3UO0A

Phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3uo0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3uo0A01
1N2KA 4B56A 4UPHA 1ZEBA 3T00A 4LRCA 3TWZA 1P49A 1AJAA 4ZG7A 1AJBA 5AJ9A 3OT9A 5GOVA 3A52A 4UPKA 3BDFA 4LR2A 2ANHA 2X98A 1EI6A 4KAVA 1KH9A 1EW9A 1ALKA 5GRRA 1KH4A 1E1ZP 1KH5A 5DLVA 3NKPA 1ALIA 4GTWA 3NKOA 2D1GA 4UORA 5L0KA 4CYRA 4NWJA 1K7HA 1URAA 4LQYA 3WAVA 5K4PA 3WAWA 4YR1A 4LRFA 1ZEDA 4LR8A 5IJQA 3KD8A 5DLWA 5TJ3A 4LR7A 4MIVA 3NKMA 4KJGA 3SZZA 2W5WA 3NKNA 2W5SA 1E3CP 4LRBA 2W5VA 3Q3QA 1KHNA 5EGEA 3MK1A 1ALHA 4LREA 3T02A 1ED8A 4KM4A 4UPLA 5LQQA 1KHLA 4CYSA 5L0BA 1KHJA 4KJDA 4LRAA 3UN3A 2XRGA 3B5QA 1URBA 2G9YA 3ED4A 2W8SA 1ELXA 4CXKA 3UN5A 3CMRA 2GSOA 3NKQA 4MHXA 3SZYA 4LRDA 4FDJA 4TN0A 5HRTA 2VQRA 3MK2A 4GTXA 5INHA 3E2DA 2GA3A 3UO0A 2W8DA 4UOPA 3IDDA 1ALJA 1AUKA 1FSUA 4QAXA 4CXSA 4UOOA 4ZGAA 1Y6VA 3M8YA 1ANJA 5KXAA 1AJCA 3BDGB 4MY4A 3WAXA 4ZG9A 3NVLA 1AJDA 1O98A 1SHQA 3NKRA 4GTZA 2RH6A 5IJSA 3LXQA 1ED9A 3DPCA 2W5TA 2GLQA 5LRMA 2W5XA 4N7TA 2W5RA 1E2SP 1ELZA 1E33P 3WBHA 5LRNA 3M8WA 1KHKA 3UN2A 3UNYA 2W5QA 3TX0A 3DYCA 4FDIA 1EW2A 2IFYA 3BDHA 2QZUA 1ZEFA 4ZG6A 1HDHA 2ZKTA 1B8JA 2XR9A 1HQAA 5EGHA 3M8ZA 1SHNA 3IGYB 1ANIA 3BDGA 1Y7AA 4CXUA 1EQJA 1EJJA 5DLTA 5LIAA 4UPIA 2IUCA 4GTYA 5C66A 1N2LA 2IUCB 4KAYA 1EW8A 1O99A 3MK0A 3T01A 3TG0A 1KH7A 2GSUA 1HJKA 4NWXA 1ELYA 3M7VA 3WAYA 3IGZB 5L0EA 2GSNA 4LR9A
chains in the Genus database with same CATH superfamily
4X66F 2GZOA 2VKZG 4LRCA 2BOAA 3VWSA 3H4DA 1WF1A 1SV5A 2VF3A 1DLOA 1C0UA 1RKIA 4E98A 3TZYA 3Q23A 1H38A 4LBIA 2HVIA 1WTFA 1X5OA 2KFZA 1X4FA 1FF2A 2PI5A 2D9OA 2KJVA 3IWLA 1KH9A 3DI6A 4FS1A 3FCHA 3NBPB 4C8KA 5KT2A 2DRBA 3M6UA 3C15A 3TEGA 4WP3A 5HBMA 3SCIE 5GMEA 3DLHA 1U26A 4AXIA 4BWJA 2R7TA 1S5ZA 4DL4A 2B56A 3BSOA 2LQ8A 3W5XA 2QE5A 4K4ZA 4PXEA 3Q2SC 3D2WA 2N7CA 4YDXA 1N32F 3IG1B 3GYNA 1MN9A 1SIWB 1VBKA 4JB8B 4LFAJ 4QWBA 4DCJB 2BJ3A 4RNFA 3GQCA 3ICLA 2MQPA 3K5NA 1NJZA 4CT8A 2RHQB 5L9NA 1FKOA 1NJXA 2OPRB 5D8HB 4PXBA 2FLNA 3FCVA 3K5MA 4BC9A 1Q81T 4W92B 4U7UD 4ZVOB 3OHBA 2ZUAA 1NB2A 3FBFA 3CCRS 1NSKL 5LMNF 4J91A 4DF4A 1FJGF 1MWZA 2NSBA 4OHVA 3M8SA 3Q3QA 2OEKA 3MR3A 2WRMA 1IKXB 2VG6A 2CQHA 3DRRB 4P72A 4OHZA 2RDJA 4KGKA 4EBDA 2J76E 4E0DA 3L4BC 2RDDA 2HHPA 4IRDA 4FYYB 1KHLA 1P27B 1V9OA 4ITSA 1NPKA 3PDNA 4OJGA 2GIQA 4Y2CA 3FQLA 3W5YA 5DLGA 3BN7A 1HHTP 4HTIA 3B5QA 4KJDA 1X5SA 3I5CA 2NPFA 3BJYA 1NKCA 1UCNA 3F44A 3ED4A 4NE9C 1CULA 1YZ7A 2WB1D 1IJFB 3CMRA 4CXKA 3M6XA 1KSPA 3PW2A 3M30B 1XNQF 1REGX 2QFJA 1FA0A 5LMUF 4O3QA 4B3TF 3W9JA 5KFJA 3IBCB 4J9MA 2MHNA 2WVFA 2IM1A 1N36J 2FVQA 3GYGA 4C11A 2GJIA 3HXMA 1M5VC 2HQCA 4IG0A 4W4MA 2FLPA 1N33F 1HWJA 5C25A 4HVZA 3AQOA 3H5SA 2HQFA 1U6FA 1OWXA 4IFYB 4M5NA 5DO2A 5K5MA 1WF0A 1S77D 1H98A 1SHQA 3QZ7A 4ECZA 3NKRA 5D0HA 4DL0C 3KD8A 2HQ3A 2F65A 3MTJA 3RRKA 1E6VB 4IOBA 4QIEA 3HSDA 3ZZPA 3KHGA 1RT4B 1H74A 3FBBA 4NL5A 3MMCA 3N6LA 3DOLB 1E2SP 3MUMP 1RHMB 1FDNA 2DPIA 1EETA 2YKOA 4ECRA 3H5XA 2GIFA 3DYCA 2ZHAA 2K06A 2VJUA 1KQSR 1DTTB 2ZBPA 1EB0A 3IRXA 5DM7Q 4V1Ak 3BBCA 4LSZB 4UQGA 3GFYA 4DQQA 3GJRB 4KY3A 1X9MA 1XJWB 4LSLB 3VGUA 1UPMB 4CM2A 1DRZA 2R7XA 3ADAC 2J5AA 5HAOA 2R7RA 1Y7AA 5D77A 2M4MA 4DJBA 5B0CA 4IRCA 4TVAB 1HI0P 1NSPA 2P5VA 5IS2A 3THPA 2VIHA 1N52B 1R8CA 2V2ZA 1OYEA 3MPUB 4XPCA 2UU9F 4ZLPA 4FNIA 2DR9A 3OL7A 3HHDA 4HH0A 1S0NA 4C98A 4A4JA 3QO9A 3G71S 2ZE2A 2ZJQQ 3N4WA 3MCNA 3DDNA 3P5TL 3ULHA 4CLTA 4NXNJ 4RUHA 2C2OB 1HNIA 2MDAA 2FHJA 2WVEA 3M8PA 3PW4A 2M2BA 2MY7A 2Q79A 2YWEA 4KO0A 3PIOQ 5D4NA 1WELA 4DSKA 1EKRA 4OYOA 1YIJS 3T1YF 4L6V3 1GMUA 2QLFB 4ECWA 1IR0A 5MAOA 2DR6A 4OHYA 2QYGA 4P6QA 3ZTPA 4X64F 3OUYA 4DU8A 4ELVA 5AXKA 2ANHA 1NZ8A 2UUBJ 5FLXU 5A8RB 1M5HA 2DNLA 1FRKA 2E5JA 2VV5A 3D6TB 3EVOA 2D3OR 5LSOA 1X9SA 2VPYB 3FBEA 4MKVA 1D9AA 4YB7A 1RU1A 1XK8A 4CLPA 3M8PB 3K59A 4GKKJ 3BKUA 5KFVA 4LF2A 4MTPA 1TL5A 4ZVHA 3KFWX 2ILZA 3BREA 5T14A 3PM9A 1NHUA 4KBIA 3CUNA 2F7VA 5E33A 2DHSA 3V81A 4LQYA 2LXUA 5HLFB 4I1TA 4NLXA 5EUHA 2ZWOA 2VBXA 3RTVA 4DF8A 4P7TA 4K4YA 2HNZB 1WTBA 5K4PA 7FD1A 3JTOA 5C2CA 3WAWA 4X65J 3SI8A 1FDDA 1SKRA 1QVFR 2WB4A 1GK8A 5L38A 2MQQA 4EO8A 2A6MA 2Y3YA 2WVDA 4BCAA 3GIJA 3CJRA 3PJWA 1FDBA 3VAHA 2NPIA 2KH9A 4ZITA 2E9ZA 2V67A 1ZS6A 4ILLA 4G1QB 4EGLA 4FXDA 2HZAA 3GSDA 2IRYA 3DDKA 4LRBA 4RW8A 2V8HA 2XWYA 5GAEI 2EFPA 2VICA 1N5YA 4OX9J 4FF1A 5F8MA 1Q4RA 1ED8A 2EG1A 3DC2A 1N56A 2D74B 3I56S 5J2NA 4CYSA 1PAUB 1WC3A 2W25A 1W2IA 5DLFA 1KP6A 1VRUA 3KTQA 4OYAA 5A76A 1FJCA 2LFVA 2XYPB 3UWTA 3CIZA 4XK8C 4DXLA 3OR2B 1SL0A 4Q5VA 3WAXA 2DCUB 4DPYA 4FDJA 4GTXA 1UMJA 3E2DA 1T9YA 2WVBA 2X1GA 4LVNP 1R0BG 2E29A 3GJTB 4OYIA 1VISA 5MLCV 3NBPA 4I68A 4K5SA 1WHXA 1VS3A 5KFAA 2F8HA 3K7RA 3CJTA 2ZH3A 4WU3A 2UU9J 1CVJA 1FJ7A 2WBMA 2ZOFA 4RLEA 4FYDA 4KAIA 2HHWA 4DQPA 1ICEB 1C0UB 1HBMA 2G0CA 1V6HA 3G82B 1ANJA 5KXAA 4YR2A 1R0AA 2ADBA 3V6HA 3KK1A 1HNWF 3GTYX 1TL1B 3M1VB 3OTEA 4QIFA 3TJ8A 1DQAA 5I42A 1KRPA 4GTZA 2RH6A 2OPPB 2ALYB 3PEJA 3BSAA 1ZPWX 3DOMA 1RZMA 2MLYA 3BH6B 4J90A 3VTIA 2EFGA 4BHQA 4B3TJ 2W5TA 1TK5A 3DPCA 5L39A 3NGSA 1ZM9A 3LWLA 1X31C 1FKAF 5C7PA 1TUVA 4FYVB 1RT7A 4KHMA 2R8KA 1FKOB 2XGQA 3P8BB 4EO6A 2CNNB 3M9MB 1IKVB 3DM2A 1YK9A 3IG1A 2L08A 2H5EA 3D54A 2AGPA 3MM9B 4NLVA 2L9NA 1Q78A 2FGOA 4HACA 3W9HA 4ZVQB 4QZVB 5GMKa 3GCXP 4QU7A 2W7PA 1R43A 1RT5A 1VQ5S 2UXCJ 1P1TA 2AD9A 3ETMA 2ZWPA 4TXSA 2PD1A 3TAQA 2PGCA 5CCMA 1NSQA 2V2VA 1KHKA 2WONA 2BJDA 4NX9A 4TQSA 2KM8C 1S12A 2Z56B 4OI0A 2QN6B 1TKTB 2VG7B 3M6WA 4NZ6A 4OHWA 3KKFA 1RK8A 4LIRA 1TL3B 2NXCA 2M0GB 1XMOJ 2H51B 4ANEA 5CCLA 4WYWA 2RF2A 3M8QB 2J9DA 4UPHA 4MT1A 1WF2A 5GADU 1DY3A 2BACA 2QMXA 3QFHA 1PG5B 1JLGB 4Q2LA 1V5VA 4ATNA 3SCJE 3UD3P 3GJQB 4G65A 3P4UB 3HFZB 1RGVA 2R42A 2DCLA 1XBWA 1BWEA 4OYPA 4NXMJ 3TRGA 4KKOA 1E6VA 2AT1B 2YWGA 3BV8A 4RNOA 4HTJA 1S0OA 2YNFB 1X7VA 3KHRA 4LF9J 4UZCA 4WTOB 2OELA 1F2HA 2ZNZA 1SL1A 4LF7J 2VFVA 1QE1B 1RT6A 4O3RA 2XY5A 3SMZA 1JLBA 2UV8A 5KTQA 1XERA 2DEIA 3NS7B 3ZO7A 1XIQA 1D8YA 4M5LA 1YRUA 3I31A 4PPZA 2AEJA 3FMBA 2IC3B 1U49A 2HHTA 5KG5A 5ETLA 5LMNJ 1WEZA 3KDOA 2BXJA 3CIMA 1HARA 4FF3A 2W5WA 3DLGA 3QJLA 4ZHRA 3OVBA 4QR1A 1U02A 1E3CP 2W5VA 1LWCB 1RUSA 3RBZA 1WDDA 3D6HB 3FNNA 4Y00A 2VQEF 4NLGA 3RW6A 4YY3J 4I6AA 2CNLB 2XI2A 4XIUA 3SFUA 2V68A 2RS8A 4HI2A 2LVWA 3AQPA 5M2UA 1H0HB 3IR6B 3QSYB 4C3KA 4NLDA 1NZAA 1BQNA 2JC1A 4YR3A 3CCTA 2ZVIA 3AXKA 3L09A 2F4VJ 2FZKB 1WSRA 3NKQA 4I2QA 1E6YA 2DGWA 4ECYA 2I9SA 1OJ4A 1ZZNA 4GKJJ 2V50A 4DLEA 1S6UA 3LAMA 8ATCB 2GA3A 2LMIA 2QIFA 2XEXA 4NASA 2ZHOA 5KFPA 1BGXT 5KG2A 1HD0A 2HBZB 4QAXA 2DNNA 3SQGA 2DNHA 3BN4A 1K1QA 3CT9A 1U24A 3RYLA 4CLWA 2V2QA 4R0EA 1EHWA 2CNOB 3HHLD 3CDUA 2HHHJ 3IBWA 5GAHU 4M8LA 1HBOA 4F2SA 4OL8A 2ZZMA 2HBQB 3LGNA 4H4KA 5I3UB 1HNZJ 2HRUA 3AJ1A 4NA2A 3W9IA 4WK3A 3UE2A 4PG8A 2MKKA 2ZH5A 2YKQA 5GAGU 3CO9A 5KAKA 4HKQA 3SQGB 1RT2B 1QD1A 5K8PA 3V6DA 4JV0A 4ZS6A 3RGIA 1TUGB 2GQ2A 2QLWA 2GX8A 2GW8A 1SB6A 3OFGA 2E5LF 1C4AA 1VR6A 4X4QA 2XZWA 3EMTA 4U9RA 4CI0B 5HL7Q 3HVTA 2W2NP 2R2UA 4ZVUB 3PEHA 5E3AA 3G6XA 4QU6A 2CPZA 4KR0B 5B0GA 4ZJQA 2ZFHA 3ISZA 4C8YA 5DG8A 1FXRA 4CLYA 3DXSX 1UW4A 3FEYB 1FKPA 1EQJA 5I4MA 5A8KA 4RUAA 1UFLA 2D7SA 2ZVSA 3C14B 3MMBB 4DR2F 3FKBA 4F8RA 2JEIA 3J7ZT 1IVZA 4ECXA 1XR6A 2DGOA 5JVGQ 3JTPA 2IA0A 4DR6J 3MDFA 4OYXA 1QAYA 3AAWB 4RW7B 3FQKA 2IVFB 4KV8B 3C14A 2GSUA 2MQLA 1IQZA 1KEKA 3BGRB 4BDPA 2H4WB 4FVMA 4X62F 2IJRA 2XYHB 1L3UA 2W4CA 1M1KT 2COLA 1JNRB 3MM6B 4QW8A 4LR9A 1RHKB 4C8MA 1KVJA 3UCUP 1EIYB 2W4PA 4AUKA 2C2DA 4ELUA 4JI4F 3EUNA 1R6VA 1TMMA 1VQKS 5F9LA 4X4OA 3NNAA 2CQDA 4K50A 4UORA 4K0KJ 1FRMA 2K3KA 2LQBA 3PHTA 4IOAQ 2BJ9A 2BQUA 3US5A 2P2CB 2IA6A 3VZIA 1SBRA 4DV6F 4R0JA 2VQFJ 2RE1A 2H54B 2P8IA 3MCMA 5ETRA 3BGOP 4UF4A 1R89A 2EEYA 1ZAXA 2XLIA 4TKTA 4G1PA 1P9YA 2GV1A 4A8SA 2Y1JA 2CJYB 2GGPA 4GMKA 6AT1B 3DOKA 1YJUA 4GO7X 4I7FB 2MLXA 3AHPA 3B8HA 4CYRA 4OZ5A 2I8EA 3GB0A 4L73A 5D15A 2ZHBA 2O66A 5FIIA 1XNQJ 1FWLA 1RA7A 3MWBA 1GMWD 2ZKUA 3MTKA 3H40A 3PO4A 2V4JA 3KUEA 1OS5A 3MPWA 4JI6J 4UY85 1P1LA 1YJ7A 4DR7F 1TL7B 4G6VB 4Q7AA 2HFSA 4LF8F 4WKYA 1M1GA 3ENWA 2CJKA 3MOJB 4F02A 2JFKA 3J81j 2JRSA 3OVAA 3SZZA 3HVAA 5KFHA 2UUAF 1NSAA 2ZZTA 1B0TA 2UUCJ 1ZTTA 3G96A 1HKAA 1YLXA 5A8RA 2H65B 3ZZZA 1H2VZ 3WIVA 2R8GA 2C42A 4N56A 2BYCA 2FVCA 2YWFA 4F7VA 3NGTA 1XNRJ 1VLOA 3ISND 3X1LB 2EFVA 4PRFA 4RU9A 4C8ZA 1KHJA 3IXQA 5GAEU 4CP5A 3N6NA 1Y7PA 4TQRA 1L3SA 4JI8J 3W2VB 3KUHA 4MK8A 5D0GA 3B4MA 4Y2IA 4LFCJ 1JLEB 3A12A 2BJ1A 2OD6A 2YVSA 4LRDA 4ES2A 1Q8LA 2VQRA 4O4GA 2GHVC 1ULRA 2KVQE 2U1AA 3UO0A 1HWLA 4RW4A 2OJ3A 3OTBA 4WYLA 2QG9B 1REVA 2DNMA 1TR0A 2ZBQA 4M5JA 3ZZUA 2UVWA 2ACYA 2BMBA 4FXVA 2B43A 4DL5A 4DV4J 4JI0J 1S1UB 1HR0F 4UOOA 5HVHA 2MQNA 2VBWA 3EDRB 2KT3A 2QYCA 3FEXB 3V4MA 1TV6A 2Q3PA 1URRA 2KZZA 1C2PA 5E7OB 4DUYJ 5ETPA 3W66A 5HMZA 5A6WA 2CPJA 3VVUA 2XWXA 3I4PA 4LFCF 3KNGA 2Z2YB 3MMAA 1KNZA 3BR9A 4GKJF 3G8QA 4TY8B 3BSNA 5CYQB 4ZCKA 1YJ9S 1YBTA 2ZH6A 5HROA 1WACA 5KFMA 4USTA 3TQ1A 3WBHA 2B7BB 2VL1A 5BR8J 3OTCA 2VH7A 3QPIA 5E5NA 3MMCB 1V5IB 1S1XB 1HHQA 2ZM6J 3RAMA 3DLEA 4AL6A 4AT1B 2FLLA 1LNQA 1Y00A 2W2OP 2CPDA 2GQCA 4RJVA 2QX0A 1WWHA 3FZ2A 3LOUA 4RL1A 2DKOB 5T7LB 4DCPB 1HQAA 3ENAA 1JXLA 3Q2TC 4IG3B 1N0UA 3IR5B 2BOPA 1VQ7S 4DR7J 4QW9A 1VI7A 3VAMA 4CO1A 4ZVFA 2DR8A 1H7WA 4CTAB 3D0IE 2C28A 1R8AA 4ED3A 1B0VA 4ED7A 1ZAVA 4FPRA 4ZJOA 1N2LA 1TKXB 2IUCB 3TG0A 5FDLA 5KT3A 3TA2A 4RO0A 1CG2A 2BEFA 3HKWA 4N8OA 4RW9A 4WE1A 4NWXA 3TZXA 1WI6A 2CIMA 2P6SA 2VASA 3KK2B 5H9EK 1M1HA 2WK4A 4O3PA 3VVTA 4PEOA 3G6VA 1X9WA 4U8VA 4R5PB 1LXNA 3NMRA 3KLIB 2K7KA 2IYIA 3NCQA 4FF2A 5EWFA 3A52A 4B56A 3EX7B 2QA1A 1W7WA 2OD4A 4DPUA 2ZBIA 2MKIA 1GXTA 1AJBA 2E5HA 1D8ZA 2DGUA 2CPYA 1E6YB 2OHDA 4P2MA 2MEWA 4RBUA 3I0RB 1R8HA 2HLUA 1RAJA 3KXDA 1IKYA 2FGCA 2OTLS 4ED8A 2ACMA 2PIIA 1LQ9A 3W2WB 3C6TA 4DV4F 2CG8A 4F50A 1RKJA 5ETNA 1IM6A 2E7VA 2AJ1A 1SPBP 2DNPA 2C3PA 3LTOA 3MM8A 1UJ6A 2E5IA 4LQ9A 3R3TA 3IMQJ 1VQ4S 1M5KC 3TUPA 4S0MA 3MEDA 1WI8A 2PA8D 2PN6A 1UAWA 4OI6A 4TYAA 2CQCA 5DQHA 3HP6A 2ALZA 2R7SA 2DYAA 4DX7A 5KFSA 1B99A 1PJ6A 3NMAA 2GAHC 2G13A 4UQTA 4UTGA 3KWMA 4DV1F 1NM2A 4DR2J 1NK8A 1LFWA 3IS9A 1MWYA 3FGVA 3MEDB 3G2XA 5KFTA 2UXCF 1UVKA 1HBOB 1WG5A 1S1VB 5ETVA 4PUOB 1FFGB 3BYPA 4PG7A 2BJ7A 4AE5A 1P6TA 2HRYA 4ZDNA 4F4XA 2XLJA 2HEKA 4DX8H 2L41A 1AROP 4DX6A 2VC1A 3I5AA 3M2VA 5CYMA 2CUYA 1NHVA 5IWAJ 1FXLA 1GXUA 3ZXWA 4DR3J 3PYFA 5KFFA 4IQMA 4ECVA 2NQPA 3WX8A 3AD9C 5F8HA 1RT1B 2Y1LB 1Z4UA 2RKIB 2KJWA 3QAEA 4MKBA 4ZP6A 3UN3A 3MOZA 5L9XA 4B9LA 4P71A 2HMIA 3VALA 3EWGA 2Z58B 3A1YG 3DGVA 2IRXA 4YMEA 3M9NB 4B17A 1VQSA 5HRTA 2YTCA 3AODA 1FKPB 4W98A 1VRQC 2VUGA 3QIPA 3CCLS 2XY6A 2IY5B 2GVZB 1PYSB 3IDDA 4UOPA 1Q0NA 2VDIA 3PW0A 2W1BA 3MM5B 3H59A 4P75A 4U95A 4X64J 3HPOA 3BBBA 4ED5A 1AUKA 2W9CA 1FHTA 4J9QA 1FO1A 1FD8A 1H6KX 5B0AA 3BYRA 5ETTA 5ADZA 1FE4A 1S57A 1Y5LB 1Y6VA 3K2YA 1FX4A 4BWMA 3GILA 2LLZA 4F0KA 3SSRA 4ZPCA 2CPXA 3KJQB 4ZVRB 4OX6A 4ED6A 4CWBA 4IUFA 5KFKA 1NLKL 1JLCB 3PFOA 4JI4J 4YUDA 5CYJA 1LV5A 5DQIA 1RU2A 1SVDA 3DU6A 2K3IA 5IM0A 1NDCA 1S1WA 3NAIA 3OQ2A 3QO9B 1HNVA 2W01A 1GMVA 4PXDA 2CRLA 4CM0A 2R2RA 2BANA 1S9GA 1YTYA 1O8BA 2YPYA 5C24A 3H0PA 2X3GA 3PFEA 5EN1A 2FJDB 2R8JA 2JEJA 5LRNA 3R7NB 3OTOJ 1YG0A 3ETOA 4UT4A 4FDIA 3PR4A 2QL5B 2J8SA 1EW2A 3BDHA 4DHVA 1BQXA 2DH9A 2Y1RI 2V8PA 4PPDA 1BE4A 5K14A 3I0RA 5LM7E 3RZAA 2B4OA 3W62A 1HMVA 2YKNB 3R8YA 4MKAA 3JB9k 1ZETA 5K14B 1X4GA 2EKNA 1TP7A 3G86A 3KHLA 1AUDA 3DRSA 1N5SA 3HD2A 4WIQA 5AXNA 3TANA 2LQJA 2JLGA 1VJWA 3RRHA 4B9VA 1OPZA 1RWOB 4DN9A 4KHPJ 3DRRA 3SBMA 4DV1J 4DS5A 4PWDA 4JUZA 1WOPA 4LF8J 3T9NA 4LF9F 4KAYA 2I6WA 2MSSA 3N5FA 2IPOB 1TAUA 2L48A 2MJNA 3DLKA 1N6QA 4B3OA 1HMVB 4KE5A 2ATCB 1F9HA 2HFZA 5E3QA 1T9XA 2OPQB 3GJSB 2YH1A 4DWIA 4CDIA 2WONB 2G9OA 3IS9B 4ZJLA 2IBOA 3T5KA 3G9CA 3T00A 1FTRA 1KQGB 4MIWA 1AUSL 3QFWA 2DRAA 1LWXA 2KDOA 1GMWA 1G4CA 1S7IA 4GVBA 4ANCA 4OZ0A 1X0FA 2DRDA 3D4JA 4KAVA 3CCES 1U1OA 1UEKA 4ZKAA 3CNQP 5E3RA 1Y5IB 3FBCA 2CQ4A 1LOUA 3JTNA 4LJMA 4MJKA 4FNHA 1NEEA 3K5LA 3L95X 1WHWA 4KV8A 1RWXB 1KOHA 3OSNA 2KTQA 2V5HG 1KTQA 5ETSA 1VRTB 1JXEA 3ITHB 3EPGA 4NWJA 2PFDA 4EZ9A 4AL5A 3SDEA 2B5JB 5J2MB 2KYZA 5KFNA 1LK7A 3MMAB 4DLGA 4EBCA 2XTJP 4M1KA 1FT8A 2L9DA 4F4AA 2HAIA 1EETB 1Y3KA 4P2XA 2NYHA 2FJVA 3DOLA 2OGUA 4RU2A 5L1LA 2JJ4D 5EX3A 5AT1B 2HHUA 4ES3A 1UA0A 1CJUB 4ZLLA 2K1RB 1EARA 4RR5A 1IKWB 3FCWA 3JAMU 1RDRA 1OMSA 1FFWB 1FE0A 1SC3B 3I87A 4X4RA 4WXOA 1H72C 4DPWA 5IZHA 1CJKA 3MECA 4IFYA 3C16A 4UPLA 2Q6BA 4W90B 3OTOF 2LEAA 2XNQA 2J0SD 4F4YA 4NCGB 5L0BA 3MECB 4ANDA 1JKHB 2FJBB 2IC3A 4DUTA 5FLXY 4K7QA 3AFGA 1VK3A 5T7LA 1IXKA 1RT7B 2IHR1 2KXHA 3D0GE 3EZOA 4FP9A 1UZDA 4K59A 3UDVA 2DH7A 4CO0A 3CPWR 1C0TB 4OX8A 2I2YA 2OPRA 2A1BA 2WHOA 3HF5A 4GRSA 1IKYB 1SQEA 5J1NA 3D7SB 2MZ1A 1RWUA 2GA7A 5F8GA 3QAUA 3OBIA 4C8OA 3QWPA 1S9FA 3GG1A 4L74A 4DV3F 1NJYA 2R8HA 4NXMF 3MPYA 3TYTA 4ZCIA 1VGYA 4Y6IA 3HO1A 3VF0B 3NCRA 3NP5A 3CJ8A 1M0SA 1U1RA 2YY3A 3QQCD 2HFUA 4NRUA 3PHEA 2F8MA 7AT1B 1U2RA 3CCQS 1WD6A 4PWDB 3DMJB 4R5PA 3W7BA 4ZPDA 3GU0A 4F4KA 1UEUA 2M70A 1S6QA 4B3RF 3T41A 4DV2F 2CQ3A 2FVPA 2FTRA 5LSRA 4BS2A 5IJSA 1RTJB 3CTRA 5KG6A 4I0WA 1G1XA 4L3KA 3AB4B 5KFGA 3VQSA 4PUOA 1UEVA 3PYEA 2OEJA 1S6PB 5DGBA 5KOWA 1DURA 2LDIA 3KG4A 2H9ZA 4OIXA 3UI3A 2W8KA 4J9RA 1GNKA 3PO5A 1CC7A 1BY9A 2G0IA 4MIBA 4DN0A 1T3NA 4LBPA 3DLBA 4QOTA 3BB5A 5E41A 2IFYA 2E5GA 4WXWA 2JDJA 2GJFA 4YB1P 1TFWA 2F1FA 4EUVA 1BD6A 2CDRB 2HK2A 2Z2ZA 3DKDA 3L7OA 3S7RA 4IKAA 3RB4A 3I5BA 3OUYB 2QLJB 2WSFC 2GNKA 2RNEA 2KRRA 3PTWA 1IWAA 2NUHA 4G1QA 4J37A 3TARA 1L5UA 2KB2A 2Z0GA 4YB5A 3GFHA 5KG7A 3ZNUA 1LKZA 3FDSA 4Y34A 2JLFA 2ZH4A 2I0XA 3MM7A 1YWXA 3LAKA 4LBHA 1K0TA 4GTYA 3OV7A 3CD5A 3HCXA 3BGRA 3WC0A 3VGTA 2RS2A 2UVVA 5H9FK 3GONA 1EW8A 3BGUA 2DR5A 4GKKF 3MAQA 2E7XA 3G87A 4HDGA 2B5JA 5J2MA 3MCSA 2OH2A 4XDDA 1U1NA 2DGXA 1MMDA 4M5IA 4NEYA 4C3MA 3HM9A 5HLFA 1LW2B 2HMIB 1UFWA 1F3VA 4RW8B 2IMWP 2J6TA 5JUMA 3SZ2A 2HQDA 4X4NA 3CO0P 1FD2A 4KB7A 2I5JA 3JSBA 3TWZA 3FVYA 2HNDB 2KYXA 2XMTA 3HFKA 3QIPB 3OD2A 3ZTOA 4ZG7A 3LPEA 3J7YI 2BM0A 2AW0A 2EKYA 4IYQA 3TW0A 5C42A 5L46A 2MZSA 2XHWA 3CDWA 1W26A 2C2NA 1SCJB 2FJAB 4DV5J 1PBAA 1SJQA 3KK1B 2IAJA 4KTQA 3R5BA 1EW9A 2W2MP 1K0VA 4J9VA 3Q8QB 1J5EJ 1IM4A 1UKUA 2OTJS 2YQ3A 4LF6F 1KH4A 1F0XA 5IM0B 2DIUA 2XMKA 2AJ0A 3ET6A 2YH0A 1FRJA 5A8WB 1JJHA 2DD8S 4CIOA 2H3EB 1IBKF 2DVIA 2O3DA 2D1GA 3QT7A 4FS2A 1LFPA 3R1LA 3JXOA 1JNZB 3TUZC 1IJEB 1PIEA 5JMNA 1NH7A 2WSCC 4L76A 2R7WA 2G0JA 1TK8A 2OIHA 4B9SA 1EJ7L 3V5RA 1WKJA 3KMSA 1C1CA 3IWXA 1R0CB 4KGVB 2OUGA 5J1EA 2OPSB 1VJQA 3KDNA 5HO4A 1EQMA 5HBMB 4LR7A 4ZVGA 1XR7A 4JP8A 2Z30B 3KLVA 2BM1A 1Q7LB 2VG5A 5G4DA 3MZIA 1FI4A 4OLPA 2DHXA 3TUJC 1HNIB 4ZMMA 3PY8A 2YKNA 1GAOA 3IBFB 2ZBRA 3ZZTA 1T9VA 4DFKA 4IFVB 4K4XA 3THVA 4JV1A 5LQQA 4QR2A 3KUGA 5LOQA 1RTJA 3IO1A 4TLQA 1U0HB 3RUBL 2D3UA 2QC3A 3DOMB 5BYRA 3UDEA 4ENOA 1V3ZA 1N4LA 2Q43A 2LEBA 3OSPA 1SKSA 4UOCA 5KFLA 2W8SA 3UN5A 4URGA 1FESA 3D1QA 3M8QA 1QAJA 2GSOA 4MAKA 2PDAA 2ZJRQ 4KPYA 4Q8EA 2DTJA 4TN0A 1B70B 2UXBF 3WZ0A 3G8TA 4R8UA 2IM3A 2HNYB 2WW8A 1RAHB 4ALZA 5LJ3Y 1OO0B 4DR4J 4PWWA 5KG4A 1TFYA 1JLEA 4B9NA 4CXSA 3V4IA 2B9XA 1HL6A 4QIWD 1MMLA 4F36A 2ZITA 3W64A 1CJTB 2MLZA 3TVKA 4DEZA 4I64A 2Z57B 2XC9A 2Y1IA 5HANA 3G8SA 1AJCA 1S1UA 3OL8A 3C2PA 2IFXA 1WORA 1I3OB 2BKNA 2DEJA 4M5HA 4IOCQ 4ZG9A 1WC4A 3CE8A 2YNHB 2AZ1A 4XO0A 1RT3A 3RW7A 1I94J 1MMNA 3CF5Q 1AW0A 2RSQA 3EPIA 2OEMA 1XQIA 3RB3A 1NJWA 2MKSA 5LRMA 2LDYA 1PKUA 2AYBA 2JLEA 4CLKA 4YN3B 2CPHA 2R4FA 1CULB 1RBLA 1XTZA 2KL8A 3ZTQA 3JSRA 3H7HB 3MF5A 4IH7A 4LSNB 5F41A 3R7SB 1AB8A 3UNYA 5KFCA 3MR2A 4TY8A 3M9OB 3CMES 3MUVP 3H25A 1G2EA 4X62J 3OVSA 3T19A 3GE9A 2IJNA 1SJFA 1U7LA 2NSCA 1JQGA 2F4FA 5HSPA 2XMMA 3Q22A 1Y9OA 1R6YA 2D3ZA 2HWIA 3LALA 4KH1B 4PAAA 1WNEA 2MQMA 5DLTA 3MEEA 5THWA 2CQ0A 3PIPQ 2DHGA 2NLWA 2WZ1A 4FKXA 1N8RT 3FSYA 2AYGA 5FDLB 4UPIA 1RXOB 6FDRA 3H5UA 4LSLA 4Y65A 1EQ0A 2JL9A 2GFFA 3G6ES 5KFEA 1DBDA 1U4BA 1LWCA 1VFJA 1X0PA 3KJNB 5G0RA 1PYTA 3MEGA 4QYRA 4CTAA 5A6PA 1TQLA 1FRHA 2OFHX 1QVGR 3K17A 2XMAA 2HIQA 3UVJA 5IT0A 3TVYA 4KH0B 3UDCA 1A9NB 3V6KA 1S10A 2WVCA 2O1PA 4IG3A 5L0EA 3HI9A 2FY1A 1UVJA 5L8RC 3PV8A 1WOOA 2GMHA 3EVWA 4URQU 2VBZA 3TAMB 4JI3J 4ECQA 3VAKA 9RUBA 1WKLA 3UR3C 3PX0A 1U6BA 1FRXA 3GPAA 4DUYF 3M05A 4DV6J 3MEGB 2J7KA 3FK4A 1NB7A 2ASYA 3FEZA 4G1IA 8AT1B 3GV5B 3D66A 4DOZA 2POKA 4NYOA 3ZZ0A 2E66A 3NCPA 3K8VA 4USHA 3J7Z5 2O01C 2WAQD 5JXSA 1N36F 2PFFB 4OZ2A 2DY1A 5F8JA 3QGPA 4ECUA 4DR4F 2HGMA 1N34F 2ASJA 5L0KA 2W2QP 3N9UC 5LSLA 1L3TA 3LP0B 2EG2A 3JAMY 4NCAA 3ZZRA 2J7WA 3DCAA 1WC6A 4ED2A 4RNNA 2BKOA 1KQKA 3OHAA 2F4VF 4JI8F 2RQCA 1YZ6A 3EXCX 1HBNA 2BX6A 3EICA 2AJ4A 4FDFA 1HHSA 1KFDA 1KR4A 3OFEA 1CC8A 1X4HA 2B4UA 2GQQA 4NEZA 4CNYA 4K4SA 4DMZA 1YVFA 3KG1A 3W5ZA 2AKWB 3DFEA 5D0RA 2A0FB 2VG7A 4N47A 2HPUA 2ZDPA 2E1PA 1ZPVA 4DFPA 3NKNA 1TV6B 2EPIA 4Z2XA 2DPJA 1N88A 3J81U 3MM7B 3J7YU 3BR8A 2UUCF 1UTAA 3H42A 3JSMB 4I69A 1FEHA 2WW4A 1QDUB 3A3NB 1SIZA 5E0OA 4NLOA 5RUBA 4FN5A 4USKA 4DUZF 2YKMA 2KFYA 4NCBA 5J2QB 1IN0A 3BM7A 3H90A 4UW2A 4Z7CA 2HW3A 3GIKA 1P9QC 1HQEA 4DR5F 4OI2A 1HNZF 2YKPA 1YJTA 1KOOA 1SQFA 5HROB 4B9MA 1FTCA 3T5JA 4MHXA 4DQRA 4EYHB 4GC7A 4NLUA 1RWMB 5J2NB 5ETQA 3MK2A 4ID8A 2NUUG 1PJ7A 1X4AA 2Q1LA 5J2QA 1YRTA 2ZD1B 1KWMA 3CGIA 3AOBA 2DXFA 3TOQA 1CLFA 4I4BA 4LF6J 3D3CJ 3PRVA 4L75A 3UPFA 4CO5A 2KU7A 1S9EB 3E01B 4DSEA 2K2PA 1VLYA 3ONQA 4TU9A 4PR6A 4LF5F 1IWGA 1RT6B 2LXIA 2A3JA 2X7IA 3H98A 4PWUA 3ZZYA 3KLGA 2JSXA 4F3OA 5KFYA 1XMBA 4M5DA 3RJMB 3DYAB 1KLMB 1S1TA 2KT2A 4O4RA 2KHCA 5A8WA 1O98A 3X3UA 4DL6A 2HURA 3PJ9A 3N5BA 1Y10A 2C2ZB 5DDPC 1NK6A 1HBMB 3G82A 3TVZA 1VQ6S 1GX6A 2Q6CA 3TUIC 2YNGB 3CCSS 3RBEA 3CCWA 1UJ5A 3D1OA 4YS2A 4C3LA 4C8NA 4I7FA 2BANB 3TX0A 4KGZB 1XMOF 1VQLS 1SC1B 1HNVB 1VQOS 4WIIA 2DXDA 1QM9A 3PNIA 1PAEX 3NOGA 5C2GA 4K4VA 1ZEFA 1EZZB 4JI1J 4Z37A 2QFIA 3B78A 3RR8A 2ATLA 2I38A 5IWAF 1SHNA 4ID5A 4PKDB 4ZN3A 3BO3A 4B02A 1MU2A 2DNZA 2CQBA 1AA1B 2GHWA 1HW8A 3GIRA 3OTDA 1V3SA 1Q7YT 2YBVA 4OX7A 3BQ2A 4KJIA 2JNJA 4DSJA 2CDQA 1FJGJ 1A6LA 4OZ3A 4EWTA 2HRTA 5CA5A 4R8UB 4WFNQ 5GADI 1K73T 1IQTA 3J81Y 1DHMA 3HULA 1PBUA 3AXMA 2MHEA 3O44A 4HT7A 4PZVA 4U6PA 1ACMB 2RT3A 3ISNC 3OJSA 3NY0A 3Q83A 2F9JA 4DR1F 3OR1A 5LXYA 1I5OB 1ZZFA 2MQOA 2IDEA 4EI2A 1VBYA 3LP2A 1TMJA 2RHSB 4KFBB 1RQ0A 2R7OA 2BJEA 4A8KA 2OSRA 1N48A 3W65A 5HP1B 1RAEB 3FC9A 4IR1A 5KFRA 1HBUB 2JC0A 2KVIA 3JQKA 3VGSA 5F9NA 2Y9HA 3W2VA 3MXHP 1ALKA 4Q0BA 2IMOA 2KT5A 2LEPA 2N82B 2C2EA 1I1GA 4JV2A 4WP8A 1ZYQA 3RB6A 2AEMA 2HAFA 2KN4A 2HBYB 3MD1A 2YPZA 2M9KA 2XM3A 2YKAA 1RSCA 3IA0A 3HSJA 3NKPA 2YNHA 1Q95G 1CSJA 1VIOA 2Y0BB 4YFUA 4KGXB 1D9FA 2VPZB 5F8IA 4JI7F 2WTFA 1C4CA 1KTVA 2QZ8A 2CYYA 3CEDA 3FSIA 1UWBA 1T05A 3WAVA 1CJTA 3AT1B 2NXNA 3DRPB 3VV2B 2FB0A 1BLUA 2D41A 2V63A 1U0SA 3GZ7A 1J5OA 2RUSA 3WQPA 4EYIB 2B0GA 1J2VA 2DGTA 2YWWA 2NYIA 1JB0C 4PYAA 4UUWA 4ILMA 4ZA1A 3IGNA 4F4WA 3MUTP 5LL6d 2NXJA 5DDRC 3GG0A 1RTHB 2QV6A 5HMXA 3O1LA 2R8IA 3W1YC 1VQ8S 3R1HA 2RH3A 4LFAF 5DETA 1B3TA 4MFBA 4TLRA 1DTQB 1JLFB 1YITS 3ZC4A 2YNIB 1BHNA 1LW0A 3U02A 1RCXB 4CLZA 4DBQA 3OL6A 4MFBB 4P10A 4D3HA 1YJNS 1NJIT 2B4PA 3NWRA 1WJ9A 5DG7A 1FDAA 1Y4ZB 3KNAA 2V9WA 3HHKA 4QWEA 5K9FA 3KK2A 2ZH1A 2ZH9A 4DX5A 2JH3A 1DJ0A 4I6YA 1RHRB 1RTHA 1BUXA 2DGVA 3GIMA 3T3FA 2PI4A 1ZH5A 1S59A 3GP9A 3N28A 2ASDA 4DV3J 1ALJA 2H4YB 2V8GA 3TAMA 1FNMA 4X4PA 2GJ2A 2M8HA 3D9BA 4XDCA 2AQ4A 3HD1A 3GFZA 1KHVA 2Z8QA 3BEGB 4Y2AA 5F3TA 3VAFA 1R8BA 2MTLA 2HFOA 1IBLJ 1BC6A 4P73A 2ZNYA 3UVJB 1F2GA 2VFSA 2DNRA 1O0PA 3IP0A 5KFUA 2YWKA 1FWKA 1YRXA 1D1UA 2NS1B 1N5VA 3CCZA 4ZVSB 3MR5A 3I0SB 4C0HA 3WBZA 4IO9Q 4ETZA 3BGFA 5EDWA 2B4VA 5KG3A 1YJVA 2CA9A 4F3QA 3KK3A 1SJRA 1VHFA 2QL9B 4JI2J 1K8AT 4Y2MA 3MD3A 2VD3A 4M5GA 1DAXA 4HACB 3QLHB 2HQIA 3TP2A 3T1HF 2RJZA 4K2JA 2DNQA 4M5MA 4Q45A 2CWXA 3AJ2A 2FC8A 2MGZA 1VHIA 2K8GA 3ZTRA 4KO0B 1KH5A 2XSJA 1LWEB 2DT9A 2VFRA 3DMJA 4P9SA 1NAQA 3MURP 1UZHA 3NL0A 4IH5A 2R2SA 2HWTA 2P9CA 3S01A 3D1HA 2BV3A 1OQ3A 1RHQB 2HWHA 4C2MA 2O67A 3AD7C 3LQVA 1BWVA 3NEKA 4F3MA 2R7VA 2RRNA 2HKEA 2WCXA 2ZDOA 2VFUA 2XMWA 4DFMA 4DL3A 3T01A 5A2QY 4RX6A 5FJ4A 5J2PB 1R31A 1GEHA 1YQHA 3SDEB 3W8PA 3KJVB 4F4ZA 1YJWS 1ROFA 3WAYA 3O6QA 4CH1A 2GSNA 3A3PB 3LPYA 2X1AA 4X4VA 5BR8F 2ZM6F 4MK9A 4JV5F 2YNFA 1B64A 1HQEB 4TYBA 1TUWA 4L72B 4CYUA 1FNOA 4WFXA 4ZP9A 3MAAB 2W9BB 1P49A 5I3PA 5DDOC 3JYTB 4HH1A 4KKOB 3NOCA 2GO8A 4LT6A 4P74A 4ZPWR 4DQSA 1CS4A 1UL3A 2AP6A 2UXDJ 2VPXB 3CXCR 5H9EJ 3C8YA 4FYWB 5CH7B 2K7JA 3ZFVA 1J5EF 1HD1A 1GTHA 2EK6A 4KC5A 2Z4PA 2CQIA 2QLBB 3VAIA 2ZC3A 1UVIA 5DLVA 1WDTA 2AZ3A 1HR0J 4RZRA 4DZDA 1ALIA 3R5DA 5HATA 4ER8A 4DSIA 3ILIA 4EBEA 3W8GA 3U27A 4OYZA 1KN6A 2JFDA 4HLBA 2GMLA 3TR5A 4DG1B 3C66A 2XSFA 5M2RA 1ZBTA 3CC7S 1RBOB 4XAKA 3DLGB 1NK0A 2DGSA 2E1MC 2IAJB 2LKZA 2LYVA 1F6TA 3GSIA 3K5PA 1NU4A 4K8RA 2C1EB 5CZXA 1S1TB 5B08A 1ZEDA 2PMZD 5IJQA 2UV8G 3RG6A 3PZPA 2HSEB 2H5IB 1T94A 4NYPA 3W61A 1S97A 1FERA 4NI2B 5DLWA 1DARA 3HX9A 3SIPB 2ZJPQ 5CZVA 4C97A 1Q8IA 2BW2A 5FD1A 1S76D 2KRBA 2P9GA 2B9WA 2FDNA 1F5BA 4B3SJ 2CAJA 1HQ2A 5EGEA 1QTNB 1D3WA 1UP1A 1B0PA 3GYXB 1VQNS 3HKZD 2VG5B 5D4OA 2QO3A 2RDIA 4IR9A 2CJBA 1OYDA 2EXUA 5CHCB 2PMWA 5KG1A 1URBA 1VDHA 4QQBA 3SSQA 3F73A 2OPQA 2WSEC 1ELXA 4DL7A 1H2TZ 1Z2ZA 2NREA 1LXJA 1YHQS 1Q53A 3DLKB 4OHXA 2QL7B 2FJXA 3CWJA 2L3MA 3K58A 4YOEA 4K5RA 7FDRA 1G3OA 4KSEB 1GT8A 2FHKA 4X2BA 4Z7YA 3MM9A 2CZVC 5IQQA 4JI0F 3HFVA 2EW9A 1EP4A 1NDKA 1RISA 4CT9A 4JV5J 1AXQA 4CYUB 3CJ3A 5HJYA 3M6VA 3LP2B 4KFBA 2G1DA 4ZP7A 4K4WA 1FWPA 4H4MA 3UD4P 1U1MA 1D0EA 3BDPA 4DSLA 2V8VA 1QLNA 4NPOA 2MY8A 1DQ9A 3BKFA 2RQMA 5EGYA 4USJC 5K8NA 2AMCB 2HFNA 4ICLA 4DR5J 2XS5A 3Q8UA 2FQQB 2KZMA 4DR3F 1KD1T 9ATCB 2ROPA 4TU7A 3PKYA 2XY7A 2XG8A 2NXUA 3NKYA 3OR2A 2DO4A 3EE3A 1HI8A 5LXRA 1OSCA 3CDAA 2AYMA 1VRTA 5AE3A 4I2PB 2CQ1A 4TN2A 4KQZA 1TL3A 1NNDA 2DIVA 2KXFA 2EFNA 2N4DA 3DGPB 1SC6A 3PJXA 4UOHA 3I4HX 5DDQC 4O4GB 5HN0A 2E1RA 3HT3A 1S72S 1SI9A 3MAAA 3NNCA 1Q79A 3CJ2A 3QRPA 1S4FA 1KDNA 5DZ6A 3I82A 4NYZA 5IXUA 4LFBJ 1NO8A 5B09A 3DGPA 1U48A 3M8ZA 2G4BA 3IGYB 4ED1A 2G2ZA 3POTA 4GVBB 3DLLQ 1H7XA 1RT4A 5KFOA 1CJUA 3UFCX 3W60A 1QE1A 3LO3A 3POTB 1GTEA 4YP3A 3KLHA 3WIUA 4PCQA 2AHOB 3DHWC 2B7CB 3I6PA 3U1NA 4OV1A 3UD5A 2W8LA 4J9SA 1MWQA 2F9DA 5I3QA 3MFHA 1QJHA 3B4DA 1HJKA 5CYQA 5AXMA 1WG4A 5G0RB 5KOXA 2VFTA 1SV5B 2KKHA 4ZK7M 3CC2S 4HHJA 3IGZB 1Y11A 1LW0B 3VQTA 2CJQA 4U7CA 2HVZA 3PW5A 3AH6A 2QMWA 1W25A 1HNWJ 4AYBD 1DTTA 4PG5A 3OT9A 1G6BA 3CD0A 5GOVA 3AJDA 3M2RB 1NKEA 1C0TA 4BBYA 3MEKA 5SUHA 1NCLA 1CBKA 3EDQB 1UPPA 1QAIA 2YNIA 3TEHB 3IR7B 3E8OA 4O23A 1LEOA 3K5OA 4ETXA 2IBKA 5LMUJ 2HBRB 3T5HA 3M2UB 2A18A 3W63A 4FYXB 4MH8A 3HDSA 2FLOA 1RTDB 4JYAF 1BXNA 1NBEB 2B6AA 2RQ4A 4FF4A 4WF9Q 3NKOA 1XMQF 3R5CA 1SH0A 1K7HA 1F5CA 4FKYA 4NRTA 4DR1J 4RW9B 2M8DB 2ZE2B 3I32A 5B0FA 4WFYA 4RUCA 1R27B 1QTMA 4DR6F 2JVOA 5GVQA 3WHIA 4LR8A 1RTIA 3AY0A 2HVDA 3S8SA 4KJGA 2J9DE 2FZCB 1RWNB 5C25B 3K89A 3C6UB 3M30A 4NMLA 3KYLA 1VQMS 5BYQA 1SJ3P 1KHNA 1JXVA 3V81B 2MKJA 1FRIA 4U8YA 2ZC4A 4BLGA 2YKMB 4X4UA 3CULA 3ZTSA 3MPVA 4ED0A 1T03B 3C46A 2PE8A 3HHEA 5J2PA 2A2CA 5E3CA 3JSMA 3Q24A 4LRAA 1IBMJ 1U09A 1X4BA 1A0OB 2FC9A 3GLJA 3OXLA 4J7CA 4TNOA 3GR1A 2MZTA 2YXLA 3I96A 4RWXA 2XMUA 2DK2A 2HG4A 4OI3A 3UCGA 2H5JB 1RHJB 2E9RX 3J80U 3PVXA 2LP4A 1VBXA 1HWIA 3SCKE 2B8PA 2HIYA 2L9WA 1H2UX 2N7YA 2RKIA 4KYZA 4A47A 4F67A 2UUBF 4CQ1A 1L3VA 2AX0A 4CLSA 1FVQA 1XWLA 3PKMA 4N77A 1GX5A 2CJXB 4WTYA 2A10A 2AEFA 5GAHI 2MXYA 1HPZA 1QUVA 4C48A 5KT5A 2VU5A 1SUQA 2RQKA 2QEXS 2IM0A 3D3BJ 2ZOGA 2ZUGA 1TKZA 3BDGB 3QZ8A 2NZCA 2M52A 2BE9B 3QT8A 3Q8SB 1JLAB 1RABB 3KJVA 2EK1A 3PX4A 2IYGA 1S9EA 1Q1KA 3E01A 3OL9A 4DV7J 4NLQA 3NVLA 4D3GA 4Q8FA 1KVKA 1JLAA 2XGPA 1FX2A 2YX1A 4K0KF 2RIJA 2ZD1A 2EFQA 2GVZA 2ZEJA 5L1KA 1NK4A 1ED9A 1XN9A 1S1XA 1TU0B 1UFKA 2U2FA 1EX8A 2Y0SD 2CPFA 3OFHA 2JEFA 4N5SA 1OIAA 1S7HA 2MZRA 3LWMA 1CJKB 2CFXA 3A3OB 4FZVA 1RHUB 2C2MB 2QSFA 2F8EX 3EYZA 3UN2A 1RWPB 2PT0A 4HHHA 3IN5A 4PQUA 1W2BR 1PJ5A 5JVHQ 1YBUA 2CQPA 2OSQA 2RMLA 3CMQA 4USIA 1B7YB 3K57A 4QCLA 3C15B 3ILLA 1EKSA 2QZUA 4ZG6A 2LXFA 1FFSB 4DFJA 2OPPA 1WC5A 3S6EA 3HHLC 2LA4A 3U1LA 5C42B 2DJWA 1GH8A 1NK9A 1UVMA 2YNGA 4MKYA 2X51A 4WK1A 1EJJA 2QJ3A 3CW2C 4YB6A 2HGNA 3UQSA 3MMJA 4X84A 4F0MA 1UETA 4J9LA 4ZPAA 4NWBA 3P6YC 2XS7A 3PRDA 1XEZA 2GS8A 4DDFA 3SEOA 3Q8VA 5SZTA 3JQMA 3AB2B 2XULA 3DU5A 1B4SA 1SL2A 4JI7J 3P5BP 2BVZA 1JJ4A 3F56A 1FJEB 4MY4A 1RA6A 2EWHA 4ID5B 4KHRA 4WFBQ 2E1CA 5CQGA 5C24B 5KFBA 1IR2A 1T7PA 3CJKA 2MZQA 5DS7A 5D6GA 1C1CB 1URNA 3MM8B 3TAPA 2HZVA 2HHHF 1TK0A 1X4CA 2H48B 2FD2A 1AJAA 2VDHA 1ZAWA 1FXDA 2JWNA 3RRGA 1RYRA 4ZLNA 4Q0BB 2HS3A 2PEBA 4X4TA 4R25A 1EI6A 1NUEA 4QWAA 3G4SS 1UA1A 1OSDA 1SKWA 2KG1A 2W7OA 2DNYA 2P9EA 4B3OB 1O6XA 2VZ9A 3Q0AA 3MI7X 5IC4B 3NS5A 1RT1A 5H1SV 4I2PA 3TX8A 2CWKA 2E1AA 2BE7D 5D4PA 4RBVA 4B3MF 1ZM3A 2AF6A 5IFMA 1FNXH 3EXYA 1VK8A 2VHGA 2QTWA 3R97A 3OJUA 2N3OA 5HVFA 1YGYA 3QMQA 2AWZA 1XC9A 2MYFA 2D9PA 1K1SA 2RF2B 3WX4A 4CNZA 4H4MB 3ITHA 1X4EA 1GQEA 2RUGA 1X8DA 2FZGB 3RU0A 5HQMA 5TJ3A 2JVRA 2OKQA 4K2XA 3NKMA 5IC6B 4C0OC 2LECA 2I1RA 1IBMF 4EK2A 4Q44A 4OX9F 3TA0A 2V0NA 4UOGA 4CRJA 1AFIA 3JQJA 1RTZA 2DH8A 1FVSA 3A8EA 3S1TA 1ALHA 1N54B 4QJVA 2FHOB 4WPAA 2GGPB 2MKYA 1MROA 1KFSA 1YKWA 4OZNA 3HJVA 3N01A 4QPTA 3QT6A 4KIAA 2R2TA 1JLQB 3L7PA 2ZH2A 1IBKJ 4CH7A 4LFBF 1HYSA 3QIDA 4PQAA 1I6JA 3L9ZA 4GVLA 4ZHRB 1TAQA 3TJAA 1WEYA 2XLKA 2KHDA 3E2EA 1F3FA 1X5PA 1HQUB 1DLOB 2VQFF 1TKDA 1ZOTA 4N8NA 4TY9A 4NLPA 1PC5A 1Q5YA 1NRKA 1K44A 4ZIWA 1JJ2R 1MNEA 1PC4A 1YBAA 1NKBA 4YEAA 5LJ5Y 3RAXA 1D9DA 3M8YA 4AXJA 4NOHA 2CXEA 3NRBA 3DRSB 1CJVB 3NWGA 1NDLA 2XQCA 1VOMA 2GO9A 2DGQA 4IFVA 4OJHA 1SH3A 4URSA 4ZVEA 3GV8B 1Y0HA 2WOMB 3UNGC 1RTDA 3UDLA 3TZWA 3LP1B 2M3DA 3QBCA 3SFGA 1P8GA 1GFWB 2CZ4A 2XI3A 4AD6A 4WZQA 1WUUA 1OY6A 1U2FA 3CDEA 3MPDA 1KLNA 2BBEA 2W5XA 5HQLA 1C1BB 2ERRA 1ELZA 2F63A 1R3NA 1WSVA 1ZM2A 3MFIA 3J7AN 1JLGA 1R8PA 4DCOB 3KK3B 1HNXJ 1RLCL 1RT5B 4Y2KA 1PILA 3NGDA 4O0IA 3L3CA 4QWCA 1B8JA 3QT5A 2VONA 2CZ9A 2VBYA 2GC8A 2IJFA 5D4LA 3T6BA 4ZN1A 5C5JA 2AJFE 4YR0A 3NG8A 4CXUA 1WC0A 2O5DA 4MYTA 3R5GA 4NLWA 1C1BA 5B7WA 1VQYA 3GV7B 2XB2D 2RB7A 5LIAA 2SXLA 1UWAA 1WHVA 3CJSA 2X1FA 3R2DJ 3QGGA 2IVYA 2M5YA 3PYDA 2UUAJ 2EFOA 5HJXA 4LF4F 3W3SA 5C66A 5BXIA 4USUA 2MZJA 1ZM4A 1NH8A 4U96A 1FK9A 2N3LA 3NLCA 5DJBA 2VB6A 4DPTA 1RWKB 2FUG9 1U1QA 3SV4A 3BKTA 2BR0A 2MPUA 5KG0A 1U45A 4V19X 4PG4A 4HDHA 3DXBA 4OV6A 3FZBA 1N2KA 1NMEB 3NS6A 4A46A 4OYBA 1H3DA 3H2VE 1PGZA 3IWNC 1ZEBA 5E2QA 1LW2A 4H4OB 1T03A 2J6SA 4H4OA 4UPKA 2DBBA 1YSJA 3J80Y 5IOLA 3SQOP 3CCJS 3WDOA 3KLEB 1JWWA 2C3YA 1X5TA 2UXBJ 3HHNB 1KKHA 3M2VB 3KLHB 2H1YA 2BE2A 4EFAC 3KLGB 2C22A 1QSYA 2F5GA 2DR7A 3B54A 4JI5F 3U1MA 4FVCA 3LGMA 1RAGB 3CJ4A 4IDKB 2XS2A 2CQGA 1M5SA 1T02A 2JOQA 1T95A 5HK4A 4PQUB 1F5AA 3TZZA 4GTWA 3A13A 5GMDA 1VCTA 1JLBB 1VRUB 2ZOMA 1ZA2B 3IAS9 2GHPA 4WFAQ 3VAJA 4ZP8A 3VZHA 3O5TB 4RNMA 3FFIA 5M2PA 2R7UA 4WWSA 3WC2A 1OY9A 4NZ7A 1U25A 3GWCA 2AU0A 3QNWB 2HVEA 2W2PP 5LT5A 2ILYA 5IT9U 3FSXA 5U47A 3Q89A 1VC5A 1ZTWA 2MQ8A 5J1EB 1RJJA 5ITHA 2IRUA 2OMLA 3N6MA 4EZ6A 3J7A1 4IDKA 1RAOA 2HHSA 2W5SA 2MMYA 2OAUA 5EWEA 3GR0A 4OZLA 1AT1B 3MK1A 3DI6B 2VA2A 3PX6A 4YHHJ 4K4TA 3C3LA 4NZ0A 2E5LJ 2RILA 3EM1A 5BJRA 4WZMA 1IKVA 3DM2B 2J8AA 2OLWA 3MCOA 4HEA9 3I55S 1HNXF 2QLXA 3PCOB 3BQ1A 2JX2A 4I2QB 4QIVA 4RBTA 3CCUS 4M94A 1HW9A 3I9ZA 4Q2MA 3TQEA 4OFZA 4XPEA 2GVDA 2W7AA 1VQPS 4ZPVR 2FY8A 2ROEA 4N76A 5K8MA 2W9AA 2DO0A 4O3SA 2BA9A 1OQ6A 4JI2F 1FEEA 2DNOA 1TZ0A 3HJFA 1RTIB 4U7UK 3KLFB 2PC6A 3D5MA 2OPSA 3EZUA 4XTTA 3V2UC 5KT6A 4JYAJ 5IT9Y 1U6ZA 3IGVA 5F3ZA 4LF1A 2G2OA 1ZA1B 4ED4A 1FCAA 1YJRA 1S0VA 2BZ2A 4DI6A 3H4BA 4NA1A 4FXWA 2X1BA 1TKTA 2DY9A 5E3PA 1RP5A 1X60A 4QYZK 1IBLF 4CZCA 2E9TA 1MN7A 4DS4A 3V4IB 1RT2A 1AJDA 4RW7A 1RYSA 2EC0A 3BPSP 2MSTA 1B7FA 3IC1A 3EGWB 4DV5F 1T05B 2XMVA 3H2UB 2VODA 2FJWA 3JS9A 3MMBA 4CLFA 3KG0A 3BDEA 3MM6A 2C3MA 2KFNA 2BKPA 2HGLA 5CD4A 5KFIA 3VAGA 4KT0C 3HT0A 1CPZA 2A6OA 2W9BA 4FBUA 2HNDA 1HFEL 3QSIA 4ES1A 3DN9A 4O3OA 1KHWA 1HPZB 2AJ2A 4P7VA 3PACA 4DPOA 5EX0A 4LIWA 1N5YB 5EGHA 3HLUA 1U1LA 1T0TV 2RU9A 5HP1A 2YWHA 3V6JA 1CEZA 3DYAA 4HL9A 2V34A 1OY8A 2BQRA 2R9LA 4QBUA 1CQMA 3R2CJ 2AIRB 2PO4A 5DZ7A 1YI2S 2V9KA 2FHMA 4RKUC 2CNKB 1QUPA 1RT3B 3GFXA 5J1PA 3MAHA 3SSSA 2QSWA 2M88A 2V94A 4QR0A 3EGNA 2YX7A 3CDBA 4DG1A 2CJ9A 3NAHA 5B0BA 3Q86A 4I56A 4FBTA 2Y8WA 3KOAA 4ZCMA 2AV5A 3E51A 4B08A 1R7IA 2DB1A 1JKHA 4O0NA 4DV0F 3EVMA 2BRKA 5K8OA 3VCDA 3UR0A 2KG0A 4DV7F 1IUJA 3T1YJ 4DPXA 3RAQA 3QJPA 2QGFB 3C16B 2QA4S 4NLSA 4RNHA 4RW6A 3IFEA 3AOCA 1UW9A 3GCWP 4DV2J 1DFDA 2K1RA 3FRZA 3EZ5A 1PYOB 2FIUA 2XNRA 2UXDF 3CVKA 3PRBA 1N33J 1JK9B 5EWGA 2G1HA 4ILRA 2HK3A 1RWVB 3B82A 5DM6Q 1TL1A 3M1VA 3MR7A 4C7QA 4CO3A 4F25A 2VC0A 1H73A 2WBRA 3M2UA 1M5PC 1TL7A 2HHQA 1HLWA 2BABA 3F0NA 4Y3CA 1N6QB 1SXLA 3HVRA 4OJ1A 2NXEA 3LP1A 3LF0A 2HYIB 4GO5X 4OI4A 1Q5VA 4WU2A 4A8XA 3KLIA 3FJ2A 3KLFA 2LCWA 4OYWA 3QLHA 2KI2A 5KT4A 1IKXA 1F9FA 1NPRA 2FHJD 2DHHA 2VG6B 4A8QA 1U1KA 3HMJG 4ERDA 4LF4J 4MIVA 4KHPF 1MLAA 2XCPA 3CCVS 2Q66A 3BH7B 3BS9A 4A8OA 3I0SA 2HHVA 1NHKL 3OFFA 3QGHA 1KC8T 1S4EA 3LA0A 5AJ3F 3O2IA 3Q8YA 4CO4A 1LWFB 4RW4B 3D6FB 3V6DB 1QSSA 4B9UA 4J9KA 1RAFB 2NZ4A 2DISA 4LF7F 2GCFA 2HS0A 2JHEA 1APSA 5I3UA 1RI7A 2DHAA 5CYMB 3THTA 1TVRB 1LWFA 1Q82T 2UP1A 3FRYA 3VHQA 2PA3A 3QRQA 2ADCA 2BUNA 1TVRA 2PSZA 4OYMA 1VC0A 2HFVA 4UUXA 3P96A 3DLEB 5H9FJ 1IBCB 4J9UE 2W8DA 2NR0A 5D0EA 3IRWP 2ASLA 1SUQB 1I51B 2CPIA 2XYGB 2BQ3A 3D28A 3KLEA 1PCAA 2R7QA 2CVIA 3BSCA 4KPCA 4ZGAA 3CC4S 1ELOA 1IKWA 3SCLE 5HMYA 2AGOA 3HVWA 2J7UA 2ROGA 6FD1A 5KFDA 3MEEB 1MW7A 4Y28C 1DQ8A 5ETOA 1PO6A 4WJBA 5ETMA 5A8KB 5JJBA 2UVUA 1UVLA 1NK5A 2V2KA 3I9V9 4USMA 5DQGA 2HZCA 2CG4A 3PG9A 2VOOA 4I67A 2APOA 2B51A 2W24A 2XCAA 2YQ0A 2BE2B 3BBFA 1Y3JA 3DHXA 4H4KC 4I6WA 3LUYA 2Z2MA 2GLQA 5A0YA 3OXFA 4AFFA 2F3JA 2FJEB 4A8WA 3H20A 4HYKA 2EI5A 3M8WA 3UW1A 4WCEQ 1S1WB 5B0DA 4UY8T 4NCGA 1NDPA 2UZAA 4P2SA 3FFIB 1RAIB 3R7BB 4YHHF 5F0WA 1Q86T 3NGRA 4OLOA 1FSUA 1N32J 2ZKTA 2VQEJ 2XR9A 2D69A 1VQ9S 4HR2A 1ANIA 1U2CA 3RR7A 2ZZNA 2YQ1A 3B6BA 1G7CB 4KGMA 5KFQA 4AQYJ 3DNCA 4ZPTR 4EMDA 4QIGA 1T11A 3LGHA 4PXCA 4NI2A 4OZ1A 3DDIA 3VGVA 2J0QD 2IUCA 3HSGA 4B3SF 1JLCA 5I42B 1HI1A 5HI7A 1KQFB 1UVNA 4E8UA 3ET6B 2Y8YA 4OJ3A 1O99A 1MU2B 1K47A 1Q16B 2JZ5A 4MIAA 2C2RA 1KH7A 3SYZA 3MHYA 1HIYA 1ELYA 3HSZA 2ZH7A 3IM8A 3VR1A 4N41A 1S6PA 3DRYA 1JJCB 3H8YA 4U67Q 4JI6F 2CPEA 3CJ0A 2KM8B 2V4QA 4P52A 3T1HJ 1QAXA 1NK7A 2V4JB 1SJ4P 1N34J 1LWEA 2ZBCA 4C4WA 2V69A 1HWUA 3T6JA 1Q8KA 3EGVA 5AJ9A 1RADB 3CJQA 2DITA 3W2WA 3LP0A 4B3RJ 1PSDA 5F8LA 4A8MP 1M5OC 3PYGA 1T3OA 3P45B 8RUCA 1BQMA 4F26A 2X98A 5CXTA 1D09B 3R5JB 3CD7A 3BO2A 1U1PA 5GRRA 3P49B 4LQ3A 2OI2A 2XHCA 2XSJB 1E1ZP 4FPIA 1EP4B 3JSYA 2FYXA 4C0BA 3TI0A 1KBRA 1SH2A 1SKUB 1N0VC 2J9EA 4USVA 3R9LA 2UVRA 2V4RA 3R27A 3Q8RB 3A8IA 1S79A 2KO1A 2PEHA 3QRRA 3OLBA 1S1VA 1RCOB 1UJ4A 4LRFA 2J6UA 4RWWA 3AD8C 4TU8A 3JYTA 5KFXA 3TO8A 2XBPA 3DRPA 4M63A 4AL7A 4YY3F 3QATA 4K4UA 4IG0B 2GIRA 3HZGA 3TJ9A 5L1IA 4DZ6A 3N0VA 5CD4H 4LREA 3T02A 3D0HE 3QYYA 1N5TA 3MM5A 5A2QU 4C9DA 2VPWB 1U47A 4JI1F 4M95A 2OFGX 3E3XA 3KHHA 1LK5A 1O5JA 1WKKA 4ICLB 5IQ6A 2G9YA 2W5QA 1Z2LA 3GMGA 3CSKA 3LW5C 3CJ5A 1GXLA 3NGUA 3TNVA 5IV3A 1RWWB 2VKRA 5IT4A 2LQ5A 1R0AB 1TELA 2VOPA 3SZYA 4NLYA 4E2FB 4IH6A 2EBEA 2XO6A 1WC1A 5INHA 4F2RA 2J0WA 1TL4A 2QRRA 3NXZA 4JI5J 1U8SA 5F0UA 3T5LA 3EJMA 5D3GB 3A4TA 3ELHA 1CJVA 1L3KA 4MK7A 4B9TA 4HT5A 2QA2A 1WHYA 2CKWA 2RD5C 3ENVA 4WE1B 2VA3A 3CD6S 3SXLA 1JMTA 2B3TB 3DRXA 3OXGA 1T9UA 1T9WA 4HI1A 3T1AA 3CMAS 3DOKB 2FVRA 4V19J 4ECSA 2EVZA 3ZNJ1 3PR5B 1JIHA 4RW6B 3SV3A 1XNRF 1VMBA 1HQUA 4QPXA 4QYZJ 4OQJA 4DQIA 2NCKL 2ZH8A 4N7TA 4USWA 2GVDB 2B6AB 5DG9A 1HWKA 1CQNA 4X4SA 3GIIA 1E33P 2IIHA 1SJ1A 2RRBA 3HHLB 1BMQB 4DUZJ 4NXNF 5HQ8A 3QWUA 3EGZA 2XZDB 1OPIA 4IRKA 3C6TB 2EC2A 3OPKA 3OLAA 2WOMA 2AGQA 2V6AA 2MGZB 1S6QB 3LANA 4PYDA 3BZQA 3M2RA 1HBUA 2M7SA 4ZIVA 5BYSA 1U0HA 3RBXA 2W4DA 4LUBA 1O51A 2J0XA 2J9CA 2V8DA 2UUTA 1SC4B 1FK9B 4L3NA 3FUYA 1KVIA 3HHLA 3K8WA 1QY7A 1HBNB 1NPPA 3HK2A 1S49A 2YX4A 5IV4A 3KJFB 2KXNB 4ZPBA 2D1CA 2HVHA 1EAYC 3AA9A 3ILOA 4IO1A 2FPHX 1UWBB 1HA1A 1A7GE 1YDLA 2DNKA 2HLTA 2UUWA 3FMWA 3M7VA 4B3MJ 1RBAA 3A8JA 1M90T 3IM9A 2RRAA 2LU2A 2A2DA 4YQWA 4NMXA 4CLUA 3BF4A 2FVSA 5T41A 3DLJA 4J9PA 3RBDA 4JBCA 1AZSB 3D68A 2R3VA 5DGAA 4YDDB 3D67A 3BDFA 4ZLJA 1I94F 1KONA 4WP9A 2GMJA 3O3LA 2HQGA 4CH0S 3BPDA 4DU7A 1J27A 4OMFG 5KT7A 1AZSA 2CVEA 2XMJA 1T8EA 4PG6A 1MROB 5AXLA 2BRLA 2P6TA 4C11B 1AYEA 5HVGA 1K9MT 4LF5J 5D3GA 1F9EB 2IVMA 3R5AA 1TTHB 1Y5NB 5HMWA 3MGJA 3K0JA 2B8QA 4JI3F 4QWDA 4KRWA 1KLMA 2BJ8A 1VYAA 1URAA 2B9YA 3D6MB 1RACB 4H54A 4O3NA 3RB0A 3QGIA 4F0HA 2GAGC 2BW7A 2IM2A 3LH2S 1WOSA 3BQ0A 4LVOP 1MG7A 5AE1A 3A8KA 3NGKA 3CCMS 4DL2A 4EEYA 2RAQA 4WKRA 1TKXA 4HHUA 4YR1A 3H5YA 1DTQA 1JLFA 1ITPA 2D3O1 2Z2LA 2DXEA 2E7WA 4NLTA 5F8NA 3IRXB 4RUBA 3OW2R 1VC6A 5L1JA 2OO4A 5AJ3J 3Q8PB 1VBZA 1RAAB 1BQNB 2N4CA 4OI1A 1S9GB 2XO7A 4J5OA 5GAGI 1WG1A 2BDPA 4KM4A 4C8LA 2C3UA 4WBFA 1AFJA 1N5QA 2IDLA 2X3DA 2MJUA 3F41A 1RLDA 1WEXA 3TA1A 5CAAA 2RU3A 2XRGA 1S6OA 3PXGa 3IAM9 2DNGA 2XZTB 4C6AA 4GC6A 4JOUA 3NNHA 3AA8A 2HS4A 3P3DA 4Y0FA 1S0MA 1XR5A 3U7JA 4CLLA 4J9OA 4PABA 3CJKB 2AX1A 1Z1ZA 5AE2A 1BQMB 4CCHA 1U8WA 2C2KB 1DZ5A 1IR1A 3OR1B 4NLRA 1QSLA 2MKHA 1Q8BA 3M32A 4X66J 1RE1B 2AJQA 4P2FA 1JX4A 2VJVA 4ELTA 4ZCLA 2QT7A 2JEGA 2ABYA 3BO4A 1F1BB 3HVTB 4MMOA 3BGLA 4O44A 4ECTA 2HNZA 4LR2A 2HNYA 3N79A 2MB0B 3LXQA 2MKCA 4J9NA 4WFZA 1S48A 2F40A 3C6UA 3O8WA 4O44B 5D78A 5KFZA 2B9EA 2W5RA 3KMQA 4LMZA 4RPFA 3R6LB 1RB0A 1YX2A 3M8RA 1SQGA 2E44A 2HHXA 1T9TA 4DV0J 4AQYF 3M32B 4IQXA 3M4XA 3MR6A 1V3RA 2I5JB 2EBGA 2OMOA 3C19A 1NXIA 2CQ2A 1HDHA 1REVB 4ZVTB 2LQ9A 4UZBA 4LSNA 1CS4B 3HZEA 3L7UA 5K20B 3G6YA 3H2LA 2LA6A 4UOFA 3ILJA 5CABA 1J5OB 4G3IA 3BDGA 2QA4G 1F60B 1KS2A 2CADA 3R6GB 3T9ZA 4EU0A 4X65F 4Q43A 3UCZP 1S99A 4A48A 2PMHA 4ZVPB 4DSFA 3QJJA 4BC7A 4A8FA 2LU1A 1JLQA 4NA3A 2RVJA 2W9CB 1HYSB 3PW7A 4OZJA 2CJAA 5ETKA 3ENQA 4ZOSA 3ZZOA 3MK0A 2QMUB 3CB4A 4MYUA 5A0YB 2OP5A 4CO2A 4F04B 1TKZB 4M5DB 4A8YA 1XMQJ 5DRKA 1FRLA 2AYEA 1VIXA 1X4DA 3AOAA 2G2YA 5B0EA 4M5KA 5KFWA 1MSWD 5EHHA 2C3OA
chains in the Genus database with same CATH topology
1N2KA 4B56A 4UPHA 1ZEBA 3T00A 4LRCA 3TWZA 1P49A 1AJAA 4ZG7A 1AJBA 5AJ9A 3OT9A 5GOVA 3A52A 4UPKA 3BDFA 4LR2A 2ANHA 2X98A 1EI6A 4KAVA 1KH9A 1EW9A 1ALKA 5GRRA 1KH4A 1E1ZP 1KH5A 5DLVA 3NKPA 1ALIA 4GTWA 3NKOA 2D1GA 4UORA 5L0KA 4CYRA 4NWJA 1K7HA 1URAA 4LQYA 3WAVA 5K4PA 3WAWA 4YR1A 4LRFA 1ZEDA 4LR8A 5IJQA 3KD8A 5DLWA 5TJ3A 4LR7A 4MIVA 3NKMA 4KJGA 3SZZA 2W5WA 3NKNA 2W5SA 1E3CP 4LRBA 2W5VA 3Q3QA 1KHNA 5EGEA 3MK1A 1ALHA 4LREA 3T02A 1ED8A 4KM4A 4UPLA 5LQQA 1KHLA 4CYSA 5L0BA 1KHJA 4KJDA 4LRAA 3UN3A 2XRGA 3B5QA 1URBA 2G9YA 3ED4A 2W8SA 1ELXA 4CXKA 3UN5A 3CMRA 2GSOA 3NKQA 4MHXA 3SZYA 4LRDA 4FDJA 4TN0A 5HRTA 2VQRA 3MK2A 4GTXA 5INHA 3E2DA 2GA3A 3UO0A 2W8DA 4UOPA 3IDDA 1ALJA 1AUKA 1FSUA 4QAXA 4CXSA 4UOOA 4ZGAA 1Y6VA 3M8YA 1ANJA 5KXAA 1AJCA 3BDGB 4MY4A 3WAXA 4ZG9A 3NVLA 1AJDA 1O98A 1SHQA 3NKRA 4GTZA 2RH6A 5IJSA 3LXQA 1ED9A 3DPCA 2W5TA 2GLQA 5LRMA 2W5XA 4N7TA 2W5RA 1E2SP 1ELZA 1E33P 3WBHA 5LRNA 3M8WA 1KHKA 3UN2A 3UNYA 2W5QA 3TX0A 3DYCA 4FDIA 1EW2A 2IFYA 3BDHA 2QZUA 1ZEFA 4ZG6A 1HDHA 2ZKTA 1B8JA 2XR9A 1HQAA 5EGHA 3M8ZA 1SHNA 3IGYB 1ANIA 3BDGA 1Y7AA 4CXUA 1EQJA 1EJJA 5DLTA 5LIAA 4UPIA 2IUCA 4GTYA 5C66A 1N2LA 2IUCB 4KAYA 1EW8A 1O99A 3MK0A 3T01A 3TG0A 1KH7A 2GSUA 1HJKA 4NWXA 1ELYA 3M7VA 3WAYA 3IGZB 5L0EA 2GSNA 4LR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2K A;  4B56 A;  4UPH A;  1ZEB A;  3T00 A;  4LRC A;  3TWZ A;  1P49 A;  1AJA A;  4ZG7 A;  1AJB A;  5AJ9 A;  3OT9 A;  5GOV A;  3A52 A;  4UPK A;  3BDF A;  4LR2 A;  2ANH A;  2X98 A;  1EI6 A;  4KAV A;  1KH9 A;  1EW9 A;  1ALK A;  5GRR A;  1KH4 A;  1E1Z P;  1KH5 A;  5DLV A;  3NKP A;  1ALI A;  4GTW A;  3NKO A;  2D1G A;  4UOR A;  5L0K A;  4CYR A;  4NWJ A;  1K7H A;  1URA A;  4LQY A;  3WAV A;  5K4P A;  3WAW A;  4YR1 A;  4LRF A;  1ZED A;  4LR8 A;  5IJQ A;  3KD8 A;  5DLW A;  5TJ3 A;  4LR7 A;  4MIV A;  3NKM A;  4KJG A;  3SZZ A;  2W5W A;  3NKN A;  2W5S A;  1E3C P;  4LRB A;  2W5V A;  3Q3Q A;  1KHN A;  5EGE A;  3MK1 A;  1ALH A;  4LRE A;  3T02 A;  1ED8 A;  4KM4 A;  4UPL A;  5LQQ A;  1KHL A;  4CYS A;  5L0B A;  1KHJ A;  4KJD A;  4LRA A;  3UN3 A;  2XRG A;  3B5Q A;  1URB A;  2G9Y A;  3ED4 A;  2W8S A;  1ELX A;  4CXK A;  3UN5 A;  3CMR A;  2GSO A;  3NKQ A;  4MHX A;  3SZY A;  4LRD A;  4FDJ A;  4TN0 A;  5HRT A;  2VQR A;  3MK2 A;  4GTX A;  5INH A;  3E2D A;  2GA3 A;  3UO0 A;  2W8D A;  4UOP A;  3IDD A;  1ALJ A;  1AUK A;  1FSU A;  4QAX A;  4CXS A;  4UOO A;  4ZGA A;  1Y6V A;  3M8Y A;  1ANJ A;  5KXA A;  1AJC A;  3BDG B;  4MY4 A;  3WAX A;  4ZG9 A;  3NVL A;  1AJD A;  1O98 A;  1SHQ A;  3NKR A;  4GTZ A;  2RH6 A;  5IJS A;  3LXQ A;  1ED9 A;  3DPC A;  2W5T A;  2GLQ A;  5LRM A;  2W5X A;  4N7T A;  2W5R A;  1E2S P;  1ELZ A;  1E33 P;  3WBH A;  5LRN A;  3M8W A;  1KHK A;  3UN2 A;  3UNY A;  2W5Q A;  3TX0 A;  3DYC A;  4FDI A;  1EW2 A;  2IFY A;  3BDH A;  2QZU A;  1ZEF A;  4ZG6 A;  1HDH A;  2ZKT A;  1B8J A;  2XR9 A;  1HQA A;  5EGH A;  3M8Z A;  1SHN A;  3IGY B;  1ANI A;  3BDG A;  1Y7A A;  4CXU A;  1EQJ A;  1EJJ A;  5DLT A;  5LIA A;  4UPI A;  2IUC A;  4GTY A;  5C66 A;  1N2L A;  2IUC B;  4KAY A;  1EW8 A;  1O99 A;  3MK0 A;  3T01 A;  3TG0 A;  1KH7 A;  2GSU A;  1HJK A;  4NWX A;  1ELY A;  3M7V A;  3WAY A;  3IGZ B;  5L0E A;  2GSN A;  4LR9 A; 
#chains in the Genus database with same CATH topology
 4X66 F;  2GZO A;  2VKZ G;  4LRC A;  2BOA A;  3VWS A;  3H4D A;  1WF1 A;  1SV5 A;  2VF3 A;  1DLO A;  1C0U A;  1RKI A;  4E98 A;  3TZY A;  3Q23 A;  1H38 A;  4LBI A;  2HVI A;  1WTF A;  1X5O A;  2KFZ A;  1X4F A;  1FF2 A;  2PI5 A;  2D9O A;  2KJV A;  3IWL A;  1KH9 A;  3DI6 A;  4FS1 A;  3FCH A;  3NBP B;  4C8K A;  5KT2 A;  2DRB A;  3M6U A;  3C15 A;  3TEG A;  4WP3 A;  5HBM A;  3SCI E;  5GME A;  3DLH A;  1U26 A;  4AXI A;  4BWJ A;  2R7T A;  1S5Z A;  4DL4 A;  2B56 A;  3BSO A;  2LQ8 A;  3W5X A;  2QE5 A;  4K4Z A;  4PXE A;  3Q2S C;  3D2W A;  2N7C A;  4YDX A;  1N32 F;  3IG1 B;  3GYN A;  1MN9 A;  1SIW B;  1VBK A;  4JB8 B;  4LFA J;  4QWB A;  4DCJ B;  2BJ3 A;  4RNF A;  3GQC A;  3ICL A;  2MQP A;  3K5N A;  1NJZ A;  4CT8 A;  2RHQ B;  5L9N A;  1FKO A;  1NJX A;  2OPR B;  5D8H B;  4PXB A;  2FLN A;  3FCV A;  3K5M A;  4BC9 A;  1Q81 T;  4W92 B;  4U7U D;  4ZVO B;  3OHB A;  2ZUA A;  1NB2 A;  3FBF A;  3CCR S;  1NSK L;  5LMN F;  4J91 A;  4DF4 A;  1FJG F;  1MWZ A;  2NSB A;  4OHV A;  3M8S A;  3Q3Q A;  2OEK A;  3MR3 A;  2WRM A;  1IKX B;  2VG6 A;  2CQH A;  3DRR B;  4P72 A;  4OHZ A;  2RDJ A;  4KGK A;  4EBD A;  2J76 E;  4E0D A;  3L4B C;  2RDD A;  2HHP A;  4IRD A;  4FYY B;  1KHL A;  1P27 B;  1V9O A;  4ITS A;  1NPK A;  3PDN A;  4OJG A;  2GIQ A;  4Y2C A;  3FQL A;  3W5Y A;  5DLG A;  3BN7 A;  1HHT P;  4HTI A;  3B5Q A;  4KJD A;  1X5S A;  3I5C A;  2NPF A;  3BJY A;  1NKC A;  1UCN A;  3F44 A;  3ED4 A;  4NE9 C;  1CUL A;  1YZ7 A;  2WB1 D;  1IJF B;  3CMR A;  4CXK A;  3M6X A;  1KSP A;  3PW2 A;  3M30 B;  1XNQ F;  1REG X;  2QFJ A;  1FA0 A;  5LMU F;  4O3Q A;  4B3T F;  3W9J A;  5KFJ A;  3IBC B;  4J9M A;  2MHN A;  2WVF A;  2IM1 A;  1N36 J;  2FVQ A;  3GYG A;  4C11 A;  2GJI A;  3HXM A;  1M5V C;  2HQC A;  4IG0 A;  4W4M A;  2FLP A;  1N33 F;  1HWJ A;  5C25 A;  4HVZ A;  3AQO A;  3H5S A;  2HQF A;  1U6F A;  1OWX A;  4IFY B;  4M5N A;  5DO2 A;  5K5M A;  1WF0 A;  1S77 D;  1H98 A;  1SHQ A;  3QZ7 A;  4ECZ A;  3NKR A;  5D0H A;  4DL0 C;  3KD8 A;  2HQ3 A;  2F65 A;  3MTJ A;  3RRK A;  1E6V B;  4IOB A;  4QIE A;  3HSD A;  3ZZP A;  3KHG A;  1RT4 B;  1H74 A;  3FBB A;  4NL5 A;  3MMC A;  3N6L A;  3DOL B;  1E2S P;  3MUM P;  1RHM B;  1FDN A;  2DPI A;  1EET A;  2YKO A;  4ECR A;  3H5X A;  2GIF A;  3DYC A;  2ZHA A;  2K06 A;  2VJU A;  1KQS R;  1DTT B;  2ZBP A;  1EB0 A;  3IRX A;  5DM7 Q;  4V1A k;  3BBC A;  4LSZ B;  4UQG A;  3GFY A;  4DQQ A;  3GJR B;  4KY3 A;  1X9M A;  1XJW B;  4LSL B;  3VGU A;  1UPM B;  4CM2 A;  1DRZ A;  2R7X A;  3ADA C;  2J5A A;  5HAO A;  2R7R A;  1Y7A A;  5D77 A;  2M4M A;  4DJB A;  5B0C A;  4IRC A;  4TVA B;  1HI0 P;  1NSP A;  2P5V A;  5IS2 A;  3THP A;  2VIH A;  1N52 B;  1R8C A;  2V2Z A;  1OYE A;  3MPU B;  4XPC A;  2UU9 F;  4ZLP A;  4FNI A;  2DR9 A;  3OL7 A;  3HHD A;  4HH0 A;  1S0N A;  4C98 A;  4A4J A;  3QO9 A;  3G71 S;  2ZE2 A;  2ZJQ Q;  3N4W A;  3MCN A;  3DDN A;  3P5T L;  3ULH A;  4CLT A;  4NXN J;  4RUH A;  2C2O B;  1HNI A;  2MDA A;  2FHJ A;  2WVE A;  3M8P A;  3PW4 A;  2M2B A;  2MY7 A;  2Q79 A;  2YWE A;  4KO0 A;  3PIO Q;  5D4N A;  1WEL A;  4DSK A;  1EKR A;  4OYO A;  1YIJ S;  3T1Y F;  4L6V 3;  1GMU A;  2QLF B;  4ECW A;  1IR0 A;  5MAO A;  2DR6 A;  4OHY A;  2QYG A;  4P6Q A;  3ZTP A;  4X64 F;  3OUY A;  4DU8 A;  4ELV A;  5AXK A;  2ANH A;  1NZ8 A;  2UUB J;  5FLX U;  5A8R B;  1M5H A;  2DNL A;  1FRK A;  2E5J A;  2VV5 A;  3D6T B;  3EVO A;  2D3O R;  5LSO A;  1X9S A;  2VPY B;  3FBE A;  4MKV A;  1D9A A;  4YB7 A;  1RU1 A;  1XK8 A;  4CLP A;  3M8P B;  3K59 A;  4GKK J;  3BKU A;  5KFV A;  4LF2 A;  4MTP A;  1TL5 A;  4ZVH A;  3KFW X;  2ILZ A;  3BRE A;  5T14 A;  3PM9 A;  1NHU A;  4KBI A;  3CUN A;  2F7V A;  5E33 A;  2DHS A;  3V81 A;  4LQY A;  2LXU A;  5HLF B;  4I1T A;  4NLX A;  5EUH A;  2ZWO A;  2VBX A;  3RTV A;  4DF8 A;  4P7T A;  4K4Y A;  2HNZ B;  1WTB A;  5K4P A;  7FD1 A;  3JTO A;  5C2C A;  3WAW A;  4X65 J;  3SI8 A;  1FDD A;  1SKR A;  1QVF R;  2WB4 A;  1GK8 A;  5L38 A;  2MQQ A;  4EO8 A;  2A6M A;  2Y3Y A;  2WVD A;  4BCA A;  3GIJ A;  3CJR A;  3PJW A;  1FDB A;  3VAH A;  2NPI A;  2KH9 A;  4ZIT A;  2E9Z A;  2V67 A;  1ZS6 A;  4ILL A;  4G1Q B;  4EGL A;  4FXD A;  2HZA A;  3GSD A;  2IRY A;  3DDK A;  4LRB A;  4RW8 A;  2V8H A;  2XWY A;  5GAE I;  2EFP A;  2VIC A;  1N5Y A;  4OX9 J;  4FF1 A;  5F8M A;  1Q4R A;  1ED8 A;  2EG1 A;  3DC2 A;  1N56 A;  2D74 B;  3I56 S;  5J2N A;  4CYS A;  1PAU B;  1WC3 A;  2W25 A;  1W2I A;  5DLF A;  1KP6 A;  1VRU A;  3KTQ A;  4OYA A;  5A76 A;  1FJC A;  2LFV A;  2XYP B;  3UWT A;  3CIZ A;  4XK8 C;  4DXL A;  3OR2 B;  1SL0 A;  4Q5V A;  3WAX A;  2DCU B;  4DPY A;  4FDJ A;  4GTX A;  1UMJ A;  3E2D A;  1T9Y A;  2WVB A;  2X1G A;  4LVN P;  1R0B G;  2E29 A;  3GJT B;  4OYI A;  1VIS A;  5MLC V;  3NBP A;  4I68 A;  4K5S A;  1WHX A;  1VS3 A;  5KFA A;  2F8H A;  3K7R A;  3CJT A;  2ZH3 A;  4WU3 A;  2UU9 J;  1CVJ A;  1FJ7 A;  2WBM A;  2ZOF A;  4RLE A;  4FYD A;  4KAI A;  2HHW A;  4DQP A;  1ICE B;  1C0U B;  1HBM A;  2G0C A;  1V6H A;  3G82 B;  1ANJ A;  5KXA A;  4YR2 A;  1R0A A;  2ADB A;  3V6H A;  3KK1 A;  1HNW F;  3GTY X;  1TL1 B;  3M1V B;  3OTE A;  4QIF A;  3TJ8 A;  1DQA A;  5I42 A;  1KRP A;  4GTZ A;  2RH6 A;  2OPP B;  2ALY B;  3PEJ A;  3BSA A;  1ZPW X;  3DOM A;  1RZM A;  2MLY A;  3BH6 B;  4J90 A;  3VTI A;  2EFG A;  4BHQ A;  4B3T J;  2W5T A;  1TK5 A;  3DPC A;  5L39 A;  3NGS A;  1ZM9 A;  3LWL A;  1X31 C;  1FKA F;  5C7P A;  1TUV A;  4FYV B;  1RT7 A;  4KHM A;  2R8K A;  1FKO B;  2XGQ A;  3P8B B;  4EO6 A;  2CNN B;  3M9M B;  1IKV B;  3DM2 A;  1YK9 A;  3IG1 A;  2L08 A;  2H5E A;  3D54 A;  2AGP A;  3MM9 B;  4NLV A;  2L9N A;  1Q78 A;  2FGO A;  4HAC A;  3W9H A;  4ZVQ B;  4QZV B;  5GMK a;  3GCX P;  4QU7 A;  2W7P A;  1R43 A;  1RT5 A;  1VQ5 S;  2UXC J;  1P1T A;  2AD9 A;  3ETM A;  2ZWP A;  4TXS A;  2PD1 A;  3TAQ A;  2PGC A;  5CCM A;  1NSQ A;  2V2V A;  1KHK A;  2WON A;  2BJD A;  4NX9 A;  4TQS A;  2KM8 C;  1S12 A;  2Z56 B;  4OI0 A;  2QN6 B;  1TKT B;  2VG7 B;  3M6W A;  4NZ6 A;  4OHW A;  3KKF A;  1RK8 A;  4LIR A;  1TL3 B;  2NXC A;  2M0G B;  1XMO J;  2H51 B;  4ANE A;  5CCL A;  4WYW A;  2RF2 A;  3M8Q B;  2J9D A;  4UPH A;  4MT1 A;  1WF2 A;  5GAD U;  1DY3 A;  2BAC A;  2QMX A;  3QFH A;  1PG5 B;  1JLG B;  4Q2L A;  1V5V A;  4ATN A;  3SCJ E;  3UD3 P;  3GJQ B;  4G65 A;  3P4U B;  3HFZ B;  1RGV A;  2R42 A;  2DCL A;  1XBW A;  1BWE A;  4OYP A;  4NXM J;  3TRG A;  4KKO A;  1E6V A;  2AT1 B;  2YWG A;  3BV8 A;  4RNO A;  4HTJ A;  1S0O A;  2YNF B;  1X7V A;  3KHR A;  4LF9 J;  4UZC A;  4WTO B;  2OEL A;  1F2H A;  2ZNZ A;  1SL1 A;  4LF7 J;  2VFV A;  1QE1 B;  1RT6 A;  4O3R A;  2XY5 A;  3SMZ A;  1JLB A;  2UV8 A;  5KTQ A;  1XER A;  2DEI A;  3NS7 B;  3ZO7 A;  1XIQ A;  1D8Y A;  4M5L A;  1YRU A;  3I31 A;  4PPZ A;  2AEJ A;  3FMB A;  2IC3 B;  1U49 A;  2HHT A;  5KG5 A;  5ETL A;  5LMN J;  1WEZ A;  3KDO A;  2BXJ A;  3CIM A;  1HAR A;  4FF3 A;  2W5W A;  3DLG A;  3QJL A;  4ZHR A;  3OVB A;  4QR1 A;  1U02 A;  1E3C P;  2W5V A;  1LWC B;  1RUS A;  3RBZ A;  1WDD A;  3D6H B;  3FNN A;  4Y00 A;  2VQE F;  4NLG A;  3RW6 A;  4YY3 J;  4I6A A;  2CNL B;  2XI2 A;  4XIU A;  3SFU A;  2V68 A;  2RS8 A;  4HI2 A;  2LVW A;  3AQP A;  5M2U A;  1H0H B;  3IR6 B;  3QSY B;  4C3K A;  4NLD A;  1NZA A;  1BQN A;  2JC1 A;  4YR3 A;  3CCT A;  2ZVI A;  3AXK A;  3L09 A;  2F4V J;  2FZK B;  1WSR A;  3NKQ A;  4I2Q A;  1E6Y A;  2DGW A;  4ECY A;  2I9S A;  1OJ4 A;  1ZZN A;  4GKJ J;  2V50 A;  4DLE A;  1S6U A;  3LAM A;  8ATC B;  2GA3 A;  2LMI A;  2QIF A;  2XEX A;  4NAS A;  2ZHO A;  5KFP A;  1BGX T;  5KG2 A;  1HD0 A;  2HBZ B;  4QAX A;  2DNN A;  3SQG A;  2DNH A;  3BN4 A;  1K1Q A;  3CT9 A;  1U24 A;  3RYL A;  4CLW A;  2V2Q A;  4R0E A;  1EHW A;  2CNO B;  3HHL D;  3CDU A;  2HHH J;  3IBW A;  5GAH U;  4M8L A;  1HBO A;  4F2S A;  4OL8 A;  2ZZM A;  2HBQ B;  3LGN A;  4H4K A;  5I3U B;  1HNZ J;  2HRU A;  3AJ1 A;  4NA2 A;  3W9I A;  4WK3 A;  3UE2 A;  4PG8 A;  2MKK A;  2ZH5 A;  2YKQ A;  5GAG U;  3CO9 A;  5KAK A;  4HKQ A;  3SQG B;  1RT2 B;  1QD1 A;  5K8P A;  3V6D A;  4JV0 A;  4ZS6 A;  3RGI A;  1TUG B;  2GQ2 A;  2QLW A;  2GX8 A;  2GW8 A;  1SB6 A;  3OFG A;  2E5L F;  1C4A A;  1VR6 A;  4X4Q A;  2XZW A;  3EMT A;  4U9R A;  4CI0 B;  5HL7 Q;  3HVT A;  2W2N P;  2R2U A;  4ZVU B;  3PEH A;  5E3A A;  3G6X A;  4QU6 A;  2CPZ A;  4KR0 B;  5B0G A;  4ZJQ A;  2ZFH A;  3ISZ A;  4C8Y A;  5DG8 A;  1FXR A;  4CLY A;  3DXS X;  1UW4 A;  3FEY B;  1FKP A;  1EQJ A;  5I4M A;  5A8K A;  4RUA A;  1UFL A;  2D7S A;  2ZVS A;  3C14 B;  3MMB B;  4DR2 F;  3FKB A;  4F8R A;  2JEI A;  3J7Z T;  1IVZ A;  4ECX A;  1XR6 A;  2DGO A;  5JVG Q;  3JTP A;  2IA0 A;  4DR6 J;  3MDF A;  4OYX A;  1QAY A;  3AAW B;  4RW7 B;  3FQK A;  2IVF B;  4KV8 B;  3C14 A;  2GSU A;  2MQL A;  1IQZ A;  1KEK A;  3BGR B;  4BDP A;  2H4W B;  4FVM A;  4X62 F;  2IJR A;  2XYH B;  1L3U A;  2W4C A;  1M1K T;  2COL A;  1JNR B;  3MM6 B;  4QW8 A;  4LR9 A;  1RHK B;  4C8M A;  1KVJ A;  3UCU P;  1EIY B;  2W4P A;  4AUK A;  2C2D A;  4ELU A;  4JI4 F;  3EUN A;  1R6V A;  1TMM A;  1VQK S;  5F9L A;  4X4O A;  3NNA A;  2CQD A;  4K50 A;  4UOR A;  4K0K J;  1FRM A;  2K3K A;  2LQB A;  3PHT A;  4IOA Q;  2BJ9 A;  2BQU A;  3US5 A;  2P2C B;  2IA6 A;  3VZI A;  1SBR A;  4DV6 F;  4R0J A;  2VQF J;  2RE1 A;  2H54 B;  2P8I A;  3MCM A;  5ETR A;  3BGO P;  4UF4 A;  1R89 A;  2EEY A;  1ZAX A;  2XLI A;  4TKT A;  4G1P A;  1P9Y A;  2GV1 A;  4A8S A;  2Y1J A;  2CJY B;  2GGP A;  4GMK A;  6AT1 B;  3DOK A;  1YJU A;  4GO7 X;  4I7F B;  2MLX A;  3AHP A;  3B8H A;  4CYR A;  4OZ5 A;  2I8E A;  3GB0 A;  4L73 A;  5D15 A;  2ZHB A;  2O66 A;  5FII A;  1XNQ J;  1FWL A;  1RA7 A;  3MWB A;  1GMW D;  2ZKU A;  3MTK A;  3H40 A;  3PO4 A;  2V4J A;  3KUE A;  1OS5 A;  3MPW A;  4JI6 J;  4UY8 5;  1P1L A;  1YJ7 A;  4DR7 F;  1TL7 B;  4G6V B;  4Q7A A;  2HFS A;  4LF8 F;  4WKY A;  1M1G A;  3ENW A;  2CJK A;  3MOJ B;  4F02 A;  2JFK A;  3J81 j;  2JRS A;  3OVA A;  3SZZ A;  3HVA A;  5KFH A;  2UUA F;  1NSA A;  2ZZT A;  1B0T A;  2UUC J;  1ZTT A;  3G96 A;  1HKA A;  1YLX A;  5A8R A;  2H65 B;  3ZZZ A;  1H2V Z;  3WIV A;  2R8G A;  2C42 A;  4N56 A;  2BYC A;  2FVC A;  2YWF A;  4F7V A;  3NGT A;  1XNR J;  1VLO A;  3ISN D;  3X1L B;  2EFV A;  4PRF A;  4RU9 A;  4C8Z A;  1KHJ A;  3IXQ A;  5GAE U;  4CP5 A;  3N6N A;  1Y7P A;  4TQR A;  1L3S A;  4JI8 J;  3W2V B;  3KUH A;  4MK8 A;  5D0G A;  3B4M A;  4Y2I A;  4LFC J;  1JLE B;  3A12 A;  2BJ1 A;  2OD6 A;  2YVS A;  4LRD A;  4ES2 A;  1Q8L A;  2VQR A;  4O4G A;  2GHV C;  1ULR A;  2KVQ E;  2U1A A;  3UO0 A;  1HWL A;  4RW4 A;  2OJ3 A;  3OTB A;  4WYL A;  2QG9 B;  1REV A;  2DNM A;  1TR0 A;  2ZBQ A;  4M5J A;  3ZZU A;  2UVW A;  2ACY A;  2BMB A;  4FXV A;  2B43 A;  4DL5 A;  4DV4 J;  4JI0 J;  1S1U B;  1HR0 F;  4UOO A;  5HVH A;  2MQN A;  2VBW A;  3EDR B;  2KT3 A;  2QYC A;  3FEX B;  3V4M A;  1TV6 A;  2Q3P A;  1URR A;  2KZZ A;  1C2P A;  5E7O B;  4DUY J;  5ETP A;  3W66 A;  5HMZ A;  5A6W A;  2CPJ A;  3VVU A;  2XWX A;  3I4P A;  4LFC F;  3KNG A;  2Z2Y B;  3MMA A;  1KNZ A;  3BR9 A;  4GKJ F;  3G8Q A;  4TY8 B;  3BSN A;  5CYQ B;  4ZCK A;  1YJ9 S;  1YBT A;  2ZH6 A;  5HRO A;  1WAC A;  5KFM A;  4UST A;  3TQ1 A;  3WBH A;  2B7B B;  2VL1 A;  5BR8 J;  3OTC A;  2VH7 A;  3QPI A;  5E5N A;  3MMC B;  1V5I B;  1S1X B;  1HHQ A;  2ZM6 J;  3RAM A;  3DLE A;  4AL6 A;  4AT1 B;  2FLL A;  1LNQ A;  1Y00 A;  2W2O P;  2CPD A;  2GQC A;  4RJV A;  2QX0 A;  1WWH A;  3FZ2 A;  3LOU A;  4RL1 A;  2DKO B;  5T7L B;  4DCP B;  1HQA A;  3ENA A;  1JXL A;  3Q2T C;  4IG3 B;  1N0U A;  3IR5 B;  2BOP A;  1VQ7 S;  4DR7 J;  4QW9 A;  1VI7 A;  3VAM A;  4CO1 A;  4ZVF A;  2DR8 A;  1H7W A;  4CTA B;  3D0I E;  2C28 A;  1R8A A;  4ED3 A;  1B0V A;  4ED7 A;  1ZAV A;  4FPR A;  4ZJO A;  1N2L A;  1TKX B;  2IUC B;  3TG0 A;  5FDL A;  5KT3 A;  3TA2 A;  4RO0 A;  1CG2 A;  2BEF A;  3HKW A;  4N8O A;  4RW9 A;  4WE1 A;  4NWX A;  3TZX A;  1WI6 A;  2CIM A;  2P6S A;  2VAS A;  3KK2 B;  5H9E K;  1M1H A;  2WK4 A;  4O3P A;  3VVT A;  4PEO A;  3G6V A;  1X9W A;  4U8V A;  4R5P B;  1LXN A;  3NMR A;  3KLI B;  2K7K A;  2IYI A;  3NCQ A;  4FF2 A;  5EWF A;  3A52 A;  4B56 A;  3EX7 B;  2QA1 A;  1W7W A;  2OD4 A;  4DPU A;  2ZBI A;  2MKI A;  1GXT A;  1AJB A;  2E5H A;  1D8Z A;  2DGU A;  2CPY A;  1E6Y B;  2OHD A;  4P2M A;  2MEW A;  4RBU A;  3I0R B;  1R8H A;  2HLU A;  1RAJ A;  3KXD A;  1IKY A;  2FGC A;  2OTL S;  4ED8 A;  2ACM A;  2PII A;  1LQ9 A;  3W2W B;  3C6T A;  4DV4 F;  2CG8 A;  4F50 A;  1RKJ A;  5ETN A;  1IM6 A;  2E7V A;  2AJ1 A;  1SPB P;  2DNP A;  2C3P A;  3LTO A;  3MM8 A;  1UJ6 A;  2E5I A;  4LQ9 A;  3R3T A;  3IMQ J;  1VQ4 S;  1M5K C;  3TUP A;  4S0M A;  3MED A;  1WI8 A;  2PA8 D;  2PN6 A;  1UAW A;  4OI6 A;  4TYA A;  2CQC A;  5DQH A;  3HP6 A;  2ALZ A;  2R7S A;  2DYA A;  4DX7 A;  5KFS A;  1B99 A;  1PJ6 A;  3NMA A;  2GAH C;  2G13 A;  4UQT A;  4UTG A;  3KWM A;  4DV1 F;  1NM2 A;  4DR2 J;  1NK8 A;  1LFW A;  3IS9 A;  1MWY A;  3FGV A;  3MED B;  3G2X A;  5KFT A;  2UXC F;  1UVK A;  1HBO B;  1WG5 A;  1S1V B;  5ETV A;  4PUO B;  1FFG B;  3BYP A;  4PG7 A;  2BJ7 A;  4AE5 A;  1P6T A;  2HRY A;  4ZDN A;  4F4X A;  2XLJ A;  2HEK A;  4DX8 H;  2L41 A;  1ARO P;  4DX6 A;  2VC1 A;  3I5A A;  3M2V A;  5CYM A;  2CUY A;  1NHV A;  5IWA J;  1FXL A;  1GXU A;  3ZXW A;  4DR3 J;  3PYF A;  5KFF A;  4IQM A;  4ECV A;  2NQP A;  3WX8 A;  3AD9 C;  5F8H A;  1RT1 B;  2Y1L B;  1Z4U A;  2RKI B;  2KJW A;  3QAE A;  4MKB A;  4ZP6 A;  3UN3 A;  3MOZ A;  5L9X A;  4B9L A;  4P71 A;  2HMI A;  3VAL A;  3EWG A;  2Z58 B;  3A1Y G;  3DGV A;  2IRX A;  4YME A;  3M9N B;  4B17 A;  1VQS A;  5HRT A;  2YTC A;  3AOD A;  1FKP B;  4W98 A;  1VRQ C;  2VUG A;  3QIP A;  3CCL S;  2XY6 A;  2IY5 B;  2GVZ B;  1PYS B;  3IDD A;  4UOP A;  1Q0N A;  2VDI A;  3PW0 A;  2W1B A;  3MM5 B;  3H59 A;  4P75 A;  4U95 A;  4X64 J;  3HPO A;  3BBB A;  4ED5 A;  1AUK A;  2W9C A;  1FHT A;  4J9Q A;  1FO1 A;  1FD8 A;  1H6K X;  5B0A A;  3BYR A;  5ETT A;  5ADZ A;  1FE4 A;  1S57 A;  1Y5L B;  1Y6V A;  3K2Y A;  1FX4 A;  4BWM A;  3GIL A;  2LLZ A;  4F0K A;  3SSR A;  4ZPC A;  2CPX A;  3KJQ B;  4ZVR B;  4OX6 A;  4ED6 A;  4CWB A;  4IUF A;  5KFK A;  1NLK L;  1JLC B;  3PFO A;  4JI4 J;  4YUD A;  5CYJ A;  1LV5 A;  5DQI A;  1RU2 A;  1SVD A;  3DU6 A;  2K3I A;  5IM0 A;  1NDC A;  1S1W A;  3NAI A;  3OQ2 A;  3QO9 B;  1HNV A;  2W01 A;  1GMV A;  4PXD A;  2CRL A;  4CM0 A;  2R2R A;  2BAN A;  1S9G A;  1YTY A;  1O8B A;  2YPY A;  5C24 A;  3H0P A;  2X3G A;  3PFE A;  5EN1 A;  2FJD B;  2R8J A;  2JEJ A;  5LRN A;  3R7N B;  3OTO J;  1YG0 A;  3ETO A;  4UT4 A;  4FDI A;  3PR4 A;  2QL5 B;  2J8S A;  1EW2 A;  3BDH A;  4DHV A;  1BQX A;  2DH9 A;  2Y1R I;  2V8P A;  4PPD A;  1BE4 A;  5K14 A;  3I0R A;  5LM7 E;  3RZA A;  2B4O A;  3W62 A;  1HMV A;  2YKN B;  3R8Y A;  4MKA A;  3JB9 k;  1ZET A;  5K14 B;  1X4G A;  2EKN A;  1TP7 A;  3G86 A;  3KHL A;  1AUD A;  3DRS A;  1N5S A;  3HD2 A;  4WIQ A;  5AXN A;  3TAN A;  2LQJ A;  2JLG A;  1VJW A;  3RRH A;  4B9V A;  1OPZ A;  1RWO B;  4DN9 A;  4KHP J;  3DRR A;  3SBM A;  4DV1 J;  4DS5 A;  4PWD A;  4JUZ A;  1WOP A;  4LF8 J;  3T9N A;  4LF9 F;  4KAY A;  2I6W A;  2MSS A;  3N5F A;  2IPO B;  1TAU A;  2L48 A;  2MJN A;  3DLK A;  1N6Q A;  4B3O A;  1HMV B;  4KE5 A;  2ATC B;  1F9H A;  2HFZ A;  5E3Q A;  1T9X A;  2OPQ B;  3GJS B;  2YH1 A;  4DWI A;  4CDI A;  2WON B;  2G9O A;  3IS9 B;  4ZJL A;  2IBO A;  3T5K A;  3G9C A;  3T00 A;  1FTR A;  1KQG B;  4MIW A;  1AUS L;  3QFW A;  2DRA A;  1LWX A;  2KDO A;  1GMW A;  1G4C A;  1S7I A;  4GVB A;  4ANC A;  4OZ0 A;  1X0F A;  2DRD A;  3D4J A;  4KAV A;  3CCE S;  1U1O A;  1UEK A;  4ZKA A;  3CNQ P;  5E3R A;  1Y5I B;  3FBC A;  2CQ4 A;  1LOU A;  3JTN A;  4LJM A;  4MJK A;  4FNH A;  1NEE A;  3K5L A;  3L95 X;  1WHW A;  4KV8 A;  1RWX B;  1KOH A;  3OSN A;  2KTQ A;  2V5H G;  1KTQ A;  5ETS A;  1VRT B;  1JXE A;  3ITH B;  3EPG A;  4NWJ A;  2PFD A;  4EZ9 A;  4AL5 A;  3SDE A;  2B5J B;  5J2M B;  2KYZ A;  5KFN A;  1LK7 A;  3MMA B;  4DLG A;  4EBC A;  2XTJ P;  4M1K A;  1FT8 A;  2L9D A;  4F4A A;  2HAI A;  1EET B;  1Y3K A;  4P2X A;  2NYH A;  2FJV A;  3DOL A;  2OGU A;  4RU2 A;  5L1L A;  2JJ4 D;  5EX3 A;  5AT1 B;  2HHU A;  4ES3 A;  1UA0 A;  1CJU B;  4ZLL A;  2K1R B;  1EAR A;  4RR5 A;  1IKW B;  3FCW A;  3JAM U;  1RDR A;  1OMS A;  1FFW B;  1FE0 A;  1SC3 B;  3I87 A;  4X4R A;  4WXO A;  1H72 C;  4DPW A;  5IZH A;  1CJK A;  3MEC A;  4IFY A;  3C16 A;  4UPL A;  2Q6B A;  4W90 B;  3OTO F;  2LEA A;  2XNQ A;  2J0S D;  4F4Y A;  4NCG B;  5L0B A;  3MEC B;  4AND A;  1JKH B;  2FJB B;  2IC3 A;  4DUT A;  5FLX Y;  4K7Q A;  3AFG A;  1VK3 A;  5T7L A;  1IXK A;  1RT7 B;  2IHR 1;  2KXH A;  3D0G E;  3EZO A;  4FP9 A;  1UZD A;  4K59 A;  3UDV A;  2DH7 A;  4CO0 A;  3CPW R;  1C0T B;  4OX8 A;  2I2Y A;  2OPR A;  2A1B A;  2WHO A;  3HF5 A;  4GRS A;  1IKY B;  1SQE A;  5J1N A;  3D7S B;  2MZ1 A;  1RWU A;  2GA7 A;  5F8G A;  3QAU A;  3OBI A;  4C8O A;  3QWP A;  1S9F A;  3GG1 A;  4L74 A;  4DV3 F;  1NJY A;  2R8H A;  4NXM F;  3MPY A;  3TYT A;  4ZCI A;  1VGY A;  4Y6I A;  3HO1 A;  3VF0 B;  3NCR A;  3NP5 A;  3CJ8 A;  1M0S A;  1U1R A;  2YY3 A;  3QQC D;  2HFU A;  4NRU A;  3PHE A;  2F8M A;  7AT1 B;  1U2R A;  3CCQ S;  1WD6 A;  4PWD B;  3DMJ B;  4R5P A;  3W7B A;  4ZPD A;  3GU0 A;  4F4K A;  1UEU A;  2M70 A;  1S6Q A;  4B3R F;  3T41 A;  4DV2 F;  2CQ3 A;  2FVP A;  2FTR A;  5LSR A;  4BS2 A;  5IJS A;  1RTJ B;  3CTR A;  5KG6 A;  4I0W A;  1G1X A;  4L3K A;  3AB4 B;  5KFG A;  3VQS A;  4PUO A;  1UEV A;  3PYE A;  2OEJ A;  1S6P B;  5DGB A;  5KOW A;  1DUR A;  2LDI A;  3KG4 A;  2H9Z A;  4OIX A;  3UI3 A;  2W8K A;  4J9R A;  1GNK A;  3PO5 A;  1CC7 A;  1BY9 A;  2G0I A;  4MIB A;  4DN0 A;  1T3N A;  4LBP A;  3DLB A;  4QOT A;  3BB5 A;  5E41 A;  2IFY A;  2E5G A;  4WXW A;  2JDJ A;  2GJF A;  4YB1 P;  1TFW A;  2F1F A;  4EUV A;  1BD6 A;  2CDR B;  2HK2 A;  2Z2Z A;  3DKD A;  3L7O A;  3S7R A;  4IKA A;  3RB4 A;  3I5B A;  3OUY B;  2QLJ B;  2WSF C;  2GNK A;  2RNE A;  2KRR A;  3PTW A;  1IWA A;  2NUH A;  4G1Q A;  4J37 A;  3TAR A;  1L5U A;  2KB2 A;  2Z0G A;  4YB5 A;  3GFH A;  5KG7 A;  3ZNU A;  1LKZ A;  3FDS A;  4Y34 A;  2JLF A;  2ZH4 A;  2I0X A;  3MM7 A;  1YWX A;  3LAK A;  4LBH A;  1K0T A;  4GTY A;  3OV7 A;  3CD5 A;  3HCX A;  3BGR A;  3WC0 A;  3VGT A;  2RS2 A;  2UVV A;  5H9F K;  3GON A;  1EW8 A;  3BGU A;  2DR5 A;  4GKK F;  3MAQ A;  2E7X A;  3G87 A;  4HDG A;  2B5J A;  5J2M A;  3MCS A;  2OH2 A;  4XDD A;  1U1N A;  2DGX A;  1MMD A;  4M5I A;  4NEY A;  4C3M A;  3HM9 A;  5HLF A;  1LW2 B;  2HMI B;  1UFW A;  1F3V A;  4RW8 B;  2IMW P;  2J6T A;  5JUM A;  3SZ2 A;  2HQD A;  4X4N A;  3CO0 P;  1FD2 A;  4KB7 A;  2I5J A;  3JSB A;  3TWZ A;  3FVY A;  2HND B;  2KYX A;  2XMT A;  3HFK A;  3QIP B;  3OD2 A;  3ZTO A;  4ZG7 A;  3LPE A;  3J7Y I;  2BM0 A;  2AW0 A;  2EKY A;  4IYQ A;  3TW0 A;  5C42 A;  5L46 A;  2MZS A;  2XHW A;  3CDW A;  1W26 A;  2C2N A;  1SCJ B;  2FJA B;  4DV5 J;  1PBA A;  1SJQ A;  3KK1 B;  2IAJ A;  4KTQ A;  3R5B A;  1EW9 A;  2W2M P;  1K0V A;  4J9V A;  3Q8Q B;  1J5E J;  1IM4 A;  1UKU A;  2OTJ S;  2YQ3 A;  4LF6 F;  1KH4 A;  1F0X A;  5IM0 B;  2DIU A;  2XMK A;  2AJ0 A;  3ET6 A;  2YH0 A;  1FRJ A;  5A8W B;  1JJH A;  2DD8 S;  4CIO A;  2H3E B;  1IBK F;  2DVI A;  2O3D A;  2D1G A;  3QT7 A;  4FS2 A;  1LFP A;  3R1L A;  3JXO A;  1JNZ B;  3TUZ C;  1IJE B;  1PIE A;  5JMN A;  1NH7 A;  2WSC C;  4L76 A;  2R7W A;  2G0J A;  1TK8 A;  2OIH A;  4B9S A;  1EJ7 L;  3V5R A;  1WKJ A;  3KMS A;  1C1C A;  3IWX A;  1R0C B;  4KGV B;  2OUG A;  5J1E A;  2OPS B;  1VJQ A;  3KDN A;  5HO4 A;  1EQM A;  5HBM B;  4LR7 A;  4ZVG A;  1XR7 A;  4JP8 A;  2Z30 B;  3KLV A;  2BM1 A;  1Q7L B;  2VG5 A;  5G4D A;  3MZI A;  1FI4 A;  4OLP A;  2DHX A;  3TUJ C;  1HNI B;  4ZMM A;  3PY8 A;  2YKN A;  1GAO A;  3IBF B;  2ZBR A;  3ZZT A;  1T9V A;  4DFK A;  4IFV B;  4K4X A;  3THV A;  4JV1 A;  5LQQ A;  4QR2 A;  3KUG A;  5LOQ A;  1RTJ A;  3IO1 A;  4TLQ A;  1U0H B;  3RUB L;  2D3U A;  2QC3 A;  3DOM B;  5BYR A;  3UDE A;  4ENO A;  1V3Z A;  1N4L A;  2Q43 A;  2LEB A;  3OSP A;  1SKS A;  4UOC A;  5KFL A;  2W8S A;  3UN5 A;  4URG A;  1FES A;  3D1Q A;  3M8Q A;  1QAJ A;  2GSO A;  4MAK A;  2PDA A;  2ZJR Q;  4KPY A;  4Q8E A;  2DTJ A;  4TN0 A;  1B70 B;  2UXB F;  3WZ0 A;  3G8T A;  4R8U A;  2IM3 A;  2HNY B;  2WW8 A;  1RAH B;  4ALZ A;  5LJ3 Y;  1OO0 B;  4DR4 J;  4PWW A;  5KG4 A;  1TFY A;  1JLE A;  4B9N A;  4CXS A;  3V4I A;  2B9X A;  1HL6 A;  4QIW D;  1MML A;  4F36 A;  2ZIT A;  3W64 A;  1CJT B;  2MLZ A;  3TVK A;  4DEZ A;  4I64 A;  2Z57 B;  2XC9 A;  2Y1I A;  5HAN A;  3G8S A;  1AJC A;  1S1U A;  3OL8 A;  3C2P A;  2IFX A;  1WOR A;  1I3O B;  2BKN A;  2DEJ A;  4M5H A;  4IOC Q;  4ZG9 A;  1WC4 A;  3CE8 A;  2YNH B;  2AZ1 A;  4XO0 A;  1RT3 A;  3RW7 A;  1I94 J;  1MMN A;  3CF5 Q;  1AW0 A;  2RSQ A;  3EPI A;  2OEM A;  1XQI A;  3RB3 A;  1NJW A;  2MKS A;  5LRM A;  2LDY A;  1PKU A;  2AYB A;  2JLE A;  4CLK A;  4YN3 B;  2CPH A;  2R4F A;  1CUL B;  1RBL A;  1XTZ A;  2KL8 A;  3ZTQ A;  3JSR A;  3H7H B;  3MF5 A;  4IH7 A;  4LSN B;  5F41 A;  3R7S B;  1AB8 A;  3UNY A;  5KFC A;  3MR2 A;  4TY8 A;  3M9O B;  3CME S;  3MUV P;  3H25 A;  1G2E A;  4X62 J;  3OVS A;  3T19 A;  3GE9 A;  2IJN A;  1SJF A;  1U7L A;  2NSC A;  1JQG A;  2F4F A;  5HSP A;  2XMM A;  3Q22 A;  1Y9O A;  1R6Y A;  2D3Z A;  2HWI A;  3LAL A;  4KH1 B;  4PAA A;  1WNE A;  2MQM A;  5DLT A;  3MEE A;  5THW A;  2CQ0 A;  3PIP Q;  2DHG A;  2NLW A;  2WZ1 A;  4FKX A;  1N8R T;  3FSY A;  2AYG A;  5FDL B;  4UPI A;  1RXO B;  6FDR A;  3H5U A;  4LSL A;  4Y65 A;  1EQ0 A;  2JL9 A;  2GFF A;  3G6E S;  5KFE A;  1DBD A;  1U4B A;  1LWC A;  1VFJ A;  1X0P A;  3KJN B;  5G0R A;  1PYT A;  3MEG A;  4QYR A;  4CTA A;  5A6P A;  1TQL A;  1FRH A;  2OFH X;  1QVG R;  3K17 A;  2XMA A;  2HIQ A;  3UVJ A;  5IT0 A;  3TVY A;  4KH0 B;  3UDC A;  1A9N B;  3V6K A;  1S10 A;  2WVC A;  2O1P A;  4IG3 A;  5L0E A;  3HI9 A;  2FY1 A;  1UVJ A;  5L8R C;  3PV8 A;  1WOO A;  2GMH A;  3EVW A;  4URQ U;  2VBZ A;  3TAM B;  4JI3 J;  4ECQ A;  3VAK A;  9RUB A;  1WKL A;  3UR3 C;  3PX0 A;  1U6B A;  1FRX A;  3GPA A;  4DUY F;  3M05 A;  4DV6 J;  3MEG B;  2J7K A;  3FK4 A;  1NB7 A;  2ASY A;  3FEZ A;  4G1I A;  8AT1 B;  3GV5 B;  3D66 A;  4DOZ A;  2POK A;  4NYO A;  3ZZ0 A;  2E66 A;  3NCP A;  3K8V A;  4USH A;  3J7Z 5;  2O01 C;  2WAQ D;  5JXS A;  1N36 F;  2PFF B;  4OZ2 A;  2DY1 A;  5F8J A;  3QGP A;  4ECU A;  4DR4 F;  2HGM A;  1N34 F;  2ASJ A;  5L0K A;  2W2Q P;  3N9U C;  5LSL A;  1L3T A;  3LP0 B;  2EG2 A;  3JAM Y;  4NCA A;  3ZZR A;  2J7W A;  3DCA A;  1WC6 A;  4ED2 A;  4RNN A;  2BKO A;  1KQK A;  3OHA A;  2F4V F;  4JI8 F;  2RQC A;  1YZ6 A;  3EXC X;  1HBN A;  2BX6 A;  3EIC A;  2AJ4 A;  4FDF A;  1HHS A;  1KFD A;  1KR4 A;  3OFE A;  1CC8 A;  1X4H A;  2B4U A;  2GQQ A;  4NEZ A;  4CNY A;  4K4S A;  4DMZ A;  1YVF A;  3KG1 A;  3W5Z A;  2AKW B;  3DFE A;  5D0R A;  2A0F B;  2VG7 A;  4N47 A;  2HPU A;  2ZDP A;  2E1P A;  1ZPV A;  4DFP A;  3NKN A;  1TV6 B;  2EPI A;  4Z2X A;  2DPJ A;  1N88 A;  3J81 U;  3MM7 B;  3J7Y U;  3BR8 A;  2UUC F;  1UTA A;  3H42 A;  3JSM B;  4I69 A;  1FEH A;  2WW4 A;  1QDU B;  3A3N B;  1SIZ A;  5E0O A;  4NLO A;  5RUB A;  4FN5 A;  4USK A;  4DUZ F;  2YKM A;  2KFY A;  4NCB A;  5J2Q B;  1IN0 A;  3BM7 A;  3H90 A;  4UW2 A;  4Z7C A;  2HW3 A;  3GIK A;  1P9Q C;  1HQE A;  4DR5 F;  4OI2 A;  1HNZ F;  2YKP A;  1YJT A;  1KOO A;  1SQF A;  5HRO B;  4B9M A;  1FTC A;  3T5J A;  4MHX A;  4DQR A;  4EYH B;  4GC7 A;  4NLU A;  1RWM B;  5J2N B;  5ETQ A;  3MK2 A;  4ID8 A;  2NUU G;  1PJ7 A;  1X4A A;  2Q1L A;  5J2Q A;  1YRT A;  2ZD1 B;  1KWM A;  3CGI A;  3AOB A;  2DXF A;  3TOQ A;  1CLF A;  4I4B A;  4LF6 J;  3D3C J;  3PRV A;  4L75 A;  3UPF A;  4CO5 A;  2KU7 A;  1S9E B;  3E01 B;  4DSE A;  2K2P A;  1VLY A;  3ONQ A;  4TU9 A;  4PR6 A;  4LF5 F;  1IWG A;  1RT6 B;  2LXI A;  2A3J A;  2X7I A;  3H98 A;  4PWU A;  3ZZY A;  3KLG A;  2JSX A;  4F3O A;  5KFY A;  1XMB A;  4M5D A;  3RJM B;  3DYA B;  1KLM B;  1S1T A;  2KT2 A;  4O4R A;  2KHC A;  5A8W A;  1O98 A;  3X3U A;  4DL6 A;  2HUR A;  3PJ9 A;  3N5B A;  1Y10 A;  2C2Z B;  5DDP C;  1NK6 A;  1HBM B;  3G82 A;  3TVZ A;  1VQ6 S;  1GX6 A;  2Q6C A;  3TUI C;  2YNG B;  3CCS S;  3RBE A;  3CCW A;  1UJ5 A;  3D1O A;  4YS2 A;  4C3L A;  4C8N A;  4I7F A;  2BAN B;  3TX0 A;  4KGZ B;  1XMO F;  1VQL S;  1SC1 B;  1HNV B;  1VQO S;  4WII A;  2DXD A;  1QM9 A;  3PNI A;  1PAE X;  3NOG A;  5C2G A;  4K4V A;  1ZEF A;  1EZZ B;  4JI1 J;  4Z37 A;  2QFI A;  3B78 A;  3RR8 A;  2ATL A;  2I38 A;  5IWA F;  1SHN A;  4ID5 A;  4PKD B;  4ZN3 A;  3BO3 A;  4B02 A;  1MU2 A;  2DNZ A;  2CQB A;  1AA1 B;  2GHW A;  1HW8 A;  3GIR A;  3OTD A;  1V3S A;  1Q7Y T;  2YBV A;  4OX7 A;  3BQ2 A;  4KJI A;  2JNJ A;  4DSJ A;  2CDQ A;  1FJG J;  1A6L A;  4OZ3 A;  4EWT A;  2HRT A;  5CA5 A;  4R8U B;  4WFN Q;  5GAD I;  1K73 T;  1IQT A;  3J81 Y;  1DHM A;  3HUL A;  1PBU A;  3AXM A;  2MHE A;  3O44 A;  4HT7 A;  4PZV A;  4U6P A;  1ACM B;  2RT3 A;  3ISN C;  3OJS A;  3NY0 A;  3Q83 A;  2F9J A;  4DR1 F;  3OR1 A;  5LXY A;  1I5O B;  1ZZF A;  2MQO A;  2IDE A;  4EI2 A;  1VBY A;  3LP2 A;  1TMJ A;  2RHS B;  4KFB B;  1RQ0 A;  2R7O A;  2BJE A;  4A8K A;  2OSR A;  1N48 A;  3W65 A;  5HP1 B;  1RAE B;  3FC9 A;  4IR1 A;  5KFR A;  1HBU B;  2JC0 A;  2KVI A;  3JQK A;  3VGS A;  5F9N A;  2Y9H A;  3W2V A;  3MXH P;  1ALK A;  4Q0B A;  2IMO A;  2KT5 A;  2LEP A;  2N82 B;  2C2E A;  1I1G A;  4JV2 A;  4WP8 A;  1ZYQ A;  3RB6 A;  2AEM A;  2HAF A;  2KN4 A;  2HBY B;  3MD1 A;  2YPZ A;  2M9K A;  2XM3 A;  2YKA A;  1RSC A;  3IA0 A;  3HSJ A;  3NKP A;  2YNH A;  1Q95 G;  1CSJ A;  1VIO A;  2Y0B B;  4YFU A;  4KGX B;  1D9F A;  2VPZ B;  5F8I A;  4JI7 F;  2WTF A;  1C4C A;  1KTV A;  2QZ8 A;  2CYY A;  3CED A;  3FSI A;  1UWB A;  1T05 A;  3WAV A;  1CJT A;  3AT1 B;  2NXN A;  3DRP B;  3VV2 B;  2FB0 A;  1BLU A;  2D41 A;  2V63 A;  1U0S A;  3GZ7 A;  1J5O A;  2RUS A;  3WQP A;  4EYI B;  2B0G A;  1J2V A;  2DGT A;  2YWW A;  2NYI A;  1JB0 C;  4PYA A;  4UUW A;  4ILM A;  4ZA1 A;  3IGN A;  4F4W A;  3MUT P;  5LL6 d;  2NXJ A;  5DDR C;  3GG0 A;  1RTH B;  2QV6 A;  5HMX A;  3O1L A;  2R8I A;  3W1Y C;  1VQ8 S;  3R1H A;  2RH3 A;  4LFA F;  5DET A;  1B3T A;  4MFB A;  4TLR A;  1DTQ B;  1JLF B;  1YIT S;  3ZC4 A;  2YNI B;  1BHN A;  1LW0 A;  3U02 A;  1RCX B;  4CLZ A;  4DBQ A;  3OL6 A;  4MFB B;  4P10 A;  4D3H A;  1YJN S;  1NJI T;  2B4P A;  3NWR A;  1WJ9 A;  5DG7 A;  1FDA A;  1Y4Z B;  3KNA A;  2V9W A;  3HHK A;  4QWE A;  5K9F A;  3KK2 A;  2ZH1 A;  2ZH9 A;  4DX5 A;  2JH3 A;  1DJ0 A;  4I6Y A;  1RHR B;  1RTH A;  1BUX A;  2DGV A;  3GIM A;  3T3F A;  2PI4 A;  1ZH5 A;  1S59 A;  3GP9 A;  3N28 A;  2ASD A;  4DV3 J;  1ALJ A;  2H4Y B;  2V8G A;  3TAM A;  1FNM A;  4X4P A;  2GJ2 A;  2M8H A;  3D9B A;  4XDC A;  2AQ4 A;  3HD1 A;  3GFZ A;  1KHV A;  2Z8Q A;  3BEG B;  4Y2A A;  5F3T A;  3VAF A;  1R8B A;  2MTL A;  2HFO A;  1IBL J;  1BC6 A;  4P73 A;  2ZNY A;  3UVJ B;  1F2G A;  2VFS A;  2DNR A;  1O0P A;  3IP0 A;  5KFU A;  2YWK A;  1FWK A;  1YRX A;  1D1U A;  2NS1 B;  1N5V A;  3CCZ A;  4ZVS B;  3MR5 A;  3I0S B;  4C0H A;  3WBZ A;  4IO9 Q;  4ETZ A;  3BGF A;  5EDW A;  2B4V A;  5KG3 A;  1YJV A;  2CA9 A;  4F3Q A;  3KK3 A;  1SJR A;  1VHF A;  2QL9 B;  4JI2 J;  1K8A T;  4Y2M A;  3MD3 A;  2VD3 A;  4M5G A;  1DAX A;  4HAC B;  3QLH B;  2HQI A;  3TP2 A;  3T1H F;  2RJZ A;  4K2J A;  2DNQ A;  4M5M A;  4Q45 A;  2CWX A;  3AJ2 A;  2FC8 A;  2MGZ A;  1VHI A;  2K8G A;  3ZTR A;  4KO0 B;  1KH5 A;  2XSJ A;  1LWE B;  2DT9 A;  2VFR A;  3DMJ A;  4P9S A;  1NAQ A;  3MUR P;  1UZH A;  3NL0 A;  4IH5 A;  2R2S A;  2HWT A;  2P9C A;  3S01 A;  3D1H A;  2BV3 A;  1OQ3 A;  1RHQ B;  2HWH A;  4C2M A;  2O67 A;  3AD7 C;  3LQV A;  1BWV A;  3NEK A;  4F3M A;  2R7V A;  2RRN A;  2HKE A;  2WCX A;  2ZDO A;  2VFU A;  2XMW A;  4DFM A;  4DL3 A;  3T01 A;  5A2Q Y;  4RX6 A;  5FJ4 A;  5J2P B;  1R31 A;  1GEH A;  1YQH A;  3SDE B;  3W8P A;  3KJV B;  4F4Z A;  1YJW S;  1ROF A;  3WAY A;  3O6Q A;  4CH1 A;  2GSN A;  3A3P B;  3LPY A;  2X1A A;  4X4V A;  5BR8 F;  2ZM6 F;  4MK9 A;  4JV5 F;  2YNF A;  1B64 A;  1HQE B;  4TYB A;  1TUW A;  4L72 B;  4CYU A;  1FNO A;  4WFX A;  4ZP9 A;  3MAA B;  2W9B B;  1P49 A;  5I3P A;  5DDO C;  3JYT B;  4HH1 A;  4KKO B;  3NOC A;  2GO8 A;  4LT6 A;  4P74 A;  4ZPW R;  4DQS A;  1CS4 A;  1UL3 A;  2AP6 A;  2UXD J;  2VPX B;  3CXC R;  5H9E J;  3C8Y A;  4FYW B;  5CH7 B;  2K7J A;  3ZFV A;  1J5E F;  1HD1 A;  1GTH A;  2EK6 A;  4KC5 A;  2Z4P A;  2CQI A;  2QLB B;  3VAI A;  2ZC3 A;  1UVI A;  5DLV A;  1WDT A;  2AZ3 A;  1HR0 J;  4RZR A;  4DZD A;  1ALI A;  3R5D A;  5HAT A;  4ER8 A;  4DSI A;  3ILI A;  4EBE A;  3W8G A;  3U27 A;  4OYZ A;  1KN6 A;  2JFD A;  4HLB A;  2GML A;  3TR5 A;  4DG1 B;  3C66 A;  2XSF A;  5M2R A;  1ZBT A;  3CC7 S;  1RBO B;  4XAK A;  3DLG B;  1NK0 A;  2DGS A;  2E1M C;  2IAJ B;  2LKZ A;  2LYV A;  1F6T A;  3GSI A;  3K5P A;  1NU4 A;  4K8R A;  2C1E B;  5CZX A;  1S1T B;  5B08 A;  1ZED A;  2PMZ D;  5IJQ A;  2UV8 G;  3RG6 A;  3PZP A;  2HSE B;  2H5I B;  1T94 A;  4NYP A;  3W61 A;  1S97 A;  1FER A;  4NI2 B;  5DLW A;  1DAR A;  3HX9 A;  3SIP B;  2ZJP Q;  5CZV A;  4C97 A;  1Q8I A;  2BW2 A;  5FD1 A;  1S76 D;  2KRB A;  2P9G A;  2B9W A;  2FDN A;  1F5B A;  4B3S J;  2CAJ A;  1HQ2 A;  5EGE A;  1QTN B;  1D3W A;  1UP1 A;  1B0P A;  3GYX B;  1VQN S;  3HKZ D;  2VG5 B;  5D4O A;  2QO3 A;  2RDI A;  4IR9 A;  2CJB A;  1OYD A;  2EXU A;  5CHC B;  2PMW A;  5KG1 A;  1URB A;  1VDH A;  4QQB A;  3SSQ A;  3F73 A;  2OPQ A;  2WSE C;  1ELX A;  4DL7 A;  1H2T Z;  1Z2Z A;  2NRE A;  1LXJ A;  1YHQ S;  1Q53 A;  3DLK B;  4OHX A;  2QL7 B;  2FJX A;  3CWJ A;  2L3M A;  3K58 A;  4YOE A;  4K5R A;  7FDR A;  1G3O A;  4KSE B;  1GT8 A;  2FHK A;  4X2B A;  4Z7Y A;  3MM9 A;  2CZV C;  5IQQ A;  4JI0 F;  3HFV A;  2EW9 A;  1EP4 A;  1NDK A;  1RIS A;  4CT9 A;  4JV5 J;  1AXQ A;  4CYU B;  3CJ3 A;  5HJY A;  3M6V A;  3LP2 B;  4KFB A;  2G1D A;  4ZP7 A;  4K4W A;  1FWP A;  4H4M A;  3UD4 P;  1U1M A;  1D0E A;  3BDP A;  4DSL A;  2V8V A;  1QLN A;  4NPO A;  2MY8 A;  1DQ9 A;  3BKF A;  2RQM A;  5EGY A;  4USJ C;  5K8N A;  2AMC B;  2HFN A;  4ICL A;  4DR5 J;  2XS5 A;  3Q8U A;  2FQQ B;  2KZM A;  4DR3 F;  1KD1 T;  9ATC B;  2ROP A;  4TU7 A;  3PKY A;  2XY7 A;  2XG8 A;  2NXU A;  3NKY A;  3OR2 A;  2DO4 A;  3EE3 A;  1HI8 A;  5LXR A;  1OSC A;  3CDA A;  2AYM A;  1VRT A;  5AE3 A;  4I2P B;  2CQ1 A;  4TN2 A;  4KQZ A;  1TL3 A;  1NND A;  2DIV A;  2KXF A;  2EFN A;  2N4D A;  3DGP B;  1SC6 A;  3PJX A;  4UOH A;  3I4H X;  5DDQ C;  4O4G B;  5HN0 A;  2E1R A;  3HT3 A;  1S72 S;  1SI9 A;  3MAA A;  3NNC A;  1Q79 A;  3CJ2 A;  3QRP A;  1S4F A;  1KDN A;  5DZ6 A;  3I82 A;  4NYZ A;  5IXU A;  4LFB J;  1NO8 A;  5B09 A;  3DGP A;  1U48 A;  3M8Z A;  2G4B A;  3IGY B;  4ED1 A;  2G2Z A;  3POT A;  4GVB B;  3DLL Q;  1H7X A;  1RT4 A;  5KFO A;  1CJU A;  3UFC X;  3W60 A;  1QE1 A;  3LO3 A;  3POT B;  1GTE A;  4YP3 A;  3KLH A;  3WIU A;  4PCQ A;  2AHO B;  3DHW C;  2B7C B;  3I6P A;  3U1N A;  4OV1 A;  3UD5 A;  2W8L A;  4J9S A;  1MWQ A;  2F9D A;  5I3Q A;  3MFH A;  1QJH A;  3B4D A;  1HJK A;  5CYQ A;  5AXM A;  1WG4 A;  5G0R B;  5KOX A;  2VFT A;  1SV5 B;  2KKH A;  4ZK7 M;  3CC2 S;  4HHJ A;  3IGZ B;  1Y11 A;  1LW0 B;  3VQT A;  2CJQ A;  4U7C A;  2HVZ A;  3PW5 A;  3AH6 A;  2QMW A;  1W25 A;  1HNW J;  4AYB D;  1DTT A;  4PG5 A;  3OT9 A;  1G6B A;  3CD0 A;  5GOV A;  3AJD A;  3M2R B;  1NKE A;  1C0T A;  4BBY A;  3MEK A;  5SUH A;  1NCL A;  1CBK A;  3EDQ B;  1UPP A;  1QAI A;  2YNI A;  3TEH B;  3IR7 B;  3E8O A;  4O23 A;  1LEO A;  3K5O A;  4ETX A;  2IBK A;  5LMU J;  2HBR B;  3T5H A;  3M2U B;  2A18 A;  3W63 A;  4FYX B;  4MH8 A;  3HDS A;  2FLO A;  1RTD B;  4JYA F;  1BXN A;  1NBE B;  2B6A A;  2RQ4 A;  4FF4 A;  4WF9 Q;  3NKO A;  1XMQ F;  3R5C A;  1SH0 A;  1K7H A;  1F5C A;  4FKY A;  4NRT A;  4DR1 J;  4RW9 B;  2M8D B;  2ZE2 B;  3I32 A;  5B0F A;  4WFY A;  4RUC A;  1R27 B;  1QTM A;  4DR6 F;  2JVO A;  5GVQ A;  3WHI A;  4LR8 A;  1RTI A;  3AY0 A;  2HVD A;  3S8S A;  4KJG A;  2J9D E;  2FZC B;  1RWN B;  5C25 B;  3K89 A;  3C6U B;  3M30 A;  4NML A;  3KYL A;  1VQM S;  5BYQ A;  1SJ3 P;  1KHN A;  1JXV A;  3V81 B;  2MKJ A;  1FRI A;  4U8Y A;  2ZC4 A;  4BLG A;  2YKM B;  4X4U A;  3CUL A;  3ZTS A;  3MPV A;  4ED0 A;  1T03 B;  3C46 A;  2PE8 A;  3HHE A;  5J2P A;  2A2C A;  5E3C A;  3JSM A;  3Q24 A;  4LRA A;  1IBM J;  1U09 A;  1X4B A;  1A0O B;  2FC9 A;  3GLJ A;  3OXL A;  4J7C A;  4TNO A;  3GR1 A;  2MZT A;  2YXL A;  3I96 A;  4RWX A;  2XMU A;  2DK2 A;  2HG4 A;  4OI3 A;  3UCG A;  2H5J B;  1RHJ B;  2E9R X;  3J80 U;  3PVX A;  2LP4 A;  1VBX A;  1HWI A;  3SCK E;  2B8P A;  2HIY A;  2L9W A;  1H2U X;  2N7Y A;  2RKI A;  4KYZ A;  4A47 A;  4F67 A;  2UUB F;  4CQ1 A;  1L3V A;  2AX0 A;  4CLS A;  1FVQ A;  1XWL A;  3PKM A;  4N77 A;  1GX5 A;  2CJX B;  4WTY A;  2A10 A;  2AEF A;  5GAH I;  2MXY A;  1HPZ A;  1QUV A;  4C48 A;  5KT5 A;  2VU5 A;  1SUQ A;  2RQK A;  2QEX S;  2IM0 A;  3D3B J;  2ZOG A;  2ZUG A;  1TKZ A;  3BDG B;  3QZ8 A;  2NZC A;  2M52 A;  2BE9 B;  3QT8 A;  3Q8S B;  1JLA B;  1RAB B;  3KJV A;  2EK1 A;  3PX4 A;  2IYG A;  1S9E A;  1Q1K A;  3E01 A;  3OL9 A;  4DV7 J;  4NLQ A;  3NVL A;  4D3G A;  4Q8F A;  1KVK A;  1JLA A;  2XGP A;  1FX2 A;  2YX1 A;  4K0K F;  2RIJ A;  2ZD1 A;  2EFQ A;  2GVZ A;  2ZEJ A;  5L1K A;  1NK4 A;  1ED9 A;  1XN9 A;  1S1X A;  1TU0 B;  1UFK A;  2U2F A;  1EX8 A;  2Y0S D;  2CPF A;  3OFH A;  2JEF A;  4N5S A;  1OIA A;  1S7H A;  2MZR A;  3LWM A;  1CJK B;  2CFX A;  3A3O B;  4FZV A;  1RHU B;  2C2M B;  2QSF A;  2F8E X;  3EYZ A;  3UN2 A;  1RWP B;  2PT0 A;  4HHH A;  3IN5 A;  4PQU A;  1W2B R;  1PJ5 A;  5JVH Q;  1YBU A;  2CQP A;  2OSQ A;  2RML A;  3CMQ A;  4USI A;  1B7Y B;  3K57 A;  4QCL A;  3C15 B;  3ILL A;  1EKS A;  2QZU A;  4ZG6 A;  2LXF A;  1FFS B;  4DFJ A;  2OPP A;  1WC5 A;  3S6E A;  3HHL C;  2LA4 A;  3U1L A;  5C42 B;  2DJW A;  1GH8 A;  1NK9 A;  1UVM A;  2YNG A;  4MKY A;  2X51 A;  4WK1 A;  1EJJ A;  2QJ3 A;  3CW2 C;  4YB6 A;  2HGN A;  3UQS A;  3MMJ A;  4X84 A;  4F0M A;  1UET A;  4J9L A;  4ZPA A;  4NWB A;  3P6Y C;  2XS7 A;  3PRD A;  1XEZ A;  2GS8 A;  4DDF A;  3SEO A;  3Q8V A;  5SZT A;  3JQM A;  3AB2 B;  2XUL A;  3DU5 A;  1B4S A;  1SL2 A;  4JI7 J;  3P5B P;  2BVZ A;  1JJ4 A;  3F56 A;  1FJE B;  4MY4 A;  1RA6 A;  2EWH A;  4ID5 B;  4KHR A;  4WFB Q;  2E1C A;  5CQG A;  5C24 B;  5KFB A;  1IR2 A;  1T7P A;  3CJK A;  2MZQ A;  5DS7 A;  5D6G A;  1C1C B;  1URN A;  3MM8 B;  3TAP A;  2HZV A;  2HHH F;  1TK0 A;  1X4C A;  2H48 B;  2FD2 A;  1AJA A;  2VDH A;  1ZAW A;  1FXD A;  2JWN A;  3RRG A;  1RYR A;  4ZLN A;  4Q0B B;  2HS3 A;  2PEB A;  4X4T A;  4R25 A;  1EI6 A;  1NUE A;  4QWA A;  3G4S S;  1UA1 A;  1OSD A;  1SKW A;  2KG1 A;  2W7O A;  2DNY A;  2P9E A;  4B3O B;  1O6X A;  2VZ9 A;  3Q0A A;  3MI7 X;  5IC4 B;  3NS5 A;  1RT1 A;  5H1S V;  4I2P A;  3TX8 A;  2CWK A;  2E1A A;  2BE7 D;  5D4P A;  4RBV A;  4B3M F;  1ZM3 A;  2AF6 A;  5IFM A;  1FNX H;  3EXY A;  1VK8 A;  2VHG A;  2QTW A;  3R97 A;  3OJU A;  2N3O A;  5HVF A;  1YGY A;  3QMQ A;  2AWZ A;  1XC9 A;  2MYF A;  2D9P A;  1K1S A;  2RF2 B;  3WX4 A;  4CNZ A;  4H4M B;  3ITH A;  1X4E A;  1GQE A;  2RUG A;  1X8D A;  2FZG B;  3RU0 A;  5HQM A;  5TJ3 A;  2JVR A;  2OKQ A;  4K2X A;  3NKM A;  5IC6 B;  4C0O C;  2LEC A;  2I1R A;  1IBM F;  4EK2 A;  4Q44 A;  4OX9 F;  3TA0 A;  2V0N A;  4UOG A;  4CRJ A;  1AFI A;  3JQJ A;  1RTZ A;  2DH8 A;  1FVS A;  3A8E A;  3S1T A;  1ALH A;  1N54 B;  4QJV A;  2FHO B;  4WPA A;  2GGP B;  2MKY A;  1MRO A;  1KFS A;  1YKW A;  4OZN A;  3HJV A;  3N01 A;  4QPT A;  3QT6 A;  4KIA A;  2R2T A;  1JLQ B;  3L7P A;  2ZH2 A;  1IBK J;  4CH7 A;  4LFB F;  1HYS A;  3QID A;  4PQA A;  1I6J A;  3L9Z A;  4GVL A;  4ZHR B;  1TAQ A;  3TJA A;  1WEY A;  2XLK A;  2KHD A;  3E2E A;  1F3F A;  1X5P A;  1HQU B;  1DLO B;  2VQF F;  1TKD A;  1ZOT A;  4N8N A;  4TY9 A;  4NLP A;  1PC5 A;  1Q5Y A;  1NRK A;  1K44 A;  4ZIW A;  1JJ2 R;  1MNE A;  1PC4 A;  1YBA A;  1NKB A;  4YEA A;  5LJ5 Y;  3RAX A;  1D9D A;  3M8Y A;  4AXJ A;  4NOH A;  2CXE A;  3NRB A;  3DRS B;  1CJV B;  3NWG A;  1NDL A;  2XQC A;  1VOM A;  2GO9 A;  2DGQ A;  4IFV A;  4OJH A;  1SH3 A;  4URS A;  4ZVE A;  3GV8 B;  1Y0H A;  2WOM B;  3UNG C;  1RTD A;  3UDL A;  3TZW A;  3LP1 B;  2M3D A;  3QBC A;  3SFG A;  1P8G A;  1GFW B;  2CZ4 A;  2XI3 A;  4AD6 A;  4WZQ A;  1WUU A;  1OY6 A;  1U2F A;  3CDE A;  3MPD A;  1KLN A;  2BBE A;  2W5X A;  5HQL A;  1C1B B;  2ERR A;  1ELZ A;  2F63 A;  1R3N A;  1WSV A;  1ZM2 A;  3MFI A;  3J7A N;  1JLG A;  1R8P A;  4DCO B;  3KK3 B;  1HNX J;  1RLC L;  1RT5 B;  4Y2K A;  1PIL A;  3NGD A;  4O0I A;  3L3C A;  4QWC A;  1B8J A;  3QT5 A;  2VON A;  2CZ9 A;  2VBY A;  2GC8 A;  2IJF A;  5D4L A;  3T6B A;  4ZN1 A;  5C5J A;  2AJF E;  4YR0 A;  3NG8 A;  4CXU A;  1WC0 A;  2O5D A;  4MYT A;  3R5G A;  4NLW A;  1C1B A;  5B7W A;  1VQY A;  3GV7 B;  2XB2 D;  2RB7 A;  5LIA A;  2SXL A;  1UWA A;  1WHV A;  3CJS A;  2X1F A;  3R2D J;  3QGG A;  2IVY A;  2M5Y A;  3PYD A;  2UUA J;  2EFO A;  5HJX A;  4LF4 F;  3W3S A;  5C66 A;  5BXI A;  4USU A;  2MZJ A;  1ZM4 A;  1NH8 A;  4U96 A;  1FK9 A;  2N3L A;  3NLC A;  5DJB A;  2VB6 A;  4DPT A;  1RWK B;  2FUG 9;  1U1Q A;  3SV4 A;  3BKT A;  2BR0 A;  2MPU A;  5KG0 A;  1U45 A;  4V19 X;  4PG4 A;  4HDH A;  3DXB A;  4OV6 A;  3FZB A;  1N2K A;  1NME B;  3NS6 A;  4A46 A;  4OYB A;  1H3D A;  3H2V E;  1PGZ A;  3IWN C;  1ZEB A;  5E2Q A;  1LW2 A;  4H4O B;  1T03 A;  2J6S A;  4H4O A;  4UPK A;  2DBB A;  1YSJ A;  3J80 Y;  5IOL A;  3SQO P;  3CCJ S;  3WDO A;  3KLE B;  1JWW A;  2C3Y A;  1X5T A;  2UXB J;  3HHN B;  1KKH A;  3M2V B;  3KLH B;  2H1Y A;  2BE2 A;  4EFA C;  3KLG B;  2C22 A;  1QSY A;  2F5G A;  2DR7 A;  3B54 A;  4JI5 F;  3U1M A;  4FVC A;  3LGM A;  1RAG B;  3CJ4 A;  4IDK B;  2XS2 A;  2CQG A;  1M5S A;  1T02 A;  2JOQ A;  1T95 A;  5HK4 A;  4PQU B;  1F5A A;  3TZZ A;  4GTW A;  3A13 A;  5GMD A;  1VCT A;  1JLB B;  1VRU B;  2ZOM A;  1ZA2 B;  3IAS 9;  2GHP A;  4WFA Q;  3VAJ A;  4ZP8 A;  3VZH A;  3O5T B;  4RNM A;  3FFI A;  5M2P A;  2R7U A;  4WWS A;  3WC2 A;  1OY9 A;  4NZ7 A;  1U25 A;  3GWC A;  2AU0 A;  3QNW B;  2HVE A;  2W2P P;  5LT5 A;  2ILY A;  5IT9 U;  3FSX A;  5U47 A;  3Q89 A;  1VC5 A;  1ZTW A;  2MQ8 A;  5J1E B;  1RJJ A;  5ITH A;  2IRU A;  2OML A;  3N6M A;  4EZ6 A;  3J7A 1;  4IDK A;  1RAO A;  2HHS A;  2W5S A;  2MMY A;  2OAU A;  5EWE A;  3GR0 A;  4OZL A;  1AT1 B;  3MK1 A;  3DI6 B;  2VA2 A;  3PX6 A;  4YHH J;  4K4T A;  3C3L A;  4NZ0 A;  2E5L J;  2RIL A;  3EM1 A;  5BJR A;  4WZM A;  1IKV A;  3DM2 B;  2J8A A;  2OLW A;  3MCO A;  4HEA 9;  3I55 S;  1HNX F;  2QLX A;  3PCO B;  3BQ1 A;  2JX2 A;  4I2Q B;  4QIV A;  4RBT A;  3CCU S;  4M94 A;  1HW9 A;  3I9Z A;  4Q2M A;  3TQE A;  4OFZ A;  4XPE A;  2GVD A;  2W7A A;  1VQP S;  4ZPV R;  2FY8 A;  2ROE A;  4N76 A;  5K8M A;  2W9A A;  2DO0 A;  4O3S A;  2BA9 A;  1OQ6 A;  4JI2 F;  1FEE A;  2DNO A;  1TZ0 A;  3HJF A;  1RTI B;  4U7U K;  3KLF B;  2PC6 A;  3D5M A;  2OPS A;  3EZU A;  4XTT A;  3V2U C;  5KT6 A;  4JYA J;  5IT9 Y;  1U6Z A;  3IGV A;  5F3Z A;  4LF1 A;  2G2O A;  1ZA1 B;  4ED4 A;  1FCA A;  1YJR A;  1S0V A;  2BZ2 A;  4DI6 A;  3H4B A;  4NA1 A;  4FXW A;  2X1B A;  1TKT A;  2DY9 A;  5E3P A;  1RP5 A;  1X60 A;  4QYZ K;  1IBL F;  4CZC A;  2E9T A;  1MN7 A;  4DS4 A;  3V4I B;  1RT2 A;  1AJD A;  4RW7 A;  1RYS A;  2EC0 A;  3BPS P;  2MST A;  1B7F A;  3IC1 A;  3EGW B;  4DV5 F;  1T05 B;  2XMV A;  3H2U B;  2VOD A;  2FJW A;  3JS9 A;  3MMB A;  4CLF A;  3KG0 A;  3BDE A;  3MM6 A;  2C3M A;  2KFN A;  2BKP A;  2HGL A;  5CD4 A;  5KFI A;  3VAG A;  4KT0 C;  3HT0 A;  1CPZ A;  2A6O A;  2W9B A;  4FBU A;  2HND A;  1HFE L;  3QSI A;  4ES1 A;  3DN9 A;  4O3O A;  1KHW A;  1HPZ B;  2AJ2 A;  4P7V A;  3PAC A;  4DPO A;  5EX0 A;  4LIW A;  1N5Y B;  5EGH A;  3HLU A;  1U1L A;  1T0T V;  2RU9 A;  5HP1 A;  2YWH A;  3V6J A;  1CEZ A;  3DYA A;  4HL9 A;  2V34 A;  1OY8 A;  2BQR A;  2R9L A;  4QBU A;  1CQM A;  3R2C J;  2AIR B;  2PO4 A;  5DZ7 A;  1YI2 S;  2V9K A;  2FHM A;  4RKU C;  2CNK B;  1QUP A;  1RT3 B;  3GFX A;  5J1P A;  3MAH A;  3SSS A;  2QSW A;  2M88 A;  2V94 A;  4QR0 A;  3EGN A;  2YX7 A;  3CDB A;  4DG1 A;  2CJ9 A;  3NAH A;  5B0B A;  3Q86 A;  4I56 A;  4FBT A;  2Y8W A;  3KOA A;  4ZCM A;  2AV5 A;  3E51 A;  4B08 A;  1R7I A;  2DB1 A;  1JKH A;  4O0N A;  4DV0 F;  3EVM A;  2BRK A;  5K8O A;  3VCD A;  3UR0 A;  2KG0 A;  4DV7 F;  1IUJ A;  3T1Y J;  4DPX A;  3RAQ A;  3QJP A;  2QGF B;  3C16 B;  2QA4 S;  4NLS A;  4RNH A;  4RW6 A;  3IFE A;  3AOC A;  1UW9 A;  3GCW P;  4DV2 J;  1DFD A;  2K1R A;  3FRZ A;  3EZ5 A;  1PYO B;  2FIU A;  2XNR A;  2UXD F;  3CVK A;  3PRB A;  1N33 J;  1JK9 B;  5EWG A;  2G1H A;  4ILR A;  2HK3 A;  1RWV B;  3B82 A;  5DM6 Q;  1TL1 A;  3M1V A;  3MR7 A;  4C7Q A;  4CO3 A;  4F25 A;  2VC0 A;  1H73 A;  2WBR A;  3M2U A;  1M5P C;  1TL7 A;  2HHQ A;  1HLW A;  2BAB A;  3F0N A;  4Y3C A;  1N6Q B;  1SXL A;  3HVR A;  4OJ1 A;  2NXE A;  3LP1 A;  3LF0 A;  2HYI B;  4GO5 X;  4OI4 A;  1Q5V A;  4WU2 A;  4A8X A;  3KLI A;  3FJ2 A;  3KLF A;  2LCW A;  4OYW A;  3QLH A;  2KI2 A;  5KT4 A;  1IKX A;  1F9F A;  1NPR A;  2FHJ D;  2DHH A;  2VG6 B;  4A8Q A;  1U1K A;  3HMJ G;  4ERD A;  4LF4 J;  4MIV A;  4KHP F;  1MLA A;  2XCP A;  3CCV S;  2Q66 A;  3BH7 B;  3BS9 A;  4A8O A;  3I0S A;  2HHV A;  1NHK L;  3OFF A;  3QGH A;  1KC8 T;  1S4E A;  3LA0 A;  5AJ3 F;  3O2I A;  3Q8Y A;  4CO4 A;  1LWF B;  4RW4 B;  3D6F B;  3V6D B;  1QSS A;  4B9U A;  4J9K A;  1RAF B;  2NZ4 A;  2DIS A;  4LF7 F;  2GCF A;  2HS0 A;  2JHE A;  1APS A;  5I3U A;  1RI7 A;  2DHA A;  5CYM B;  3THT A;  1TVR B;  1LWF A;  1Q82 T;  2UP1 A;  3FRY A;  3VHQ A;  2PA3 A;  3QRQ A;  2ADC A;  2BUN A;  1TVR A;  2PSZ A;  4OYM A;  1VC0 A;  2HFV A;  4UUX A;  3P96 A;  3DLE B;  5H9F J;  1IBC B;  4J9U E;  2W8D A;  2NR0 A;  5D0E A;  3IRW P;  2ASL A;  1SUQ B;  1I51 B;  2CPI A;  2XYG B;  2BQ3 A;  3D28 A;  3KLE A;  1PCA A;  2R7Q A;  2CVI A;  3BSC A;  4KPC A;  4ZGA A;  3CC4 S;  1ELO A;  1IKW A;  3SCL E;  5HMY A;  2AGO A;  3HVW A;  2J7U A;  2ROG A;  6FD1 A;  5KFD A;  3MEE B;  1MW7 A;  4Y28 C;  1DQ8 A;  5ETO A;  1PO6 A;  4WJB A;  5ETM A;  5A8K B;  5JJB A;  2UVU A;  1UVL A;  1NK5 A;  2V2K A;  3I9V 9;  4USM A;  5DQG A;  2HZC A;  2CG4 A;  3PG9 A;  2VOO A;  4I67 A;  2APO A;  2B51 A;  2W24 A;  2XCA A;  2YQ0 A;  2BE2 B;  3BBF A;  1Y3J A;  3DHX A;  4H4K C;  4I6W A;  3LUY A;  2Z2M A;  2GLQ A;  5A0Y A;  3OXF A;  4AFF A;  2F3J A;  2FJE B;  4A8W A;  3H20 A;  4HYK A;  2EI5 A;  3M8W A;  3UW1 A;  4WCE Q;  1S1W B;  5B0D A;  4UY8 T;  4NCG A;  1NDP A;  2UZA A;  4P2S A;  3FFI B;  1RAI B;  3R7B B;  4YHH F;  5F0W A;  1Q86 T;  3NGR A;  4OLO A;  1FSU A;  1N32 J;  2ZKT A;  2VQE J;  2XR9 A;  2D69 A;  1VQ9 S;  4HR2 A;  1ANI A;  1U2C A;  3RR7 A;  2ZZN A;  2YQ1 A;  3B6B A;  1G7C B;  4KGM A;  5KFQ A;  4AQY J;  3DNC A;  4ZPT R;  4EMD A;  4QIG A;  1T11 A;  3LGH A;  4PXC A;  4NI2 A;  4OZ1 A;  3DDI A;  3VGV A;  2J0Q D;  2IUC A;  3HSG A;  4B3S F;  1JLC A;  5I42 B;  1HI1 A;  5HI7 A;  1KQF B;  1UVN A;  4E8U A;  3ET6 B;  2Y8Y A;  4OJ3 A;  1O99 A;  1MU2 B;  1K47 A;  1Q16 B;  2JZ5 A;  4MIA A;  2C2R A;  1KH7 A;  3SYZ A;  3MHY A;  1HIY A;  1ELY A;  3HSZ A;  2ZH7 A;  3IM8 A;  3VR1 A;  4N41 A;  1S6P A;  3DRY A;  1JJC B;  3H8Y A;  4U67 Q;  4JI6 F;  2CPE A;  3CJ0 A;  2KM8 B;  2V4Q A;  4P52 A;  3T1H J;  1QAX A;  1NK7 A;  2V4J B;  1SJ4 P;  1N34 J;  1LWE A;  2ZBC A;  4C4W A;  2V69 A;  1HWU A;  3T6J A;  1Q8K A;  3EGV A;  5AJ9 A;  1RAD B;  3CJQ A;  2DIT A;  3W2W A;  3LP0 A;  4B3R J;  1PSD A;  5F8L A;  4A8M P;  1M5O C;  3PYG A;  1T3O A;  3P45 B;  8RUC A;  1BQM A;  4F26 A;  2X98 A;  5CXT A;  1D09 B;  3R5J B;  3CD7 A;  3BO2 A;  1U1P A;  5GRR A;  3P49 B;  4LQ3 A;  2OI2 A;  2XHC A;  2XSJ B;  1E1Z P;  4FPI A;  1EP4 B;  3JSY A;  2FYX A;  4C0B A;  3TI0 A;  1KBR A;  1SH2 A;  1SKU B;  1N0V C;  2J9E A;  4USV A;  3R9L A;  2UVR A;  2V4R A;  3R27 A;  3Q8R B;  3A8I A;  1S79 A;  2KO1 A;  2PEH A;  3QRR A;  3OLB A;  1S1V A;  1RCO B;  1UJ4 A;  4LRF A;  2J6U A;  4RWW A;  3AD8 C;  4TU8 A;  3JYT A;  5KFX A;  3TO8 A;  2XBP A;  3DRP A;  4M63 A;  4AL7 A;  4YY3 F;  3QAT A;  4K4U A;  4IG0 B;  2GIR A;  3HZG A;  3TJ9 A;  5L1I A;  4DZ6 A;  3N0V A;  5CD4 H;  4LRE A;  3T02 A;  3D0H E;  3QYY A;  1N5T A;  3MM5 A;  5A2Q U;  4C9D A;  2VPW B;  1U47 A;  4JI1 F;  4M95 A;  2OFG X;  3E3X A;  3KHH A;  1LK5 A;  1O5J A;  1WKK A;  4ICL B;  5IQ6 A;  2G9Y A;  2W5Q A;  1Z2L A;  3GMG A;  3CSK A;  3LW5 C;  3CJ5 A;  1GXL A;  3NGU A;  3TNV A;  5IV3 A;  1RWW B;  2VKR A;  5IT4 A;  2LQ5 A;  1R0A B;  1TEL A;  2VOP A;  3SZY A;  4NLY A;  4E2F B;  4IH6 A;  2EBE A;  2XO6 A;  1WC1 A;  5INH A;  4F2R A;  2J0W A;  1TL4 A;  2QRR A;  3NXZ A;  4JI5 J;  1U8S A;  5F0U A;  3T5L A;  3EJM A;  5D3G B;  3A4T A;  3ELH A;  1CJV A;  1L3K A;  4MK7 A;  4B9T A;  4HT5 A;  2QA2 A;  1WHY A;  2CKW A;  2RD5 C;  3ENV A;  4WE1 B;  2VA3 A;  3CD6 S;  3SXL A;  1JMT A;  2B3T B;  3DRX A;  3OXG A;  1T9U A;  1T9W A;  4HI1 A;  3T1A A;  3CMA S;  3DOK B;  2FVR A;  4V19 J;  4ECS A;  2EVZ A;  3ZNJ 1;  3PR5 B;  1JIH A;  4RW6 B;  3SV3 A;  1XNR F;  1VMB A;  1HQU A;  4QPX A;  4QYZ J;  4OQJ A;  4DQI A;  2NCK L;  2ZH8 A;  4N7T A;  4USW A;  2GVD B;  2B6A B;  5DG9 A;  1HWK A;  1CQN A;  4X4S A;  3GII A;  1E33 P;  2IIH A;  1SJ1 A;  2RRB A;  3HHL B;  1BMQ B;  4DUZ J;  4NXN F;  5HQ8 A;  3QWU A;  3EGZ A;  2XZD B;  1OPI A;  4IRK A;  3C6T B;  2EC2 A;  3OPK A;  3OLA A;  2WOM A;  2AGQ A;  2V6A A;  2MGZ B;  1S6Q B;  3LAN A;  4PYD A;  3BZQ A;  3M2R A;  1HBU A;  2M7S A;  4ZIV A;  5BYS A;  1U0H A;  3RBX A;  2W4D A;  4LUB A;  1O51 A;  2J0X A;  2J9C A;  2V8D A;  2UUT A;  1SC4 B;  1FK9 B;  4L3N A;  3FUY A;  1KVI A;  3HHL A;  3K8W A;  1QY7 A;  1HBN B;  1NPP A;  3HK2 A;  1S49 A;  2YX4 A;  5IV4 A;  3KJF B;  2KXN B;  4ZPB A;  2D1C A;  2HVH A;  1EAY C;  3AA9 A;  3ILO A;  4IO1 A;  2FPH X;  1UWB B;  1HA1 A;  1A7G E;  1YDL A;  2DNK A;  2HLT A;  2UUW A;  3FMW A;  3M7V A;  4B3M J;  1RBA A;  3A8J A;  1M90 T;  3IM9 A;  2RRA A;  2LU2 A;  2A2D A;  4YQW A;  4NMX A;  4CLU A;  3BF4 A;  2FVS A;  5T41 A;  3DLJ A;  4J9P A;  3RBD A;  4JBC A;  1AZS B;  3D68 A;  2R3V A;  5DGA A;  4YDD B;  3D67 A;  3BDF A;  4ZLJ A;  1I94 F;  1KON A;  4WP9 A;  2GMJ A;  3O3L A;  2HQG A;  4CH0 S;  3BPD A;  4DU7 A;  1J27 A;  4OMF G;  5KT7 A;  1AZS A;  2CVE A;  2XMJ A;  1T8E A;  4PG6 A;  1MRO B;  5AXL A;  2BRL A;  2P6T A;  4C11 B;  1AYE A;  5HVG A;  1K9M T;  4LF5 J;  5D3G A;  1F9E B;  2IVM A;  3R5A A;  1TTH B;  1Y5N B;  5HMW A;  3MGJ A;  3K0J A;  2B8Q A;  4JI3 F;  4QWD A;  4KRW A;  1KLM A;  2BJ8 A;  1VYA A;  1URA A;  2B9Y A;  3D6M B;  1RAC B;  4H54 A;  4O3N A;  3RB0 A;  3QGI A;  4F0H A;  2GAG C;  2BW7 A;  2IM2 A;  3LH2 S;  1WOS A;  3BQ0 A;  4LVO P;  1MG7 A;  5AE1 A;  3A8K A;  3NGK A;  3CCM S;  4DL2 A;  4EEY A;  2RAQ A;  4WKR A;  1TKX A;  4HHU A;  4YR1 A;  3H5Y A;  1DTQ A;  1JLF A;  1ITP A;  2D3O 1;  2Z2L A;  2DXE A;  2E7W A;  4NLT A;  5F8N A;  3IRX B;  4RUB A;  3OW2 R;  1VC6 A;  5L1J A;  2OO4 A;  5AJ3 J;  3Q8P B;  1VBZ A;  1RAA B;  1BQN B;  2N4C A;  4OI1 A;  1S9G B;  2XO7 A;  4J5O A;  5GAG I;  1WG1 A;  2BDP A;  4KM4 A;  4C8L A;  2C3U A;  4WBF A;  1AFJ A;  1N5Q A;  2IDL A;  2X3D A;  2MJU A;  3F41 A;  1RLD A;  1WEX A;  3TA1 A;  5CAA A;  2RU3 A;  2XRG A;  1S6O A;  3PXG a;  3IAM 9;  2DNG A;  2XZT B;  4C6A A;  4GC6 A;  4JOU A;  3NNH A;  3AA8 A;  2HS4 A;  3P3D A;  4Y0F A;  1S0M A;  1XR5 A;  3U7J A;  4CLL A;  4J9O A;  4PAB A;  3CJK B;  2AX1 A;  1Z1Z A;  5AE2 A;  1BQM B;  4CCH A;  1U8W A;  2C2K B;  1DZ5 A;  1IR1 A;  3OR1 B;  4NLR A;  1QSL A;  2MKH A;  1Q8B A;  3M32 A;  4X66 J;  1RE1 B;  2AJQ A;  4P2F A;  1JX4 A;  2VJV A;  4ELT A;  4ZCL A;  2QT7 A;  2JEG A;  2ABY A;  3BO4 A;  1F1B B;  3HVT B;  4MMO A;  3BGL A;  4O44 A;  4ECT A;  2HNZ A;  4LR2 A;  2HNY A;  3N79 A;  2MB0 B;  3LXQ A;  2MKC A;  4J9N A;  4WFZ A;  1S48 A;  2F40 A;  3C6U A;  3O8W A;  4O44 B;  5D78 A;  5KFZ A;  2B9E A;  2W5R A;  3KMQ A;  4LMZ A;  4RPF A;  3R6L B;  1RB0 A;  1YX2 A;  3M8R A;  1SQG A;  2E44 A;  2HHX A;  1T9T A;  4DV0 J;  4AQY F;  3M32 B;  4IQX A;  3M4X A;  3MR6 A;  1V3R A;  2I5J B;  2EBG A;  2OMO A;  3C19 A;  1NXI A;  2CQ2 A;  1HDH A;  1REV B;  4ZVT B;  2LQ9 A;  4UZB A;  4LSN A;  1CS4 B;  3HZE A;  3L7U A;  5K20 B;  3G6Y A;  3H2L A;  2LA6 A;  4UOF A;  3ILJ A;  5CAB A;  1J5O B;  4G3I A;  3BDG A;  2QA4 G;  1F60 B;  1KS2 A;  2CAD A;  3R6G B;  3T9Z A;  4EU0 A;  4X65 F;  4Q43 A;  3UCZ P;  1S99 A;  4A48 A;  2PMH A;  4ZVP B;  4DSF A;  3QJJ A;  4BC7 A;  4A8F A;  2LU1 A;  1JLQ A;  4NA3 A;  2RVJ A;  2W9C B;  1HYS B;  3PW7 A;  4OZJ A;  2CJA A;  5ETK A;  3ENQ A;  4ZOS A;  3ZZO A;  3MK0 A;  2QMU B;  3CB4 A;  4MYU A;  5A0Y B;  2OP5 A;  4CO2 A;  4F04 B;  1TKZ B;  4M5D B;  4A8Y A;  1XMQ J;  5DRK A;  1FRL A;  2AYE A;  1VIX A;  1X4D A;  3AOA A;  2G2Y A;  5B0E A;  4M5K A;  5KFW A;  1MSW D;  5EHH A;  2C3O A; 
#chains in the Genus database with same CATH homology
 1N2K A;  4B56 A;  4UPH A;  1ZEB A;  3T00 A;  4LRC A;  3TWZ A;  1P49 A;  1AJA A;  4ZG7 A;  1AJB A;  5AJ9 A;  3OT9 A;  5GOV A;  3A52 A;  4UPK A;  3BDF A;  4LR2 A;  2ANH A;  2X98 A;  1EI6 A;  4KAV A;  1KH9 A;  1EW9 A;  1ALK A;  5GRR A;  1KH4 A;  1E1Z P;  1KH5 A;  5DLV A;  3NKP A;  1ALI A;  4GTW A;  3NKO A;  2D1G A;  4UOR A;  5L0K A;  4CYR A;  4NWJ A;  1K7H A;  1URA A;  4LQY A;  3WAV A;  5K4P A;  3WAW A;  4YR1 A;  4LRF A;  1ZED A;  4LR8 A;  5IJQ A;  3KD8 A;  5DLW A;  5TJ3 A;  4LR7 A;  4MIV A;  3NKM A;  4KJG A;  3SZZ A;  2W5W A;  3NKN A;  2W5S A;  1E3C P;  4LRB A;  2W5V A;  3Q3Q A;  1KHN A;  5EGE A;  3MK1 A;  1ALH A;  4LRE A;  3T02 A;  1ED8 A;  4KM4 A;  4UPL A;  5LQQ A;  1KHL A;  4CYS A;  5L0B A;  1KHJ A;  4KJD A;  4LRA A;  3UN3 A;  2XRG A;  3B5Q A;  1URB A;  2G9Y A;  3ED4 A;  2W8S A;  1ELX A;  4CXK A;  3UN5 A;  3CMR A;  2GSO A;  3NKQ A;  4MHX A;  3SZY A;  4LRD A;  4FDJ A;  4TN0 A;  5HRT A;  2VQR A;  3MK2 A;  4GTX A;  5INH A;  3E2D A;  2GA3 A;  3UO0 A;  2W8D A;  4UOP A;  3IDD A;  1ALJ A;  1AUK A;  1FSU A;  4QAX A;  4CXS A;  4UOO A;  4ZGA A;  1Y6V A;  3M8Y A;  1ANJ A;  5KXA A;  1AJC A;  3BDG B;  4MY4 A;  3WAX A;  4ZG9 A;  3NVL A;  1AJD A;  1O98 A;  1SHQ A;  3NKR A;  4GTZ A;  2RH6 A;  5IJS A;  3LXQ A;  1ED9 A;  3DPC A;  2W5T A;  2GLQ A;  5LRM A;  2W5X A;  4N7T A;  2W5R A;  1E2S P;  1ELZ A;  1E33 P;  3WBH A;  5LRN A;  3M8W A;  1KHK A;  3UN2 A;  3UNY A;  2W5Q A;  3TX0 A;  3DYC A;  4FDI A;  1EW2 A;  2IFY A;  3BDH A;  2QZU A;  1ZEF A;  4ZG6 A;  1HDH A;  2ZKT A;  1B8J A;  2XR9 A;  1HQA A;  5EGH A;  3M8Z A;  1SHN A;  3IGY B;  1ANI A;  3BDG A;  1Y7A A;  4CXU A;  1EQJ A;  1EJJ A;  5DLT A;  5LIA A;  4UPI A;  2IUC A;  4GTY A;  5C66 A;  1N2L A;  2IUC B;  4KAY A;  1EW8 A;  1O99 A;  3MK0 A;  3T01 A;  3TG0 A;  1KH7 A;  2GSU A;  1HJK A;  4NWX A;  1ELY A;  3M7V A;  3WAY A;  3IGZ B;  5L0E A;  2GSN A;  4LR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...