3UO0A

Phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3uo0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3uo0A01
3IGYB 3UNYA 3MK2A 5EGEA 1K7HA 3IGZB 4LR9A 5LIAA 5GOVA 3UN5A 1O99A 2VQRA 3LXQA 3MK0A 1KH4A 2G9YA 4GTWA 3KD8A 2GSOA 3SZZA 2XR9A 1AJCA 3Q3QA 1ED8A 1ANJA 1E33P 1SHQA 4NWJA 2W8SA 1ALIA 5L0KA 3M7VA 5EGHA 4LR8A 1HDHA 1ZEFA 3A52A 1O98A 3E2DA 4ZG9A 4KJDA 5C66A 4LRDA 4LRFA 3NKOA 1ELZA 3ED4A 3WAYA 3T00A 4KM4A 5LRNA 1EW8A 3WAWA 2W5SA 3NKMA 4LR2A 2W5VA 2W8DA 1KHJA 3NKQA 3NKPA 4MY4A 3CMRA 1B8JA 4UPIA 4QAXA 1ED9A 1EI6A 1N2LA 4CXKA 4MHXA 2IUCA 1SHNA 3BDHA 2GA3A 5DLTA 1KHKA 4FDIA 5GRRA 1EJJA 3B5QA 4KJGA 2QZUA 4LQYA 4CYSA 1KHLA 3T02A 4ZGAA 3IDDA 5DLVA 2GSNA 4UOPA 5L0EA 3NKRA 4ZG6A 1Y7AA 2GLQA 5AJ9A 3OT9A 2ZKTA 1AJBA 4ZG7A 3TG0A 5LRMA 4UPHA 5LQQA 3BDGA 2IUCB 1AJAA 3NVLA 4CXSA 2IFYA 3M8YA 1ZEBA 3BDFA 2W5XA 2D1GA 4GTZA 5IJQA 3TWZA 3M8ZA 1AUKA 3WAXA 3UO0A 1AJDA 3SZYA 2W5TA 1KH7A 4TN0A 5IJSA 5HRTA 4FDJA 1EQJA 1HQAA 4KAYA 1KHNA 1URBA 4UPKA 4LRBA 2RH6A 4GTXA 3T01A 1ELYA 1ALHA 4CXUA 1ALKA 1FSUA 5DLWA 4YR1A 2W5WA 5K4PA 1Y6VA 2ANHA 2W5QA 4GTYA 3WAVA 1EW2A 3TX0A 3NKNA 4LRAA 1ZEDA 4LRCA 1KH9A 4CYRA 2GSUA 4NWXA 1ANIA 1URAA 4UPLA 1E3CP 1HJKA 4UORA 5INHA 1E1ZP 4B56A 3M8WA 3UN2A 4LREA 1ALJA 3DPCA 4LR7A 1N2KA 1EW9A 4N7TA 5L0BA 4KAVA 2XRGA 5KXAA 3UN3A 3MK1A 3WBHA 1KH5A 1P49A 2X98A 3BDGB 2W5RA 1ELXA 5TJ3A 3DYCA 4UOOA 4MIVA 1E2SP
chains in the Genus database with same CATH superfamily
1SKRA 1FK9A 4JYAJ 1WSRA 4DL6A 2RUSA 1OY8A 1XBWA 3CW2C 3IMQJ 4LF7F 2W2QP 2AX0A 2F3JA 4LF5F 2KM8C 2OUGA 5KFGA 3GB0A 5I42B 2LEAA 2DGQA 1B8JA 3PW7A 3EXYA 1ZETA 2C3OA 1DTTB 1HHSA 2CQBA 2B4VA 1H74A 1SQGA 2Y1JA 2B8PA 3QMQA 1BQXA 1H38A 4DV3J 5HRTA 3TA2A 3AA8A 1KKHA 3GJTB 4CXUA 2H54B 1ROFA 1N32J 1HMVA 3MEEA 1YSJA 1NJIT 2K06A 3FSIA 3EGWB 1F60B 2MKKA 1RU1A 5L1IA 4IH6A 3IC1A 2BQRA 2YWGA 3EZ5A 2KTQA 4U67Q 4ZHRA 1N52B 2XY7A 3NAHA 4LF9J 3JSRA 3GIKA 2PN6A 4YR2A 4R25A 3KDNA 1S4EA 3HO1A 3SCIE 2B9YA 3A52A 2J9EA 4G3IA 2J8AA 4AXIA 3CMAS 3NBPB 4MYTA 1SVDA 3AJDA 4USIA 2IBOA 1Q5VA 4L74A 3PYDA 3ICLA 5E3CA 1S79A 4YB5A 4B9VA 1D9FA 2JEJA 3WX8A 5L1LA 2HK2A 4KRWA 2L48A 1TL3A 4DL2A 3UCZP 4TN0A 5KFLA 5BR8F 2HKEA 2OD6A 2DT9A 3MM5B 3A12A 4NA2A 1N34J 2C2ZB 5E3PA 4WU3A 4TU7A 1VOMA 4MAKA 3ENWA 3GR1A 5EWEA 4DPWA 5LT5A 1DQ9A 5A8KB 2PFFB 2H48B 1NCLA 4J9NA 4NCBA 3U02A 3NNHA 1RT1B 1SCJB 4DJBA 2QC3A 2FHJD 4PR6A 3UPFA 2B7BB 1GMUA 3D1QA 4K59A 3KD8A 5GADU 2DY1A 2VG6B 3MMCA 4MYUA 4LT6A 2GMJA 1N48A 2PSZA 1KHVA 3UNGC 4FPRA 1U1PA 3MPWA 3NRBA 1WELA 3FCVA 1WC6A 4DR3F 1ZA2B 3HVTB 4OFZA 2XB2D 2HYIB 1NZAA 2ATCB 3EXCX 2VG5B 3MM8B 1K47A 3KMSA 2J0QD 5B0DA 1HYSA 1LXNA 1JNZB 3EGVA 1NO8A 2JNJA 4OI0A 1JLCB 5KFPA 1HBMB 3BGRA 1R8CA 2M70A 4IYQA 3MPUB 1J5OA 4X65F 1QAJA 2RH6A 3IXQA 3T19A 4C0HA 2HFZA 3CGIA 3SSQA 3OTOF 4K7QA 3FRZA 2XY5A 1TL7B 5HROA 1HJKA 2DGTA 3CVKA 1K73T 4XPCA 4X4VA 1BE4A 4A46A 4C8KA 2DHAA 4JV5J 2ILYA 1RCXB 1GMWA 3LO3A 2P5VA 4X4OA 3GV5B 3HM9A 3KOAA 3MM7B 1UJ6A 1RWOB 2GZOA 4ZPWR 1N0VC 1LWCA 1Q53A 4RWXA 1O6XA 1JK9B 2KL8A 1S72S 2PDAA 4JI1F 4B3SF 5EUHA 2QFIA 1VYAA 1PYTA 4KT0C 1SPBP 1RU2A 3CJKB 5KFVA 1EP4A 2QSWA 1HBUA 4D3GA 3LOUA 2V2QA 4Z2XA 1UEVA 4J90A 2CKWA 3CULA 3NY0A 1JLAA 1KOOA 1H73A 4HI2A 2W9BB 4ZVFA 1SJRA 3T01A 4JV2A 3T1AA 4UQTA 2HFVA 5B0AA 5C7PA 1U26A 1PJ5A 2CQ1A 1AUSL 2OPRB 3OUYB 4CYRA 1VS3A 3OTCA 4UORA 2C3PA 3HX9A 5CYMA 3S7RA 2OTJS 1UPPA 1YDLA 4F0MA 4KQZA 1LW2B 1RKIA 1U1RA 4QR2A 5D4LA 4A8OA 3PYEA 2B5JA 3BSOA 4DQSA 1TKTB 1KQKA 2DO0A 1ZPVA 3AXMA 3G87A 3ILOA 3NKYA 1S97A 1C2PA 1NJWA 3PHTA 2JFDA 4P2XA 1VRUB 1WF1A 2IM1A 4UF4A 2BJ3A 2L3MA 2YH1A 3F41A 3A3OB 3Q2TC 3TG0A 3A3PB 4I4BA 3W8PA 1R3NA 3JTNA 3POTB 2QGFB 1YK9A 4P72A 3MM6A 2QYCA 3IRXA 4YFUA 3C66A 5HVFA 1XK8A 3DI6A 4MKVA 1ICEB 4AQYF 2QMUB 4RWWA 8RUCA 1B7YB 1P1LA 2JEFA 3MR3A 4A48A 4EZ6A 1M5SA 1QAIA 4DQIA 1S1WA 2Q6BA 1WC1A 2FB0A 2YKOA 5HI7A 2M9KA 1W26A 4Y2IA 4ZLLA 1TV6A 4UQGA 5C2GA 1RUSA 4B9LA 3MM9A 4IO1A 1CULA 5C25B 1KH4A 2DY9A 3MTJA 2NYIA 3P45B 2LFVA 1VHFA 1D9DA 1SHQA 4J37A 4Q44A 2E1RA 2E5JA 2GFFA 1RHKB 4WTOB 4WFBQ 2G1HA 1X0FA 4K2JA 1B7FA 5HLFB 1KP6A 4CRJA 3M2UA 1MSWD 1GTEA 2HHHF 2F1FA 3LWMA 4P75A 2YWFA 1HNWJ 1KR4A 3LGNA 1RDRA 5EWGA 3SSRA 4IFYA 3MGJA 3J7ZT 2KFZA 3NGDA 1HI8A 1HNXJ 4NYPA 1GNKA 4UOHA 2W5XA 4KGVB 4PYAA 2FHJA 4I67A 2VASA 3DYAB 4NLPA 1CJKB 1X8DA 4UUXA 4ED7A 3LW5C 3T6BA 3VALA 2QX0A 1U7LA 3MAHA 1FERA 2HW3A 4ZVSB 2VF3A 2HSEB 2C3YA 1HPZA 5A0YA 2MQLA 3TVKA 3IFEA 1IR2A 3KLFB 3Q2SC 1FFGB 1X4BA 4WKRA 2ALYB 1MMDA 2MKIA 3R3TA 2YTCA 2ZBPA 4LFCF 2NR0A 1HDHA 1FKPB 3PRVA 3TZYA 1GX6A 2XS7A 3AD7C 2BEFA 2O5DA 2W5VA 1XC9A 4QIGA 4M5GA 1EZZB 2DCLA 1JJ4A 2HS4A 2CQ2A 4DFKA 5ETVA 3M32B 5EN1A 2DNOA 1VC0A 3IBWA 3L09A 3V5RA 3DLGB 4DV7J 2HLTA 2QA4S 3CCQS 4GTXA 2DYAA 2GHVC 1FX4A 2VG6A 5HO4A 4O44B 5KFYA 1ZEDA 3ZO7A 3KLGA 4IFVB 5AJ3J 3HVTA 2IM0A 1BQNB 2RT3A 2HZCA 3H0PA 2B9EA 2AJ1A 3JAMU 5I3UA 4CO5A 1MU2B 4G65A 1BUXA 2CPJA 1ZS6A 1N36J 2GJ2A 3R6GB 1JLEA 2BMBA 1EIYB 3I6PA 3Q89A 3RRHA 2CNNB 2N4CA 3BBFA 2FHMA 3DFEA 4Y2AA 2A1BA 1HR0J 3X1LB 2E7WA 2RAQA 2ZHBA 1UFLA 4AT1B 4ZLNA 4DV3F 5LMNJ 4F3QA 1N32F 4ED5A 3BDFA 4NRUA 4FYWB 4ILMA 5CH7B 5C2CA 3T5LA 1SH3A 2FJDB 1KVJA 2A3JA 3MR2A 3R1LA 2G0IA 1U2CA 2AX1A 4WK3A 5KFKA 1LQ9A 3GPAA 1FNOA 5ETRA 4EBCA 4LF9F 4ZOSA 1L3KA 1QE1B 2NLWA 2G4BA 3SQOP 4CT9A 2FPHX 5BYSA 4P9SA 2IJRA 3AFGA 4RW4B 1VC5A 2AJFE 1W25A 3TQ1A 2UZAA 1U0SA 5SZTA 2W9BA 2XNQA 4X66J 3NKPA 2YBVA 1K0TA 4HYKA 1U1KA 1TAUA 1ELOA 2ZH4A 1S1VB 1Y7AA 2CDRB 4X4SA 2HQIA 2VH7A 2ERRA 4L3KA 2C42A 1N34F 4M8LA 2BE7D 3I82A 2QJ3A 3M30B 2ZHOA 2GHWA 2YNGA 4AL7A 3ZC4A 4XDCA 3D9BA 4QU6A 1IWGA 1RT4B 1D1UA 2FTRA 1VCTA 4ERDA 1URAA 1FRLA 4F2SA 3K5MA 1VI7A 2DNKA 4ES2A 2UXBF 1VRUA 2CG4A 3E3XA 3CC7S 1YI2S 1SXLA 5CYQA 4I2PA 3C6TA 1RT3B 2A0FB 2QRRA 3QLHB 3FVYA 1UJ5A 3V6DB 1XIQA 5E41A 3GIRA 3BDPA 2Z4PA 2R3VA 1S6PA 4RL1A 2IC3A 3G6YA 3DRRA 3CC2S 3PW5A 3PCOB 2XYPB 1T9TA 3K58A 2FD2A 4OZ0A 3I0RB 1N2LA 3D54A 3UDVA 2F7VA 4OYZA 4V19J 3T9ZA 2J0WA 1J5EJ 5GADI 1HWUA 2DKOB 4EO8A 2BV3A 1VDHA 2FVCA 3M6VA 3AJ2A 4ER8A 2GX8A 1GXTA 4ZCKA 3UD5A 3THPA 2B56A 3OSPA 2YKQA 3I56S 4IO9Q 2HFNA 2LP4A 3KUEA 2CG8A 1FVQA 3G8TA 4JV5F 1RWVB 3NCRA 2NXEA 5KT6A 1UW4A 2W9AA 2AEMA 2F63A 4YDXA 1YJWS 2GO8A 1IR0A 3H25A 3H20A 4FF4A 1UW9A 3HSDA 2XYGB 1RTDA 2NCKL 1K7HA 1R0AB 4OQJA 1U47A 3DOMB 3W63A 2FUG9 1YKWA 4KBIA 2OEJA 1SC3B 1CS4A 1YRTA 4A47A 3U27A 4QPTA 3VAKA 3O1LA 3GR0A 4URGA 2GVDB 4CLFA 1EX8A 2DGVA 1WI6A 4I64A 3Q8QB 3BR8A 5A8RB 1HQEA 1KHKA 4CLSA 4EBDA 5KT7A 1NHUA 4FKXA 3CCZA 3DOLA 4IG3B 3QT6A 3CJ0A 2CNKB 3WZ0A 3KLFA 2R7TA 4DV2J 1APSA 4QYZJ 1QLNA 2G13A 1RTJA 4GTZA 5DETA 2I6WA 2HBZB 2CPEA 3DOKA 3FDSA 4DV6J 4KH0B 5B09A 5HN0A 3HFVA 5DG9A 4DU7A 4FF3A 1UWBB 4Y0FA 2XI2A 2ZBQA 1ZZNA 3I0SA 4DX5A 1UFKA 4AE5A 4YDDB 2ZFHA 1Y4ZB 2LA4A 4G1PA 4LSLA 2P6TA 4C2MA 5M2UA 4F36A 1ZH5A 3AXKA 4ZITA 4RW8B 1OSDA 1S4FA 1RWXB 2W25A 4CLUA 4FNIA 4ANCA 1SI9A 1CBKA 3MMBA 3IGVA 5GAGI 2W8LA 1KD1T 1VJQA 4O44A 2L41A 3CMRA 1CG2A 4KFBB 4CIOA 4QWAA 2MZ1A 2QLBB 2OO4A 3CSKA 2ZJQQ 4RW7B 5IT9Y 4PAAA 1HBOB 5JVGQ 1JIHA 3OBIA 1SL1A 2Z2LA 4RX6A 2A6MA 2ZKUA 2MDAA 3PY8A 3OLAA 1VLYA 2HGNA 1OYEA 2V8HA 2AJ4A 3N5BA 1IM6A 4A8SA 4K4VA 1T9YA 1TVRB 3DRSB 4DCPB 3VR1A 3V6KA 5HMZA 3NXZA 3Q22A 1TKDA 2GC8A 4NI2B 3NMRA 1SKUB 4WFZA 2BA9A 4V1Ak 3PKYA 4X4PA 3JSBA 5GOVA 2MGZB 3DLEB 3CDEA 4ZP9A 5AE3A 3Q3QA 4WP8A 3OXGA 4Q2LA 1TMJA 2R2TA 1HNWF 3CCRS 1O98A 3Q8UA 3M8RA 4LBPA 1N5QA 1U49A 3N6NA 2CZ9A 2V4JB 1VQ6S 3K8VA 2HHWA 2KN4A 2IUCA 2BACA 1HNXF 4ETZA 1VK8A 1K9MT 1HHTP 2VONA 1YTYA 4ZVGA 5B0BA 1VQ4S 1XTZA 3GJQB 1X5TA 1S0NA 4TVAB 4ILLA 1YBUA 4ZVTB 3AA9A 1WACA 3O8WA 5KFFA 3A4TA 3MUTP 3LP0A 2DGXA 2WRMA 1S1XB 2P9EA 2QO3A 4OX8A 1N6QB 1LW0B 3HDSA 2Z57B 2FHKA 4FBUA 3R97A 2XZTB 1TKXB 1OY9A 4TXSA 4ZJOA 1I6JA 5KFAA 4CO0A 2RF2A 4IUFA 2E66A 4M5MA 3DCAA 4RUAA 3MK1A 3QRQA 1FFWB 2R7OA 4HHJA 1S1VA 4LVOP 4C7QA 2V4QA 4OYOA 3NGKA 4B9UA 5DGBA 4U6PA 4PQUB 2AJ2A 1FDDA 1NSKL 1TP7A 4QR0A 1LFWA 2UV8G 1JLQA 3WC0A 3W2WB 3FJ2A 1SJ1A 3EDRB 3QQCD 1MN7A 3W65A 4K4ZA 5CAAA 1YJNS 4WKYA 5LM7E 4LQYA 1RTHA 1Q8IA 1K1SA 4PXDA 1NK5A 4WK1A 5KOXA 5D4NA 2CZVC 4PXEA 4LUBA 4F3OA 3R7BB 5KFBA 1IR1A 3IS9A 2AW0A 4RLEA 2C3UA 4X84A 2VBZA 3RYLA 4UW2A 2QEXS 4LFAF 4QIWD 3TOQA 5AJ3F 4KGKA 3FMBA 1IQZA 2YQ0A 4ZVHA 1R27B 1RAIB 2GHPA 1VISA 4FYVB 4QW9A 1KSPA 4NZ0A 4BLGA 4RU2A 3HT0A 3DRXA 1BGXT 3HJVA 3PVXA 4DEZA 4DU8A 1PBAA 2ZE2B 5LIAA 2HFOA 3P5TL 1T3NA 3KLVA 2M88A 1HR0F 2HVEA 2KXFA 4QYZK 1S6OA 3TARA 2Y0SD 1ALIA 2BDPA 2OFHX 1QVGR 1H2TZ 3CJ2A 1CJVB 3I96A 3BREA 3C6UA 5RUBA 2DHHA 3E01A 4QAXA 2JJ4D 5LMNF 1KN6A 1SHNA 4JI0J 3BSCA 3MD3A 1GTHA 1NSPA 3EVWA 2HHTA 3AOCA 5IM0B 3D68A 3QO9B 1WHVA 1EETA 2CQCA 4LBHA 2BQ3A 1GEHA 2YWEA 2J9DA 5K8NA 4YHHJ 1EKRA 2DR6A 4AYBD 4DG1A 2FY1A 4UUWA 1MWYA 2O66A 4DXLA 5KFEA 1URBA 2W9CB 3GQCA 2DO4A 2BE2A 1SQEA 3QPIA 2OKQA 3Q8YA 3IM8A 1RZMA 2I0XA 3J7YU 3NNAA 1NKBA 4WFAQ 2GVDA 1WKKA 1GT8A 2QL7B 5HK4A 2Q6CA 1E6VB 3NS5A 4WE1B 4DR5F 2PI5A 1UVLA 5EGEA 4X4TA 3Q23A 3KG1A 4PYDA 1AFIA 1YJTA 4A8FA 2UUBJ 4ZLPA 4NZ6A 5FLXU 1KTVA 2AYEA 2PGCA 5EGHA 1C0TA 5K14B 2QT7A 4IKAA 4YR3A 4MK8A 4OZLA 1EW8A 3BGOP 2MKHA 2ZITA 4WCEQ 2ROEA 3PDNA 4CI0B 4KHRA 1ULRA 4FYXB 2R7UA 1MW7A 3OPKA 5F3ZA 5T7LB 1DURA 3PIPQ 2DIVA 4J5OA 5IV4A 4M5HA 3MFHA 1F5BA 3KNAA 2FLOA 4ALZA 3GTYX 3JYTB 5AXMA 1RT5B 2FJVA 5GAEU 2WOMB 1C0UB 3ISND 4YN3B 4F4ZA 2OP5A 3CCJS 2MZQA 4FVCA 4NLGA 2AQ4A 3K17A 2VL1A 4NWXA 2I38A 2EXUA 3G6VA 4ZCMA 2MB0B 2H65B 4IRCA 1KQSR 3D1HA 2E1MC 2D1CA 3IGYB 3ET6B 3LP1B 3ZTSA 5HQ8A 2QA1A 2HRUA 2E9ZA 3PJ9A 2BM1A 3IWLA 2VDIA 2XR9A 1AJCA 1JLBA 1LWFB 3G6ES 3S01A 1M5HA 2RS8A 3OR1A 4NLWA 1JMTA 2BABA 1IJEB 4O3RA 1J5EF 3K57A 4HVZA 1TVRA 1T05A 4E2FB 2XBPA 3CF5Q 3QFHA 5IQ6A 1MWZA 1N5TA 2FGCA 1U6BA 2QSFA 3QJPA 3CO0P 2GIQA 2AV5A 2PEHA 3TUPA 1JKHB 2J6SA 4QWDA 4DV0J 2JH3A 6FDRA 2YPZA 4CYUB 3MZIA 2YNHA 4OZ2A 3G71S 1ELYA 4KPCA 2ZOFA 4F04B 1YBTA 4DX7A 1TQLA 2Z58B 5J2NB 2BUNA 2LDYA 3CT9A 1FT8A 3HVRA 1WUUA 5CCMA 2R9LA 4J9LA 2UXCJ 3CCTA 4WIQA 1IKYB 3M2RB 5L1JA 1RAHB 1KDNA 2U1AA 5FD1A 2IVYA 4KAIA 5J2MB 4JI5J 3MK0A 4ANEA 2HK3A 1UEKA 3F44A 4JB8B 3W66A 4NRTA 3CEDA 1F5AA 4KHPJ 1LW0A 2FZKB 2EFQA 1ED9A 1Y00A 4ES1A 4DV2F 5KTQA 3W2VB 2KB2A 1U6FA 1JJHA 1S6QB 2QLJB 5ETMA 5HQMA 1NBEB 3Q86A 2ZVSA 4DV6F 2EFGA 3I4HX 2ACMA 4KIAA 2W7OA 7FD1A 4FXVA 1RYRA 4F26A 2CNLB 4CM0A 3M8QA 3DLKB 3MPDA 3FEXB 1RJJA 5JMNA 4JI6F 3T1YJ 3KWMA 2BW7A 3AY0A 2HNDB 5INHA 2FHOB 2B9WA 4ID5B 1OS5A 1LWXA 4BCAA 1U6ZA 3EYZA 1XR7A 4BS2A 5EDWA 4KYZA 4N76A 3RBZA 1B3TA 3TQEA 3MHYA 1S9GB 2V2ZA 1RWPB 3D0HE 2QV6A 1ZA1B 4IRKA 1VIXA 4DL5A 3MUVP 4OX6A 4I7FB 3BF4A 3PEHA 2EG2A 1X4AA 4ZIWA 3GYNA 2VPYB 3ZZUA 4M63A 2CQGA 1FI4A 1VQOS 1J27A 5AXLA 3M8SA 4MHXA 1C4AA 1X5SA 2PI4A 3VHQA 4B3TF 1YHQS 2R8KA 1YWXA 2R8JA 2E5IA 3VTIA 4UZCA 3SFGA 3WIUA 2QTWA 1SKWA 3CIZA 4QIEA 3IG1A 1T03B 1K0VA 2BANB 1V9OA 3Q8SB 3OHBA 4QWEA 3PZPA 1PILA 4P74A 1R8AA 1GQEA 3DGPB 4URQU 2FVSA 1CJVA 3PW2A 4KKOA 2JOQA 3M05A 4A8MP 4PABA 1IBLJ 2HNZB 1GMVA 7AT1B 1TELA 4NLQA 1U1OA 1K1QA 3QO9A 3BQ0A 2F8HA 4ES3A 3PR4A 3UCGA 4NX9A 4G6VB 1R31A 1U25A 2HHXA 2EVZA 2ROGA 1S0OA 2H51B 1WJ9A 3TA1A 4USKA 2HRTA 1MNEA 2F4FA 2VU5A 5AE2A 1F9FA 1FE0A 2XMKA 2DXFA 2W2PP 2AIRB 4F4AA 2CWXA 1AZSB 3IO1A 3F73A 2RE1A 3BYPA 4EYIB 3PW0A 3G4SS 3HT3A 4HTJA 3G6XA 1M5PC 3E8OA 1DBDA 5LSRA 3GIMA 2XG8A 2EFNA 1UJ4A 1NXIA 2FJWA 2MXYA 1YIJS 2ADBA 4JBCA 1DQ8A 2XSJB 1REVA 1WC0A 1HARA 4B56A 4B9TA 1IJFB 3H5YA 5FDLB 4CLWA 4YY3J 4DQPA 1E2SP 2EK6A 2ZBRA 2DNLA 2VOPA 3RTVA 2R7WA 2XZDB 4NLUA 4Q5VA 2EBEA 3N79A 1TUVA 4KV8B 4HLBA 3QYYA 4K4XA 1S9EB 2LKZA 5EHHA 3SSSA 2B9XA 3BKTA 2VQEJ 4I6YA 2YKMA 3ZZTA 5CA5A 2ZJPQ 2WW4A 2JDJA 2YQ1A 1Q79A 4XTTA 3H4DA 1J2VA 4PG5A 3J81U 1N8RT 2HHQA 2LDIA 4F3MA 2J7UA 1N4LA 4NASA 1L3TA 2Y1RI 3D5MA 2D41A 5D77A 1NK0A 1TL4A 4M5DB 5KG1A 1LK7A 1KH9A 1R89A 2EK1A 1QSSA 2AP6A 1AT1B 2DHXA 3SEOA 2XMTA 1C4CA 4F4KA 3UE2A 4Q43A 2KYXA 1RXOB 2W4PA 5IWAJ 2HAIA 4TY8B 3OSNA 1WKJA 3QSYB 3MEGB 3BKUA 1DLOB 1RWWB 2DNQA 5H1SV 2DNRA 2I5JB 3HZGA 1KBRA 2Z56B 2LQ9A 4ZKAA 2V8VA 3VAJA 2ZH5A 4YHHF 4F4WA 3GV8B 4NPOA 5DZ6A 3PFOA 1PO6A 4DSFA 2FLPA 3DRPA 3DHXA 4CT8A 2AT1B 3AB2B 2AZ3A 2YNIB 4CXSA 3GSDA 3M2RA 1TR0A 4W98A 3EX7B 2BOPA 4IQMA 5E3AA 5J2MA 2PT0A 1YZ6A 2HVDA 4ZPTR 5EX0A 3RR8A 5HQLA 2DH7A 1VQLS 4B3OA 2ZNYA 4DSEA 3R2CJ 2IDEA 2ZD1B 2CJ9A 2N7YA 5A8WB 2RKIB 4H4OA 1WOSA 2PMZD 5ITHA 2ZUAA 1VK3A 4F0HA 2WONB 2UUBF 1KH5A 4NCGA 2MY7A 4WXWA 2NSCA 2DNPA 4P7TA 4EI2A 4DFPA 4LR9A 2XHCA 1IKXB 4KE5A 3R9LA 4WYWA 4CTAB 1VRTB 2AKWB 3TEHB 1WEYA 1F9HA 2ZH7A 1FK9B 1FVSA 5HAOA 1URRA 3VVUA 1V5IB 5IT0A 2MZTA 3E2DA 3KK2B 3DLKA 1T3OA 4G1QB 1M1HA 1M5KC 1Y7PA 3V81A 5KT2A 3M8PB 4ECQA 4J9VA 3PG9A 1GX5A 5IC4B 3RAMA 3EICA 5E2QA 3K59A 1NDKA 1G6BA 4BHQA 2OMOA 4KY3A 4PEOA 1E6YA 2GJIA 1SJ3P 2DGOA 5IJQA 5DQIA 1URNA 2ZUGA 1IKVA 3J7A1 1WHXA 2KRRA 4OL8A 3S8SA 5CZVA 4LIRA 2R4FA 3VAIA 2ZHAA 2IJFA 4RPFA 4LFBJ 4B3RJ 2KZMA 5ETTA 1RT6A 1HMVB 2JVRA 3MEEB 1BMQB 4LF6J 4HTIA 1XQIA 5DLFA 5M2PA 4UOFA 1ZOTA 4JI2J 4JUZA 1OYDA 1CJTA 4DS4A 3P3DA 2EFOA 2ZZTA 2HQCA 1RHUB 1XN9A 4TLRA 4WP3A 3SCLE 1NSQA 3NKOA 1DAXA 1HBNA 4KM4A 5D4OA 1O8BA 1C1BA 1XR5A 3DGPA 3ENAA 1WC3A 4DSJA 1TK0A 2CFXA 4DV0F 4NXNJ 4OYMA 2CJXB 5DM7Q 1N33J 2CAJA 2F9JA 1ACMB 1AJAA 2HFSA 5F41A 3GSIA 2UXDF 5HSPA 5IJSA 1RE1B 1DTQA 1TL3B 2UXCF 3D6TB 4A4JA 4C8OA 5BXIA 3ZTPA 1KVKA 2GSUA 2LQ5A 3FKBA 2Y9HA 3CIMA 3GWCA 4L6V3 1RLDA 3TA0A 4JI5F 1N54B 1IQTA 1UEUA 1HFEL 4PG7A 2EKNA 2M8DB 4XPEA 3ZZ0A 1NRKA 1B0TA 5D3GA 1Q81T 1QDUB 4ICLA 3EPGA 4X2BA 1S7IA 4Y2CA 1KQFB 4ED4A 4QIVA 3ZZYA 1OWXA 3W9IA 3H59A 3KK1A 1JLFA 4FPIA 4P71A 3MMCB 4H4KA 2XSJA 3OLBA 1TTHB 1BQMA 3M6WA 3H5XA 2NREA 3CD6S 1NK8A 4ZG7A 1CC7A 4AL5A 2J9CA 4A8WA 3VZIA 3FEZA 4ED0A 3T1YF 2XI3A 2P9CA 2G2ZA 3UR0A 1HYSB 4OI6A 1OQ6A 1WD6A 2WVDA 4FDJA 1QVFR 3P96A 2GGPA 2VBYA 4IRDA 1NB7A 2QZ8A 2WVFA 5F0WA 4ZCIA 3BGRB 4MFBA 4OZJA 1GXLA 4ECWA 2J6UA 1J5OB 1OPIA 3RUBL 2ZM6J 2PMWA 1IVZA 2JLFA 2BZ2A 5IS2A 3CJ3A 3M9MB 2GVZA 1S1TA 4MIAA 3TZZA 2Y8WA 5LJ3Y 5CQGA 2V4RA 3AT1B 3CDWA 2ASDA 5HROB 3KLHB 3KJNB 1JB0C 2LU2A 2F8MA 4OMFG 4C3LA 1S48A 2RRAA 2WVBA 1LV5A 1LKZA 2GNKA 4MIWA 3QJLA 4HH1A 2VUGA 2GV1A 4DL7A 5HP1A 2YX7A 2YWWA 2CA9A 3OW2R 4OJ1A 5T41A 1SH0A 4MKAA 2R7RA 3WHIA 1LWCB 2V63A 1EQ0A 3NOGA 2BJ7A 4ZGAA 2B6AA 2EG1A 2AD9A 1X60A 2A2CA 1YGYA 2M7SA 2VA2A 1T11A 4IR1A 1GH8A 1HBUB 3BKFA 3DC2A 2KT3A 3MF5A 2K7KA 2R8HA 4IOAQ 3OFEA 4DQRA 1QJHA 2J7WA 4J9KA 2I1RA 3MEGA 4U96A 1IBLF 4MKBA 3UI3A 2CPYA 1JLAB 4HHHA 2ZOGA 2I5JA 3N6MA 2JC0A 4C98A 4TKTA 3B54A 4OHYA 5ADZA 5A6PA 3D2WA 2H4WB 2VFVA 3JAMY 2IMOA 2CNOB 3VGTA 4YB1P 2RU3A 3DU6A 5CYMB 2IFXA 1RHMB 4QZVB 3HCXA 2YNIA 3BN7A 4XAKA 1V6HA 1NPKA 4A8QA 4KJDA 9RUBA 1ELZA 2LLZA 1AXQA 2FZCB 2Y8YA 2B5JB 4K4WA 2L08A 1BY9A 3WIVA 2ADCA 5A8WA 3B5QA 3QGPA 2C2MB 2GSNA 2VIHA 1VQNS 3W9JA 4MK7A 1CPZA 1UVJA 2V0NA 2DRBA 4U7UD 4PZVA 1HI0P 3W5ZA 4OHXA 2X51A 3MPVA 3V4MA 4IG0A 4NLTA 3VAGA 1G7CB 4YY3F 4U8VA 2YKAA 1FKAF 3D66A 1REGX 2W5QA 2X3GA 3LPYA 2HWTA 3KK2A 2QLWA 2RVJA 3SI8A 2SXLA 3MM6B 4G1QA 1RP5A 3IRXB 1VFJA 4ZIVA 4JI3J 3DI6B 3M8PA 2VBXA 2XMAA 5KFRA 4DF8A 2YY3A 5LL6d 1XMQJ 1S1WB 3ILIA 4ZP6A 4ZVOB 1TV6B 1RLCL 2VQEF 9ATCB 3MM9B 1AFJA 1RHQB 1CULB 3A8JA 3GFYA 3T3FA 1VBZA 4NLOA 1U09A 4OX7A 2HMIA 4O0NA 3RU0A 3HHLA 2PIIA 1VQSA 1YJUA 4UOCA 4C11B 5G0RA 3OL9A 4RW9A 4R0JA 3SFUA 3M2UB 3CJ4A 3HI9A 2ZH3A 4LSZB 1IKWA 3D3CJ 4QWBA 4FXWA 2FDNA 4IFYB 5HJYA 2IVMA 1FKOA 4KAYA 5B0CA 3QIPA 2MQNA 2IJNA 4OJGA 4RUCA 3ENVA 2APOA 3THVA 1RAEB 3KUGA 5J1PA 1VRQC 3K0JA 1RWMB 2W2OP 4F25A 4OV1A 5IWAF 1UZHA 3KJVA 4DV1J 1NDLA 2K3KA 4OJHA 1M1GA 3BDGB 1CVJA 2L9DA 3BO4A 1L3VA 4KH1B 2R2UA 2D3UA 1HPZB 5A0YB 5KT4A 1TMMA 3R5BA 1U02A 1PC4A 2WSEC 3IR5B 2MPUA 2VA3A 3RRKA 4LRFA 3DKDA 4U9RA 2IAJA 2CPIA 3PYGA 4GVBA 3PEJA 3KLIA 3FQLA 3LH2S 1XWLA 5KFSA 3SV3A 1L3SA 2R8IA 4TN2A 2F9DA 2O01C 2FGOA 2B51A 2ZC4A 2MKSA 1U48A 3SDEB 2CPHA 2DNHA 5IV3A 2HBQB 1L5UA 3MEDA 1FSUA 5DLWA 4XDDA 2FIUA 2C28A 4IOBA 3HHLC 2HGLA 4TY9A 2Z8QA 4DUTA 4ETXA 3C3LA 2XHWA 1H7WA 4O3QA 1TU0B 3QRRA 3GFZA 4AXJA 1RK8A 5KFWA 1YVFA 4OIXA 3DYCA 3KLGB 1VMBA 3PIOQ 3GJRB 3BQ1A 3CTRA 2KU7A 2JZ5A 2XCPA 4FYDA 4FVMA 4WJBA 4DCJB 3DN9A 2D3O1 4E98A 3UCUP 1X5PA 1FX2A 1ED8A 5I3UB 4UOGA 2LQJA 3NLCA 2PMHA 4ITSA 1KFSA 1JLEB 1KFDA 4GMKA 1R6VA 4MY4A 1FE4A 5I3QA 2FJEB 1U8SA 2CPFA 1PKUA 4OZNA 4ECTA 3U1NA 3EZUA 1WC5A 4W92B 3VVTA 2VQFJ 5L0EA 3MI7X 5EGYA 1FTRA 5LSLA 2EC0A 3ZZOA 3BDEA 1HLWA 1M90T 5GAHU 3KLHA 3BN4A 3G82B 3D7SB 4KSEB 4LFBF 4B3RF 4PUOA 4C8YA 2KG1A 3UD3P 2W4CA 4LF6F 3E2EA 4NOHA 1WC4A 3Q0AA 3CJQA 3N5FA 2JEGA 1ANIA 4JI2F 3D6MB 1FTCA 3RRGA 1F0XA 1T94A 1S1UB 3KHRA 3HHKA 3HHNB 4N7TA 1TL1A 4Q0BB 3VZHA 4OYXA 3QNWB 3TJAA 1VC6A 3D0IE 3I9ZA 4DPXA 1F3FA 1V3RA 2RS2A 3H8YA 2HHUA 5D0RA 4TNOA 2G9YA 3M9NB 2PE8A 3RJMB 4NXNF 2AGPA 5BJRA 4HDGA 3DU5A 1N33F 3LAMA 4LQ3A 2DRAA 4C4WA 2CJBA 3UFCX 1JXEA 2GA3A 3CCMS 2AGOA 1UA1A 2QA2A 1XEZA 1X31C 4LBIA 3ZTQA 4B9NA 2IYIA 1WI8A 3CDUA 5LXYA 2BJ9A 4JI4J 1NK6A 5CABA 2ACYA 5GAGU 3C46A 4LF5J 2ZH9A 5HMYA 2MKJA 1U2FA 1XERA 4KO0A 3OL8A 3H98A 4F4XA 2OIHA 3NNCA 5DDRC 1QSYA 2B8QA 2YNGB 3PACA 4KTQA 2HIQA 1N2KA 3MPYA 3UN3A 1Q16B 3CD7A 3V4IA 3KHHA 3B4DA 3O3LA 4I6WA 3OJSA 4J9OA 1H0HB 4KGMA 3FZBA 3T5HA 4I2PB 5CYQB 1IM4A 1WEXA 2DBBA 3C6TB 2KG0A 1PGZA 4LRDA 3TI0A 4DX8H 1S6PB 2IC3B 3TZWA 3A8EA 3DRRB 2B7CB 3W9HA 4DR7J 3NKRA 5D0EA 1YJ7A 4OYPA 4B08A 3ISZA 4FN5A 1F9EB 2W01A 2KJWA 3DDIA 2WSFC 4DSLA 2FYXA 3G8SA 4DUZF 5B0EA 2OTLS 2GQQA 2YKPA 4USHA 1S0VA 4NE9C 1FEHA 4M5NA 3DLLQ 1Y11A 2RU9A 3IR7B 1E1ZP 4MH8A 1O0PA 1TK8A 2RD5C 2EPIA 4FP9A 4ZPBA 2EC2A 4HACB 2EW9A 4GC6A 2Z2YB 1KEKA 2N7CA 4C11A 1XR6A 2DNNA 5KG7A 4N5SA 2CADA 2GW8A 3W7BA 1HNIB 4P52A 5BR8J 2F5GA 4YMEA 1N5YB 1RTDB 2RQ4A 3ADAC 2R2RA 1O51A 1CS4B 3T1HJ 1U1MA 5KFNA 2GIFA 5KFTA 3L4BC 1WTFA 5ETPA 4USVA 4OI2A 1FWPA 2ZBIA 1A6LA 4CNZA 4LSNB 5DO2A 2YH0A 3KJFB 3FCWA 2MY8A 2XSFA 2POKA 2DGSA 1H3DA 3B4MA 2NS1B 2KH9A 2KRBA 3BDGA 3UDEA 1HQEB 5ETQA 4ED6A 3M8YA 3TRGA 5KFUA 5CZXA 4N8OA 1MROA 3DOLB 1DHMA 2DK2A 4GC7A 1CJUA 1ZM9A 3E51A 3MMJA 4OYWA 2DD8S 4DR3J 3WAVA 1PYSB 4N77A 1RTJB 3R27A 1KHWA 2MQOA 1FWLA 2W2MP 4J7CA 3ZZZA 4B9MA 1L3UA 3LP2A 2FC9A 3JXOA 3DOKB 1UTAA 4LR7A 2DXDA 3NS6A 2FY8A 3BH7B 3UVJB 3I4PA 1LWEB 4N41A 1HL6A 3AJ1A 5KFXA 3R5GA 3U7JA 1W7WA 2QYGA 1HD0A 3I0SB 5F8LA 2HBRB 3W5XA 3VAFA 3A1YG 2Q43A 3BZQA 2CQPA 3SDEA 4LSLB 3CO9A 1BWVA 2N3OA 3W60A 5ETOA 3H2LA 4LR2A 3MR7A 1YG0A 1FNXH 1GAOA 2QE5A 3NWRA 3QZ8A 3HHEA 3CCLS 3MMBB 3DDKA 4ED8A 4M5KA 2NXJA 4PQAA 2IM2A 1VHIA 4JYAF 1KWMA 1NU4A 1VJWA 3MDFA 4X4QA 2UV8A 2OJ3A 4JI3F 1KHNA 5F8MA 3TAMA 1EKSA 3L95X 1Y6VA 4X4UA 3BSAA 2RDJA 2ILZA 1R6YA 1XMQF 4L76A 4WFYA 3KG0A 2G1DA 2HQ3A 3CPWR 1UETA 2ZWOA 1X4CA 1D09B 4F2RA 3IGZB 1ZZFA 2WW8A 2B4PA 3T41A 4ANDA 2QLFB 3C2PA 4I2QA 2AHOB 3B6BA 5FLXY 3QIDA 3G82A 3AHPA 1Y10A 2XULA 2E1CA 4NCAA 1UKUA 3C14A 3C8YA 1V3ZA 3FQKA 3TYTA 3UWTA 3UW1A 4EUVA 2Z2ZA 4Y28C 1DZ5A 1S1UA 1YITS 4Q0BA 2XMJA 5LQQA 2IUCB 4C3KA 3W5YA 1DQAA 4TYAA 3JTOA 7FDRA 2MHEA 4F8RA 2MZSA 3D28A 1HQAA 2JHEA 4LRBA 5DQHA 1Y3JA 2DH8A 2QL5B 4DV1F 5B08A 4QW8A 3MFIA 1B4SA 5HVHA 2MMYA 4EU0A 4P7VA 5KG4A 4P2FA 1FRIA 1RBLA 3LP0B 2M5YA 4X62J 2K1RA 1MN9A 1F3VA 4DHVA 5G4DA 4LF4J 3TO8A 3PO5A 3WBHA 1KNZA 2QL9B 2AGQA 3GFHA 1UVMA 1YBAA 2RF2B 3BH6B 4ZVPB 3FRYA 4P2SA 2E5LJ 3AOAA 2NUHA 4ZK7M 1RB0A 3DLJA 2IRYA 2FVQA 1SC4B 4ECSA 1IBMJ 1YJVA 4CLYA 2OAUA 4NEYA 5K5MA 2VFRA 3U1MA 4ZP8A 2JX2A 1B0VA 3IRWP 1FNMA 5C24B 3SQGA 2JC1A 3KK3A 1YX2A 3RG6A 4DV5J 3T02A 1JLQB 4YB7A 1QAYA 5D8HB 5MLCV 4CZCA 4CNYA 1RTHB 5DG8A 2B43A 1P8GA 1A0OB 3ITHA 2X7IA 3IBCB 1SH2A 2IYGA 4U95A 2F4VJ 3QGHA 1QY7A 5DM6Q 3BO3A 3IS9B 4TQRA 2H5JB 5KFCA 3R1HA 3W62A 3HSGA 4RNHA 5HL7Q 4DS5A 1E3CP 3MXHP 2VG7A 2UU9J 1LK5A 3N01A 1ZBTA 1RSCA 4CO4A 4DDFA 2ZH2A 3LXQA 3NP5A 3EGZA 2DNYA 2GSOA 2QG9B 3SCJE 2VQFF 1CSJA 4ZVQB 3LQVA 1C1CA 2VBWA 3W61A 2HBYB 4WP9A 4YR0A 3AH6A 2GIRA 1HWKA 3VQSA 3FNNA 4ZJLA 3MR6A 2PA3A 3MECA 3CC4S 2LEBA 1TL5A 5GMKa 2XGPA 3C6UB 4WXOA 1T7PA 1NKCA 3E01B 3B82A 3EUNA 4HACA 2ASLA 2MSTA 1SV5A 2DHSA 4DCOB 3GLJA 2W24A 1M0SA 1SUQA 3RB6A 4F4YA 2DISA 5CYJA 1EETB 1FD2A 2WB4A 1HNIA 3WC2A 1RABB 1N5YA 3ONQA 4YR1A 4OYIA 3TX0A 2W4DA 2DJWA 4DG1B 5GAHI 1HWIA 2HHSA 1KC8T 2BE2B 1IBCB 2Z0GA 2UUWA 1D9AA 1S76D 2CPDA 2V67A 4LSNA 2IMWP 2XM3A 4ED2A 1F6TA 1UMJA 1HKAA 2KVIA 4JOUA 2C22A 3B8HA 3DHWC 2AWZA 2RILA 3A13A 1R0BG 2BRKA 1JJ2R 2OSRA 2PA8D 4RNMA 3T00A 5LRNA 5CCLA 5KG6A 1U0HB 2KI2A 3PR5B 3HKWA 4W90B 1C0TB 1RT7A 4C9DA 4ZN1A 4EO6A 4CYSA 3IDDA 1W2BR 3IWNC 1PCAA 3MD1A 4JI4F 3UVJA 1LWEA 1YLXA 1K44A 1KLMA 5E0OA 2OELA 2M4MA 2QMXA 3OR2A 1R8BA 1Y5IB 4RNFA 4O4GB 1F2HA 2N4DA 2LQBA 3OTEA 2CQHA 3JSMA 1UA0A 4WWSA 3JS9A 4ZVUB 2ASYA 2CWKA 4Q45A 3L7UA 2ATLA 2UVVA 2I8EA 1VQ5S 1Q1KA 4XK8C 1I51B 2AZ1A 3ZZPA 3MUMP 3FSXA 1KOHA 2CPXA 2CYYA 3NS7B 3M9OB 1U2RA 3IR6B 1ZEFA 5D15A 3K5NA 4DR2J 4DR7F 3FZ2A 4OHVA 4QR1A 3RBDA 2BJ1A 1JLBB 2Y0BB 3OR1B 3BDHA 3K2YA 3OVAA 5HBMA 4Q8EA 1Q78A 1SC6A 3NWGA 4Y34A 1S0MA 4LJMA 1T05B 3CUNA 1T9VA 3W1YC 4BWMA 1SC1B 4BC7A 2QMWA 3BGLA 2NSBA 4U7CA 2HPUA 2VC0A 3K89A 3NOCA 2VHGA 4IH7A 5I4MA 3EZOA 2A18A 2YNHB 4ZA1A 2BR0A 1HWLA 4FNHA 3PRDA 4OLPA 4IDKA 1D8ZA 3DMJB 4KAVA 1RACB 1BLUA 2LXUA 2X1BA 2HQGA 2JLGA 1RAGB 3C15A 1JLGA 3OXFA 1VLOA 3T1HF 4ZPAA 4R8UA 1RWUA 2K7JA 5LXRA 2UUAJ 3P49B 4K0KJ 2M2BA 3GP9A 1WDDA 2XMVA 2QIFA 4ZPDA 1G4CA 3W3SA 4YEAA 4OZ5A 2UXBJ 5E33A 4O0IA 2OPPA 2V68A 2R42A 5L39A 2Z2MA 1S99A 2EFVA 4ZS6A 1OY6A 3J81Y 4LMZA 1KVIA 1RCOB 3BQ2A 2AYGA 5A6WA 3UO0A 1NPPA 4Z37A 2AYMA 4V19X 2FLNA 3PJWA 3FFIA 3AOBA 3JSYA 2LXFA 4C8ZA 1Q95G 2W5WA 2YKNB 3OQ2A 3Q8PB 4WBFA 1RT2B 3LWLA 2VJVA 4EWTA 4UPLA 3M8QB 4F0KA 5L9XA 3R7SB 2JRSA 3L7OA 1QD1A 5CHCB 2RQMA 3P8BB 4YS2A 4CO1A 5C24A 1HNZJ 3AD8C 3A8IA 2JSXA 1IUJA 2CJYB 4ELUA 1ZTWA 4DMZA 1FJ7A 4J9SA 4CWBA 4DV7F 2XCAA 5B0FA 4LR8A 2KKHA 1UVNA 2BJEA 2E7VA 1Z4UA 2VB6A 2DIUA 2QA4G 4KGXB 1ZM3A 5J2PA 3HSZA 2GO9A 3K5OA 4CH7A 5AJ9A 4FF2A 1TUWA 5K9FA 4X4RA 3HVWA 3ELHA 3I5AA 1QUPA 4C6AA 1VBYA 2YNFA 1Q8BA 1N36F 5HVGA 2UVRA 3MAQA 4K4SA 2RRBA 1KH7A 3FMWA 1WTBA 2E44A 2CJQA 4HI1A 3QT7A 3K5PA 2RHQB 1BHNA 4NLXA 1P6TA 2BKOA 3CDAA 3IG1B 1ALJA 2LEPA 1W2IA 3G2XA 2O1PA 2MLXA 2VZ9A 3B78A 3RAXA 4YP3A 4KKOB 5D0HA 3WBZA 2OLWA 4NYOA 2BX6A 3M4XA 5DGAA 4EFAC 3AODA 1E33P 3QBCA 1NK4A 1EB0A 5F8HA 3UQSA 2V6AA 4JV0A 5GVQA 3ZXWA 4B02A 1HQUB 4FBTA 5KAKA 4J9QA 4ZN3A 2NYHA 4GO7X 4YOEA 1XJWB 2VODA 4FXDA 4FF1A 1HNVA 4FDFA 6AT1B 3V6HA 3MMAB 1AJDA 4X62F 4Y6IA 2OPQB 1ALHA 4DN9A 4QBUA 2E29A 3OFGA 4LF4F 4DR1J 3UR3C 4L73A 3QGGA 3HXMA 1FHTA 3PJXA 4X66F 1FESA 1NJYA 2DGWA 2AJ0A 1U0HA 3GCXP 2E5LF 1RTIB 2MJNA 4UOOA 1REVB 2OI2A 2D9PA 4I0WA 2NXNA 1IBMF 1S77D 2X3DA 2VD3A 3S1TA 1T95A 4AUKA 1NH8A 1ZYQA 5I42A 2XWXA 5DRKA 1LXJA 4K50A 5HMXA 4DV5F 1DTTA 2JVOA 4O4GA 4PWWA 4F02A 1TKZB 3WX4A 1XNQJ 1KHJA 1RHJB 4L75A 2ZC3A 2MHNA 4CO3A 1DFDA 4J91A 5LJ5Y 5FIIA 4RR5A 1RQ0A 2IHR1 2V9WA 1RAJA 2KYZA 2PD1A 4ZG6A 3RBEA 2F4VF 1PJ6A 4BWJA 4BBYA 2YKMB 2XYHB 3AQPA 3RW6A 4UY85 2LECA 1FRMA 2XC9A 3S6EA 2UU9F 3KXDA 4PCQA 4GKKJ 1Q5YA 4X64J 2XMMA 4K2XA 1SJ4P 3TUIC 4HT7A 4FS2A 3I87A 1T9XA 1ELXA 1G3OA 4DR4J 4C48A 2Q1LA 2IA6A 4QCLA 3BSNA 3HD1A 2PO4A 2O3DA 3GYXB 3CD0A 4CQ1A 3NBPA 3H40A 2H1YA 2ZH1A 4O23A 1RHRB 4C8LA 2RQKA 3ED4A 4NA3A 4K5SA 1I1GA 3J80U 2R7QA 4KJGA 3RAQA 5H9FJ 2MKCA 3DMJA 3LANA 5A2QU 5JJBA 2H9ZA 3D1OA 4C8MA 5KG3A 2ALZA 4O3PA 3MCOA 5E7OB 3DRPB 2G0CA 3TWZA 2DR8A 3MM5A 2WK4A 4UT4A 2HVHA 2NXUA 2FJBB 5IT4A 2V9KA 2V8GA 2N3LA 3IWXA 5A8KA 2B4UA 2XEXA 3KHGA 1WG5A 2AEJA 5K20B 2P6SA 1RT1A 2RMLA 1ZAXA 2CXEA 1BWEA 2MEWA 2N82B 2H4YB 4B3OB 1LFPA 1QTMA 5IZHA 3WDOA 2JWNA 5THWA 3TVYA 4H4OB 2CDQA 4LFAJ 1UVKA 4XIUA 2XMWA 2W1BA 5L46A 2OHDA 3HFZB 4NCGB 3GG1A 1N5VA 4Y3CA 2XO6A 2I9SA 3RB0A 3DDNA 2VG5A 1H72C 2HVZA 1G1XA 4C97A 3MM8A 5K8PA 1Z1ZA 1YJRA 2YKNA 1JLCA 1O5JA 1RT2A 1NB2A 1U1QA 4KB7A 1HBMA 4QYRA 4CCHA 2XLKA 3RGIA 4IQXA 3V81B 1NZ8A 1VQ8S 3OL7A 3NVLA 2LA6A 1RBAA 2ROPA 3L3CA 1VQ7S 2YXLA 2F40A 2V94A 1TL7A 4DBQA 3NCQA 1E6YB 2J7KA 3TNVA 1WF0A 3D3BJ 3US5A 2UUCJ 2KFYA 2HRYA 3D6FB 1IKVB 3D6HB 1Q7YT 5F8IA 4F7VA 5IQQA 2YX4A 3MM7A 1X4FA 2C2RA 5M2RA 2H5IB 4QJVA 2X1AA 4DR2F 1Y9OA 2WCXA 4HR2A 2HZVA 3ETOA 1RT6B 4CDIA 4MT1A 2HHPA 2IPOB 2VFUA 3CJKA 4DZ6A 1CJTB 1FA0A 3DXBA 3CCSS 2CVEA 4UPIA 5DDPC 3H2VE 3VV2B 1FO1A 2WVCA 4DR5J 3MAAB 1WEZA 2G0JA 5GRRA 3R5DA 1JXLA 2OPSB 1R8PA 1HBNB 1SIWB 2MZJA 3JQMA 3KKFA 4RUBA 1C1BB 2KVQE 1JNRB 2CQ3A 2K8GA 3J7AN 1WNEA 2OPRA 3NAIA 3OUYA 1AUKA 3BBCA 3V6JA 3I31A 4ZP7A 1UCNA 3MURP 1AB8A 3H7HB 3SYZA 3IAS9 3GMGA 2RJZA 4DL3A 2MQQA 5LMUJ 2H5EA 2AYBA 1PJ7A 3BYRA 3NCPA 1LW2A 2GQ2A 2WHOA 1DTQB 1HQUA 2E9TA 2VKRA 4Z7CA 3VF0B 2UUAF 1TKTA 1HHQA 3EWGA 1FXDA 5IC6B 3JQJA 1VBXA 4K0KF 4KR0B 2DNZA 1KRPA 1LEOA 4DZDA 4KGZB 2MQPA 3CE8A 2GS8A 1ANJA 3MMAA 4AFFA 5D3GB 4DV4J 4GKJJ 4ICLB 2OPQA 1OQ3A 3I5CA 3QZ7A 3GE9A 1ZAVA 3FGVA 3HD2A 2VC1A 3CCES 3QWPA 2KHCA 2A2DA 4OZ3A 1WWHA 1SBRA 1KTQA 4FDIA 1CEZA 3KK1B 3POTA 1CC8A 1RTIA 2HG4A 2XLJA 4F67A 1JLFB 3VAHA 3T5KA 1AW0A 4UPHA 2HURA 1NJZA 1BQMB 4USWA 1Z2LA 1ITPA 3T5JA 3Q8VA 5I3PA 1ZM4A 3MCNA 1Q82T 2WB1D 2W5TA 2ZVIA 4Q2MA 4PG8A 5CD4A 4NLSA 2Y1IA 4OX9J 3TZXA 4GTYA 4A8XA 4Q8FA 4LRAA 1HNZF 1MWQA 1HW8A 4M5JA 5F8NA 2GGPB 1TKZA 1WSVA 4NYZA 4PWDB 2O67A 3CB4A 2HLUA 4MFBB 5C25A 5C5JA 4Z7YA 2FJXA 5H9FK 2DNMA 3TJ8A 5KFMA 4ELVA 2KXNB 2GVZB 1S1TB 5HLFA 1CQMA 3R5JB 4UZBA 1SIZA 4H4MB 4RKUC 3R2DJ 4ZG9A 5C66A 2XO7A 4DPUA 1P27B 5L9NA 2FC8A 1OPZA 2MKYA 4Y2KA 5KG0A 5HP1B 1JX4A 4N47A 5LSOA 4DR6J 1PSDA 1T0TV 3DYAA 1CJKA 1R7IA 2ABYA 3OFHA 2GMHA 2B6AB 2C2EA 4EMDA 4K4YA 2VPZB 2OEKA 5FJ4A 2WBMA 2KM8B 2GAGC 4JP8A 3TUJC 2DCUB 4HT5A 4R5PB 3PX0A 2DTJA 4KJIA 2BE9B 2C2DA 4C0OC 2E1AA 2EWHA 2ZH6A 4EBEA 4PKDB 2NZ4A 1QUVA 2FZGB 5BYQA 2C2KB 4JI0F 1PC5A 4J9MA 3OVBA 2GLQA 5CD4H 1XMOJ 3PXGa 2OD4A 1FKPA 2G2OA 1K8AT 3UDCA 1X9SA 1FXRA 4EYHB 1VIOA 3KTQA 3MCMA 4JI6J 3M7VA 4DL0C 5DDQC 1NHKL 3VGUA 3M32A 4YB6A 1FRKA 5HMWA 1RTZA 1U8WA 5KFDA 2GAHC 3CDBA 3PKMA 1EJJA 3N4WA 3DLGA 4LF2A 1JQGA 3KDOA 2VJUA 3O44A 1NH7A 2RSQA 3SCKE 2AJQA 4URSA 1NLKL 4DR1F 3GYGA 3ETMA 1EJ7L 3ZZRA 1WORA 4AD6A 3SV4A 4IFVA 5J1EB 4PWUA 1F5CA 4Y00A 2W8KA 4NMXA 1BQNA 2M0GB 2DRDA 4NZ7A 2NQPA 1RAOA 2LQ8A 3BJYA 1MU2A 4IG0B 4TU8A 3UD4P 4B3TJ 1X5OA 2BBEA 3L9ZA 4MIVA 2VOOA 3ILLA 3M1VB 2OEMA 1FRXA 3M6UA 1XNQF 4NA1A 4WTYA 3OTDA 4LF8J 3QAUA 4NWBA 2E9RX 1OSCA 2CQDA 4P2MA 1HQ2A 4CM2A 4RU9A 3GZ7A 1PAEX 2VV5A 1Z2ZA 4DN0A 3DRYA 1UWAA 3MTKA 4ECUA 2HMIB 4NEZA 2ZZMA 1S12A 3HHLB 3GJSB 1OJ4A 1S57A 2V5HG 1EHWA 3VQTA 4GKKF 5G0RB 4X64F 5F8GA 4RW9B 2LYVA 4F50A 4OLOA 1T9WA 2RDIA 2MLYA 1QE1A 1GK8A 1IKWB 2YVSA 2F65A 4DR4F 1PIEA 1FJGJ 1FKOB 2DNGA 3NGTA 3QIPB 2IDLA 3Q24A 4RW4A 2GJFA 1UAWA 3MAAA 4OYBA 2Z30B 4OV6A 5KFQA 2OPSA 3Q8RB 2DITA 2HQDA 4UY8T 1FRJA 4KHMA 1N88A 2VQRA 3KJVB 2C1EB 4GTWA 4JI7J 3CCVS 2NPIA 5A76A 4FZVA 5BYRA 4NLVA 3EDQB 2J0SD 1V3SA 3NKMA 1FJCA 5L8RC 1U4BA 5F3TA 2NXCA 3PW4A 2DR5A 2C2OB 1KHLA 4HL9A 3HHLD 3GU0A 3CJRA 2UVUA 2IAJB 3M30A 4CH1A 1KQGB 4ECXA 1Q4RA 3HK2A 4WU2A 3HJFA 1RAFB 3N0VA 3IGNA 4ZPVR 1I3OB 3KJQB 1RT4A 4GVBB 5KT5A 4ZCLA 4FS1A 4P6QA 3KLIB 3EPIA 1TFYA 2V2KA 2CVIA 2IBKA 4USUA 1EW2A 8ATCB 4RUHA 4KHPF 3TW0A 1A7GE 4CP5A 1U1NA 2K2PA 3CCUS 1RT3A 3LUYA 3MEDB 3NMAA 4ZJQA 3QLHA 2DHGA 5IFMA 2ZDOA 3V6DA 1XNRJ 1P49A 1YRXA 4CLTA 1FCAA 2VKZG 4OJ3A 2QLXA 2RH3A 4USTA 5GMDA 4E0DA 3EGNA 3SIPB 4ECZA 1OO0B 3W8GA 3I0RA 4Q7AA 3MWBA 2V8PA 3RZAA 4WFNQ 1IBKJ 3MOZA 4DL4A 2KXHA 2IVFB 1Q8KA 4RBVA 1TUGB 3GIJA 1ZAWA 3BEGB 2WTFA 1ZPWX 3QGIA 4PWDA 3PRBA 3QT8A 3G8QA 3OT9A 2IY5B 3NL0A 3KMQA 5ETKA 2UUCF 4DPYA 3CD5A 4WZQA 3GILA 3WQPA 1IWAA 4R0EA 1NUEA 3VAMA 3FK4A 2DH9A 2A10A 3BBBA 3IP0A 3R5AA 4I68A 4H4MA 1GXUA 1R0AA 1D0EA 1MMNA 3IA0A 4PUOB 2FLLA 2GMLA 3DOMA 3SXLA 4DF4A 1EARA 3KYLA 3N28A 3TJ9A 2VDHA 1FFSB 3ZTRA 1FWKA 3G9CA 2ZBCA 2XTJP 2R2SA 1TL1B 4DSKA 1NPRA 5LOQA 1KS2A 3U1LA 5A8RA 2DR7A 2EKYA 2K3IA 5KFOA 2H3EB 5DQGA 3WAYA 2R8GA 3KLEB 4IG3A 4R5PA 3TEGA 1Q8LA 1HWJA 1EQMA 1UPMB 5E5NA 1XMBA 1S7HA 1TK5A 4ENOA 1N56A 3QT5A 4M5IA 4B3MJ 4RNNA 1SJFA 1FEEA 3WAXA 3CJSA 5LMUF 3SZYA 4BDPA 2ZNZA 4IOCQ 2RIJA 2J9DE 1UWBA 4NL5A 4I1TA 2CQIA 2AF6A 5KFIA 1I94J 5H9EJ 3K8WA 5DS7A 1S6UA 4OI1A 3O5TB 1WG4A 3H2UB 3THTA 1B64A 1FF2A 5KXAA 4I6AA 4RBTA 1HI1A 4KO0B 4ID8A 4RW8A 3UNYA 1RA6A 4DV4F 4GKJF 1WG1A 2EI5A 3EMTA 5ETLA 1YRUA 1QAXA 4RZRA 4KFBA 3V4IB 2A6OA 1VQKS 3J81j 4KC5A 5J1EA 4RW7A 1HBOA 1AROP 3DM2B 1Q0NA 3NGUA 1V5VA 2KHDA 3BV8A 3LAKA 1TAQA 2HQFA 1U1LA 2IM3A 2CZ4A 4ILRA 2ZKTA 1AJBA 2D3OR 4O4RA 4PPZA 4OX9F 1RWKB 3DRSA 5DJBA 3X3UA 3M1VA 1S10A 2IRXA 2YX1A 2LMIA 5HJXA 3DLHA 3AB4B 2OMLA 3D4JA 3EVMA 4NI2A 2XLIA 4JV1A 4LRCA 2F8EX 1M1KT 2MGZA 2ZEJA 3DLEA 3IAM9 4BC9A 2B0GA 2CQ0A 2RUGA 1FDAA 3QATA 1S59A 3QWUA 1Y0HA 4D3HA 3UN5A 1O99A 2UXDJ 5SUHA 2V4JA 1VQ9S 3OJUA 2IA0A 3FSYA 2CRLA 5IXUA 3HSJA 3L7PA 4DR6F 3WAWA 4K8RA 4GRSA 3DLBA 3ILJA 5DZ7A 2G2YA 3H5SA 4OI4A 3R6LB 4UOPA 2VFSA 1FD8A 1S1XA 1DRZA 3VWSA 2Q66A 1N6QA 3QJJA 2RRNA 2OH2A 4DLGA 4USMA 1MLAA 3AD9C 1TKXA 3LALA 3DXSX 1ALKA 3KG4A 1OIAA 4X4NA 2BJ8A 4XO0A 3NKNA 2COLA 3H4BA 1MROB 3CXCR 2LVWA 1XMOF 4QWCA 3GIIA 4LQ9A 2V8DA 1CJUB 2QN6B 1PG5B 4M5LA 4LREA 3FCHA 3PM9A 1CQNA 2D69A 5T14A 4O3SA 4H54A 1AYEA 3AAWB 2NZCA 3C19A 2OGUA 2WSCC 3PTWA 3IM9A 4PQUA 1IXKA 1RKJA 5GMEA 3LP2B 1RADB 3FEYB 2XY6A 4EGLA 3W2WA 3BM7A 2MJUA 4U8YA 1M5VC 3TAQA 3EJMA 1VQMS 3JQKA 4QPXA 1RBOB 2C3MA 3FBEA 3P4UB 5KFZA 1NHVA 1QSLA 2QZUA 3LF0A 4S0MA 3BO2A 3BPSP 2CJKA 2WAQD 3BS9A 3V2UC 2W2NP 2UUTA 1ZTTA 2GA7A 2Q3PA 1X9WA 2UP1A 4UPKA 2KDOA 1WF2A 4CLKA 1X0PA 2M8HA 2OSQA 4Y65A 2ZE2A 1UFWA 3TAMB 3PFEA 2DPIA 3TAPA 2W5RA 4J9UE 4LF8F 4RBUA 1X4DA 3P5BP 5ETSA 4ED3A 5F9LA 1U24A 2R7VA 2XMUA 4WZMA 2HAFA 4DPTA 1HIYA 4TQSA 1YQHA 2VPXB 1D8YA 1H2UX 2KT2A 3O6QA 1VBKA 1SL0A 3H5UA 3HFKA 4I2QB 4E8UA 5IM0A 4P10A 1X4HA 1SKSA 1PAUB 3LA0A 2FVRA 5H9EK 1UL3A 2BYCA 1P9QC 3BR9A 3PV8A 2W7PA 1H6KX 3CJ5A 4USJC 4DUYJ 3C14B 1UVIA 5JUMA 5IT9U 2G9OA 3CJTA 5E3QA 2W9CA 3BPDA 1B0PA 5KFJA 3OL6A 1F1BB 3PX6A 2FVPA 2HWHA 3GONA 2XNRA 1FJGF 1E6VA 5CXTA 3ULHA 3M2VB 1Q86T 4WE1A 4M94A 4FKYA 2D9OA 4C3MA 3ZNUA 4DWIA 3PYFA 4G1IA 3PNIA 4QOTA 2J8SA 2BM0A 4DI6A 3A8KA 4L72B 3KLEA 3JTPA 2Q79A 3OD2A 4HH0A 4WFXA 5ETNA 5F9NA 4JI7F 3F0NA 3OXLA 4MKYA 4DFMA 3C16B 1AA1B 3FC9A 1F2GA 4NMLA 2K1RB 4DPOA 5K14A 3HLUA 4CLPA 3MEKA 4PXCA 4NXMJ 4JI8J 5U47A 2MQMA 2W8SA 1YZ7A 2ASJA 2C2NA 2VFTA 2OFGX 4TLQA 5T7LA 2XS2A 5MAOA 3NGSA 2HFUA 4LF7J 2HGMA 3GCWP 4QQBA 2MQ8A 2HEKA 3JYTA 1NSAA 3Q83A 1RT5A 5F0UA 2WOMA 3W64A 1C0UA 4W4MA 2W7AA 2JEIA 3SQGB 4K4TA 3KK3B 2MSSA 2XZWA 4OZ1A 3RB3A 4LIWA 3N9UC 3RB4A 3CMQA 2WVEA 4MMOA 1S49A 4OHWA 1XNRF 2YQ3A 1FRHA 3ITHB 2HHVA 3ET6A 2CIMA 2WBRA 3LP1A 1Q7LB 3DM2A 1SL2A 3UN2A 1LNQA 2XRGA 2Y3YA 2HZAA 1LWFA 1NAQA 1DARA 1DJ0A 2M3DA 1IBKF 1R43A 4ECVA 3VGSA 3PX4A 3ISNC 3D67A 5J1NA 4RW6B 2BXJA 2VG7B 1RA7A 2BRLA 2L9WA 1H7XA 4K5RA 4QIFA 4J9RA 3GV7B 4WIIA 4NWJA 2VPWB 4DQQA 4TU9A 5K8OA 3QRPA 2EFPA 4HDHA 1Y3KA 2ZH8A 5DG7A 2NUUG 1JKHA 4CXKA 3T6JA 4DFJA 3N6LA 1NKEA 4GVLA 2KZZA 4ELTA 2ZM6F 2V34A 3BB5A 5J2QB 1C1CB 5IOLA 4CYUA 3OV7A 4FYYB 2E7XA 5LRMA 5D78A 1FDNA 5JXSA 2M52A 3MECB 3RBXA 1KLNA 2R7XA 4ATNA 3TVZA 4ZLJA 3MOJB 2Y1LB 5J2NA 3HHDA 2KO1A 2MYFA 3SBMA 1SV5B 1D3WA 2AMCB 2NPFA 4IR9A 1RAAB 3KFWX 5KT3A 1SUQB 2YWKA 1WKLA 1IKYA 3RW7A 1UZDA 2DPJA 3M8WA 1WOOA 2KFNA 2HNYB 3I55S 2ZWPA 1HW9A 4MJKA 2MTLA 1DY3A 3QAEA 3O2IA 1R8HA 1Y5NB 3QFWA 2P2CB 5L38A 1RYSA 5F8JA 3HULA 3I9V9 5EX3A 3W2VA 2KT5A 2UVWA 1NM2A 3ZNJ1 1S6QA 2XQCA 2BKPA 2RQCA 3J7YI 4B3MF 5DLTA 5C42B 4LF1A 5HANA 3LPEA 1RWNB 1T8EA 3KUHA 4NLRA 3SZ2A 4MK9A 2P8IA 3H90A 1RT7B 1I94F 2HNDA 4ED1A 1FXLA 1WOPA 2GQCA 4I69A 4B9SA 4ID5A 3HVAA 1KLMB 2MZRA 4DSIA 4ZVRB 3FBBA 1N0UA 1X7VA 4NLYA 1I5OB 4O3OA 3TR5A 1HA1A 3OR2B 4X65J 3UDLA 3FBCA 4LVNP 3FUYA 2ZOMA 4C0BA 1S9GA 4ZDNA 3JSMB 4M1KA 2E1PA 2X98A 2IIHA 4MTPA 3OTOJ 2VICA 4I7FA 1CLFA 2KJVA 3T9NA 1B70B 2JFKA 1FJEB 5DLGA 1IN0A 4CLLA 4A8KA 5L0KA 4NLDA 5AXNA 5GAEI 1A9NB 3EM1A 1X9MA 2CJAA 3LTOA 2L9NA 1U45A 2W8DA 1UP1A 1RGVA 4J9PA 1BD6A 4JI1J 2XWYA 4ZHRB 4B3SJ 1NEEA 2DXEA 2HIYA 3DGVA 1T03A 3HZEA 2BANA 3VCDA 2IFYA 5HBMB 3RR7A 3EVOA 1N5SA 4DLEA 1VQYA 4N8NA 4O3NA 3OFFA 5KG2A 3NGRA 2BOAA 5KOWA 3MCSA 2HNZA 4YQWA 3G96A 2BJDA 4L3NA 4WPAA 2BW2A 5EWFA 3TP2A 1SJQA 1BC6A 1R0CB 2ZDPA 3FBFA 3H42A 1EAYC 2AEFA 1T9UA 1EW9A 3AQOA 3G86A 1X4GA 2D74B 2CPZA 1TZ0A 3MK2A 4I56A 1WDTA 1P1TA 1QM9A 4DX6A 5D4PA 2DEIA 4GO5X 2V69A 3GFXA 3I32A 4UTGA 4IDKB 4MIBA 1M5OC 2EEYA 1RI7A 3KHLA 3SZZA 4QU7A 3CNQP 2U2FA 3P6YC 2RNEA 3C15B 3CWJA 5AE1A 1B99A 1JLGB 4PRFA 2GCFA 1JWWA 3M2VA 1NK9A 4EZ9A 4R8UB 4KPYA 1AZSA 3K5LA 2AU0A 5D6GA 3ENQA 4CLZA 3PO4A 4PPDA 3VGVA 3QSIA 2DGUA 4AL6A 3ZTOA 2V50A 2OPPB 3C16A 2X1GA 2DR9A 4OHZA 1VQPS 1H98A 4HHUA 4PG4A 5K8MA 2CUYA 1NMEB 3R7NB 2FQQB 2HWIA 5FDLA 2QFJA 5E3RA 2LXIA 2V2VA 2DVIA 1GFWB 2XGQA 3FFIB 2PEBA 2X1FA 3OVSA 3DPCA 4AQYJ 5L0BA 3KNGA 1PBUA 3MR5A 3TANA 1MG7A 4KV8A 4OYAA 1S9EA 2RDDA 2D3ZA 3NG8A 1SB6A 1NJXA 2JL9A 3J7Z5 4EEYA 1ZM2A 3HMJG 2J6TA 2P9GA 4DUZJ 5JVHQ 3PHEA 3SMZA 2J5AA 1VGYA 1OMSA 4HEA9 3OHAA 4PG6A 3J80Y 2BKNA 4M95A 1T02A 5B7WA 4C8NA 2HS0A 1YJ9S 1S9FA 2PC6A 3HF5A 3LGMA 3M6XA 2CQ4A 1G2EA 1JXVA 5A2QY 4TYBA 4PXBA 1BXNA 3HKZD 3A3NB 2HHHJ 5AXKA 2HVIA 4M5DA 5J2PB 2B3TB 4ECRA 4RW6A 2DB1A 2DEJA 2ZJRQ 3D0GE 5DDOC 1EQJA 1X4EA 3HPOA 2LU1A 1FDBA 2ANHA 5L1KA 2YWHA 2WZ1A 2YNFB 3BGFA 5AT1B 1EP4B 5B0GA 3CCWA 4YUDA 3JB9k 1NDCA 8AT1B 1AUDA 3R5CA 2FJAB 1TFWA 3CJ8A 4WF9Q 2B4OA 4TY8A 2I2YA 2RHSB 3IBFB 2XS5A 5TJ3A 1DLOA 5J2QA 3CMES 3TX8A 2PFDA 2E5GA 4H4KC 4IH5A 4Y2MA 1QTNB 3NEKA 2R7SA 4N56A 1NK7A 1Y5LB 4WYLA 3R8YA 1LOUA 4OI3A 4ZVEA 1NNDA 4DUYF 5HATA 2LCWA 4HKQA 4U7UK 2W5SA 3NKQA 3ZFVA 1EI6A 4ZPCA 2BVZA 2J76E 6FD1A 3K7RA 2EBGA 4RJVA 3IN5A 4LFCJ 1GMWD 1NDPA 3OTBA 4CO2A 4P73A 2MLZA 4ZMMA 5DLVA 4RO0A 4ECYA 1JJCB 5KG5A 3LGHA 1PYOB 2E5HA 3I5BA 2HNYA 3GG0A 4B17A 2JLEA 1ZEBA 3BGUA 3DNCA 2D1GA 5KFHA 1RISA 3M8ZA 1KONA 2ZD1A 3TUZC 2RKIA 4EK2A 1SQFA 1HNVB 1H2VZ 1HD1A 5K4PA 2BQUA 2J0XA 2YPYA 1MMLA 4DOZA 2WONA 2D7SA 1P9YA 4A8YA 1WHYA 3F56A 1S5ZA 1VR6A 1WHWA 3HP6A 2RB7A 4K4UA 1IKXA 4RNOA 2ZZNA 2IRUA 4NXMF 4JI8F 5C42A 3EE3A 4CH0S 4CTAA 1VRTA 5D0GA 2HS3A
chains in the Genus database with same CATH topology
3IGYB 3UNYA 3MK2A 5EGEA 1K7HA 3IGZB 4LR9A 5LIAA 5GOVA 3UN5A 1O99A 2VQRA 3LXQA 3MK0A 1KH4A 2G9YA 4GTWA 3KD8A 2GSOA 3SZZA 2XR9A 1AJCA 3Q3QA 1ED8A 1ANJA 1E33P 1SHQA 4NWJA 2W8SA 1ALIA 5L0KA 3M7VA 5EGHA 4LR8A 1HDHA 1ZEFA 3A52A 1O98A 3E2DA 4ZG9A 4KJDA 5C66A 4LRDA 4LRFA 3NKOA 1ELZA 3ED4A 3WAYA 3T00A 4KM4A 5LRNA 1EW8A 3WAWA 2W5SA 3NKMA 4LR2A 2W5VA 2W8DA 1KHJA 3NKQA 3NKPA 4MY4A 3CMRA 1B8JA 4UPIA 4QAXA 1ED9A 1EI6A 1N2LA 4CXKA 4MHXA 2IUCA 1SHNA 3BDHA 2GA3A 5DLTA 1KHKA 4FDIA 5GRRA 1EJJA 3B5QA 4KJGA 2QZUA 4LQYA 4CYSA 1KHLA 3T02A 4ZGAA 3IDDA 5DLVA 2GSNA 4UOPA 5L0EA 3NKRA 4ZG6A 1Y7AA 2GLQA 5AJ9A 3OT9A 2ZKTA 1AJBA 4ZG7A 3TG0A 5LRMA 4UPHA 5LQQA 3BDGA 2IUCB 1AJAA 3NVLA 4CXSA 2IFYA 3M8YA 1ZEBA 3BDFA 2W5XA 2D1GA 4GTZA 5IJQA 3TWZA 3M8ZA 1AUKA 3WAXA 3UO0A 1AJDA 3SZYA 2W5TA 1KH7A 4TN0A 5IJSA 5HRTA 4FDJA 1EQJA 1HQAA 4KAYA 1KHNA 1URBA 4UPKA 4LRBA 2RH6A 4GTXA 3T01A 1ELYA 1ALHA 4CXUA 1ALKA 1FSUA 5DLWA 4YR1A 2W5WA 5K4PA 1Y6VA 2ANHA 2W5QA 4GTYA 3WAVA 1EW2A 3TX0A 3NKNA 4LRAA 1ZEDA 4LRCA 1KH9A 4CYRA 2GSUA 4NWXA 1ANIA 1URAA 4UPLA 1E3CP 1HJKA 4UORA 5INHA 1E1ZP 4B56A 3M8WA 3UN2A 4LREA 1ALJA 3DPCA 4LR7A 1N2KA 1EW9A 4N7TA 5L0BA 4KAVA 2XRGA 5KXAA 3UN3A 3MK1A 3WBHA 1KH5A 1P49A 2X98A 3BDGB 2W5RA 1ELXA 5TJ3A 3DYCA 4UOOA 4MIVA 1E2SP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGY B;  3UNY A;  3MK2 A;  5EGE A;  1K7H A;  3IGZ B;  4LR9 A;  5LIA A;  5GOV A;  3UN5 A;  1O99 A;  2VQR A;  3LXQ A;  3MK0 A;  1KH4 A;  2G9Y A;  4GTW A;  3KD8 A;  2GSO A;  3SZZ A;  2XR9 A;  1AJC A;  3Q3Q A;  1ED8 A;  1ANJ A;  1E33 P;  1SHQ A;  4NWJ A;  2W8S A;  1ALI A;  5L0K A;  3M7V A;  5EGH A;  4LR8 A;  1HDH A;  1ZEF A;  3A52 A;  1O98 A;  3E2D A;  4ZG9 A;  4KJD A;  5C66 A;  4LRD A;  4LRF A;  3NKO A;  1ELZ A;  3ED4 A;  3WAY A;  3T00 A;  4KM4 A;  5LRN A;  1EW8 A;  3WAW A;  2W5S A;  3NKM A;  4LR2 A;  2W5V A;  2W8D A;  1KHJ A;  3NKQ A;  3NKP A;  4MY4 A;  3CMR A;  1B8J A;  4UPI A;  4QAX A;  1ED9 A;  1EI6 A;  1N2L A;  4CXK A;  4MHX A;  2IUC A;  1SHN A;  3BDH A;  2GA3 A;  5DLT A;  1KHK A;  4FDI A;  5GRR A;  1EJJ A;  3B5Q A;  4KJG A;  2QZU A;  4LQY A;  4CYS A;  1KHL A;  3T02 A;  4ZGA A;  3IDD A;  5DLV A;  2GSN A;  4UOP A;  5L0E A;  3NKR A;  4ZG6 A;  1Y7A A;  2GLQ A;  5AJ9 A;  3OT9 A;  2ZKT A;  1AJB A;  4ZG7 A;  3TG0 A;  5LRM A;  4UPH A;  5LQQ A;  3BDG A;  2IUC B;  1AJA A;  3NVL A;  4CXS A;  2IFY A;  3M8Y A;  1ZEB A;  3BDF A;  2W5X A;  2D1G A;  4GTZ A;  5IJQ A;  3TWZ A;  3M8Z A;  1AUK A;  3WAX A;  3UO0 A;  1AJD A;  3SZY A;  2W5T A;  1KH7 A;  4TN0 A;  5IJS A;  5HRT A;  4FDJ A;  1EQJ A;  1HQA A;  4KAY A;  1KHN A;  1URB A;  4UPK A;  4LRB A;  2RH6 A;  4GTX A;  3T01 A;  1ELY A;  1ALH A;  4CXU A;  1ALK A;  1FSU A;  5DLW A;  4YR1 A;  2W5W A;  5K4P A;  1Y6V A;  2ANH A;  2W5Q A;  4GTY A;  3WAV A;  1EW2 A;  3TX0 A;  3NKN A;  4LRA A;  1ZED A;  4LRC A;  1KH9 A;  4CYR A;  2GSU A;  4NWX A;  1ANI A;  1URA A;  4UPL A;  1E3C P;  1HJK A;  4UOR A;  5INH A;  1E1Z P;  4B56 A;  3M8W A;  3UN2 A;  4LRE A;  1ALJ A;  3DPC A;  4LR7 A;  1N2K A;  1EW9 A;  4N7T A;  5L0B A;  4KAV A;  2XRG A;  5KXA A;  3UN3 A;  3MK1 A;  3WBH A;  1KH5 A;  1P49 A;  2X98 A;  3BDG B;  2W5R A;  1ELX A;  5TJ3 A;  3DYC A;  4UOO A;  4MIV A;  1E2S P; 
#chains in the Genus database with same CATH topology
 1SKR A;  1FK9 A;  4JYA J;  1WSR A;  4DL6 A;  2RUS A;  1OY8 A;  1XBW A;  3CW2 C;  3IMQ J;  4LF7 F;  2W2Q P;  2AX0 A;  2F3J A;  4LF5 F;  2KM8 C;  2OUG A;  5KFG A;  3GB0 A;  5I42 B;  2LEA A;  2DGQ A;  1B8J A;  3PW7 A;  3EXY A;  1ZET A;  2C3O A;  1DTT B;  1HHS A;  2CQB A;  2B4V A;  1H74 A;  1SQG A;  2Y1J A;  2B8P A;  3QMQ A;  1BQX A;  1H38 A;  4DV3 J;  5HRT A;  3TA2 A;  3AA8 A;  1KKH A;  3GJT B;  4CXU A;  2H54 B;  1ROF A;  1N32 J;  1HMV A;  3MEE A;  1YSJ A;  1NJI T;  2K06 A;  3FSI A;  3EGW B;  1F60 B;  2MKK A;  1RU1 A;  5L1I A;  4IH6 A;  3IC1 A;  2BQR A;  2YWG A;  3EZ5 A;  2KTQ A;  4U67 Q;  4ZHR A;  1N52 B;  2XY7 A;  3NAH A;  4LF9 J;  3JSR A;  3GIK A;  2PN6 A;  4YR2 A;  4R25 A;  3KDN A;  1S4E A;  3HO1 A;  3SCI E;  2B9Y A;  3A52 A;  2J9E A;  4G3I A;  2J8A A;  4AXI A;  3CMA S;  3NBP B;  4MYT A;  1SVD A;  3AJD A;  4USI A;  2IBO A;  1Q5V A;  4L74 A;  3PYD A;  3ICL A;  5E3C A;  1S79 A;  4YB5 A;  4B9V A;  1D9F A;  2JEJ A;  3WX8 A;  5L1L A;  2HK2 A;  4KRW A;  2L48 A;  1TL3 A;  4DL2 A;  3UCZ P;  4TN0 A;  5KFL A;  5BR8 F;  2HKE A;  2OD6 A;  2DT9 A;  3MM5 B;  3A12 A;  4NA2 A;  1N34 J;  2C2Z B;  5E3P A;  4WU3 A;  4TU7 A;  1VOM A;  4MAK A;  3ENW A;  3GR1 A;  5EWE A;  4DPW A;  5LT5 A;  1DQ9 A;  5A8K B;  2PFF B;  2H48 B;  1NCL A;  4J9N A;  4NCB A;  3U02 A;  3NNH A;  1RT1 B;  1SCJ B;  4DJB A;  2QC3 A;  2FHJ D;  4PR6 A;  3UPF A;  2B7B B;  1GMU A;  3D1Q A;  4K59 A;  3KD8 A;  5GAD U;  2DY1 A;  2VG6 B;  3MMC A;  4MYU A;  4LT6 A;  2GMJ A;  1N48 A;  2PSZ A;  1KHV A;  3UNG C;  4FPR A;  1U1P A;  3MPW A;  3NRB A;  1WEL A;  3FCV A;  1WC6 A;  4DR3 F;  1ZA2 B;  3HVT B;  4OFZ A;  2XB2 D;  2HYI B;  1NZA A;  2ATC B;  3EXC X;  2VG5 B;  3MM8 B;  1K47 A;  3KMS A;  2J0Q D;  5B0D A;  1HYS A;  1LXN A;  1JNZ B;  3EGV A;  1NO8 A;  2JNJ A;  4OI0 A;  1JLC B;  5KFP A;  1HBM B;  3BGR A;  1R8C A;  2M70 A;  4IYQ A;  3MPU B;  1J5O A;  4X65 F;  1QAJ A;  2RH6 A;  3IXQ A;  3T19 A;  4C0H A;  2HFZ A;  3CGI A;  3SSQ A;  3OTO F;  4K7Q A;  3FRZ A;  2XY5 A;  1TL7 B;  5HRO A;  1HJK A;  2DGT A;  3CVK A;  1K73 T;  4XPC A;  4X4V A;  1BE4 A;  4A46 A;  4C8K A;  2DHA A;  4JV5 J;  2ILY A;  1RCX B;  1GMW A;  3LO3 A;  2P5V A;  4X4O A;  3GV5 B;  3HM9 A;  3KOA A;  3MM7 B;  1UJ6 A;  1RWO B;  2GZO A;  4ZPW R;  1N0V C;  1LWC A;  1Q53 A;  4RWX A;  1O6X A;  1JK9 B;  2KL8 A;  1S72 S;  2PDA A;  4JI1 F;  4B3S F;  5EUH A;  2QFI A;  1VYA A;  1PYT A;  4KT0 C;  1SPB P;  1RU2 A;  3CJK B;  5KFV A;  1EP4 A;  2QSW A;  1HBU A;  4D3G A;  3LOU A;  2V2Q A;  4Z2X A;  1UEV A;  4J90 A;  2CKW A;  3CUL A;  3NY0 A;  1JLA A;  1KOO A;  1H73 A;  4HI2 A;  2W9B B;  4ZVF A;  1SJR A;  3T01 A;  4JV2 A;  3T1A A;  4UQT A;  2HFV A;  5B0A A;  5C7P A;  1U26 A;  1PJ5 A;  2CQ1 A;  1AUS L;  2OPR B;  3OUY B;  4CYR A;  1VS3 A;  3OTC A;  4UOR A;  2C3P A;  3HX9 A;  5CYM A;  3S7R A;  2OTJ S;  1UPP A;  1YDL A;  4F0M A;  4KQZ A;  1LW2 B;  1RKI A;  1U1R A;  4QR2 A;  5D4L A;  4A8O A;  3PYE A;  2B5J A;  3BSO A;  4DQS A;  1TKT B;  1KQK A;  2DO0 A;  1ZPV A;  3AXM A;  3G87 A;  3ILO A;  3NKY A;  1S97 A;  1C2P A;  1NJW A;  3PHT A;  2JFD A;  4P2X A;  1VRU B;  1WF1 A;  2IM1 A;  4UF4 A;  2BJ3 A;  2L3M A;  2YH1 A;  3F41 A;  3A3O B;  3Q2T C;  3TG0 A;  3A3P B;  4I4B A;  3W8P A;  1R3N A;  3JTN A;  3POT B;  2QGF B;  1YK9 A;  4P72 A;  3MM6 A;  2QYC A;  3IRX A;  4YFU A;  3C66 A;  5HVF A;  1XK8 A;  3DI6 A;  4MKV A;  1ICE B;  4AQY F;  2QMU B;  4RWW A;  8RUC A;  1B7Y B;  1P1L A;  2JEF A;  3MR3 A;  4A48 A;  4EZ6 A;  1M5S A;  1QAI A;  4DQI A;  1S1W A;  2Q6B A;  1WC1 A;  2FB0 A;  2YKO A;  5HI7 A;  2M9K A;  1W26 A;  4Y2I A;  4ZLL A;  1TV6 A;  4UQG A;  5C2G A;  1RUS A;  4B9L A;  3MM9 A;  4IO1 A;  1CUL A;  5C25 B;  1KH4 A;  2DY9 A;  3MTJ A;  2NYI A;  3P45 B;  2LFV A;  1VHF A;  1D9D A;  1SHQ A;  4J37 A;  4Q44 A;  2E1R A;  2E5J A;  2GFF A;  1RHK B;  4WTO B;  4WFB Q;  2G1H A;  1X0F A;  4K2J A;  1B7F A;  5HLF B;  1KP6 A;  4CRJ A;  3M2U A;  1MSW D;  1GTE A;  2HHH F;  2F1F A;  3LWM A;  4P75 A;  2YWF A;  1HNW J;  1KR4 A;  3LGN A;  1RDR A;  5EWG A;  3SSR A;  4IFY A;  3MGJ A;  3J7Z T;  2KFZ A;  3NGD A;  1HI8 A;  1HNX J;  4NYP A;  1GNK A;  4UOH A;  2W5X A;  4KGV B;  4PYA A;  2FHJ A;  4I67 A;  2VAS A;  3DYA B;  4NLP A;  1CJK B;  1X8D A;  4UUX A;  4ED7 A;  3LW5 C;  3T6B A;  3VAL A;  2QX0 A;  1U7L A;  3MAH A;  1FER A;  2HW3 A;  4ZVS B;  2VF3 A;  2HSE B;  2C3Y A;  1HPZ A;  5A0Y A;  2MQL A;  3TVK A;  3IFE A;  1IR2 A;  3KLF B;  3Q2S C;  1FFG B;  1X4B A;  4WKR A;  2ALY B;  1MMD A;  2MKI A;  3R3T A;  2YTC A;  2ZBP A;  4LFC F;  2NR0 A;  1HDH A;  1FKP B;  3PRV A;  3TZY A;  1GX6 A;  2XS7 A;  3AD7 C;  2BEF A;  2O5D A;  2W5V A;  1XC9 A;  4QIG A;  4M5G A;  1EZZ B;  2DCL A;  1JJ4 A;  2HS4 A;  2CQ2 A;  4DFK A;  5ETV A;  3M32 B;  5EN1 A;  2DNO A;  1VC0 A;  3IBW A;  3L09 A;  3V5R A;  3DLG B;  4DV7 J;  2HLT A;  2QA4 S;  3CCQ S;  4GTX A;  2DYA A;  2GHV C;  1FX4 A;  2VG6 A;  5HO4 A;  4O44 B;  5KFY A;  1ZED A;  3ZO7 A;  3KLG A;  4IFV B;  5AJ3 J;  3HVT A;  2IM0 A;  1BQN B;  2RT3 A;  2HZC A;  3H0P A;  2B9E A;  2AJ1 A;  3JAM U;  5I3U A;  4CO5 A;  1MU2 B;  4G65 A;  1BUX A;  2CPJ A;  1ZS6 A;  1N36 J;  2GJ2 A;  3R6G B;  1JLE A;  2BMB A;  1EIY B;  3I6P A;  3Q89 A;  3RRH A;  2CNN B;  2N4C A;  3BBF A;  2FHM A;  3DFE A;  4Y2A A;  2A1B A;  1HR0 J;  3X1L B;  2E7W A;  2RAQ A;  2ZHB A;  1UFL A;  4AT1 B;  4ZLN A;  4DV3 F;  5LMN J;  4F3Q A;  1N32 F;  4ED5 A;  3BDF A;  4NRU A;  4FYW B;  4ILM A;  5CH7 B;  5C2C A;  3T5L A;  1SH3 A;  2FJD B;  1KVJ A;  2A3J A;  3MR2 A;  3R1L A;  2G0I A;  1U2C A;  2AX1 A;  4WK3 A;  5KFK A;  1LQ9 A;  3GPA A;  1FNO A;  5ETR A;  4EBC A;  4LF9 F;  4ZOS A;  1L3K A;  1QE1 B;  2NLW A;  2G4B A;  3SQO P;  4CT9 A;  2FPH X;  5BYS A;  4P9S A;  2IJR A;  3AFG A;  4RW4 B;  1VC5 A;  2AJF E;  1W25 A;  3TQ1 A;  2UZA A;  1U0S A;  5SZT A;  2W9B A;  2XNQ A;  4X66 J;  3NKP A;  2YBV A;  1K0T A;  4HYK A;  1U1K A;  1TAU A;  1ELO A;  2ZH4 A;  1S1V B;  1Y7A A;  2CDR B;  4X4S A;  2HQI A;  2VH7 A;  2ERR A;  4L3K A;  2C42 A;  1N34 F;  4M8L A;  2BE7 D;  3I82 A;  2QJ3 A;  3M30 B;  2ZHO A;  2GHW A;  2YNG A;  4AL7 A;  3ZC4 A;  4XDC A;  3D9B A;  4QU6 A;  1IWG A;  1RT4 B;  1D1U A;  2FTR A;  1VCT A;  4ERD A;  1URA A;  1FRL A;  4F2S A;  3K5M A;  1VI7 A;  2DNK A;  4ES2 A;  2UXB F;  1VRU A;  2CG4 A;  3E3X A;  3CC7 S;  1YI2 S;  1SXL A;  5CYQ A;  4I2P A;  3C6T A;  1RT3 B;  2A0F B;  2QRR A;  3QLH B;  3FVY A;  1UJ5 A;  3V6D B;  1XIQ A;  5E41 A;  3GIR A;  3BDP A;  2Z4P A;  2R3V A;  1S6P A;  4RL1 A;  2IC3 A;  3G6Y A;  3DRR A;  3CC2 S;  3PW5 A;  3PCO B;  2XYP B;  1T9T A;  3K58 A;  2FD2 A;  4OZ0 A;  3I0R B;  1N2L A;  3D54 A;  3UDV A;  2F7V A;  4OYZ A;  4V19 J;  3T9Z A;  2J0W A;  1J5E J;  5GAD I;  1HWU A;  2DKO B;  4EO8 A;  2BV3 A;  1VDH A;  2FVC A;  3M6V A;  3AJ2 A;  4ER8 A;  2GX8 A;  1GXT A;  4ZCK A;  3UD5 A;  3THP A;  2B56 A;  3OSP A;  2YKQ A;  3I56 S;  4IO9 Q;  2HFN A;  2LP4 A;  3KUE A;  2CG8 A;  1FVQ A;  3G8T A;  4JV5 F;  1RWV B;  3NCR A;  2NXE A;  5KT6 A;  1UW4 A;  2W9A A;  2AEM A;  2F63 A;  4YDX A;  1YJW S;  2GO8 A;  1IR0 A;  3H25 A;  3H20 A;  4FF4 A;  1UW9 A;  3HSD A;  2XYG B;  1RTD A;  2NCK L;  1K7H A;  1R0A B;  4OQJ A;  1U47 A;  3DOM B;  3W63 A;  2FUG 9;  1YKW A;  4KBI A;  2OEJ A;  1SC3 B;  1CS4 A;  1YRT A;  4A47 A;  3U27 A;  4QPT A;  3VAK A;  3O1L A;  3GR0 A;  4URG A;  2GVD B;  4CLF A;  1EX8 A;  2DGV A;  1WI6 A;  4I64 A;  3Q8Q B;  3BR8 A;  5A8R B;  1HQE A;  1KHK A;  4CLS A;  4EBD A;  5KT7 A;  1NHU A;  4FKX A;  3CCZ A;  3DOL A;  4IG3 B;  3QT6 A;  3CJ0 A;  2CNK B;  3WZ0 A;  3KLF A;  2R7T A;  4DV2 J;  1APS A;  4QYZ J;  1QLN A;  2G13 A;  1RTJ A;  4GTZ A;  5DET A;  2I6W A;  2HBZ B;  2CPE A;  3DOK A;  3FDS A;  4DV6 J;  4KH0 B;  5B09 A;  5HN0 A;  3HFV A;  5DG9 A;  4DU7 A;  4FF3 A;  1UWB B;  4Y0F A;  2XI2 A;  2ZBQ A;  1ZZN A;  3I0S A;  4DX5 A;  1UFK A;  4AE5 A;  4YDD B;  2ZFH A;  1Y4Z B;  2LA4 A;  4G1P A;  4LSL A;  2P6T A;  4C2M A;  5M2U A;  4F36 A;  1ZH5 A;  3AXK A;  4ZIT A;  4RW8 B;  1OSD A;  1S4F A;  1RWX B;  2W25 A;  4CLU A;  4FNI A;  4ANC A;  1SI9 A;  1CBK A;  3MMB A;  3IGV A;  5GAG I;  2W8L A;  1KD1 T;  1VJQ A;  4O44 A;  2L41 A;  3CMR A;  1CG2 A;  4KFB B;  4CIO A;  4QWA A;  2MZ1 A;  2QLB B;  2OO4 A;  3CSK A;  2ZJQ Q;  4RW7 B;  5IT9 Y;  4PAA A;  1HBO B;  5JVG Q;  1JIH A;  3OBI A;  1SL1 A;  2Z2L A;  4RX6 A;  2A6M A;  2ZKU A;  2MDA A;  3PY8 A;  3OLA A;  1VLY A;  2HGN A;  1OYE A;  2V8H A;  2AJ4 A;  3N5B A;  1IM6 A;  4A8S A;  4K4V A;  1T9Y A;  1TVR B;  3DRS B;  4DCP B;  3VR1 A;  3V6K A;  5HMZ A;  3NXZ A;  3Q22 A;  1TKD A;  2GC8 A;  4NI2 B;  3NMR A;  1SKU B;  4WFZ A;  2BA9 A;  4V1A k;  3PKY A;  4X4P A;  3JSB A;  5GOV A;  2MGZ B;  3DLE B;  3CDE A;  4ZP9 A;  5AE3 A;  3Q3Q A;  4WP8 A;  3OXG A;  4Q2L A;  1TMJ A;  2R2T A;  1HNW F;  3CCR S;  1O98 A;  3Q8U A;  3M8R A;  4LBP A;  1N5Q A;  1U49 A;  3N6N A;  2CZ9 A;  2V4J B;  1VQ6 S;  3K8V A;  2HHW A;  2KN4 A;  2IUC A;  2BAC A;  1HNX F;  4ETZ A;  1VK8 A;  1K9M T;  1HHT P;  2VON A;  1YTY A;  4ZVG A;  5B0B A;  1VQ4 S;  1XTZ A;  3GJQ B;  1X5T A;  1S0N A;  4TVA B;  4ILL A;  1YBU A;  4ZVT B;  3AA9 A;  1WAC A;  3O8W A;  5KFF A;  3A4T A;  3MUT P;  3LP0 A;  2DGX A;  2WRM A;  1S1X B;  2P9E A;  2QO3 A;  4OX8 A;  1N6Q B;  1LW0 B;  3HDS A;  2Z57 B;  2FHK A;  4FBU A;  3R97 A;  2XZT B;  1TKX B;  1OY9 A;  4TXS A;  4ZJO A;  1I6J A;  5KFA A;  4CO0 A;  2RF2 A;  4IUF A;  2E66 A;  4M5M A;  3DCA A;  4RUA A;  3MK1 A;  3QRQ A;  1FFW B;  2R7O A;  4HHJ A;  1S1V A;  4LVO P;  4C7Q A;  2V4Q A;  4OYO A;  3NGK A;  4B9U A;  5DGB A;  4U6P A;  4PQU B;  2AJ2 A;  1FDD A;  1NSK L;  1TP7 A;  4QR0 A;  1LFW A;  2UV8 G;  1JLQ A;  3WC0 A;  3W2W B;  3FJ2 A;  1SJ1 A;  3EDR B;  3QQC D;  1MN7 A;  3W65 A;  4K4Z A;  5CAA A;  1YJN S;  4WKY A;  5LM7 E;  4LQY A;  1RTH A;  1Q8I A;  1K1S A;  4PXD A;  1NK5 A;  4WK1 A;  5KOX A;  5D4N A;  2CZV C;  4PXE A;  4LUB A;  4F3O A;  3R7B B;  5KFB A;  1IR1 A;  3IS9 A;  2AW0 A;  4RLE A;  2C3U A;  4X84 A;  2VBZ A;  3RYL A;  4UW2 A;  2QEX S;  4LFA F;  4QIW D;  3TOQ A;  5AJ3 F;  4KGK A;  3FMB A;  1IQZ A;  2YQ0 A;  4ZVH A;  1R27 B;  1RAI B;  2GHP A;  1VIS A;  4FYV B;  4QW9 A;  1KSP A;  4NZ0 A;  4BLG A;  4RU2 A;  3HT0 A;  3DRX A;  1BGX T;  3HJV A;  3PVX A;  4DEZ A;  4DU8 A;  1PBA A;  2ZE2 B;  5LIA A;  2HFO A;  3P5T L;  1T3N A;  3KLV A;  2M88 A;  1HR0 F;  2HVE A;  2KXF A;  4QYZ K;  1S6O A;  3TAR A;  2Y0S D;  1ALI A;  2BDP A;  2OFH X;  1QVG R;  1H2T Z;  3CJ2 A;  1CJV B;  3I96 A;  3BRE A;  3C6U A;  5RUB A;  2DHH A;  3E01 A;  4QAX A;  2JJ4 D;  5LMN F;  1KN6 A;  1SHN A;  4JI0 J;  3BSC A;  3MD3 A;  1GTH A;  1NSP A;  3EVW A;  2HHT A;  3AOC A;  5IM0 B;  3D68 A;  3QO9 B;  1WHV A;  1EET A;  2CQC A;  4LBH A;  2BQ3 A;  1GEH A;  2YWE A;  2J9D A;  5K8N A;  4YHH J;  1EKR A;  2DR6 A;  4AYB D;  4DG1 A;  2FY1 A;  4UUW A;  1MWY A;  2O66 A;  4DXL A;  5KFE A;  1URB A;  2W9C B;  3GQC A;  2DO4 A;  2BE2 A;  1SQE A;  3QPI A;  2OKQ A;  3Q8Y A;  3IM8 A;  1RZM A;  2I0X A;  3J7Y U;  3NNA A;  1NKB A;  4WFA Q;  2GVD A;  1WKK A;  1GT8 A;  2QL7 B;  5HK4 A;  2Q6C A;  1E6V B;  3NS5 A;  4WE1 B;  4DR5 F;  2PI5 A;  1UVL A;  5EGE A;  4X4T A;  3Q23 A;  3KG1 A;  4PYD A;  1AFI A;  1YJT A;  4A8F A;  2UUB J;  4ZLP A;  4NZ6 A;  5FLX U;  1KTV A;  2AYE A;  2PGC A;  5EGH A;  1C0T A;  5K14 B;  2QT7 A;  4IKA A;  4YR3 A;  4MK8 A;  4OZL A;  1EW8 A;  3BGO P;  2MKH A;  2ZIT A;  4WCE Q;  2ROE A;  3PDN A;  4CI0 B;  4KHR A;  1ULR A;  4FYX B;  2R7U A;  1MW7 A;  3OPK A;  5F3Z A;  5T7L B;  1DUR A;  3PIP Q;  2DIV A;  4J5O A;  5IV4 A;  4M5H A;  3MFH A;  1F5B A;  3KNA A;  2FLO A;  4ALZ A;  3GTY X;  3JYT B;  5AXM A;  1RT5 B;  2FJV A;  5GAE U;  2WOM B;  1C0U B;  3ISN D;  4YN3 B;  4F4Z A;  2OP5 A;  3CCJ S;  2MZQ A;  4FVC A;  4NLG A;  2AQ4 A;  3K17 A;  2VL1 A;  4NWX A;  2I38 A;  2EXU A;  3G6V A;  4ZCM A;  2MB0 B;  2H65 B;  4IRC A;  1KQS R;  3D1H A;  2E1M C;  2D1C A;  3IGY B;  3ET6 B;  3LP1 B;  3ZTS A;  5HQ8 A;  2QA1 A;  2HRU A;  2E9Z A;  3PJ9 A;  2BM1 A;  3IWL A;  2VDI A;  2XR9 A;  1AJC A;  1JLB A;  1LWF B;  3G6E S;  3S01 A;  1M5H A;  2RS8 A;  3OR1 A;  4NLW A;  1JMT A;  2BAB A;  1IJE B;  4O3R A;  1J5E F;  3K57 A;  4HVZ A;  1TVR A;  1T05 A;  4E2F B;  2XBP A;  3CF5 Q;  3QFH A;  5IQ6 A;  1MWZ A;  1N5T A;  2FGC A;  1U6B A;  2QSF A;  3QJP A;  3CO0 P;  2GIQ A;  2AV5 A;  2PEH A;  3TUP A;  1JKH B;  2J6S A;  4QWD A;  4DV0 J;  2JH3 A;  6FDR A;  2YPZ A;  4CYU B;  3MZI A;  2YNH A;  4OZ2 A;  3G71 S;  1ELY A;  4KPC A;  2ZOF A;  4F04 B;  1YBT A;  4DX7 A;  1TQL A;  2Z58 B;  5J2N B;  2BUN A;  2LDY A;  3CT9 A;  1FT8 A;  3HVR A;  1WUU A;  5CCM A;  2R9L A;  4J9L A;  2UXC J;  3CCT A;  4WIQ A;  1IKY B;  3M2R B;  5L1J A;  1RAH B;  1KDN A;  2U1A A;  5FD1 A;  2IVY A;  4KAI A;  5J2M B;  4JI5 J;  3MK0 A;  4ANE A;  2HK3 A;  1UEK A;  3F44 A;  4JB8 B;  3W66 A;  4NRT A;  3CED A;  1F5A A;  4KHP J;  1LW0 A;  2FZK B;  2EFQ A;  1ED9 A;  1Y00 A;  4ES1 A;  4DV2 F;  5KTQ A;  3W2V B;  2KB2 A;  1U6F A;  1JJH A;  1S6Q B;  2QLJ B;  5ETM A;  5HQM A;  1NBE B;  3Q86 A;  2ZVS A;  4DV6 F;  2EFG A;  3I4H X;  2ACM A;  4KIA A;  2W7O A;  7FD1 A;  4FXV A;  1RYR A;  4F26 A;  2CNL B;  4CM0 A;  3M8Q A;  3DLK B;  3MPD A;  3FEX B;  1RJJ A;  5JMN A;  4JI6 F;  3T1Y J;  3KWM A;  2BW7 A;  3AY0 A;  2HND B;  5INH A;  2FHO B;  2B9W A;  4ID5 B;  1OS5 A;  1LWX A;  4BCA A;  1U6Z A;  3EYZ A;  1XR7 A;  4BS2 A;  5EDW A;  4KYZ A;  4N76 A;  3RBZ A;  1B3T A;  3TQE A;  3MHY A;  1S9G B;  2V2Z A;  1RWP B;  3D0H E;  2QV6 A;  1ZA1 B;  4IRK A;  1VIX A;  4DL5 A;  3MUV P;  4OX6 A;  4I7F B;  3BF4 A;  3PEH A;  2EG2 A;  1X4A A;  4ZIW A;  3GYN A;  2VPY B;  3ZZU A;  4M63 A;  2CQG A;  1FI4 A;  1VQO S;  1J27 A;  5AXL A;  3M8S A;  4MHX A;  1C4A A;  1X5S A;  2PI4 A;  3VHQ A;  4B3T F;  1YHQ S;  2R8K A;  1YWX A;  2R8J A;  2E5I A;  3VTI A;  4UZC A;  3SFG A;  3WIU A;  2QTW A;  1SKW A;  3CIZ A;  4QIE A;  3IG1 A;  1T03 B;  1K0V A;  2BAN B;  1V9O A;  3Q8S B;  3OHB A;  4QWE A;  3PZP A;  1PIL A;  4P74 A;  1R8A A;  1GQE A;  3DGP B;  4URQ U;  2FVS A;  1CJV A;  3PW2 A;  4KKO A;  2JOQ A;  3M05 A;  4A8M P;  4PAB A;  1IBL J;  2HNZ B;  1GMV A;  7AT1 B;  1TEL A;  4NLQ A;  1U1O A;  1K1Q A;  3QO9 A;  3BQ0 A;  2F8H A;  4ES3 A;  3PR4 A;  3UCG A;  4NX9 A;  4G6V B;  1R31 A;  1U25 A;  2HHX A;  2EVZ A;  2ROG A;  1S0O A;  2H51 B;  1WJ9 A;  3TA1 A;  4USK A;  2HRT A;  1MNE A;  2F4F A;  2VU5 A;  5AE2 A;  1F9F A;  1FE0 A;  2XMK A;  2DXF A;  2W2P P;  2AIR B;  4F4A A;  2CWX A;  1AZS B;  3IO1 A;  3F73 A;  2RE1 A;  3BYP A;  4EYI B;  3PW0 A;  3G4S S;  3HT3 A;  4HTJ A;  3G6X A;  1M5P C;  3E8O A;  1DBD A;  5LSR A;  3GIM A;  2XG8 A;  2EFN A;  1UJ4 A;  1NXI A;  2FJW A;  2MXY A;  1YIJ S;  2ADB A;  4JBC A;  1DQ8 A;  2XSJ B;  1REV A;  1WC0 A;  1HAR A;  4B56 A;  4B9T A;  1IJF B;  3H5Y A;  5FDL B;  4CLW A;  4YY3 J;  4DQP A;  1E2S P;  2EK6 A;  2ZBR A;  2DNL A;  2VOP A;  3RTV A;  2R7W A;  2XZD B;  4NLU A;  4Q5V A;  2EBE A;  3N79 A;  1TUV A;  4KV8 B;  4HLB A;  3QYY A;  4K4X A;  1S9E B;  2LKZ A;  5EHH A;  3SSS A;  2B9X A;  3BKT A;  2VQE J;  4I6Y A;  2YKM A;  3ZZT A;  5CA5 A;  2ZJP Q;  2WW4 A;  2JDJ A;  2YQ1 A;  1Q79 A;  4XTT A;  3H4D A;  1J2V A;  4PG5 A;  3J81 U;  1N8R T;  2HHQ A;  2LDI A;  4F3M A;  2J7U A;  1N4L A;  4NAS A;  1L3T A;  2Y1R I;  3D5M A;  2D41 A;  5D77 A;  1NK0 A;  1TL4 A;  4M5D B;  5KG1 A;  1LK7 A;  1KH9 A;  1R89 A;  2EK1 A;  1QSS A;  2AP6 A;  1AT1 B;  2DHX A;  3SEO A;  2XMT A;  1C4C A;  4F4K A;  3UE2 A;  4Q43 A;  2KYX A;  1RXO B;  2W4P A;  5IWA J;  2HAI A;  4TY8 B;  3OSN A;  1WKJ A;  3QSY B;  3MEG B;  3BKU A;  1DLO B;  1RWW B;  2DNQ A;  5H1S V;  2DNR A;  2I5J B;  3HZG A;  1KBR A;  2Z56 B;  2LQ9 A;  4ZKA A;  2V8V A;  3VAJ A;  2ZH5 A;  4YHH F;  4F4W A;  3GV8 B;  4NPO A;  5DZ6 A;  3PFO A;  1PO6 A;  4DSF A;  2FLP A;  3DRP A;  3DHX A;  4CT8 A;  2AT1 B;  3AB2 B;  2AZ3 A;  2YNI B;  4CXS A;  3GSD A;  3M2R A;  1TR0 A;  4W98 A;  3EX7 B;  2BOP A;  4IQM A;  5E3A A;  5J2M A;  2PT0 A;  1YZ6 A;  2HVD A;  4ZPT R;  5EX0 A;  3RR8 A;  5HQL A;  2DH7 A;  1VQL S;  4B3O A;  2ZNY A;  4DSE A;  3R2C J;  2IDE A;  2ZD1 B;  2CJ9 A;  2N7Y A;  5A8W B;  2RKI B;  4H4O A;  1WOS A;  2PMZ D;  5ITH A;  2ZUA A;  1VK3 A;  4F0H A;  2WON B;  2UUB F;  1KH5 A;  4NCG A;  2MY7 A;  4WXW A;  2NSC A;  2DNP A;  4P7T A;  4EI2 A;  4DFP A;  4LR9 A;  2XHC A;  1IKX B;  4KE5 A;  3R9L A;  4WYW A;  4CTA B;  1VRT B;  2AKW B;  3TEH B;  1WEY A;  1F9H A;  2ZH7 A;  1FK9 B;  1FVS A;  5HAO A;  1URR A;  3VVU A;  1V5I B;  5IT0 A;  2MZT A;  3E2D A;  3KK2 B;  3DLK A;  1T3O A;  4G1Q B;  1M1H A;  1M5K C;  1Y7P A;  3V81 A;  5KT2 A;  3M8P B;  4ECQ A;  4J9V A;  3PG9 A;  1GX5 A;  5IC4 B;  3RAM A;  3EIC A;  5E2Q A;  3K59 A;  1NDK A;  1G6B A;  4BHQ A;  2OMO A;  4KY3 A;  4PEO A;  1E6Y A;  2GJI A;  1SJ3 P;  2DGO A;  5IJQ A;  5DQI A;  1URN A;  2ZUG A;  1IKV A;  3J7A 1;  1WHX A;  2KRR A;  4OL8 A;  3S8S A;  5CZV A;  4LIR A;  2R4F A;  3VAI A;  2ZHA A;  2IJF A;  4RPF A;  4LFB J;  4B3R J;  2KZM A;  5ETT A;  1RT6 A;  1HMV B;  2JVR A;  3MEE B;  1BMQ B;  4LF6 J;  4HTI A;  1XQI A;  5DLF A;  5M2P A;  4UOF A;  1ZOT A;  4JI2 J;  4JUZ A;  1OYD A;  1CJT A;  4DS4 A;  3P3D A;  2EFO A;  2ZZT A;  2HQC A;  1RHU B;  1XN9 A;  4TLR A;  4WP3 A;  3SCL E;  1NSQ A;  3NKO A;  1DAX A;  1HBN A;  4KM4 A;  5D4O A;  1O8B A;  1C1B A;  1XR5 A;  3DGP A;  3ENA A;  1WC3 A;  4DSJ A;  1TK0 A;  2CFX A;  4DV0 F;  4NXN J;  4OYM A;  2CJX B;  5DM7 Q;  1N33 J;  2CAJ A;  2F9J A;  1ACM B;  1AJA A;  2HFS A;  5F41 A;  3GSI A;  2UXD F;  5HSP A;  5IJS A;  1RE1 B;  1DTQ A;  1TL3 B;  2UXC F;  3D6T B;  4A4J A;  4C8O A;  5BXI A;  3ZTP A;  1KVK A;  2GSU A;  2LQ5 A;  3FKB A;  2Y9H A;  3CIM A;  3GWC A;  4L6V 3;  1RLD A;  3TA0 A;  4JI5 F;  1N54 B;  1IQT A;  1UEU A;  1HFE L;  4PG7 A;  2EKN A;  2M8D B;  4XPE A;  3ZZ0 A;  1NRK A;  1B0T A;  5D3G A;  1Q81 T;  1QDU B;  4ICL A;  3EPG A;  4X2B A;  1S7I A;  4Y2C A;  1KQF B;  4ED4 A;  4QIV A;  3ZZY A;  1OWX A;  3W9I A;  3H59 A;  3KK1 A;  1JLF A;  4FPI A;  4P71 A;  3MMC B;  4H4K A;  2XSJ A;  3OLB A;  1TTH B;  1BQM A;  3M6W A;  3H5X A;  2NRE A;  3CD6 S;  1NK8 A;  4ZG7 A;  1CC7 A;  4AL5 A;  2J9C A;  4A8W A;  3VZI A;  3FEZ A;  4ED0 A;  3T1Y F;  2XI3 A;  2P9C A;  2G2Z A;  3UR0 A;  1HYS B;  4OI6 A;  1OQ6 A;  1WD6 A;  2WVD A;  4FDJ A;  1QVF R;  3P96 A;  2GGP A;  2VBY A;  4IRD A;  1NB7 A;  2QZ8 A;  2WVF A;  5F0W A;  4ZCI A;  3BGR B;  4MFB A;  4OZJ A;  1GXL A;  4ECW A;  2J6U A;  1J5O B;  1OPI A;  3RUB L;  2ZM6 J;  2PMW A;  1IVZ A;  2JLF A;  2BZ2 A;  5IS2 A;  3CJ3 A;  3M9M B;  2GVZ A;  1S1T A;  4MIA A;  3TZZ A;  2Y8W A;  5LJ3 Y;  5CQG A;  2V4R A;  3AT1 B;  3CDW A;  2ASD A;  5HRO B;  3KLH B;  3KJN B;  1JB0 C;  2LU2 A;  2F8M A;  4OMF G;  4C3L A;  1S48 A;  2RRA A;  2WVB A;  1LV5 A;  1LKZ A;  2GNK A;  4MIW A;  3QJL A;  4HH1 A;  2VUG A;  2GV1 A;  4DL7 A;  5HP1 A;  2YX7 A;  2YWW A;  2CA9 A;  3OW2 R;  4OJ1 A;  5T41 A;  1SH0 A;  4MKA A;  2R7R A;  3WHI A;  1LWC B;  2V63 A;  1EQ0 A;  3NOG A;  2BJ7 A;  4ZGA A;  2B6A A;  2EG1 A;  2AD9 A;  1X60 A;  2A2C A;  1YGY A;  2M7S A;  2VA2 A;  1T11 A;  4IR1 A;  1GH8 A;  1HBU B;  3BKF A;  3DC2 A;  2KT3 A;  3MF5 A;  2K7K A;  2R8H A;  4IOA Q;  3OFE A;  4DQR A;  1QJH A;  2J7W A;  4J9K A;  2I1R A;  3MEG A;  4U96 A;  1IBL F;  4MKB A;  3UI3 A;  2CPY A;  1JLA B;  4HHH A;  2ZOG A;  2I5J A;  3N6M A;  2JC0 A;  4C98 A;  4TKT A;  3B54 A;  4OHY A;  5ADZ A;  5A6P A;  3D2W A;  2H4W B;  2VFV A;  3JAM Y;  2IMO A;  2CNO B;  3VGT A;  4YB1 P;  2RU3 A;  3DU6 A;  5CYM B;  2IFX A;  1RHM B;  4QZV B;  3HCX A;  2YNI A;  3BN7 A;  4XAK A;  1V6H A;  1NPK A;  4A8Q A;  4KJD A;  9RUB A;  1ELZ A;  2LLZ A;  1AXQ A;  2FZC B;  2Y8Y A;  2B5J B;  4K4W A;  2L08 A;  1BY9 A;  3WIV A;  2ADC A;  5A8W A;  3B5Q A;  3QGP A;  2C2M B;  2GSN A;  2VIH A;  1VQN S;  3W9J A;  4MK7 A;  1CPZ A;  1UVJ A;  2V0N A;  2DRB A;  4U7U D;  4PZV A;  1HI0 P;  3W5Z A;  4OHX A;  2X51 A;  3MPV A;  3V4M A;  4IG0 A;  4NLT A;  3VAG A;  1G7C B;  4YY3 F;  4U8V A;  2YKA A;  1FKA F;  3D66 A;  1REG X;  2W5Q A;  2X3G A;  3LPY A;  2HWT A;  3KK2 A;  2QLW A;  2RVJ A;  3SI8 A;  2SXL A;  3MM6 B;  4G1Q A;  1RP5 A;  3IRX B;  1VFJ A;  4ZIV A;  4JI3 J;  3DI6 B;  3M8P A;  2VBX A;  2XMA A;  5KFR A;  4DF8 A;  2YY3 A;  5LL6 d;  1XMQ J;  1S1W B;  3ILI A;  4ZP6 A;  4ZVO B;  1TV6 B;  1RLC L;  2VQE F;  9ATC B;  3MM9 B;  1AFJ A;  1RHQ B;  1CUL B;  3A8J A;  3GFY A;  3T3F A;  1VBZ A;  4NLO A;  1U09 A;  4OX7 A;  2HMI A;  4O0N A;  3RU0 A;  3HHL A;  2PII A;  1VQS A;  1YJU A;  4UOC A;  4C11 B;  5G0R A;  3OL9 A;  4RW9 A;  4R0J A;  3SFU A;  3M2U B;  3CJ4 A;  3HI9 A;  2ZH3 A;  4LSZ B;  1IKW A;  3D3C J;  4QWB A;  4FXW A;  2FDN A;  4IFY B;  5HJY A;  2IVM A;  1FKO A;  4KAY A;  5B0C A;  3QIP A;  2MQN A;  2IJN A;  4OJG A;  4RUC A;  3ENV A;  2APO A;  3THV A;  1RAE B;  3KUG A;  5J1P A;  1VRQ C;  3K0J A;  1RWM B;  2W2O P;  4F25 A;  4OV1 A;  5IWA F;  1UZH A;  3KJV A;  4DV1 J;  1NDL A;  2K3K A;  4OJH A;  1M1G A;  3BDG B;  1CVJ A;  2L9D A;  3BO4 A;  1L3V A;  4KH1 B;  2R2U A;  2D3U A;  1HPZ B;  5A0Y B;  5KT4 A;  1TMM A;  3R5B A;  1U02 A;  1PC4 A;  2WSE C;  3IR5 B;  2MPU A;  2VA3 A;  3RRK A;  4LRF A;  3DKD A;  4U9R A;  2IAJ A;  2CPI A;  3PYG A;  4GVB A;  3PEJ A;  3KLI A;  3FQL A;  3LH2 S;  1XWL A;  5KFS A;  3SV3 A;  1L3S A;  2R8I A;  4TN2 A;  2F9D A;  2O01 C;  2FGO A;  2B51 A;  2ZC4 A;  2MKS A;  1U48 A;  3SDE B;  2CPH A;  2DNH A;  5IV3 A;  2HBQ B;  1L5U A;  3MED A;  1FSU A;  5DLW A;  4XDD A;  2FIU A;  2C28 A;  4IOB A;  3HHL C;  2HGL A;  4TY9 A;  2Z8Q A;  4DUT A;  4ETX A;  3C3L A;  2XHW A;  1H7W A;  4O3Q A;  1TU0 B;  3QRR A;  3GFZ A;  4AXJ A;  1RK8 A;  5KFW A;  1YVF A;  4OIX A;  3DYC A;  3KLG B;  1VMB A;  3PIO Q;  3GJR B;  3BQ1 A;  3CTR A;  2KU7 A;  2JZ5 A;  2XCP A;  4FYD A;  4FVM A;  4WJB A;  4DCJ B;  3DN9 A;  2D3O 1;  4E98 A;  3UCU P;  1X5P A;  1FX2 A;  1ED8 A;  5I3U B;  4UOG A;  2LQJ A;  3NLC A;  2PMH A;  4ITS A;  1KFS A;  1JLE B;  1KFD A;  4GMK A;  1R6V A;  4MY4 A;  1FE4 A;  5I3Q A;  2FJE B;  1U8S A;  2CPF A;  1PKU A;  4OZN A;  4ECT A;  3U1N A;  3EZU A;  1WC5 A;  4W92 B;  3VVT A;  2VQF J;  5L0E A;  3MI7 X;  5EGY A;  1FTR A;  5LSL A;  2EC0 A;  3ZZO A;  3BDE A;  1HLW A;  1M90 T;  5GAH U;  3KLH A;  3BN4 A;  3G82 B;  3D7S B;  4KSE B;  4LFB F;  4B3R F;  4PUO A;  4C8Y A;  2KG1 A;  3UD3 P;  2W4C A;  4LF6 F;  3E2E A;  4NOH A;  1WC4 A;  3Q0A A;  3CJQ A;  3N5F A;  2JEG A;  1ANI A;  4JI2 F;  3D6M B;  1FTC A;  3RRG A;  1F0X A;  1T94 A;  1S1U B;  3KHR A;  3HHK A;  3HHN B;  4N7T A;  1TL1 A;  4Q0B B;  3VZH A;  4OYX A;  3QNW B;  3TJA A;  1VC6 A;  3D0I E;  3I9Z A;  4DPX A;  1F3F A;  1V3R A;  2RS2 A;  3H8Y A;  2HHU A;  5D0R A;  4TNO A;  2G9Y A;  3M9N B;  2PE8 A;  3RJM B;  4NXN F;  2AGP A;  5BJR A;  4HDG A;  3DU5 A;  1N33 F;  3LAM A;  4LQ3 A;  2DRA A;  4C4W A;  2CJB A;  3UFC X;  1JXE A;  2GA3 A;  3CCM S;  2AGO A;  1UA1 A;  2QA2 A;  1XEZ A;  1X31 C;  4LBI A;  3ZTQ A;  4B9N A;  2IYI A;  1WI8 A;  3CDU A;  5LXY A;  2BJ9 A;  4JI4 J;  1NK6 A;  5CAB A;  2ACY A;  5GAG U;  3C46 A;  4LF5 J;  2ZH9 A;  5HMY A;  2MKJ A;  1U2F A;  1XER A;  4KO0 A;  3OL8 A;  3H98 A;  4F4X A;  2OIH A;  3NNC A;  5DDR C;  1QSY A;  2B8Q A;  2YNG B;  3PAC A;  4KTQ A;  2HIQ A;  1N2K A;  3MPY A;  3UN3 A;  1Q16 B;  3CD7 A;  3V4I A;  3KHH A;  3B4D A;  3O3L A;  4I6W A;  3OJS A;  4J9O A;  1H0H B;  4KGM A;  3FZB A;  3T5H A;  4I2P B;  5CYQ B;  1IM4 A;  1WEX A;  2DBB A;  3C6T B;  2KG0 A;  1PGZ A;  4LRD A;  3TI0 A;  4DX8 H;  1S6P B;  2IC3 B;  3TZW A;  3A8E A;  3DRR B;  2B7C B;  3W9H A;  4DR7 J;  3NKR A;  5D0E A;  1YJ7 A;  4OYP A;  4B08 A;  3ISZ A;  4FN5 A;  1F9E B;  2W01 A;  2KJW A;  3DDI A;  2WSF C;  4DSL A;  2FYX A;  3G8S A;  4DUZ F;  5B0E A;  2OTL S;  2GQQ A;  2YKP A;  4USH A;  1S0V A;  4NE9 C;  1FEH A;  4M5N A;  3DLL Q;  1Y11 A;  2RU9 A;  3IR7 B;  1E1Z P;  4MH8 A;  1O0P A;  1TK8 A;  2RD5 C;  2EPI A;  4FP9 A;  4ZPB A;  2EC2 A;  4HAC B;  2EW9 A;  4GC6 A;  2Z2Y B;  1KEK A;  2N7C A;  4C11 A;  1XR6 A;  2DNN A;  5KG7 A;  4N5S A;  2CAD A;  2GW8 A;  3W7B A;  1HNI B;  4P52 A;  5BR8 J;  2F5G A;  4YME A;  1N5Y B;  1RTD B;  2RQ4 A;  3ADA C;  2R2R A;  1O51 A;  1CS4 B;  3T1H J;  1U1M A;  5KFN A;  2GIF A;  5KFT A;  3L4B C;  1WTF A;  5ETP A;  4USV A;  4OI2 A;  1FWP A;  2ZBI A;  1A6L A;  4CNZ A;  4LSN B;  5DO2 A;  2YH0 A;  3KJF B;  3FCW A;  2MY8 A;  2XSF A;  2POK A;  2DGS A;  1H3D A;  3B4M A;  2NS1 B;  2KH9 A;  2KRB A;  3BDG A;  3UDE A;  1HQE B;  5ETQ A;  4ED6 A;  3M8Y A;  3TRG A;  5KFU A;  5CZX A;  4N8O A;  1MRO A;  3DOL B;  1DHM A;  2DK2 A;  4GC7 A;  1CJU A;  1ZM9 A;  3E51 A;  3MMJ A;  4OYW A;  2DD8 S;  4DR3 J;  3WAV A;  1PYS B;  4N77 A;  1RTJ B;  3R27 A;  1KHW A;  2MQO A;  1FWL A;  2W2M P;  4J7C A;  3ZZZ A;  4B9M A;  1L3U A;  3LP2 A;  2FC9 A;  3JXO A;  3DOK B;  1UTA A;  4LR7 A;  2DXD A;  3NS6 A;  2FY8 A;  3BH7 B;  3UVJ B;  3I4P A;  1LWE B;  4N41 A;  1HL6 A;  3AJ1 A;  5KFX A;  3R5G A;  3U7J A;  1W7W A;  2QYG A;  1HD0 A;  3I0S B;  5F8L A;  2HBR B;  3W5X A;  3VAF A;  3A1Y G;  2Q43 A;  3BZQ A;  2CQP A;  3SDE A;  4LSL B;  3CO9 A;  1BWV A;  2N3O A;  3W60 A;  5ETO A;  3H2L A;  4LR2 A;  3MR7 A;  1YG0 A;  1FNX H;  1GAO A;  2QE5 A;  3NWR A;  3QZ8 A;  3HHE A;  3CCL S;  3MMB B;  3DDK A;  4ED8 A;  4M5K A;  2NXJ A;  4PQA A;  2IM2 A;  1VHI A;  4JYA F;  1KWM A;  1NU4 A;  1VJW A;  3MDF A;  4X4Q A;  2UV8 A;  2OJ3 A;  4JI3 F;  1KHN A;  5F8M A;  3TAM A;  1EKS A;  3L95 X;  1Y6V A;  4X4U A;  3BSA A;  2RDJ A;  2ILZ A;  1R6Y A;  1XMQ F;  4L76 A;  4WFY A;  3KG0 A;  2G1D A;  2HQ3 A;  3CPW R;  1UET A;  2ZWO A;  1X4C A;  1D09 B;  4F2R A;  3IGZ B;  1ZZF A;  2WW8 A;  2B4P A;  3T41 A;  4AND A;  2QLF B;  3C2P A;  4I2Q A;  2AHO B;  3B6B A;  5FLX Y;  3QID A;  3G82 A;  3AHP A;  1Y10 A;  2XUL A;  2E1C A;  4NCA A;  1UKU A;  3C14 A;  3C8Y A;  1V3Z A;  3FQK A;  3TYT A;  3UWT A;  3UW1 A;  4EUV A;  2Z2Z A;  4Y28 C;  1DZ5 A;  1S1U A;  1YIT S;  4Q0B A;  2XMJ A;  5LQQ A;  2IUC B;  4C3K A;  3W5Y A;  1DQA A;  4TYA A;  3JTO A;  7FDR A;  2MHE A;  4F8R A;  2MZS A;  3D28 A;  1HQA A;  2JHE A;  4LRB A;  5DQH A;  1Y3J A;  2DH8 A;  2QL5 B;  4DV1 F;  5B08 A;  4QW8 A;  3MFI A;  1B4S A;  5HVH A;  2MMY A;  4EU0 A;  4P7V A;  5KG4 A;  4P2F A;  1FRI A;  1RBL A;  3LP0 B;  2M5Y A;  4X62 J;  2K1R A;  1MN9 A;  1F3V A;  4DHV A;  5G4D A;  4LF4 J;  3TO8 A;  3PO5 A;  3WBH A;  1KNZ A;  2QL9 B;  2AGQ A;  3GFH A;  1UVM A;  1YBA A;  2RF2 B;  3BH6 B;  4ZVP B;  3FRY A;  4P2S A;  2E5L J;  3AOA A;  2NUH A;  4ZK7 M;  1RB0 A;  3DLJ A;  2IRY A;  2FVQ A;  1SC4 B;  4ECS A;  1IBM J;  1YJV A;  4CLY A;  2OAU A;  4NEY A;  5K5M A;  2VFR A;  3U1M A;  4ZP8 A;  2JX2 A;  1B0V A;  3IRW P;  1FNM A;  5C24 B;  3SQG A;  2JC1 A;  3KK3 A;  1YX2 A;  3RG6 A;  4DV5 J;  3T02 A;  1JLQ B;  4YB7 A;  1QAY A;  5D8H B;  5MLC V;  4CZC A;  4CNY A;  1RTH B;  5DG8 A;  2B43 A;  1P8G A;  1A0O B;  3ITH A;  2X7I A;  3IBC B;  1SH2 A;  2IYG A;  4U95 A;  2F4V J;  3QGH A;  1QY7 A;  5DM6 Q;  3BO3 A;  3IS9 B;  4TQR A;  2H5J B;  5KFC A;  3R1H A;  3W62 A;  3HSG A;  4RNH A;  5HL7 Q;  4DS5 A;  1E3C P;  3MXH P;  2VG7 A;  2UU9 J;  1LK5 A;  3N01 A;  1ZBT A;  1RSC A;  4CO4 A;  4DDF A;  2ZH2 A;  3LXQ A;  3NP5 A;  3EGZ A;  2DNY A;  2GSO A;  2QG9 B;  3SCJ E;  2VQF F;  1CSJ A;  4ZVQ B;  3LQV A;  1C1C A;  2VBW A;  3W61 A;  2HBY B;  4WP9 A;  4YR0 A;  3AH6 A;  2GIR A;  1HWK A;  3VQS A;  3FNN A;  4ZJL A;  3MR6 A;  2PA3 A;  3MEC A;  3CC4 S;  2LEB A;  1TL5 A;  5GMK a;  2XGP A;  3C6U B;  4WXO A;  1T7P A;  1NKC A;  3E01 B;  3B82 A;  3EUN A;  4HAC A;  2ASL A;  2MST A;  1SV5 A;  2DHS A;  4DCO B;  3GLJ A;  2W24 A;  1M0S A;  1SUQ A;  3RB6 A;  4F4Y A;  2DIS A;  5CYJ A;  1EET B;  1FD2 A;  2WB4 A;  1HNI A;  3WC2 A;  1RAB B;  1N5Y A;  3ONQ A;  4YR1 A;  4OYI A;  3TX0 A;  2W4D A;  2DJW A;  4DG1 B;  5GAH I;  1HWI A;  2HHS A;  1KC8 T;  2BE2 B;  1IBC B;  2Z0G A;  2UUW A;  1D9A A;  1S76 D;  2CPD A;  2V67 A;  4LSN A;  2IMW P;  2XM3 A;  4ED2 A;  1F6T A;  1UMJ A;  1HKA A;  2KVI A;  4JOU A;  2C22 A;  3B8H A;  3DHW C;  2AWZ A;  2RIL A;  3A13 A;  1R0B G;  2BRK A;  1JJ2 R;  2OSR A;  2PA8 D;  4RNM A;  3T00 A;  5LRN A;  5CCL A;  5KG6 A;  1U0H B;  2KI2 A;  3PR5 B;  3HKW A;  4W90 B;  1C0T B;  1RT7 A;  4C9D A;  4ZN1 A;  4EO6 A;  4CYS A;  3IDD A;  1W2B R;  3IWN C;  1PCA A;  3MD1 A;  4JI4 F;  3UVJ A;  1LWE A;  1YLX A;  1K44 A;  1KLM A;  5E0O A;  2OEL A;  2M4M A;  2QMX A;  3OR2 A;  1R8B A;  1Y5I B;  4RNF A;  4O4G B;  1F2H A;  2N4D A;  2LQB A;  3OTE A;  2CQH A;  3JSM A;  1UA0 A;  4WWS A;  3JS9 A;  4ZVU B;  2ASY A;  2CWK A;  4Q45 A;  3L7U A;  2ATL A;  2UVV A;  2I8E A;  1VQ5 S;  1Q1K A;  4XK8 C;  1I51 B;  2AZ1 A;  3ZZP A;  3MUM P;  3FSX A;  1KOH A;  2CPX A;  2CYY A;  3NS7 B;  3M9O B;  1U2R A;  3IR6 B;  1ZEF A;  5D15 A;  3K5N A;  4DR2 J;  4DR7 F;  3FZ2 A;  4OHV A;  4QR1 A;  3RBD A;  2BJ1 A;  1JLB B;  2Y0B B;  3OR1 B;  3BDH A;  3K2Y A;  3OVA A;  5HBM A;  4Q8E A;  1Q78 A;  1SC6 A;  3NWG A;  4Y34 A;  1S0M A;  4LJM A;  1T05 B;  3CUN A;  1T9V A;  3W1Y C;  4BWM A;  1SC1 B;  4BC7 A;  2QMW A;  3BGL A;  2NSB A;  4U7C A;  2HPU A;  2VC0 A;  3K89 A;  3NOC A;  2VHG A;  4IH7 A;  5I4M A;  3EZO A;  2A18 A;  2YNH B;  4ZA1 A;  2BR0 A;  1HWL A;  4FNH A;  3PRD A;  4OLP A;  4IDK A;  1D8Z A;  3DMJ B;  4KAV A;  1RAC B;  1BLU A;  2LXU A;  2X1B A;  2HQG A;  2JLG A;  1RAG B;  3C15 A;  1JLG A;  3OXF A;  1VLO A;  3T1H F;  4ZPA A;  4R8U A;  1RWU A;  2K7J A;  5LXR A;  2UUA J;  3P49 B;  4K0K J;  2M2B A;  3GP9 A;  1WDD A;  2XMV A;  2QIF A;  4ZPD A;  1G4C A;  3W3S A;  4YEA A;  4OZ5 A;  2UXB J;  5E33 A;  4O0I A;  2OPP A;  2V68 A;  2R42 A;  5L39 A;  2Z2M A;  1S99 A;  2EFV A;  4ZS6 A;  1OY6 A;  3J81 Y;  4LMZ A;  1KVI A;  1RCO B;  3BQ2 A;  2AYG A;  5A6W A;  3UO0 A;  1NPP A;  4Z37 A;  2AYM A;  4V19 X;  2FLN A;  3PJW A;  3FFI A;  3AOB A;  3JSY A;  2LXF A;  4C8Z A;  1Q95 G;  2W5W A;  2YKN B;  3OQ2 A;  3Q8P B;  4WBF A;  1RT2 B;  3LWL A;  2VJV A;  4EWT A;  4UPL A;  3M8Q B;  4F0K A;  5L9X A;  3R7S B;  2JRS A;  3L7O A;  1QD1 A;  5CHC B;  2RQM A;  3P8B B;  4YS2 A;  4CO1 A;  5C24 A;  1HNZ J;  3AD8 C;  3A8I A;  2JSX A;  1IUJ A;  2CJY B;  4ELU A;  1ZTW A;  4DMZ A;  1FJ7 A;  4J9S A;  4CWB A;  4DV7 F;  2XCA A;  5B0F A;  4LR8 A;  2KKH A;  1UVN A;  2BJE A;  2E7V A;  1Z4U A;  2VB6 A;  2DIU A;  2QA4 G;  4KGX B;  1ZM3 A;  5J2P A;  3HSZ A;  2GO9 A;  3K5O A;  4CH7 A;  5AJ9 A;  4FF2 A;  1TUW A;  5K9F A;  4X4R A;  3HVW A;  3ELH A;  3I5A A;  1QUP A;  4C6A A;  1VBY A;  2YNF A;  1Q8B A;  1N36 F;  5HVG A;  2UVR A;  3MAQ A;  4K4S A;  2RRB A;  1KH7 A;  3FMW A;  1WTB A;  2E44 A;  2CJQ A;  4HI1 A;  3QT7 A;  3K5P A;  2RHQ B;  1BHN A;  4NLX A;  1P6T A;  2BKO A;  3CDA A;  3IG1 B;  1ALJ A;  2LEP A;  1W2I A;  3G2X A;  2O1P A;  2MLX A;  2VZ9 A;  3B78 A;  3RAX A;  4YP3 A;  4KKO B;  5D0H A;  3WBZ A;  2OLW A;  4NYO A;  2BX6 A;  3M4X A;  5DGA A;  4EFA C;  3AOD A;  1E33 P;  3QBC A;  1NK4 A;  1EB0 A;  5F8H A;  3UQS A;  2V6A A;  4JV0 A;  5GVQ A;  3ZXW A;  4B02 A;  1HQU B;  4FBT A;  5KAK A;  4J9Q A;  4ZN3 A;  2NYH A;  4GO7 X;  4YOE A;  1XJW B;  2VOD A;  4FXD A;  4FF1 A;  1HNV A;  4FDF A;  6AT1 B;  3V6H A;  3MMA B;  1AJD A;  4X62 F;  4Y6I A;  2OPQ B;  1ALH A;  4DN9 A;  4QBU A;  2E29 A;  3OFG A;  4LF4 F;  4DR1 J;  3UR3 C;  4L73 A;  3QGG A;  3HXM A;  1FHT A;  3PJX A;  4X66 F;  1FES A;  1NJY A;  2DGW A;  2AJ0 A;  1U0H A;  3GCX P;  2E5L F;  1RTI B;  2MJN A;  4UOO A;  1REV B;  2OI2 A;  2D9P A;  4I0W A;  2NXN A;  1IBM F;  1S77 D;  2X3D A;  2VD3 A;  3S1T A;  1T95 A;  4AUK A;  1NH8 A;  1ZYQ A;  5I42 A;  2XWX A;  5DRK A;  1LXJ A;  4K50 A;  5HMX A;  4DV5 F;  1DTT A;  2JVO A;  4O4G A;  4PWW A;  4F02 A;  1TKZ B;  3WX4 A;  1XNQ J;  1KHJ A;  1RHJ B;  4L75 A;  2ZC3 A;  2MHN A;  4CO3 A;  1DFD A;  4J91 A;  5LJ5 Y;  5FII A;  4RR5 A;  1RQ0 A;  2IHR 1;  2V9W A;  1RAJ A;  2KYZ A;  2PD1 A;  4ZG6 A;  3RBE A;  2F4V F;  1PJ6 A;  4BWJ A;  4BBY A;  2YKM B;  2XYH B;  3AQP A;  3RW6 A;  4UY8 5;  2LEC A;  1FRM A;  2XC9 A;  3S6E A;  2UU9 F;  3KXD A;  4PCQ A;  4GKK J;  1Q5Y A;  4X64 J;  2XMM A;  4K2X A;  1SJ4 P;  3TUI C;  4HT7 A;  4FS2 A;  3I87 A;  1T9X A;  1ELX A;  1G3O A;  4DR4 J;  4C48 A;  2Q1L A;  2IA6 A;  4QCL A;  3BSN A;  3HD1 A;  2PO4 A;  2O3D A;  3GYX B;  3CD0 A;  4CQ1 A;  3NBP A;  3H40 A;  2H1Y A;  2ZH1 A;  4O23 A;  1RHR B;  4C8L A;  2RQK A;  3ED4 A;  4NA3 A;  4K5S A;  1I1G A;  3J80 U;  2R7Q A;  4KJG A;  3RAQ A;  5H9F J;  2MKC A;  3DMJ A;  3LAN A;  5A2Q U;  5JJB A;  2H9Z A;  3D1O A;  4C8M A;  5KG3 A;  2ALZ A;  4O3P A;  3MCO A;  5E7O B;  3DRP B;  2G0C A;  3TWZ A;  2DR8 A;  3MM5 A;  2WK4 A;  4UT4 A;  2HVH A;  2NXU A;  2FJB B;  5IT4 A;  2V9K A;  2V8G A;  2N3L A;  3IWX A;  5A8K A;  2B4U A;  2XEX A;  3KHG A;  1WG5 A;  2AEJ A;  5K20 B;  2P6S A;  1RT1 A;  2RML A;  1ZAX A;  2CXE A;  1BWE A;  2MEW A;  2N82 B;  2H4Y B;  4B3O B;  1LFP A;  1QTM A;  5IZH A;  3WDO A;  2JWN A;  5THW A;  3TVY A;  4H4O B;  2CDQ A;  4LFA J;  1UVK A;  4XIU A;  2XMW A;  2W1B A;  5L46 A;  2OHD A;  3HFZ B;  4NCG B;  3GG1 A;  1N5V A;  4Y3C A;  2XO6 A;  2I9S A;  3RB0 A;  3DDN A;  2VG5 A;  1H72 C;  2HVZ A;  1G1X A;  4C97 A;  3MM8 A;  5K8P A;  1Z1Z A;  1YJR A;  2YKN A;  1JLC A;  1O5J A;  1RT2 A;  1NB2 A;  1U1Q A;  4KB7 A;  1HBM A;  4QYR A;  4CCH A;  2XLK A;  3RGI A;  4IQX A;  3V81 B;  1NZ8 A;  1VQ8 S;  3OL7 A;  3NVL A;  2LA6 A;  1RBA A;  2ROP A;  3L3C A;  1VQ7 S;  2YXL A;  2F40 A;  2V94 A;  1TL7 A;  4DBQ A;  3NCQ A;  1E6Y B;  2J7K A;  3TNV A;  1WF0 A;  3D3B J;  3US5 A;  2UUC J;  2KFY A;  2HRY A;  3D6F B;  1IKV B;  3D6H B;  1Q7Y T;  5F8I A;  4F7V A;  5IQQ A;  2YX4 A;  3MM7 A;  1X4F A;  2C2R A;  5M2R A;  2H5I B;  4QJV A;  2X1A A;  4DR2 F;  1Y9O A;  2WCX A;  4HR2 A;  2HZV A;  3ETO A;  1RT6 B;  4CDI A;  4MT1 A;  2HHP A;  2IPO B;  2VFU A;  3CJK A;  4DZ6 A;  1CJT B;  1FA0 A;  3DXB A;  3CCS S;  2CVE A;  4UPI A;  5DDP C;  3H2V E;  3VV2 B;  1FO1 A;  2WVC A;  4DR5 J;  3MAA B;  1WEZ A;  2G0J A;  5GRR A;  3R5D A;  1JXL A;  2OPS B;  1R8P A;  1HBN B;  1SIW B;  2MZJ A;  3JQM A;  3KKF A;  4RUB A;  1C1B B;  2KVQ E;  1JNR B;  2CQ3 A;  2K8G A;  3J7A N;  1WNE A;  2OPR A;  3NAI A;  3OUY A;  1AUK A;  3BBC A;  3V6J A;  3I31 A;  4ZP7 A;  1UCN A;  3MUR P;  1AB8 A;  3H7H B;  3SYZ A;  3IAS 9;  3GMG A;  2RJZ A;  4DL3 A;  2MQQ A;  5LMU J;  2H5E A;  2AYB A;  1PJ7 A;  3BYR A;  3NCP A;  1LW2 A;  2GQ2 A;  2WHO A;  1DTQ B;  1HQU A;  2E9T A;  2VKR A;  4Z7C A;  3VF0 B;  2UUA F;  1TKT A;  1HHQ A;  3EWG A;  1FXD A;  5IC6 B;  3JQJ A;  1VBX A;  4K0K F;  4KR0 B;  2DNZ A;  1KRP A;  1LEO A;  4DZD A;  4KGZ B;  2MQP A;  3CE8 A;  2GS8 A;  1ANJ A;  3MMA A;  4AFF A;  5D3G B;  4DV4 J;  4GKJ J;  4ICL B;  2OPQ A;  1OQ3 A;  3I5C A;  3QZ7 A;  3GE9 A;  1ZAV A;  3FGV A;  3HD2 A;  2VC1 A;  3CCE S;  3QWP A;  2KHC A;  2A2D A;  4OZ3 A;  1WWH A;  1SBR A;  1KTQ A;  4FDI A;  1CEZ A;  3KK1 B;  3POT A;  1CC8 A;  1RTI A;  2HG4 A;  2XLJ A;  4F67 A;  1JLF B;  3VAH A;  3T5K A;  1AW0 A;  4UPH A;  2HUR A;  1NJZ A;  1BQM B;  4USW A;  1Z2L A;  1ITP A;  3T5J A;  3Q8V A;  5I3P A;  1ZM4 A;  3MCN A;  1Q82 T;  2WB1 D;  2W5T A;  2ZVI A;  4Q2M A;  4PG8 A;  5CD4 A;  4NLS A;  2Y1I A;  4OX9 J;  3TZX A;  4GTY A;  4A8X A;  4Q8F A;  4LRA A;  1HNZ F;  1MWQ A;  1HW8 A;  4M5J A;  5F8N A;  2GGP B;  1TKZ A;  1WSV A;  4NYZ A;  4PWD B;  2O67 A;  3CB4 A;  2HLU A;  4MFB B;  5C25 A;  5C5J A;  4Z7Y A;  2FJX A;  5H9F K;  2DNM A;  3TJ8 A;  5KFM A;  4ELV A;  2KXN B;  2GVZ B;  1S1T B;  5HLF A;  1CQM A;  3R5J B;  4UZB A;  1SIZ A;  4H4M B;  4RKU C;  3R2D J;  4ZG9 A;  5C66 A;  2XO7 A;  4DPU A;  1P27 B;  5L9N A;  2FC8 A;  1OPZ A;  2MKY A;  4Y2K A;  5KG0 A;  5HP1 B;  1JX4 A;  4N47 A;  5LSO A;  4DR6 J;  1PSD A;  1T0T V;  3DYA A;  1CJK A;  1R7I A;  2ABY A;  3OFH A;  2GMH A;  2B6A B;  2C2E A;  4EMD A;  4K4Y A;  2VPZ B;  2OEK A;  5FJ4 A;  2WBM A;  2KM8 B;  2GAG C;  4JP8 A;  3TUJ C;  2DCU B;  4HT5 A;  4R5P B;  3PX0 A;  2DTJ A;  4KJI A;  2BE9 B;  2C2D A;  4C0O C;  2E1A A;  2EWH A;  2ZH6 A;  4EBE A;  4PKD B;  2NZ4 A;  1QUV A;  2FZG B;  5BYQ A;  2C2K B;  4JI0 F;  1PC5 A;  4J9M A;  3OVB A;  2GLQ A;  5CD4 H;  1XMO J;  3PXG a;  2OD4 A;  1FKP A;  2G2O A;  1K8A T;  3UDC A;  1X9S A;  1FXR A;  4EYH B;  1VIO A;  3KTQ A;  3MCM A;  4JI6 J;  3M7V A;  4DL0 C;  5DDQ C;  1NHK L;  3VGU A;  3M32 A;  4YB6 A;  1FRK A;  5HMW A;  1RTZ A;  1U8W A;  5KFD A;  2GAH C;  3CDB A;  3PKM A;  1EJJ A;  3N4W A;  3DLG A;  4LF2 A;  1JQG A;  3KDO A;  2VJU A;  3O44 A;  1NH7 A;  2RSQ A;  3SCK E;  2AJQ A;  4URS A;  1NLK L;  4DR1 F;  3GYG A;  3ETM A;  1EJ7 L;  3ZZR A;  1WOR A;  4AD6 A;  3SV4 A;  4IFV A;  5J1E B;  4PWU A;  1F5C A;  4Y00 A;  2W8K A;  4NMX A;  1BQN A;  2M0G B;  2DRD A;  4NZ7 A;  2NQP A;  1RAO A;  2LQ8 A;  3BJY A;  1MU2 A;  4IG0 B;  4TU8 A;  3UD4 P;  4B3T J;  1X5O A;  2BBE A;  3L9Z A;  4MIV A;  2VOO A;  3ILL A;  3M1V B;  2OEM A;  1FRX A;  3M6U A;  1XNQ F;  4NA1 A;  4WTY A;  3OTD A;  4LF8 J;  3QAU A;  4NWB A;  2E9R X;  1OSC A;  2CQD A;  4P2M A;  1HQ2 A;  4CM2 A;  4RU9 A;  3GZ7 A;  1PAE X;  2VV5 A;  1Z2Z A;  4DN0 A;  3DRY A;  1UWA A;  3MTK A;  4ECU A;  2HMI B;  4NEZ A;  2ZZM A;  1S12 A;  3HHL B;  3GJS B;  1OJ4 A;  1S57 A;  2V5H G;  1EHW A;  3VQT A;  4GKK F;  5G0R B;  4X64 F;  5F8G A;  4RW9 B;  2LYV A;  4F50 A;  4OLO A;  1T9W A;  2RDI A;  2MLY A;  1QE1 A;  1GK8 A;  1IKW B;  2YVS A;  2F65 A;  4DR4 F;  1PIE A;  1FJG J;  1FKO B;  2DNG A;  3NGT A;  3QIP B;  2IDL A;  3Q24 A;  4RW4 A;  2GJF A;  1UAW A;  3MAA A;  4OYB A;  2Z30 B;  4OV6 A;  5KFQ A;  2OPS A;  3Q8R B;  2DIT A;  2HQD A;  4UY8 T;  1FRJ A;  4KHM A;  1N88 A;  2VQR A;  3KJV B;  2C1E B;  4GTW A;  4JI7 J;  3CCV S;  2NPI A;  5A76 A;  4FZV A;  5BYR A;  4NLV A;  3EDQ B;  2J0S D;  1V3S A;  3NKM A;  1FJC A;  5L8R C;  1U4B A;  5F3T A;  2NXC A;  3PW4 A;  2DR5 A;  2C2O B;  1KHL A;  4HL9 A;  3HHL D;  3GU0 A;  3CJR A;  2UVU A;  2IAJ B;  3M30 A;  4CH1 A;  1KQG B;  4ECX A;  1Q4R A;  3HK2 A;  4WU2 A;  3HJF A;  1RAF B;  3N0V A;  3IGN A;  4ZPV R;  1I3O B;  3KJQ B;  1RT4 A;  4GVB B;  5KT5 A;  4ZCL A;  4FS1 A;  4P6Q A;  3KLI B;  3EPI A;  1TFY A;  2V2K A;  2CVI A;  2IBK A;  4USU A;  1EW2 A;  8ATC B;  4RUH A;  4KHP F;  3TW0 A;  1A7G E;  4CP5 A;  1U1N A;  2K2P A;  3CCU S;  1RT3 A;  3LUY A;  3MED B;  3NMA A;  4ZJQ A;  3QLH A;  2DHG A;  5IFM A;  2ZDO A;  3V6D A;  1XNR J;  1P49 A;  1YRX A;  4CLT A;  1FCA A;  2VKZ G;  4OJ3 A;  2QLX A;  2RH3 A;  4UST A;  5GMD A;  4E0D A;  3EGN A;  3SIP B;  4ECZ A;  1OO0 B;  3W8G A;  3I0R A;  4Q7A A;  3MWB A;  2V8P A;  3RZA A;  4WFN Q;  1IBK J;  3MOZ A;  4DL4 A;  2KXH A;  2IVF B;  1Q8K A;  4RBV A;  1TUG B;  3GIJ A;  1ZAW A;  3BEG B;  2WTF A;  1ZPW X;  3QGI A;  4PWD A;  3PRB A;  3QT8 A;  3G8Q A;  3OT9 A;  2IY5 B;  3NL0 A;  3KMQ A;  5ETK A;  2UUC F;  4DPY A;  3CD5 A;  4WZQ A;  3GIL A;  3WQP A;  1IWA A;  4R0E A;  1NUE A;  3VAM A;  3FK4 A;  2DH9 A;  2A10 A;  3BBB A;  3IP0 A;  3R5A A;  4I68 A;  4H4M A;  1GXU A;  1R0A A;  1D0E A;  1MMN A;  3IA0 A;  4PUO B;  2FLL A;  2GML A;  3DOM A;  3SXL A;  4DF4 A;  1EAR A;  3KYL A;  3N28 A;  3TJ9 A;  2VDH A;  1FFS B;  3ZTR A;  1FWK A;  3G9C A;  2ZBC A;  2XTJ P;  2R2S A;  1TL1 B;  4DSK A;  1NPR A;  5LOQ A;  1KS2 A;  3U1L A;  5A8R A;  2DR7 A;  2EKY A;  2K3I A;  5KFO A;  2H3E B;  5DQG A;  3WAY A;  2R8G A;  3KLE B;  4IG3 A;  4R5P A;  3TEG A;  1Q8L A;  1HWJ A;  1EQM A;  1UPM B;  5E5N A;  1XMB A;  1S7H A;  1TK5 A;  4ENO A;  1N56 A;  3QT5 A;  4M5I A;  4B3M J;  4RNN A;  1SJF A;  1FEE A;  3WAX A;  3CJS A;  5LMU F;  3SZY A;  4BDP A;  2ZNZ A;  4IOC Q;  2RIJ A;  2J9D E;  1UWB A;  4NL5 A;  4I1T A;  2CQI A;  2AF6 A;  5KFI A;  1I94 J;  5H9E J;  3K8W A;  5DS7 A;  1S6U A;  4OI1 A;  3O5T B;  1WG4 A;  3H2U B;  3THT A;  1B64 A;  1FF2 A;  5KXA A;  4I6A A;  4RBT A;  1HI1 A;  4KO0 B;  4ID8 A;  4RW8 A;  3UNY A;  1RA6 A;  4DV4 F;  4GKJ F;  1WG1 A;  2EI5 A;  3EMT A;  5ETL A;  1YRU A;  1QAX A;  4RZR A;  4KFB A;  3V4I B;  2A6O A;  1VQK S;  3J81 j;  4KC5 A;  5J1E A;  4RW7 A;  1HBO A;  1ARO P;  3DM2 B;  1Q0N A;  3NGU A;  1V5V A;  2KHD A;  3BV8 A;  3LAK A;  1TAQ A;  2HQF A;  1U1L A;  2IM3 A;  2CZ4 A;  4ILR A;  2ZKT A;  1AJB A;  2D3O R;  4O4R A;  4PPZ A;  4OX9 F;  1RWK B;  3DRS A;  5DJB A;  3X3U A;  3M1V A;  1S10 A;  2IRX A;  2YX1 A;  2LMI A;  5HJX A;  3DLH A;  3AB4 B;  2OML A;  3D4J A;  3EVM A;  4NI2 A;  2XLI A;  4JV1 A;  4LRC A;  2F8E X;  1M1K T;  2MGZ A;  2ZEJ A;  3DLE A;  3IAM 9;  4BC9 A;  2B0G A;  2CQ0 A;  2RUG A;  1FDA A;  3QAT A;  1S59 A;  3QWU A;  1Y0H A;  4D3H A;  3UN5 A;  1O99 A;  2UXD J;  5SUH A;  2V4J A;  1VQ9 S;  3OJU A;  2IA0 A;  3FSY A;  2CRL A;  5IXU A;  3HSJ A;  3L7P A;  4DR6 F;  3WAW A;  4K8R A;  4GRS A;  3DLB A;  3ILJ A;  5DZ7 A;  2G2Y A;  3H5S A;  4OI4 A;  3R6L B;  4UOP A;  2VFS A;  1FD8 A;  1S1X A;  1DRZ A;  3VWS A;  2Q66 A;  1N6Q A;  3QJJ A;  2RRN A;  2OH2 A;  4DLG A;  4USM A;  1MLA A;  3AD9 C;  1TKX A;  3LAL A;  3DXS X;  1ALK A;  3KG4 A;  1OIA A;  4X4N A;  2BJ8 A;  4XO0 A;  3NKN A;  2COL A;  3H4B A;  1MRO B;  3CXC R;  2LVW A;  1XMO F;  4QWC A;  3GII A;  4LQ9 A;  2V8D A;  1CJU B;  2QN6 B;  1PG5 B;  4M5L A;  4LRE A;  3FCH A;  3PM9 A;  1CQN A;  2D69 A;  5T14 A;  4O3S A;  4H54 A;  1AYE A;  3AAW B;  2NZC A;  3C19 A;  2OGU A;  2WSC C;  3PTW A;  3IM9 A;  4PQU A;  1IXK A;  1RKJ A;  5GME A;  3LP2 B;  1RAD B;  3FEY B;  2XY6 A;  4EGL A;  3W2W A;  3BM7 A;  2MJU A;  4U8Y A;  1M5V C;  3TAQ A;  3EJM A;  1VQM S;  3JQK A;  4QPX A;  1RBO B;  2C3M A;  3FBE A;  3P4U B;  5KFZ A;  1NHV A;  1QSL A;  2QZU A;  3LF0 A;  4S0M A;  3BO2 A;  3BPS P;  2CJK A;  2WAQ D;  3BS9 A;  3V2U C;  2W2N P;  2UUT A;  1ZTT A;  2GA7 A;  2Q3P A;  1X9W A;  2UP1 A;  4UPK A;  2KDO A;  1WF2 A;  4CLK A;  1X0P A;  2M8H A;  2OSQ A;  4Y65 A;  2ZE2 A;  1UFW A;  3TAM B;  3PFE A;  2DPI A;  3TAP A;  2W5R A;  4J9U E;  4LF8 F;  4RBU A;  1X4D A;  3P5B P;  5ETS A;  4ED3 A;  5F9L A;  1U24 A;  2R7V A;  2XMU A;  4WZM A;  2HAF A;  4DPT A;  1HIY A;  4TQS A;  1YQH A;  2VPX B;  1D8Y A;  1H2U X;  2KT2 A;  3O6Q A;  1VBK A;  1SL0 A;  3H5U A;  3HFK A;  4I2Q B;  4E8U A;  5IM0 A;  4P10 A;  1X4H A;  1SKS A;  1PAU B;  3LA0 A;  2FVR A;  5H9E K;  1UL3 A;  2BYC A;  1P9Q C;  3BR9 A;  3PV8 A;  2W7P A;  1H6K X;  3CJ5 A;  4USJ C;  4DUY J;  3C14 B;  1UVI A;  5JUM A;  5IT9 U;  2G9O A;  3CJT A;  5E3Q A;  2W9C A;  3BPD A;  1B0P A;  5KFJ A;  3OL6 A;  1F1B B;  3PX6 A;  2FVP A;  2HWH A;  3GON A;  2XNR A;  1FJG F;  1E6V A;  5CXT A;  3ULH A;  3M2V B;  1Q86 T;  4WE1 A;  4M94 A;  4FKY A;  2D9O A;  4C3M A;  3ZNU A;  4DWI A;  3PYF A;  4G1I A;  3PNI A;  4QOT A;  2J8S A;  2BM0 A;  4DI6 A;  3A8K A;  4L72 B;  3KLE A;  3JTP A;  2Q79 A;  3OD2 A;  4HH0 A;  4WFX A;  5ETN A;  5F9N A;  4JI7 F;  3F0N A;  3OXL A;  4MKY A;  4DFM A;  3C16 B;  1AA1 B;  3FC9 A;  1F2G A;  4NML A;  2K1R B;  4DPO A;  5K14 A;  3HLU A;  4CLP A;  3MEK A;  4PXC A;  4NXM J;  4JI8 J;  5U47 A;  2MQM A;  2W8S A;  1YZ7 A;  2ASJ A;  2C2N A;  2VFT A;  2OFG X;  4TLQ A;  5T7L A;  2XS2 A;  5MAO A;  3NGS A;  2HFU A;  4LF7 J;  2HGM A;  3GCW P;  4QQB A;  2MQ8 A;  2HEK A;  3JYT A;  1NSA A;  3Q83 A;  1RT5 A;  5F0U A;  2WOM A;  3W64 A;  1C0U A;  4W4M A;  2W7A A;  2JEI A;  3SQG B;  4K4T A;  3KK3 B;  2MSS A;  2XZW A;  4OZ1 A;  3RB3 A;  4LIW A;  3N9U C;  3RB4 A;  3CMQ A;  2WVE A;  4MMO A;  1S49 A;  4OHW A;  1XNR F;  2YQ3 A;  1FRH A;  3ITH B;  2HHV A;  3ET6 A;  2CIM A;  2WBR A;  3LP1 A;  1Q7L B;  3DM2 A;  1SL2 A;  3UN2 A;  1LNQ A;  2XRG A;  2Y3Y A;  2HZA A;  1LWF A;  1NAQ A;  1DAR A;  1DJ0 A;  2M3D A;  1IBK F;  1R43 A;  4ECV A;  3VGS A;  3PX4 A;  3ISN C;  3D67 A;  5J1N A;  4RW6 B;  2BXJ A;  2VG7 B;  1RA7 A;  2BRL A;  2L9W A;  1H7X A;  4K5R A;  4QIF A;  4J9R A;  3GV7 B;  4WII A;  4NWJ A;  2VPW B;  4DQQ A;  4TU9 A;  5K8O A;  3QRP A;  2EFP A;  4HDH A;  1Y3K A;  2ZH8 A;  5DG7 A;  2NUU G;  1JKH A;  4CXK A;  3T6J A;  4DFJ A;  3N6L A;  1NKE A;  4GVL A;  2KZZ A;  4ELT A;  2ZM6 F;  2V34 A;  3BB5 A;  5J2Q B;  1C1C B;  5IOL A;  4CYU A;  3OV7 A;  4FYY B;  2E7X A;  5LRM A;  5D78 A;  1FDN A;  5JXS A;  2M52 A;  3MEC B;  3RBX A;  1KLN A;  2R7X A;  4ATN A;  3TVZ A;  4ZLJ A;  3MOJ B;  2Y1L B;  5J2N A;  3HHD A;  2KO1 A;  2MYF A;  3SBM A;  1SV5 B;  1D3W A;  2AMC B;  2NPF A;  4IR9 A;  1RAA B;  3KFW X;  5KT3 A;  1SUQ B;  2YWK A;  1WKL A;  1IKY A;  3RW7 A;  1UZD A;  2DPJ A;  3M8W A;  1WOO A;  2KFN A;  2HNY B;  3I55 S;  2ZWP A;  1HW9 A;  4MJK A;  2MTL A;  1DY3 A;  3QAE A;  3O2I A;  1R8H A;  1Y5N B;  3QFW A;  2P2C B;  5L38 A;  1RYS A;  5F8J A;  3HUL A;  3I9V 9;  5EX3 A;  3W2V A;  2KT5 A;  2UVW A;  1NM2 A;  3ZNJ 1;  1S6Q A;  2XQC A;  2BKP A;  2RQC A;  3J7Y I;  4B3M F;  5DLT A;  5C42 B;  4LF1 A;  5HAN A;  3LPE A;  1RWN B;  1T8E A;  3KUH A;  4NLR A;  3SZ2 A;  4MK9 A;  2P8I A;  3H90 A;  1RT7 B;  1I94 F;  2HND A;  4ED1 A;  1FXL A;  1WOP A;  2GQC A;  4I69 A;  4B9S A;  4ID5 A;  3HVA A;  1KLM B;  2MZR A;  4DSI A;  4ZVR B;  3FBB A;  1N0U A;  1X7V A;  4NLY A;  1I5O B;  4O3O A;  3TR5 A;  1HA1 A;  3OR2 B;  4X65 J;  3UDL A;  3FBC A;  4LVN P;  3FUY A;  2ZOM A;  4C0B A;  1S9G A;  4ZDN A;  3JSM B;  4M1K A;  2E1P A;  2X98 A;  2IIH A;  4MTP A;  3OTO J;  2VIC A;  4I7F A;  1CLF A;  2KJV A;  3T9N A;  1B70 B;  2JFK A;  1FJE B;  5DLG A;  1IN0 A;  4CLL A;  4A8K A;  5L0K A;  4NLD A;  5AXN A;  5GAE I;  1A9N B;  3EM1 A;  1X9M A;  2CJA A;  3LTO A;  2L9N A;  1U45 A;  2W8D A;  1UP1 A;  1RGV A;  4J9P A;  1BD6 A;  4JI1 J;  2XWY A;  4ZHR B;  4B3S J;  1NEE A;  2DXE A;  2HIY A;  3DGV A;  1T03 A;  3HZE A;  2BAN A;  3VCD A;  2IFY A;  5HBM B;  3RR7 A;  3EVO A;  1N5S A;  4DLE A;  1VQY A;  4N8N A;  4O3N A;  3OFF A;  5KG2 A;  3NGR A;  2BOA A;  5KOW A;  3MCS A;  2HNZ A;  4YQW A;  3G96 A;  2BJD A;  4L3N A;  4WPA A;  2BW2 A;  5EWF A;  3TP2 A;  1SJQ A;  1BC6 A;  1R0C B;  2ZDP A;  3FBF A;  3H42 A;  1EAY C;  2AEF A;  1T9U A;  1EW9 A;  3AQO A;  3G86 A;  1X4G A;  2D74 B;  2CPZ A;  1TZ0 A;  3MK2 A;  4I56 A;  1WDT A;  1P1T A;  1QM9 A;  4DX6 A;  5D4P A;  2DEI A;  4GO5 X;  2V69 A;  3GFX A;  3I32 A;  4UTG A;  4IDK B;  4MIB A;  1M5O C;  2EEY A;  1RI7 A;  3KHL A;  3SZZ A;  4QU7 A;  3CNQ P;  2U2F A;  3P6Y C;  2RNE A;  3C15 B;  3CWJ A;  5AE1 A;  1B99 A;  1JLG B;  4PRF A;  2GCF A;  1JWW A;  3M2V A;  1NK9 A;  4EZ9 A;  4R8U B;  4KPY A;  1AZS A;  3K5L A;  2AU0 A;  5D6G A;  3ENQ A;  4CLZ A;  3PO4 A;  4PPD A;  3VGV A;  3QSI A;  2DGU A;  4AL6 A;  3ZTO A;  2V50 A;  2OPP B;  3C16 A;  2X1G A;  2DR9 A;  4OHZ A;  1VQP S;  1H98 A;  4HHU A;  4PG4 A;  5K8M A;  2CUY A;  1NME B;  3R7N B;  2FQQ B;  2HWI A;  5FDL A;  2QFJ A;  5E3R A;  2LXI A;  2V2V A;  2DVI A;  1GFW B;  2XGQ A;  3FFI B;  2PEB A;  2X1F A;  3OVS A;  3DPC A;  4AQY J;  5L0B A;  3KNG A;  1PBU A;  3MR5 A;  3TAN A;  1MG7 A;  4KV8 A;  4OYA A;  1S9E A;  2RDD A;  2D3Z A;  3NG8 A;  1SB6 A;  1NJX A;  2JL9 A;  3J7Z 5;  4EEY A;  1ZM2 A;  3HMJ G;  2J6T A;  2P9G A;  4DUZ J;  5JVH Q;  3PHE A;  3SMZ A;  2J5A A;  1VGY A;  1OMS A;  4HEA 9;  3OHA A;  4PG6 A;  3J80 Y;  2BKN A;  4M95 A;  1T02 A;  5B7W A;  4C8N A;  2HS0 A;  1YJ9 S;  1S9F A;  2PC6 A;  3HF5 A;  3LGM A;  3M6X A;  2CQ4 A;  1G2E A;  1JXV A;  5A2Q Y;  4TYB A;  4PXB A;  1BXN A;  3HKZ D;  3A3N B;  2HHH J;  5AXK A;  2HVI A;  4M5D A;  5J2P B;  2B3T B;  4ECR A;  4RW6 A;  2DB1 A;  2DEJ A;  2ZJR Q;  3D0G E;  5DDO C;  1EQJ A;  1X4E A;  3HPO A;  2LU1 A;  1FDB A;  2ANH A;  5L1K A;  2YWH A;  2WZ1 A;  2YNF B;  3BGF A;  5AT1 B;  1EP4 B;  5B0G A;  3CCW A;  4YUD A;  3JB9 k;  1NDC A;  8AT1 B;  1AUD A;  3R5C A;  2FJA B;  1TFW A;  3CJ8 A;  4WF9 Q;  2B4O A;  4TY8 A;  2I2Y A;  2RHS B;  3IBF B;  2XS5 A;  5TJ3 A;  1DLO A;  5J2Q A;  3CME S;  3TX8 A;  2PFD A;  2E5G A;  4H4K C;  4IH5 A;  4Y2M A;  1QTN B;  3NEK A;  2R7S A;  4N56 A;  1NK7 A;  1Y5L B;  4WYL A;  3R8Y A;  1LOU A;  4OI3 A;  4ZVE A;  1NND A;  4DUY F;  5HAT A;  2LCW A;  4HKQ A;  4U7U K;  2W5S A;  3NKQ A;  3ZFV A;  1EI6 A;  4ZPC A;  2BVZ A;  2J76 E;  6FD1 A;  3K7R A;  2EBG A;  4RJV A;  3IN5 A;  4LFC J;  1GMW D;  1NDP A;  3OTB A;  4CO2 A;  4P73 A;  2MLZ A;  4ZMM A;  5DLV A;  4RO0 A;  4ECY A;  1JJC B;  5KG5 A;  3LGH A;  1PYO B;  2E5H A;  3I5B A;  2HNY A;  3GG0 A;  4B17 A;  2JLE A;  1ZEB A;  3BGU A;  3DNC A;  2D1G A;  5KFH A;  1RIS A;  3M8Z A;  1KON A;  2ZD1 A;  3TUZ C;  2RKI A;  4EK2 A;  1SQF A;  1HNV B;  1H2V Z;  1HD1 A;  5K4P A;  2BQU A;  2J0X A;  2YPY A;  1MML A;  4DOZ A;  2WON A;  2D7S A;  1P9Y A;  4A8Y A;  1WHY A;  3F56 A;  1S5Z A;  1VR6 A;  1WHW A;  3HP6 A;  2RB7 A;  4K4U A;  1IKX A;  4RNO A;  2ZZN A;  2IRU A;  4NXM F;  4JI8 F;  5C42 A;  3EE3 A;  4CH0 S;  4CTA A;  1VRT A;  5D0G A;  2HS3 A; 
#chains in the Genus database with same CATH homology
 3IGY B;  3UNY A;  3MK2 A;  5EGE A;  1K7H A;  3IGZ B;  4LR9 A;  5LIA A;  5GOV A;  3UN5 A;  1O99 A;  2VQR A;  3LXQ A;  3MK0 A;  1KH4 A;  2G9Y A;  4GTW A;  3KD8 A;  2GSO A;  3SZZ A;  2XR9 A;  1AJC A;  3Q3Q A;  1ED8 A;  1ANJ A;  1E33 P;  1SHQ A;  4NWJ A;  2W8S A;  1ALI A;  5L0K A;  3M7V A;  5EGH A;  4LR8 A;  1HDH A;  1ZEF A;  3A52 A;  1O98 A;  3E2D A;  4ZG9 A;  4KJD A;  5C66 A;  4LRD A;  4LRF A;  3NKO A;  1ELZ A;  3ED4 A;  3WAY A;  3T00 A;  4KM4 A;  5LRN A;  1EW8 A;  3WAW A;  2W5S A;  3NKM A;  4LR2 A;  2W5V A;  2W8D A;  1KHJ A;  3NKQ A;  3NKP A;  4MY4 A;  3CMR A;  1B8J A;  4UPI A;  4QAX A;  1ED9 A;  1EI6 A;  1N2L A;  4CXK A;  4MHX A;  2IUC A;  1SHN A;  3BDH A;  2GA3 A;  5DLT A;  1KHK A;  4FDI A;  5GRR A;  1EJJ A;  3B5Q A;  4KJG A;  2QZU A;  4LQY A;  4CYS A;  1KHL A;  3T02 A;  4ZGA A;  3IDD A;  5DLV A;  2GSN A;  4UOP A;  5L0E A;  3NKR A;  4ZG6 A;  1Y7A A;  2GLQ A;  5AJ9 A;  3OT9 A;  2ZKT A;  1AJB A;  4ZG7 A;  3TG0 A;  5LRM A;  4UPH A;  5LQQ A;  3BDG A;  2IUC B;  1AJA A;  3NVL A;  4CXS A;  2IFY A;  3M8Y A;  1ZEB A;  3BDF A;  2W5X A;  2D1G A;  4GTZ A;  5IJQ A;  3TWZ A;  3M8Z A;  1AUK A;  3WAX A;  3UO0 A;  1AJD A;  3SZY A;  2W5T A;  1KH7 A;  4TN0 A;  5IJS A;  5HRT A;  4FDJ A;  1EQJ A;  1HQA A;  4KAY A;  1KHN A;  1URB A;  4UPK A;  4LRB A;  2RH6 A;  4GTX A;  3T01 A;  1ELY A;  1ALH A;  4CXU A;  1ALK A;  1FSU A;  5DLW A;  4YR1 A;  2W5W A;  5K4P A;  1Y6V A;  2ANH A;  2W5Q A;  4GTY A;  3WAV A;  1EW2 A;  3TX0 A;  3NKN A;  4LRA A;  1ZED A;  4LRC A;  1KH9 A;  4CYR A;  2GSU A;  4NWX A;  1ANI A;  1URA A;  4UPL A;  1E3C P;  1HJK A;  4UOR A;  5INH A;  1E1Z P;  4B56 A;  3M8W A;  3UN2 A;  4LRE A;  1ALJ A;  3DPC A;  4LR7 A;  1N2K A;  1EW9 A;  4N7T A;  5L0B A;  4KAV A;  2XRG A;  5KXA A;  3UN3 A;  3MK1 A;  3WBH A;  1KH5 A;  1P49 A;  2X98 A;  3BDG B;  2W5R A;  1ELX A;  5TJ3 A;  3DYC A;  4UOO A;  4MIV A;  1E2S P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...