;  3QZ7 A;  3HP6 A;  3A8K A;  2IRY A;  4DLG A;  4H4M B;  5I3Q A;  1PC5 A;  4P9S A;  1KEK A;  3W66 A;  2DH7 A;  2J7U A;  1YJR A;  1NSA A;  2EG1 A;  4YEA A;  2RHS B;  3K57 A;  3THV A;  2BKO A;  2PA8 D;  3VQT A;  4OHW A;  4DPW A;  4X4U A;  3OQ2 A;  2P9G A;  1I3O B;  2IDE A;  4YB7 A;  3DKD A;  4ZKA A;  4AQY F;  2CQB A;  1DZ5 A;  2JC0 A;  1ZTT A;  4UPL A;  2G4B A;  3CDB A;  3G8S A;  1D8Z A;  3OR1 B;  4V19 X;  2ZUA A;  4IR1 A;  4D3G A;  5C2C A;  3PW7 A;  1CC7 A;  3BH7 B;  3AOA A;  1M5P C;  4IRK A;  5TJ3 A;  1D1U A;  4JI6 F;  3MD1 A;  2VOD A;  1ZH5 A;  3O5T B;  4CYS A;  1ARO P;  2C1E B;  3WBZ A;  3EYZ A;  2BX6 A;  3M2R B;  2M8D B;  3GII A;  2CNN B;  4NLX A;  4XO0 A;  5C66 A;  2V4Q A;  2DR7 A;  1FA0 A;  1QSL A;  2VD3 A;  4Q8F A;  2DNZ A;  5KFJ A;  1R8B A;  4XIU A;  2IBK A;  1RKI A;  1IKX A;  1GX6 A;  1TL1 B;  1UPM B;  3OLA A;  4J9O A;  1S1U B;  3CF5 Q;  3NWG A;  5G0R B;  4DZD A;  1RAJ A;  4ZCK A;  1KNZ A;  1AZS A;  2W25 A;  3BZQ A;  4K0K F;  2NZ4 A;  1ZA2 B;  1EQJ A;  5B0D A;  1EW2 A;  1KH4 A;  1FTC A;  2CQI A;  5DQI A;  3SCL E;  4OX7 A;  3BO2 A;  1DBD A;  5A6P A;  2ZD1 A;  2MKI A;  2JVO A;  3T9Z A;  3V2U C;  2IMO A;  2EBE A;  4LRE A;  5IOL A;  1PJ6 A;  1AFI A;  2W2M P;  1KON A;  1T03 A;  4CH7 A;  2W2Q P;  3C46 A;  4JI3 F;  1K44 A;  3QID A;  3G2X A;  3DFE A;  4O4G B;  3VTI A;  2ASL A;  4P2S A;  3W5Z A;  5IT0 A;  2J0W A;  2VG6 B;  1G4C A;  2JDJ A;  3ETM A;  5DZ7 A;  5HQL A;  2GO9 A;  4DCJ B;  1FJC A;  2YBV A;  2HK3 A;  2VQF F;  3CD6 S;  2V2K A;  3AJ1 A;  5CA5 A;  2R8H A;  5L0K A;  4KPC A;  4OZJ A;  2E7V A;  4TXS A;  2GZO A;  1Q53 A;  3AQP A;  1KLN A;  2OTL S;  1NLK L;  4DN0 A;  2Y9H A;  4N47 A;  2HHU A;  5CZX A;  1J2V A;  1SXL A;  2QIF A;  3HSZ A;  4X64 F;  4N5S A;  2V2V A;  5F8M A;  4N8O A;  2ZD1 B;  2DHH A;  3RAM A;  2DHX A;  3U02 A;  3BB5 A;  3ZZP A;  4NCB A;  1SH3 A;  5LMN F;  4ECZ A;  5M2P A;  4DJB A;  4RUC A;  2OTJ S;  4K4T A;  1RTI A;  2M0G B;  5F0U A;  3LQV A;  2YWF A;  2JRS A;  2C3O A;  3M8P B;  4DBQ A;  2DGS A;  1U48 A;  4A8W A;  1TKZ A;  4TLQ A;  4URQ U;  3BBC A;  2HNZ B;  1F9E B;  1S6P B;  4EI2 A;  5HN0 A;  3UCZ P;  4HHJ A;  2FLN A;  3ET6 B;  5GAG U;  5C25 B;  2QA2 A;  1SB6 A;  3LXQ A;  2HVH A;  3AA9 A;  4DR2 F;  1Y7A A;  4KIA A;  1U2R A;  2VUG A;  2A2D A;  1U4B A;  1EET A;  1NDC A;  1MWY A;  2K3K A;  1VRU A;  4J90 A;  3AXK A;  5D0E A;  5F9N A;  3ZZZ A;  2OEJ A;  5SZT A;  3BN4 A;  3KYL A;  2Y1J A;  1ZM9 A;  5A2Q Y;  5T7L A;  4DPU A;  1HBN A;  3EE3 A;  3NGS A;  2IRU A;  1UA0 A;  2X3D A;  2OO4 A;  4KM4 A;  1HBM B;  2BE7 D;  3DN9 A;  1RT7 B;  2EEY A;  3FZB A;  1N5T A;  3QAE A;  1XIQ A;  4DL0 C;  1ALK A;  2PMH A;  1K47 A;  2DIU A;  4LF6 J;  2DCL A;  3MCN A;  1NHU A;  4LRC A;  2WON B;  4PWW A;  3ZTR A;  5IJQ A;  3LPE A;  3DRR A;  3M9O B;  4A8M P;  1UA1 A;  4O3O A;  3M30 A;  3SYZ A;  2W9C B;  1VQP S;  2Q6B A;  2DPJ A;  3OXG A;  2VPY B;  3H0P A;  2DJW A;  2V4J A;  4FNI A;  1RWV B;  4OYP A;  4U9R A;  4FKY A;  3VF0 B;  4BLG A;  3PR5 B;  4RW6 A;  5DQH A;  1PC4 A;  3OPK A;  3MCS A;  2LVW A;  5JVG Q;  1VBZ A;  4DR1 F;  2NZC A;  4MFB A;  1TEL A;  2H4Y B;  1VBX A;  3ISN C;  1FXR A;  3TI0 A;  2VU5 A;  3TRG A;  2CAJ A;  1Z1Z A;  4CO5 A;  2W9C A;  4OYI A;  3CXC R;  1T05 B;  5L39 A;  3TA2 A;  4UOP A;  1JK9 B;  2E1A A;  3ULH A;  4CZC A;  1WG1 A;  1TFY A;  3PAC A;  2OLW A;  2Z2M A;  3NOC A;  5M2R A;  1CC8 A;  4O44 A;  5GME A;  3W9J A;  2L3M A;  1U0S A;  4BHQ A;  1VHI A;  3TZX A;  5KFO A;  2AD9 A;  1B64 A;  3RUB L;  5BJR A;  2OFH X;  4EBE A;  4ANE A;  3OSP A;  1C4A A;  1FNX H;  5FDL A;  1WD6 A;  4WK3 A;  2CPI A;  2AEM A;  2FB0 A;  4UOO A;  1UPP A;  2HQF A;  4MIV A;  3MEC B;  4X4P A;  2X1F A;  3A1Y G;  3MCO A;  2GVZ B;  3TP2 A;  1SBR A;  4P7V A;  2EI5 A;  1O99 A;  4HH1 A;  2QYG A;  1VS3 A;  3BGF A;  3BPD A;  3RAQ A;  2B4P A;  2FQQ B;  3IGV A;  2VZ9 A;  1N48 A;  4WU2 A;  1XMQ F;  1F5A A;  4CI0 B;  2UU9 F;  1HHQ A;  2QC3 A;  5A8K B;  4QPX A;  3HMJ G;  4ZP8 A;  4I68 A;  2YWW A;  3ILL A;  1BMQ B;  2SXL A;  3QT5 A;  4WFZ A;  3GPA A;  2CZ4 A;  1JLA B;  3QFW A;  2NLW A;  3ZTP A;  4OYZ A;  1M5V C;  4IG3 B;  4DR4 F;  3DXS X;  3N4W A;  1MML A;  4K5R A;  4C0O C;  5HMW A;  1HWL A;  1IWG A;  4I6A A;  2M7S A;  4NLQ A;  3BKF A;  4W90 B;  2FGO A;  2GJF A;  2OI2 A;  2VFT A;  3CO9 A;  4R8U A;  4LJM A;  4UW2 A;  5H9E K;  1H73 A;  2VFV A;  1SPB P;  1X4A A;  2LU1 A;  2VAS A;  4V1A k;  3OVB A;  1C0T A;  3FQL A;  1D09 B;  4NXM F;  2XRG A;  1O5J A;  3C66 A;  3GP9 A;  2JC1 A;  5BYR A;  5KG1 A;  4AND A;  1CJT A;  4RW4 B;  4ZVR B;  2XO7 A;  4RX6 A;  4FPR A;  4QWB A;  2V8P A;  3EDR B;  4KRW A;  4NLW A;  5E7O B;  4J9R A;  4JI8 F;  1T9X A;  1UVM A;  2CPX A;  5HBM A;  3Q8Q B;  5CYQ A;  3UW1 A;  3KK1 A;  1GNK A;  1JX4 A;  3J81 U;  3FC9 A;  1JLF B;  2XUL A;  4USW A;  5B0B A;  2DIT A;  2EVZ A;  2YX4 A;  4ITS A;  3J7Y U;  4QQB A;  1REV B;  1ZAV A;  4AFF A;  2F7V A;  4ELV A;  2KKH A;  1EP4 B;  2JEF A;  2WAQ D;  1IBM J;  1QJH A;  4X4T A;  2MLZ A;  3NGK A;  5HQ8 A;  1KBR A;  4J9M A;  1TAU A;  3D6T B;  2HGN A;  2DR6 A;  4MIA A;  3I5C A;  4PYD A;  4USK A;  3TQE A;  1A6L A;  4DPO A;  4C48 A;  3IAM 9;  5HK4 A;  1P27 B;  3P5B P;  5KT2 A;  1U8S A;  1NPK A;  4PXE A;  5FDL B;  3MUT P;  2YNI A;  1IBL F;  3GFX A;  3D6M B;  3KHH A;  2XSF A;  3PYG A;  1DQA A;  1S1U A;  4DPX A;  1SKR A;  2B6A B;  3QT7 A;  2HQG A;  4EZ9 A;  1RTJ B;  1NBE B;  4JI4 J;  2YPZ A;  4X84 A;  5B7W A;  3PV8 A;  4B3R J;  1XK8 A;  1RHJ B;  2LU2 A;  4OYA A;  3RB4 A;  2EKY A;  5E3R A;  3H98 A;  1X9M A;  3PJX A;  2ZH6 A;  1OPZ A;  1SJ3 P;  4KGX B;  2MMY A;  2NRE A;  3D54 A;  3QGG A;  4AXI A;  2G2Z A;  4UZB A;  1OY8 A;  3GYG A;  4IR9 A;  3SQG A;  4KGV B;  2ZBI A;  1MNE A;  1OMS A;  2WCX A;  3FFI A;  3K8W A;  3M6V A;  1SIW B;  1X4F A;  3WZ0 A;  2VIH A;  4CLS A;  1CVJ A;  4LMZ A;  4RUH A;  4HT5 A;  4UOH A;  4LR2 A;  1FDN A;  3CD7 A;  1FWK A;  5LSO A;  4YOE A;  1C4C A;  4U7U K;  3MEG A;  4MKB A;  4B9M A;  1URN A;  1KKH A;  1RAO A;  2VB6 A;  4Y00 A;  3MR2 A;  1RA6 A;  3WC2 A;  4UY8 5;  1TK5 A;  2DNL A;  4IG0 B;  3A8E A;  4LSZ B;  2UP1 A;  2UVW A;  2H65 B;  3D1Q A;  2B5J A;  3L4B C;  2BJ3 A;  2MKC A;  3WIV A;  4KAY A;  3H20 A;  1ELO A;  3NRB A;  4KQZ A;  3HJF A;  3FSY A;  4BCA A;  4QBU A;  1LFW A;  2CVI A;  3NS5 A;  3FMW A;  3LP0 B;  2GMH A;  1IM4 A;  3LUY A;  3O8W A;  4OI4 A;  3U1L A;  3OV7 A;  2MZ1 A;  2DH8 A;  4QW9 A;  3Q23 A;  2M2B A;  1C1B B;  5GOV A;  1OJ4 A;  4PUO A;  2V50 A;  5D4P A;  5IV4 A;  3CVK A;  1KLM A;  4ZVO B;  3EPI A;  3DMJ B;  3QJP A;  1DFD A;  1PGZ A;  2BV3 A;  2JFK A;  2DNY A;  3MR7 A;  4DX5 A;  5IT9 Y;  1RBA A;  4DWI A;  4KJI A;  2HWH A;  3A12 A;  3VQS A;  4R5P A;  5KFN A;  3HSD A;  2J76 E;  2FZK B;  1VQO S;  5J2Q A;  5DDO C;  1G7C B;  3TAQ A;  1CLF A;  4TU7 A;  2WTF A;  1GT8 A;  1H7W A;  2P9E A;  4X4N A;  1HDH A;  3BJY A;  3OD2 A;  1RT5 A;  1TL7 A;  3R7B B;  2L41 A;  3DI6 B;  2Y3Y A;  3EWG A;  3W61 A;  1SH2 A;  3A3N B;  2QSF A;  3KFW X;  5HLF B;  1HPZ A;  2RH3 A;  2OUG A;  4DV5 F;  1LWF B;  1M5H A;  2YNF A;  4PG7 A;  4YME A;  4FS2 A;  4WP8 A;  3DRS A;  4MKV A;  3WX4 A;  5FJ4 A;  2JHE A;  1R31 A;  2C3P A;  2W7A A;  1AJB A;  1RCO B;  4DFJ A;  2HRT A;  4PWD B;  1E1Z P;  1TL5 A;  1VLY A;  2AGO A;  2W2O P;  1HQU B;  2GAG C;  5LOQ A;  2ZZT A;  2VQR A;  5K14 A;  4DV4 F;  3KDN A;  3MM6 B;  4EBD A;  1BD6 A;  1PKU A;  2LLZ A;  3F56 A;  4FDF A;  2FY1 A;  2VC1 A;  4C8K A;  2E5H A;  2MKY A;  4KV8 B;  1FWL A;  1VQ9 S;  1FRK A;  2R4F A;  3A4T A;  1FXL A;  3BO4 A;  1UCN A;  1U2C A;  5HAT A;  3OTO J;  2RQ4 A;  2ZH2 A;  5HRO A;  4UOR A;  3MCM A;  1NZA A;  4DV3 J;  2HNZ A;  1SJR A;  1TL3 A;  2HFN A;  1SC3 B;  1S6Q B;  2VH7 A;  4RW9 A;  5MLC V;  1NK6 A;  1EW8 A;  5KG7 A;  4KHR A;  2G9O A;  2J6U A;  2OJ3 A;  5DDP C;  1FF2 A;  2HFZ A;  5C5J A;  3DHW C;  1WI6 A;  2GLQ A;  2W5T A;  3MK2 A;  4KR0 B;  1NU4 A;  1Y5I B;  3L09 A;  3MK0 A;  3QLH A;  4ZLP A;  3CCW A;  1RAC B;  2X51 A;  3MHY A;  1AW0 A;  1NM2 A;  1YBU A;  2W8L A;  2PI4 A;  3L7O A;  4USV A;  2B4U A;  2EC2 A;  1YJW S;  1S1V B;  4CO3 A;  2QMU B;  3QO9 A;  1S7H A;  4ERD A;  4J9U E;  2V0N A;  4C3K A;  4PG8 A;  1RU1 A;  1RK8 A;  2APO A;  3HSG A;  2DEI A;  2L9N A;  3DYC A;  2D9P A;  2F8H A;  2HBY B;  1UEU A;  2VG6 A;  4LIR A;  4ZDN A;  1YJU A;  3THT A;  3KHL A;  1BGX T;  2QJ3 A;  4C9D A;  3LPY A;  1S77 D;  3G71 S;  2PFD A;  3LH2 S;  3JYT A;  2BE2 B;  2YWK A;  4J9Q A;  5KFU A;  2AYG A;  1OSC A;  3KMS A;  1FKO B;  3M1V B;  4P71 A;  4MK7 A;  1CJU B;  2RU3 A;  2LEB A;  3MM7 B;  2J6T A;  4FKX A;  1ZAW A;  4P72 A;  4Y65 A;  3ZFV A;  1I94 F;  5L9X A;  1U1N A;  1RT1 B;  2VA2 A;  2C2K B;  1EAY C;  2QG9 B;  3GIL A;  1H2T Z;  1WI8 A;  3G87 A;  4NLT A;  2MZR A;  1AZS B;  2HFV A;  5AXM A;  2R7V A;  7FDR A;  4Q0B B;  5KFG A;  4AXJ A;  2X1A A;  3MTJ A;  4MT1 A;  3QGP A;  1Q0N A;  4CWB A;  4FF1 A;  3J7Z 5;  3DRS B;  1XJW B;  5C25 A;  5BYS A;  2W8D A;  2ZZM A;  1H6K X;  2K1R B;  3O1L A;  2B51 A;  1YJT A;  1TKZ B;  2RUG A;  5IM0 B;  2CQH A;  2HHH J;  4DQR A;  4LF8 F;  5BR8 F;  3QRQ A;  3NWR A;  1N33 J;  1C0U B;  2HLU A;  2JH3 A;  2M9K A;  4P2M A;  1D9D A;  1UWB B;  2J7W A;  4LF4 F;  1M5K C;  2LQJ A;  3CGI A;  1HHT P;  3QWU A;  4PYA A;  4DR6 F;  3DLE A;  4Y2K A;  1JXL A;  4WYL A;  2X7I A;  5E33 A;  2DXF A;  4QAX A;  2VKR A;  2HHV A;  1CQN A;  1YZ7 A;  3LGN A;  3CJ5 A;  3VAI A;  2HZA A;  3ZZU A;  1RT7 A;  1PAU B;  3LP1 A;  4N8N A;  1FI4 A;  4YN3 B;  1N34 J;  4F2S A;  2HBZ B;  2P6T A;  2XQC A;  2ZH7 A;  2ASD A;  4YP3 A;  3NKM A;  1RHU B;  1L3V A;  5L46 A;  1OS5 A;  2K2P A;  4X4Q A;  4N56 A;  5LJ5 Y;  1RHR B;  3RRH A;  3KUE A;  2GIR A;  1YWX A;  3TO8 A;  2DNP A;  5D0G A;  2CPH A;  4CTA A;  2W5X A;  3W5X A;  3H59 A;  4GVB A;  3D2W A;  3RB6 A;  2G2O A;  2VG7 A;  4O4R A;  2JEG A;  2V8G A;  3ED4 A;  5J2N A;  4Y2M A;  3KLE A;  1XMQ J;  2UU9 J;  2Q66 A;  3VGT A;  4B3T F;  4MYT A;  1FK9 B;  1TP7 A;  1V3Z A;  1DHM A;  5DM7 Q;  1H72 C;  1YGY A;  2CQG A;  4IH5 A;  4M5H A;  2AZ3 A;  2JJ4 D;  3Q8V A;  4DV2 F;  2RNE A;  2CQ3 A;  3QNW B;  1SIZ A;  2DGW A;  3F0N A;  3BQ2 A;  3AJD A;  1GXU A;  3K5P A;  4ED1 A;  2RRA A;  3Q8R B;  1IBK J;  2ZBR A;  1BQM A;  4KH1 B;  1RTD A;  2VPW B;  3I5A A;  2FJE B;  3AD8 C;  2DGU A;  1S9G A;  3S01 A;  4F50 A;  1MW7 A;  3IM9 A;  1YHQ S;  4C6A A;  1TL1 A;  3D6F B;  3EGZ A;  4P2X A;  2IFY A;  2HPU A;  1VK8 A;  1T9U A;  2K06 A;  5A76 A;  1EKR A;  3F44 A;  1IN0 A;  1V6H A;  2R7Q A;  5E3Q A;  3DLH A;  2RF2 B;  1CJU A;  3ENA A;  2FVC A;  4C4W A;  2RH6 A;  4M95 A;  3ONQ A;  5F8N A;  3PW4 A;  4O3P A;  1JLG B;  1IR2 A;  2MQQ A;  2CXE A;  2YWH A;  2R8G A;  2BE2 A;  4P2F A;  1KHK A;  5F3Z A;  1HKA A;  3AT1 B;  4F7V A;  2E9T A;  1WEY A;  1S9E A;  5D77 A;  1Y5L B;  4D3H A;  3C6U A;  2VPZ B;  3LP0 A;  2EKN A;  3NGR A;  4M5D A;  4DG1 B;  2ZHB A;  4DL7 A;  2DBB A;  3H5X A;  1R8C A;  1D0E A;  3BSN A;  2GQQ A;  2YNI B;  3KNG A;  4USM A;  1RWM B;  2ZVI A;  3RU0 A;  2BJ1 A;  4I7F A;  1T11 A;  1DQ8 A;  2XWY A;  4BBY A;  1Q95 G;  1PYO B;  3P96 A;  4ALZ A;  2BQR A;  3B78 A;  1NJI T;  1M90 T;  5EGE A;  2DO0 A;  2FLL A;  2MZT A;  4ZK7 M;  2RF2 A;  1NPP A;  1HW8 A;  2F3J A;  4BWM A;  3D1O A;  3IWL A;  3M05 A;  3PRB A;  4HTI A;  5ETS A;  3ZTQ A;  5KG4 A;  4WFN Q;  5KFM A;  2KM8 B;  1EKS A;  5C24 A;  3GYN A;  4C11 B;  2XM3 A;  3HVR A;  2QFJ A;  2GS8 A;  2WOM A;  3ENQ A;  2VG5 B;  2BM0 A;  4WU3 A;  1VIS A;  2YKP A;  4ZIV A;  4TQR A;  4EO8 A;  1T9W A;  4K4V A;  1JLE A;  3KWM A;  1GXT A;  2HNY A;  1SC1 B;  3I4H X;  3SQG B;  4B3S F;  2GSN A;  4U6P A;  2ACY A;  2W2P P;  1ACM B;  3PXG a;  1F1B B;  1WUU A;  2PI5 A;  4IH7 A;  1Y3J A;  3PDN A;  3EPG A;  2GJI A;  4MK8 A;  1YJ7 A;  1S0O A;  3WAX A;  3E2D A;  3QGH A;  1GH8 A;  3K17 A;  4JI2 J;  3X1L B;  4LF9 F;  1O51 A;  3HVA A;  5I3U A;  1HNV B;  2AJQ A;  3QT8 A;  1YDL A;  3WC0 A;  4OX9 J;  3CD0 A;  2V68 A;  4V19 J;  4NML A;  4IFY B;  3WIU A;  4YFU A;  4HDH A;  2A0F B;  4Z2X A;  4NI2 B;  4NA3 A;  5HMY A;  3GSI A;  1HQE A;  1MU2 B;  3CW2 C;  3BDF A;  1X4B A;  4ETX A;  3V6D A;  1O0P A;  4TYA A;  2YKM B;  1ZS6 A;  2WVB A;  1N36 J;  1N6Q B;  1Q5Y A;  4CM0 A;  4DU7 A;  4GC6 A;  3GSD A;  2E66 A;  1RHK B;  4NYZ A;  1JLC B;  2E1M C;  4UZC A;  4RNN A;  1RGV A;  4FXV A;  4CLW A;  1C1C B;  1H7X A;  2BAB A;  4X4O A;  3IFE A;  1M1G A;  4KO0 B;  3T1H J;  2NQP A;  2DNR A;  4IG0 A;  5DO2 A;  3OLB A;  3HUL A;  2IPO B;  2JL9 A;  2RQC A;  1Y5N B;  3QT6 A;  2IDL A;  2J0Q D;  3C2P A;  4MY4 A;  2GGP B;  1TTH B;  2V8D A;  1V3R A;  1SC6 A;  4IDK A;  4AL6 A;  2DPI A;  4WKR A;  1KH5 A;  4CXS A;  5EHH A;  4DUY F;  1SHN A;  5D3G A;  2I9S A;  5HVG A;  5L1L A;  1BY9 A;  2H3E B;  3LA0 A;  1Q81 T;  5IM0 A;  4R5P B;  4NI2 A;  2RHQ B;  3OTE A;  2HHH F;  4LF8 J;  3P3D A;  1HR0 J;  5I3P A;  3JS9 A;  2KFY A;  2ZKU A;  4K50 A;  2R7U A;  3CTR A;  2IC3 A;  2ZBQ A;  4R0J A;  3D66 A;  3Q8U A;  3TUI C;  2YNH B;  1ZOT A;  1IVZ A;  4C7Q A;  1KQG B;  2Z4P A;  4JI5 J;  4GTY A;  4J7C A;  4DV4 J;  2NYI A;  3D0G E;  2QZ8 A;  3GE9 A;  3LOU A;  5GAG I;  2LKZ A;  4KGZ B;  1HI0 P;  3W8P A;  2EBG A;  4ZCL A;  4ZLL A;  5AJ9 A;  4DR7 F;  2NSC A;  1S1T B;  3PJ9 A;  2UZA A;  2Q79 A;  3HO1 A;  1DAR A;  4DV7 J;  2WOM B;  4MIW A;  3W1Y C;  1HYS B;  2CZV C;  3HK2 A;  1LWE A;  3MMA B;  2Z30 B;  1XEZ A;  1SQE A;  2V5H G;  3BKU A;  5C7P A;  4X62 J;  1RT6 B;  2NS1 B;  2ZH5 A;  1BUX A;  4DV5 J;  3CJQ A;  3BGO P;  4CLU A;  2KRR A;  2ERR A;  1XER A;  5CCL A;  2RJZ A;  4OYX A;  4CDI A;  1FKA F;  4JV0 A;  4MAK A;  1ALH A;  3AHP A;  3MAH A;  3DRR B;  4DFP A;  1KHN A;  1T95 A;  2BAN A;  4WF9 Q;  3RR7 A;  4LFC J;  4P10 A;  1DJ0 A;  3EZU A;  1PAE X;  2H5E A;  2D3U A;  1Z2L A;  3JTO A;  3R7N B;  2PEB A;  1OY9 A;  3KHG A;  5HP1 A;  1RT2 A;  4DUT A;  1SV5 A;  2IYI A;  2XHC A;  1FWP A;  4ZPA A;  5KFW A;  1IBK F;  4J37 A;  4ELT A;  4DR5 J;  4OJ1 A;  3RR8 A;  4ID8 A;  1TK0 A;  3CMQ A;  2V8V A;  4JV5 F;  4KJG A;  2LEP A;  4ZP7 A;  3HT3 A;  2ZC4 A;  1ZM2 A;  2ZEJ A;  3HKW A;  4YDX A;  1JQG A;  3EGW B;  3V6D B;  4CLL A;  4KHM A;  1TU0 B;  2Y1I A;  2KN4 A;  3A3P B;  1JKH A;  3PW5 A;  1KQK A;  5A8R B;  5A2Q U;  4F3M A;  3H42 A;  4LFB F;  4R8U B;  2RVJ A;  1X5T A;  2V2Q A;  1EB0 A;  4FPI A;  1N56 A;  2CJB A;  1L3S A;  1KS2 A;  3HFK A;  2M8H A;  4MFB B;  4P52 A;  1SKU B;  4RBU A;  1B99 A;  1E6Y A;  2QMX A;  3EIC A;  2FHK A;  4Y3C A;  2B8P A;  1U25 A;  1X31 C;  2UUT A;  1CJK A;  2DRD A;  3BF4 A;  3N6M A;  2FUG 9;  4R0E A;  4DPY A;  3O44 A;  3PKM A;  4K4X A;  1YJ9 S;  1ALJ A;  4FS1 A;  1EP4 A;  3AFG A;  4YS2 A;  4F4Y A;  4WZQ A;  1SCJ B;  2YX7 A;  1VMB A;  1FSU A;  1HI1 A;  3RGI A;  2GGP A;  3H7H B;  4GVL A;  4AD6 A;  1JLB B;  5K8M A;  1NK5 A;  2CAD A;  2R7W A;  4CTA B;  2Y8W A;  2I38 A;  1CJV A;  1WKL A;  3FRY A;  3KLI B;  4ANC A;  1KTQ A;  4DS5 A;  4JI7 F;  1X8D A;  3M4X A;  3UO0 A;  2BAC A;  5DLG A;  3UDC A;  1GFW B;  1GTH A;  2DCU B;  2HQ3 A;  2M3D A;  4FYW B;  4HAC A;  4KB7 A;  4LSL A;  4Y28 C;  3ZNU A;  1NJX A;  1N5V A;  1TMM A;  4NEY A;  1R8A A;  1KHW A;  2D69 A;  3GFZ A;  2V6A A;  1HJK A;  2C2D A;  3NOG A;  4L3K A;  4Y6I A;  4B56 A;  5J2Q B;  2OEL A;  3CC2 S;  3VAJ A;  1IWA A;  2N4C A;  4Q43 A;  2HKE A;  2VJU A;  4J9K A;  3OW2 R;  1KTV A;  5I3U B;  1SKS A;  2AYB A;  1RUS A;  2PII A;  2VC0 A;  4OFZ A;  5GMK a;  5KFA A;  2FLP A;  2D74 B;  4DU8 A;  2UUA F;  5K4P A;  1CUL A;  2F65 A;  3CCL S;  3IWN C;  2EWH A;  1FRI A;  3MD3 A;  3WAW A;  1R43 A;  2V69 A;  3KG4 A;  4NA2 A;  4LF5 J;  2ZE2 A;  4UTG A;  3LAN A;  4UPI A;  2AIR B;  3MDF A;  1P1T A;  1JNR B;  2LXF A;  3FKB A;  4C11 A;  5C24 B;  2BQU A;  2HND B;  1GXL A;  2XMV A;  2NYH A;  2R7S A;  1NME B;  2KHD A;  4FBU A;  1N5Y B;  4O3Q A;  2DHA A;  1B7Y B;  1Q86 T;  2KO1 A;  1ZEB A;  1RLC L;  3MEG B;  1Q8L A;  1UP1 A;  2MY7 A;  2VQE F;  3GR1 A;  1RHM B;  3MEE A;  3C16 B;  1EW9 A;  3MPY A;  4QCL A;  1N33 F;  2JZ5 A;  2QL5 B;  3HKZ D;  2FD2 A;  3BR9 A;  3M2V B;  2CWK A;  4I2P B;  4WE1 B;  3S6E A;  4IRC A;  4KGM A;  2MY8 A;  1SJF A;  1J5E J;  3D3B J;  5F9L A;  1PYS B;  2HG4 A;  5KFB A;  1WNE A;  3OHB A;  2V67 A;  2A18 A;  2D7S A;  5DG8 A;  1U1O A;  1ZZN A;  4JI3 J;  3D5M A;  2ZBP A;  2XS2 A;  3LP1 B;  2BYC A;  3C15 A;  2GC8 A;  2VF3 A;  4WFX A;  5CYM A;  2Y8Y A;  3TNV A;  5KOX A;  4GO5 X;  4DV2 J;  2YKQ A;  3THP A;  2XLI A;  1UVL A;  2P2C B;  4DF8 A;  5A8W B;  1WHY A;  1SI9 A;  3TX8 A;  1FRH A;  1XMO F;  4IOC Q;  2JSX A;  3C3L A;  2KFN A;  5KAK A;  3C15 B;  1HWI A;  5B0C A;  3RBX A;  1APS A;  4TU9 A;  2V8H A;  2OPS B;  5K8N A;  4OYB A;  2QLB B;  1CSJ A;  2J0S D;  2A1B A;  5HSP A;  4ELU A;  2C2Z B;  3IXQ A;  4HVZ A;  3R1H A;  5IFM A;  3R2C J;  2YXL A;  3P5T L;  2YQ3 A;  2CA9 A;  2DEJ A;  5T7L B;  3BGL A;  4DPT A;  1WHW A;  4DLE A;  3POT B;  3SI8 A;  1VGY A;  2JLE A;  3AA8 A;  4QR2 A;  2HFO A;  2W24 A;  5T14 A;  2F9J A;  3AOC A;  4NYP A;  2Z8Q A;  5EN1 A;  5KT6 A;  1GEH A;  4DR5 F;  2HYI B;  2LQ5 A;  1X4D A;  4O3S A;  2AYE A;  4QYZ K;  4I69 A;  2XR9 A;  2HND A;  3H90 A;  1RHQ B;  5KT4 A;  1ZTW A;  3CJK B;  1NND A;  3MTK A;  4H4O A;  3UN5 A;  2XBP A;  5J1P A;  1LK5 A;  3MAA A;  2O66 A;  3G8T A;  4RNF A;  3T1Y F;  3HF5 A;  2KFZ A;  1EJJ A;  4FF2 A;  2AP6 A;  3FNN A;  2HSE B;  4CT9 A;  4DX7 A;  3FCV A;  4CQ1 A;  1HQE B;  1MU2 A;  3QWP A;  4ZN1 A;  1QVG R;  1B8J A;  1UWA A;  1L3K A;  4OHV A;  3NCP A;  4B3O A;  2LYV A;  2B43 A;  3TAM A;  3TZZ A;  1WWH A;  1TL4 A;  5HAO A;  2ZJQ Q;  3VAM A;  2HS0 A;  5GRR A;  3NGT A;  1CQM A;  1YKW A;  2J9C A;  3DM2 A;  5IC6 B;  3KLV A;  1NJZ A;  2RRN A;  1HAR A;  2CWX A;  2QYC A;  5DLV A;  2DIS A;  1HQA A;  2MQL A;  5KG2 A;  3PX4 A;  3AY0 A;  4E2F B;  2EPI A;  3HHL D;  4A47 A;  1FFG B;  1HBO B;  2AEJ A;  2BJ7 A;  1XMB A;  1T9Y A;  2I1R A;  1QUP A;  3DYA A;  4NRT A;  2OSR A;  4GMK A;  1HQ2 A;  1D3W A;  3QBC A;  4HAC B;  5HJX A;  2ZM6 J;  1VDH A;  4TVA B;  2HEK A;  3A3O B;  3H40 A;  1HMV B;  4NCG A;  4ED6 A;  4J9V A;  3VZH A;  1VQY A;  2B5J B;  2Z2Z A;  4DR2 J;  5LXR A;  1RTH A;  3TUJ C;  2B8Q A;  1Q4R A;  4FN5 A;  4LSN A;  4NZ0 A;  4QPT A;  5IXU A;  3OVA A;  2CQC A;  1K1Q A;  5K14 B;  3KJV A;  3NKO A;  4QIV A;  2J0X A;  4J9N A;  1JJC B;  1HHS A;  4MK9 A;  4UY8 T;  3CDA A;  4A8X A;  3T19 A;  4OL8 A;  1DUR A;  4ECU A;  3P4U B;  5J1E A;  4LF1 A;  1YG0 A;  3Q22 A;  1FJE B;  4I2Q A;  1PG5 B;  1S48 A;  5L0B A;  1FKP A;  2RIJ A;  3LW5 C;  4L3N A;  3SSS A;  3OUY B;  3I96 A;  1R89 A;  3MM8 B;  2F4F A;  4ZS6 A;  1M1K T;  1UJ6 A;  1VRT A;  5GMD A;  2VBZ A;  1SKW A;  3DI6 A;  2ZZN A;  4X2B A;  2CRL A;  1KWM A;  3D9B A;  1R6Y A;  3PCO B;  2HMI A;  4I2P A;  2WB1 D;  1UZH A;  2ZUG A;  2B3T B;  2IM0 A;  3BBB A;  1B0T A;  3W8G A;  4GTW A;  4LQY A;  3FVY A;  4WIQ A;  1QVF R;  4ED5 A;  4DR3 J;  2B0G A;  1SV5 B;  5E2Q A;  4PXB A;  4LR9 A;  3HFV A;  2VQE J;  3OTB A;  4L6V 3;  3ITH B;  2DK2 A;  4QU6 A;  3EGN A;  2XMK A;  1FFS B;  4TQS A;  4ECV A;  2AHO B;  2KI2 A;  1MN9 A;  2IAJ A;  4QJV A;  1NEE A;  4WXW A;  3BBF A;  4H4K C;  1UKU A;  1YQH A;  3BV8 A;  1BQX A;  5AXK A;  2VA3 A;  5J2N B;  4LBI A;  4PQU B;  4JBC A;  4ZJL A;  4FYY B;  2DO4 A;  4ZMM A;  5D3G B;  2C2R A;  2C42 A;  4EWT A;  3CJS A;  2CPY A;  2KB2 A;  4ECR A;  4KGK A;  5B0G A;  2ZE2 B;  3I0S B;  4BC9 A;  3BYR A;  3KK2 A;  1DTQ A;  1RJJ A;  5IC4 B;  4HKQ A;  2HHT A;  2AF6 A;  2CZ9 A;  1F5B A;  3JAM Y;  2RS8 A;  3MPU B;  3KK1 B;  4F4Z A;  3V4I B;  1UW4 A;  3DDK A;  4LF7 F;  1CJK B;  1WOR A;  4KAV A;  2AYM A;  1AT1 B;  2GW8 A;  2RRB A;  3ITH A;  4X62 F;  1RAG B;  3Q8S B;  2XHW A;  2Z57 B;  1IJE B;  1YTY A;  4LRA A;  4DQP A;  2NXJ A;  3E01 A;  4NLD A;  1ZED A;  1FE4 A;  4F26 A;  2AGQ A;  2G0C A;  1W26 A;  2MZJ A;  1LV5 A;  2KT2 A;  2N7Y A;  4MMO A;  4ZG9 A;  1PIE A;  5K5M A;  3AD9 C;  5E0O A;  3QIP B;  4GRS A;  3V6K A;  4XK8 C;  4JI1 J;  1VQ7 S;  3NLC A;  4QIW D;  4Q44 A;  1VLO A;  3R5J B;  2ATC B;  3DHX A;  3E01 B;  2KJV A;  2Q6C A;  3VCD A;  3MUV P;  2AQ4 A;  4OZ1 A;  4ZPB A;  3S1T A;  4QWC A;  2FHM A;  2XYG B;  3V81 B;  2W4C A;  3L7P A;  3SV4 A;  1S72 S;  3TOQ A;  1RT2 B;  5ETL A;  3G96 A;  4PKD B;  3LWL A;  1CJV B;  2G1D A;  3KLI A;  3OTD A;  2XSJ A;  4X65 F;  4OYW A;  3PX6 A;  2OML A;  4X66 F;  3GIJ A;  4EGL A;  4QZV B;  2N7C A;  3TVY A;  5KFE A;  1D9F A;  4B02 A;  2UXC F;  3ILO A;  2BAN B;  3KK3 A;  3BDP A;  2BJE A;  1U1P A;  5ETQ A;  1Q79 A;  4ZIT A;  3SMZ A;  1B0P A;  2R8I A;  1KP6 A;  3MFI A;  3KLG A;  4B9V A;  1VBY A;  2F5G A;  2HWI A;  2BRL A;  2LA4 A;  4OLP A;  4ZVP B;  4JP8 A;  1GMU A;  3SZY A;  1UEK A;  3L95 X;  2W9B B;  1T3O A;  4DQS A;  1QTM A;  2ROG A;  3ISN D;  3TAP A;  2PO4 A;  3KXD A;  1WC0 A;  1X9S A;  3PVX A;  3U7J A;  4ZCI A;  3MR6 A;  3MPW A;  2WSE C;  1WSR A;  2KT5 A;  2ZOG A;  4F0K A;  4U95 A;  4TU8 A;  3RB3 A;  3V81 A;  3VGS A;  2K7J A;  2GJ2 A;  1DAX A;  2NXN A;  5I4M A;  2XEX A;  2YH1 A;  4EO6 A;  1NAQ A;  3QGI A;  2ANH A;  2ALY B;  4ATN A;  1FDB A;  4DSE A;  5A0Y A;  2OAU A;  2IUC A;  2W9B A;  5GVQ A;  2VBW A;  2AWZ A;  3J7Z T;  4LF6 F;  1WHX A;  3CIM A;  1G1X A;  2O3D A;  2GHV C;  1YRT A;  2GQC A;  5BYQ A;  1GK8 A;  5ETM A;  1K7H A;  4K5S A;  3JTP A;  4K2J A;  1UFK A;  3NEK A;  2B7C B;  2RDI A;  3K59 A;  4NWB A;  3QZ8 A;  2KXH A;  3VAF A;  3JTN A;  1N4L A;  2ASY A;  3IS9 A;  1IM6 A;  2V63 A;  1WSV A;  5E3P A;  3X3U A;  1S0M A;  1KRP A;  2GHW A;  3UR0 A;  1JXE A;  3BDG B;  1CG2 A;  1IQT A;  2JOQ A;  2HRU A;  4F0H A;  5CH7 B;  4ZA1 A;  3ZNJ 1;  3MM6 A;  1RAD B;  4DHV A;  4IQM A;  3VZI A;  1XQI A;  1TUG B;  4FF4 A;  2PA3 A;  1RXO B;  4C8N A;  3I9V 9;  3MOZ A;  1VRU B;  4BDP A;  4PWD A;  1FD2 A;  1X5S A;  1N0V C;  2WW4 A;  3MEC A;  2UV8 A;  1WC6 A;  3SCJ E;  4ZLJ A;  1YBA A;  5MAO A;  3BS9 A;  3KLF B;  4F02 A;  2N3O A;  1SJQ A;  1JIH A;  1P49 A;  3MWB A;  3TAM B;  3IS9 B;  3KUG A;  4HT7 A;  3UD4 P;  2IVF B;  5DLT A;  2FJV A;  1UJ5 A;  4ICL A;  5KFY A;  3D67 A;  1IUJ A;  3VWS A;  1RTD B;  3HVT A;  4KFB B;  1FNM A;  1OQ6 A;  3BDE A;  3TVK A;  5I42 A;  1S5Z A;  1NB2 A;  3CC7 S;  1UWB A;  3IAS 9;  3WQP A;  5G4D A;  3NAI A;  2YNG B;  4WII A;  2XMT A;  2DD8 S;  3R5B A;  1IKW B;  1RBL A;  4U67 Q;  1VR6 A;  4HLB A;  5HVF A;  3TW0 A;  3WX8 A;  1X4G A;  4KH0 B;  4JI8 J;  5K9F A;  4CNZ A;  4FYD A;  1PO6 A;  1FCA A;  7AT1 B;  2NCK L;  5RUB A;  3I6P A;  1NCL A;  1LQ9 A;  5DDR C;  2W8S A;  2KVQ E;  5K8O A;  1HWJ A;  2MKH A;  3DLB A;  4OZ0 A;  1TVR B;  3AXM A;  2DHS A;  4ZVS B;  5SUH A;  1KOH A;  2DR8 A;  4AT1 B;  3EM1 A;  3AOD A;  2XY5 A;  1HIY A;  5F8G A;  1NK8 A;  5IWA F;  2ZWO A;  2ZH3 A;  3MMC A;  5J2P A;  3Q2T C;  5D4N A;  3R3T A;  1RLD A;  1E6V A;  4WXO A;  1FDA A;  4HHU A;  3VHQ A;  2ATL A;  1HBU B;  1RIS A;  1TUW A;  1U7L A;  4JI6 J;  3OT9 A;  4NA1 A;  3T6J A;  1EET B;  3BSO A;  1XN9 A;  3KK3 B;  1QAY A;  4J5O A;  1LW2 A;  1UEV A;  1EJ7 L;  4QIG A;  4KJD A;  2DIV A;  1ZBT A;  2WVE A;  3PHE A;  4PXC A;  2IM2 A;  3M8Q B;  3E3X A;  3N01 A;  3CDE A;  1UW9 A;  4A4J A;  4RW8 A;  3GV7 B;  1ELZ A;  1GMW A;  2VBX A;  3GJS B;  3HDS A;  3OTO F;  4DSF A;  2DRB A;  3O2I A;  5IJS A;  4ED8 A;  2GQ2 A;  1HNZ J;  5HJY A;  3MMJ A;  1RWP B;  1N52 B;  1FO1 A;  2C2O B;  2JLF A;  4TLR A;  3KLH A;  4IQX A;  3E2E A;  3VVU A;  5ETR A;  3H4D A;  2HHX A;  2VPX B;  3FBC A;  5AT1 B;  5CCM A;  3CCM S;  2Z58 B;  2W8K A;  3K5M A;  2N4D A;  3B54 A;  5D4O A;  5E41 A;  3FSI A;  4DSI A;  2HQD A;  4F3O A;  2KXN B;  1UVI A;  2WK4 A;  1E6V B;  2DGQ A;  3MEK A;  3SZZ A;  2CQD A;  5CQG A;  4DX8 H;  3GTY X;  4LF4 J;  3WHI A;  3NCR A;  1HLW A;  3HX9 A;  2OGU A;  3CJ0 A;  1WC1 A;  1EIY B;  4TY9 A;  1A0O B;  1U1R A;  1MLA A;  2KRB A;  2GSU A;  2CFX A;  1V5I B;  2G0I A;  3BEG B;  1HNX J;  3DOM A;  4B9U A;  1X4E A;  3A13 A;  4UOF A;  1REV A;  1IKY B;  2GX8 A;  2JFD A;  4DR3 F;  1JLF A;  3MPV A;  3PYF A;  4NL5 A;  2FLO A;  5HRT A;  1HWK A;  1TUV A;  2ZM6 F;  3PIP Q;  1HW9 A;  3HZE A;  4ECX A;  1T03 B;  1VQM S;  1BLU A;  2JWN A;  2QFI A;  3TUZ C;  3JSM A;  3C6T A;  2OEK A;  2H1Y A;  3CED A;  4ZHR B;  1U45 A;  1L3U A;  1VQ4 S;  3NNH A;  1FEH A;  5DGA A;  2RT3 A;  4CO4 A;  2X1G A;  4N77 A;  4ZJO A;  4JUZ A;  3BGR A;  5A8W A;  4YR3 A;  4OI0 A;  4GO7 X;  4HL9 A;  2FZG B;  4URS A;  2GO8 A;  4U96 A;  4ED0 A;  4YB5 A;  1EAR A;  3IR7 B;  1E2S P;  2JEJ A;  3CCJ S;  3M7V A;  8RUC A;  1VQN S;  3MOJ B;  2BJ8 A;  2X1B A;  2FVQ A;  4I67 A;  2OP5 A;  3OR1 A;  1NO8 A;  4L75 A;  3KLF A;  4LRD A;  3SQO P;  3ZTS A;  4PAA A;  2QN6 B;  1NKB A;  1RAH B;  2RQK A;  5L8R C;  4DQQ A;  2MZQ A;  2W4D A;  3MM8 A;  1DTQ B;  3VGU A;  3HCX A;  1WDT A;  3M2R A;  4M5N A;  2E9R X;  4YHH J;  4NAS A;  5J1E B;  3SXL A;  2HZC A;  1SUQ A;  3NKP A;  2CNK B;  4ZP6 A;  1N5S A;  2AEF A;  3ZZO A;  2KG1 A;  3I82 A;  3TAN A;  2R7T A;  1FNO A;  2C3M A;  4FDI A;  2BW2 A;  3PM9 A;  3OR2 A;  1NSK L;  2DY1 A;  4CH0 S;  1PBA A;  1S1X B;  1Y00 A;  2K7K A;  3MZI A;  4LF2 A;  4CRJ A;  4J9L A;  4HI2 A;  3I4P A;  3IRX A;  4OI3 A;  5I42 B;  2FPH X;  3IR5 B;  3J81 Y;  2KG0 A;  1X5O A;  1O8B A;  1RWU A;  3MMB A;  1K73 T;  2ZNZ A;  3RBD A;  2H54 B;  5LSR A;  2YWG A;  1RBO B;  2MHN A;  2IUC B;  1JLQ B;  1V9O A;  2RSQ A;  2XC9 A;  2AKW B;  3KHR A;  2ADB A;  2IM3 A;  1M1H A;  3RRG A;  4RW9 B;  2R2U A;  1F2G A;  2YPY A;  4B3T J;  1B0V A;  3HSJ A;  4O3R A;  1U1K A;  4DFM A;  4OJH A;  1H3D A;  2MST A;  2AJ4 A;  3BGU A;  2HFS A;  1R0C B;  2HAF A;  3HI9 A;  3EXY A;  3OFF A;  5ETN A;  1URB A;  1U24 A;  1NSP A;  2QLF B;  4QIF A;  2K3I A;  1YI2 S;  1UET A;  5AE1 A;  1EQM A;  4NMX A;  2UUC J;  2ZDP A;  4W92 B;  3KJQ B;  2KL8 A;  2VBY A;  3MEE B;  1LWX A;  1Q7L B;  3MM9 B;  2AV5 A;  1WAC A;  4GC7 A;  1RAI B;  4Y2C A;  1O98 A;  4OZ2 A;  3BSC A;  1QUV A;  3DLK A;  2KYX A;  4OI6 A;  3G82 A;  5FD1 A;  4B9L A;  1R0A B;  4H4O B;  2D1C A;  3GG1 A;  2ILZ A;  3NS6 A;  2BMB A;  4WP3 A;  2LA6 A;  4DDF A;  1RT6 A;  1KH7 A;  1YZ6 A;  3Q86 A;  1IJF B;  3F41 A;  8ATC B;  2Z56 B;  1ZYQ A;  1N36 F;  2EFP A;  1DTT A;  2FZC B;  1F2H A;  4ILR A;  2Y1R I;  4H4M A;  1VC6 A;  4DCO B;  1HBN B;  3TJ8 A;  1KSP A;  2HAI A;  1FJG F;  2I5J B;  2KZM A;  4FDJ A;  3TZY A;  3C14 B;  3DOL B;  4ZG6 A;  2CNL B;  4JI0 F;  3T1H F;  1X5P A;  4F4A A;  1S49 A;  4DS4 A;  2YTC A;  4EYI B;  3HHD A;  4WCE Q;  4OYM A;  1WTF A;  2E1P A;  4O3N A;  2YNH A;  3SIP B;  3T1A A;  1U49 A;  3CDW A;  3Q83 A;  1EHW A;  1RU2 A;  3JQM A;  5H1S V;  2EXU A;  5KFZ A;  2MDA A;  4WK1 A;  2HWT A;  2XCP A;  1XR6 A;  3GWC A;  3HD2 A;  2BQ3 A;  2O67 A;  1BC6 A;  3NKN A;  3UD3 P;  2F63 A;  2BKN A;  4DN9 A;  1IBC B;  1X0F A;  4H4K A;  1RTI B;  5C42 B;  3RW7 A;  1RQ0 A;  1N32 F;  3I56 S;  3T00 A;  3DGV A;  3SEO A;  3RW6 A;  3L9Z A;  3VAG A;  3MGJ A;  1QAX A;  1NHV A;  1JLA A;  2BBE A;  5J1N A;  2E5L J;  2VFR A;  3IRX B;  3LF0 A;  4UUW A;  4OZ3 A;  5JMN A;  1CBK A;  2RD5 C;  3H2U B;  4B9N A;  1T8E A;  1K0V A;  4YR1 A;  1C1C A;  3OR2 B;  2GA7 A;  4DV0 J;  2ABY A;  1UJ4 A;  1W7W A;  2LDY A;  3DDN A;  4NYO A;  1JNZ B;  1NB7 A;  4M5K A;  2QL9 B;  1F3V A;  3DRP B;  1NZ8 A;  2YKM A;  3A8J A;  3IP0 A;  5HBM B;  4RU9 A;  1WOP A;  4WFB Q;  2MKK A;  2IMW P;  4OLO A;  1VQS A;  3W2W A;  1VIX A;  1XBW A;  2DXD A;  2FC8 A;  5D0H A;  3C6U B;  2G13 A;  4RUA A;  2MXY A;  3GJR B;  3FRZ A;  4OV6 A;  3NKQ A;  3GV8 B;  4FXW A;  1PJ7 A;  1S57 A;  3GR0 A;  2COL A;  1BXN A;  1S1W B;  2CVE A;  3R97 A;  2U1A A;  2R7R A;  4DL4 A;  3PX0 A;  4B3M F;  4EZ6 A;  2QEX S;  4RW7 A;  3I55 S;  3UVJ A;  3ZZY A;  5IV3 A;  2ZH4 A;  2MJU A;  1FER A;  1DY3 A;  2LMI A;  4ES3 A;  1ZET A;  4K59 A;  3H8Y A;  1LXN A;  2P6S A;  2RQM A;  3KLH B;  4EBC A;  4DV6 F;  4A8O A;  4JV2 A;  2XZT B;  3U1M A;  2W7P A;  4C3M A;  1MRO B;  4DUZ J;  1UTA A;  2W5V A;  4OI1 A;  5ITH A;  4B17 A;  1XNQ J;  1S1X A;  2FJX A;  2I8E A;  3C8Y A;  3C19 A;  2AJF E;  4WFY A;  1LW0 B;  1T9V A;  5LM7 E;  4C98 A;  3JB9 k;  3CDU A;  5DG7 A;  2HHQ A;  4RPF A;  4JI5 F;  4OHZ A;  4CLP A;  1IXK A;  2E5J A;  4KE5 A;  4BC7 A;  3QFH A;  4QOT A;  2CDR B;  3GFY A;  2OEM A;  1KFS A;  1VJQ A;  1SJ4 P;  1RTZ A;  3PO5 A;  2PDA A;  4ZPW R;  4C8Y A;  4DR7 J;  2RIL A;  4LSN B;  4NZ6 A;  4YDD B;  8AT1 B;  4F04 B;  1CS4 B;  2J9D A;  3MED A;  4DV7 F;  3KOA A;  4CXK A;  3B82 A;  1M5O C;  3M32 B;  3CJ8 A;  4XDD A;  2OD4 A;  3QSY B;  4KT0 C;  3MXH P;  2F8M A;  2XG8 A;  1ELX A;  1DLO B;  1Q8I A;  3CUN A;  3PW0 A;  1YIJ S;  5EUH A;  3VV2 B;  3ILJ A;  2EK1 A;  1GQE A;  3U1N A;  3EXC X;  2MQM A;  1IQZ A;  2QSW A;  3G86 A;  3N6N A;  4NPO A;  3RJM B;  3RRK A;  4A8S A;  4DL6 A;  1MN7 A;  2OPP A;  3UFC X;  2QE5 A;  2BXJ A;  2PGC A;  3ZXW A;  2NXC A;  2OIH A;  1BWE A;  4RL1 A;  2HVE A;  2QTW A;  2LQ8 A;  3T6B A;  2PD1 A;  2RDD A;  4RJV A;  1KDN A;  3MM5 A;  3DOK A;  1IR1 A;  2H51 B;  4OIX A;  9ATC B;  4EFA C;  4USH A;  4B3O B;  1JWW A;  3ICL A;  1EZZ B;  2YNG A;  4OX9 F;  3PR4 A;  4NEZ A;  1E6Y B;  3UDV A;  3Q24 A;  2LFV A;  3CC4 S;  1V3S A;  3DRY A;  1FXD A;  1WF0 A;  2QLW A;  3R5G A;  1LOU A;  5KFQ A;  4KYZ A;  1S7I A;  4RBV A;  5L1J A;  2XCA A;  2LP4 A;  2CNO B;  3V6H A;  3OL7 A;  1RTH B;  3K0J A;  4FYX B;  4UPH A;  1K8A T;  4PXD A;  1A7G E;  3QYY A;  1E33 P;  1VQ6 S;  3JSR A;  1S12 A;  1U6Z A;  3LAK A;  4ZVQ B;  3P6Y C;  4RW4 A;  1N6Q A;  3UN2 A;  3P49 B;  4I7F B;  1FVS A;  2C3U A;  2IFX A;  3L7U A;  3TX0 A;  3UR3 C;  1NXI A;  3NNC A;  2LQ9 A;  3TZW A;  3FCW A;  1HI8 A;  1Q5V A;  1UL3 A;  4CIO A;  4MKA A;  4O44 B;  5GAD U;  3NP5 A;  4RNM A;  4DG1 A;  3DLE B;  4N41 A;  3MAQ A;  1YSJ A;  2DNN A;  1R8P A;  4Z7C A;  2XYP B;  2E1R A;  3R6G B;  2I2Y A;  1HR0 F;  3OVS A;  3SCI E;  1VRT B;  4WKY A;  3BO3 A;  3PO4 A;  1NUE A;  1V5V A;  2BVZ A;  3OUY A;  2HBR B;  3GZ7 A;  4C3L A;  3MFH A;  2DR5 A;  3SFU A;  3CJT A;  3DLJ A;  5LJ3 Y;  1RT3 B;  1IKW A;  4J9S A;  3IWX A;  2BA9 A;  2XGQ A;  1HNW J;  2AX0 A;  2VG5 A;  4RZR A;  4CLT A;  1N2K A;  1GX5 A;  4F4W A;  1N32 J;  3B4M A;  3R2D J;  2CPF A;  4RWW A;  2HW3 A;  1JKH B;  1WHV A;  2PN6 A;  3SSQ A;  3ZTO A;  5DQG A;  1K9M T;  4BS2 A;  3CCV S;  3NNA A;  2XMA A;  3EZO A;  3N9U C;  1VQL S;  4HH0 A;  3V5R A;  1RT1 A;  1AJD A;  4LQ3 A;  2H4W B;  3DLK B;  2IHR 1;  3IG1 A;  4YY3 J;  2J9D E;  2HGL A;  1FK9 A;  1N5Q A;  5J2P B;  4QWA A;  1S1W A;  1FFW B;  1FT8 A;  3DLG A;  1XMO J;  1H98 A;  3PEJ A;  5KFT A;  3TJ9 A;  6AT1 B;  3TQ1 A;  2HBQ B;  3A52 A;  2ZOM A;  3PRV A;  4KKO A;  1PIL A;  3CCU S;  1TVR A;  1CPZ A;  4OMF G;  3AH6 A;  1QSY A;  1F5C A;  1AXQ A;  4DL5 A;  3HXM A;  2V9W A;  1JLG A;  1HWU A;  5BXI A;  1U6B A;  3ENW A;  4RNH A;  3TA0 A;  1Y11 A;  1VC5 A;  4LQ9 A;  3K8V A;  2XS5 A;  3QRR A;  4F4X A;  3PNI A;  4RWX A;  5H9F K;  3FBE A;  2M4M A;  1QM9 A;  2YNF B;  4LFA F;  2IRX A;  4ID5 A;  1EI6 A;  3T5H A;  2UUC F;  3OXF A;  1IKV B;  5HLF A;  3ET6 A;  3OXL A;  5U47 A;  3UDE A;  2DY9 A;  1I94 J;  3MMB B;  5G0R A;  4Z7Y A;  2QA4 G;  2ILY A;  4DUZ F;  3PW2 A;  1U02 A;  3OBI A;  5C42 A;  4DSJ A;  1ZEF A;  3HHE A;  1URA A;  3WAY A;  2BKP A;  1J5E F;  2DRA A;  5F41 A;  2XZD B;  1QAJ A;  5A0Y B;  1SL2 A;  3G6X A;  3IMQ J;  4FP9 A;  3OTC A;  4DCP B;  3BM7 A;  5DLF A;  1YJN S;  4FXD A;  1KHV A;  2IVM A;  4Q5V A;  3DMJ A;  1RP5 A;  1KC8 T;  1Q1K A;  2QLJ B;  2F4V F;  3LAM A;  2ACM A;  3M9N B;  3T5L A;  5BR8 J;  1M0S A;  2GML A;  4CO2 A;  4ZPD A;  3TJA A;  3M8S A;  2PC6 A;  2UV8 G;  4GKK J;  2ZOF A;  3PZP A;  3DLL Q;  4ZGA A;  1VYA A;  4MTP A;  1UAW A;  1JXV A;  2HNY B;  2OSQ A;  1GAO A;  1OY6 A;  2I5J A;  6FDR A;  2X98 A;  2NUH A;  3BDG A;  1YVF A;  4XDC A;  1FDD A;  4RNO A;  2Q3P A;  3K5N A;  4IH6 A;  1TV6 B;  5DDQ C;  2VHG A;  2QMW A;  3FQK A;  3CUL A;  1JLC A;  3FGV A;  1N0U A;  2CQ2 A;  3HT0 A;  1KHJ A;  2WSC C;  1JJ4 A;  3SBM A;  3IBC B;  2E5L F;  5E5N A;  5D8H B;  3RTV A;  4Q7A A;  1DQ9 A;  3KG0 A;  2MPU A;  3ZZR A;  1IKX B;  4PQA A;  3EUN A;  2HGM A;  4M5D B;  5DS7 A;  4YB1 P;  4RU2 A;  1ED8 A;  4ZPT R;  5AXL A;  3HLU A;  3LGM A;  4DI6 A;  3W9I A;  3IGY B;  1ZZF A;  4QR0 A;  2DNH A;  3CD5 A;  4NOH A;  5D6G A;  1NK0 A;  1OYD A;  4FNH A;  4C2M A;  2B9Y A;  2XY7 A;  1XNR J;  3OL9 A;  5IT9 U;  2OD6 A;  4WP9 A;  2HMI B;  2GIQ A;  2V2Z A;  2E9Z A;  2UUW A;  4W4M A;  2O5D A;  4ZN3 A;  2XO6 A;  2UXD J;  4O4G A;  4HTJ A;  1TZ0 A;  2FTR A;  4K2X A;  4RBT A;  5B0A A;  2Z0G A;  5HRO B;  3IGZ B;  2ZJP Q;  5M2U A;  1OQ3 A;  5KFF A;  3EMT A;  2CDQ A;  4DSL A;  3HM9 A;  4USU A;  3M32 A;  1WEX A;  3UCU P;  4M5I A;  1OIA A;  3W2W B;  1ANJ A;  1Y10 A;  3G82 B;  1NDL A;  1RAE B;  2LEA A;  3Q0A A;  3HHK A;  4S0M A; 
#chains in the Genus database with same CATH homology
 4MHX A;  4B56 A;  2ANH A;  3MK1 A;  2IUC A;  3BDF A;  1N2K A;  5HRT A;  4YR1 A;  5K4P A;  1E3C P;  3NKO A;  1AJC A;  3TWZ A;  4KM4 A;  3UNY A;  3WAW A;  1K7H A;  1AJD A;  5INH A;  3IDD A;  4UPI A;  4MY4 A;  1FSU A;  4LR8 A;  4N7T A;  5L0B A;  1ALK A;  2G9Y A;  3NKQ A;  3UN3 A;  4LR2 A;  2W8D A;  4LRC A;  1E2S P;  3BDG B;  1KH5 A;  2D1G A;  5IJQ A;  4CXS A;  3M7V A;  3A52 A;  1SHN A;  5LIA A;  5EGH A;  3WBH A;  1ELY A;  5LRM A;  1ZEB A;  4LR7 A;  4LRD A;  5LRN A;  4KAY A;  5L0E A;  4GTX A;  1ZED A;  1EW9 A;  2GA3 A;  4ZG7 A;  4QAX A;  4CXU A;  4GTW A;  5KXA A;  4LQY A;  5LQQ A;  2W5S A;  1P49 A;  4UPL A;  2W5V A;  1N2L A;  1EI6 A;  5DLW A;  4LR9 A;  3NKP A;  4UOP A;  3WAV A;  4GTY A;  3NKM A;  5DLT A;  3M8W A;  5GOV A;  5TJ3 A;  3M8Z A;  4FDI A;  5AJ9 A;  4CYS A;  3WAY A;  1ZEF A;  1HJK A;  1O98 A;  3T02 A;  2W5X A;  2ZKT A;  5C66 A;  4UOO A;  4MIV A;  3BDH A;  3ED4 A;  3NVL A;  1HDH A;  4CXK A;  2IUC B;  1O99 A;  4KAV A;  4LRB A;  1ALH A;  1ELX A;  1KHN A;  2W8S A;  3NKR A;  4LRA A;  4ZGA A;  4NWJ A;  2X98 A;  1AJB A;  1EW2 A;  1KH4 A;  2IFY A;  1EQJ A;  3BDG A;  3CMR A;  1E1Z P;  1URB A;  4ZG9 A;  2VQR A;  4KJG A;  4LRE A;  2RH6 A;  4NWX A;  3Q3Q A;  1KHJ A;  1KHK A;  3OT9 A;  1ALI A;  4GTZ A;  3T01 A;  2XRG A;  1Y6V A;  3KD8 A;  4UOR A;  2XR9 A;  4KJD A;  1KH7 A;  5L0K A;  1EW8 A;  3UN5 A;  3B5Q A;  3M8Y A;  1URA A;  1ED8 A;  1EJJ A;  3IGY B;  4UPH A;  1ELZ A;  5EGE A;  1ALJ A;  1E33 P;  1KHL A;  2GLQ A;  2GSO A;  2QZU A;  2W5T A;  3MK2 A;  4FDJ A;  4ZG6 A;  5IJS A;  3MK0 A;  1AJA A;  1B8J A;  3UN2 A;  3SZY A;  3TG0 A;  2W5W A;  4UPK A;  3TX0 A;  5GRR A;  4LRF A;  1ANJ A;  2GSN A;  3IGZ B;  3UO0 A;  4TN0 A;  3SZZ A;  4CYR A;  1KH9 A;  2W5R A;  1ANI A;  5DLV A;  1ED9 A;  1HQA A;  3DYC A;  3T00 A;  3NKN A;  3WAX A;  3E2D A;  3LXQ A;  1AUK A;  1SHQ A;  2GSU A;  3DPC A;  2W5Q A;  1Y7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...