4LREA

Phosphopentomutase soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lreA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lreA01
4MIVA 5L0BA 5EGHA 3MK0A 3A52A 3BDGA 3B5QA 4LREA 2QZUA 3WAVA 1E3CP 5L0KA 1ELYA 4YR1A 1ZEFA 1N2LA 4UORA 1EQJA 3UO0A 1EW8A 1URAA 3DPCA 1KH4A 4LRDA 4CXKA 4ZGAA 1N2KA 1URBA 3SZYA 3TWZA 5DLTA 2X98A 1ALJA 5GRRA 4MHXA 5K4PA 3NKPA 5LQQA 1KHJA 1SHQA 4UOOA 3OT9A 1ALIA 3BDFA 1KHKA 5GOVA 1ALKA 1HJKA 4GTZA 2ZKTA 5DLWA 4LRCA 1KHNA 4UOPA 5LRMA 1AJBA 2IUCB 1Y7AA 5LIAA 3LXQA 3UN2A 1AUKA 2VQRA 1EW9A 3WAXA 4KJDA 3MK2A 3M8WA 2W5SA 5DLVA 4LRAA 1SHNA 2W5VA 4KAVA 2GLQA 1FSUA 4ZG7A 4CXUA 1ED8A 3WAWA 3NVLA 3Q3QA 1Y6VA 5KXAA 2XR9A 1ZEBA 5C66A 4GTXA 1O99A 4UPHA 1E2SP 2IUCA 3M7VA 3T00A 4MY4A 3ED4A 1ALHA 1KH9A 1EJJA 2GSOA 3KD8A 3MK1A 1E1ZP 4NWXA 1KH7A 2W8SA 4CYRA 3UNYA 2IFYA 4ZG6A 3IDDA 4GTYA 3T01A 3WAYA 1EI6A 5LRNA 1ANIA 5AJ9A 2W5TA 3CMRA 2D1GA 1KH5A 3NKQA 4LR8A 1B8JA 4KAYA 4LR2A 1ELXA 1ANJA 5EGEA 3TX0A 4LRBA 1AJAA 1O98A 2W5QA 2W5WA 4UPIA 4N7TA 1KHLA 3IGZB 2ANHA 4FDJA 2W5RA 3SZZA 4FDIA 3IGYB 4B56A 4GTWA 5HRTA 5TJ3A 1ED9A 4UPKA 3WBHA 3NKOA 4CXSA 4UPLA 1K7HA 4KM4A 4LRFA 3NKMA 3E2DA 1P49A 4ZG9A 1AJDA 2XRGA 3NKNA 5L0EA 3UN5A 3T02A 2GSUA 3DYCA 4NWJA 1AJCA 3M8YA 4LR9A 5IJSA 4CYSA 1HDHA 3M8ZA 3BDGB 3UN3A 3NKRA 1E33P 1ZEDA 2G9YA 1ELZA 2GSNA 4QAXA 5INHA 1HQAA 2GA3A 2RH6A 4TN0A 4LQYA 4KJGA 3TG0A 3BDHA 4LR7A 5IJQA 1EW2A 2W5XA 2W8DA
chains in the Genus database with same CATH superfamily
3SI8A 6FDRA 1E3CP 2GHPA 1C1CA 1YZ6A 3BKFA 2CVIA 4U67Q 2ZJQQ 1IVZA 1U24A 2ZBCA 4YY3F 2BVZA 4UZBA 4R8UB 2FD2A 1NSAA 1R7IA 2OFHX 3I0RB 4EK2A 1CULA 3SQGB 1HNWJ 2YNHB 2EFQA 2F1FA 5EUHA 5LL6d 3FMBA 3HSGA 2JLFA 3TJ8A 1T9TA 2V34A 4HDGA 4O3RA 5JMNA 5DDRC 4DR3J 2MB0B 1NBEB 4LSLB 1XR6A 3NGRA 2H54B 2OD6A 1JKHB 2DHAA 4EZ9A 1RT1A 1XBWA 3O5TB 2RF2B 5HMXA 3D6FB 2FDNA 2FGOA 1U47A 4DFJA 5A8WB 1ZETA 3B6BA 3X3UA 3KLGB 4KC5A 2OO4A 4ZCKA 1QTNB 2GVDB 2B0GA 4WFNQ 1DAXA 4NLPA 2YNIB 3VCDA 4RUBA 4I4BA 4TN0A 4F0KA 4BCAA 1HA1A 3PX4A 2XZTB 2QLWA 2YKNB 4F4ZA 3QATA 1WKKA 3DKDA 1U1LA 2DBBA 2C3OA 4R25A 4F36A 1R8PA 3FBFA 4A8OA 3H0PA 2ZVSA 3ITHA 1RTDA 4LT6A 3R1HA 1REVA 4M95A 1LWFB 4X65J 4ZMMA 3VAFA 3Q24A 4KO0B 5L9NA 2DNLA 5KFVA 1R89A 3MM5A 3OL6A 4IH7A 2LEBA 4GKKJ 5ETRA 4DSIA 3M9MB 2HVDA 3IXQA 2M5YA 2GS8A 2D9PA 2IM2A 5GVQA 1V9OA 3CCJS 2MQPA 3TZXA 4B3MJ 3V4IB 1AFIA 2XS7A 2CJAA 3MOJB 4C98A 4YB6A 5JXSA 3ENAA 5F8GA 2K06A 2OTLS 3M6WA 1TK5A 1Q53A 4QAXA 2WBRA 3T1HJ 2OPQA 4I2PB 4F2SA 1Y3JA 2B4PA 4ZVRB 1FRMA 1S6OA 1WHVA 1FDAA 2AEJA 3ENVA 4NEZA 4DR6J 3VF0B 1FEEA 4OZLA 4IOAQ 1S77D 1S1WB 3KLFA 1O0PA 3GPAA 4X4NA 1NAQA 2VPWB 2AW0A 4Y00A 3PR4A 1K9MT 4USJC 2XLJA 3BM7A 3S8SA 4FXVA 2Z58B 3HVTB 2JEGA 4TYAA 4XAKA 5D4LA 1B7YB 4PWDA 3QFWA 2HFZA 4BWMA 1RT7B 1SJRA 3NNAA 4OI1A 2BRLA 2GMJA 3HHKA 2IM3A 1DLOA 2WW4A 2HWTA 4R0EA 2KJWA 1TAQA 2HVIA 1C4CA 1IQTA 2XO7A 5HRTA 1LW0A 1TL3A 2GMHA 4NCGB 3W2VA 1NNDA 2ZC4A 3IWNC 3QAUA 1RAFB 4NEYA 4U8YA 2ZH4A 4MTPA 3FEYB 2EPIA 1JLQA 2L3MA 3HJFA 3RB0A 3R8YA 1KVKA 3NWRA 2M52A 5LMNJ 3AFGA 5L39A 1WEXA 1S12A 3C15A 1LOUA 1IBLF 1SBRA 1ZA1B 2B9WA 4Q0BA 4WIIA 3EX7B 2XZWA 3SZYA 1U4BA 2OFGX 2YNGA 4KH0B 4USUA 1KTVA 5ETOA 2AEMA 2W7PA 3UVJA 3PO5A 1MMNA 3JB9k 2YWWA 3V4MA 3OFEA 1CJUB 4BBYA 4DQQA 1D09B 3P45B 2DO4A 4YR0A 1X4CA 2QA4G 1A6LA 4FP9A 5KOXA 3GFZA 2DNZA 3HKZD 4F02A 3C2PA 3CD0A 1ZZFA 2PDAA 2ZD1B 4RBVA 3NKNA 4WYLA 3QGIA 5G4DA 1KTQA 2B7CB 2QA2A 2VFVA 2K7KA 3G71S 1SC3B 1MROB 1CPZA 2WK4A 2GHWA 3NMRA 1T9YA 4DV3J 1GMWD 2QZUA 3QZ8A 4OJGA 2AF6A 4ZOSA 3WZ0A 1KS2A 4J9SA 1URBA 4F4AA 2HNZB 3JTOA 4QPXA 5HMZA 2ALYB 1KKHA 2DRBA 2YNFA 2OKQA 4O44A 5D3GA 1Q79A 5DLVA 1APSA 1TL7B 2CPXA 3I9V9 2ZZTA 4DV4F 2R7QA 4Y0FA 2FZKB 3MCOA 3G82B 2RB7A 1P9YA 2P9CA 4LRBA 3SYZA 5J1EA 5A2QU 4K4YA 1U45A 4AFFA 2UP1A 4LQ3A 3HFZB 2A1BA 3NKOA 4KM4A 2OHDA 4TLQA 3IGVA 2GQCA 1Q8LA 2BACA 1LQ9A 4PXDA 2HZVA 3EJMA 1RP5A 3GP9A 2YQ3A 5J2PB 3DHXA 1VQMS 2AJFE 3BPSP 5IJQA 2L9DA 5ETPA 2ZUGA 4PR6A 3RW6A 1JQGA 2D74B 3I32A 5GAGU 4OYOA 4CO1A 1BD6A 1URAA 1RK8A 1M5HA 1TZ0A 2XWXA 1FKOA 2XM3A 4JYAJ 4AYBD 2MTLA 1V3SA 5K20B 1HW9A 4NLXA 3WHIA 1ALKA 3UDEA 2LQ8A 4PAAA 4C8OA 3BSAA 4CO5A 4ED7A 2ZH6A 2GLQA 3OBIA 4USTA 3HSJA 4ZCMA 4QIFA 1VQYA 4GTYA 3T5KA 4YR3A 4DL4A 1X4AA 2CJ9A 2CNLB 4H4KC 2ZH1A 5T41A 5HLFA 4BC9A 3PX0A 3ILIA 1V5IB 1NHKL 2MGZB 3EZUA 1LWCA 4AQYF 1DTTB 2EBEA 3KTQA 2GSUA 2VG7A 1IKXB 2RUGA 2BABA 4DX8H 2BJ7A 1G4CA 1IJFB 3KUGA 5ETNA 3GSDA 3IRXA 3KK1B 2GQQA 1X4FA 3RG6A 4N76A 4RUAA 1R0AB 2BOPA 1N6QB 1ELYA 5I3UA 3BB5A 3G86A 4DU8A 2AJ0A 2E44A 3U02A 4QU6A 1VGYA 3CT9A 1UW9A 2ADCA 3L9ZA 1ZYQA 4N47A 4B9UA 2LYVA 2W5VA 4RW9B 3ICLA 1AYEA 1S9EA 1VK8A 4K4SA 2J76E 2HFOA 2B9EA 4ECXA 5K9FA 2GJFA 2R8GA 1O51A 2HK2A 1IBKF 3IR7B 2FLOA 4JI7J 1IBMJ 1U0HB 2DNGA 5L1IA 4N7TA 2ZDOA 3EPGA 4URGA 4A47A 4ZPVR 1N32F 4B3OB 1TKTA 2M70A 2UU9F 3N4WA 1KHWA 3PHTA 4DUZF 1K73T 1HDHA 2D3ZA 2FUG9 1KWMA 2KFZA 1SCJB 1C1CB 3NLCA 8RUCA 4IYQA 2HK3A 3E3XA 1UWAA 3GWCA 1CULB 1XMOJ 2WBMA 4HEA9 1F9HA 1FNXH 3MEEA 2BRKA 3ZZOA 1RHRB 2YWHA 1ALJA 2Q6CA 3DLEA 4UOOA 4L3KA 2DR8A 2DISA 5D6GA 3HHDA 3MOZA 1RT1B 3DXSX 4LF5F 4DV6F 2IAJA 4YHHJ 3PJWA 2VODA 5LT5A 1UW4A 3PYEA 1CS4A 2K3KA 3RR7A 3VGVA 4JI5J 4JUZA 2W2OP 3R7SB 3ZZTA 2WSCC 3MR5A 1QLNA 2LP4A 4WK1A 3PDNA 2D1GA 2SXLA 4KAYA 1GAOA 3GV8B 3B8HA 3HJVA 1RTJA 4ZPTR 5H9FJ 4ECQA 4WU3A 3H5SA 2BX6A 4ZJLA 1RWXB 3Q8UA 3K0JA 1H2VZ 3W9IA 2VQFJ 3T6BA 3QIPA 4DOZA 4LF1A 5GMEA 3CC2S 4DLEA 3W8GA 3CIMA 5E3PA 4PWWA 4IFYA 3GYXB 1HQUA 2W8DA 4RKUC 4CNYA 2KZMA 3BH7B 3GG1A 4LREA 2DK2A 3ITHB 4ES1A 2HFSA 1RTDB 4ZLJA 4K4VA 1REVB 2YKMA 3KUHA 5C42A 2CJYB 1NJXA 4K5RA 5L8RC 1PIEA 4HHUA 1VISA 2I0XA 3AH6A 4PYDA 2OSRA 2IA6A 2LLZA 4A8KA 4YP3A 3MM5B 5EHHA 3JAMY 1VLYA 3KG1A 2PD1A 4DSEA 2UUBF 5IWAJ 3TEGA 3K5PA 1NXIA 4C3KA 1R8CA 3AD9C 3WC2A 5F3ZA 1KH9A 3M8PA 3HKWA 4JV5J 2XSJA 2VPXB 2W8SA 4NASA 1KHVA 1RCOB 4JI2F 4A8YA 3TI0A 1R0BG 2OPQB 1HPZA 4ATNA 3VWSA 5E3RA 4W4MA 3LANA 3R2CJ 2UUAF 2E5LF 3M8ZA 5E33A 2YKAA 1B64A 1Q7LB 3LF0A 2J0QD 2AIRB 3KLFB 3VZHA 4YEAA 1U1KA 3CMQA 2F7VA 3KHRA 3KLEA 3OXFA 2IDEA 3Q23A 4YS2A 1EW8A 2FVCA 3DCAA 4PWDB 3OJUA 1ZOTA 1LKZA 3FCWA 2AU0A 1VI7A 3CJ2A 2JVOA 2Z4PA 3J81U 4NXMF 3B4MA 2M9KA 3AD7C 3R1LA 1DLOB 4KPCA 1FTCA 4NA3A 4M5KA 4OX9J 1HBUA 5F8NA 3MTJA 1DBDA 2FHMA 4GTXA 2YKQA 3MR2A 2ZITA 1ALHA 4CO4A 2J8SA 1LW0B 2CNOB 1TL3B 4NZ7A 3W2VB 1SIWB 3CJ8A 2EKYA 1UJ5A 5JUMA 1JLQB 5A76A 1EX8A 4UPLA 4B9SA 1REGX 2I5JA 3T1YF 1GTHA 4H4MA 2KYZA 4EMDA 4DS4A 2FB0A 1GMWA 3C15B 2XWYA 3P5TL 1VQPS 3LGHA 5KG4A 3MHYA 4Q0BB 4Y2CA 1QAYA 3W60A 3SFUA 3TUIC 1YBAA 4WFZA 2IVFB 2VA2A 4I2QA 2VB6A 2RVJA 3TAPA 2GO9A 2F4VF 3A8JA 3ILJA 4XK8C 2C2KB 3UWTA 5HVFA 3W62A 3OTCA 3GIKA 1LWEA 4MKBA 1RTZA 3UVJB 3E8OA 2J5AA 1KHNA 5GADI 1WHYA 5LRMA 5LIAA 4ZVEA 3ETOA 3W3SA 3JXOA 3HHLD 4UF4A 2GVZA 2HS4A 2M0GB 1WC0A 5F8HA 4GC7A 1QM9A 4WZMA 1UA0A 5SUHA 4EYHB 5U47A 2E5GA 3M8SA 1EZZB 3OLAA 1KDNA 1VRTA 2X51A 3GIRA 1X31C 1FDNA 1T03A 2X1FA 2G2YA 2HWHA 4UZCA 5K5MA 2KVQE 4CRJA 5D4NA 1VR6A 3OFGA 5D0RA 2FJAB 4F67A 4KHPJ 1SIZA 4JI6J 3BF4A 1WC6A 3A1YG 2RJZA 2UUCF 3D6TB 2C1EB 2HHPA 4XIUA 2F8EX 3OUYA 2YNFB 1DQ8A 1XJWB 4BDPA 2G0JA 3P96A 4O44B 5AXLA 5D3GB 4JV2A 3PW7A 1N5SA 3UW1A 2LQBA 3BDFA 1GXTA 9RUBA 3CE8A 1PG5B 5B0DA 4KGMA 2HIQA 2XNRA 1VC6A 2XMUA 1SHNA 1EIYB 3H7HB 3MUMP 1QSSA 3K17A 2A18A 1M5SA 2KRBA 3S01A 1N34J 3TQEA 1DZ5A 5J1EB 5H9EJ 2WCXA 2VV5A 2PN6A 2FJXA 2PA3A 3FNNA 3DLLQ 3NGSA 3HULA 3W5XA 2YBVA 2B4UA 1OS5A 3KJNB 1GT8A 4CT9A 3I5CA 2BV3A 4FYWB 2W7AA 5HI7A 3H2LA 1FJEB 2RKIA 3TVKA 5B0GA 2O01C 1XN9A 2OMLA 2E1AA 4W90B 3ISZA 2Q6BA 2Z0GA 1FDBA 3D0GE 3U7JA 5KFKA 1FKOB 3AHPA 4DSLA 5FDLA 1NSPA 1HW8A 1GFWB 1OQ3A 5H1SV 1W2BR 1J5OA 2MKSA 3I5AA 1S76D 3HFVA 4NMXA 4DSJA 1J5EJ 4NYZA 5K8OA 1XEZA 3WAXA 2GIQA 2G9OA 2H9ZA 2QLJB 1BY9A 1O99A 2QE5A 3HD2A 2EEYA 2H65B 5J1NA 5HLFB 2JJ4D 4ECZA 3KD8A 4QCLA 4IO1A 5B0FA 5AJ9A 4M5JA 2L41A 2OMOA 3AXMA 1LWCB 2VG7B 4ENOA 4NRTA 1RWMB 3D7SB 3TP2A 5FLXY 1J2VA 3T3FA 5F41A 3EWGA 2E5HA 3DLJA 2HBRB 5L0EA 2B7BB 2MLYA 3QQCD 2MKYA 3IRXB 3EGWB 1UA1A 3GLJA 4I69A 3CWJA 1HQAA 3LA0A 5I3UB 1ZBTA 2B4OA 1MNEA 1YKWA 2ACMA 2XNQA 3EDQB 2ZH2A 3BR9A 2PC6A 2E7XA 1TL4A 5D8HB 4DV7F 3UD3P 3UDVA 2LCWA 3CVKA 4DUTA 2NUHA 3L3CA 1RZMA 2JC0A 5A6PA 1S9EB 2QMUB 2LXFA 5IT9U 1AJBA 1X5OA 3TAQA 4DR4F 1P6TA 3KG0A 5D77A 4RW7A 2FVPA 2ZM6J 2O5DA 4CYRA 1TKTB 3KJFB 2M2BA 5KG6A 4DR5F 5IM0A 4A8XA 3DLGA 3PFEA 3BSCA 2O66A 2A10A 3N01A 2AV5A 4TXSA 4PXEA 1IKVA 4FF2A 1EQMA 3W61A 4V1Ak 2HG4A 2LEPA 1HMVA 3IGNA 1NB2A 4F25A 3MEEB 3SCKE 5BYQA 4L75A 1RTHA 4OV6A 5E5NA 1C0TA 3DLEB 3H2VE 3M4XA 2Y1RI 2QSWA 1JJCB 3OJSA 1RAAB 3KLVA 1X9SA 2GGPA 4N8OA 3VTIA 4TYBA 4DV1J 1Q5VA 2UXDJ 5IV4A 1PC4A 2IAJB 4JI3J 1CS4B 3W9HA 4O0NA 4S0MA 1MW7A 1T9WA 5H9FK 4LQ9A 2WAQD 1IN0A 2BE7D 1A9NB 1N33F 1RAGB 4DCJB 2ZZNA 4J5OA 1FFGB 2H5JB 1TV6A 3UQSA 3OHAA 4OHZA 2ZEJA 3M2VA 9ATCB 1E2SP 1RTJB 2DRAA 1F2GA 2BW7A 1RBAA 1E6YA 4F4KA 2KB2A 4RLEA 2R9LA 4RO0A 1BE4A 5KT2A 2ASYA 3CJRA 4RUCA 3QIPB 2RQMA 5AXMA 4EU0A 4DV5J 1TVRA 2HHHF 4OI3A 5B09A 4H4OA 4IFYB 3K89A 1HQUB 3RRHA 2VIHA 2RD5C 4DHVA 3THTA 4WFXA 2YKMB 5C42B 1WELA 3GIIA 5C7PA 4DN9A 3I4PA 5A8KA 1S9FA 1AUDA 1OJ4A 2IM1A 4Y6IA 1UFWA 5KFBA 3NY0A 4WTYA 3I82A 3JTPA 5DG9A 4DQIA 1HJKA 2Z2ZA 3IWLA 5C5JA 3PJ9A 2BM1A 2FVSA 4RPFA 1RB0A 3GCXP 3M8PB 4A8MP 2XSJB 5IV3A 2RS8A 5E7OB 3GR0A 4LFCJ 1HNXF 2OP5A 3Q3QA 1Y6VA 2P9GA 1WSRA 2XC9A 3W66A 4CI0B 2UXBF 4PUOA 1HD0A 1HPZB 3V6KA 5LXYA 3DMJA 1NLKL 2LQJA 3ZTSA 1FWKA 1FJGJ 3VAKA 5I3QA 3H59A 2JOQA 4LFAJ 2HRTA 1TR0A 2Y1IA 4DV2F 4OI0A 4B9VA 3T02A 2IA0A 4WP3A 1RSCA 1ROFA 3KLEB 1IM4A 4PG4A 1C2PA 1UEUA 2GA3A 2VH7A 4ECYA 3BDHA 2EK6A 4LUBA 1S1UA 3B78A 4ANCA 3FGVA 4DV0J 4MIVA 1S0NA 2XMMA 4KAIA 2DB1A 4UOHA 3JYTA 5J2NA 4MT1A 1Y5IB 1KHJA 1HBUB 1JXEA 2D9OA 4B3RF 1T0TV 5DS7A 1RKJA 3HHLA 1SL1A 4KJIA 1Y10A 1B70B 5A6WA 2BQRA 2MY8A 3V6DA 1YLXA 2I1RA 4I7FA 4HT5A 3SCJE 5T7LA 3J7A1 2DT9A 3GCWP 1HI0P 3HDSA 2I5JB 4UPIA 4H4MB 3BO3A 3PW5A 3CPWR 4JI0J 3VAGA 3NKMA 3RBXA 3VAMA 1L5UA 2J0XA 4RBTA 2MJUA 1VRQC 2HZCA 4I2QB 1YJTA 3KMQA 3NGUA 2IVYA 4RNMA 1AROP 2XB2D 2K3IA 3D28A 4ZP9A 2GA7A 2EFNA 4J9LA 4V19X 2J7UA 2NXNA 4U7CA 2WSEC 4PYAA 3WX4A 1IKWA 4O3SA 1LWEB 1VBKA 5D4OA 4LF9J 2VQEJ 1H2TZ 4F50A 4RBUA 2IVMA 1NZAA 4LF7F 4NRUA 1X5TA 1B3TA 4TU9A 3PYFA 2GIFA 4QR0A 2GVZB 1WF2A 2BZ2A 4LF6F 1D3WA 5HQ8A 3MK2A 1B7FA 3RGIA 4ZA1A 1VRTB 1M90T 4QW8A 2DIVA 4ZPDA 2QEXS 1T03B 4OLPA 1T95A 5LOQA 2W2MP 1RAEB 1HBNA 1VQNS 4MIBA 2JEFA 1KN6A 4DU7A 2HBYB 3RW7A 2DNRA 1U1NA 2NYHA 2GCFA 3N5BA 4M63A 2R7VA 3PW4A 1RT6A 1TUVA 2MY7A 4CLTA 1VRUA 2HNDA 4WKYA 2HBZB 4X65F 4ERDA 3U1NA 3R3TA 3MR7A 3OLBA 1JJ2R 3T5JA 5B08A 2B8QA 5C2CA 4I6WA 3OUYB 4DDFA 1SKSA 3NNHA 3MI7X 3SIPB 4RW4A 3CCES 3IR6B 4ZVTB 1X4HA 4U7UK 4UOFA 4N77A 5B7WA 4R0JA 1N52B 1DARA 4EYIB 2VFUA 4K4XA 7FDRA 2AYEA 5FIIA 4Q7AA 5GRRA 2DY1A 4KR0B 4DG1A 1SC4B 2GO8A 1EB0A 2B5JA 2V94A 4RU2A 3KK3A 1OY9A 4J9VA 4A8FA 4QQBA 4F26A 4M5HA 1CVJA 3Q8YA 4KRWA 1I94F 2CQDA 3FEXB 2FTRA 2H51B 2VL1A 4DL2A 3KG4A 4U96A 2CPFA 3PW2A 5K8PA 4OHWA 1HLWA 4D3HA 1ZZNA 2RKIB 4OYXA 1RT2A 1S6PA 2V0NA 4DL6A 3NG8A 3OXGA 3CULA 4C2MA 3M32A 1WACA 5FDLB 1RAOA 1RGVA 4DR7F 3AB4B 2DHGA 2QRRA 2E1MC 3BR8A 2VF3A 1J5OB 1PBUA 5KT7A 4J91A 3PKMA 2Q79A 1K0TA 5DDPC 4YDDB 3ZTOA 3QWPA 3KFWX 1NPPA 2K7JA 5ETTA 5GAHI 4WF9Q 2F40A 5KG2A 4ZVUB 1R0CB 2CQGA 2QC3A 4NOHA 3QWUA 2GNKA 2OSQA 5F8JA 4Q5VA 3WAWA 2C3YA 5E0OA 2RUSA 1FRJA 3N9UC 1Q81T 3TX8A 1M1GA 1PAEX 3JSYA 3JSBA 1WF0A 1WJ9A 2Y3YA 2F9DA 4CM0A 4PPDA 3MPWA 1NHVA 3OTOJ 4GVBA 2XBPA 4USIA 2HRYA 1RHKB 5CD4H 4X62F 2ZH8A 4GO5X 4ZLNA 1MWYA 1PJ6A 3N6NA 3BBCA 3V5RA 3TG0A 3QJJA 1X60A 3PXGa 3TYTA 5GADU 1S0VA 4BC7A 3A52A 2R8HA 1NDKA 4F04B 1GMVA 3LP0A 1NPRA 3TA1A 3Q8RB 2CJBA 3FCHA 3VGTA 1TTHB 1FO1A 1KP6A 3R7BB 1QUVA 2ZHAA 1UPMB 4RW7B 4JOUA 4ZP6A 3MXHP 2ASJA 8ATCB 1WKLA 5IZHA 5IM0B 1BQMA 4OIXA 3OQ2A 1FNMA 3DLGB 4Y2MA 4X4OA 4M8LA 1M5VC 3A3NB 3ZZ0A 1IKVB 1SV5A 3SZZA 2EKNA 1G1XA 1HMVB 4UPKA 1K7HA 2NYIA 4PEOA 1GQEA 5KFHA 5CZXA 4MFBA 3FSIA 1R43A 2XYGB 1RTHB 2GMLA 1TU0B 1C0TB 4YY3J 4PPZA 3M9NB 2R7TA 3OVSA 4X4VA 2GGPB 1E6VA 1CQMA 1NK0A 1EW2A 2ASLA 2QYGA 2KHCA 3BDGA 2IRYA 1UVKA 5JVHQ 2DGXA 2KHDA 3HXMA 5E3QA 1IXKA 2HLUA 2OAUA 2EW9A 3G6YA 1H98A 1TV6B 3CO9A 2RIJA 4GTZA 3M2VB 3V6HA 1KOHA 3NNCA 2F3JA 5AE1A 4ILMA 1GXUA 1E6YB 3DU6A 1FSUA 2C3UA 2VDIA 2PSZA 4PG5A 2DEJA 3K8VA 1QDUB 2P5VA 2HURA 1NH7A 3WAYA 2E29A 4IR9A 2GIRA 4UQTA 1TVRB 4CTAA 4UY8T 3X1LB 3A4TA 4H4OB 1FJ7A 2YKOA 3EXYA 3ILLA 1XMBA 3K5LA 2RRNA 4I0WA 3MEDB 3KNAA 4P2XA 4A46A 2J6SA 2ZHOA 1RADB 2QZ8A 3BV8A 5A8KB 3PHEA 4KY3A 2D3UA 4B3TF 3M6UA 2BJ8A 3S7RA 4A8SA 3ZTQA 2EWHA 2HS3A 3HZGA 1MSWD 3MM9A 3DXBA 3R5JB 3PG9A 5IC4B 3GJSB 1UETA 1G6BA 3T9NA 2KZZA 3CW2C 4U8VA 4XPCA 4TY8A 5ETKA 1HBMA 3QJPA 5B0AA 2R7XA 2NXJA 2ABYA 3D66A 1F6TA 2KRRA 2MMYA 3OSPA 2WOMA 2R7WA 3G87A 4PUOB 5HN0A 1KD1T 2MKIA 3DMJB 4QYZJ 3VAHA 2P2CB 3HF5A 4ZN1A 2NQPA 3BSOA 1TMMA 1Q82T 1PJ5A 2A2CA 1S9GA 3ADAC 4FDIA 3D3BJ 1VIOA 1VLOA 4X2BA 4HI2A 5HQMA 1Y4ZB 2L08A 1S1UB 4L74A 1MN9A 2LKZA 2XS2A 4ZPWR 1EHWA 2VJVA 3KUEA 4OYMA 1KVIA 3CCVS 2EFGA 5B0BA 4ETZA 3ZZYA 3JYTB 2IJNA 5J2NB 2G1DA 3IM9A 1NK6A 5L1LA 1SJFA 5HO4A 2IJFA 1NJIT 1FX2A 3W5YA 3EPIA 3HHLB 2VJUA 2BDPA 3V6DB 5A2QY 2UVVA 1S0MA 4DUYF 1AW0A 4WWSA 2BKNA 4ED8A 4I7FB 5T7LB 2PMWA 3QSYB 4KT0C 2DNOA 2R2UA 3A8EA 1N5QA 3TZYA 1S6QA 1X0PA 3CCZA 5E3CA 3KMSA 5LRNA 2CQ4A 3FJ2A 3G6ES 3D1OA 2VFTA 1ZPWX 1IKYA 5HQLA 2BJ9A 1R31A 3CJ3A 4EUVA 1SVDA 1IBLJ 5HANA 5M2RA 1T9VA 1HNVA 1Z2ZA 1Q16B 1IKWB 4USHA 3HHLC 5GAEI 2LECA 3R5GA 4A8QA 4NCBA 1ZH5A 2GZOA 2QLBB 4MHXA 2JSXA 1L3SA 1SHQA 4ED5A 2HQIA 1I51B 3TUJC 1RAHB 4L76A 2FJVA 4LRAA 4A8WA 3OV7A 2CPDA 3SV4A 4NZ6A 1HBNB 4OYPA 3LUYA 4ANEA 2RNEA 2YX7A 2AX0A 3O8WA 4LR2A 3KNGA 4LMZA 1RT6B 1AJAA 2JHEA 3NMAA 1VRUB 2HNDB 5DRKA 1ZM9A 1HR0F 3G6VA 4OHYA 2FHKA 3CIZA 4Z2XA 5KT3A 4DLGA 2D1CA 3MM6A 5ETLA 4USWA 4RW4B 2MSSA 1JX4A 4M94A 1JNZB 2EFVA 2W5XA 4JI8F 3QT8A 5LSRA 1FE4A 3RUBL 3MK0A 2ASDA 4DG1B 3KK2A 3LAKA 2R3VA 4QWDA 2B5JB 2ERRA 1KSPA 3FQKA 4PQAA 3GIJA 3KK3B 4FF1A 1D8YA 4DV4J 2J9DA 4QJVA 1I3OB 1NRKA 5BYSA 1M0SA 3CJSA 1NHUA 4CH0S 4QR2A 3ULHA 1F9EB 2FLPA 3OVBA 2HFUA 2HSEB 5HMYA 2VC1A 1YJ9S 1RT2B 1S6PB 2DR6A 4DPXA 2Z2MA 5HVGA 3CJ0A 4C9DA 3FRZA 2PO4A 2VBYA 1FWLA 2OLWA 4MYUA 4KB7A 2CQPA 5DLFA 2HQ3A 2CQ0A 3M32B 1Y11A 2FJEB 1S7HA 3CDEA 2O67A 2DPJA 3M2RA 1Y5NB 3L7PA 3E51A 1ZPVA 3VZIA 4EZ6A 3M30A 4EO8A 2V4QA 3TANA 2R7UA 1WEYA 5KG1A 3KK1A 1AUSL 5BXIA 3DDNA 3A13A 3FK4A 2HRUA 4NE9C 4ZJOA 2E66A 2PT0A 4CP5A 4I56A 1JB0C 5F8IA 4DSKA 4NYOA 4IH6A 1HWLA 4Q8FA 1JWWA 1L3UA 2FHOB 2CYYA 4OFZA 2YXLA 3ZO7A 4RNNA 1TKXA 2O1PA 3P4UB 3H4DA 3MM8A 4AL6A 2DTJA 3M9OB 1FA0A 1KBRA 4K4WA 2RH3A 2XULA 4B9MA 1YITS 1FHTA 4AQYJ 2PEHA 2F5GA 2N3LA 4CH1A 5DZ7A 3EMTA 1U1PA 4GVBB 5AJ3F 2MEWA 3DI6A 1MMDA 3OR2A 5KG3A 1X5PA 4MKYA 3QJLA 4PZVA 5E3AA 3OTEA 3ZTPA 3W9JA 4CLLA 4CYSA 1YJ7A 1DQ9A 2DEIA 2BR0A 3R9LA 3D6MB 4FBTA 3LP2A 2AYGA 3D9BA 3LP0B 4ELUA 4FF4A 1HI8A 1CLFA 4DF4A 2LXIA 1VS3A 1VC0A 3UD5A 3JAMU 2PMZD 2CQ3A 1SJ4P 3PEJA 2YWKA 5KFFA 2RHSB 5HJXA 5ETSA 5LMUF 2JFKA 2HYIB 2CIMA 3KJVA 1R8BA 1YG0A 3HZEA 4OJ3A 1IBKJ 1BQMB 5FJ4A 1XQIA 3I96A 3JQKA 3LALA 3UNGC 4P10A 1CSJA 1N32J 3GONA 2E7VA 2UU9J 1XMQF 2B51A 4FPIA 3T00A 1SV5B 4JI6F 3TR5A 5KFRA 4DUZJ 4K4TA 2DGVA 2VA3A 4NMLA 2X3DA 2BBEA 3L7UA 4ICLA 4MFBB 1V3ZA 2W8LA 3OW2R 4F8RA 3MAQA 5CABA 3IGYB 4KV8A 1HQ2A 2V2ZA 3I87A 5K14A 3ZZRA 1E6VB 2BE9B 3J81Y 3BDGB 1ZAVA 2XMJA 4F4WA 4MKAA 4LBIA 1OY6A 4H54A 4CLPA 1FRLA 4OYAA 1KC8T 2MKCA 1SKUB 4LF5J 2D3OR 4IOBA 3P5BP 5KFJA 2XY5A 3UDCA 2AGOA 3PY8A 2YWEA 3BEGB 4ZVGA 4ED4A 4ED1A 3DRYA 1IWGA 2HHUA 2KDOA 5F8MA 5DQHA 2UVWA 4CTAB 4UUWA 4FYVB 1M1HA 4P71A 5J1PA 3GYNA 4LSNA 3U1LA 2GSOA 4KHRA 2H48B 2BEFA 3D3CJ 1KH5A 1YJVA 3C8YA 2ZH3A 5F0UA 4ZVQB 2CPIA 2BQ3A 4C3MA 1P49A 4J9NA 1QSYA 1S10A 4FS2A 2AGPA 1FESA 5GAHU 3MM9B 4MMOA 5T14A 2ROEA 3RAMA 1HNIA 4NLGA 1HL6A 4TY8B 1HBMB 3D0HE 4M5LA 4U9RA 4K5SA 1S97A 5IC6B 3DC2A 4QYZK 5L0KA 2UUBJ 4IG0A 4MKVA 1FX4A 3LPEA 2JVRA 3BS9A 2D3O1 4IKAA 1S1TA 5DO2A 3MZIA 2NXEA 2WOMB 2DH7A 3OFFA 1N48A 1O6XA 2ZNZA 2F63A 3AT1B 2IM0A 3BBFA 4LRCA 4DPWA 2FQQB 1NKEA 4NLOA 3FZ2A 4TNOA 1Q5YA 2B56A 3OL8A 5KT4A 4JI1F 2JDJA 1S9GB 3GJTB 2ROPA 1QY7A 3B54A 4ZP8A 2UUAJ 3MMJA 2AQ4A 2ACYA 2E5LJ 4LR8A 4IH5A 1IBCB 3NEKA 2R7RA 4C8KA 2AX1A 3MMAA 1UCNA 3OR1A 2HEKA 2XHWA 1AXQA 1S4EA 2V69A 3PEHA 1UVMA 2YWFA 1IUJA 5KFZA 2K8GA 2VG5A 3BSNA 1GX5A 4CWBA 3FC9A 3QT5A 1TQLA 3Q8QB 2VOPA 2RAQA 1KOOA 4NXMJ 1BWVA 5IQQA 2WSFC 2ATCB 2KXHA 3W7BA 3AD8C 2EC0A 5LJ3Y 3D6HB 4KIAA 1JNRB 4WE1A 4FYDA 4OX8A 2CG8A 4ZHRA 3K7RA 1FD8A 1Q8BA 1S6QB 5HJYA 2L9WA 2CDRB 2W5SA 3SSQA 3H90A 2R8KA 4Y2IA 4DX5A 2CPYA 3TUZC 4ECTA 1RA6A 1U25A 1UJ4A 3T1YJ 4F4XA 5D0EA 3MM7A 1XR7A 4PG6A 3MK1A 1IKYB 1HWKA 4PG7A 4ZG6A 2XCAA 3MPDA 1JLFA 1FKPA 3NCPA 4OLOA 3E2EA 3NKQA 4P73A 3CF5Q 1OSCA 3NGDA 1W25A 1P9QC 2J9EA 1HNVB 4OYZA 1Y3KA 3MPVA 1ACMB 2ZUAA 5JVGQ 1XNRF 2PEBA 4ID5A 3U1MA 3OL7A 3M05A 2XI3A 2F4VJ 4P2FA 5EWGA 5F9NA 2CQIA 3SBMA 3DGVA 4RU9A 3BZQA 4NLYA 3OPKA 2OPRA 3BQ0A 4Y2KA 3SEOA 4NLTA 1OYEA 2R8JA 1T9XA 5I3PA 1S1VA 3RRKA 1RWOB 2A6OA 3ZNUA 2BMBA 2J9CA 2QL9B 3TWZA 1P1LA 1EP4A 4JBCA 2W8KA 2V67A 1YRTA 2E5JA 4RNOA 4DV5F 3G2XA 4P52A 2LQ5A 2XMKA 1VQ8S 1BWEA 4IRDA 3CCTA 3QZ7A 4AE5A 4ZJQA 3D68A 5FLXU 2W9CA 4EEYA 1UVLA 3RBEA 4LF4F 2CPJA 5DG8A 3BGRA 4X64F 4OV1A 2HHXA 3WX8A 3OHBA 2OGUA 3MM6B 4YQWA 2XGQA 1HNZF 2V8PA 2WVEA 3NGKA 4K8RA 1VQSA 3HT3A 1FE0A 2J7KA 1X4EA 1Q8IA 3PM9A 4FKYA 1JLGA 2HFNA 3POTA 3G8SA 1RACB 5IT9Y 3MFIA 3UN3A 1KLMA 3NGTA 3RBZA 5CAAA 3KK2B 5INHA 4QOTA 3W63A 4OZ1A 1NKBA 3H20A 1QAIA 5CYMA 5L0BA 3UCGA 1F2HA 2HBQB 1FTRA 3CJ4A 1T02A 1UFLA 2VFRA 2IJRA 2E1CA 2MKKA 3UO0A 2WZ1A 4I1TA 1T8EA 3NS6A 4B17A 2W4CA 5LSOA 1CBKA 3P3DA 1NK4A 1ZAXA 4X4TA 2MKHA 2UUTA 4ID8A 4ZPAA 3NOCA 2N3OA 1SQGA 4DMZA 4URSA 3A3PB 3G4SS 1U8SA 2G0CA 1BGXT 2YH1A 3Q22A 2EG2A 4MAKA 1W7WA 2GC8A 4DV0F 2IDLA 2KI2A 5EWFA 2CA9A 4UOGA 3DOLA 3M2RB 1WI6A 4YB1P 1NDLA 1KVJA 1NMEB 2G13A 3M30B 4L6V3 3UR3C 5D4PA 2IIHA 3NCRA 4AXJA 1YSJA 1MLAA 3CGIA 1N88A 5DM6Q 4AD6A 2V5HG 1WTFA 2C22A 1WDDA 3JS9A 2W9AA 3AA9A 3DFEA 1XNQJ 2XS5A 4O3PA 4ZP7A 4C8MA 1K44A 1V5VA 3ISND 1JMTA 1TKXB 1VBZA 2N7CA 1RI7A 1V6HA 3MM8B 4Y3CA 3L95X 5F0WA 4KGVB 2XCPA 1FF2A 4JI0F 2H5IB 4QIGA 4X66F 4KYZA 3KKFA 4UW2A 2AJQA 2FVRA 4P74A 4E0DA 3F0NA 1AZSA 1TL1A 1YX2A 1KQFB 1Q86T 3DI6B 2RDIA 3HHNB 3OR2B 4Q2LA 3H25A 3QPIA 1WOOA 1UJ6A 5DLGA 4NWXA 3EYZA 4FXWA 4TN2A 5KFXA 2HGMA 3MTKA 3CDAA 5BJRA 2OEJA 5GAEU 2HS0A 1ITPA 2QL7B 3J81j 3PZPA 1NU4A 3W65A 5TJ3A 2AYBA 2MLZA 3LP2B 3CMAS 4CCHA 2DH9A 2HGNA 2W01A 4DV7J 4QU7A 2B9XA 3O3LA 3CJ5A 2KFNA 1EKRA 4HTJA 4HHJA 5CHCB 3KJVB 1FRKA 4NLVA 4DR4J 2BA9A 1N54B 3HM9A 2JRSA 3HSZA 1N2KA 4ELTA 1N36F 4A48A 4B3SF 2FGCA 1WC4A 3TNVA 4DJBA 4TU8A 4DR5J 3NP5A 3NL0A 3T6JA 5KFGA 3J7AN 2Z56B 2RDDA 3ILOA 1Z2LA 1EETA 1HWUA 3I5BA 2COLA 1UZHA 4ICLB 4ILLA 3ED4A 1EJJA 4KV8B 1WI8A 2BKOA 4QIVA 5K14B 3QMQA 1L3TA 3QGHA 3PNIA 2FZCB 2AZ3A 2UXCF 4NI2A 3NAHA 3QBCA 3PRVA 3WDOA 4WXWA 3MPYA 3GV7B 4OJHA 3DOMB 1D8ZA 5L1JA 1HQEA 1D9DA 4R5PA 5EDWA 3NXZA 3HI9A 1ULRA 4DR2J 4ZPBA 2RMLA 1WUUA 1N33J 2VOOA 4E98A 3JSMA 1BMQB 2Y8WA 1RE1B 2DHSA 2CZ9A 2C42A 1URRA 2Z2LA 1XIQA 1ALIA 1BUXA 4DR1F 5J2MA 4FBUA 1S7IA 4WU2A 4LSNB 2XTJP 1WTBA 3FRYA 4IO9Q 1RHQB 4K59A 4CLKA 5DETA 3N28A 2VD3A 1UP1A 3DLBA 1UTAA 2MZQA 2IHR1 2HHHJ 1U7LA 3D4JA 3IDDA 1ZM3A 3T1AA 3N6MA 2CQHA 2LU1A 2NXCA 3K5NA 3DRSA 2AWZA 4DN0A 1FRXA 2HQCA 1G7CB 1HNIB 1UAWA 3JTNA 2XHCA 1N56A 3UI3A 1VBYA 4TQSA 5DQIA 3PV8A 5C2GA 3UFCX 4IG0B 3DM2A 4DXLA 1RWKB 2JEJA 5EN1A 1S1TB 3FQLA 4C0OC 2WVDA 2A0FB 3EVMA 2XMVA 2AP6A 3ZNJ1 4OZNA 3BKTA 3PO4A 1HNXJ 4LRDA 1J27A 5BR8J 4K0KJ 1I5OB 4EWTA 5K4PA 2VZ9A 3J7YU 3QT7A 2UXBJ 4AT1B 1WSVA 3OTOF 3LAMA 2LA4A 2OPPA 3V2UC 3Q0AA 2W2NP 3UN2A 2ZC3A 3G6XA 4RNFA 3M8RA 2FPHX 1QE1A 2BJ1A 3I9ZA 3QT6A 2CQCA 2J0WA 2MQ8A 4DV2J 2CG4A 2IUCA 4RW8A 3MMAB 3OR1B 1FFSB 4NA2A 5HBMA 3MMCA 2VG5B 5HMWA 2GX8A 1X4BA 5IFMA 1YRXA 1T7PA 4GO7X 1YBUA 4HHHA 1HIYA 5HK4A 3G8TA 2CUYA 3FEZA 2QSFA 3HMJG 4KFBA 4CDIA 2MKJA 4RWWA 2MSTA 1IR1A 4WCEQ 3L4BC 2BJDA 1SH0A 3TW0A 3EGVA 4WE1B 1YJWS 1NH8A 4ZHRB 2I9SA 3M2UA 3CJQA 2U2FA 1YGYA 3FCVA 4J9RA 4QYRA 2DGQA 4P9SA 3F56A 2I6WA 5KT6A 3MM7B 2CQBA 3OFHA 3H5XA 3IC1A 4NWBA 1JLFB 5HATA 1FKPB 1H7WA 1B0PA 3RB6A 1XK8A 2MZTA 1NSQA 3KYLA 2FVQA 3H42A 1VQ6S 2IMOA 3SQOP 4ID5B 3QLHA 2ZH9A 2LVWA 1ANJA 2IRXA 3IN5A 1Q0NA 2DCLA 4HL9A 2WB1D 4I67A 1C0UA 2AJ4A 3TOQA 4DS5A 2OEKA 1S0OA 2CKWA 3SDEA 2ZNYA 2OPRB 4J9KA 2DNMA 2AYMA 2R2SA 4ZIVA 4LF7J 4B02A 1LV5A 1T3OA 2ZH7A 1NK7A 1S1VB 1H72C 1NB7A 2ZFHA 1FK9A 5IOLA 2F8MA 3I55S 1NK9A 1EP4B 4LF6J 3RRGA 3G96A 2E9RX 2GQ2A 4Y34A 2QMWA 4A4JA 2VG6A 1VFJA 3VR1A 1HFEL 3DRPA 3IBCB 2BJ3A 1SJ3P 5DZ6A 1PYTA 2W9CB 4G1PA 3QIDA 3W2WA 1U0SA 3BGRB 3P8BB 1U1QA 3AOCA 4C8LA 3JSRA 5KXAA 1FD2A 3K58A 2VBZA 1RQ0A 2KJVA 1WORA 1VYAA 4PRFA 3BO2A 4LFBF 2V9KA 1JLGB 2IYGA 3POTB 4ES3A 4OHVA 4GKJF 3MDFA 4KGXB 2HZAA 1GEHA 1KLMB 2MZSA 4DBQA 2RILA 2NSCA 5CYMB 2XY7A 1B4SA 4C3LA 3AOBA 2U1AA 4L73A 2VASA 2EI5A 2LXUA 3H2UB 2OUGA 4YMEA 2HAIA 4HACA 4ZVOB 2BUNA 2VKZG 2QA1A 1I94J 3FVYA 4EGLA 1HD1A 1NO8A 4FZVA 1RBOB 2IC3A 3WC0A 3Q83A 1GTEA 5DGBA 3BN7A 3O44A 1AB8A 1BC6A 2V4JA 2QYCA 2J0SD 3GIMA 2FYXA 1OQ6A 1ZTWA 3Q8VA 3SZ2A 4W98A 3DOLB 3IMQJ 5C66A 2KG1A 4UPHA 5D78A 3MECA 5CXTA 1NK8A 5AE3A 2HVEA 1B8JA 1VDHA 4DR7J 3D2WA 2MQMA 2JFDA 7FD1A 2KT5A 5KFOA 4NPOA 1WC1A 3GMGA 3F73A 4PG8A 4JV0A 2DKOB 4NLSA 2F9JA 5L9XA 1W26A 1VHFA 3SSSA 4IG3A 4BS2A 3NKRA 3EE3A 4C4WA 2ZBQA 2MHEA 3C6TA 4G6VB 3O2IA 5DG7A 1ZM2A 2D41A 5F8LA 4QBUA 5ETMA 3EGZA 4GMKA 1JLEA 2M7SA 4RX6A 1SKWA 3PX6A 5D0HA 5DQGA 3J80Y 1HARA 1AZSB 2F8HA 1TL1B 1S5ZA 3EM1A 3SSRA 3J7ZT 4Y65A 2HMIA 3CJKA 2CXEA 3R5BA 1RA7A 3H5UA 3LW5C 2E1RA 2HW3A 3LPYA 3QGGA 4WFAQ 2YX1A 4X62J 4KH1B 3QRQA 2FHJD 4G65A 1XC9A 1U49A 4MK8A 2B4VA 1DTQA 3IGZB 5CCLA 2B3TB 2E7WA 2ZWPA 2IBOA 2RE1A 4KGKA 1P27B 1KONA 3M8YA 2HQDA 3OTBA 4OJ1A 3KLIA 2MQOA 1E33P 2KU7A 1ELZA 1SH2A 1NCLA 4AL7A 1RHUB 3FKBA 1CG2A 4DPYA 3OSNA 1X4DA 4J7CA 3ENQA 1VQ4S 3OXLA 4NLRA 4FDFA 3MUTP 4HT7A 5I42A 1ICEB 3V81A 1ZEFA 4XDDA 5L46A 2NPFA 1H73A 4NZ0A 1NJZA 2WVCA 3H98A 1SUQA 1KHKA 1EETB 2R8IA 2WVFA 5THWA 2FIUA 3BPDA 3T19A 1U2RA 4U6PA 2K1RA 3ZFVA 4N41A 2FC8A 3IFEA 4HVZA 2IYIA 3TARA 1K1QA 4MY4A 2I2YA 4NXNF 3GQCA 3PFOA 4NI2B 4OHXA 3BBBA 1BQXA 1FNOA 3FFIA 3MEDA 2Q66A 4KPYA 2PI4A 3VALA 3HPOA 1SKRA 3HO1A 1HQEB 3MR6A 4BLGA 4R5PB 1FXDA 1DQAA 2JLGA 1S4FA 2DHXA 4O3NA 3AJDA 5LJ5Y 4LF8F 1B0VA 2G9YA 4USKA 4C11A 1IWAA 1NPKA 2UVRA 3HVRA 1TELA 4ZS6A 3JSMB 1CJKA 1PSDA 2KVIA 3A8IA 1U2CA 1UFKA 3M6XA 5KG5A 2B43A 4WTOB 2OEMA 4TVAB 4YR1A 2ZKUA 5J2MB 4O3QA 2DXDA 1Q95G 3S6EA 2J7WA 4DSFA 1Y5LB 2ZJPQ 5JJBA 3PYGA 1H74A 2H4YB 1NZ8A 4ZCIA 3DRSB 1TK8A 3QNWB 3BO4A 2CWKA 1RYSA 4FF3A 3FSXA 4UY85 3MFHA 2KKHA 4B3TJ 1MU2A 1RWVB 1T9UA 2ZZMA 2NLWA 1F1BB 1RTIA 1NJYA 3DM2B 1SB6A 4UT4A 2DGSA 1FWPA 1AJDA 1MG7A 3DHWC 3DYCA 4ETXA 3MR3A 2J6UA 1UEKA 4IRKA 4CT8A 3IBFB 2XI2A 2FJWA 4KKOA 2IMWP 3MAAA 4ED3A 4ITSA 1CQNA 3TAMA 3BH6B 3U27A 4PXCA 2BJEA 1U6ZA 2OPPB 4LSZB 4M1KA 4P7TA 3UR0A 1GNKA 3NKPA 5BYRA 5E41A 1LK7A 2QV6A 1QE1B 3PJXA 2W9BA 2PGCA 3W8PA 2F65A 2IUCB 2HQGA 2JEIA 4RW8B 4JI4J 1RWNB 1VQKS 2YPZA 5HBMB 2QLFB 2ZOFA 1QAJA 1MN7A 3MMCB 4U7UD 3VHQA 2DVIA 3DYAA 2X1BA 1KH7A 4ECWA 3UNYA 2JLEA 1HNWF 1EI6A 2W5TA 1WNEA 4AXIA 2DH8A 5KFAA 1PAUB 1G2EA 4ZIWA 2CNNB 1HBOA 4M5DA 4I68A 1RJJA 2DGOA 1B0TA 2DNYA 4DR3F 3QFHA 4C8ZA 1JLCA 2LMIA 4XO0A 4Y28C 2P6TA 4KFBB 4ZG9A 3UN5A 2C2EA 3TRGA 1RT3A 3KDOA 4LQYA 2MPUA 5B0EA 3QAEA 1YJRA 4DUYJ 4ECRA 1GXLA 3M2UB 5AT1B 1UVIA 2HVHA 1WG4A 4MK9A 3TVZA 3ET6A 3E01A 5KAKA 3A12A 2ZVIA 2EXUA 4IQMA 1S72S 2JH3A 5AXNA 4F3MA 2V2VA 4I6YA 4K4ZA 4CH7A 2CADA 4MJKA 4UUXA 2V6AA 2XO6A 3N0VA 2ZWOA 3QLHB 4ZN3A 3RJMB 3GJRB 2DXEA 2Z2YB 1C0UB 4XTTA 5CA5A 1KFDA 5EGYA 3Q8SB 1FT8A 3SXLA 1YVFA 5C25A 2QX0A 1S49A 1SJ1A 3SDEB 3LP1A 1IQZA 2HNYA 3LO3A 2C2RA 4FYXB 4GTWA 3WBHA 4GKKF 1OPIA 5M2UA 3C6UA 4Y2AA 2QIFA 4TQRA 4J37A 1F0XA 1S1XA 3NBPA 4WFYA 4C6AA 2XZDB 4AL5A 2KT3A 1XR5A 1FK9B 2GJ2A 1OMSA 5AXKA 3DDKA 4MH8A 2KO1A 1WKJA 3DGPA 4B3MF 3P49B 5ITHA 1FRIA 2FZGB 2B8PA 2VG6B 3DRPB 1PYSB 2VFSA 3I56S 4Z7CA 1IM6A 5HL7Q 1EQJA 2MXYA 3D1QA 4P75A 5DGAA 1RBLA 3D1HA 3W2WB 3T1HF 5KFPA 4WFBQ 3FBBA 4OYBA 3S1TA 1NJWA 3IWXA 3TUPA 4NLWA 4DR6F 1Y7AA 3M8WA 2VKRA 2OIHA 4KAVA 1S99A 1HR0J 2VU5A 4F3QA 4DL7A 5KFSA 2FJDB 3G9CA 1JLAA 1SQEA 3BGUA 4Q2MA 3GILA 1FJCA 3DNCA 5DM7Q 2VPYB 2OPSA 2BXJA 2Y0SD 4JI8J 3HLUA 4FPRA 3QRPA 2JL9A 4WIQA 4LIRA 3IAS9 7AT1B 4RL1A 4C8YA 1RT4A 2W2PP 1H0HB 2X3GA 4NYPA 2PFDA 3Q2TC 4HACB 3TVYA 4JB8B 3M8QA 4WK3A 3EVOA 3UPFA 4V19J 2J9DE 4FNHA 2IPOB 4QWEA 1U1RA 1TUGB 2KYXA 2AD9A 1DRZA 4YR2A 2IC3B 2J8AA 4C97A 3UD4P 2Q43A 3KXDA 3NCQA 3ZZZA 2V4JB 1YIJS 1LNQA 5HVHA 5LQQA 2XSFA 5LMNF 3MECB 4QWAA 1MWQA 2HLTA 1PILA 2QGFB 2AKWB 2FHJA 4GC6A 4NLUA 2FJBB 4F0HA 2V68A 2R7OA 4ZVHA 1OY8A 2G2ZA 4HH0A 2XMWA 4DF8A 1NM2A 3ISNC 1HI1A 3CTRA 1KLNA 1X0FA 3GZ7A 3GR1A 1I1GA 4IG3B 2W5RA 1VMBA 4YUDA 2KXFA 3C3LA 5EWEA 2VBXA 4ZLPA 3O6QA 3C6TB 2F4FA 2YY3A 2BE2A 4ZVFA 3EDRB 4LVOP 1LK5A 1JLEB 4WYWA 4P7VA 3DLKA 5K8MA 4HLBA 1FERA 2G4BA 3DN9A 3EGNA 2H3EB 3AA8A 2W4DA 4UORA 1X4GA 2HMIB 3CJKB 1Z1ZA 3C66A 1UL3A 1OWXA 2ZE2A 2X98A 2CZVC 3CEDA 4X84A 2EFOA 1HYSA 3VVTA 1R8HA 5HP1A 4C48A 4DV3F 3NWGA 2NREA 5AJ3J 1W2IA 2YNGB 2EK1A 3CSKA 1MMLA 4DEZA 3IS9A 1SQFA 3L7OA 3ZXWA 2V8HA 3AJ1A 4BHQA 2YX4A 1F5AA 2DGWA 3D67A 1YJNS 1DTQB 3PYDA 2DITA 2EG1A 4PXBA 2N7YA 3AY0A 1RDRA 4IQXA 4YB5A 4U95A 3GFHA 1RLCL 4IFVA 2C2OB 5CYQA 3MMBA 2DR7A 3C16A 3KLIB 1KRPA 2ALZA 1JLBA 5MAOA 2CAJA 2WTFA 1VQOS 5HROA 4WZQA 5KFTA 4X4UA 1WD6A 3I31A 5LMUJ 5I42B 3V81B 3VQSA 2BW2A 1VHIA 1TAUA 1WOPA 1IR2A 3DOKA 2ATLA 2C28A 1N4LA 4ER8A 2HHQA 1SUQB 3N79A 1TMJA 1DURA 4HTIA 1XMQJ 2C2MB 3T5HA 1T05A 4DL0C 2K1RB 1KQKA 5RUBA 1TUWA 2C2ZB 2DRDA 4DZ6A 3GYGA 2QLXA 4J9UE 2Y1JA 2GV1A 2CVEA 1ZEBA 2OI2A 3FFIB 4JYAF 2DNNA 4OZ2A 1EKSA 1YJUA 3CCRS 2IFYA 5GMDA 2BM0A 3JQJA 2CRLA 2BQUA 5D15A 2VONA 1QJHA 1P1TA 4FDJA 4P72A 1U2FA 1PGZA 3CC4S 1YRUA 4P2SA 4ZPCA 4C11B 1IR0A 5SZTA 2XYPB 1CJKB 4WBFA 2GW8A 2KG0A 2I8EA 2ROGA 2XQCA 2UUWA 1RHMB 4EI2A 3CMES 4CLSA 1RWUA 1ZA2B 1C1BA 3AAWB 4ZVSB 1RLDA 2UVUA 4PKDB 2E5IA 4TKTA 1VQ7S 2HWIA 4X4RA 2K2PA 1LW2A 4EBEA 3DPCA 2R2TA 4K50A 1ZS6A 3EXCX 3R5DA 1R27B 4DQPA 1K1SA 2IFXA 4USVA 4HI1A 1RHJB 2WB4A 1HWIA 2AZ1A 2M8DB 4Q44A 2CPZA 3KOAA 4LBPA 3Q86A 3PRDA 1SC6A 2VUGA 3K5OA 4X4SA 1XNQF 1MU2B 3T01A 3F44A 3VAJA 3AQPA 1RTIB 2NZ4A 1PJ7A 1D1UA 2W1BA 1RABB 2ILYA 2PFFB 3RZAA 1SH3A 1FCAA 2QMXA 2DIUA 1WEZA 2RQCA 4RJVA 2MQLA 4KKOB 2WVBA 2QO3A 3P6YC 3MAAB 3SCLE 3TAMB 1VQLS 4NCAA 4JI7F 1IBMF 2X7IA 4CYUA 3K8WA 1U6BA 5KFLA 2EBGA 4WJBA 4LJMA 2AJ2A 4MYTA 4B9NA 2ZBPA 4GRSA 3TA0A 4KBIA 1URNA 2W9BB 3BYPA 4XPEA 4JI1J 2JWNA 2ILZA 4DPUA 1FXRA 5C24A 2J6TA 1N5YA 3V6JA 4UOPA 1S6UA 3FBEA 2XG8A 4ED2A 2VQRA 3DYAB 2KM8B 2APOA 1ZM4A 1LXJA 1XMOF 2NSBA 3BGOP 1ED8A 3R27A 1DJ0A 1HBOB 4M5DB 4DX6A 3F41A 4M5NA 1JLCB 3TEHB 4O4RA 4DL3A 1G3OA 2N82B 2E1PA 1T3NA 3RB3A 5DDQC 2W5WA 2ZHBA 3MD1A 4YHHF 5KT5A 1ZTTA 4L3NA 1NEEA 4JI5F 4K2XA 1RT3B 2DNQA 5KFWA 1AT1B 1RT5A 3MCMA 2O3DA 4C7QA 4HYKA 4NWJA 3BREA 1HWJA 4DFKA 2IBKA 2HFVA 1VQ5S 3AODA 5CCMA 4NL5A 1LFWA 3R97A 1U02A 1TP7A 3ET6B 3E01B 5LXRA 4IUFA 2DJWA 1TFYA 3ZTRA 2KM8C 2VQFF 2P6SA 2KN4A 2M4MA 1GMUA 5KFIA 2X1GA 3C14A 3FBCA 5DLWA 1S57A 4YOEA 3GSIA 2XLKA 3PVXA 5C25B 1XNRJ 2XMTA 1UZDA 3LP1B 2HNYB 4DR2F 3G8QA 1ANIA 3PRBA 1D9AA 1KNZA 3AJ2A 3C6UB 1N5TA 2UZAA 1JK9B 1S1XB 3NBPB 3DDIA 3PKYA 5IWAF 1R3NA 2LA6A 1CJVA 1ED9A 3CUNA 3HCXA 4K4UA 3BN4A 4CO2A 4JV5F 3DGPB 3NAIA 2ZOGA 2LFVA 3MCNA 2MQQA 5KFNA 3JQMA 3GJQB 4OI4A 2DHHA 3IRWP 1GH8A 4LR7A 1VBXA 1P8GA 3NRBA 3ETMA 3I0SA 4F0MA 6FD1A 4JV1A 1YDLA 3PCOB 1F3VA 3K59A 2CZ4A 4OZJA 1RAIB 1H7XA 3W5ZA 4WKRA 2MZRA 2V2KA 3T9ZA 4ZDNA 1AA1B 4LF4J 3M1VA 4UQGA 4X64J 1RYRA 3OT9A 3R6GB 1BQNA 4LIWA 3MD3A 4NLDA 3WQPA 5I4MA 4ZITA 1JLAB 1HNZJ 4DZDA 4K7QA 1UVNA 4ZG7A 1EAYC 5FD1A 3PW0A 1WC3A 2OPSB 1XERA 4KQZA 3OTDA 5KFUA 1NKCA 2Y0BB 4FNIA 1RT4B 4YDXA 4F3OA 4WP9A 1ZAWA 4OX9F 2A6MA 2LDYA 5ETQA 5BR8F 4K0KF 3M8QB 4ED6A 1HHTP 1JIHA 3SCIE 2QA4S 4LRFA 2JNJA 3KLHA 1ELOA 2G2OA 4FXDA 5KTQA 1EQ0A 1X8DA 4YFUA 3RAQA 2Q3PA 2FY8A 4F2RA 4DQRA 4ZCLA 2PIIA 3MWBA 1F3FA 3WIUA 4G1QA 4PQUA 3CDWA 2GAGC 2D7SA 2EC2A 2I38A 3SMZA 3KWMA 3B5QA 1NK5A 3ZZUA 4DL5A 3CCMS 1LEOA 3Q8PB 4E2FB 2PMHA 3KDNA 3US5A 4ECSA 1TKDA 5DLTA 1WWHA 1F5CA 4IDKA 5KFMA 4E8UA 2RS2A 1OPZA 2NCKL 3LWMA 2CDQA 3VGUA 1PBAA 4DFPA 3HX9A 2M3DA 1AUKA 2H5EA 2XLIA 2UV8A 2NZCA 1NUEA 2DPIA 5D0GA 2V8GA 2BYCA 3I6PA 1OO0B 3VQTA 3GTYX 4QWCA 4RUHA 5A0YA 4RW6A 4RNHA 3LOUA 3PIOQ 1ELXA 3KHGA 5HAOA 2W5QA 5L38A 3ENWA 4TLRA 1VOMA 3FMWA 4IR1A 3N5FA 4W92B 2BE2B 4EO6A 2MHNA 1FI4A 1IJEB 3DLKB 1AJCA 5IJSA 1S48A 2DD8S 1VQ9S 2HAFA 1F5BA 3HK2A 2RH6A 2QT7A 3QGPA 1LWXA 2HQFA 1SL0A 2FLLA 3T5LA 3GV5B 2ZE2B 3NKYA 4X66J 4YN3B 3L09A 4ELVA 2CJKA 1V3RA 1Y00A 1X7VA 1HYSB 3AQOA 4CQ1A 1LFPA 4F4YA 3EICA 2NPIA 5HP1B 5DJBA 1OSDA 3VAIA 1N0VC 3UDLA 3IS9B 4G1IA 4DPOA 1XWLA 1Y9OA 4KHPF 2B6AA 1PO6A 3THPA 1NDCA 1CJTA 2RT3A 1R6YA 3TO8A 2V4RA 5A8RA 1QVFR 2XYHB 1U1OA 4IFVB 3NVLA 2CJQA 3R7NB 4CNZA 5CYQB 3MMBB 2QL5B 4D3GA 3C16B 2YVSA 2AGQA 3HFKA 2PI5A 1JLBB 6AT1B 2ZJRQ 5K8NA 2QJ3A 3IM8A 5HROB 3PTWA 2JX2A 3DOMA 4CXSA 1BLUA 3CDUA 1N34F 2JC1A 4DV6J 2YQ1A 4FS1A 3O1LA 1BHNA 3CCWA 3NS7B 4OX6A 2DGTA 3ZC4A 1M1KT 3DOKB 1N36J 2DNKA 2XEXA 4B3SJ 2C2DA 1U48A 1L3KA 2N4CA 2DYAA 1SPBP 1KEKA 1T05B 5G0RA 3N6LA 3BDPA 1H3DA 3OVAA 3IG1A 4MK7A 3CJTA 2DNPA 1M5KC 3B4DA 2ZBRA 1UWBA 5IQ6A 1TKZA 4DPTA 4QR1A 3QRRA 1EW9A 3FSYA 4CIOA 1FKAF 2R4FA 5H9EK 4CXUA 2UXCJ 5J2QA 4O4GA 1T11A 4JP8A 1UVJA 3EZOA 4J9PA 1J5EF 3HT0A 2DR5A 1LXNA 4OI2A 4B9TA 4QW9A 1WHWA 5DDOC 4C0HA 2DNHA 1QTMA 2C3MA 4URQU 1H6KX 2AHOB 4O3OA 4F7VA 2OH2A 3IA0A 5IS2A 4WXOA 4ZK7M 1YWXA 1C1BB 2QG9B 5IT0A 2QFJA 2LEAA 4YB7A 3DRRA 5KFEA 1VIXA 2EVZA 3MURP 1JXVA 1HKAA 1LW2B 1Q78A 1SXLA 4DR1J 4DFMA 5CQGA 4JI2J 2YKPA 3UCUP 2NR0A 3IBWA 2GHVC 4CXKA 3CCQS 1Q7YT 2A2DA 4NLQA 2BANA 2WONA 5B0CA 5M2PA 4N5SA 2CQ2A 2HHSA 5EX0A 4I64A 1U8WA 2ZKTA 3HP6A 3IP0A 1WC5A 2E9TA 1QAXA 2V9WA 3MEGA 4X4PA 2XR9A 2Y8YA 4Z7YA 1CEZA 3CB4A 3ZZPA 1YZ7A 4AUKA 3PACA 2YWGA 1Y7PA 2YTCA 2VPZB 4ED0A 5EGEA 1R8AA 1D0EA 3IR5B 3H40A 1KHLA 1YHQS 4IOCQ 2NXUA 3CD7A 2HHWA 2LU2A 1RISA 4CYUB 2ZM6F 4WPAA 3PIPQ 4Z37A 1OIAA 3BQ2A 2EFPA 2JZ5A 4B9LA 2MZJA 1UMJA 3QO9A 1Q1KA 5LSLA 3K5MA 2CJXB 2MZ1A 5C24B 1F60B 4HH1A 2MDAA 4KTQA 1N5YB 5F3TA 4KE5A 5KFDA 2OELA 4LVNP 2MJNA 2IRUA 4ES2A 2VDHA 1WHXA 1GK8A 2FY1A 5AE2A 2KH9A 4PCQA 2QFIA 3KHLA 5CH7B 4R8UA 4Q45A 3CCLS 2G1HA 1X9WA 5ETVA 3I0RA 4J9MA 2GJIA 3SQGA 2YNHA 2ZOMA 4DV1F 2UXDF 3CXCR 4J90A 4JI3F 4RWXA 2HHVA 4CLWA 1RT5B 4LSLA 2R7SA 1JKHA 2Y1LB 1Q4RA 4CLFA 1RWWB 2ANHA 3MUVP 3C19A 1NSKL 3BGFA 2RF2A 2RQ4A 3I4HX 4UOCA 4QIEA 1VC5A 1DHMA 2C2NA 3WBZA 2HGLA 2RU3A 5A8WA 4FVMA 2KT2A 3KLGA 4IRCA 2RQKA 2GSNA 3H4BA 2X1AA 2L48A 4DQSA 2GVDA 4NX9A 1OYDA 5CYJA 3VV2B 4OX7A 2YNIA 3AXKA 3LGNA 3WAVA 1YK9A 4P2MA 1EJ7L 3C14B 1PKUA 1N2LA 3SFGA 2YKNA 3ONQA 3VVUA 1QSLA 3EZ5A 4J9OA 2YPYA 1R6VA 3LH2S 5KFYA 3GE9A 1H38A 2D69A 4B08A 1Z4UA 3MCSA 3H5YA 2YQ0A 1TFWA 3IO1A 3R5CA 2CQ1A 2M8HA 1LWFA 2DY9A 2UUCJ 2OJ3A 4DWIA 3DU5A 3IAM9 4BWJA 3FZBA 1FDDA 1H2UX 3R6LB 2C3PA 5CD4A 4KO0A 1CJVB 2V8DA 2VICA 3FUYA 2DCUB 4M5IA 1I6JA 2N4DA 5KG7A 2WW8A 1PC5A 4B56A 4LFCF 4OZ5A 4MIAA 4DCPB 2NUUG 2AT1B 2AEFA 4OL8A 3I0SB 4CO0A 5EX3A 1F9FA 1FVQA 4TY9A 2RHQB 3V4IA 1PCAA 3K57A 4KJGA 3J80U 1FJGF 3Q2SC 4ANDA 4ZKAA 4RR5A 4LFAF 2Y9HA 3LTOA 5LM7E 3M1VB 4I2PA 2Z30B 3CCSS 3OL9A 4ECUA 1BQNB 3QSIA 3RR8A 4DI6A 4CLYA 2KTQA 2KL8A 3K2YA 5KOWA 5CZVA 1S1WA 1U26A 4LFBJ 3GG0A 1T94A 4Q8EA 3RBDA 2V50A 2XY6A 1HHQA 5GAGI 4GKJJ 1GX6A 1BXNA 4EFAC 1YBTA 2GAHC 1DFDA 2RRAA 2P9EA 3HVTA 2CFXA 1JJHA 1TL5A 1KQGB 1WG1A 1SC1B 1RT7A 3HVAA 1QUPA 1M5PC 1KQSR 2NS1B 3CD6S 2ZDPA 5E2QA 5IT4A 3KLHB 4CO3A 2LDIA 3HVWA 4DCOB 1SI9A 3NS5A 1WG5A 3PR5B 3HSDA 2M88A 1FXLA 4G1QB 4OMFG 4PQUB 4ZLLA 3UE2A 3CC7S 4OZ3A 2VHGA 3CNQP 4NCGA 4JI4F 2ADBA 4QWBA 3BDEA 4ECVA 4M5GA 3TZWA 4CZCA 3ELHA 1U09A 4ZVPB 2UV8G 4PABA 1VK3A 1M5OC 4IDKB 3TJ9A 1A7GE 1RXOB 1DY3A 4EBDA 2W4PA 2H1YA 1X9MA 3MF5A 4EBCA 4NA1A 3AOAA 1C4AA 2MQNA 1FFWB 3DRXA 1L3VA 1UEVA 5A0YB 2W7OA 4LF9F 4RW6B 2VQEF 2DO0A 1N8RT 1PYOB 2PE8A 4L72B 1JXLA 3MPUB 3HD1A 3A8KA 1MWZA 4XDCA 1O98A 1Q8KA 1Y0HA 2PA8D 3LGMA 3BYRA 2LQ9A 5F9LA 1CJUA 3TA2A 1CC7A 3EVWA 2KXNB 3T41A 3RYLA 4OI6A 3E2DA 8AT1B 1N0UA 1S79A 3AB2B 2VBWA 4LR9A 2HIYA 2V8VA 4FYYB 3M6VA 4KHMA 2DXFA 3QYYA 1RCXB 2W2QP 2ZD1A 4OYWA 1N5VA 3BGLA 4OQJA 5IXUA 3GB0A 1MROA 2B6AB 1CJTB 4CM2A 3H8YA 4FN5A 1KR4A 3CDBA 1UKUA 5A8RB 1QD1A 3R5AA 4FKXA 2VC0A 5GMKa 1YTYA 2B9YA 3GFYA 4DX7A 1RWPB 3BKUA 3J7Z5 1AFJA 1FVSA 3GU0A 3LXQA 2HNZA 1YI2S 3CD5A 1WF1A 4P6QA 5KFQA 3FDSA 1O5JA 2XMAA 4M5MA 1X5SA 2ZBIA 3W1YC 1K8AT 4HR2A 1RAJA 1TL7A 4N56A 1SL2A 3TX0A 2OD4A 3GFXA 1RUSA 2IY5B 1EARA 1RU2A 3KHHA 1CC8A 5KFCA 2RU9A 4ALZA 5L1KA 3HHEA 3C46A 1TK0A 3TZZA 4USMA 3B82A 3G82A 3D0IE 4K2JA 3RB4A 2FC9A 1VCTA 2A3JA 2Q1LA 1JJ4A 1ZEDA 1VJWA 2V2QA 3WIVA 5G0RB 2V63A 4GVLA 2E9ZA 3IG1B 4H4KA 3LWLA 5EGHA 4QIWD 2MYFA 1UWBB 4J9QA 3RTVA 2CPHA 2MLXA 5KG0A 1SJQA 2HPUA 4I6AA 5J2PA 4X4QA 1TKZB 4O0IA 1KH4A 4ZGAA 3Q89A 2DR9A 4C8NA 3LQVA 4HDHA 4NXNJ 2WRMA 4O23A 5J2QB 1RU1A 1K0VA 4O4GB 2CWXA 3BJYA 2XGPA 1YQHA 3MAHA 4C0BA 2KFYA 2WHOA 2AMCB 4HKQA 2OTJS 3M7VA 1E1ZP 3MGJA 3CMRA 2GFFA 3THVA 4LF8J 3KJQB 2POKA 2DGUA 4TU7A 2BOAA 2Z57B 2R2RA 3DRRB 1K47A 4PWUA 4OYIA 2XRGA 4KSEB 1KFSA 1UPPA 1FRHA 3OD2A 1D9FA 2MGZA 3RAXA 3W64A 4WP8A 1A0OB 1DTTA 1O8BA 2RSQA 1IKXA 4QPTA 3UCZP 2BANB 1WOSA 4UTGA 2P8IA 2WONB 2R42A 1VJQA 1RKIA 4KGZB 3RU0A 2ZH5A 3R2DJ 2W25A 2RDJA 2L9NA 2HKEA 2H4WB 4OZ0A 3MEGB 1R0AA 3VGSA 1N6QA 5GOVA 4CLZA 4LBHA 4LF2A 4MIWA 3D54A 4KJDA 3CO0P 5MLCV 1U1MA 3EUNA 3NOGA 3BQ1A 4G3IA 2W24A 3D5MA 2HHTA 1QVGR 4RZRA 1XTZA 3A3OB 4RW9A 2FLNA 3CCUS 4Q43A 2QTWA 1S59A 4QZVB 4CLUA 2BKPA 3DLHA 4B3RJ 1NDPA 1HHSA 4FVCA 3J7YI 1U0HA 3QO9B 2AJ1A 5ADZA 1WDTA 4B3OA 2Z8QA 2RRBA 2G0IA 2CPEA 1U6FA 5HSPA 2YH0A 3TQ1A 2HVZA 2CNKB 1FEHA 4ILRA 3TJAA 3SV3A 1B99A 2QN6B 3MEKA 4N8NA
chains in the Genus database with same CATH topology
4MIVA 5L0BA 5EGHA 3MK0A 3A52A 3BDGA 3B5QA 4LREA 2QZUA 3WAVA 1E3CP 5L0KA 1ELYA 4YR1A 1ZEFA 1N2LA 4UORA 1EQJA 3UO0A 1EW8A 1URAA 3DPCA 1KH4A 4LRDA 4CXKA 4ZGAA 1N2KA 1URBA 3SZYA 3TWZA 5DLTA 2X98A 1ALJA 5GRRA 4MHXA 5K4PA 3NKPA 5LQQA 1KHJA 1SHQA 4UOOA 3OT9A 1ALIA 3BDFA 1KHKA 5GOVA 1ALKA 1HJKA 4GTZA 2ZKTA 5DLWA 4LRCA 1KHNA 4UOPA 5LRMA 1AJBA 2IUCB 1Y7AA 5LIAA 3LXQA 3UN2A 1AUKA 2VQRA 1EW9A 3WAXA 4KJDA 3MK2A 3M8WA 2W5SA 5DLVA 4LRAA 1SHNA 2W5VA 4KAVA 2GLQA 1FSUA 4ZG7A 4CXUA 1ED8A 3WAWA 3NVLA 3Q3QA 1Y6VA 5KXAA 2XR9A 1ZEBA 5C66A 4GTXA 1O99A 4UPHA 1E2SP 2IUCA 3M7VA 3T00A 4MY4A 3ED4A 1ALHA 1KH9A 1EJJA 2GSOA 3KD8A 3MK1A 1E1ZP 4NWXA 1KH7A 2W8SA 4CYRA 3UNYA 2IFYA 4ZG6A 3IDDA 4GTYA 3T01A 3WAYA 1EI6A 5LRNA 1ANIA 5AJ9A 2W5TA 3CMRA 2D1GA 1KH5A 3NKQA 4LR8A 1B8JA 4KAYA 4LR2A 1ELXA 1ANJA 5EGEA 3TX0A 4LRBA 1AJAA 1O98A 2W5QA 2W5WA 4UPIA 4N7TA 1KHLA 3IGZB 2ANHA 4FDJA 2W5RA 3SZZA 4FDIA 3IGYB 4B56A 4GTWA 5HRTA 5TJ3A 1ED9A 4UPKA 3WBHA 3NKOA 4CXSA 4UPLA 1K7HA 4KM4A 4LRFA 3NKMA 3E2DA 1P49A 4ZG9A 1AJDA 2XRGA 3NKNA 5L0EA 3UN5A 3T02A 2GSUA 3DYCA 4NWJA 1AJCA 3M8YA 4LR9A 5IJSA 4CYSA 1HDHA 3M8ZA 3BDGB 3UN3A 3NKRA 1E33P 1ZEDA 2G9YA 1ELZA 2GSNA 4QAXA 5INHA 1HQAA 2GA3A 2RH6A 4TN0A 4LQYA 4KJGA 3TG0A 3BDHA 4LR7A 5IJQA 1EW2A 2W5XA 2W8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MIV A;  5L0B A;  5EGH A;  3MK0 A;  3A52 A;  3BDG A;  3B5Q A;  4LRE A;  2QZU A;  3WAV A;  1E3C P;  5L0K A;  1ELY A;  4YR1 A;  1ZEF A;  1N2L A;  4UOR A;  1EQJ A;  3UO0 A;  1EW8 A;  1URA A;  3DPC A;  1KH4 A;  4LRD A;  4CXK A;  4ZGA A;  1N2K A;  1URB A;  3SZY A;  3TWZ A;  5DLT A;  2X98 A;  1ALJ A;  5GRR A;  4MHX A;  5K4P A;  3NKP A;  5LQQ A;  1KHJ A;  1SHQ A;  4UOO A;  3OT9 A;  1ALI A;  3BDF A;  1KHK A;  5GOV A;  1ALK A;  1HJK A;  4GTZ A;  2ZKT A;  5DLW A;  4LRC A;  1KHN A;  4UOP A;  5LRM A;  1AJB A;  2IUC B;  1Y7A A;  5LIA A;  3LXQ A;  3UN2 A;  1AUK A;  2VQR A;  1EW9 A;  3WAX A;  4KJD A;  3MK2 A;  3M8W A;  2W5S A;  5DLV A;  4LRA A;  1SHN A;  2W5V A;  4KAV A;  2GLQ A;  1FSU A;  4ZG7 A;  4CXU A;  1ED8 A;  3WAW A;  3NVL A;  3Q3Q A;  1Y6V A;  5KXA A;  2XR9 A;  1ZEB A;  5C66 A;  4GTX A;  1O99 A;  4UPH A;  1E2S P;  2IUC A;  3M7V A;  3T00 A;  4MY4 A;  3ED4 A;  1ALH A;  1KH9 A;  1EJJ A;  2GSO A;  3KD8 A;  3MK1 A;  1E1Z P;  4NWX A;  1KH7 A;  2W8S A;  4CYR A;  3UNY A;  2IFY A;  4ZG6 A;  3IDD A;  4GTY A;  3T01 A;  3WAY A;  1EI6 A;  5LRN A;  1ANI A;  5AJ9 A;  2W5T A;  3CMR A;  2D1G A;  1KH5 A;  3NKQ A;  4LR8 A;  1B8J A;  4KAY A;  4LR2 A;  1ELX A;  1ANJ A;  5EGE A;  3TX0 A;  4LRB A;  1AJA A;  1O98 A;  2W5Q A;  2W5W A;  4UPI A;  4N7T A;  1KHL A;  3IGZ B;  2ANH A;  4FDJ A;  2W5R A;  3SZZ A;  4FDI A;  3IGY B;  4B56 A;  4GTW A;  5HRT A;  5TJ3 A;  1ED9 A;  4UPK A;  3WBH A;  3NKO A;  4CXS A;  4UPL A;  1K7H A;  4KM4 A;  4LRF A;  3NKM A;  3E2D A;  1P49 A;  4ZG9 A;  1AJD A;  2XRG A;  3NKN A;  5L0E A;  3UN5 A;  3T02 A;  2GSU A;  3DYC A;  4NWJ A;  1AJC A;  3M8Y A;  4LR9 A;  5IJS A;  4CYS A;  1HDH A;  3M8Z A;  3BDG B;  3UN3 A;  3NKR A;  1E33 P;  1ZED A;  2G9Y A;  1ELZ A;  2GSN A;  4QAX A;  5INH A;  1HQA A;  2GA3 A;  2RH6 A;  4TN0 A;  4LQY A;  4KJG A;  3TG0 A;  3BDH A;  4LR7 A;  5IJQ A;  1EW2 A;  2W5X A;  2W8D A; 
#chains in the Genus database with same CATH topology
 3SI8 A;  6FDR A;  1E3C P;  2GHP A;  1C1C A;  1YZ6 A;  3BKF A;  2CVI A;  4U67 Q;  2ZJQ Q;  1IVZ A;  1U24 A;  2ZBC A;  4YY3 F;  2BVZ A;  4UZB A;  4R8U B;  2FD2 A;  1NSA A;  1R7I A;  2OFH X;  3I0R B;  4EK2 A;  1CUL A;  3SQG B;  1HNW J;  2YNH B;  2EFQ A;  2F1F A;  5EUH A;  5LL6 d;  3FMB A;  3HSG A;  2JLF A;  3TJ8 A;  1T9T A;  2V34 A;  4HDG A;  4O3R A;  5JMN A;  5DDR C;  4DR3 J;  2MB0 B;  1NBE B;  4LSL B;  1XR6 A;  3NGR A;  2H54 B;  2OD6 A;  1JKH B;  2DHA A;  4EZ9 A;  1RT1 A;  1XBW A;  3O5T B;  2RF2 B;  5HMX A;  3D6F B;  2FDN A;  2FGO A;  1U47 A;  4DFJ A;  5A8W B;  1ZET A;  3B6B A;  3X3U A;  3KLG B;  4KC5 A;  2OO4 A;  4ZCK A;  1QTN B;  2GVD B;  2B0G A;  4WFN Q;  1DAX A;  4NLP A;  2YNI B;  3VCD A;  4RUB A;  4I4B A;  4TN0 A;  4F0K A;  4BCA A;  1HA1 A;  3PX4 A;  2XZT B;  2QLW A;  2YKN B;  4F4Z A;  3QAT A;  1WKK A;  3DKD A;  1U1L A;  2DBB A;  2C3O A;  4R25 A;  4F36 A;  1R8P A;  3FBF A;  4A8O A;  3H0P A;  2ZVS A;  3ITH A;  1RTD A;  4LT6 A;  3R1H A;  1REV A;  4M95 A;  1LWF B;  4X65 J;  4ZMM A;  3VAF A;  3Q24 A;  4KO0 B;  5L9N A;  2DNL A;  5KFV A;  1R89 A;  3MM5 A;  3OL6 A;  4IH7 A;  2LEB A;  4GKK J;  5ETR A;  4DSI A;  3M9M B;  2HVD A;  3IXQ A;  2M5Y A;  2GS8 A;  2D9P A;  2IM2 A;  5GVQ A;  1V9O A;  3CCJ S;  2MQP A;  3TZX A;  4B3M J;  3V4I B;  1AFI A;  2XS7 A;  2CJA A;  3MOJ B;  4C98 A;  4YB6 A;  5JXS A;  3ENA A;  5F8G A;  2K06 A;  2OTL S;  3M6W A;  1TK5 A;  1Q53 A;  4QAX A;  2WBR A;  3T1H J;  2OPQ A;  4I2P B;  4F2S A;  1Y3J A;  2B4P A;  4ZVR B;  1FRM A;  1S6O A;  1WHV A;  1FDA A;  2AEJ A;  3ENV A;  4NEZ A;  4DR6 J;  3VF0 B;  1FEE A;  4OZL A;  4IOA Q;  1S77 D;  1S1W B;  3KLF A;  1O0P A;  3GPA A;  4X4N A;  1NAQ A;  2VPW B;  2AW0 A;  4Y00 A;  3PR4 A;  1K9M T;  4USJ C;  2XLJ A;  3BM7 A;  3S8S A;  4FXV A;  2Z58 B;  3HVT B;  2JEG A;  4TYA A;  4XAK A;  5D4L A;  1B7Y B;  4PWD A;  3QFW A;  2HFZ A;  4BWM A;  1RT7 B;  1SJR A;  3NNA A;  4OI1 A;  2BRL A;  2GMJ A;  3HHK A;  2IM3 A;  1DLO A;  2WW4 A;  2HWT A;  4R0E A;  2KJW A;  1TAQ A;  2HVI A;  1C4C A;  1IQT A;  2XO7 A;  5HRT A;  1LW0 A;  1TL3 A;  2GMH A;  4NCG B;  3W2V A;  1NND A;  2ZC4 A;  3IWN C;  3QAU A;  1RAF B;  4NEY A;  4U8Y A;  2ZH4 A;  4MTP A;  3FEY B;  2EPI A;  1JLQ A;  2L3M A;  3HJF A;  3RB0 A;  3R8Y A;  1KVK A;  3NWR A;  2M52 A;  5LMN J;  3AFG A;  5L39 A;  1WEX A;  1S12 A;  3C15 A;  1LOU A;  1IBL F;  1SBR A;  1ZA1 B;  2B9W A;  4Q0B A;  4WII A;  3EX7 B;  2XZW A;  3SZY A;  1U4B A;  2OFG X;  2YNG A;  4KH0 B;  4USU A;  1KTV A;  5ETO A;  2AEM A;  2W7P A;  3UVJ A;  3PO5 A;  1MMN A;  3JB9 k;  2YWW A;  3V4M A;  3OFE A;  1CJU B;  4BBY A;  4DQQ A;  1D09 B;  3P45 B;  2DO4 A;  4YR0 A;  1X4C A;  2QA4 G;  1A6L A;  4FP9 A;  5KOX A;  3GFZ A;  2DNZ A;  3HKZ D;  4F02 A;  3C2P A;  3CD0 A;  1ZZF A;  2PDA A;  2ZD1 B;  4RBV A;  3NKN A;  4WYL A;  3QGI A;  5G4D A;  1KTQ A;  2B7C B;  2QA2 A;  2VFV A;  2K7K A;  3G71 S;  1SC3 B;  1MRO B;  1CPZ A;  2WK4 A;  2GHW A;  3NMR A;  1T9Y A;  4DV3 J;  1GMW D;  2QZU A;  3QZ8 A;  4OJG A;  2AF6 A;  4ZOS A;  3WZ0 A;  1KS2 A;  4J9S A;  1URB A;  4F4A A;  2HNZ B;  3JTO A;  4QPX A;  5HMZ A;  2ALY B;  1KKH A;  2DRB A;  2YNF A;  2OKQ A;  4O44 A;  5D3G A;  1Q79 A;  5DLV A;  1APS A;  1TL7 B;  2CPX A;  3I9V 9;  2ZZT A;  4DV4 F;  2R7Q A;  4Y0F A;  2FZK B;  3MCO A;  3G82 B;  2RB7 A;  1P9Y A;  2P9C A;  4LRB A;  3SYZ A;  5J1E A;  5A2Q U;  4K4Y A;  1U45 A;  4AFF A;  2UP1 A;  4LQ3 A;  3HFZ B;  2A1B A;  3NKO A;  4KM4 A;  2OHD A;  4TLQ A;  3IGV A;  2GQC A;  1Q8L A;  2BAC A;  1LQ9 A;  4PXD A;  2HZV A;  3EJM A;  1RP5 A;  3GP9 A;  2YQ3 A;  5J2P B;  3DHX A;  1VQM S;  2AJF E;  3BPS P;  5IJQ A;  2L9D A;  5ETP A;  2ZUG A;  4PR6 A;  3RW6 A;  1JQG A;  2D74 B;  3I32 A;  5GAG U;  4OYO A;  4CO1 A;  1BD6 A;  1URA A;  1RK8 A;  1M5H A;  1TZ0 A;  2XWX A;  1FKO A;  2XM3 A;  4JYA J;  4AYB D;  2MTL A;  1V3S A;  5K20 B;  1HW9 A;  4NLX A;  3WHI A;  1ALK A;  3UDE A;  2LQ8 A;  4PAA A;  4C8O A;  3BSA A;  4CO5 A;  4ED7 A;  2ZH6 A;  2GLQ A;  3OBI A;  4UST A;  3HSJ A;  4ZCM A;  4QIF A;  1VQY A;  4GTY A;  3T5K A;  4YR3 A;  4DL4 A;  1X4A A;  2CJ9 A;  2CNL B;  4H4K C;  2ZH1 A;  5T41 A;  5HLF A;  4BC9 A;  3PX0 A;  3ILI A;  1V5I B;  1NHK L;  2MGZ B;  3EZU A;  1LWC A;  4AQY F;  1DTT B;  2EBE A;  3KTQ A;  2GSU A;  2VG7 A;  1IKX B;  2RUG A;  2BAB A;  4DX8 H;  2BJ7 A;  1G4C A;  1IJF B;  3KUG A;  5ETN A;  3GSD A;  3IRX A;  3KK1 B;  2GQQ A;  1X4F A;  3RG6 A;  4N76 A;  4RUA A;  1R0A B;  2BOP A;  1N6Q B;  1ELY A;  5I3U A;  3BB5 A;  3G86 A;  4DU8 A;  2AJ0 A;  2E44 A;  3U02 A;  4QU6 A;  1VGY A;  3CT9 A;  1UW9 A;  2ADC A;  3L9Z A;  1ZYQ A;  4N47 A;  4B9U A;  2LYV A;  2W5V A;  4RW9 B;  3ICL A;  1AYE A;  1S9E A;  1VK8 A;  4K4S A;  2J76 E;  2HFO A;  2B9E A;  4ECX A;  5K9F A;  2GJF A;  2R8G A;  1O51 A;  2HK2 A;  1IBK F;  3IR7 B;  2FLO A;  4JI7 J;  1IBM J;  1U0H B;  2DNG A;  5L1I A;  4N7T A;  2ZDO A;  3EPG A;  4URG A;  4A47 A;  4ZPV R;  1N32 F;  4B3O B;  1TKT A;  2M70 A;  2UU9 F;  3N4W A;  1KHW A;  3PHT A;  4DUZ F;  1K73 T;  1HDH A;  2D3Z A;  2FUG 9;  1KWM A;  2KFZ A;  1SCJ B;  1C1C B;  3NLC A;  8RUC A;  4IYQ A;  2HK3 A;  3E3X A;  1UWA A;  3GWC A;  1CUL B;  1XMO J;  2WBM A;  4HEA 9;  1F9H A;  1FNX H;  3MEE A;  2BRK A;  3ZZO A;  1RHR B;  2YWH A;  1ALJ A;  2Q6C A;  3DLE A;  4UOO A;  4L3K A;  2DR8 A;  2DIS A;  5D6G A;  3HHD A;  3MOZ A;  1RT1 B;  3DXS X;  4LF5 F;  4DV6 F;  2IAJ A;  4YHH J;  3PJW A;  2VOD A;  5LT5 A;  1UW4 A;  3PYE A;  1CS4 A;  2K3K A;  3RR7 A;  3VGV A;  4JI5 J;  4JUZ A;  2W2O P;  3R7S B;  3ZZT A;  2WSC C;  3MR5 A;  1QLN A;  2LP4 A;  4WK1 A;  3PDN A;  2D1G A;  2SXL A;  4KAY A;  1GAO A;  3GV8 B;  3B8H A;  3HJV A;  1RTJ A;  4ZPT R;  5H9F J;  4ECQ A;  4WU3 A;  3H5S A;  2BX6 A;  4ZJL A;  1RWX B;  3Q8U A;  3K0J A;  1H2V Z;  3W9I A;  2VQF J;  3T6B A;  3QIP A;  4DOZ A;  4LF1 A;  5GME A;  3CC2 S;  4DLE A;  3W8G A;  3CIM A;  5E3P A;  4PWW A;  4IFY A;  3GYX B;  1HQU A;  2W8D A;  4RKU C;  4CNY A;  2KZM A;  3BH7 B;  3GG1 A;  4LRE A;  2DK2 A;  3ITH B;  4ES1 A;  2HFS A;  1RTD B;  4ZLJ A;  4K4V A;  1REV B;  2YKM A;  3KUH A;  5C42 A;  2CJY B;  1NJX A;  4K5R A;  5L8R C;  1PIE A;  4HHU A;  1VIS A;  2I0X A;  3AH6 A;  4PYD A;  2OSR A;  2IA6 A;  2LLZ A;  4A8K A;  4YP3 A;  3MM5 B;  5EHH A;  3JAM Y;  1VLY A;  3KG1 A;  2PD1 A;  4DSE A;  2UUB F;  5IWA J;  3TEG A;  3K5P A;  1NXI A;  4C3K A;  1R8C A;  3AD9 C;  3WC2 A;  5F3Z A;  1KH9 A;  3M8P A;  3HKW A;  4JV5 J;  2XSJ A;  2VPX B;  2W8S A;  4NAS A;  1KHV A;  1RCO B;  4JI2 F;  4A8Y A;  3TI0 A;  1R0B G;  2OPQ B;  1HPZ A;  4ATN A;  3VWS A;  5E3R A;  4W4M A;  3LAN A;  3R2C J;  2UUA F;  2E5L F;  3M8Z A;  5E33 A;  2YKA A;  1B64 A;  1Q7L B;  3LF0 A;  2J0Q D;  2AIR B;  3KLF B;  3VZH A;  4YEA A;  1U1K A;  3CMQ A;  2F7V A;  3KHR A;  3KLE A;  3OXF A;  2IDE A;  3Q23 A;  4YS2 A;  1EW8 A;  2FVC A;  3DCA A;  4PWD B;  3OJU A;  1ZOT A;  1LKZ A;  3FCW A;  2AU0 A;  1VI7 A;  3CJ2 A;  2JVO A;  2Z4P A;  3J81 U;  4NXM F;  3B4M A;  2M9K A;  3AD7 C;  3R1L A;  1DLO B;  4KPC A;  1FTC A;  4NA3 A;  4M5K A;  4OX9 J;  1HBU A;  5F8N A;  3MTJ A;  1DBD A;  2FHM A;  4GTX A;  2YKQ A;  3MR2 A;  2ZIT A;  1ALH A;  4CO4 A;  2J8S A;  1LW0 B;  2CNO B;  1TL3 B;  4NZ7 A;  3W2V B;  1SIW B;  3CJ8 A;  2EKY A;  1UJ5 A;  5JUM A;  1JLQ B;  5A76 A;  1EX8 A;  4UPL A;  4B9S A;  1REG X;  2I5J A;  3T1Y F;  1GTH A;  4H4M A;  2KYZ A;  4EMD A;  4DS4 A;  2FB0 A;  1GMW A;  3C15 B;  2XWY A;  3P5T L;  1VQP S;  3LGH A;  5KG4 A;  3MHY A;  4Q0B B;  4Y2C A;  1QAY A;  3W60 A;  3SFU A;  3TUI C;  1YBA A;  4WFZ A;  2IVF B;  2VA2 A;  4I2Q A;  2VB6 A;  2RVJ A;  3TAP A;  2GO9 A;  2F4V F;  3A8J A;  3ILJ A;  4XK8 C;  2C2K B;  3UWT A;  5HVF A;  3W62 A;  3OTC A;  3GIK A;  1LWE A;  4MKB A;  1RTZ A;  3UVJ B;  3E8O A;  2J5A A;  1KHN A;  5GAD I;  1WHY A;  5LRM A;  5LIA A;  4ZVE A;  3ETO A;  3W3S A;  3JXO A;  3HHL D;  4UF4 A;  2GVZ A;  2HS4 A;  2M0G B;  1WC0 A;  5F8H A;  4GC7 A;  1QM9 A;  4WZM A;  1UA0 A;  5SUH A;  4EYH B;  5U47 A;  2E5G A;  3M8S A;  1EZZ B;  3OLA A;  1KDN A;  1VRT A;  2X51 A;  3GIR A;  1X31 C;  1FDN A;  1T03 A;  2X1F A;  2G2Y A;  2HWH A;  4UZC A;  5K5M A;  2KVQ E;  4CRJ A;  5D4N A;  1VR6 A;  3OFG A;  5D0R A;  2FJA B;  4F67 A;  4KHP J;  1SIZ A;  4JI6 J;  3BF4 A;  1WC6 A;  3A1Y G;  2RJZ A;  2UUC F;  3D6T B;  2C1E B;  2HHP A;  4XIU A;  2F8E X;  3OUY A;  2YNF B;  1DQ8 A;  1XJW B;  4BDP A;  2G0J A;  3P96 A;  4O44 B;  5AXL A;  5D3G B;  4JV2 A;  3PW7 A;  1N5S A;  3UW1 A;  2LQB A;  3BDF A;  1GXT A;  9RUB A;  3CE8 A;  1PG5 B;  5B0D A;  4KGM A;  2HIQ A;  2XNR A;  1VC6 A;  2XMU A;  1SHN A;  1EIY B;  3H7H B;  3MUM P;  1QSS A;  3K17 A;  2A18 A;  1M5S A;  2KRB A;  3S01 A;  1N34 J;  3TQE A;  1DZ5 A;  5J1E B;  5H9E J;  2WCX A;  2VV5 A;  2PN6 A;  2FJX A;  2PA3 A;  3FNN A;  3DLL Q;  3NGS A;  3HUL A;  3W5X A;  2YBV A;  2B4U A;  1OS5 A;  3KJN B;  1GT8 A;  4CT9 A;  3I5C A;  2BV3 A;  4FYW B;  2W7A A;  5HI7 A;  3H2L A;  1FJE B;  2RKI A;  3TVK A;  5B0G A;  2O01 C;  1XN9 A;  2OML A;  2E1A A;  4W90 B;  3ISZ A;  2Q6B A;  2Z0G A;  1FDB A;  3D0G E;  3U7J A;  5KFK A;  1FKO B;  3AHP A;  4DSL A;  5FDL A;  1NSP A;  1HW8 A;  1GFW B;  1OQ3 A;  5H1S V;  1W2B R;  1J5O A;  2MKS A;  3I5A A;  1S76 D;  3HFV A;  4NMX A;  4DSJ A;  1J5E J;  4NYZ A;  5K8O A;  1XEZ A;  3WAX A;  2GIQ A;  2G9O A;  2H9Z A;  2QLJ B;  1BY9 A;  1O99 A;  2QE5 A;  3HD2 A;  2EEY A;  2H65 B;  5J1N A;  5HLF B;  2JJ4 D;  4ECZ A;  3KD8 A;  4QCL A;  4IO1 A;  5B0F A;  5AJ9 A;  4M5J A;  2L41 A;  2OMO A;  3AXM A;  1LWC B;  2VG7 B;  4ENO A;  4NRT A;  1RWM B;  3D7S B;  3TP2 A;  5FLX Y;  1J2V A;  3T3F A;  5F41 A;  3EWG A;  2E5H A;  3DLJ A;  2HBR B;  5L0E A;  2B7B B;  2MLY A;  3QQC D;  2MKY A;  3IRX B;  3EGW B;  1UA1 A;  3GLJ A;  4I69 A;  3CWJ A;  1HQA A;  3LA0 A;  5I3U B;  1ZBT A;  2B4O A;  1MNE A;  1YKW A;  2ACM A;  2XNQ A;  3EDQ B;  2ZH2 A;  3BR9 A;  2PC6 A;  2E7X A;  1TL4 A;  5D8H B;  4DV7 F;  3UD3 P;  3UDV A;  2LCW A;  3CVK A;  4DUT A;  2NUH A;  3L3C A;  1RZM A;  2JC0 A;  5A6P A;  1S9E B;  2QMU B;  2LXF A;  5IT9 U;  1AJB A;  1X5O A;  3TAQ A;  4DR4 F;  1P6T A;  3KG0 A;  5D77 A;  4RW7 A;  2FVP A;  2ZM6 J;  2O5D A;  4CYR A;  1TKT B;  3KJF B;  2M2B A;  5KG6 A;  4DR5 F;  5IM0 A;  4A8X A;  3DLG A;  3PFE A;  3BSC A;  2O66 A;  2A10 A;  3N01 A;  2AV5 A;  4TXS A;  4PXE A;  1IKV A;  4FF2 A;  1EQM A;  3W61 A;  4V1A k;  2HG4 A;  2LEP A;  1HMV A;  3IGN A;  1NB2 A;  4F25 A;  3MEE B;  3SCK E;  5BYQ A;  4L75 A;  1RTH A;  4OV6 A;  5E5N A;  1C0T A;  3DLE B;  3H2V E;  3M4X A;  2Y1R I;  2QSW A;  1JJC B;  3OJS A;  1RAA B;  3KLV A;  1X9S A;  2GGP A;  4N8O A;  3VTI A;  4TYB A;  4DV1 J;  1Q5V A;  2UXD J;  5IV4 A;  1PC4 A;  2IAJ B;  4JI3 J;  1CS4 B;  3W9H A;  4O0N A;  4S0M A;  1MW7 A;  1T9W A;  5H9F K;  4LQ9 A;  2WAQ D;  1IN0 A;  2BE7 D;  1A9N B;  1N33 F;  1RAG B;  4DCJ B;  2ZZN A;  4J5O A;  1FFG B;  2H5J B;  1TV6 A;  3UQS A;  3OHA A;  4OHZ A;  2ZEJ A;  3M2V A;  9ATC B;  1E2S P;  1RTJ B;  2DRA A;  1F2G A;  2BW7 A;  1RBA A;  1E6Y A;  4F4K A;  2KB2 A;  4RLE A;  2R9L A;  4RO0 A;  1BE4 A;  5KT2 A;  2ASY A;  3CJR A;  4RUC A;  3QIP B;  2RQM A;  5AXM A;  4EU0 A;  4DV5 J;  1TVR A;  2HHH F;  4OI3 A;  5B09 A;  4H4O A;  4IFY B;  3K89 A;  1HQU B;  3RRH A;  2VIH A;  2RD5 C;  4DHV A;  3THT A;  4WFX A;  2YKM B;  5C42 B;  1WEL A;  3GII A;  5C7P A;  4DN9 A;  3I4P A;  5A8K A;  1S9F A;  1AUD A;  1OJ4 A;  2IM1 A;  4Y6I A;  1UFW A;  5KFB A;  3NY0 A;  4WTY A;  3I82 A;  3JTP A;  5DG9 A;  4DQI A;  1HJK A;  2Z2Z A;  3IWL A;  5C5J A;  3PJ9 A;  2BM1 A;  2FVS A;  4RPF A;  1RB0 A;  3GCX P;  3M8P B;  4A8M P;  2XSJ B;  5IV3 A;  2RS8 A;  5E7O B;  3GR0 A;  4LFC J;  1HNX F;  2OP5 A;  3Q3Q A;  1Y6V A;  2P9G A;  1WSR A;  2XC9 A;  3W66 A;  4CI0 B;  2UXB F;  4PUO A;  1HD0 A;  1HPZ B;  3V6K A;  5LXY A;  3DMJ A;  1NLK L;  2LQJ A;  3ZTS A;  1FWK A;  1FJG J;  3VAK A;  5I3Q A;  3H59 A;  2JOQ A;  4LFA J;  2HRT A;  1TR0 A;  2Y1I A;  4DV2 F;  4OI0 A;  4B9V A;  3T02 A;  2IA0 A;  4WP3 A;  1RSC A;  1ROF A;  3KLE B;  1IM4 A;  4PG4 A;  1C2P A;  1UEU A;  2GA3 A;  2VH7 A;  4ECY A;  3BDH A;  2EK6 A;  4LUB A;  1S1U A;  3B78 A;  4ANC A;  3FGV A;  4DV0 J;  4MIV A;  1S0N A;  2XMM A;  4KAI A;  2DB1 A;  4UOH A;  3JYT A;  5J2N A;  4MT1 A;  1Y5I B;  1KHJ A;  1HBU B;  1JXE A;  2D9O A;  4B3R F;  1T0T V;  5DS7 A;  1RKJ A;  3HHL A;  1SL1 A;  4KJI A;  1Y10 A;  1B70 B;  5A6W A;  2BQR A;  2MY8 A;  3V6D A;  1YLX A;  2I1R A;  4I7F A;  4HT5 A;  3SCJ E;  5T7L A;  3J7A 1;  2DT9 A;  3GCW P;  1HI0 P;  3HDS A;  2I5J B;  4UPI A;  4H4M B;  3BO3 A;  3PW5 A;  3CPW R;  4JI0 J;  3VAG A;  3NKM A;  3RBX A;  3VAM A;  1L5U A;  2J0X A;  4RBT A;  2MJU A;  1VRQ C;  2HZC A;  4I2Q B;  1YJT A;  3KMQ A;  3NGU A;  2IVY A;  4RNM A;  1ARO P;  2XB2 D;  2K3I A;  3D28 A;  4ZP9 A;  2GA7 A;  2EFN A;  4J9L A;  4V19 X;  2J7U A;  2NXN A;  4U7C A;  2WSE C;  4PYA A;  3WX4 A;  1IKW A;  4O3S A;  1LWE B;  1VBK A;  5D4O A;  4LF9 J;  2VQE J;  1H2T Z;  4F50 A;  4RBU A;  2IVM A;  1NZA A;  4LF7 F;  4NRU A;  1X5T A;  1B3T A;  4TU9 A;  3PYF A;  2GIF A;  4QR0 A;  2GVZ B;  1WF2 A;  2BZ2 A;  4LF6 F;  1D3W A;  5HQ8 A;  3MK2 A;  1B7F A;  3RGI A;  4ZA1 A;  1VRT B;  1M90 T;  4QW8 A;  2DIV A;  4ZPD A;  2QEX S;  1T03 B;  4OLP A;  1T95 A;  5LOQ A;  2W2M P;  1RAE B;  1HBN A;  1VQN S;  4MIB A;  2JEF A;  1KN6 A;  4DU7 A;  2HBY B;  3RW7 A;  2DNR A;  1U1N A;  2NYH A;  2GCF A;  3N5B A;  4M63 A;  2R7V A;  3PW4 A;  1RT6 A;  1TUV A;  2MY7 A;  4CLT A;  1VRU A;  2HND A;  4WKY A;  2HBZ B;  4X65 F;  4ERD A;  3U1N A;  3R3T A;  3MR7 A;  3OLB A;  1JJ2 R;  3T5J A;  5B08 A;  2B8Q A;  5C2C A;  4I6W A;  3OUY B;  4DDF A;  1SKS A;  3NNH A;  3MI7 X;  3SIP B;  4RW4 A;  3CCE S;  3IR6 B;  4ZVT B;  1X4H A;  4U7U K;  4UOF A;  4N77 A;  5B7W A;  4R0J A;  1N52 B;  1DAR A;  4EYI B;  2VFU A;  4K4X A;  7FDR A;  2AYE A;  5FII A;  4Q7A A;  5GRR A;  2DY1 A;  4KR0 B;  4DG1 A;  1SC4 B;  2GO8 A;  1EB0 A;  2B5J A;  2V94 A;  4RU2 A;  3KK3 A;  1OY9 A;  4J9V A;  4A8F A;  4QQB A;  4F26 A;  4M5H A;  1CVJ A;  3Q8Y A;  4KRW A;  1I94 F;  2CQD A;  3FEX B;  2FTR A;  2H51 B;  2VL1 A;  4DL2 A;  3KG4 A;  4U96 A;  2CPF A;  3PW2 A;  5K8P A;  4OHW A;  1HLW A;  4D3H A;  1ZZN A;  2RKI B;  4OYX A;  1RT2 A;  1S6P A;  2V0N A;  4DL6 A;  3NG8 A;  3OXG A;  3CUL A;  4C2M A;  3M32 A;  1WAC A;  5FDL B;  1RAO A;  1RGV A;  4DR7 F;  3AB4 B;  2DHG A;  2QRR A;  2E1M C;  3BR8 A;  2VF3 A;  1J5O B;  1PBU A;  5KT7 A;  4J91 A;  3PKM A;  2Q79 A;  1K0T A;  5DDP C;  4YDD B;  3ZTO A;  3QWP A;  3KFW X;  1NPP A;  2K7J A;  5ETT A;  5GAH I;  4WF9 Q;  2F40 A;  5KG2 A;  4ZVU B;  1R0C B;  2CQG A;  2QC3 A;  4NOH A;  3QWU A;  2GNK A;  2OSQ A;  5F8J A;  4Q5V A;  3WAW A;  2C3Y A;  5E0O A;  2RUS A;  1FRJ A;  3N9U C;  1Q81 T;  3TX8 A;  1M1G A;  1PAE X;  3JSY A;  3JSB A;  1WF0 A;  1WJ9 A;  2Y3Y A;  2F9D A;  4CM0 A;  4PPD A;  3MPW A;  1NHV A;  3OTO J;  4GVB A;  2XBP A;  4USI A;  2HRY A;  1RHK B;  5CD4 H;  4X62 F;  2ZH8 A;  4GO5 X;  4ZLN A;  1MWY A;  1PJ6 A;  3N6N A;  3BBC A;  3V5R A;  3TG0 A;  3QJJ A;  1X60 A;  3PXG a;  3TYT A;  5GAD U;  1S0V A;  4BC7 A;  3A52 A;  2R8H A;  1NDK A;  4F04 B;  1GMV A;  3LP0 A;  1NPR A;  3TA1 A;  3Q8R B;  2CJB A;  3FCH A;  3VGT A;  1TTH B;  1FO1 A;  1KP6 A;  3R7B B;  1QUV A;  2ZHA A;  1UPM B;  4RW7 B;  4JOU A;  4ZP6 A;  3MXH P;  2ASJ A;  8ATC B;  1WKL A;  5IZH A;  5IM0 B;  1BQM A;  4OIX A;  3OQ2 A;  1FNM A;  3DLG B;  4Y2M A;  4X4O A;  4M8L A;  1M5V C;  3A3N B;  3ZZ0 A;  1IKV B;  1SV5 A;  3SZZ A;  2EKN A;  1G1X A;  1HMV B;  4UPK A;  1K7H A;  2NYI A;  4PEO A;  1GQE A;  5KFH A;  5CZX A;  4MFB A;  3FSI A;  1R43 A;  2XYG B;  1RTH B;  2GML A;  1TU0 B;  1C0T B;  4YY3 J;  4PPZ A;  3M9N B;  2R7T A;  3OVS A;  4X4V A;  2GGP B;  1E6V A;  1CQM A;  1NK0 A;  1EW2 A;  2ASL A;  2QYG A;  2KHC A;  3BDG A;  2IRY A;  1UVK A;  5JVH Q;  2DGX A;  2KHD A;  3HXM A;  5E3Q A;  1IXK A;  2HLU A;  2OAU A;  2EW9 A;  3G6Y A;  1H98 A;  1TV6 B;  3CO9 A;  2RIJ A;  4GTZ A;  3M2V B;  3V6H A;  1KOH A;  3NNC A;  2F3J A;  5AE1 A;  4ILM A;  1GXU A;  1E6Y B;  3DU6 A;  1FSU A;  2C3U A;  2VDI A;  2PSZ A;  4PG5 A;  2DEJ A;  3K8V A;  1QDU B;  2P5V A;  2HUR A;  1NH7 A;  3WAY A;  2E29 A;  4IR9 A;  2GIR A;  4UQT A;  1TVR B;  4CTA A;  4UY8 T;  3X1L B;  3A4T A;  4H4O B;  1FJ7 A;  2YKO A;  3EXY A;  3ILL A;  1XMB A;  3K5L A;  2RRN A;  4I0W A;  3MED B;  3KNA A;  4P2X A;  4A46 A;  2J6S A;  2ZHO A;  1RAD B;  2QZ8 A;  3BV8 A;  5A8K B;  3PHE A;  4KY3 A;  2D3U A;  4B3T F;  3M6U A;  2BJ8 A;  3S7R A;  4A8S A;  3ZTQ A;  2EWH A;  2HS3 A;  3HZG A;  1MSW D;  3MM9 A;  3DXB A;  3R5J B;  3PG9 A;  5IC4 B;  3GJS B;  1UET A;  1G6B A;  3T9N A;  2KZZ A;  3CW2 C;  4U8V A;  4XPC A;  4TY8 A;  5ETK A;  1HBM A;  3QJP A;  5B0A A;  2R7X A;  2NXJ A;  2ABY A;  3D66 A;  1F6T A;  2KRR A;  2MMY A;  3OSP A;  2WOM A;  2R7W A;  3G87 A;  4PUO B;  5HN0 A;  1KD1 T;  2MKI A;  3DMJ B;  4QYZ J;  3VAH A;  2P2C B;  3HF5 A;  4ZN1 A;  2NQP A;  3BSO A;  1TMM A;  1Q82 T;  1PJ5 A;  2A2C A;  1S9G A;  3ADA C;  4FDI A;  3D3B J;  1VIO A;  1VLO A;  4X2B A;  4HI2 A;  5HQM A;  1Y4Z B;  2L08 A;  1S1U B;  4L74 A;  1MN9 A;  2LKZ A;  2XS2 A;  4ZPW R;  1EHW A;  2VJV A;  3KUE A;  4OYM A;  1KVI A;  3CCV S;  2EFG A;  5B0B A;  4ETZ A;  3ZZY A;  3JYT B;  2IJN A;  5J2N B;  2G1D A;  3IM9 A;  1NK6 A;  5L1L A;  1SJF A;  5HO4 A;  2IJF A;  1NJI T;  1FX2 A;  3W5Y A;  3EPI A;  3HHL B;  2VJU A;  2BDP A;  3V6D B;  5A2Q Y;  2UVV A;  1S0M A;  4DUY F;  1AW0 A;  4WWS A;  2BKN A;  4ED8 A;  4I7F B;  5T7L B;  2PMW A;  3QSY B;  4KT0 C;  2DNO A;  2R2U A;  3A8E A;  1N5Q A;  3TZY A;  1S6Q A;  1X0P A;  3CCZ A;  5E3C A;  3KMS A;  5LRN A;  2CQ4 A;  3FJ2 A;  3G6E S;  3D1O A;  2VFT A;  1ZPW X;  1IKY A;  5HQL A;  2BJ9 A;  1R31 A;  3CJ3 A;  4EUV A;  1SVD A;  1IBL J;  5HAN A;  5M2R A;  1T9V A;  1HNV A;  1Z2Z A;  1Q16 B;  1IKW B;  4USH A;  3HHL C;  5GAE I;  2LEC A;  3R5G A;  4A8Q A;  4NCB A;  1ZH5 A;  2GZO A;  2QLB B;  4MHX A;  2JSX A;  1L3S A;  1SHQ A;  4ED5 A;  2HQI A;  1I51 B;  3TUJ C;  1RAH B;  4L76 A;  2FJV A;  4LRA A;  4A8W A;  3OV7 A;  2CPD A;  3SV4 A;  4NZ6 A;  1HBN B;  4OYP A;  3LUY A;  4ANE A;  2RNE A;  2YX7 A;  2AX0 A;  3O8W A;  4LR2 A;  3KNG A;  4LMZ A;  1RT6 B;  1AJA A;  2JHE A;  3NMA A;  1VRU B;  2HND B;  5DRK A;  1ZM9 A;  1HR0 F;  3G6V A;  4OHY A;  2FHK A;  3CIZ A;  4Z2X A;  5KT3 A;  4DLG A;  2D1C A;  3MM6 A;  5ETL A;  4USW A;  4RW4 B;  2MSS A;  1JX4 A;  4M94 A;  1JNZ B;  2EFV A;  2W5X A;  4JI8 F;  3QT8 A;  5LSR A;  1FE4 A;  3RUB L;  3MK0 A;  2ASD A;  4DG1 B;  3KK2 A;  3LAK A;  2R3V A;  4QWD A;  2B5J B;  2ERR A;  1KSP A;  3FQK A;  4PQA A;  3GIJ A;  3KK3 B;  4FF1 A;  1D8Y A;  4DV4 J;  2J9D A;  4QJV A;  1I3O B;  1NRK A;  5BYS A;  1M0S A;  3CJS A;  1NHU A;  4CH0 S;  4QR2 A;  3ULH A;  1F9E B;  2FLP A;  3OVB A;  2HFU A;  2HSE B;  5HMY A;  2VC1 A;  1YJ9 S;  1RT2 B;  1S6P B;  2DR6 A;  4DPX A;  2Z2M A;  5HVG A;  3CJ0 A;  4C9D A;  3FRZ A;  2PO4 A;  2VBY A;  1FWL A;  2OLW A;  4MYU A;  4KB7 A;  2CQP A;  5DLF A;  2HQ3 A;  2CQ0 A;  3M32 B;  1Y11 A;  2FJE B;  1S7H A;  3CDE A;  2O67 A;  2DPJ A;  3M2R A;  1Y5N B;  3L7P A;  3E51 A;  1ZPV A;  3VZI A;  4EZ6 A;  3M30 A;  4EO8 A;  2V4Q A;  3TAN A;  2R7U A;  1WEY A;  5KG1 A;  3KK1 A;  1AUS L;  5BXI A;  3DDN A;  3A13 A;  3FK4 A;  2HRU A;  4NE9 C;  4ZJO A;  2E66 A;  2PT0 A;  4CP5 A;  4I56 A;  1JB0 C;  5F8I A;  4DSK A;  4NYO A;  4IH6 A;  1HWL A;  4Q8F A;  1JWW A;  1L3U A;  2FHO B;  2CYY A;  4OFZ A;  2YXL A;  3ZO7 A;  4RNN A;  1TKX A;  2O1P A;  3P4U B;  3H4D A;  3MM8 A;  4AL6 A;  2DTJ A;  3M9O B;  1FA0 A;  1KBR A;  4K4W A;  2RH3 A;  2XUL A;  4B9M A;  1YIT S;  1FHT A;  4AQY J;  2PEH A;  2F5G A;  2N3L A;  4CH1 A;  5DZ7 A;  3EMT A;  1U1P A;  4GVB B;  5AJ3 F;  2MEW A;  3DI6 A;  1MMD A;  3OR2 A;  5KG3 A;  1X5P A;  4MKY A;  3QJL A;  4PZV A;  5E3A A;  3OTE A;  3ZTP A;  3W9J A;  4CLL A;  4CYS A;  1YJ7 A;  1DQ9 A;  2DEI A;  2BR0 A;  3R9L A;  3D6M B;  4FBT A;  3LP2 A;  2AYG A;  3D9B A;  3LP0 B;  4ELU A;  4FF4 A;  1HI8 A;  1CLF A;  4DF4 A;  2LXI A;  1VS3 A;  1VC0 A;  3UD5 A;  3JAM U;  2PMZ D;  2CQ3 A;  1SJ4 P;  3PEJ A;  2YWK A;  5KFF A;  2RHS B;  5HJX A;  5ETS A;  5LMU F;  2JFK A;  2HYI B;  2CIM A;  3KJV A;  1R8B A;  1YG0 A;  3HZE A;  4OJ3 A;  1IBK J;  1BQM B;  5FJ4 A;  1XQI A;  3I96 A;  3JQK A;  3LAL A;  3UNG C;  4P10 A;  1CSJ A;  1N32 J;  3GON A;  2E7V A;  2UU9 J;  1XMQ F;  2B51 A;  4FPI A;  3T00 A;  1SV5 B;  4JI6 F;  3TR5 A;  5KFR A;  4DUZ J;  4K4T A;  2DGV A;  2VA3 A;  4NML A;  2X3D A;  2BBE A;  3L7U A;  4ICL A;  4MFB B;  1V3Z A;  2W8L A;  3OW2 R;  4F8R A;  3MAQ A;  5CAB A;  3IGY B;  4KV8 A;  1HQ2 A;  2V2Z A;  3I87 A;  5K14 A;  3ZZR A;  1E6V B;  2BE9 B;  3J81 Y;  3BDG B;  1ZAV A;  2XMJ A;  4F4W A;  4MKA A;  4LBI A;  1OY6 A;  4H54 A;  4CLP A;  1FRL A;  4OYA A;  1KC8 T;  2MKC A;  1SKU B;  4LF5 J;  2D3O R;  4IOB A;  3P5B P;  5KFJ A;  2XY5 A;  3UDC A;  2AGO A;  3PY8 A;  2YWE A;  3BEG B;  4ZVG A;  4ED4 A;  4ED1 A;  3DRY A;  1IWG A;  2HHU A;  2KDO A;  5F8M A;  5DQH A;  2UVW A;  4CTA B;  4UUW A;  4FYV B;  1M1H A;  4P71 A;  5J1P A;  3GYN A;  4LSN A;  3U1L A;  2GSO A;  4KHR A;  2H48 B;  2BEF A;  3D3C J;  1KH5 A;  1YJV A;  3C8Y A;  2ZH3 A;  5F0U A;  4ZVQ B;  2CPI A;  2BQ3 A;  4C3M A;  1P49 A;  4J9N A;  1QSY A;  1S10 A;  4FS2 A;  2AGP A;  1FES A;  5GAH U;  3MM9 B;  4MMO A;  5T14 A;  2ROE A;  3RAM A;  1HNI A;  4NLG A;  1HL6 A;  4TY8 B;  1HBM B;  3D0H E;  4M5L A;  4U9R A;  4K5S A;  1S97 A;  5IC6 B;  3DC2 A;  4QYZ K;  5L0K A;  2UUB J;  4IG0 A;  4MKV A;  1FX4 A;  3LPE A;  2JVR A;  3BS9 A;  2D3O 1;  4IKA A;  1S1T A;  5DO2 A;  3MZI A;  2NXE A;  2WOM B;  2DH7 A;  3OFF A;  1N48 A;  1O6X A;  2ZNZ A;  2F63 A;  3AT1 B;  2IM0 A;  3BBF A;  4LRC A;  4DPW A;  2FQQ B;  1NKE A;  4NLO A;  3FZ2 A;  4TNO A;  1Q5Y A;  2B56 A;  3OL8 A;  5KT4 A;  4JI1 F;  2JDJ A;  1S9G B;  3GJT B;  2ROP A;  1QY7 A;  3B54 A;  4ZP8 A;  2UUA J;  3MMJ A;  2AQ4 A;  2ACY A;  2E5L J;  4LR8 A;  4IH5 A;  1IBC B;  3NEK A;  2R7R A;  4C8K A;  2AX1 A;  3MMA A;  1UCN A;  3OR1 A;  2HEK A;  2XHW A;  1AXQ A;  1S4E A;  2V69 A;  3PEH A;  1UVM A;  2YWF A;  1IUJ A;  5KFZ A;  2K8G A;  2VG5 A;  3BSN A;  1GX5 A;  4CWB A;  3FC9 A;  3QT5 A;  1TQL A;  3Q8Q B;  2VOP A;  2RAQ A;  1KOO A;  4NXM J;  1BWV A;  5IQQ A;  2WSF C;  2ATC B;  2KXH A;  3W7B A;  3AD8 C;  2EC0 A;  5LJ3 Y;  3D6H B;  4KIA A;  1JNR B;  4WE1 A;  4FYD A;  4OX8 A;  2CG8 A;  4ZHR A;  3K7R A;  1FD8 A;  1Q8B A;  1S6Q B;  5HJY A;  2L9W A;  2CDR B;  2W5S A;  3SSQ A;  3H90 A;  2R8K A;  4Y2I A;  4DX5 A;  2CPY A;  3TUZ C;  4ECT A;  1RA6 A;  1U25 A;  1UJ4 A;  3T1Y J;  4F4X A;  5D0E A;  3MM7 A;  1XR7 A;  4PG6 A;  3MK1 A;  1IKY B;  1HWK A;  4PG7 A;  4ZG6 A;  2XCA A;  3MPD A;  1JLF A;  1FKP A;  3NCP A;  4OLO A;  3E2E A;  3NKQ A;  4P73 A;  3CF5 Q;  1OSC A;  3NGD A;  1W25 A;  1P9Q C;  2J9E A;  1HNV B;  4OYZ A;  1Y3K A;  3MPV A;  1ACM B;  2ZUA A;  5JVG Q;  1XNR F;  2PEB A;  4ID5 A;  3U1M A;  3OL7 A;  3M05 A;  2XI3 A;  2F4V J;  4P2F A;  5EWG A;  5F9N A;  2CQI A;  3SBM A;  3DGV A;  4RU9 A;  3BZQ A;  4NLY A;  3OPK A;  2OPR A;  3BQ0 A;  4Y2K A;  3SEO A;  4NLT A;  1OYE A;  2R8J A;  1T9X A;  5I3P A;  1S1V A;  3RRK A;  1RWO B;  2A6O A;  3ZNU A;  2BMB A;  2J9C A;  2QL9 B;  3TWZ A;  1P1L A;  1EP4 A;  4JBC A;  2W8K A;  2V67 A;  1YRT A;  2E5J A;  4RNO A;  4DV5 F;  3G2X A;  4P52 A;  2LQ5 A;  2XMK A;  1VQ8 S;  1BWE A;  4IRD A;  3CCT A;  3QZ7 A;  4AE5 A;  4ZJQ A;  3D68 A;  5FLX U;  2W9C A;  4EEY A;  1UVL A;  3RBE A;  4LF4 F;  2CPJ A;  5DG8 A;  3BGR A;  4X64 F;  4OV1 A;  2HHX A;  3WX8 A;  3OHB A;  2OGU A;  3MM6 B;  4YQW A;  2XGQ A;  1HNZ F;  2V8P A;  2WVE A;  3NGK A;  4K8R A;  1VQS A;  3HT3 A;  1FE0 A;  2J7K A;  1X4E A;  1Q8I A;  3PM9 A;  4FKY A;  1JLG A;  2HFN A;  3POT A;  3G8S A;  1RAC B;  5IT9 Y;  3MFI A;  3UN3 A;  1KLM A;  3NGT A;  3RBZ A;  5CAA A;  3KK2 B;  5INH A;  4QOT A;  3W63 A;  4OZ1 A;  1NKB A;  3H20 A;  1QAI A;  5CYM A;  5L0B A;  3UCG A;  1F2H A;  2HBQ B;  1FTR A;  3CJ4 A;  1T02 A;  1UFL A;  2VFR A;  2IJR A;  2E1C A;  2MKK A;  3UO0 A;  2WZ1 A;  4I1T A;  1T8E A;  3NS6 A;  4B17 A;  2W4C A;  5LSO A;  1CBK A;  3P3D A;  1NK4 A;  1ZAX A;  4X4T A;  2MKH A;  2UUT A;  4ID8 A;  4ZPA A;  3NOC A;  2N3O A;  1SQG A;  4DMZ A;  4URS A;  3A3P B;  3G4S S;  1U8S A;  2G0C A;  1BGX T;  2YH1 A;  3Q22 A;  2EG2 A;  4MAK A;  1W7W A;  2GC8 A;  4DV0 F;  2IDL A;  2KI2 A;  5EWF A;  2CA9 A;  4UOG A;  3DOL A;  3M2R B;  1WI6 A;  4YB1 P;  1NDL A;  1KVJ A;  1NME B;  2G13 A;  3M30 B;  4L6V 3;  3UR3 C;  5D4P A;  2IIH A;  3NCR A;  4AXJ A;  1YSJ A;  1MLA A;  3CGI A;  1N88 A;  5DM6 Q;  4AD6 A;  2V5H G;  1WTF A;  2C22 A;  1WDD A;  3JS9 A;  2W9A A;  3AA9 A;  3DFE A;  1XNQ J;  2XS5 A;  4O3P A;  4ZP7 A;  4C8M A;  1K44 A;  1V5V A;  3ISN D;  1JMT A;  1TKX B;  1VBZ A;  2N7C A;  1RI7 A;  1V6H A;  3MM8 B;  4Y3C A;  3L95 X;  5F0W A;  4KGV B;  2XCP A;  1FF2 A;  4JI0 F;  2H5I B;  4QIG A;  4X66 F;  4KYZ A;  3KKF A;  4UW2 A;  2AJQ A;  2FVR A;  4P74 A;  4E0D A;  3F0N A;  1AZS A;  1TL1 A;  1YX2 A;  1KQF B;  1Q86 T;  3DI6 B;  2RDI A;  3HHN B;  3OR2 B;  4Q2L A;  3H25 A;  3QPI A;  1WOO A;  1UJ6 A;  5DLG A;  4NWX A;  3EYZ A;  4FXW A;  4TN2 A;  5KFX A;  2HGM A;  3MTK A;  3CDA A;  5BJR A;  2OEJ A;  5GAE U;  2HS0 A;  1ITP A;  2QL7 B;  3J81 j;  3PZP A;  1NU4 A;  3W65 A;  5TJ3 A;  2AYB A;  2MLZ A;  3LP2 B;  3CMA S;  4CCH A;  2DH9 A;  2HGN A;  2W01 A;  4DV7 J;  4QU7 A;  2B9X A;  3O3L A;  3CJ5 A;  2KFN A;  1EKR A;  4HTJ A;  4HHJ A;  5CHC B;  3KJV B;  1FRK A;  4NLV A;  4DR4 J;  2BA9 A;  1N54 B;  3HM9 A;  2JRS A;  3HSZ A;  1N2K A;  4ELT A;  1N36 F;  4A48 A;  4B3S F;  2FGC A;  1WC4 A;  3TNV A;  4DJB A;  4TU8 A;  4DR5 J;  3NP5 A;  3NL0 A;  3T6J A;  5KFG A;  3J7A N;  2Z56 B;  2RDD A;  3ILO A;  1Z2L A;  1EET A;  1HWU A;  3I5B A;  2COL A;  1UZH A;  4ICL B;  4ILL A;  3ED4 A;  1EJJ A;  4KV8 B;  1WI8 A;  2BKO A;  4QIV A;  5K14 B;  3QMQ A;  1L3T A;  3QGH A;  3PNI A;  2FZC B;  2AZ3 A;  2UXC F;  4NI2 A;  3NAH A;  3QBC A;  3PRV A;  3WDO A;  4WXW A;  3MPY A;  3GV7 B;  4OJH A;  3DOM B;  1D8Z A;  5L1J A;  1HQE A;  1D9D A;  4R5P A;  5EDW A;  3NXZ A;  3HI9 A;  1ULR A;  4DR2 J;  4ZPB A;  2RML A;  1WUU A;  1N33 J;  2VOO A;  4E98 A;  3JSM A;  1BMQ B;  2Y8W A;  1RE1 B;  2DHS A;  2CZ9 A;  2C42 A;  1URR A;  2Z2L A;  1XIQ A;  1ALI A;  1BUX A;  4DR1 F;  5J2M A;  4FBU A;  1S7I A;  4WU2 A;  4LSN B;  2XTJ P;  1WTB A;  3FRY A;  4IO9 Q;  1RHQ B;  4K59 A;  4CLK A;  5DET A;  3N28 A;  2VD3 A;  1UP1 A;  3DLB A;  1UTA A;  2MZQ A;  2IHR 1;  2HHH J;  1U7L A;  3D4J A;  3IDD A;  1ZM3 A;  3T1A A;  3N6M A;  2CQH A;  2LU1 A;  2NXC A;  3K5N A;  3DRS A;  2AWZ A;  4DN0 A;  1FRX A;  2HQC A;  1G7C B;  1HNI B;  1UAW A;  3JTN A;  2XHC A;  1N56 A;  3UI3 A;  1VBY A;  4TQS A;  5DQI A;  3PV8 A;  5C2G A;  3UFC X;  4IG0 B;  3DM2 A;  4DXL A;  1RWK B;  2JEJ A;  5EN1 A;  1S1T B;  3FQL A;  4C0O C;  2WVD A;  2A0F B;  3EVM A;  2XMV A;  2AP6 A;  3ZNJ 1;  4OZN A;  3BKT A;  3PO4 A;  1HNX J;  4LRD A;  1J27 A;  5BR8 J;  4K0K J;  1I5O B;  4EWT A;  5K4P A;  2VZ9 A;  3J7Y U;  3QT7 A;  2UXB J;  4AT1 B;  1WSV A;  3OTO F;  3LAM A;  2LA4 A;  2OPP A;  3V2U C;  3Q0A A;  2W2N P;  3UN2 A;  2ZC3 A;  3G6X A;  4RNF A;  3M8R A;  2FPH X;  1QE1 A;  2BJ1 A;  3I9Z A;  3QT6 A;  2CQC A;  2J0W A;  2MQ8 A;  4DV2 J;  2CG4 A;  2IUC A;  4RW8 A;  3MMA B;  3OR1 B;  1FFS B;  4NA2 A;  5HBM A;  3MMC A;  2VG5 B;  5HMW A;  2GX8 A;  1X4B A;  5IFM A;  1YRX A;  1T7P A;  4GO7 X;  1YBU A;  4HHH A;  1HIY A;  5HK4 A;  3G8T A;  2CUY A;  3FEZ A;  2QSF A;  3HMJ G;  4KFB A;  4CDI A;  2MKJ A;  4RWW A;  2MST A;  1IR1 A;  4WCE Q;  3L4B C;  2BJD A;  1SH0 A;  3TW0 A;  3EGV A;  4WE1 B;  1YJW S;  1NH8 A;  4ZHR B;  2I9S A;  3M2U A;  3CJQ A;  2U2F A;  1YGY A;  3FCV A;  4J9R A;  4QYR A;  2DGQ A;  4P9S A;  3F56 A;  2I6W A;  5KT6 A;  3MM7 B;  2CQB A;  3OFH A;  3H5X A;  3IC1 A;  4NWB A;  1JLF B;  5HAT A;  1FKP B;  1H7W A;  1B0P A;  3RB6 A;  1XK8 A;  2MZT A;  1NSQ A;  3KYL A;  2FVQ A;  3H42 A;  1VQ6 S;  2IMO A;  3SQO P;  4ID5 B;  3QLH A;  2ZH9 A;  2LVW A;  1ANJ A;  2IRX A;  3IN5 A;  1Q0N A;  2DCL A;  4HL9 A;  2WB1 D;  4I67 A;  1C0U A;  2AJ4 A;  3TOQ A;  4DS5 A;  2OEK A;  1S0O A;  2CKW A;  3SDE A;  2ZNY A;  2OPR B;  4J9K A;  2DNM A;  2AYM A;  2R2S A;  4ZIV A;  4LF7 J;  4B02 A;  1LV5 A;  1T3O A;  2ZH7 A;  1NK7 A;  1S1V B;  1H72 C;  1NB7 A;  2ZFH A;  1FK9 A;  5IOL A;  2F8M A;  3I55 S;  1NK9 A;  1EP4 B;  4LF6 J;  3RRG A;  3G96 A;  2E9R X;  2GQ2 A;  4Y34 A;  2QMW A;  4A4J A;  2VG6 A;  1VFJ A;  3VR1 A;  1HFE L;  3DRP A;  3IBC B;  2BJ3 A;  1SJ3 P;  5DZ6 A;  1PYT A;  2W9C B;  4G1P A;  3QID A;  3W2W A;  1U0S A;  3BGR B;  3P8B B;  1U1Q A;  3AOC A;  4C8L A;  3JSR A;  5KXA A;  1FD2 A;  3K58 A;  2VBZ A;  1RQ0 A;  2KJV A;  1WOR A;  1VYA A;  4PRF A;  3BO2 A;  4LFB F;  2V9K A;  1JLG B;  2IYG A;  3POT B;  4ES3 A;  4OHV A;  4GKJ F;  3MDF A;  4KGX B;  2HZA A;  1GEH A;  1KLM B;  2MZS A;  4DBQ A;  2RIL A;  2NSC A;  5CYM B;  2XY7 A;  1B4S A;  4C3L A;  3AOB A;  2U1A A;  4L73 A;  2VAS A;  2EI5 A;  2LXU A;  3H2U B;  2OUG A;  4YME A;  2HAI A;  4HAC A;  4ZVO B;  2BUN A;  2VKZ G;  2QA1 A;  1I94 J;  3FVY A;  4EGL A;  1HD1 A;  1NO8 A;  4FZV A;  1RBO B;  2IC3 A;  3WC0 A;  3Q83 A;  1GTE A;  5DGB A;  3BN7 A;  3O44 A;  1AB8 A;  1BC6 A;  2V4J A;  2QYC A;  2J0S D;  3GIM A;  2FYX A;  1OQ6 A;  1ZTW A;  3Q8V A;  3SZ2 A;  4W98 A;  3DOL B;  3IMQ J;  5C66 A;  2KG1 A;  4UPH A;  5D78 A;  3MEC A;  5CXT A;  1NK8 A;  5AE3 A;  2HVE A;  1B8J A;  1VDH A;  4DR7 J;  3D2W A;  2MQM A;  2JFD A;  7FD1 A;  2KT5 A;  5KFO A;  4NPO A;  1WC1 A;  3GMG A;  3F73 A;  4PG8 A;  4JV0 A;  2DKO B;  4NLS A;  2F9J A;  5L9X A;  1W26 A;  1VHF A;  3SSS A;  4IG3 A;  4BS2 A;  3NKR A;  3EE3 A;  4C4W A;  2ZBQ A;  2MHE A;  3C6T A;  4G6V B;  3O2I A;  5DG7 A;  1ZM2 A;  2D41 A;  5F8L A;  4QBU A;  5ETM A;  3EGZ A;  4GMK A;  1JLE A;  2M7S A;  4RX6 A;  1SKW A;  3PX6 A;  5D0H A;  5DQG A;  3J80 Y;  1HAR A;  1AZS B;  2F8H A;  1TL1 B;  1S5Z A;  3EM1 A;  3SSR A;  3J7Z T;  4Y65 A;  2HMI A;  3CJK A;  2CXE A;  3R5B A;  1RA7 A;  3H5U A;  3LW5 C;  2E1R A;  2HW3 A;  3LPY A;  3QGG A;  4WFA Q;  2YX1 A;  4X62 J;  4KH1 B;  3QRQ A;  2FHJ D;  4G65 A;  1XC9 A;  1U49 A;  4MK8 A;  2B4V A;  1DTQ A;  3IGZ B;  5CCL A;  2B3T B;  2E7W A;  2ZWP A;  2IBO A;  2RE1 A;  4KGK A;  1P27 B;  1KON A;  3M8Y A;  2HQD A;  3OTB A;  4OJ1 A;  3KLI A;  2MQO A;  1E33 P;  2KU7 A;  1ELZ A;  1SH2 A;  1NCL A;  4AL7 A;  1RHU B;  3FKB A;  1CG2 A;  4DPY A;  3OSN A;  1X4D A;  4J7C A;  3ENQ A;  1VQ4 S;  3OXL A;  4NLR A;  4FDF A;  3MUT P;  4HT7 A;  5I42 A;  1ICE B;  3V81 A;  1ZEF A;  4XDD A;  5L46 A;  2NPF A;  1H73 A;  4NZ0 A;  1NJZ A;  2WVC A;  3H98 A;  1SUQ A;  1KHK A;  1EET B;  2R8I A;  2WVF A;  5THW A;  2FIU A;  3BPD A;  3T19 A;  1U2R A;  4U6P A;  2K1R A;  3ZFV A;  4N41 A;  2FC8 A;  3IFE A;  4HVZ A;  2IYI A;  3TAR A;  1K1Q A;  4MY4 A;  2I2Y A;  4NXN F;  3GQC A;  3PFO A;  4NI2 B;  4OHX A;  3BBB A;  1BQX A;  1FNO A;  3FFI A;  3MED A;  2Q66 A;  4KPY A;  2PI4 A;  3VAL A;  3HPO A;  1SKR A;  3HO1 A;  1HQE B;  3MR6 A;  4BLG A;  4R5P B;  1FXD A;  1DQA A;  2JLG A;  1S4F A;  2DHX A;  4O3N A;  3AJD A;  5LJ5 Y;  4LF8 F;  1B0V A;  2G9Y A;  4USK A;  4C11 A;  1IWA A;  1NPK A;  2UVR A;  3HVR A;  1TEL A;  4ZS6 A;  3JSM B;  1CJK A;  1PSD A;  2KVI A;  3A8I A;  1U2C A;  1UFK A;  3M6X A;  5KG5 A;  2B43 A;  4WTO B;  2OEM A;  4TVA B;  4YR1 A;  2ZKU A;  5J2M B;  4O3Q A;  2DXD A;  1Q95 G;  3S6E A;  2J7W A;  4DSF A;  1Y5L B;  2ZJP Q;  5JJB A;  3PYG A;  1H74 A;  2H4Y B;  1NZ8 A;  4ZCI A;  3DRS B;  1TK8 A;  3QNW B;  3BO4 A;  2CWK A;  1RYS A;  4FF3 A;  3FSX A;  4UY8 5;  3MFH A;  2KKH A;  4B3T J;  1MU2 A;  1RWV B;  1T9U A;  2ZZM A;  2NLW A;  1F1B B;  1RTI A;  1NJY A;  3DM2 B;  1SB6 A;  4UT4 A;  2DGS A;  1FWP A;  1AJD A;  1MG7 A;  3DHW C;  3DYC A;  4ETX A;  3MR3 A;  2J6U A;  1UEK A;  4IRK A;  4CT8 A;  3IBF B;  2XI2 A;  2FJW A;  4KKO A;  2IMW P;  3MAA A;  4ED3 A;  4ITS A;  1CQN A;  3TAM A;  3BH6 B;  3U27 A;  4PXC A;  2BJE A;  1U6Z A;  2OPP B;  4LSZ B;  4M1K A;  4P7T A;  3UR0 A;  1GNK A;  3NKP A;  5BYR A;  5E41 A;  1LK7 A;  2QV6 A;  1QE1 B;  3PJX A;  2W9B A;  2PGC A;  3W8P A;  2F65 A;  2IUC B;  2HQG A;  2JEI A;  4RW8 B;  4JI4 J;  1RWN B;  1VQK S;  2YPZ A;  5HBM B;  2QLF B;  2ZOF A;  1QAJ A;  1MN7 A;  3MMC B;  4U7U D;  3VHQ A;  2DVI A;  3DYA A;  2X1B A;  1KH7 A;  4ECW A;  3UNY A;  2JLE A;  1HNW F;  1EI6 A;  2W5T A;  1WNE A;  4AXI A;  2DH8 A;  5KFA A;  1PAU B;  1G2E A;  4ZIW A;  2CNN B;  1HBO A;  4M5D A;  4I68 A;  1RJJ A;  2DGO A;  1B0T A;  2DNY A;  4DR3 F;  3QFH A;  4C8Z A;  1JLC A;  2LMI A;  4XO0 A;  4Y28 C;  2P6T A;  4KFB B;  4ZG9 A;  3UN5 A;  2C2E A;  3TRG A;  1RT3 A;  3KDO A;  4LQY A;  2MPU A;  5B0E A;  3QAE A;  1YJR A;  4DUY J;  4ECR A;  1GXL A;  3M2U B;  5AT1 B;  1UVI A;  2HVH A;  1WG4 A;  4MK9 A;  3TVZ A;  3ET6 A;  3E01 A;  5KAK A;  3A12 A;  2ZVI A;  2EXU A;  4IQM A;  1S72 S;  2JH3 A;  5AXN A;  4F3M A;  2V2V A;  4I6Y A;  4K4Z A;  4CH7 A;  2CAD A;  4MJK A;  4UUX A;  2V6A A;  2XO6 A;  3N0V A;  2ZWO A;  3QLH B;  4ZN3 A;  3RJM B;  3GJR B;  2DXE A;  2Z2Y B;  1C0U B;  4XTT A;  5CA5 A;  1KFD A;  5EGY A;  3Q8S B;  1FT8 A;  3SXL A;  1YVF A;  5C25 A;  2QX0 A;  1S49 A;  1SJ1 A;  3SDE B;  3LP1 A;  1IQZ A;  2HNY A;  3LO3 A;  2C2R A;  4FYX B;  4GTW A;  3WBH A;  4GKK F;  1OPI A;  5M2U A;  3C6U A;  4Y2A A;  2QIF A;  4TQR A;  4J37 A;  1F0X A;  1S1X A;  3NBP A;  4WFY A;  4C6A A;  2XZD B;  4AL5 A;  2KT3 A;  1XR5 A;  1FK9 B;  2GJ2 A;  1OMS A;  5AXK A;  3DDK A;  4MH8 A;  2KO1 A;  1WKJ A;  3DGP A;  4B3M F;  3P49 B;  5ITH A;  1FRI A;  2FZG B;  2B8P A;  2VG6 B;  3DRP B;  1PYS B;  2VFS A;  3I56 S;  4Z7C A;  1IM6 A;  5HL7 Q;  1EQJ A;  2MXY A;  3D1Q A;  4P75 A;  5DGA A;  1RBL A;  3D1H A;  3W2W B;  3T1H F;  5KFP A;  4WFB Q;  3FBB A;  4OYB A;  3S1T A;  1NJW A;  3IWX A;  3TUP A;  4NLW A;  4DR6 F;  1Y7A A;  3M8W A;  2VKR A;  2OIH A;  4KAV A;  1S99 A;  1HR0 J;  2VU5 A;  4F3Q A;  4DL7 A;  5KFS A;  2FJD B;  3G9C A;  1JLA A;  1SQE A;  3BGU A;  4Q2M A;  3GIL A;  1FJC A;  3DNC A;  5DM7 Q;  2VPY B;  2OPS A;  2BXJ A;  2Y0S D;  4JI8 J;  3HLU A;  4FPR A;  3QRP A;  2JL9 A;  4WIQ A;  4LIR A;  3IAS 9;  7AT1 B;  4RL1 A;  4C8Y A;  1RT4 A;  2W2P P;  1H0H B;  2X3G A;  4NYP A;  2PFD A;  3Q2T C;  4HAC B;  3TVY A;  4JB8 B;  3M8Q A;  4WK3 A;  3EVO A;  3UPF A;  4V19 J;  2J9D E;  4FNH A;  2IPO B;  4QWE A;  1U1R A;  1TUG B;  2KYX A;  2AD9 A;  1DRZ A;  4YR2 A;  2IC3 B;  2J8A A;  4C97 A;  3UD4 P;  2Q43 A;  3KXD A;  3NCQ A;  3ZZZ A;  2V4J B;  1YIJ S;  1LNQ A;  5HVH A;  5LQQ A;  2XSF A;  5LMN F;  3MEC B;  4QWA A;  1MWQ A;  2HLT A;  1PIL A;  2QGF B;  2AKW B;  2FHJ A;  4GC6 A;  4NLU A;  2FJB B;  4F0H A;  2V68 A;  2R7O A;  4ZVH A;  1OY8 A;  2G2Z A;  4HH0 A;  2XMW A;  4DF8 A;  1NM2 A;  3ISN C;  1HI1 A;  3CTR A;  1KLN A;  1X0F A;  3GZ7 A;  3GR1 A;  1I1G A;  4IG3 B;  2W5R A;  1VMB A;  4YUD A;  2KXF A;  3C3L A;  5EWE A;  2VBX A;  4ZLP A;  3O6Q A;  3C6T B;  2F4F A;  2YY3 A;  2BE2 A;  4ZVF A;  3EDR B;  4LVO P;  1LK5 A;  1JLE B;  4WYW A;  4P7V A;  3DLK A;  5K8M A;  4HLB A;  1FER A;  2G4B A;  3DN9 A;  3EGN A;  2H3E B;  3AA8 A;  2W4D A;  4UOR A;  1X4G A;  2HMI B;  3CJK B;  1Z1Z A;  3C66 A;  1UL3 A;  1OWX A;  2ZE2 A;  2X98 A;  2CZV C;  3CED A;  4X84 A;  2EFO A;  1HYS A;  3VVT A;  1R8H A;  5HP1 A;  4C48 A;  4DV3 F;  3NWG A;  2NRE A;  5AJ3 J;  1W2I A;  2YNG B;  2EK1 A;  3CSK A;  1MML A;  4DEZ A;  3IS9 A;  1SQF A;  3L7O A;  3ZXW A;  2V8H A;  3AJ1 A;  4BHQ A;  2YX4 A;  1F5A A;  2DGW A;  3D67 A;  1YJN S;  1DTQ B;  3PYD A;  2DIT A;  2EG1 A;  4PXB A;  2N7Y A;  3AY0 A;  1RDR A;  4IQX A;  4YB5 A;  4U95 A;  3GFH A;  1RLC L;  4IFV A;  2C2O B;  5CYQ A;  3MMB A;  2DR7 A;  3C16 A;  3KLI B;  1KRP A;  2ALZ A;  1JLB A;  5MAO A;  2CAJ A;  2WTF A;  1VQO S;  5HRO A;  4WZQ A;  5KFT A;  4X4U A;  1WD6 A;  3I31 A;  5LMU J;  5I42 B;  3V81 B;  3VQS A;  2BW2 A;  1VHI A;  1TAU A;  1WOP A;  1IR2 A;  3DOK A;  2ATL A;  2C28 A;  1N4L A;  4ER8 A;  2HHQ A;  1SUQ B;  3N79 A;  1TMJ A;  1DUR A;  4HTI A;  1XMQ J;  2C2M B;  3T5H A;  1T05 A;  4DL0 C;  2K1R B;  1KQK A;  5RUB A;  1TUW A;  2C2Z B;  2DRD A;  4DZ6 A;  3GYG A;  2QLX A;  4J9U E;  2Y1J A;  2GV1 A;  2CVE A;  1ZEB A;  2OI2 A;  3FFI B;  4JYA F;  2DNN A;  4OZ2 A;  1EKS A;  1YJU A;  3CCR S;  2IFY A;  5GMD A;  2BM0 A;  3JQJ A;  2CRL A;  2BQU A;  5D15 A;  2VON A;  1QJH A;  1P1T A;  4FDJ A;  4P72 A;  1U2F A;  1PGZ A;  3CC4 S;  1YRU A;  4P2S A;  4ZPC A;  4C11 B;  1IR0 A;  5SZT A;  2XYP B;  1CJK B;  4WBF A;  2GW8 A;  2KG0 A;  2I8E A;  2ROG A;  2XQC A;  2UUW A;  1RHM B;  4EI2 A;  3CME S;  4CLS A;  1RWU A;  1ZA2 B;  1C1B A;  3AAW B;  4ZVS B;  1RLD A;  2UVU A;  4PKD B;  2E5I A;  4TKT A;  1VQ7 S;  2HWI A;  4X4R A;  2K2P A;  1LW2 A;  4EBE A;  3DPC A;  2R2T A;  4K50 A;  1ZS6 A;  3EXC X;  3R5D A;  1R27 B;  4DQP A;  1K1S A;  2IFX A;  4USV A;  4HI1 A;  1RHJ B;  2WB4 A;  1HWI A;  2AZ1 A;  2M8D B;  4Q44 A;  2CPZ A;  3KOA A;  4LBP A;  3Q86 A;  3PRD A;  1SC6 A;  2VUG A;  3K5O A;  4X4S A;  1XNQ F;  1MU2 B;  3T01 A;  3F44 A;  3VAJ A;  3AQP A;  1RTI B;  2NZ4 A;  1PJ7 A;  1D1U A;  2W1B A;  1RAB B;  2ILY A;  2PFF B;  3RZA A;  1SH3 A;  1FCA A;  2QMX A;  2DIU A;  1WEZ A;  2RQC A;  4RJV A;  2MQL A;  4KKO B;  2WVB A;  2QO3 A;  3P6Y C;  3MAA B;  3SCL E;  3TAM B;  1VQL S;  4NCA A;  4JI7 F;  1IBM F;  2X7I A;  4CYU A;  3K8W A;  1U6B A;  5KFL A;  2EBG A;  4WJB A;  4LJM A;  2AJ2 A;  4MYT A;  4B9N A;  2ZBP A;  4GRS A;  3TA0 A;  4KBI A;  1URN A;  2W9B B;  3BYP A;  4XPE A;  4JI1 J;  2JWN A;  2ILZ A;  4DPU A;  1FXR A;  5C24 A;  2J6T A;  1N5Y A;  3V6J A;  4UOP A;  1S6U A;  3FBE A;  2XG8 A;  4ED2 A;  2VQR A;  3DYA B;  2KM8 B;  2APO A;  1ZM4 A;  1LXJ A;  1XMO F;  2NSB A;  3BGO P;  1ED8 A;  3R27 A;  1DJ0 A;  1HBO B;  4M5D B;  4DX6 A;  3F41 A;  4M5N A;  1JLC B;  3TEH B;  4O4R A;  4DL3 A;  1G3O A;  2N82 B;  2E1P A;  1T3N A;  3RB3 A;  5DDQ C;  2W5W A;  2ZHB A;  3MD1 A;  4YHH F;  5KT5 A;  1ZTT A;  4L3N A;  1NEE A;  4JI5 F;  4K2X A;  1RT3 B;  2DNQ A;  5KFW A;  1AT1 B;  1RT5 A;  3MCM A;  2O3D A;  4C7Q A;  4HYK A;  4NWJ A;  3BRE A;  1HWJ A;  4DFK A;  2IBK A;  2HFV A;  1VQ5 S;  3AOD A;  5CCM A;  4NL5 A;  1LFW A;  3R97 A;  1U02 A;  1TP7 A;  3ET6 B;  3E01 B;  5LXR A;  4IUF A;  2DJW A;  1TFY A;  3ZTR A;  2KM8 C;  2VQF F;  2P6S A;  2KN4 A;  2M4M A;  1GMU A;  5KFI A;  2X1G A;  3C14 A;  3FBC A;  5DLW A;  1S57 A;  4YOE A;  3GSI A;  2XLK A;  3PVX A;  5C25 B;  1XNR J;  2XMT A;  1UZD A;  3LP1 B;  2HNY B;  4DR2 F;  3G8Q A;  1ANI A;  3PRB A;  1D9A A;  1KNZ A;  3AJ2 A;  3C6U B;  1N5T A;  2UZA A;  1JK9 B;  1S1X B;  3NBP B;  3DDI A;  3PKY A;  5IWA F;  1R3N A;  2LA6 A;  1CJV A;  1ED9 A;  3CUN A;  3HCX A;  4K4U A;  3BN4 A;  4CO2 A;  4JV5 F;  3DGP B;  3NAI A;  2ZOG A;  2LFV A;  3MCN A;  2MQQ A;  5KFN A;  3JQM A;  3GJQ B;  4OI4 A;  2DHH A;  3IRW P;  1GH8 A;  4LR7 A;  1VBX A;  1P8G A;  3NRB A;  3ETM A;  3I0S A;  4F0M A;  6FD1 A;  4JV1 A;  1YDL A;  3PCO B;  1F3V A;  3K59 A;  2CZ4 A;  4OZJ A;  1RAI B;  1H7X A;  3W5Z A;  4WKR A;  2MZR A;  2V2K A;  3T9Z A;  4ZDN A;  1AA1 B;  4LF4 J;  3M1V A;  4UQG A;  4X64 J;  1RYR A;  3OT9 A;  3R6G B;  1BQN A;  4LIW A;  3MD3 A;  4NLD A;  3WQP A;  5I4M A;  4ZIT A;  1JLA B;  1HNZ J;  4DZD A;  4K7Q A;  1UVN A;  4ZG7 A;  1EAY C;  5FD1 A;  3PW0 A;  1WC3 A;  2OPS B;  1XER A;  4KQZ A;  3OTD A;  5KFU A;  1NKC A;  2Y0B B;  4FNI A;  1RT4 B;  4YDX A;  4F3O A;  4WP9 A;  1ZAW A;  4OX9 F;  2A6M A;  2LDY A;  5ETQ A;  5BR8 F;  4K0K F;  3M8Q B;  4ED6 A;  1HHT P;  1JIH A;  3SCI E;  2QA4 S;  4LRF A;  2JNJ A;  3KLH A;  1ELO A;  2G2O A;  4FXD A;  5KTQ A;  1EQ0 A;  1X8D A;  4YFU A;  3RAQ A;  2Q3P A;  2FY8 A;  4F2R A;  4DQR A;  4ZCL A;  2PII A;  3MWB A;  1F3F A;  3WIU A;  4G1Q A;  4PQU A;  3CDW A;  2GAG C;  2D7S A;  2EC2 A;  2I38 A;  3SMZ A;  3KWM A;  3B5Q A;  1NK5 A;  3ZZU A;  4DL5 A;  3CCM S;  1LEO A;  3Q8P B;  4E2F B;  2PMH A;  3KDN A;  3US5 A;  4ECS A;  1TKD A;  5DLT A;  1WWH A;  1F5C A;  4IDK A;  5KFM A;  4E8U A;  2RS2 A;  1OPZ A;  2NCK L;  3LWM A;  2CDQ A;  3VGU A;  1PBA A;  4DFP A;  3HX9 A;  2M3D A;  1AUK A;  2H5E A;  2XLI A;  2UV8 A;  2NZC A;  1NUE A;  2DPI A;  5D0G A;  2V8G A;  2BYC A;  3I6P A;  1OO0 B;  3VQT A;  3GTY X;  4QWC A;  4RUH A;  5A0Y A;  4RW6 A;  4RNH A;  3LOU A;  3PIO Q;  1ELX A;  3KHG A;  5HAO A;  2W5Q A;  5L38 A;  3ENW A;  4TLR A;  1VOM A;  3FMW A;  4IR1 A;  3N5F A;  4W92 B;  2BE2 B;  4EO6 A;  2MHN A;  1FI4 A;  1IJE B;  3DLK B;  1AJC A;  5IJS A;  1S48 A;  2DD8 S;  1VQ9 S;  2HAF A;  1F5B A;  3HK2 A;  2RH6 A;  2QT7 A;  3QGP A;  1LWX A;  2HQF A;  1SL0 A;  2FLL A;  3T5L A;  3GV5 B;  2ZE2 B;  3NKY A;  4X66 J;  4YN3 B;  3L09 A;  4ELV A;  2CJK A;  1V3R A;  1Y00 A;  1X7V A;  1HYS B;  3AQO A;  4CQ1 A;  1LFP A;  4F4Y A;  3EIC A;  2NPI A;  5HP1 B;  5DJB A;  1OSD A;  3VAI A;  1N0V C;  3UDL A;  3IS9 B;  4G1I A;  4DPO A;  1XWL A;  1Y9O A;  4KHP F;  2B6A A;  1PO6 A;  3THP A;  1NDC A;  1CJT A;  2RT3 A;  1R6Y A;  3TO8 A;  2V4R A;  5A8R A;  1QVF R;  2XYH B;  1U1O A;  4IFV B;  3NVL A;  2CJQ A;  3R7N B;  4CNZ A;  5CYQ B;  3MMB B;  2QL5 B;  4D3G A;  3C16 B;  2YVS A;  2AGQ A;  3HFK A;  2PI5 A;  1JLB B;  6AT1 B;  2ZJR Q;  5K8N A;  2QJ3 A;  3IM8 A;  5HRO B;  3PTW A;  2JX2 A;  3DOM A;  4CXS A;  1BLU A;  3CDU A;  1N34 F;  2JC1 A;  4DV6 J;  2YQ1 A;  4FS1 A;  3O1L A;  1BHN A;  3CCW A;  3NS7 B;  4OX6 A;  2DGT A;  3ZC4 A;  1M1K T;  3DOK B;  1N36 J;  2DNK A;  2XEX A;  4B3S J;  2C2D A;  1U48 A;  1L3K A;  2N4C A;  2DYA A;  1SPB P;  1KEK A;  1T05 B;  5G0R A;  3N6L A;  3BDP A;  1H3D A;  3OVA A;  3IG1 A;  4MK7 A;  3CJT A;  2DNP A;  1M5K C;  3B4D A;  2ZBR A;  1UWB A;  5IQ6 A;  1TKZ A;  4DPT A;  4QR1 A;  3QRR A;  1EW9 A;  3FSY A;  4CIO A;  1FKA F;  2R4F A;  5H9E K;  4CXU A;  2UXC J;  5J2Q A;  4O4G A;  1T11 A;  4JP8 A;  1UVJ A;  3EZO A;  4J9P A;  1J5E F;  3HT0 A;  2DR5 A;  1LXN A;  4OI2 A;  4B9T A;  4QW9 A;  1WHW A;  5DDO C;  4C0H A;  2DNH A;  1QTM A;  2C3M A;  4URQ U;  1H6K X;  2AHO B;  4O3O A;  4F7V A;  2OH2 A;  3IA0 A;  5IS2 A;  4WXO A;  4ZK7 M;  1YWX A;  1C1B B;  2QG9 B;  5IT0 A;  2QFJ A;  2LEA A;  4YB7 A;  3DRR A;  5KFE A;  1VIX A;  2EVZ A;  3MUR P;  1JXV A;  1HKA A;  1LW2 B;  1Q78 A;  1SXL A;  4DR1 J;  4DFM A;  5CQG A;  4JI2 J;  2YKP A;  3UCU P;  2NR0 A;  3IBW A;  2GHV C;  4CXK A;  3CCQ S;  1Q7Y T;  2A2D A;  4NLQ A;  2BAN A;  2WON A;  5B0C A;  5M2P A;  4N5S A;  2CQ2 A;  2HHS A;  5EX0 A;  4I64 A;  1U8W A;  2ZKT A;  3HP6 A;  3IP0 A;  1WC5 A;  2E9T A;  1QAX A;  2V9W A;  3MEG A;  4X4P A;  2XR9 A;  2Y8Y A;  4Z7Y A;  1CEZ A;  3CB4 A;  3ZZP A;  1YZ7 A;  4AUK A;  3PAC A;  2YWG A;  1Y7P A;  2YTC A;  2VPZ B;  4ED0 A;  5EGE A;  1R8A A;  1D0E A;  3IR5 B;  3H40 A;  1KHL A;  1YHQ S;  4IOC Q;  2NXU A;  3CD7 A;  2HHW A;  2LU2 A;  1RIS A;  4CYU B;  2ZM6 F;  4WPA A;  3PIP Q;  4Z37 A;  1OIA A;  3BQ2 A;  2EFP A;  2JZ5 A;  4B9L A;  2MZJ A;  1UMJ A;  3QO9 A;  1Q1K A;  5LSL A;  3K5M A;  2CJX B;  2MZ1 A;  5C24 B;  1F60 B;  4HH1 A;  2MDA A;  4KTQ A;  1N5Y B;  5F3T A;  4KE5 A;  5KFD A;  2OEL A;  4LVN P;  2MJN A;  2IRU A;  4ES2 A;  2VDH A;  1WHX A;  1GK8 A;  2FY1 A;  5AE2 A;  2KH9 A;  4PCQ A;  2QFI A;  3KHL A;  5CH7 B;  4R8U A;  4Q45 A;  3CCL S;  2G1H A;  1X9W A;  5ETV A;  3I0R A;  4J9M A;  2GJI A;  3SQG A;  2YNH A;  2ZOM A;  4DV1 F;  2UXD F;  3CXC R;  4J90 A;  4JI3 F;  4RWX A;  2HHV A;  4CLW A;  1RT5 B;  4LSL A;  2R7S A;  1JKH A;  2Y1L B;  1Q4R A;  4CLF A;  1RWW B;  2ANH A;  3MUV P;  3C19 A;  1NSK L;  3BGF A;  2RF2 A;  2RQ4 A;  3I4H X;  4UOC A;  4QIE A;  1VC5 A;  1DHM A;  2C2N A;  3WBZ A;  2HGL A;  2RU3 A;  5A8W A;  4FVM A;  2KT2 A;  3KLG A;  4IRC A;  2RQK A;  2GSN A;  3H4B A;  2X1A A;  2L48 A;  4DQS A;  2GVD A;  4NX9 A;  1OYD A;  5CYJ A;  3VV2 B;  4OX7 A;  2YNI A;  3AXK A;  3LGN A;  3WAV A;  1YK9 A;  4P2M A;  1EJ7 L;  3C14 B;  1PKU A;  1N2L A;  3SFG A;  2YKN A;  3ONQ A;  3VVU A;  1QSL A;  3EZ5 A;  4J9O A;  2YPY A;  1R6V A;  3LH2 S;  5KFY A;  3GE9 A;  1H38 A;  2D69 A;  4B08 A;  1Z4U A;  3MCS A;  3H5Y A;  2YQ0 A;  1TFW A;  3IO1 A;  3R5C A;  2CQ1 A;  2M8H A;  1LWF A;  2DY9 A;  2UUC J;  2OJ3 A;  4DWI A;  3DU5 A;  3IAM 9;  4BWJ A;  3FZB A;  1FDD A;  1H2U X;  3R6L B;  2C3P A;  5CD4 A;  4KO0 A;  1CJV B;  2V8D A;  2VIC A;  3FUY A;  2DCU B;  4M5I A;  1I6J A;  2N4D A;  5KG7 A;  2WW8 A;  1PC5 A;  4B56 A;  4LFC F;  4OZ5 A;  4MIA A;  4DCP B;  2NUU G;  2AT1 B;  2AEF A;  4OL8 A;  3I0S B;  4CO0 A;  5EX3 A;  1F9F A;  1FVQ A;  4TY9 A;  2RHQ B;  3V4I A;  1PCA A;  3K57 A;  4KJG A;  3J80 U;  1FJG F;  3Q2S C;  4AND A;  4ZKA A;  4RR5 A;  4LFA F;  2Y9H A;  3LTO A;  5LM7 E;  3M1V B;  4I2P A;  2Z30 B;  3CCS S;  3OL9 A;  4ECU A;  1BQN B;  3QSI A;  3RR8 A;  4DI6 A;  4CLY A;  2KTQ A;  2KL8 A;  3K2Y A;  5KOW A;  5CZV A;  1S1W A;  1U26 A;  4LFB J;  3GG0 A;  1T94 A;  4Q8E A;  3RBD A;  2V50 A;  2XY6 A;  1HHQ A;  5GAG I;  4GKJ J;  1GX6 A;  1BXN A;  4EFA C;  1YBT A;  2GAH C;  1DFD A;  2RRA A;  2P9E A;  3HVT A;  2CFX A;  1JJH A;  1TL5 A;  1KQG B;  1WG1 A;  1SC1 B;  1RT7 A;  3HVA A;  1QUP A;  1M5P C;  1KQS R;  2NS1 B;  3CD6 S;  2ZDP A;  5E2Q A;  5IT4 A;  3KLH B;  4CO3 A;  2LDI A;  3HVW A;  4DCO B;  1SI9 A;  3NS5 A;  1WG5 A;  3PR5 B;  3HSD A;  2M88 A;  1FXL A;  4G1Q B;  4OMF G;  4PQU B;  4ZLL A;  3UE2 A;  3CC7 S;  4OZ3 A;  2VHG A;  3CNQ P;  4NCG A;  4JI4 F;  2ADB A;  4QWB A;  3BDE A;  4ECV A;  4M5G A;  3TZW A;  4CZC A;  3ELH A;  1U09 A;  4ZVP B;  2UV8 G;  4PAB A;  1VK3 A;  1M5O C;  4IDK B;  3TJ9 A;  1A7G E;  1RXO B;  1DY3 A;  4EBD A;  2W4P A;  2H1Y A;  1X9M A;  3MF5 A;  4EBC A;  4NA1 A;  3AOA A;  1C4A A;  2MQN A;  1FFW B;  3DRX A;  1L3V A;  1UEV A;  5A0Y B;  2W7O A;  4LF9 F;  4RW6 B;  2VQE F;  2DO0 A;  1N8R T;  1PYO B;  2PE8 A;  4L72 B;  1JXL A;  3MPU B;  3HD1 A;  3A8K A;  1MWZ A;  4XDC A;  1O98 A;  1Q8K A;  1Y0H A;  2PA8 D;  3LGM A;  3BYR A;  2LQ9 A;  5F9L A;  1CJU A;  3TA2 A;  1CC7 A;  3EVW A;  2KXN B;  3T41 A;  3RYL A;  4OI6 A;  3E2D A;  8AT1 B;  1N0U A;  1S79 A;  3AB2 B;  2VBW A;  4LR9 A;  2HIY A;  2V8V A;  4FYY B;  3M6V A;  4KHM A;  2DXF A;  3QYY A;  1RCX B;  2W2Q P;  2ZD1 A;  4OYW A;  1N5V A;  3BGL A;  4OQJ A;  5IXU A;  3GB0 A;  1MRO A;  2B6A B;  1CJT B;  4CM2 A;  3H8Y A;  4FN5 A;  1KR4 A;  3CDB A;  1UKU A;  5A8R B;  1QD1 A;  3R5A A;  4FKX A;  2VC0 A;  5GMK a;  1YTY A;  2B9Y A;  3GFY A;  4DX7 A;  1RWP B;  3BKU A;  3J7Z 5;  1AFJ A;  1FVS A;  3GU0 A;  3LXQ A;  2HNZ A;  1YI2 S;  3CD5 A;  1WF1 A;  4P6Q A;  5KFQ A;  3FDS A;  1O5J A;  2XMA A;  4M5M A;  1X5S A;  2ZBI A;  3W1Y C;  1K8A T;  4HR2 A;  1RAJ A;  1TL7 A;  4N56 A;  1SL2 A;  3TX0 A;  2OD4 A;  3GFX A;  1RUS A;  2IY5 B;  1EAR A;  1RU2 A;  3KHH A;  1CC8 A;  5KFC A;  2RU9 A;  4ALZ A;  5L1K A;  3HHE A;  3C46 A;  1TK0 A;  3TZZ A;  4USM A;  3B82 A;  3G82 A;  3D0I E;  4K2J A;  3RB4 A;  2FC9 A;  1VCT A;  2A3J A;  2Q1L A;  1JJ4 A;  1ZED A;  1VJW A;  2V2Q A;  3WIV A;  5G0R B;  2V63 A;  4GVL A;  2E9Z A;  3IG1 B;  4H4K A;  3LWL A;  5EGH A;  4QIW D;  2MYF A;  1UWB B;  4J9Q A;  3RTV A;  2CPH A;  2MLX A;  5KG0 A;  1SJQ A;  2HPU A;  4I6A A;  5J2P A;  4X4Q A;  1TKZ B;  4O0I A;  1KH4 A;  4ZGA A;  3Q89 A;  2DR9 A;  4C8N A;  3LQV A;  4HDH A;  4NXN J;  2WRM A;  4O23 A;  5J2Q B;  1RU1 A;  1K0V A;  4O4G B;  2CWX A;  3BJY A;  2XGP A;  1YQH A;  3MAH A;  4C0B A;  2KFY A;  2WHO A;  2AMC B;  4HKQ A;  2OTJ S;  3M7V A;  1E1Z P;  3MGJ A;  3CMR A;  2GFF A;  3THV A;  4LF8 J;  3KJQ B;  2POK A;  2DGU A;  4TU7 A;  2BOA A;  2Z57 B;  2R2R A;  3DRR B;  1K47 A;  4PWU A;  4OYI A;  2XRG A;  4KSE B;  1KFS A;  1UPP A;  1FRH A;  3OD2 A;  1D9F A;  2MGZ A;  3RAX A;  3W64 A;  4WP8 A;  1A0O B;  1DTT A;  1O8B A;  2RSQ A;  1IKX A;  4QPT A;  3UCZ P;  2BAN B;  1WOS A;  4UTG A;  2P8I A;  2WON B;  2R42 A;  1VJQ A;  1RKI A;  4KGZ B;  3RU0 A;  2ZH5 A;  3R2D J;  2W25 A;  2RDJ A;  2L9N A;  2HKE A;  2H4W B;  4OZ0 A;  3MEG B;  1R0A A;  3VGS A;  1N6Q A;  5GOV A;  4CLZ A;  4LBH A;  4LF2 A;  4MIW A;  3D54 A;  4KJD A;  3CO0 P;  5MLC V;  1U1M A;  3EUN A;  3NOG A;  3BQ1 A;  4G3I A;  2W24 A;  3D5M A;  2HHT A;  1QVG R;  4RZR A;  1XTZ A;  3A3O B;  4RW9 A;  2FLN A;  3CCU S;  4Q43 A;  2QTW A;  1S59 A;  4QZV B;  4CLU A;  2BKP A;  3DLH A;  4B3R J;  1NDP A;  1HHS A;  4FVC A;  3J7Y I;  1U0H A;  3QO9 B;  2AJ1 A;  5ADZ A;  1WDT A;  4B3O A;  2Z8Q A;  2RRB A;  2G0I A;  2CPE A;  1U6F A;  5HSP A;  2YH0 A;  3TQ1 A;  2HVZ A;  2CNK B;  1FEH A;  4ILR A;  3TJA A;  3SV3 A;  1B99 A;  2QN6 B;  3MEK A;  4N8N A; 
#chains in the Genus database with same CATH homology
 4MIV A;  5L0B A;  5EGH A;  3MK0 A;  3A52 A;  3BDG A;  3B5Q A;  4LRE A;  2QZU A;  3WAV A;  1E3C P;  5L0K A;  1ELY A;  4YR1 A;  1ZEF A;  1N2L A;  4UOR A;  1EQJ A;  3UO0 A;  1EW8 A;  1URA A;  3DPC A;  1KH4 A;  4LRD A;  4CXK A;  4ZGA A;  1N2K A;  1URB A;  3SZY A;  3TWZ A;  5DLT A;  2X98 A;  1ALJ A;  5GRR A;  4MHX A;  5K4P A;  3NKP A;  5LQQ A;  1KHJ A;  1SHQ A;  4UOO A;  3OT9 A;  1ALI A;  3BDF A;  1KHK A;  5GOV A;  1ALK A;  1HJK A;  4GTZ A;  2ZKT A;  5DLW A;  4LRC A;  1KHN A;  4UOP A;  5LRM A;  1AJB A;  2IUC B;  1Y7A A;  5LIA A;  3LXQ A;  3UN2 A;  1AUK A;  2VQR A;  1EW9 A;  3WAX A;  4KJD A;  3MK2 A;  3M8W A;  2W5S A;  5DLV A;  4LRA A;  1SHN A;  2W5V A;  4KAV A;  2GLQ A;  1FSU A;  4ZG7 A;  4CXU A;  1ED8 A;  3WAW A;  3NVL A;  3Q3Q A;  1Y6V A;  5KXA A;  2XR9 A;  1ZEB A;  5C66 A;  4GTX A;  1O99 A;  4UPH A;  1E2S P;  2IUC A;  3M7V A;  3T00 A;  4MY4 A;  3ED4 A;  1ALH A;  1KH9 A;  1EJJ A;  2GSO A;  3KD8 A;  3MK1 A;  1E1Z P;  4NWX A;  1KH7 A;  2W8S A;  4CYR A;  3UNY A;  2IFY A;  4ZG6 A;  3IDD A;  4GTY A;  3T01 A;  3WAY A;  1EI6 A;  5LRN A;  1ANI A;  5AJ9 A;  2W5T A;  3CMR A;  2D1G A;  1KH5 A;  3NKQ A;  4LR8 A;  1B8J A;  4KAY A;  4LR2 A;  1ELX A;  1ANJ A;  5EGE A;  3TX0 A;  4LRB A;  1AJA A;  1O98 A;  2W5Q A;  2W5W A;  4UPI A;  4N7T A;  1KHL A;  3IGZ B;  2ANH A;  4FDJ A;  2W5R A;  3SZZ A;  4FDI A;  3IGY B;  4B56 A;  4GTW A;  5HRT A;  5TJ3 A;  1ED9 A;  4UPK A;  3WBH A;  3NKO A;  4CXS A;  4UPL A;  1K7H A;  4KM4 A;  4LRF A;  3NKM A;  3E2D A;  1P49 A;  4ZG9 A;  1AJD A;  2XRG A;  3NKN A;  5L0E A;  3UN5 A;  3T02 A;  2GSU A;  3DYC A;  4NWJ A;  1AJC A;  3M8Y A;  4LR9 A;  5IJS A;  4CYS A;  1HDH A;  3M8Z A;  3BDG B;  3UN3 A;  3NKR A;  1E33 P;  1ZED A;  2G9Y A;  1ELZ A;  2GSN A;  4QAX A;  5INH A;  1HQA A;  2GA3 A;  2RH6 A;  4TN0 A;  4LQY A;  4KJG A;  3TG0 A;  3BDH A;  4LR7 A;  5IJQ A;  1EW2 A;  2W5X A;  2W8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...