4LREA

Phosphopentomutase soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lreA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lreA01
3T00A 3M8ZA 3IDDA 4MHXA 1ALHA 3TG0A 5KXAA 3BDGA 4CXKA 3IGZB 3TX0A 4B56A 4KAYA 2GLQA 3NKMA 3NKNA 4LRFA 2GSOA 2W8DA 5LQQA 2W5TA 5DLWA 5L0KA 2ZKTA 1KH9A 4UPIA 4LRAA 4LQYA 4FDIA 4LRCA 1KH5A 3NKOA 5LRMA 4GTZA 1E1ZP 1SHNA 2XRGA 4UPKA 3UNYA 3DYCA 1ZEDA 4N7TA 5EGEA 2ANHA 2W5VA 1Y6VA 4YR1A 1AJAA 3ED4A 3BDHA 1KHLA 3M7VA 1AUKA 3Q3QA 1Y7AA 1HQAA 1KHNA 1SHQA 1N2LA 4UOOA 5HRTA 4KJDA 4LR8A 1E33P 2D1GA 4MY4A 1ANIA 4CXSA 5GRRA 4LR2A 3M8YA 3UN3A 1B8JA 3CMRA 1AJBA 3LXQA 4LRDA 5DLTA 1N2KA 1KH7A 1EW9A 5EGHA 1ELXA 3B5QA 5LIAA 2GSNA 5C66A 1ZEFA 1HJKA 1EJJA 1ZEBA 3DPCA 2W8SA 3SZZA 5IJSA 3NKRA 1URBA 4LR7A 3MK1A 1ELYA 2W5SA 2XR9A 2IFYA 4CYRA 1AJCA 4KAVA 3MK2A 5INHA 4ZGAA 1KHJA 1ELZA 1EQJA 4UPLA 2W5QA 2W5XA 3NKQA 2W5WA 2GA3A 4TN0A 4GTYA 1FSUA 3WAYA 4GTWA 3WAXA 2IUCB 3MK0A 3M8WA 4UORA 5IJQA 4UOPA 1O99A 3BDFA 4ZG6A 2QZUA 2G9YA 3KD8A 1K7HA 4LRBA 1ALKA 5K4PA 4QAXA 4CXUA 4ZG9A 4LR9A 4KM4A 1E2SP 1E3CP 1ALIA 3WAWA 1KHKA 1EI6A 3WAVA 5LRNA 2X98A 1ALJA 3A52A 1KH4A 1HDHA 1ANJA 1O98A 2VQRA 4KJGA 3T02A 2RH6A 4FDJA 5GOVA 3TWZA 1ED9A 3UN2A 1EW2A 4NWXA 1ED8A 2W5RA 2GSUA 1URAA 5AJ9A 4LREA 4ZG7A 3T01A 5L0EA 3BDGB 5DLVA 3UN5A 3OT9A 3WBHA 1AJDA 3NVLA 3SZYA 5TJ3A 4GTXA 3UO0A 3NKPA 5L0BA 4UPHA 3IGYB 4MIVA 3E2DA 4CYSA 4NWJA 1EW8A 1P49A 2IUCA
chains in the Genus database with same CATH superfamily
3HVTA 4IG3B 4DL3A 3GONA 2H65B 4LF8J 1HFEL 2UVVA 3DLJA 1H7WA 2VC1A 1XNRF 2QGFB 2MZJA 1WOOA 2J6SA 2P8IA 3GZ7A 1ITPA 4QW9A 3T1HJ 4WPAA 2V8HA 1TMMA 1LWXA 3M4XA 2HSEB 3W1YC 4RWXA 1B4SA 1NSKL 1ELXA 5DGAA 4WFBQ 4ECSA 2OH2A 4G65A 1UFKA 4AUKA 1GH8A 3V81B 1QSYA 4P52A 2VA3A 1O51A 2FVPA 5HJXA 1SC4B 2DH8A 2V94A 4LBPA 3W7BA 3BGOP 4FVMA 3LWMA 4I67A 1FD8A 1HARA 4RW6B 2F40A 5B0AA 5FLXY 2G2ZA 3DDNA 3GYNA 5KTQA 4MYTA 5KFDA 1VLOA 1CBKA 4WIQA 1G1XA 3G87A 3DGPB 3LALA 5LL6d 1RT2B 1GFWB 1HD1A 2HBZB 1H2VZ 5BYRA 1R0AB 4TXSA 1RT4A 4A8SA 2VL1A 4LJMA 2JJ4D 3JTPA 4NLSA 3G86A 2WVEA 1RI7A 3I6PA 2XTJP 1LFWA 2GVZB 4Q2LA 1NNDA 2W24A 1NHKL 4IOBA 3D4JA 4I2PA 2HLUA 4OHYA 4ID5B 3HI9A 3AA8A 2ZE2B 3V6DA 3TW0A 2ZH4A 4RO0A 2HZVA 2PIIA 4KRWA 1S6QA 4DPXA 3H2UB 5JXSA 3DCAA 3R2CJ 1Y3KA 1VBZA 3PY8A 4DUYF 4OJ3A 2D1CA 3G9CA 2DD8S 2DR5A 1RT3A 2MGZB 4P73A 1FI4A 3ZO7A 2ZOFA 1N8RT 5HBMA 1RA7A 4NI2B 1LK7A 2FLOA 1TKXA 3E2DA 3K17A 4I4BA 1VQKS 5GAEI 1UVIA 3BDGA 1QJHA 4WJBA 3MEEA 5CYJA 2EC0A 1B0TA 3KK3B 2YTCA 4KHMA 2W5TA 4DUZF 2N7CA 3PHTA 4X65F 3ZXWA 1IKWB 2RJZA 2IYIA 2OPQA 1C1CB 3J80U 4I6AA 2RDDA 5GRRA 1TK0A 2CUYA 3HJVA 3ZTQA 4H4OA 5AJ3F 4PYAA 1HI8A 2W1BA 3C16B 4ZJLA 1NZAA 4CIOA 4ZN1A 4WKRA 3KJVA 3H4BA 2WOMB 2YKAA 3HDSA 1IKXB 5D4OA 1D8YA 3OD2A 1OIAA 2HQIA 5JVHQ 2VPZB 1Y00A 4JI0J 2KO1A 1U1RA 2P2CB 2N4DA 3W2VA 1RISA 4AQYJ 1XERA 3E2EA 1H3DA 3JTNA 1ZBTA 3QWUA 2RH6A 3GFHA 2ZJRQ 2J76E 2QYCA 1PYTA 4KV8A 3RB3A 1I6JA 3QBCA 5DETA 3DLLQ 4NASA 4K8RA 1UVMA 3IGZB 3A3OB 1EB0A 1P9QC 4X4SA 1JLCA 3CCWA 3DNCA 4TU8A 3DMJB 2HAFA 5AXNA 2YKMB 1VGYA 1WF1A 2PMZD 4DV6J 3SXLA 3TVKA 2W5VA 3EM1A 3C14A 2PN6A 5HRTA 3RB6A 2HLTA 2VOPA 1WEZA 2BA9A 3BKFA 3ZNUA 4F3MA 3TUJC 4F04B 5ETOA 4C3MA 2R7OA 2HFZA 1HBMA 4ZVQB 3HP6A 4ECRA 1V3ZA 3OLBA 4LF9F 4B9TA 3WDOA 2GQCA 2KXFA 3BSNA 4ELTA 4YB7A 4YY3J 3MK0A 3I55S 3K8WA 4DSEA 3C3LA 1B7FA 8ATCB 4Y2IA 5K14B 3KLIA 3A13A 4NXNJ 3W60A 4KM4A 4CLLA 1WEYA 4WBFA 3NWRA 1I3OB 4WE1A 3DLKB 1F5BA 4RW9A 4AL7A 3QT5A 5DQHA 2F8EX 3SIPB 4CWBA 5KFBA 1OY9A 2A18A 1N54B 3B4MA 2MKKA 3TG0A 4YHHJ 2O5DA 3FMWA 2HBRB 2GNKA 4J91A 2HPUA 4MK8A 4Y2AA 1GQEA 1M5OC 1ZPWX 4PRFA 1R6VA 4G1PA 2VG7B 2ZC3A 2DNPA 2JLEA 4LF6J 2VB6A 4J5OA 3E3XA 1NSQA 3ZZUA 2RKIB 1KQFB 2HHWA 3GSIA 4LUBA 3N9UC 1VFJA 2FLNA 1VJWA 4WTOB 5H9FK 5ETSA 2EKYA 2YY3A 5A8WA 3VR1A 3CD6S 3IMQJ 2F5GA 4I56A 3K59A 4OYZA 2XY6A 3PRDA 2HVHA 2OSQA 1X7VA 4ZVOB 4QWAA 1Q8KA 3HZEA 2X98A 2AD9A 4I69A 4IFVB 3UCGA 5BR8J 2AQ4A 1YDLA 4LREA 3GCXP 2VUGA 3VV2B 5IWAJ 3HHLC 2V2VA 4I6WA 1JKHB 2GHPA 2BE2A 1Q79A 2DGVA 4HEA9 4DV3F 2XHWA 1FNXH 1D8ZA 3FZBA 3A3NB 3CJ8A 4DR7J 3BDHA 4HI2A 2VV5A 3PYFA 4P72A 2ZBPA 2YH1A 4PR6A 2KN4A 3PW5A 2Z8QA 1N5YB 5A76A 2Z2LA 1HNIB 2M4MA 2CPIA 4CM0A 1WG1A 1X4AA 3KFWX 3CJTA 2LVWA 2YNHB 1R8HA 4DF4A 4IO1A 1QDUB 2G1HA 4ZVUB 4GC7A 3K8VA 5LJ5Y 3MPUB 1VQNS 1ALIA 3QAUA 2QLXA 3POTA 2XMVA 2Y1RI 4X66J 2UUWA 2XZWA 3CVKA 3GJTB 1T9VA 2NSCA 2DCUB 3IWNC 1RBLA 2DR8A 1R89A 5KG4A 3PVXA 1P49A 3CC7S 1ALHA 2FZCB 2X1FA 2N3LA 4EYIB 1RADB 4JI5J 3VQSA 3T6BA 3V6JA 3BH7B 1HNWF 1B3TA 2OTJS 4UPIA 4MH8A 4PWWA 3IRWP 3KLEB 2LQBA 4U8YA 3ZZ0A 5GAEU 1UVNA 2KG1A 4KYZA 5KFNA 1QLNA 4M1KA 2CPEA 4FYXB 3KUGA 5ETTA 2CVEA 2QMWA 1JWWA 4O3QA 2NXUA 4ZLPA 1OY8A 4WU2A 1B7YB 4ED6A 4OI1A 3IGNA 5JJBA 3NLCA 1B70B 3OSPA 3G2XA 2J8AA 4H4KC 3I4HX 2B0GA 2C22A 1SJ1A 3CCLS 1SQGA 2LA4A 2ZD1A 2B5JA 4XPCA 2AIRB 4BLGA 3W5XA 2RQ4A 2WK4A 3U7JA 2JNJA 4I2PB 3W2WA 3NBPA 4DV1J 2ZH9A 1WELA 1E6VA 1S6QB 1RQ0A 1YZ7A 2BJ9A 2YWEA 2GLQA 4XK8C 3AXMA 4K0KF 2ZWPA 3GG1A 3D1OA 2HHQA 4OZ5A 1RAGB 2DEJA 3FBCA 3D1QA 4ILRA 3GILA 3KDNA 5HJYA 4KGZB 1RT3B 5KFGA 4K4ZA 1WDTA 1NHUA 1YBAA 1U2RA 3D2WA 4FF2A 1NAQA 2MQMA 1XR7A 3FJ2A 3TNVA 2AW0A 2LDYA 1RTHA 1TKXB 4DPWA 2B4OA 1RLCL 2YX1A 3P3DA 4OHZA 3FGVA 1N5QA 4Y3CA 3KK2B 4P75A 3MEEB 3M30A 3VWSA 3RR7A 4FS1A 3IRXB 3RYLA 3RRGA 2VKRA 1RJJA 3MPDA 1YIJS 5ETNA 2YVSA 1J5EF 3MCOA 2DT9A 5L0BA 2C1EB 4RR5A 1UEVA 2HGLA 1JLEB 3ZZRA 3MAQA 1D1UA 3TX0A 3LP2B 3GR1A 4QWEA 3N01A 1ZAVA 3SZ2A 3RRHA 3MMCB 5KFUA 3I96A 1X60A 4RPFA 4EFAC 2A6OA 3TJ8A 1ZH5A 1WEXA 3JSYA 4B9UA 4DR5J 4HHUA 2HHSA 1U47A 1J27A 4U7UK 2V50A 4DV0F 2GSNA 3GIRA 3TANA 5ETVA 4DMZA 2RMLA 3CB4A 1PO6A 2IFYA 4KV8B 1XNRJ 2VBZA 2V8GA 4ZCIA 4BDPA 1C1BA 4UORA 5KFXA 2FB0A 4F4KA 3DM2A 1JX4A 4O4GA 4B17A 3PYGA 4LT6A 1RU2A 3GYGA 3CGIA 4KAIA 3H5YA 2BANA 3C14B 2ZH1A 2LECA 2GIFA 2IAJB 2XCPA 3WBHA 1U1PA 5GAHI 1TKDA 2J5AA 3H5SA 3T00A 2GHWA 1RE1B 3NKNA 3W61A 1RWMB 1HBMB 2ZH7A 4X4UA 4JB8B 4FDFA 4P10A 5KFZA 2OELA 5KT7A 4WIIA 4A46A 4KHPF 5A0YA 1ZEDA 3EUNA 4TY8B 1FRLA 2WW8A 4LSLA 1T3NA 4RWWA 1SIZA 2XSFA 4PG8A 4LFCF 2F63A 3THPA 4NLXA 4R0EA 2F9DA 2NREA 4M94A 2IYGA 4DLEA 5EWEA 2VONA 3AOBA 3DC2A 5LSOA 5D3GA 4ECYA 2GGPB 2G2YA 1NKCA 4ZVHA 3RAQA 3NAHA 2MSTA 4LF5J 3FNNA 1YJTA 2RNEA 1WKJA 2JLGA 3GFYA 4EMDA 4C97A 4PKDB 4YR2A 2M7SA 2OSRA 3RBXA 1RAFB 4LBIA 3EJMA 2PE8A 3SV3A 1SI9A 3HULA 3CSKA 2Y1LB 4M5KA 2FTRA 3G71S 4DUYJ 4ED5A 4KIAA 2MZSA 4HTIA 4X4NA 3HPOA 2FLLA 3CWJA 1MSWD 3P96A 3I32A 4DCJB 5HROA 2RD5C 2HQCA 2OD6A 5HMYA 5LMNJ 2FZGB 5GMKa 3I0SB 4K4VA 3G6YA 5D8HB 2W8DA 5A8WB 1RBOB 4UPKA 3TQEA 4JOUA 4DZ6A 5T41A 4B3TF 1S79A 4ECQA 1DLOB 2JFDA 2J0WA 1YI2S 2JC0A 3S8SA 1Q4RA 1TTHB 4JV5F 3MR7A 1FKOB 1RDRA 2DCLA 2FPHX 4X4VA 2KVIA 2MQQA 1CJTB 1U6BA 3A3PB 2PMWA 4FKXA 2WSCC 4DN0A 5B0DA 4EZ6A 4GTWA 2KT5A 5IT4A 1N34F 2BE2B 3JTOA 1UAWA 2BZ2A 4K4XA 3P8BB 3OXGA 3X3UA 5AJ3J 3R9LA 5C2CA 1BWVA 1UWBA 5DJBA 4DL4A 1R8PA 4P74A 1UVJA 1U02A 2X3DA 1YK9A 1OPZA 4ECTA 1TL3A 4M5NA 3WQPA 4CH7A 4Q8FA 4LVNP 5H9EJ 5LRMA 2DEIA 4P7TA 5BYQA 1Y6VA 1AW0A 4EI2A 1D9AA 1ZPVA 1KEKA 2ZZNA 4A4JA 1D0EA 4DV2J 3ET6A 1NK8A 2CJKA 2OEKA 3V4IB 4LR7A 1H2UX 2HG4A 5F0WA 2I6WA 1VYAA 3NKYA 1Z2LA 1ZAXA 1K73T 2FHKA 3FSIA 1Z1ZA 3OL9A 1VC0A 4RW4A 3TUPA 4OZ2A 3MM5A 1X4EA 4IRCA 2QYGA 3T3FA 3ITHA 4AL6A 4TQRA 1FWKA 5F8MA 1HHSA 2RE1A 3BPSP 2OIHA 2N7YA 4OYPA 1S9FA 5J2NA 2HWTA 4L72B 1A7GE 4OIXA 3UN5A 4UQTA 2EFOA 1KS2A 2QN6B 3GPAA 1RAOA 3ENAA 2ZUGA 1NU4A 4U6PA 2BOAA 1CEZA 4NZ6A 2HAIA 5KFMA 2AGOA 2KVQE 2BE7D 3AOAA 3R5CA 1S1VB 3KK1A 1V5IB 2Q3PA 4FP9A 3CJ0A 2ZD1B 2B5JB 5B7WA 3LTOA 3MMJA 1WI6A 3N5FA 2XGQA 5L1JA 3KOAA 2EFQA 1N4LA 2AYGA 4K2JA 2GQ2A 1OYEA 2FQQB 4Y34A 2ZFHA 4OQJA 3W2WB 1RWPB 1RGVA 3QGHA 4WXOA 3JQJA 4YEAA 1N6QA 5SZTA 1E6VB 2V2KA 4ITSA 2CG8A 3CO9A 5E2QA 2H3EB 3I5BA 4CTAB 8RUCA 3M8QA 3MUVP 1GMWA 4D3HA 3DOKB 3RUBL 1HI1A 2G2OA 2HWIA 1FWPA 4DV4F 2A0FB 2EFPA 2GJIA 4MKVA 3MR2A 1S1UA 2AYMA 4UY8T 2J6TA 2P9CA 2NXCA 3NY0A 4QIGA 3T01A 3KJFB 4C9DA 1CVJA 2HQFA 1H7XA 4M5JA 1AT1B 3UDVA 1TL1A 3SZZA 1S97A 4OX9F 1SJRA 1ICEB 3GE9A 5GAHU 3AB4B 1G7CB 2MKIA 3TA2A 3SFGA 2IHR1 3M2RA 1FX4A 1SHQA 4QR1A 5IT9Y 3H5UA 2HHVA 2AMCB 3HHLA 4C0HA 3NCPA 2HKEA 1IM4A 2FJBB 5RUBA 4IRDA 1SKWA 2CQ0A 1REVA 4QIEA 3GMGA 4RW8A 4ANEA 3DRRA 3C2PA 2VPXB 4TU7A 3E51A 3PYDA 2OO4A 2HGMA 1O6XA 5KG7A 5AE2A 1Q82T 1SB6A 1U25A 4BWJA 3A8KA 4ZVRB 1X8DA 3CMQA 2EBGA 2XNRA 2QSWA 3MAAA 3DLBA 5B0FA 4GKJF 1PIEA 1URAA 3VHQA 2O67A 4KY3A 3QMQA 5J1EB 2CFXA 3S01A 3EGWB 4X62F 3OFEA 2R7TA 4KKOA 2QA1A 1FT8A 4L73A 3WIUA 3I31A 1M5KC 2DNZA 1VHIA 3C6TA 3EGVA 4C0OC 4DQRA 3MM8A 5G0RA 3C15B 4DQIA 2P9GA 2HHTA 3M8PA 1F2HA 1S6PA 3R3TA 2HGNA 4WFAQ 4F67A 1U26A 4I68A 2D9PA 4O4GB 1F2GA 4ECZA 2D69A 2V34A 4QWDA 5EGHA 3MFHA 2BANB 2W8SA 1RZMA 4OX8A 3OJSA 1HNWJ 3GSDA 3CJ5A 1YITS 1JJCB 2CQPA 2DO0A 3OHBA 2HWHA 3A8IA 1OQ6A 4OZJA 5KFJA 4LFAJ 2DY1A 4ZP9A 3BDFA 2EEYA 1NRKA 3BR9A 4TNOA 4B9VA 5HMWA 1S7IA 4CO0A 2N82B 2CQBA 1EP4A 1HDHA 3MEDB 2IRYA 2BJ3A 6AT1B 4QBUA 4EK2A 2ZEJA 1FRJA 1NSPA 4WK1A 3O5TB 2JEFA 1XMOF 4GO7X 3PTWA 4ZPTR 2QTWA 3NAIA 3RU0A 2GV1A 3CNQP 1JLQA 5D3GB 3H5XA 1AFJA 1WHYA 3EMTA 2LXFA 5J2QA 1W2BR 2JSXA 2MSSA 1U1QA 5A2QU 4NL5A 2IJFA 3CC2S 1U6ZA 4ES2A 5JUMA 3W8PA 1RWVB 2NSBA 3OTBA 3PKYA 4K0KJ 4X64J 4KGXB 2JC1A 2QC3A 4J90A 2ZH2A 3BDPA 4ZLLA 1VDHA 4UOGA 2FVCA 2W5XA 1BD6A 5HROB 1CJVB 4TU9A 1KRPA 4UOPA 4PG4A 3IR5B 5ETMA 1S9EA 1HNVA 4OYOA 4X84A 2Z4PA 4Q7AA 2XY5A 1QUVA 1C0UA 2CNLB 4KJIA 3AH6A 1YJWS 3GJSB 4JYAF 1NB2A 1RTIA 1ED9A 5DO2A 1F3FA 3N79A 4YUDA 3PW2A 1EJ7L 1IBLJ 1KKHA 4B02A 1GMWD 3TO8A 2QE5A 2WBMA 4V1Ak 5L1KA 4B3SJ 3EGZA 4OHVA 2B56A 4FVCA 3NOCA 2AJQA 1WC5A 2CADA 4B3RF 3R5GA 4LIRA 3UVJA 1LW0A 2MZTA 4R5PA 1LQ9A 2AZ3A 2DH7A 1FKAF 1K1SA 2MZRA 2AYBA 2ERRA 3R5DA 4NWBA 2C2OB 4UW2A 4HT7A 3HMJG 1JLGA 3NS5A 3MUMP 5IJSA 4USJC 1SCJB 3M2UA 3BYRA 1FD2A 3BDEA 4J9QA 2AF6A 4DR6F 5DZ6A 4NMLA 2HRYA 4DSIA 3SQGA 4FF4A 1XWLA 4F2RA 3SBMA 2CNKB 1TL3B 3LP1B 5KFHA 2V4JB 3SI8A 2D3O1 4DV0J 2DVIA 2GX8A 4J9VA 5KFSA 2DNLA 4DQPA 3B8HA 4PABA 3DKDA 3UO0A 3WZ0A 1YRTA 2DGUA 4CYSA 5F9NA 1UKUA 4DPTA 1MROA 3L7PA 3CJ2A 1I5OB 2HURA 1RTDA 5IQ6A 2G0JA 3MR3A 4LF4F 4KSEB 3BREA 2IRXA 1KDNA 3C8YA 2CDQA 1NLKL 3MEKA 3MR5A 3FSXA 4RW4B 5T14A 3HLUA 3KHGA 3US5A 1VBKA 4LRDA 4MK7A 3CDBA 3QGPA 1HBOA 4PAAA 4KO0A 4ED2A 4Y65A 4FNHA 4JI1J 1M1HA 5J2NB 1K1QA 2U2FA 2D3OR 2VG5A 4O4RA 2CPDA 4KHPJ 4JP8A 4OV6A 2NUHA 2UXBF 3GP9A 2K7JA 2M0GB 3NG8A 3EICA 4ICLB 3FRYA 1X4HA 2KZZA 4ED8A 3L7UA 3CJ3A 2HIYA 2OAUA 1KQGB 2MQOA 3A52A 3Q86A 3QJJA 4NMXA 4IOAQ 3H20A 5K8PA 4KT0C 4HDHA 5KT2A 5H9FJ 1XNQF 3W62A 1HW8A 2ADCA 3I4PA 3CC4S 2MLYA 3BYPA 1PSDA 5HP1A 4MYUA 2MKYA 2B8PA 1YJVA 2HZAA 3NOGA 2EFVA 4URSA 3QO9A 5IFMA 4LRCA 5DRKA 4H4MA 4XPEA 3CJQA 3KNGA 2CRLA 4DSJA 2R4FA 4NLUA 3BSCA 1XEZA 4JI2F 1QY7A 1S10A 3A8EA 3M8QB 1FKPA 2IPOB 2DH9A 3X1LB 3MEGA 4X4RA 3W5YA 2QFIA 2E1RA 4PUOB 3DOMA 4ECVA 1S1UB 2Y8WA 2YX7A 2CPYA 1LWFA 3OJUA 3WX8A 3UNGC 2D41A 4B3TJ 3HSDA 1HYSA 1CJUA 2QA4S 4O3OA 2Y9HA 2I5JB 2DKOB 4ETXA 2GHVC 2AJFE 3MTJA 4OZ1A 5K4PA 4Z7CA 2GVDB 4JV5J 2BQRA 2I2YA 5CA5A 2HK2A 3DRYA 2UVWA 2PFFB 1RTJA 4J9KA 1U45A 2IRUA 2OPPA 2ZBCA 4HACA 1XQIA 3GIMA 4MIVA 2VF3A 1N34J 2BQUA 2G13A 4ZCLA 1MWQA 3LPYA 4DV7J 1DQ9A 4PXCA 1VLYA 3K5PA 2W2OP 2VASA 5E3PA 1KH9A 3HJFA 1M1GA 3B78A 2BR0A 4YR1A 2W9CB 3AT1B 3PYEA 4M5DA 2YQ0A 4NCAA 1Y7AA 2VQFF 2IDLA 4LR2A 3KWMA 3GFZA 3D54A 1JMTA 1K9MT 5E0OA 4AXJA 3OQ2A 2MKSA 3KHRA 3CUNA 3DU6A 1SH2A 3MAAB 3RZAA 1FFSB 4KKOB 3TJ9A 2W01A 1Q8LA 4LSZB 5IJQA 3AB2B 3C6TB 4HDGA 3SCKE 5IC6B 4NXMJ 4ELUA 1E3CP 2KTQA 2EKNA 5KAKA 1S6PB 2JEGA 3GQCA 1L3TA 1GTHA 1F60B 4Y00A 2E7XA 4KFBA 2BACA 3BF4A 1QSSA 4QU7A 2BV3A 3BSAA 3FBEA 3NS7B 1K47A 4ZOSA 2E29A 3J7A1 2NZCA 2L3MA 5JVGQ 1FHTA 3MD3A 4DUTA 5K20B 2F4VJ 2O3DA 3C6UB 2ANHA 2ASYA 2B6AB 5I42A 4N56A 4CLUA 1RHJB 1KWMA 1JJ4A 4F8RA 1S49A 4RU2A 2DITA 4GO5X 5DLTA 2LCWA 4R8UA 1LXJA 5EUHA 2CQ4A 1R8AA 1CJKA 1RB0A 2VU5A 4TVAB 3I9ZA 1S12A 1ZZFA 1IVZA 3J81U 2ZVSA 1IQZA 4CT8A 1P1TA 2R2TA 3U1MA 4EU0A 3IM9A 3S1TA 3BH6B 2N3OA 2EFGA 1JLQB 2PD1A 2E5LF 4J9RA 5K8MA 1HWIA 1VQYA 4CLZA 1ALKA 4JV2A 2EC2A 4WP9A 5K9FA 2OEMA 2CQ3A 4NWXA 3ZTOA 3CF5Q 2OJ3A 3FFIB 1S1XB 2XLKA 5A8KA 4QWCA 4F4YA 3Q22A 2W25A 4BC7A 2JHEA 4ZPBA 3I0RA 2YWGA 3PX0A 1A6LA 2CQIA 1CLFA 3QWPA 4IH5A 3ILLA 1X5TA 2NUUG 4IG3A 2RU3A 4RUAA 4C3KA 4TYAA 2RRAA 1HQAA 4DWIA 1NEEA 4A47A 4NLQA 1S9EB 2ZNZA 2BW7A 1IM6A 4OX9J 2FJXA 3T9ZA 1TKZA 2VODA 1ELYA 4OFZA 3N0VA 1QAJA 2B9XA 2XR9A 2BJ1A 3MK2A 1ELZA 2ASJA 3VAFA 1U09A 3QT7A 2DHGA 3WAYA 3BR8A 3OSNA 3AAWB 5IXUA 1WNEA 1HBUB 1SC1B 2CQDA 5FDLA 1C4AA 1LW0B 5C2GA 1CPZA 5E33A 2CJAA 3JS9A 3LA0A 3UW1A 2BEFA 4O44B 1X4CA 3QRRA 2V5HG 3IWLA 4YB1P 1JLGB 2JEIA 4F26A 3DGPA 4B56A 4LRFA 1T9YA 4OHWA 1R0AA 2FJWA 3D6HB 3NKOA 4IQMA 3SQGB 2ZH8A 1IBKF 2I9SA 1E6YA 4ED7A 5I3PA 4PQAA 3MM9B 4DV5F 3LAKA 3VGSA 4L75A 5DLGA 1CG2A 1KHNA 3P45B 4USHA 4CXSA 2WBRA 2G4BA 3PW7A 5F8LA 1FJGF 2ZE2A 2HFUA 2RB7A 3ETMA 3QRPA 2LQ9A 1YHQS 1WC3A 5KOXA 1S77D 1FDAA 3ENVA 4OZ0A 4W92B 3FCVA 1N33F 2Y8YA 1LNQA 1PAUB 5K5MA 1H2TZ 1PYSB 1LV5A 1X9MA 4JI7F 2YX4A 4C0BA 2OPRA 3NGTA 4KH0B 1AROP 4YDXA 4CO1A 1UL3A 4QAXA 1MN7A 3OTOF 1UFWA 4NE9C 2YWKA 2FHJD 2K8GA 3WC2A 4USIA 5J1PA 2PFDA 3LH2S 1EHWA 3H42A 1HD0A 4P2XA 3CPWR 5C25A 5DQIA 2PMHA 4NWJA 1HBOB 1UPPA 1X4DA 2YKNB 1MU2A 4NI2A 4Y2KA 2XG8A 3LAMA 4ZP6A 2RAQA 3M9MB 1NK5A 5L0KA 4NEZA 1HKAA 3MOJB 3KK3A 3DYCA 1XMQF 1BY9A 3GIKA 5KG1A 3C66A 1G3OA 4CP5A 3UR3C 4O3SA 2R7RA 1GTEA 1IKWA 2IFXA 2GQQA 1N5VA 4H54A 5LIAA 4NLGA 1C1CA 4NPOA 4TY9A 3PFEA 4E0DA 1IR1A 3ZZTA 1FXLA 3VALA 1EQMA 3VAMA 3C16A 3TARA 2WONA 4RUBA 2PDAA 1QUPA 4Y6IA 1WDDA 2YKPA 1IKXA 2XMTA 2IJRA 2AJ0A 3PO4A 2DJWA 2CNNB 4A8FA 2WVDA 1IQTA 1FDBA 5L9NA 2MJNA 3KUHA 3RG6A 1Y0HA 2BBEA 2KRBA 2IJNA 3ULHA 1VK3A 3W65A 1MW7A 4JI6F 3MEGB 2F1FA 3Q8UA 2PI5A 1RYSA 3OVBA 6FD1A 3G96A 5EWFA 1C0TB 3QT6A 4OI3A 3T9NA 1LWFB 2ZWOA 4EGLA 3JSBA 5BXIA 2FYXA 3IP0A 2YBVA 4JYAJ 1FO1A 2JOQA 1NCLA 1HYSB 3UWTA 2QV6A 1HNXJ 1YWXA 5A8RA 4W98A 2R9LA 2E66A 3RB0A 2XS2A 1PJ6A 4ZITA 2OTLS 4IFYB 2MTLA 3LQVA 5KG0A 1T9WA 2FHOB 1SV5A 1WORA 2YPYA 1D9DA 1OPIA 3PJWA 1P8GA 1NBEB 1VBYA 2HHPA 4MTPA 1RWKB 2P9EA 2RILA 1RT1A 2MB0B 1NKBA 2C3YA 4ZP7A 4NLTA 4OI6A 4ELVA 3AXKA 1KSPA 1HA1A 3PO5A 1VQSA 1BE4A 1O98A 2C2MB 4DR3F 4DR6J 3OBIA 4FF1A 1TL7A 5L39A 1RAIB 3BSOA 3TRGA 3G82B 2WTFA 1IKVB 3IDDA 2JLFA 3D67A 2FIUA 2K06A 1VJQA 4DR4F 2NZ4A 3WX4A 3QATA 1HNZF 2B51A 1NXIA 1UJ5A 2IDEA 1ANIA 1JNRB 3VF0B 1WHVA 3UN3A 4C8MA 3CMRA 5KFLA 4QIVA 5IC4B 2D7SA 5M2PA 2B7BB 2ZBRA 3RBEA 5F9LA 3MECB 1RHQB 2RKIA 4LF4J 4X4QA 3D0GE 2LU1A 2MQLA 1U1NA 1SJ4P 3M8WA 3HFKA 4ZKAA 2AT1B 1TK8A 1O0PA 3UD3P 3FMBA 1NDKA 1NJXA 2BW2A 1R0BG 2IY5B 4YB5A 3PACA 5HSPA 3RW6A 5LRNA 4C8LA 2ZC4A 1ZOTA 4DL6A 4KHRA 1NK4A 3A4TA 3TQ1A 2VFRA 2UXBJ 4U7UD 4R8UB 3IWXA 2IVFB 5KT3A 2O1PA 2QX0A 3NCQA 2VC0A 5AT1B 1CJKB 1DURA 3M32A 4L3KA 4RBTA 4NYZA 1RWOB 4P2MA 1JKHA 2E5IA 4IH6A 1RSCA 1NSAA 1XJWB 1FE4A 3PV8A 1AFIA 5F8NA 3MAHA 4ZLJA 3MR6A 1M5HA 1XNQJ 2RDIA 4DQSA 3R27A 4EYHB 2KJWA 1M5SA 3HHEA 1DY3A 5D6GA 4IOCQ 2E1MC 1HBNA 3PIOQ 1WKKA 1NH8A 4B9MA 2KZMA 1FVQA 1VQ5S 1FJEB 2DNHA 4TN0A 2VKZG 3I0RB 1B99A 4AE5A 3BS9A 3CCRS 1LWCA 2Z2MA 3P49B 3SDEB 2MDAA 3QIPA 4NLDA 3SSSA 1BC6A 5B0GA 4F0KA 3CDEA 3AOCA 2GCFA 2ZDOA 5GOVA 3CCMS 3LGNA 5HQLA 5CZXA 4ECWA 2D74B 1U0HB 2RRBA 5F8JA 2NQPA 2JEJA 2BYCA 2UV8G 3L09A 4RNNA 3AD7C 4EBDA 2IUCA 3MFIA 1N88A 1TKZB 3NKMA 2PO4A 2RQMA 4F3QA 3PXGa 1SL0A 3V6HA 1H6KX 4J7CA 1VS3A 1S1WB 3M1VA 4DPOA 4I0WA 4N8NA 3LGHA 5KFPA 5EGEA 2DR9A 4B9LA 2HVDA 4F4XA 1F9HA 2UXDF 4AD6A 3KLEA 5FDLB 3O2IA 4ZLNA 2LFVA 1N2KA 3NGDA 1KQSR 5GADI 4RKUC 4RJVA 3I56S 2X1GA 3OTCA 4F4AA 5INHA 2Z56B 1T9XA 3DHXA 1RT5A 2A2DA 4TN2A 4DR2F 4HHJA 5AXLA 2PSZA 4V19J 4RL1A 2RRNA 2R8GA 4K4WA 2E5HA 3N6MA 4A8KA 2XMMA 2N4CA 1E6YB 4N77A 1DAXA 5T7LB 2M8HA 1WSVA 3QSYB 3V4MA 4PZVA 2I38A 2LEAA 3AA9A 2AP6A 4F25A 2CJ9A 4WZMA 4MHXA 4LF2A 2VPYB 2V0NA 2E1PA 1FVSA 5LXRA 3NL0A 4PWDB 1CULB 3AODA 2ZHAA 3HM9A 2OPRB 2D9OA 4P71A 2FGOA 3M6XA 4PXBA 2KB2A 4J9LA 4MY4A 5KT5A 2I1RA 4M63A 5L46A 2JWNA 4ID8A 8AT1B 1KLMA 1EW9A 2FC9A 1Y5NB 2KT3A 4ZVSB 5E3QA 3MF5A 3MMBA 2A10A 4DQQA 2ZITA 4KAVA 4FZVA 1TV6B 5C25B 3G6VA 2BJ7A 4NZ0A 4PPDA 4GTYA 2AZ1A 1FESA 1MU2B 1WG5A 3JYTB 4M95A 2O01C 1UVKA 1Q78A 2W7PA 3KK2A 1S4EA 4Q5VA 4ZK7M 3OV7A 1YTYA 3ZZYA 1X9SA 3TEGA 2QG9B 4WP3A 2EBEA 2GMLA 3IRXA 5DLVA 1KONA 1WI8A 3UCUP 5F3TA 1YZ6A 4WTYA 3SFUA 1HHQA 4TQSA 2E5LJ 4A8XA 4LF8F 4CO2A 3TJAA 4U8VA 3G8QA 2RSQA 1JLEA 1LWEA 4WF9Q 3HSGA 4LRAA 4NZ7A 3FEYB 2XULA 2KXNB 1U2FA 2WONB 3LP2A 1GT8A 3FQLA 1WTFA 4ED0A 2VICA 1SH0A 1BQXA 5IT9U 3NRBA 2YKOA 2FVQA 1C4CA 2QMUB 5KG5A 5EN1A 1GX5A 2UUBJ 3MMCA 4BWMA 3M6VA 1O8BA 2AX1A 2BQ3A 2XO6A 2RU9A 2W9AA 1Q5YA 2XSJB 1LW2B 2V67A 4USMA 1EQ0A 3H8YA 2ATCB 5IT0A 4N41A 5LM7E 4UPLA 4A48A 3NKQA 3KUEA 2LYVA 2DNMA 5LSRA 1V3RA 3I9V9 3PRVA 5DLFA 3HCXA 1PYOB 5L9XA 4J9OA 1NK0A 4ILMA 5E7OB 2IM0A 2Y0SD 1YSJA 1M0SA 5B0CA 3NGRA 1NDLA 4PG5A 5A8RB 4KTQA 3KMQA 3PX6A 3CJKA 2FJVA 5D77A 2BM0A 1U48A 1SV5B 3KDOA 4X4PA 3K5MA 1FFGB 2IAJA 4A8WA 5C5JA 2CG4A 5HN0A 4TLQA 1BLUA 2H4WB 2V69A 2XMKA 4ETZA 5IV3A 3Q23A 1FF2A 2J0QD 3Q83A 4CLPA 1RT1B 1VQPS 3OL6A 1KHLA 2JDJA 2LU2A 2D3UA 5IM0B 1A0OB 4TY8A 3FUYA 3CJRA 1XTZA 2HFNA 3FCWA 2QRRA 4EBCA 3E8OA 1TL7B 4ED1A 4KE5A 3HD1A 2CQGA 1RCOB 4DV5J 3NS6A 3J7ZT 3MGJA 2P5VA 3WAXA 4JI4F 3A8JA 3IBFB 2XQCA 2GGPA 4ZPVR 3CT9A 2QZ8A 2VZ9A 3F0NA 4DJBA 2KXHA 3CJSA 3NEKA 4GKKF 3FVYA 3L9ZA 2ASLA 3QT8A 4HHHA 2C2NA 1Q86T 4IG0B 3AJ1A 1N33J 2V4QA 4JI8F 3BGFA 4JI3F 4JI7J 2WHOA 4USTA 5C24A 2IIHA 4CXKA 3BEGB 1JXVA 2KHCA 1HI0P 2KI2A 6FDRA 1T9TA 3T1YF 2GJ2A 1WACA 3I0SA 3MPYA 1YBUA 1AJAA 2U1AA 3RR8A 3OPKA 2Z2YB 3QJPA 4ZVEA 1UA1A 2HS0A 5HL7Q 2X7IA 1ZS6A 3MCMA 1SH3A 4I2QB 4DF8A 4RNHA 1Q8IA 2NPFA 4WCEQ 2LEPA 1DLOA 1I94F 1HW9A 2LXUA 3NGUA 4UOFA 4NLVA 3GFXA 5D4LA 9ATCB 1FKOA 4ZDNA 4JI0F 1T05B 1N36F 4O3RA 1CJTA 3TA1A 3M32B 1R8BA 4OMFG 1PKUA 4K4YA 5D4NA 3BV8A 4RNFA 2W8LA 2DIUA 3U1LA 1VIOA 3HT3A 2BOPA 5CYMA 4YMEA 4ED4A 3D0IE 4IDKB 3RAMA 2MEWA 5IS2A 2KYXA 1HBNB 5HQ8A 3LGMA 4X2BA 4Q0BA 2E44A 3DLGA 3OR1B 1F9EB 5KFIA 3CIZA 1D3WA 4UTGA 3DI6A 4YR0A 2OP5A 1U1MA 1LWCB 3QIPB 4JI6J 3BO2A 4CM2A 1KTVA 2EVZA 1HJKA 2HMIA 4OYAA 3VAIA 3DXSX 2DHSA 2KM8B 3JSRA 1DARA 2ALZA 4YY3F 1RA6A 2DGOA 1S99A 2RH3A 3QPIA 3V4IA 2ACYA 2IUCB 3TX8A 4UUWA 4NCBA 4HLBA 2XS7A 4FKYA 3GV7B 4ZG9A 5CZVA 1FRIA 4G3IA 3M1VB 2CXEA 1ANJA 4CLFA 2QL7B 1NJYA 1RP5A 2K1RA 3ENWA 4FS2A 4BC9A 4WFNQ 3NVLA 3H7HB 4GTXA 4YHHF 3OL8A 2PA3A 1UA0A 1H73A 1RT5B 2FJAB 1NM2A 4GTZA 4DR3J 2DXDA 4FYYB 2H5JB 2XRGA 5KFTA 4LF6F 4Y2MA 3GIIA 2F7VA 4DFJA 4FBUA 2A3JA 1S1VA 1T3OA 2ROGA 3QIDA 2Q1LA 1N0UA 2POKA 1H72C 1X4FA 3PR5B 2IBOA 1FK9B 4CLWA 3GV5B 4DR4J 1T8EA 1CQMA 3Q2SC 1GEHA 4ZN3A 3T5LA 1MN9A 4S0MA 1TELA 2A6MA 1KC8T 2PI4A 2R8JA 5CAAA 3AJ2A 2R42A 3THTA 2DGXA 4ECUA 4K4UA 1FRKA 1NPRA 3ZNJ1 4F4ZA 4DS5A 3G6XA 4CTAA 4UOCA 4DFMA 1NDPA 1SIWB 2BX6A 3QJLA 3DOKA 4DFPA 4DL5A 5IWAF 3JAMY 2MQPA 1RLDA 1ZTTA 4K5SA 1YJUA 3IGYB 1N0VC 3J7AN 3PCOB 1KLMB 4OYIA 1IN0A 4P9SA 4NA1A 2UP1A 1Z2ZA 2NLWA 5THWA 1SC3B 3H98A 4ERDA 3MMBB 1DTQA 3PRBA 2IC3B 4DR7F 4IQXA 1FTCA 2MQNA 2OFGX 1K8AT 5GMDA 4BS2A 1VQ8S 3K5OA 2BMBA 3QFWA 4L74A 1PBUA 1H38A 4OYWA 2C2KB 3FEXB 4QW8A 4CRJA 1Q1KA 1T03B 2V6AA 3WIVA 3BN7A 5AXKA 4C11A 1ZEBA 2FC8A 1F5CA 1BQMB 1SC6A 2NXNA 3OR2B 3DRSB 2EPIA 2DY9A 3T19A 4RNOA 2J9DE 2Y1IA 2JVOA 2QO3A 1QE1A 1NPKA 2R7SA 1T02A 1URNA 2ADBA 4ZPCA 2WAQD 3FEZA 4LF7J 4JV0A 3RJMB 1LWEB 2DGTA 4FYWB 4X66F 5ITHA 2Q6BA 3WAVA 2RF2B 2FDNA 4CO3A 4DPUA 1FE0A 3KNAA 2DTJA 4AT1B 4PPZA 3M9NB 2GSUA 3EVMA 3ZFVA 3RB4A 4JV1A 3HT0A 1OMSA 1PILA 2XI2A 2B43A 3M2VB 5J1EA 4RNMA 5KFFA 1AYEA 3CE8A 4M5MA 1RYRA 1VRQC 1NK7A 2W9BA 1GXLA 4Z2XA 2QLBB 4DS4A 1X0PA 3W3SA 1WSRA 4PXEA 3W66A 3C15A 4HT5A 3PW0A 2COLA 1NJZA 3BBCA 2J9EA 4NCGA 1QAXA 2GMJA 3CCUS 4QR2A 1FDNA 1S1TA 1JLBA 1XN9A 3CW2C 3CJKB 4ZJOA 2CPHA 4EZ9A 2BVZA 2DGWA 5DG7A 3KLFA 4ER8A 2IMOA 1S4FA 4MIBA 4L3NA 4U67Q 5CCLA 3W9JA 5M2UA 1YJ9S 4ILLA 2BABA 1HWLA 1JLFB 2A2CA 3ADAC 4B08A 2VQRA 4YR3A 4M5HA 4DV1F 3GIJA 3I5AA 2YXLA 3QFHA 5KT4A 1RT7B 1LXNA 3KG0A 3MEDA 3TOQA 2V63A 5HVHA 2YNFA 3G8SA 2LXIA 2WW4A 2V2QA 4ZCKA 3PJXA 5CABA 2FVRA 2LKZA 4Y2CA 1MLAA 1R3NA 3GCWP 3SEOA 1F1BB 4C8KA 2ZDPA 2DHAA 3M05A 3OHAA 3OXFA 1XMBA 4PQUB 2RS8A 1Q0NA 2I8EA 2NXJA 2WSEC 5C66A 1TVRB 3DPCA 2DIVA 5IV4A 2E9ZA 2HQDA 1KOOA 1R43A 4RBVA 1ZM2A 4DG1B 1HWJA 1G2EA 5C24B 2G0CA 5A2QY 7FDRA 1F9FA 4UF4A 1CJVA 1DZ5A 4CDIA 4FBTA 3W5ZA 5BJRA 2ABYA 5HMZA 3HKWA 4NLRA 1YGYA 1IKYB 4IR9A 2LQ8A 2AJ1A 2W2QP 4CCHA 4UPHA 4HH0A 3C46A 1U8WA 3DLEA 1LFPA 1SKRA 3LOUA 4OYXA 1IR0A 5AE1A 2CA9A 1EETB 3SCIE 1Y11A 1N56A 1UWAA 1YVFA 4DUZJ 2RDJA 1RAHB 1RUSA 4DR5F 4X65J 2CZ4A 1AJBA 2L9DA 4OJGA 1CSJA 2QMXA 4BHQA 5EGYA 1VRTA 1XK8A 2M2BA 5HMXA 1PCAA 2AJ2A 3KLHB 2GW8A 5CD4H 3THVA 2YQ1A 2LDIA 4LFBF 3W63A 5CYMB 3UDLA 1RHRB 1S48A 4B3MF 3AQOA 1JJHA 4K4SA 4Q0BB 1VK8A 3DLGB 4USWA 3SCLE 2YH0A 2HVZA 4GMKA 3PNIA 3LP1A 2V4JA 4NLOA 4KPYA 3MURP 3DI6B 4DPYA 3KXDA 1ZAWA 5JMNA 3TI0A 3KMSA 1EW8A 3T1AA 4OJ1A 2HMIB 2WVFA 5HLFB 4ZPDA 4C4WA 1DTTA 1N32F 1QTMA 2LLZA 5LQQA 2XMAA 4F0HA 3NGSA 4CLKA 3CD0A 4K2XA 5CQGA 5EWGA 2HNZB 4E8UA 4RUCA 3MPVA 4WYWA 4XIUA 3HVAA 1RHMB 4RW7B 1UW4A 3K57A 1VRUB 2K1RB 3DYAA 4FYVB 1KHJA 1ZM4A 3OL7A 1WHXA 4LF5F 1JK9B 2VDIA 3ETOA 2GA3A 4I64A 1S57A 3H2LA 1WOSA 4LF9J 3B6BA 1X4GA 2MJUA 3HD2A 2CQHA 1NDCA 2QZUA 5HATA 5E3CA 4ZPAA 3FDSA 4OV1A 2XB2D 3LWLA 2EK6A 1FXRA 1P27B 3TVZA 1CQNA 4ICLA 2UZAA 1NH7A 3TVYA 1YRXA 4F02A 2Y1JA 4CLTA 3GG0A 2FY1A 5LMNF 1T7PA 1Q8BA 4JI4J 4X4TA 5CYQA 4Q44A 4IO9Q 1GXUA 2MY7A 2KYZA 1ZM9A 4ZVTB 4KPCA 2D3ZA 2RVJA 4GKKJ 3EZ5A 4C2MA 4L76A 1X31C 4OJHA 4JI8J 4ED3A 1S5ZA 3Q3QA 1KP6A 4JI3J 2PEBA 3EZUA 2IVMA 1NKEA 3M8YA 3N6NA 1VCTA 3BQ2A 3T5JA 2BXJA 2DNOA 2ZUAA 3T1YJ 1YQHA 4A8QA 1N52B 5B08A 3GU0A 3GJQB 4OLPA 4PUOA 2DB1A 2XLJA 3IXQA 3CD7A 2AWZA 4ZG6A 2G9YA 3Q8RB 1DTQB 2DNYA 4LRBA 2C3MA 2I5JA 4UUXA 2VG6B 5KFRA 3KG1A 5K8NA 3D28A 1I94J 3MWBA 1YBTA 2YNIB 2GVDA 3OT9A 4XAKA 3QZ7A 1N36J 3Q8SB 2OPSA 4C11B 1UJ4A 4RBUA 2PEHA 1QAIA 3TZZA 4YP3A 2WB1D 4URQU 2ACMA 2P6TA 3IGVA 3MI7X 2EFNA 4FDIA 2VHGA 1QM9A 4DV3J 1TKTB 3OW2R 4KQZA 2BDPA 4DV2F 1SXLA 2AJ4A 1QE1B 1OWXA 2HHHF 4KJDA 3ZTSA 2V2ZA 1RHUB 3H40A 1SL1A 2ZOGA 1XR6A 1OSCA 5J2MB 2W9CA 1W7WA 1TAQA 4RU9A 2QLFB 1BXNA 2Y3YA 4K5RA 3CCES 1UZDA 1SQEA 4CYRA 1JLAA 4J37A 3K0JA 4CLSA 3OTDA 4USUA 1SPBP 4ZS6A 3AD9C 3L7OA 3GTYX 2DGSA 3WC0A 3IS9B 2CWXA 4K50A 3W8GA 1KVJA 3O8WA 2W9BB 4O3PA 1YX2A 2R8HA 1RACB 3IBWA 3QQCD 2XY7A 1EW2A 3V6KA 2FUG9 3CJ4A 4DEZA 4J9PA 4KC5A 3TYTA 4NCGB 2ALYB 3DU5A 3D6FB 2R7UA 2VH7A 1S1TB 4DR1F 4DN9A 1JLBB 4U7CA 2IA0A 2SXLA 1R8CA 5DGBA 1RK8A 2DRBA 1ZZNA 2HK3A 2CPFA 2KH9A 3KLFB 2IMWP 3LUYA 5LXYA 2HNYB 4ANCA 2RUSA 3HZGA 1UW9A 3C6UA 4I1TA 2B6AA 1VQLS 3PEJA 1URBA 2DNGA 3ILIA 9RUBA 3PW4A 2QA4G 3UD4P 3QYYA 2CWKA 2CPJA 2YNFB 4ZJQA 3DRXA 3T41A 3JQKA 1J5OB 1T94A 2ZNYA 4LR9A 7FD1A 4XDDA 1RAJA 3J81Y 2AHOB 4AYBD 4FDJA 2J7WA 2XMWA 2BRLA 3IG1B 1NB7A 1U7LA 4OZ3A 4GRSA 4O0IA 1FNMA 5M2RA 3FFIA 1S1XA 2QFJA 3D6TB 3BGRA 2ZM6F 2XMJA 3TEHB 2V9WA 1XC9A 2GSOA 4U9RA 2EI5A 2ZKTA 4B9NA 3TAMA 2BJ8A 4DX8H 3UCZP 4WFXA 1GX6A 3FCHA 2QA2A 1KN6A 4C8OA 1JB0C 2RIJA 1B8JA 4G1QB 4I7FB 1DBDA 1YJNS 2Q79A 1H98A 4OZLA 4TLRA 2DR6A 2OMLA 2FGCA 4CLYA 1V5VA 2RS2A 1Y5IB 4QCLA 2ZJPQ 1F3VA 2H54B 3MM7A 2BKPA 2EG1A 3PM9A 4QJVA 2ZKUA 2Z30B 1MWZA 3DLEB 3EVWA 5F8IA 2QIFA 4CNYA 2KG0A 1NJWA 3P6YC 5KG6A 2C28A 2XEXA 3BQ0A 2W4DA 3C19A 1HBUA 4KJGA 3VZHA 2JX2A 1UFLA 2CQ1A 2WSFC 3PHEA 2OHDA 2MKJA 1AJDA 3HVTB 3O3LA 2H48B 5I3UA 2DNNA 1J5EJ 4IR1A 3BJYA 4DL2A 1VRTB 4MMOA 1FXDA 4O44A 2DISA 2IM2A 5AE3A 4ZIWA 1Z4UA 2Z57B 2XCAA 3U1NA 3T5HA 2XYHB 2WZ1A 2B7CB 5KFEA 3MCNA 1S72S 1OSDA 5KG3A 4KBIA 2OMOA 2KJVA 5KT6A 2X51A 3HKZD 3AD8C 5J1NA 4ALZA 3MM9A 3MOZA 2CJYB 3SSRA 2HQGA 5FIIA 4CH0S 4MKYA 5FLXU 3MK1A 3OFGA 3M6UA 1HPZA 5E41A 4WFYA 3UR0A 4LFAF 1NZ8A 1FDDA 3IN5A 2KL8A 1DTTB 3KD8A 1VI7A 3CDUA 3IC1A 4WXWA 1Q95G 2K3KA 4B3OA 1SJFA 4DX5A 4NEYA 2DRDA 5IZHA 1YJ7A 3B82A 3TWZA 1RT4B 2QL9B 2DPIA 2E1CA 2KFYA 4V19X 1OJ4A 4OL8A 3K7RA 1Q53A 2G9OA 1UPMB 4FNIA 1HHTP 3ISZA 2UXCF 4DHVA 3DYAB 1L3VA 2C3PA 5K8OA 3CCVS 2YKNA 3BBFA 2XNQA 3V6DB 1RCXB 3SYZA 5HI7A 1YLXA 3ED4A 2M8DB 4DSFA 1HR0F 3TP2A 3CXCR 1FWLA 4MJKA 1S0VA 1NHVA 3P5TL 4X64F 1BMQB 2DHXA 4LFCJ 4ZIVA 1R27B 5CH7B 3HO1A 2V4RA 1BHNA 3EDQB 4U95A 1SVDA 3ILOA 1K0VA 5ETKA 3S6EA 2K2PA 5D15A 4F7VA 3LANA 2EW9A 1S76D 5CYQB 4C3LA 1X0FA 3NNHA 2CVIA 2GJFA 3J7YI 3K2YA 5HBMB 4IH7A 3R7NB 3BM7A 4CXUA 2GO9A 3WAWA 2VIHA 1EI6A 1K44A 2PA8D 3H90A 3LF0A 2V8VA 1IBLF 1WF0A 1AA1B 2HW3A 3BDGB 5HANA 2VD3A 3HFZB 4UQGA 3EXYA 1RWXB 2FHMA 1MG7A 2LMIA 1PJ5A 4B3SF 1U8SA 5DDQC 4F3OA 3FSYA 1B0PA 1EIYB 2Z0GA 4DZDA 1KVIA 2OPQB 3Q89A 4NA2A 1PC4A 3MXHP 4BBYA 2C2ZB 2M3DA 2AEFA 2XMUA 1C0TA 4H4OB 2H5EA 2R2SA 2RT3A 2AEJA 3R8YA 4IYQA 2KM8C 3HSZA 1FX2A 4ZA1A 2H5IB 4ZPWR 3LO3A 3KJVB 2DXFA 1PG5B 2BJDA 4ZVFA 2AV5A 4IFYA 1TUGB 3B4DA 3DGVA 3DOLA 4CO4A 4Q43A 5KFWA 1OQ3A 1Q7YT 1FSUA 4WYLA 3Q2TC 2OPSB 3W2VB 2W7AA 2EXUA 2C3UA 1D9FA 4FN5A 3R6LB 2DRAA 1ZA2B 1WD6A 2NXEA 4LFBJ 1DFDA 3UN2A 5KOWA 1CC8A 1ZETA 3DDIA 3JSMA 1YG0A 1WF2A 2HNDA 1JLCB 4B3MJ 4NLYA 2HFOA 4ZCMA 3TAPA 3BPDA 4KAYA 2MHNA 4QYZK 1JLAB 4YQWA 4LF1A 3G82A 3J7Z5 1IKVA 1XR5A 1S59A 4YFUA 2YNGA 1I1GA 2M9KA 4ZVGA 2M52A 2FHJA 2B4PA 3UFCX 4HH1A 5SUHA 1NK6A 3IR6B 4JI1F 1VC5A 4CT9A 1S0NA 1N32J 1KFDA 3FC9A 1F0XA 3UQSA 2XO7A 3ISND 1SUQA 1VQ9S 3D68A 4FXWA 2W5WA 3CD5A 3KLIB 1VBXA 3MECA 1IXKA 1N5TA 1WC6A 3HVRA 2QLWA 3Q8VA 1TL5A 4WE1B 1T95A 2C42A 3PIPQ 2KHDA 1S9GA 5ETPA 4YOEA 2F3JA 4RW9B 3CDWA 4PG6A 1ULRA 3OTEA 3VVTA 2B4VA 3MM6A 2HQ3A 2HVIA 4NRUA 4CI0B 2W5RA 1WJ9A 1X9WA 4G1IA 2W4PA 3CCJS 2HRUA 2KU7A 4AFFA 4J9NA 4Q8EA 2V9KA 4NX9A 5KFKA 2X3GA 5F8HA 1HQ2A 2EK1A 2I0XA 3NNCA 2C2DA 1KLNA 5GAGI 1RAAB 2MLXA 4KGKA 2DHHA 4O23A 2APOA 3FQKA 1M5VC 2GMHA 2XBPA 3PDNA 5LOQA 4U96A 2XM3A 2BKNA 4J9MA 1TP7A 2VA2A 2AGQA 2RQCA 1TUWA 3CCZA 2VJVA 2H4YB 3ZTRA 3I5CA 2GAHC 4Z7YA 1JJ2R 1ACMB 1P9YA 1EARA 2LA6A 3I87A 3SMZA 5DG8A 4DL7A 3BGRB 5KG2A 3ELHA 1S7HA 1HQUA 4ECXA 3BBBA 3TAMB 3MHYA 5F0UA 2HS3A 4K7QA 1FFWB 3SDEA 2OLWA 4DV4J 1LOUA 2CYYA 1PAEX 3EXCX 1ED8A 3TZYA 1WHWA 4CH1A 2DNRA 2E7VA 5LMUF 3HK2A 2EWHA 5DDRC 2ZOMA 4DV7F 3NKPA 2ILYA 1IR2A 3Q24A 3F44A 1EKSA 1U0HA 4BCAA 3L4BC 4DX7A 3MTKA 1UVLA 1DJ0A 2DXEA 1B0VA 3UDCA 4I6YA 1OS5A 3R2DJ 3MM7B 3FK4A 4USKA 2DPJA 4GC6A 3NXZA 2JZ5A 1WG4A 2VFVA 1S1WA 2CNOB 3QLHA 3VGTA 2VBXA 3QZ8A 3N6LA 5F8GA 1AZSA 3QGIA 4Q45A 1GMUA 2HHUA 2W5QA 5I3UB 2IA6A 2F8MA 4ANDA 2HHHJ 3SSQA 2GFFA 3DFEA 4NXMF 2HZCA 3HF5A 3POTB 2L08A 3KTQA 5GMEA 5C42A 5DM6Q 4O0NA 3BN4A 2PC6A 1RWUA 2W2PP 4GVLA 2LQ5A 1WC0A 2V68A 1ALJA 3DLHA 2M88A 3EYZA 2VQEF 4PG7A 3J7YU 2C2EA 4ES1A 4Y0FA 4GKJJ 5T7LA 4DL0C 2Q6CA 3IO1A 3M8RA 1IBMF 1WUUA 2JL9A 4X4OA 4X62J 5KXAA 3W9HA 2NPIA 4OYMA 2F4VF 1HPZB 5G4DA 2V8DA 4Z37A 4LQYA 1KH5A 2ZHOA 2XZDB 3L3CA 1BWEA 2ZVIA 5E3RA 4PWDA 1CULA 1DQ8A 1FJCA 1W2IA 2VDHA 1I51B 4B3OB 2Z2ZA 4CQ1A 4DR1J 5IQQA 1GAOA 1DQAA 2GC8A 2BM1A 1U1KA 5L1IA 2DK2A 3GR0A 3LW5C 4MK9A 3NMRA 2HHXA 1KR4A 1ZA1B 2Y0BB 1TK5A 1S0MA 4W90B 4N8OA 1TV6A 2FJEB 3F73A 1Y9OA 2MKCA 4OX7A 3TZWA 3JYTA 4AXIA 4C48A 3NBPB 2VBWA 1U4BA 2PGCA 3ENQA 2WCXA 1VOMA 3JAMU 3PJ9A 3IAM9 3VQTA 4FPIA 1U6FA 2VOOA 4OI0A 1XMOJ 3Q8QB 4LQ3A 2K7KA 3B54A 3OLAA 3PKMA 5GVQA 3PFOA 2B8QA 4ES3A 2MY8A 1GXTA 3DDKA 5LSLA 3UNYA 1IJFB 3CMAS 5E3AA 2NYHA 5U47A 2BRKA 4NYOA 3EVOA 3ZTPA 5MAOA 3J80Y 1IUJA 1L3KA 3PR4A 2YKQA 5E5NA 3UDEA 3RGIA 1RTHB 2ZM6J 1X4BA 4PEOA 2QSFA 1NK9A 2GZOA 1EQJA 2AU0A 2HS4A 3M30B 4QIWD 1YKWA 3DXBA 5KFCA 3K58A 2XSJA 2CPZA 3ONQA 1LW2A 4TKTA 1QAYA 2OFHX 2J9CA 1U0SA 3LP0A 1B64A 2ZZMA 3Q0AA 3VTIA 1MWYA 5D0EA 1TR0A 2B9WA 3CCTA 2GO8A 1UTAA 4KGVB 2W2NP 4KR0B 5KFAA 3DRPA 2J8SA 2R2RA 2VPWB 4A8YA 5EX3A 3DOLB 1AXQA 2KT2A 2VBYA 3H0PA 4HVZA 1TFYA 4B3RJ 3FBBA 1E33P 4YS2A 2XS5A 3P4UB 5B0EA 5GAGU 3CTRA 1GMVA 5IM0A 2VFTA 3BGLA 1TUVA 2X1BA 1C1BB 1BUXA 2CIMA 3JSMB 1NMEB 2HNDB 1ZYQA 1FJ7A 1WOPA 3OUYA 5HAOA 4LQ9A 3DM2B 3O44A 2B4UA 1JNZB 4NRTA 1JIHA 4QYRA 2B9EA 2XHCA 2E5GA 1M1KT 3NWGA 1PBAA 2QT7A 4LMZA 3R1HA 2YNGB 5KFYA 2G0IA 2F8HA 3BQ1A 1L5UA 3N5BA 5DDPC 1FA0A 5LT5A 2YWWA 4C7QA 1APSA 2H1YA 4FYDA 4XDCA 2VFSA 4IG0A 5A0YB 1SUQB 2GIRA 3G8TA 5D4PA 3AJDA 4LSLB 3VVUA 4H4KA 2AEMA 1E1ZP 2DNKA 2MZ1A 1H74A 4C8NA 3NGKA 3CEDA 2BUNA 4UOOA 1S9GB 3BGUA 3UI3A 2E1AA 1HL6A 3R5BA 1VC6A 3B5QA 3MM6B 2UXCJ 5DM7Q 3R97A 4DDFA 3P5BP 1UEKA 1R0CB 1JXLA 1W26A 3IFEA 4NLWA 4I2QA 3AHPA 4ZGAA 2HFVA 3MPWA 5I3QA 4N76A 2KDOA 3V5RA 1EZZB 3PG9A 3QSIA 1HR0J 3HVWA 2CQCA 3PEHA 4HTJA 1RWNB 4WFZA 4DSLA 1MMDA 3D9BA 3MMAA 1T05A 1C2PA 2MYFA 1G6BA 1V3SA 4F36A 2ZZTA 1MMNA 3MD1A 3NMAA 1EX8A 3CO0P 2H9ZA 5AJ9A 3GB0A 5L8RC 3QRQA 4PWUA 1RAEB 4CO5A 4A8OA 5ADZA 2ZBQA 5A6PA 3SQOP 3HSJA 2KKHA 3WHIA 4IDKA 4P2SA 1HNXF 1U49A 3HHNB 3VCDA 1KD1T 1FNOA 3O1LA 2UUCF 2GS8A 3OVSA 1FRXA 2NCKL 2R7WA 3OR1A 1Y4ZB 4JI2J 2RHQB 3PZPA 1HQUB 2R7VA 2UU9F 2MQ8A 4EWTA 3K5LA 2C2RA 2YQ3A 2FJDB 4OX6A 1S6UA 5HVFA 4ZHRA 4LVOP 5HK4A 2W8KA 3D6MB 4LBHA 2G1DA 3R1LA 5F41A 3H4DA 2KFZA 2K3IA 4DSKA 1UWBB 1WKLA 4PCQA 4KB7A 2F4FA 2OD4A 2ZHBA 4ZVPB 4DLGA 4R25A 5CD4A 1R7IA 2H51B 4CNZA 3HHLD 3JQMA 4C8YA 1HWKA 4QPTA 1LKZA 3QLHB 3T6JA 2HRTA 3EE3A 1WTBA 5EDWA 1AZSB 4QR0A 4ATNA 1KQKA 3QNWB 5L1LA 1Q16B 1OYDA 4N7TA 1TQLA 3ET6B 2V8PA 4GVBA 2MPUA 1F5AA 1SJ3P 1HMVA 5C42B 1ZTWA 4WKYA 2ROEA 5F3ZA 2NR0A 3Q8PB 2VQFJ 5HVGA 3TA0A 1V6HA 2B9YA 2CZ9A 1AUDA 3ZZZA 3NKRA 3D3CJ 2F65A 3D7SB 4C98A 2UVUA 5IOLA 1QVGR 2ILZA 2IVYA 1FK9A 7AT1B 3MM5B 2CZVC 3ITHB 1CC7A 1NUEA 4DCPB 3JXOA 2P6SA 1VMBA 1WC4A 2HEKA 3R7BB 5D78A 1KOHA 5DS7A 4B9SA 1P1LA 2AYEA 2OUGA 3OVAA 4CYUA 1KTQA 2MXYA 3IA0A 5LJ3Y 2E9TA 3NCRA 2X1AA 3TAQA 2GIQA 3M8ZA 3EPGA 3HHKA 2UUAF 3CMES 3QGGA 3VGUA 2QJ3A 3KK1B 4MFBA 1TL4A 4J9UE 4UY85 3F56A 1S0OA 5D0HA 4O3NA 4W4MA 2KFNA 3H2VE 2IC3A 4OI2A 2ZBIA 4ZMMA 4M5GA 3G6ES 2ZJQQ 2KRRA 1FEEA 3VAKA 3AFGA 1N6QB 4IUFA 1QVFR 5A6WA 2WVBA 5DZ7A 3EPIA 5DQGA 1T03A 2W5SA 1EAYC 4EO6A 3GV8B 4M5IA 1BQMA 1RBAA 3OR2A 3KLVA 4Q2MA 3DRSA 2MHEA 2XYPB 1H0HB 1TFWA 2DO4A 2HVEA 1TZ0A 5CXTA 3M6WA 1XIQA 3V2UC 4ZP8A 3EDRB 1KBRA 5KFQA 1RT6A 1MNEA 1HIYA 1TL1B 5L38A 3TZXA 2DBBA 3N4WA 2C3OA 4J9SA 3T1HF 3KHLA 2RF2A 5ETLA 1VQMS 4WP8A 1FRMA 2ZH5A 3M9OB 1KHWA 5KFOA 2QEXS 3ZZOA 4FXVA 1FERA 3M2RB 1SKSA 2MMYA 3M2VA 3G4SS 3N28A 1EKRA 3HHLB 5EHHA 4URGA 2JH3A 1PJ7A 4UZCA 5HQMA 3M7VA 3LP0B 2AX0A 5LMUJ 4HR2A 1U1LA 1REVB 1S6OA 4RW8B 2FVSA 3D0HE 2ASDA 3DRRB 3H59A 2YWFA 2HIQA 1F6TA 2HBQB 1FCAA 5B0BA 4UZBA 3O6QA 4OYBA 4C8ZA 2R2UA 3A12A 2Z58B 3TUZC 3HX9A 2O66A 3MZIA 2UVRA 2DR7A 4DU7A 3D5MA 1VQ4S 1NPPA 3DRPB 3UE2A 5KFVA 2BJEA 4DX6A 2CJXB 5EX0A 1VQOS 1SJQA 1KHKA 1KH4A 4F4WA 1JLFA 1CS4A 3E01A 1Y10A 1QTNB 3W64A 2UUTA 3A1YG 2VFUA 3DN9A 3F41A 3OFFA 3MM8B 5G0RB 1QSLA 1FRHA 2QL5B 1RT7A 3FZ2A 3M8PB 4F50A 5BYSA 4M5LA 5J2PA 1NO8A 3OUYB 3U02A 4P7VA 4RZRA 4TYBA 2VQEJ 3NP5A 1IBKJ 1HQEA 2D1GA 1N5SA 3VAGA 2UV8A 1IBMJ 1SBRA 1TAUA 1Y7PA 2NYIA 1U2CA 4P2FA 4YN3B 1EJJA 1FJGJ 4PQUA 3MDFA 2EG2A 3L95X 1TVRA 3SV4A 1U1OA 4KH1B 4E2FB 1P6TA 4FXDA 1O99A 1RKJA 5ETQA 3R6GB 4RUHA 1EP4B 4DG1A 2HBYB 1HWUA 1Q81T 1D09B 3GWCA 3U27A 2MZQA 2E7WA 4LSNA 3OTOJ 3KLGA 1TMJA 3FKBA 2M5YA 5D0RA 3TUIC 2L48A 1IWAA 2XWYA 1IKYA 5FD1A 1LK5A 1UEUA 3UD5A 2FLPA 1LEOA 5J2QB 4EBEA 4KGMA 3T5KA 3KJNB 1XBWA 2LQJA 3BZQA 2MKHA 4YDDB 2IBKA 2UUBF 1EETA 1FTRA 1XMQJ 3MMAB 4E98A 1BQNA 3EZOA 2FZKB 5GADU 2L41A 4AQYF 4HI1A 3CCSS 1VQ6S 2XI3A 3EGNA 3BO4A 4A8MP 1WWHA 3KLHA 1HNVB 2OGUA 4F2SA 1C0UB 2IM3A 1RTIB 4XTTA 4QQBA 3VAHA 4AL5A 4EEYA 2XZTB 3T02A 2XC9A 1O5JA 4DV6F 2R8IA 2CKWA 4YB6A 3OFHA 3V81A 1BGXT 3SZYA 1T9UA 4K59A 2OEJA 3KJQB 2ATLA 1ELOA 3CCQS 5HO4A 4P6QA 2B3TB 3UVJB 4R5PB 1KNZA 4PXDA 4ZHRB 3RAXA 4OHXA 4RW6A 2JFKA 2AKWB 5HLFA 4UOHA 2AGPA 3MCSA 4FPRA 4RX6A 2M70A 1U24A 3VAJA 1RWWB 1K0TA 4NLPA 1IWGA 3M2UB 2YWHA 1RT2A 2GA7A 3W9IA 4JBCA 1KH7A 4NXNF 1M90T 3BB5A 2CQ2A 2HNZA 2RQKA 1TU0B 2J7UA 2XYGB 1PC5A 4Y28C 4R0JA 4RW7A 4QYZJ 2GVZA 3EX7B 3IM8A 4IRKA 4K4TA 4DBQA 1VHFA 1GNKA 3ZC4A 2J6UA 1VRUA 3TR5A 2RHSB 4ID5A 1UCNA 1RABB 2DNQA 2HYIB 2HFSA 4JUZA 3IAS9 4EUVA 1KFSA 4QZVB 4HL9A 4DCOB 3RBZA 2Q66A 4GVBB 1MROB 1RHKB 1HMVB 3EWGA 4WK3A 3CDAA 3KG4A 1RTDB 2BE9B 1AB8A 1Y5LB 2R3VA 1ZM3A 3R5AA 1SKUB 4NYPA 1SQFA 3I82A 1JQGA 3ILJA 2QLJB 3AY0A 1R31A 2MGZA 2BKOA 2JVRA 2WRMA 1UJ6A 5DG9A 1A9NB 1RTZA 2R7QA 3AQPA 4KO0B 1HNZJ 4LR8A 2L9NA 3OXLA 2CJBA 1L3UA 3LXQA 3IBCB 2A1BA 3GJRB 1G4CA 1KVKA 2VG5B 2DGQA 2DYAA 4DOZA 1T11A 3UPFA 1RXOB 5BR8F 4DXLA 1AJCA 3H25A 4CYUB 1W25A 1DHMA 1QD1A 2Q43A 3RRKA 1KHVA 4XO0A 4MFBB 4WU3A 3D3BJ 3JB9k 2J0XA 1SL2A 3RTVA 1UZHA 1R6YA 5FJ4A 1VISA 5HP1B 1OY6A 2OKQA 2IM1A 1IJEB 2WOMA 3RBDA 2VG6A 2RUGA 3BKTA 3LPEA 2J0SD 3QO9B 2YNIA 4H4MB 2ZH3A 2OI2A 3HXMA 1VR6A 2VJUA 1FKPB 1YJRA 1SHNA 5C7PA 2CAJA 4L6V3 1URRA 3ICLA 1AUKA 1MMLA 2WVCA 4QPXA 3DOMB 4USVA 1X5OA 4C6AA 4PYDA 5H1SV 1TKTA 2LEBA 5ETRA 1RT6B 1ZEFA 4F0MA 3DHWC 1JXEA 4OZNA 1RU1A 3IR7B 3NNAA 2FY8A 1PGZA 1CJUB 5J2MA 3DMJA 3S7RA 2UUCJ 2CDRB 4MKBA 2YKMA 3ISNC 1Q7LB 4QIFA 4MT1A 3GLJA 3CIMA 5H9EK 2PT0A 2UU9J 1RTJB 5B09A 1REGX 4JI5F 2R7XA 4N5SA 4N47A 1VQ7S 3PX4A 2OPPB 3IS9A 4HACB 1J2VA 4QU6A 3M8SA 4ZG7A 4UT4A 1N48A 3R7SB 4QWBA 2CJQA 5D0GA 2FD2A 3QAEA 1UETA 4CZCA 5K14A 4ENOA 4M5DB 2E5JA 5AXMA 1YRUA 3WBZA 5I4MA 2MLZA 4MIAA 3DLKA 3BO3A 3KHHA 1ROFA 1N2LA 1Y3JA 4DI6A 5CHCB 2W2MP 4NOHA 1WC1A 3CULA 1Q5VA 4M8LA 2UXDJ 2HNYA 3FRZA 4DU8A 1CS4B 3BKUA 3E01B 4MAKA 1DRZA 4OI4A 4MIWA 1T0TV 1HLWA 1NJIT 4HYKA 2L9WA 2GAGC 1RKIA 4NA3A 2YPZA 2W7OA 2WB4A 4HKQA 4G6VB 4FF3A 4WWSA 5MLCV 2VG7A 4RLEA 4DR2J 4OLOA 1K7HA 3KYLA 4KFBB 3D66A 1E2SP 5J2PB 3K89A 1FEHA 2NS1B 1J5OA 1HQEB 5L0EA 3D1HA 2W4CA 3RW7A 3VGVA 5TJ3A 4LIWA 2XWXA 1AUSL 3IG1A 4EO8A 3J81j 2XLIA 3KKFA 5I42B 4DFKA 5DLWA 2CPXA 1VIXA 1GK8A 1OO0B 4IFVA 1L3SA 2XGPA 1M5PC 3R5JB 2UUAJ 4QOTA 3GYXB 2F9JA 1UP1A 4G1QA 4LSNB 2ROPA 3HHDA 4I7FA 1UMJA 3KLGB 3VZIA 3HFVA 2JRSA 4D3GA 3SCJE 4IKAA 3FBFA 3MUTP 4LF7F 1IBCB 4MKAA 2J9DA 5CCMA 3ZZPA 2E9RX 2J7KA 1X5PA 4WZQA 5A8KB 5DDOC 3Q8YA 3K5NA 1X5SA 1N5YA 1V9OA 1HNIA 2LP4A 1BQNB 2R8KA 2ZH6A 2YNHA
chains in the Genus database with same CATH topology
3T00A 3M8ZA 3IDDA 4MHXA 1ALHA 3TG0A 5KXAA 3BDGA 4CXKA 3IGZB 3TX0A 4B56A 4KAYA 2GLQA 3NKMA 3NKNA 4LRFA 2GSOA 2W8DA 5LQQA 2W5TA 5DLWA 5L0KA 2ZKTA 1KH9A 4UPIA 4LRAA 4LQYA 4FDIA 4LRCA 1KH5A 3NKOA 5LRMA 4GTZA 1E1ZP 1SHNA 2XRGA 4UPKA 3UNYA 3DYCA 1ZEDA 4N7TA 5EGEA 2ANHA 2W5VA 1Y6VA 4YR1A 1AJAA 3ED4A 3BDHA 1KHLA 3M7VA 1AUKA 3Q3QA 1Y7AA 1HQAA 1KHNA 1SHQA 1N2LA 4UOOA 5HRTA 4KJDA 4LR8A 1E33P 2D1GA 4MY4A 1ANIA 4CXSA 5GRRA 4LR2A 3M8YA 3UN3A 1B8JA 3CMRA 1AJBA 3LXQA 4LRDA 5DLTA 1N2KA 1KH7A 1EW9A 5EGHA 1ELXA 3B5QA 5LIAA 2GSNA 5C66A 1ZEFA 1HJKA 1EJJA 1ZEBA 3DPCA 2W8SA 3SZZA 5IJSA 3NKRA 1URBA 4LR7A 3MK1A 1ELYA 2W5SA 2XR9A 2IFYA 4CYRA 1AJCA 4KAVA 3MK2A 5INHA 4ZGAA 1KHJA 1ELZA 1EQJA 4UPLA 2W5QA 2W5XA 3NKQA 2W5WA 2GA3A 4TN0A 4GTYA 1FSUA 3WAYA 4GTWA 3WAXA 2IUCB 3MK0A 3M8WA 4UORA 5IJQA 4UOPA 1O99A 3BDFA 4ZG6A 2QZUA 2G9YA 3KD8A 1K7HA 4LRBA 1ALKA 5K4PA 4QAXA 4CXUA 4ZG9A 4LR9A 4KM4A 1E2SP 1E3CP 1ALIA 3WAWA 1KHKA 1EI6A 3WAVA 5LRNA 2X98A 1ALJA 3A52A 1KH4A 1HDHA 1ANJA 1O98A 2VQRA 4KJGA 3T02A 2RH6A 4FDJA 5GOVA 3TWZA 1ED9A 3UN2A 1EW2A 4NWXA 1ED8A 2W5RA 2GSUA 1URAA 5AJ9A 4LREA 4ZG7A 3T01A 5L0EA 3BDGB 5DLVA 3UN5A 3OT9A 3WBHA 1AJDA 3NVLA 3SZYA 5TJ3A 4GTXA 3UO0A 3NKPA 5L0BA 4UPHA 3IGYB 4MIVA 3E2DA 4CYSA 4NWJA 1EW8A 1P49A 2IUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T00 A;  3M8Z A;  3IDD A;  4MHX A;  1ALH A;  3TG0 A;  5KXA A;  3BDG A;  4CXK A;  3IGZ B;  3TX0 A;  4B56 A;  4KAY A;  2GLQ A;  3NKM A;  3NKN A;  4LRF A;  2GSO A;  2W8D A;  5LQQ A;  2W5T A;  5DLW A;  5L0K A;  2ZKT A;  1KH9 A;  4UPI A;  4LRA A;  4LQY A;  4FDI A;  4LRC A;  1KH5 A;  3NKO A;  5LRM A;  4GTZ A;  1E1Z P;  1SHN A;  2XRG A;  4UPK A;  3UNY A;  3DYC A;  1ZED A;  4N7T A;  5EGE A;  2ANH A;  2W5V A;  1Y6V A;  4YR1 A;  1AJA A;  3ED4 A;  3BDH A;  1KHL A;  3M7V A;  1AUK A;  3Q3Q A;  1Y7A A;  1HQA A;  1KHN A;  1SHQ A;  1N2L A;  4UOO A;  5HRT A;  4KJD A;  4LR8 A;  1E33 P;  2D1G A;  4MY4 A;  1ANI A;  4CXS A;  5GRR A;  4LR2 A;  3M8Y A;  3UN3 A;  1B8J A;  3CMR A;  1AJB A;  3LXQ A;  4LRD A;  5DLT A;  1N2K A;  1KH7 A;  1EW9 A;  5EGH A;  1ELX A;  3B5Q A;  5LIA A;  2GSN A;  5C66 A;  1ZEF A;  1HJK A;  1EJJ A;  1ZEB A;  3DPC A;  2W8S A;  3SZZ A;  5IJS A;  3NKR A;  1URB A;  4LR7 A;  3MK1 A;  1ELY A;  2W5S A;  2XR9 A;  2IFY A;  4CYR A;  1AJC A;  4KAV A;  3MK2 A;  5INH A;  4ZGA A;  1KHJ A;  1ELZ A;  1EQJ A;  4UPL A;  2W5Q A;  2W5X A;  3NKQ A;  2W5W A;  2GA3 A;  4TN0 A;  4GTY A;  1FSU A;  3WAY A;  4GTW A;  3WAX A;  2IUC B;  3MK0 A;  3M8W A;  4UOR A;  5IJQ A;  4UOP A;  1O99 A;  3BDF A;  4ZG6 A;  2QZU A;  2G9Y A;  3KD8 A;  1K7H A;  4LRB A;  1ALK A;  5K4P A;  4QAX A;  4CXU A;  4ZG9 A;  4LR9 A;  4KM4 A;  1E2S P;  1E3C P;  1ALI A;  3WAW A;  1KHK A;  1EI6 A;  3WAV A;  5LRN A;  2X98 A;  1ALJ A;  3A52 A;  1KH4 A;  1HDH A;  1ANJ A;  1O98 A;  2VQR A;  4KJG A;  3T02 A;  2RH6 A;  4FDJ A;  5GOV A;  3TWZ A;  1ED9 A;  3UN2 A;  1EW2 A;  4NWX A;  1ED8 A;  2W5R A;  2GSU A;  1URA A;  5AJ9 A;  4LRE A;  4ZG7 A;  3T01 A;  5L0E A;  3BDG B;  5DLV A;  3UN5 A;  3OT9 A;  3WBH A;  1AJD A;  3NVL A;  3SZY A;  5TJ3 A;  4GTX A;  3UO0 A;  3NKP A;  5L0B A;  4UPH A;  3IGY B;  4MIV A;  3E2D A;  4CYS A;  4NWJ A;  1EW8 A;  1P49 A;  2IUC A; 
#chains in the Genus database with same CATH topology
 3HVT A;  4IG3 B;  4DL3 A;  3GON A;  2H65 B;  4LF8 J;  1HFE L;  2UVV A;  3DLJ A;  1H7W A;  2VC1 A;  1XNR F;  2QGF B;  2MZJ A;  1WOO A;  2J6S A;  2P8I A;  3GZ7 A;  1ITP A;  4QW9 A;  3T1H J;  4WPA A;  2V8H A;  1TMM A;  1LWX A;  3M4X A;  2HSE B;  3W1Y C;  4RWX A;  1B4S A;  1NSK L;  1ELX A;  5DGA A;  4WFB Q;  4ECS A;  2OH2 A;  4G65 A;  1UFK A;  4AUK A;  1GH8 A;  3V81 B;  1QSY A;  4P52 A;  2VA3 A;  1O51 A;  2FVP A;  5HJX A;  1SC4 B;  2DH8 A;  2V94 A;  4LBP A;  3W7B A;  3BGO P;  4FVM A;  3LWM A;  4I67 A;  1FD8 A;  1HAR A;  4RW6 B;  2F40 A;  5B0A A;  5FLX Y;  2G2Z A;  3DDN A;  3GYN A;  5KTQ A;  4MYT A;  5KFD A;  1VLO A;  1CBK A;  4WIQ A;  1G1X A;  3G87 A;  3DGP B;  3LAL A;  5LL6 d;  1RT2 B;  1GFW B;  1HD1 A;  2HBZ B;  1H2V Z;  5BYR A;  1R0A B;  4TXS A;  1RT4 A;  4A8S A;  2VL1 A;  4LJM A;  2JJ4 D;  3JTP A;  4NLS A;  3G86 A;  2WVE A;  1RI7 A;  3I6P A;  2XTJ P;  1LFW A;  2GVZ B;  4Q2L A;  1NND A;  2W24 A;  1NHK L;  4IOB A;  3D4J A;  4I2P A;  2HLU A;  4OHY A;  4ID5 B;  3HI9 A;  3AA8 A;  2ZE2 B;  3V6D A;  3TW0 A;  2ZH4 A;  4RO0 A;  2HZV A;  2PII A;  4KRW A;  1S6Q A;  4DPX A;  3H2U B;  5JXS A;  3DCA A;  3R2C J;  1Y3K A;  1VBZ A;  3PY8 A;  4DUY F;  4OJ3 A;  2D1C A;  3G9C A;  2DD8 S;  2DR5 A;  1RT3 A;  2MGZ B;  4P73 A;  1FI4 A;  3ZO7 A;  2ZOF A;  1N8R T;  5HBM A;  1RA7 A;  4NI2 B;  1LK7 A;  2FLO A;  1TKX A;  3E2D A;  3K17 A;  4I4B A;  1VQK S;  5GAE I;  1UVI A;  3BDG A;  1QJH A;  4WJB A;  3MEE A;  5CYJ A;  2EC0 A;  1B0T A;  3KK3 B;  2YTC A;  4KHM A;  2W5T A;  4DUZ F;  2N7C A;  3PHT A;  4X65 F;  3ZXW A;  1IKW B;  2RJZ A;  2IYI A;  2OPQ A;  1C1C B;  3J80 U;  4I6A A;  2RDD A;  5GRR A;  1TK0 A;  2CUY A;  3HJV A;  3ZTQ A;  4H4O A;  5AJ3 F;  4PYA A;  1HI8 A;  2W1B A;  3C16 B;  4ZJL A;  1NZA A;  4CIO A;  4ZN1 A;  4WKR A;  3KJV A;  3H4B A;  2WOM B;  2YKA A;  3HDS A;  1IKX B;  5D4O A;  1D8Y A;  3OD2 A;  1OIA A;  2HQI A;  5JVH Q;  2VPZ B;  1Y00 A;  4JI0 J;  2KO1 A;  1U1R A;  2P2C B;  2N4D A;  3W2V A;  1RIS A;  4AQY J;  1XER A;  3E2E A;  1H3D A;  3JTN A;  1ZBT A;  3QWU A;  2RH6 A;  3GFH A;  2ZJR Q;  2J76 E;  2QYC A;  1PYT A;  4KV8 A;  3RB3 A;  1I6J A;  3QBC A;  5DET A;  3DLL Q;  4NAS A;  4K8R A;  1UVM A;  3IGZ B;  3A3O B;  1EB0 A;  1P9Q C;  4X4S A;  1JLC A;  3CCW A;  3DNC A;  4TU8 A;  3DMJ B;  2HAF A;  5AXN A;  2YKM B;  1VGY A;  1WF1 A;  2PMZ D;  4DV6 J;  3SXL A;  3TVK A;  2W5V A;  3EM1 A;  3C14 A;  2PN6 A;  5HRT A;  3RB6 A;  2HLT A;  2VOP A;  1WEZ A;  2BA9 A;  3BKF A;  3ZNU A;  4F3M A;  3TUJ C;  4F04 B;  5ETO A;  4C3M A;  2R7O A;  2HFZ A;  1HBM A;  4ZVQ B;  3HP6 A;  4ECR A;  1V3Z A;  3OLB A;  4LF9 F;  4B9T A;  3WDO A;  2GQC A;  2KXF A;  3BSN A;  4ELT A;  4YB7 A;  4YY3 J;  3MK0 A;  3I55 S;  3K8W A;  4DSE A;  3C3L A;  1B7F A;  8ATC B;  4Y2I A;  5K14 B;  3KLI A;  3A13 A;  4NXN J;  3W60 A;  4KM4 A;  4CLL A;  1WEY A;  4WBF A;  3NWR A;  1I3O B;  4WE1 A;  3DLK B;  1F5B A;  4RW9 A;  4AL7 A;  3QT5 A;  5DQH A;  2F8E X;  3SIP B;  4CWB A;  5KFB A;  1OY9 A;  2A18 A;  1N54 B;  3B4M A;  2MKK A;  3TG0 A;  4YHH J;  2O5D A;  3FMW A;  2HBR B;  2GNK A;  4J91 A;  2HPU A;  4MK8 A;  4Y2A A;  1GQE A;  1M5O C;  1ZPW X;  4PRF A;  1R6V A;  4G1P A;  2VG7 B;  2ZC3 A;  2DNP A;  2JLE A;  4LF6 J;  2VB6 A;  4J5O A;  3E3X A;  1NSQ A;  3ZZU A;  2RKI B;  1KQF B;  2HHW A;  3GSI A;  4LUB A;  3N9U C;  1VFJ A;  2FLN A;  1VJW A;  4WTO B;  5H9F K;  5ETS A;  2EKY A;  2YY3 A;  5A8W A;  3VR1 A;  3CD6 S;  3IMQ J;  2F5G A;  4I56 A;  3K59 A;  4OYZ A;  2XY6 A;  3PRD A;  2HVH A;  2OSQ A;  1X7V A;  4ZVO B;  4QWA A;  1Q8K A;  3HZE A;  2X98 A;  2AD9 A;  4I69 A;  4IFV B;  3UCG A;  5BR8 J;  2AQ4 A;  1YDL A;  4LRE A;  3GCX P;  2VUG A;  3VV2 B;  5IWA J;  3HHL C;  2V2V A;  4I6W A;  1JKH B;  2GHP A;  2BE2 A;  1Q79 A;  2DGV A;  4HEA 9;  4DV3 F;  2XHW A;  1FNX H;  1D8Z A;  3FZB A;  3A3N B;  3CJ8 A;  4DR7 J;  3BDH A;  4HI2 A;  2VV5 A;  3PYF A;  4P72 A;  2ZBP A;  2YH1 A;  4PR6 A;  2KN4 A;  3PW5 A;  2Z8Q A;  1N5Y B;  5A76 A;  2Z2L A;  1HNI B;  2M4M A;  2CPI A;  4CM0 A;  1WG1 A;  1X4A A;  3KFW X;  3CJT A;  2LVW A;  2YNH B;  1R8H A;  4DF4 A;  4IO1 A;  1QDU B;  2G1H A;  4ZVU B;  4GC7 A;  3K8V A;  5LJ5 Y;  3MPU B;  1VQN S;  1ALI A;  3QAU A;  2QLX A;  3POT A;  2XMV A;  2Y1R I;  4X66 J;  2UUW A;  2XZW A;  3CVK A;  3GJT B;  1T9V A;  2NSC A;  2DCU B;  3IWN C;  1RBL A;  2DR8 A;  1R89 A;  5KG4 A;  3PVX A;  1P49 A;  3CC7 S;  1ALH A;  2FZC B;  2X1F A;  2N3L A;  4EYI B;  1RAD B;  4JI5 J;  3VQS A;  3T6B A;  3V6J A;  3BH7 B;  1HNW F;  1B3T A;  2OTJ S;  4UPI A;  4MH8 A;  4PWW A;  3IRW P;  3KLE B;  2LQB A;  4U8Y A;  3ZZ0 A;  5GAE U;  1UVN A;  2KG1 A;  4KYZ A;  5KFN A;  1QLN A;  4M1K A;  2CPE A;  4FYX B;  3KUG A;  5ETT A;  2CVE A;  2QMW A;  1JWW A;  4O3Q A;  2NXU A;  4ZLP A;  1OY8 A;  4WU2 A;  1B7Y B;  4ED6 A;  4OI1 A;  3IGN A;  5JJB A;  3NLC A;  1B70 B;  3OSP A;  3G2X A;  2J8A A;  4H4K C;  3I4H X;  2B0G A;  2C22 A;  1SJ1 A;  3CCL S;  1SQG A;  2LA4 A;  2ZD1 A;  2B5J A;  4XPC A;  2AIR B;  4BLG A;  3W5X A;  2RQ4 A;  2WK4 A;  3U7J A;  2JNJ A;  4I2P B;  3W2W A;  3NBP A;  4DV1 J;  2ZH9 A;  1WEL A;  1E6V A;  1S6Q B;  1RQ0 A;  1YZ7 A;  2BJ9 A;  2YWE A;  2GLQ A;  4XK8 C;  3AXM A;  4K0K F;  2ZWP A;  3GG1 A;  3D1O A;  2HHQ A;  4OZ5 A;  1RAG B;  2DEJ A;  3FBC A;  3D1Q A;  4ILR A;  3GIL A;  3KDN A;  5HJY A;  4KGZ B;  1RT3 B;  5KFG A;  4K4Z A;  1WDT A;  1NHU A;  1YBA A;  1U2R A;  3D2W A;  4FF2 A;  1NAQ A;  2MQM A;  1XR7 A;  3FJ2 A;  3TNV A;  2AW0 A;  2LDY A;  1RTH A;  1TKX B;  4DPW A;  2B4O A;  1RLC L;  2YX1 A;  3P3D A;  4OHZ A;  3FGV A;  1N5Q A;  4Y3C A;  3KK2 B;  4P75 A;  3MEE B;  3M30 A;  3VWS A;  3RR7 A;  4FS1 A;  3IRX B;  3RYL A;  3RRG A;  2VKR A;  1RJJ A;  3MPD A;  1YIJ S;  5ETN A;  2YVS A;  1J5E F;  3MCO A;  2DT9 A;  5L0B A;  2C1E B;  4RR5 A;  1UEV A;  2HGL A;  1JLE B;  3ZZR A;  3MAQ A;  1D1U A;  3TX0 A;  3LP2 B;  3GR1 A;  4QWE A;  3N01 A;  1ZAV A;  3SZ2 A;  3RRH A;  3MMC B;  5KFU A;  3I96 A;  1X60 A;  4RPF A;  4EFA C;  2A6O A;  3TJ8 A;  1ZH5 A;  1WEX A;  3JSY A;  4B9U A;  4DR5 J;  4HHU A;  2HHS A;  1U47 A;  1J27 A;  4U7U K;  2V50 A;  4DV0 F;  2GSN A;  3GIR A;  3TAN A;  5ETV A;  4DMZ A;  2RML A;  3CB4 A;  1PO6 A;  2IFY A;  4KV8 B;  1XNR J;  2VBZ A;  2V8G A;  4ZCI A;  4BDP A;  1C1B A;  4UOR A;  5KFX A;  2FB0 A;  4F4K A;  3DM2 A;  1JX4 A;  4O4G A;  4B17 A;  3PYG A;  4LT6 A;  1RU2 A;  3GYG A;  3CGI A;  4KAI A;  3H5Y A;  2BAN A;  3C14 B;  2ZH1 A;  2LEC A;  2GIF A;  2IAJ B;  2XCP A;  3WBH A;  1U1P A;  5GAH I;  1TKD A;  2J5A A;  3H5S A;  3T00 A;  2GHW A;  1RE1 B;  3NKN A;  3W61 A;  1RWM B;  1HBM B;  2ZH7 A;  4X4U A;  4JB8 B;  4FDF A;  4P10 A;  5KFZ A;  2OEL A;  5KT7 A;  4WII A;  4A46 A;  4KHP F;  5A0Y A;  1ZED A;  3EUN A;  4TY8 B;  1FRL A;  2WW8 A;  4LSL A;  1T3N A;  4RWW A;  1SIZ A;  2XSF A;  4PG8 A;  4LFC F;  2F63 A;  3THP A;  4NLX A;  4R0E A;  2F9D A;  2NRE A;  4M94 A;  2IYG A;  4DLE A;  5EWE A;  2VON A;  3AOB A;  3DC2 A;  5LSO A;  5D3G A;  4ECY A;  2GGP B;  2G2Y A;  1NKC A;  4ZVH A;  3RAQ A;  3NAH A;  2MST A;  4LF5 J;  3FNN A;  1YJT A;  2RNE A;  1WKJ A;  2JLG A;  3GFY A;  4EMD A;  4C97 A;  4PKD B;  4YR2 A;  2M7S A;  2OSR A;  3RBX A;  1RAF B;  4LBI A;  3EJM A;  2PE8 A;  3SV3 A;  1SI9 A;  3HUL A;  3CSK A;  2Y1L B;  4M5K A;  2FTR A;  3G71 S;  4DUY J;  4ED5 A;  4KIA A;  2MZS A;  4HTI A;  4X4N A;  3HPO A;  2FLL A;  3CWJ A;  1MSW D;  3P96 A;  3I32 A;  4DCJ B;  5HRO A;  2RD5 C;  2HQC A;  2OD6 A;  5HMY A;  5LMN J;  2FZG B;  5GMK a;  3I0S B;  4K4V A;  3G6Y A;  5D8H B;  2W8D A;  5A8W B;  1RBO B;  4UPK A;  3TQE A;  4JOU A;  4DZ6 A;  5T41 A;  4B3T F;  1S79 A;  4ECQ A;  1DLO B;  2JFD A;  2J0W A;  1YI2 S;  2JC0 A;  3S8S A;  1Q4R A;  1TTH B;  4JV5 F;  3MR7 A;  1FKO B;  1RDR A;  2DCL A;  2FPH X;  4X4V A;  2KVI A;  2MQQ A;  1CJT B;  1U6B A;  3A3P B;  2PMW A;  4FKX A;  2WSC C;  4DN0 A;  5B0D A;  4EZ6 A;  4GTW A;  2KT5 A;  5IT4 A;  1N34 F;  2BE2 B;  3JTO A;  1UAW A;  2BZ2 A;  4K4X A;  3P8B B;  3OXG A;  3X3U A;  5AJ3 J;  3R9L A;  5C2C A;  1BWV A;  1UWB A;  5DJB A;  4DL4 A;  1R8P A;  4P74 A;  1UVJ A;  1U02 A;  2X3D A;  1YK9 A;  1OPZ A;  4ECT A;  1TL3 A;  4M5N A;  3WQP A;  4CH7 A;  4Q8F A;  4LVN P;  5H9E J;  5LRM A;  2DEI A;  4P7T A;  5BYQ A;  1Y6V A;  1AW0 A;  4EI2 A;  1D9A A;  1ZPV A;  1KEK A;  2ZZN A;  4A4J A;  1D0E A;  4DV2 J;  3ET6 A;  1NK8 A;  2CJK A;  2OEK A;  3V4I B;  4LR7 A;  1H2U X;  2HG4 A;  5F0W A;  2I6W A;  1VYA A;  3NKY A;  1Z2L A;  1ZAX A;  1K73 T;  2FHK A;  3FSI A;  1Z1Z A;  3OL9 A;  1VC0 A;  4RW4 A;  3TUP A;  4OZ2 A;  3MM5 A;  1X4E A;  4IRC A;  2QYG A;  3T3F A;  3ITH A;  4AL6 A;  4TQR A;  1FWK A;  5F8M A;  1HHS A;  2RE1 A;  3BPS P;  2OIH A;  2N7Y A;  4OYP A;  1S9F A;  5J2N A;  2HWT A;  4L72 B;  1A7G E;  4OIX A;  3UN5 A;  4UQT A;  2EFO A;  1KS2 A;  2QN6 B;  3GPA A;  1RAO A;  3ENA A;  2ZUG A;  1NU4 A;  4U6P A;  2BOA A;  1CEZ A;  4NZ6 A;  2HAI A;  5KFM A;  2AGO A;  2KVQ E;  2BE7 D;  3AOA A;  3R5C A;  1S1V B;  3KK1 A;  1V5I B;  2Q3P A;  4FP9 A;  3CJ0 A;  2ZD1 B;  2B5J B;  5B7W A;  3LTO A;  3MMJ A;  1WI6 A;  3N5F A;  2XGQ A;  5L1J A;  3KOA A;  2EFQ A;  1N4L A;  2AYG A;  4K2J A;  2GQ2 A;  1OYE A;  2FQQ B;  4Y34 A;  2ZFH A;  4OQJ A;  3W2W B;  1RWP B;  1RGV A;  3QGH A;  4WXO A;  3JQJ A;  4YEA A;  1N6Q A;  5SZT A;  1E6V B;  2V2K A;  4ITS A;  2CG8 A;  3CO9 A;  5E2Q A;  2H3E B;  3I5B A;  4CTA B;  8RUC A;  3M8Q A;  3MUV P;  1GMW A;  4D3H A;  3DOK B;  3RUB L;  1HI1 A;  2G2O A;  2HWI A;  1FWP A;  4DV4 F;  2A0F B;  2EFP A;  2GJI A;  4MKV A;  3MR2 A;  1S1U A;  2AYM A;  4UY8 T;  2J6T A;  2P9C A;  2NXC A;  3NY0 A;  4QIG A;  3T01 A;  3KJF B;  4C9D A;  1CVJ A;  2HQF A;  1H7X A;  4M5J A;  1AT1 B;  3UDV A;  1TL1 A;  3SZZ A;  1S97 A;  4OX9 F;  1SJR A;  1ICE B;  3GE9 A;  5GAH U;  3AB4 B;  1G7C B;  2MKI A;  3TA2 A;  3SFG A;  2IHR 1;  3M2R A;  1FX4 A;  1SHQ A;  4QR1 A;  5IT9 Y;  3H5U A;  2HHV A;  2AMC B;  3HHL A;  4C0H A;  3NCP A;  2HKE A;  1IM4 A;  2FJB B;  5RUB A;  4IRD A;  1SKW A;  2CQ0 A;  1REV A;  4QIE A;  3GMG A;  4RW8 A;  4ANE A;  3DRR A;  3C2P A;  2VPX B;  4TU7 A;  3E51 A;  3PYD A;  2OO4 A;  2HGM A;  1O6X A;  5KG7 A;  5AE2 A;  1Q82 T;  1SB6 A;  1U25 A;  4BWJ A;  3A8K A;  4ZVR B;  1X8D A;  3CMQ A;  2EBG A;  2XNR A;  2QSW A;  3MAA A;  3DLB A;  5B0F A;  4GKJ F;  1PIE A;  1URA A;  3VHQ A;  2O67 A;  4KY3 A;  3QMQ A;  5J1E B;  2CFX A;  3S01 A;  3EGW B;  4X62 F;  3OFE A;  2R7T A;  4KKO A;  2QA1 A;  1FT8 A;  4L73 A;  3WIU A;  3I31 A;  1M5K C;  2DNZ A;  1VHI A;  3C6T A;  3EGV A;  4C0O C;  4DQR A;  3MM8 A;  5G0R A;  3C15 B;  4DQI A;  2P9G A;  2HHT A;  3M8P A;  1F2H A;  1S6P A;  3R3T A;  2HGN A;  4WFA Q;  4F67 A;  1U26 A;  4I68 A;  2D9P A;  4O4G B;  1F2G A;  4ECZ A;  2D69 A;  2V34 A;  4QWD A;  5EGH A;  3MFH A;  2BAN B;  2W8S A;  1RZM A;  4OX8 A;  3OJS A;  1HNW J;  3GSD A;  3CJ5 A;  1YIT S;  1JJC B;  2CQP A;  2DO0 A;  3OHB A;  2HWH A;  3A8I A;  1OQ6 A;  4OZJ A;  5KFJ A;  4LFA J;  2DY1 A;  4ZP9 A;  3BDF A;  2EEY A;  1NRK A;  3BR9 A;  4TNO A;  4B9V A;  5HMW A;  1S7I A;  4CO0 A;  2N82 B;  2CQB A;  1EP4 A;  1HDH A;  3MED B;  2IRY A;  2BJ3 A;  6AT1 B;  4QBU A;  4EK2 A;  2ZEJ A;  1FRJ A;  1NSP A;  4WK1 A;  3O5T B;  2JEF A;  1XMO F;  4GO7 X;  3PTW A;  4ZPT R;  2QTW A;  3NAI A;  3RU0 A;  2GV1 A;  3CNQ P;  1JLQ A;  5D3G B;  3H5X A;  1AFJ A;  1WHY A;  3EMT A;  2LXF A;  5J2Q A;  1W2B R;  2JSX A;  2MSS A;  1U1Q A;  5A2Q U;  4NL5 A;  2IJF A;  3CC2 S;  1U6Z A;  4ES2 A;  5JUM A;  3W8P A;  1RWV B;  2NSB A;  3OTB A;  3PKY A;  4K0K J;  4X64 J;  4KGX B;  2JC1 A;  2QC3 A;  4J90 A;  2ZH2 A;  3BDP A;  4ZLL A;  1VDH A;  4UOG A;  2FVC A;  2W5X A;  1BD6 A;  5HRO B;  1CJV B;  4TU9 A;  1KRP A;  4UOP A;  4PG4 A;  3IR5 B;  5ETM A;  1S9E A;  1HNV A;  4OYO A;  4X84 A;  2Z4P A;  4Q7A A;  2XY5 A;  1QUV A;  1C0U A;  2CNL B;  4KJI A;  3AH6 A;  1YJW S;  3GJS B;  4JYA F;  1NB2 A;  1RTI A;  1ED9 A;  5DO2 A;  1F3F A;  3N79 A;  4YUD A;  3PW2 A;  1EJ7 L;  1IBL J;  1KKH A;  4B02 A;  1GMW D;  3TO8 A;  2QE5 A;  2WBM A;  4V1A k;  5L1K A;  4B3S J;  3EGZ A;  4OHV A;  2B56 A;  4FVC A;  3NOC A;  2AJQ A;  1WC5 A;  2CAD A;  4B3R F;  3R5G A;  4LIR A;  3UVJ A;  1LW0 A;  2MZT A;  4R5P A;  1LQ9 A;  2AZ3 A;  2DH7 A;  1FKA F;  1K1S A;  2MZR A;  2AYB A;  2ERR A;  3R5D A;  4NWB A;  2C2O B;  4UW2 A;  4HT7 A;  3HMJ G;  1JLG A;  3NS5 A;  3MUM P;  5IJS A;  4USJ C;  1SCJ B;  3M2U A;  3BYR A;  1FD2 A;  3BDE A;  4J9Q A;  2AF6 A;  4DR6 F;  5DZ6 A;  4NML A;  2HRY A;  4DSI A;  3SQG A;  4FF4 A;  1XWL A;  4F2R A;  3SBM A;  2CNK B;  1TL3 B;  3LP1 B;  5KFH A;  2V4J B;  3SI8 A;  2D3O 1;  4DV0 J;  2DVI A;  2GX8 A;  4J9V A;  5KFS A;  2DNL A;  4DQP A;  3B8H A;  4PAB A;  3DKD A;  3UO0 A;  3WZ0 A;  1YRT A;  2DGU A;  4CYS A;  5F9N A;  1UKU A;  4DPT A;  1MRO A;  3L7P A;  3CJ2 A;  1I5O B;  2HUR A;  1RTD A;  5IQ6 A;  2G0J A;  3MR3 A;  4LF4 F;  4KSE B;  3BRE A;  2IRX A;  1KDN A;  3C8Y A;  2CDQ A;  1NLK L;  3MEK A;  3MR5 A;  3FSX A;  4RW4 B;  5T14 A;  3HLU A;  3KHG A;  3US5 A;  1VBK A;  4LRD A;  4MK7 A;  3CDB A;  3QGP A;  1HBO A;  4PAA A;  4KO0 A;  4ED2 A;  4Y65 A;  4FNH A;  4JI1 J;  1M1H A;  5J2N B;  1K1Q A;  2U2F A;  2D3O R;  2VG5 A;  4O4R A;  2CPD A;  4KHP J;  4JP8 A;  4OV6 A;  2NUH A;  2UXB F;  3GP9 A;  2K7J A;  2M0G B;  3NG8 A;  3EIC A;  4ICL B;  3FRY A;  1X4H A;  2KZZ A;  4ED8 A;  3L7U A;  3CJ3 A;  2HIY A;  2OAU A;  1KQG B;  2MQO A;  3A52 A;  3Q86 A;  3QJJ A;  4NMX A;  4IOA Q;  3H20 A;  5K8P A;  4KT0 C;  4HDH A;  5KT2 A;  5H9F J;  1XNQ F;  3W62 A;  1HW8 A;  2ADC A;  3I4P A;  3CC4 S;  2MLY A;  3BYP A;  1PSD A;  5HP1 A;  4MYU A;  2MKY A;  2B8P A;  1YJV A;  2HZA A;  3NOG A;  2EFV A;  4URS A;  3QO9 A;  5IFM A;  4LRC A;  5DRK A;  4H4M A;  4XPE A;  3CJQ A;  3KNG A;  2CRL A;  4DSJ A;  2R4F A;  4NLU A;  3BSC A;  1XEZ A;  4JI2 F;  1QY7 A;  1S10 A;  3A8E A;  3M8Q B;  1FKP A;  2IPO B;  2DH9 A;  3X1L B;  3MEG A;  4X4R A;  3W5Y A;  2QFI A;  2E1R A;  4PUO B;  3DOM A;  4ECV A;  1S1U B;  2Y8W A;  2YX7 A;  2CPY A;  1LWF A;  3OJU A;  3WX8 A;  3UNG C;  2D41 A;  4B3T J;  3HSD A;  1HYS A;  1CJU A;  2QA4 S;  4O3O A;  2Y9H A;  2I5J B;  2DKO B;  4ETX A;  2GHV C;  2AJF E;  3MTJ A;  4OZ1 A;  5K4P A;  4Z7C A;  2GVD B;  4JV5 J;  2BQR A;  2I2Y A;  5CA5 A;  2HK2 A;  3DRY A;  2UVW A;  2PFF B;  1RTJ A;  4J9K A;  1U45 A;  2IRU A;  2OPP A;  2ZBC A;  4HAC A;  1XQI A;  3GIM A;  4MIV A;  2VF3 A;  1N34 J;  2BQU A;  2G13 A;  4ZCL A;  1MWQ A;  3LPY A;  4DV7 J;  1DQ9 A;  4PXC A;  1VLY A;  3K5P A;  2W2O P;  2VAS A;  5E3P A;  1KH9 A;  3HJF A;  1M1G A;  3B78 A;  2BR0 A;  4YR1 A;  2W9C B;  3AT1 B;  3PYE A;  4M5D A;  2YQ0 A;  4NCA A;  1Y7A A;  2VQF F;  2IDL A;  4LR2 A;  3KWM A;  3GFZ A;  3D54 A;  1JMT A;  1K9M T;  5E0O A;  4AXJ A;  3OQ2 A;  2MKS A;  3KHR A;  3CUN A;  3DU6 A;  1SH2 A;  3MAA B;  3RZA A;  1FFS B;  4KKO B;  3TJ9 A;  2W01 A;  1Q8L A;  4LSZ B;  5IJQ A;  3AB2 B;  3C6T B;  4HDG A;  3SCK E;  5IC6 B;  4NXM J;  4ELU A;  1E3C P;  2KTQ A;  2EKN A;  5KAK A;  1S6P B;  2JEG A;  3GQC A;  1L3T A;  1GTH A;  1F60 B;  4Y00 A;  2E7X A;  4KFB A;  2BAC A;  3BF4 A;  1QSS A;  4QU7 A;  2BV3 A;  3BSA A;  3FBE A;  3NS7 B;  1K47 A;  4ZOS A;  2E29 A;  3J7A 1;  2NZC A;  2L3M A;  5JVG Q;  1FHT A;  3MD3 A;  4DUT A;  5K20 B;  2F4V J;  2O3D A;  3C6U B;  2ANH A;  2ASY A;  2B6A B;  5I42 A;  4N56 A;  4CLU A;  1RHJ B;  1KWM A;  1JJ4 A;  4F8R A;  1S49 A;  4RU2 A;  2DIT A;  4GO5 X;  5DLT A;  2LCW A;  4R8U A;  1LXJ A;  5EUH A;  2CQ4 A;  1R8A A;  1CJK A;  1RB0 A;  2VU5 A;  4TVA B;  3I9Z A;  1S12 A;  1ZZF A;  1IVZ A;  3J81 U;  2ZVS A;  1IQZ A;  4CT8 A;  1P1T A;  2R2T A;  3U1M A;  4EU0 A;  3IM9 A;  3S1T A;  3BH6 B;  2N3O A;  2EFG A;  1JLQ B;  2PD1 A;  2E5L F;  4J9R A;  5K8M A;  1HWI A;  1VQY A;  4CLZ A;  1ALK A;  4JV2 A;  2EC2 A;  4WP9 A;  5K9F A;  2OEM A;  2CQ3 A;  4NWX A;  3ZTO A;  3CF5 Q;  2OJ3 A;  3FFI B;  1S1X B;  2XLK A;  5A8K A;  4QWC A;  4F4Y A;  3Q22 A;  2W25 A;  4BC7 A;  2JHE A;  4ZPB A;  3I0R A;  2YWG A;  3PX0 A;  1A6L A;  2CQI A;  1CLF A;  3QWP A;  4IH5 A;  3ILL A;  1X5T A;  2NUU G;  4IG3 A;  2RU3 A;  4RUA A;  4C3K A;  4TYA A;  2RRA A;  1HQA A;  4DWI A;  1NEE A;  4A47 A;  4NLQ A;  1S9E B;  2ZNZ A;  2BW7 A;  1IM6 A;  4OX9 J;  2FJX A;  3T9Z A;  1TKZ A;  2VOD A;  1ELY A;  4OFZ A;  3N0V A;  1QAJ A;  2B9X A;  2XR9 A;  2BJ1 A;  3MK2 A;  1ELZ A;  2ASJ A;  3VAF A;  1U09 A;  3QT7 A;  2DHG A;  3WAY A;  3BR8 A;  3OSN A;  3AAW B;  5IXU A;  1WNE A;  1HBU B;  1SC1 B;  2CQD A;  5FDL A;  1C4A A;  1LW0 B;  5C2G A;  1CPZ A;  5E33 A;  2CJA A;  3JS9 A;  3LA0 A;  3UW1 A;  2BEF A;  4O44 B;  1X4C A;  3QRR A;  2V5H G;  3IWL A;  4YB1 P;  1JLG B;  2JEI A;  4F26 A;  3DGP A;  4B56 A;  4LRF A;  1T9Y A;  4OHW A;  1R0A A;  2FJW A;  3D6H B;  3NKO A;  4IQM A;  3SQG B;  2ZH8 A;  1IBK F;  2I9S A;  1E6Y A;  4ED7 A;  5I3P A;  4PQA A;  3MM9 B;  4DV5 F;  3LAK A;  3VGS A;  4L75 A;  5DLG A;  1CG2 A;  1KHN A;  3P45 B;  4USH A;  4CXS A;  2WBR A;  2G4B A;  3PW7 A;  5F8L A;  1FJG F;  2ZE2 A;  2HFU A;  2RB7 A;  3ETM A;  3QRP A;  2LQ9 A;  1YHQ S;  1WC3 A;  5KOX A;  1S77 D;  1FDA A;  3ENV A;  4OZ0 A;  4W92 B;  3FCV A;  1N33 F;  2Y8Y A;  1LNQ A;  1PAU B;  5K5M A;  1H2T Z;  1PYS B;  1LV5 A;  1X9M A;  4JI7 F;  2YX4 A;  4C0B A;  2OPR A;  3NGT A;  4KH0 B;  1ARO P;  4YDX A;  4CO1 A;  1UL3 A;  4QAX A;  1MN7 A;  3OTO F;  1UFW A;  4NE9 C;  2YWK A;  2FHJ D;  2K8G A;  3WC2 A;  4USI A;  5J1P A;  2PFD A;  3LH2 S;  1EHW A;  3H42 A;  1HD0 A;  4P2X A;  3CPW R;  5C25 A;  5DQI A;  2PMH A;  4NWJ A;  1HBO B;  1UPP A;  1X4D A;  2YKN B;  1MU2 A;  4NI2 A;  4Y2K A;  2XG8 A;  3LAM A;  4ZP6 A;  2RAQ A;  3M9M B;  1NK5 A;  5L0K A;  4NEZ A;  1HKA A;  3MOJ B;  3KK3 A;  3DYC A;  1XMQ F;  1BY9 A;  3GIK A;  5KG1 A;  3C66 A;  1G3O A;  4CP5 A;  3UR3 C;  4O3S A;  2R7R A;  1GTE A;  1IKW A;  2IFX A;  2GQQ A;  1N5V A;  4H54 A;  5LIA A;  4NLG A;  1C1C A;  4NPO A;  4TY9 A;  3PFE A;  4E0D A;  1IR1 A;  3ZZT A;  1FXL A;  3VAL A;  1EQM A;  3VAM A;  3C16 A;  3TAR A;  2WON A;  4RUB A;  2PDA A;  1QUP A;  4Y6I A;  1WDD A;  2YKP A;  1IKX A;  2XMT A;  2IJR A;  2AJ0 A;  3PO4 A;  2DJW A;  2CNN B;  4A8F A;  2WVD A;  1IQT A;  1FDB A;  5L9N A;  2MJN A;  3KUH A;  3RG6 A;  1Y0H A;  2BBE A;  2KRB A;  2IJN A;  3ULH A;  1VK3 A;  3W65 A;  1MW7 A;  4JI6 F;  3MEG B;  2F1F A;  3Q8U A;  2PI5 A;  1RYS A;  3OVB A;  6FD1 A;  3G96 A;  5EWF A;  1C0T B;  3QT6 A;  4OI3 A;  3T9N A;  1LWF B;  2ZWO A;  4EGL A;  3JSB A;  5BXI A;  2FYX A;  3IP0 A;  2YBV A;  4JYA J;  1FO1 A;  2JOQ A;  1NCL A;  1HYS B;  3UWT A;  2QV6 A;  1HNX J;  1YWX A;  5A8R A;  4W98 A;  2R9L A;  2E66 A;  3RB0 A;  2XS2 A;  1PJ6 A;  4ZIT A;  2OTL S;  4IFY B;  2MTL A;  3LQV A;  5KG0 A;  1T9W A;  2FHO B;  1SV5 A;  1WOR A;  2YPY A;  1D9D A;  1OPI A;  3PJW A;  1P8G A;  1NBE B;  1VBY A;  2HHP A;  4MTP A;  1RWK B;  2P9E A;  2RIL A;  1RT1 A;  2MB0 B;  1NKB A;  2C3Y A;  4ZP7 A;  4NLT A;  4OI6 A;  4ELV A;  3AXK A;  1KSP A;  1HA1 A;  3PO5 A;  1VQS A;  1BE4 A;  1O98 A;  2C2M B;  4DR3 F;  4DR6 J;  3OBI A;  4FF1 A;  1TL7 A;  5L39 A;  1RAI B;  3BSO A;  3TRG A;  3G82 B;  2WTF A;  1IKV B;  3IDD A;  2JLF A;  3D67 A;  2FIU A;  2K06 A;  1VJQ A;  4DR4 F;  2NZ4 A;  3WX4 A;  3QAT A;  1HNZ F;  2B51 A;  1NXI A;  1UJ5 A;  2IDE A;  1ANI A;  1JNR B;  3VF0 B;  1WHV A;  3UN3 A;  4C8M A;  3CMR A;  5KFL A;  4QIV A;  5IC4 B;  2D7S A;  5M2P A;  2B7B B;  2ZBR A;  3RBE A;  5F9L A;  3MEC B;  1RHQ B;  2RKI A;  4LF4 J;  4X4Q A;  3D0G E;  2LU1 A;  2MQL A;  1U1N A;  1SJ4 P;  3M8W A;  3HFK A;  4ZKA A;  2AT1 B;  1TK8 A;  1O0P A;  3UD3 P;  3FMB A;  1NDK A;  1NJX A;  2BW2 A;  1R0B G;  2IY5 B;  4YB5 A;  3PAC A;  5HSP A;  3RW6 A;  5LRN A;  4C8L A;  2ZC4 A;  1ZOT A;  4DL6 A;  4KHR A;  1NK4 A;  3A4T A;  3TQ1 A;  2VFR A;  2UXB J;  4U7U D;  4R8U B;  3IWX A;  2IVF B;  5KT3 A;  2O1P A;  2QX0 A;  3NCQ A;  2VC0 A;  5AT1 B;  1CJK B;  1DUR A;  3M32 A;  4L3K A;  4RBT A;  4NYZ A;  1RWO B;  4P2M A;  1JKH A;  2E5I A;  4IH6 A;  1RSC A;  1NSA A;  1XJW B;  1FE4 A;  3PV8 A;  1AFI A;  5F8N A;  3MAH A;  4ZLJ A;  3MR6 A;  1M5H A;  1XNQ J;  2RDI A;  4DQS A;  3R27 A;  4EYH B;  2KJW A;  1M5S A;  3HHE A;  1DY3 A;  5D6G A;  4IOC Q;  2E1M C;  1HBN A;  3PIO Q;  1WKK A;  1NH8 A;  4B9M A;  2KZM A;  1FVQ A;  1VQ5 S;  1FJE B;  2DNH A;  4TN0 A;  2VKZ G;  3I0R B;  1B99 A;  4AE5 A;  3BS9 A;  3CCR S;  1LWC A;  2Z2M A;  3P49 B;  3SDE B;  2MDA A;  3QIP A;  4NLD A;  3SSS A;  1BC6 A;  5B0G A;  4F0K A;  3CDE A;  3AOC A;  2GCF A;  2ZDO A;  5GOV A;  3CCM S;  3LGN A;  5HQL A;  5CZX A;  4ECW A;  2D74 B;  1U0H B;  2RRB A;  5F8J A;  2NQP A;  2JEJ A;  2BYC A;  2UV8 G;  3L09 A;  4RNN A;  3AD7 C;  4EBD A;  2IUC A;  3MFI A;  1N88 A;  1TKZ B;  3NKM A;  2PO4 A;  2RQM A;  4F3Q A;  3PXG a;  1SL0 A;  3V6H A;  1H6K X;  4J7C A;  1VS3 A;  1S1W B;  3M1V A;  4DPO A;  4I0W A;  4N8N A;  3LGH A;  5KFP A;  5EGE A;  2DR9 A;  4B9L A;  2HVD A;  4F4X A;  1F9H A;  2UXD F;  4AD6 A;  3KLE A;  5FDL B;  3O2I A;  4ZLN A;  2LFV A;  1N2K A;  3NGD A;  1KQS R;  5GAD I;  4RKU C;  4RJV A;  3I56 S;  2X1G A;  3OTC A;  4F4A A;  5INH A;  2Z56 B;  1T9X A;  3DHX A;  1RT5 A;  2A2D A;  4TN2 A;  4DR2 F;  4HHJ A;  5AXL A;  2PSZ A;  4V19 J;  4RL1 A;  2RRN A;  2R8G A;  4K4W A;  2E5H A;  3N6M A;  4A8K A;  2XMM A;  2N4C A;  1E6Y B;  4N77 A;  1DAX A;  5T7L B;  2M8H A;  1WSV A;  3QSY B;  3V4M A;  4PZV A;  2I38 A;  2LEA A;  3AA9 A;  2AP6 A;  4F25 A;  2CJ9 A;  4WZM A;  4MHX A;  4LF2 A;  2VPY B;  2V0N A;  2E1P A;  1FVS A;  5LXR A;  3NL0 A;  4PWD B;  1CUL B;  3AOD A;  2ZHA A;  3HM9 A;  2OPR B;  2D9O A;  4P71 A;  2FGO A;  3M6X A;  4PXB A;  2KB2 A;  4J9L A;  4MY4 A;  5KT5 A;  2I1R A;  4M63 A;  5L46 A;  2JWN A;  4ID8 A;  8AT1 B;  1KLM A;  1EW9 A;  2FC9 A;  1Y5N B;  2KT3 A;  4ZVS B;  5E3Q A;  3MF5 A;  3MMB A;  2A10 A;  4DQQ A;  2ZIT A;  4KAV A;  4FZV A;  1TV6 B;  5C25 B;  3G6V A;  2BJ7 A;  4NZ0 A;  4PPD A;  4GTY A;  2AZ1 A;  1FES A;  1MU2 B;  1WG5 A;  3JYT B;  4M95 A;  2O01 C;  1UVK A;  1Q78 A;  2W7P A;  3KK2 A;  1S4E A;  4Q5V A;  4ZK7 M;  3OV7 A;  1YTY A;  3ZZY A;  1X9S A;  3TEG A;  2QG9 B;  4WP3 A;  2EBE A;  2GML A;  3IRX A;  5DLV A;  1KON A;  1WI8 A;  3UCU P;  5F3T A;  1YZ6 A;  4WTY A;  3SFU A;  1HHQ A;  4TQS A;  2E5L J;  4A8X A;  4LF8 F;  4CO2 A;  3TJA A;  4U8V A;  3G8Q A;  2RSQ A;  1JLE A;  1LWE A;  4WF9 Q;  3HSG A;  4LRA A;  4NZ7 A;  3FEY B;  2XUL A;  2KXN B;  1U2F A;  2WON B;  3LP2 A;  1GT8 A;  3FQL A;  1WTF A;  4ED0 A;  2VIC A;  1SH0 A;  1BQX A;  5IT9 U;  3NRB A;  2YKO A;  2FVQ A;  1C4C A;  2QMU B;  5KG5 A;  5EN1 A;  1GX5 A;  2UUB J;  3MMC A;  4BWM A;  3M6V A;  1O8B A;  2AX1 A;  2BQ3 A;  2XO6 A;  2RU9 A;  2W9A A;  1Q5Y A;  2XSJ B;  1LW2 B;  2V67 A;  4USM A;  1EQ0 A;  3H8Y A;  2ATC B;  5IT0 A;  4N41 A;  5LM7 E;  4UPL A;  4A48 A;  3NKQ A;  3KUE A;  2LYV A;  2DNM A;  5LSR A;  1V3R A;  3I9V 9;  3PRV A;  5DLF A;  3HCX A;  1PYO B;  5L9X A;  4J9O A;  1NK0 A;  4ILM A;  5E7O B;  2IM0 A;  2Y0S D;  1YSJ A;  1M0S A;  5B0C A;  3NGR A;  1NDL A;  4PG5 A;  5A8R B;  4KTQ A;  3KMQ A;  3PX6 A;  3CJK A;  2FJV A;  5D77 A;  2BM0 A;  1U48 A;  1SV5 B;  3KDO A;  4X4P A;  3K5M A;  1FFG B;  2IAJ A;  4A8W A;  5C5J A;  2CG4 A;  5HN0 A;  4TLQ A;  1BLU A;  2H4W B;  2V69 A;  2XMK A;  4ETZ A;  5IV3 A;  3Q23 A;  1FF2 A;  2J0Q D;  3Q83 A;  4CLP A;  1RT1 B;  1VQP S;  3OL6 A;  1KHL A;  2JDJ A;  2LU2 A;  2D3U A;  5IM0 B;  1A0O B;  4TY8 A;  3FUY A;  3CJR A;  1XTZ A;  2HFN A;  3FCW A;  2QRR A;  4EBC A;  3E8O A;  1TL7 B;  4ED1 A;  4KE5 A;  3HD1 A;  2CQG A;  1RCO B;  4DV5 J;  3NS6 A;  3J7Z T;  3MGJ A;  2P5V A;  3WAX A;  4JI4 F;  3A8J A;  3IBF B;  2XQC A;  2GGP A;  4ZPV R;  3CT9 A;  2QZ8 A;  2VZ9 A;  3F0N A;  4DJB A;  2KXH A;  3CJS A;  3NEK A;  4GKK F;  3FVY A;  3L9Z A;  2ASL A;  3QT8 A;  4HHH A;  2C2N A;  1Q86 T;  4IG0 B;  3AJ1 A;  1N33 J;  2V4Q A;  4JI8 F;  3BGF A;  4JI3 F;  4JI7 J;  2WHO A;  4UST A;  5C24 A;  2IIH A;  4CXK A;  3BEG B;  1JXV A;  2KHC A;  1HI0 P;  2KI2 A;  6FDR A;  1T9T A;  3T1Y F;  2GJ2 A;  1WAC A;  3I0S A;  3MPY A;  1YBU A;  1AJA A;  2U1A A;  3RR8 A;  3OPK A;  2Z2Y B;  3QJP A;  4ZVE A;  1UA1 A;  2HS0 A;  5HL7 Q;  2X7I A;  1ZS6 A;  3MCM A;  1SH3 A;  4I2Q B;  4DF8 A;  4RNH A;  1Q8I A;  2NPF A;  4WCE Q;  2LEP A;  1DLO A;  1I94 F;  1HW9 A;  2LXU A;  3NGU A;  4UOF A;  4NLV A;  3GFX A;  5D4L A;  9ATC B;  1FKO A;  4ZDN A;  4JI0 F;  1T05 B;  1N36 F;  4O3R A;  1CJT A;  3TA1 A;  3M32 B;  1R8B A;  4OMF G;  1PKU A;  4K4Y A;  5D4N A;  3BV8 A;  4RNF A;  2W8L A;  2DIU A;  3U1L A;  1VIO A;  3HT3 A;  2BOP A;  5CYM A;  4YME A;  4ED4 A;  3D0I E;  4IDK B;  3RAM A;  2MEW A;  5IS2 A;  2KYX A;  1HBN B;  5HQ8 A;  3LGM A;  4X2B A;  4Q0B A;  2E44 A;  3DLG A;  3OR1 B;  1F9E B;  5KFI A;  3CIZ A;  1D3W A;  4UTG A;  3DI6 A;  4YR0 A;  2OP5 A;  1U1M A;  1LWC B;  3QIP B;  4JI6 J;  3BO2 A;  4CM2 A;  1KTV A;  2EVZ A;  1HJK A;  2HMI A;  4OYA A;  3VAI A;  3DXS X;  2DHS A;  2KM8 B;  3JSR A;  1DAR A;  2ALZ A;  4YY3 F;  1RA6 A;  2DGO A;  1S99 A;  2RH3 A;  3QPI A;  3V4I A;  2ACY A;  2IUC B;  3TX8 A;  4UUW A;  4NCB A;  4HLB A;  2XS7 A;  4FKY A;  3GV7 B;  4ZG9 A;  5CZV A;  1FRI A;  4G3I A;  3M1V B;  2CXE A;  1ANJ A;  4CLF A;  2QL7 B;  1NJY A;  1RP5 A;  2K1R A;  3ENW A;  4FS2 A;  4BC9 A;  4WFN Q;  3NVL A;  3H7H B;  4GTX A;  4YHH F;  3OL8 A;  2PA3 A;  1UA0 A;  1H73 A;  1RT5 B;  2FJA B;  1NM2 A;  4GTZ A;  4DR3 J;  2DXD A;  4FYY B;  2H5J B;  2XRG A;  5KFT A;  4LF6 F;  4Y2M A;  3GII A;  2F7V A;  4DFJ A;  4FBU A;  2A3J A;  1S1V A;  1T3O A;  2ROG A;  3QID A;  2Q1L A;  1N0U A;  2POK A;  1H72 C;  1X4F A;  3PR5 B;  2IBO A;  1FK9 B;  4CLW A;  3GV5 B;  4DR4 J;  1T8E A;  1CQM A;  3Q2S C;  1GEH A;  4ZN3 A;  3T5L A;  1MN9 A;  4S0M A;  1TEL A;  2A6M A;  1KC8 T;  2PI4 A;  2R8J A;  5CAA A;  3AJ2 A;  2R42 A;  3THT A;  2DGX A;  4ECU A;  4K4U A;  1FRK A;  1NPR A;  3ZNJ 1;  4F4Z A;  4DS5 A;  3G6X A;  4CTA A;  4UOC A;  4DFM A;  1NDP A;  1SIW B;  2BX6 A;  3QJL A;  3DOK A;  4DFP A;  4DL5 A;  5IWA F;  3JAM Y;  2MQP A;  1RLD A;  1ZTT A;  4K5S A;  1YJU A;  3IGY B;  1N0V C;  3J7A N;  3PCO B;  1KLM B;  4OYI A;  1IN0 A;  4P9S A;  4NA1 A;  2UP1 A;  1Z2Z A;  2NLW A;  5THW A;  1SC3 B;  3H98 A;  4ERD A;  3MMB B;  1DTQ A;  3PRB A;  2IC3 B;  4DR7 F;  4IQX A;  1FTC A;  2MQN A;  2OFG X;  1K8A T;  5GMD A;  4BS2 A;  1VQ8 S;  3K5O A;  2BMB A;  3QFW A;  4L74 A;  1PBU A;  1H38 A;  4OYW A;  2C2K B;  3FEX B;  4QW8 A;  4CRJ A;  1Q1K A;  1T03 B;  2V6A A;  3WIV A;  3BN7 A;  5AXK A;  4C11 A;  1ZEB A;  2FC8 A;  1F5C A;  1BQM B;  1SC6 A;  2NXN A;  3OR2 B;  3DRS B;  2EPI A;  2DY9 A;  3T19 A;  4RNO A;  2J9D E;  2Y1I A;  2JVO A;  2QO3 A;  1QE1 A;  1NPK A;  2R7S A;  1T02 A;  1URN A;  2ADB A;  4ZPC A;  2WAQ D;  3FEZ A;  4LF7 J;  4JV0 A;  3RJM B;  1LWE B;  2DGT A;  4FYW B;  4X66 F;  5ITH A;  2Q6B A;  3WAV A;  2RF2 B;  2FDN A;  4CO3 A;  4DPU A;  1FE0 A;  3KNA A;  2DTJ A;  4AT1 B;  4PPZ A;  3M9N B;  2GSU A;  3EVM A;  3ZFV A;  3RB4 A;  4JV1 A;  3HT0 A;  1OMS A;  1PIL A;  2XI2 A;  2B43 A;  3M2V B;  5J1E A;  4RNM A;  5KFF A;  1AYE A;  3CE8 A;  4M5M A;  1RYR A;  1VRQ C;  1NK7 A;  2W9B A;  1GXL A;  4Z2X A;  2QLB B;  4DS4 A;  1X0P A;  3W3S A;  1WSR A;  4PXE A;  3W66 A;  3C15 A;  4HT5 A;  3PW0 A;  2COL A;  1NJZ A;  3BBC A;  2J9E A;  4NCG A;  1QAX A;  2GMJ A;  3CCU S;  4QR2 A;  1FDN A;  1S1T A;  1JLB A;  1XN9 A;  3CW2 C;  3CJK B;  4ZJO A;  2CPH A;  4EZ9 A;  2BVZ A;  2DGW A;  5DG7 A;  3KLF A;  4ER8 A;  2IMO A;  1S4F A;  4MIB A;  4L3N A;  4U67 Q;  5CCL A;  3W9J A;  5M2U A;  1YJ9 S;  4ILL A;  2BAB A;  1HWL A;  1JLF B;  2A2C A;  3ADA C;  4B08 A;  2VQR A;  4YR3 A;  4M5H A;  4DV1 F;  3GIJ A;  3I5A A;  2YXL A;  3QFH A;  5KT4 A;  1RT7 B;  1LXN A;  3KG0 A;  3MED A;  3TOQ A;  2V63 A;  5HVH A;  2YNF A;  3G8S A;  2LXI A;  2WW4 A;  2V2Q A;  4ZCK A;  3PJX A;  5CAB A;  2FVR A;  2LKZ A;  4Y2C A;  1MLA A;  1R3N A;  3GCW P;  3SEO A;  1F1B B;  4C8K A;  2ZDP A;  2DHA A;  3M05 A;  3OHA A;  3OXF A;  1XMB A;  4PQU B;  2RS8 A;  1Q0N A;  2I8E A;  2NXJ A;  2WSE C;  5C66 A;  1TVR B;  3DPC A;  2DIV A;  5IV4 A;  2E9Z A;  2HQD A;  1KOO A;  1R43 A;  4RBV A;  1ZM2 A;  4DG1 B;  1HWJ A;  1G2E A;  5C24 B;  2G0C A;  5A2Q Y;  7FDR A;  1F9F A;  4UF4 A;  1CJV A;  1DZ5 A;  4CDI A;  4FBT A;  3W5Z A;  5BJR A;  2ABY A;  5HMZ A;  3HKW A;  4NLR A;  1YGY A;  1IKY B;  4IR9 A;  2LQ8 A;  2AJ1 A;  2W2Q P;  4CCH A;  4UPH A;  4HH0 A;  3C46 A;  1U8W A;  3DLE A;  1LFP A;  1SKR A;  3LOU A;  4OYX A;  1IR0 A;  5AE1 A;  2CA9 A;  1EET B;  3SCI E;  1Y11 A;  1N56 A;  1UWA A;  1YVF A;  4DUZ J;  2RDJ A;  1RAH B;  1RUS A;  4DR5 F;  4X65 J;  2CZ4 A;  1AJB A;  2L9D A;  4OJG A;  1CSJ A;  2QMX A;  4BHQ A;  5EGY A;  1VRT A;  1XK8 A;  2M2B A;  5HMX A;  1PCA A;  2AJ2 A;  3KLH B;  2GW8 A;  5CD4 H;  3THV A;  2YQ1 A;  2LDI A;  4LFB F;  3W63 A;  5CYM B;  3UDL A;  1RHR B;  1S48 A;  4B3M F;  3AQO A;  1JJH A;  4K4S A;  4Q0B B;  1VK8 A;  3DLG B;  4USW A;  3SCL E;  2YH0 A;  2HVZ A;  4GMK A;  3PNI A;  3LP1 A;  2V4J A;  4NLO A;  4KPY A;  3MUR P;  3DI6 B;  4DPY A;  3KXD A;  1ZAW A;  5JMN A;  3TI0 A;  3KMS A;  1EW8 A;  3T1A A;  4OJ1 A;  2HMI B;  2WVF A;  5HLF B;  4ZPD A;  4C4W A;  1DTT A;  1N32 F;  1QTM A;  2LLZ A;  5LQQ A;  2XMA A;  4F0H A;  3NGS A;  4CLK A;  3CD0 A;  4K2X A;  5CQG A;  5EWG A;  2HNZ B;  4E8U A;  4RUC A;  3MPV A;  4WYW A;  4XIU A;  3HVA A;  1RHM B;  4RW7 B;  1UW4 A;  3K57 A;  1VRU B;  2K1R B;  3DYA A;  4FYV B;  1KHJ A;  1ZM4 A;  3OL7 A;  1WHX A;  4LF5 F;  1JK9 B;  2VDI A;  3ETO A;  2GA3 A;  4I64 A;  1S57 A;  3H2L A;  1WOS A;  4LF9 J;  3B6B A;  1X4G A;  2MJU A;  3HD2 A;  2CQH A;  1NDC A;  2QZU A;  5HAT A;  5E3C A;  4ZPA A;  3FDS A;  4OV1 A;  2XB2 D;  3LWL A;  2EK6 A;  1FXR A;  1P27 B;  3TVZ A;  1CQN A;  4ICL A;  2UZA A;  1NH7 A;  3TVY A;  1YRX A;  4F02 A;  2Y1J A;  4CLT A;  3GG0 A;  2FY1 A;  5LMN F;  1T7P A;  1Q8B A;  4JI4 J;  4X4T A;  5CYQ A;  4Q44 A;  4IO9 Q;  1GXU A;  2MY7 A;  2KYZ A;  1ZM9 A;  4ZVT B;  4KPC A;  2D3Z A;  2RVJ A;  4GKK J;  3EZ5 A;  4C2M A;  4L76 A;  1X31 C;  4OJH A;  4JI8 J;  4ED3 A;  1S5Z A;  3Q3Q A;  1KP6 A;  4JI3 J;  2PEB A;  3EZU A;  2IVM A;  1NKE A;  3M8Y A;  3N6N A;  1VCT A;  3BQ2 A;  3T5J A;  2BXJ A;  2DNO A;  2ZUA A;  3T1Y J;  1YQH A;  4A8Q A;  1N52 B;  5B08 A;  3GU0 A;  3GJQ B;  4OLP A;  4PUO A;  2DB1 A;  2XLJ A;  3IXQ A;  3CD7 A;  2AWZ A;  4ZG6 A;  2G9Y A;  3Q8R B;  1DTQ B;  2DNY A;  4LRB A;  2C3M A;  2I5J A;  4UUX A;  2VG6 B;  5KFR A;  3KG1 A;  5K8N A;  3D28 A;  1I94 J;  3MWB A;  1YBT A;  2YNI B;  2GVD A;  3OT9 A;  4XAK A;  3QZ7 A;  1N36 J;  3Q8S B;  2OPS A;  4C11 B;  1UJ4 A;  4RBU A;  2PEH A;  1QAI A;  3TZZ A;  4YP3 A;  2WB1 D;  4URQ U;  2ACM A;  2P6T A;  3IGV A;  3MI7 X;  2EFN A;  4FDI A;  2VHG A;  1QM9 A;  4DV3 J;  1TKT B;  3OW2 R;  4KQZ A;  2BDP A;  4DV2 F;  1SXL A;  2AJ4 A;  1QE1 B;  1OWX A;  2HHH F;  4KJD A;  3ZTS A;  2V2Z A;  1RHU B;  3H40 A;  1SL1 A;  2ZOG A;  1XR6 A;  1OSC A;  5J2M B;  2W9C A;  1W7W A;  1TAQ A;  4RU9 A;  2QLF B;  1BXN A;  2Y3Y A;  4K5R A;  3CCE S;  1UZD A;  1SQE A;  4CYR A;  1JLA A;  4J37 A;  3K0J A;  4CLS A;  3OTD A;  4USU A;  1SPB P;  4ZS6 A;  3AD9 C;  3L7O A;  3GTY X;  2DGS A;  3WC0 A;  3IS9 B;  2CWX A;  4K50 A;  3W8G A;  1KVJ A;  3O8W A;  2W9B B;  4O3P A;  1YX2 A;  2R8H A;  1RAC B;  3IBW A;  3QQC D;  2XY7 A;  1EW2 A;  3V6K A;  2FUG 9;  3CJ4 A;  4DEZ A;  4J9P A;  4KC5 A;  3TYT A;  4NCG B;  2ALY B;  3DU5 A;  3D6F B;  2R7U A;  2VH7 A;  1S1T B;  4DR1 F;  4DN9 A;  1JLB B;  4U7C A;  2IA0 A;  2SXL A;  1R8C A;  5DGB A;  1RK8 A;  2DRB A;  1ZZN A;  2HK3 A;  2CPF A;  2KH9 A;  3KLF B;  2IMW P;  3LUY A;  5LXY A;  2HNY B;  4ANC A;  2RUS A;  3HZG A;  1UW9 A;  3C6U A;  4I1T A;  2B6A A;  1VQL S;  3PEJ A;  1URB A;  2DNG A;  3ILI A;  9RUB A;  3PW4 A;  2QA4 G;  3UD4 P;  3QYY A;  2CWK A;  2CPJ A;  2YNF B;  4ZJQ A;  3DRX A;  3T41 A;  3JQK A;  1J5O B;  1T94 A;  2ZNY A;  4LR9 A;  7FD1 A;  4XDD A;  1RAJ A;  3J81 Y;  2AHO B;  4AYB D;  4FDJ A;  2J7W A;  2XMW A;  2BRL A;  3IG1 B;  1NB7 A;  1U7L A;  4OZ3 A;  4GRS A;  4O0I A;  1FNM A;  5M2R A;  3FFI A;  1S1X A;  2QFJ A;  3D6T B;  3BGR A;  2ZM6 F;  2XMJ A;  3TEH B;  2V9W A;  1XC9 A;  2GSO A;  4U9R A;  2EI5 A;  2ZKT A;  4B9N A;  3TAM A;  2BJ8 A;  4DX8 H;  3UCZ P;  4WFX A;  1GX6 A;  3FCH A;  2QA2 A;  1KN6 A;  4C8O A;  1JB0 C;  2RIJ A;  1B8J A;  4G1Q B;  4I7F B;  1DBD A;  1YJN S;  2Q79 A;  1H98 A;  4OZL A;  4TLR A;  2DR6 A;  2OML A;  2FGC A;  4CLY A;  1V5V A;  2RS2 A;  1Y5I B;  4QCL A;  2ZJP Q;  1F3V A;  2H54 B;  3MM7 A;  2BKP A;  2EG1 A;  3PM9 A;  4QJV A;  2ZKU A;  2Z30 B;  1MWZ A;  3DLE B;  3EVW A;  5F8I A;  2QIF A;  4CNY A;  2KG0 A;  1NJW A;  3P6Y C;  5KG6 A;  2C28 A;  2XEX A;  3BQ0 A;  2W4D A;  3C19 A;  1HBU A;  4KJG A;  3VZH A;  2JX2 A;  1UFL A;  2CQ1 A;  2WSF C;  3PHE A;  2OHD A;  2MKJ A;  1AJD A;  3HVT B;  3O3L A;  2H48 B;  5I3U A;  2DNN A;  1J5E J;  4IR1 A;  3BJY A;  4DL2 A;  1VRT B;  4MMO A;  1FXD A;  4O44 A;  2DIS A;  2IM2 A;  5AE3 A;  4ZIW A;  1Z4U A;  2Z57 B;  2XCA A;  3U1N A;  3T5H A;  2XYH B;  2WZ1 A;  2B7C B;  5KFE A;  3MCN A;  1S72 S;  1OSD A;  5KG3 A;  4KBI A;  2OMO A;  2KJV A;  5KT6 A;  2X51 A;  3HKZ D;  3AD8 C;  5J1N A;  4ALZ A;  3MM9 A;  3MOZ A;  2CJY B;  3SSR A;  2HQG A;  5FII A;  4CH0 S;  4MKY A;  5FLX U;  3MK1 A;  3OFG A;  3M6U A;  1HPZ A;  5E41 A;  4WFY A;  3UR0 A;  4LFA F;  1NZ8 A;  1FDD A;  3IN5 A;  2KL8 A;  1DTT B;  3KD8 A;  1VI7 A;  3CDU A;  3IC1 A;  4WXW A;  1Q95 G;  2K3K A;  4B3O A;  1SJF A;  4DX5 A;  4NEY A;  2DRD A;  5IZH A;  1YJ7 A;  3B82 A;  3TWZ A;  1RT4 B;  2QL9 B;  2DPI A;  2E1C A;  2KFY A;  4V19 X;  1OJ4 A;  4OL8 A;  3K7R A;  1Q53 A;  2G9O A;  1UPM B;  4FNI A;  1HHT P;  3ISZ A;  2UXC F;  4DHV A;  3DYA B;  1L3V A;  2C3P A;  5K8O A;  3CCV S;  2YKN A;  3BBF A;  2XNQ A;  3V6D B;  1RCX B;  3SYZ A;  5HI7 A;  1YLX A;  3ED4 A;  2M8D B;  4DSF A;  1HR0 F;  3TP2 A;  3CXC R;  1FWL A;  4MJK A;  1S0V A;  1NHV A;  3P5T L;  4X64 F;  1BMQ B;  2DHX A;  4LFC J;  4ZIV A;  1R27 B;  5CH7 B;  3HO1 A;  2V4R A;  1BHN A;  3EDQ B;  4U95 A;  1SVD A;  3ILO A;  1K0V A;  5ETK A;  3S6E A;  2K2P A;  5D15 A;  4F7V A;  3LAN A;  2EW9 A;  1S76 D;  5CYQ B;  4C3L A;  1X0F A;  3NNH A;  2CVI A;  2GJF A;  3J7Y I;  3K2Y A;  5HBM B;  4IH7 A;  3R7N B;  3BM7 A;  4CXU A;  2GO9 A;  3WAW A;  2VIH A;  1EI6 A;  1K44 A;  2PA8 D;  3H90 A;  3LF0 A;  2V8V A;  1IBL F;  1WF0 A;  1AA1 B;  2HW3 A;  3BDG B;  5HAN A;  2VD3 A;  3HFZ B;  4UQG A;  3EXY A;  1RWX B;  2FHM A;  1MG7 A;  2LMI A;  1PJ5 A;  4B3S F;  1U8S A;  5DDQ C;  4F3O A;  3FSY A;  1B0P A;  1EIY B;  2Z0G A;  4DZD A;  1KVI A;  2OPQ B;  3Q89 A;  4NA2 A;  1PC4 A;  3MXH P;  4BBY A;  2C2Z B;  2M3D A;  2AEF A;  2XMU A;  1C0T A;  4H4O B;  2H5E A;  2R2S A;  2RT3 A;  2AEJ A;  3R8Y A;  4IYQ A;  2KM8 C;  3HSZ A;  1FX2 A;  4ZA1 A;  2H5I B;  4ZPW R;  3LO3 A;  3KJV B;  2DXF A;  1PG5 B;  2BJD A;  4ZVF A;  2AV5 A;  4IFY A;  1TUG B;  3B4D A;  3DGV A;  3DOL A;  4CO4 A;  4Q43 A;  5KFW A;  1OQ3 A;  1Q7Y T;  1FSU A;  4WYL A;  3Q2T C;  2OPS B;  3W2V B;  2W7A A;  2EXU A;  2C3U A;  1D9F A;  4FN5 A;  3R6L B;  2DRA A;  1ZA2 B;  1WD6 A;  2NXE A;  4LFB J;  1DFD A;  3UN2 A;  5KOW A;  1CC8 A;  1ZET A;  3DDI A;  3JSM A;  1YG0 A;  1WF2 A;  2HND A;  1JLC B;  4B3M J;  4NLY A;  2HFO A;  4ZCM A;  3TAP A;  3BPD A;  4KAY A;  2MHN A;  4QYZ K;  1JLA B;  4YQW A;  4LF1 A;  3G82 A;  3J7Z 5;  1IKV A;  1XR5 A;  1S59 A;  4YFU A;  2YNG A;  1I1G A;  2M9K A;  4ZVG A;  2M52 A;  2FHJ A;  2B4P A;  3UFC X;  4HH1 A;  5SUH A;  1NK6 A;  3IR6 B;  4JI1 F;  1VC5 A;  4CT9 A;  1S0N A;  1N32 J;  1KFD A;  3FC9 A;  1F0X A;  3UQS A;  2XO7 A;  3ISN D;  1SUQ A;  1VQ9 S;  3D68 A;  4FXW A;  2W5W A;  3CD5 A;  3KLI B;  1VBX A;  3MEC A;  1IXK A;  1N5T A;  1WC6 A;  3HVR A;  2QLW A;  3Q8V A;  1TL5 A;  4WE1 B;  1T95 A;  2C42 A;  3PIP Q;  2KHD A;  1S9G A;  5ETP A;  4YOE A;  2F3J A;  4RW9 B;  3CDW A;  4PG6 A;  1ULR A;  3OTE A;  3VVT A;  2B4V A;  3MM6 A;  2HQ3 A;  2HVI A;  4NRU A;  4CI0 B;  2W5R A;  1WJ9 A;  1X9W A;  4G1I A;  2W4P A;  3CCJ S;  2HRU A;  2KU7 A;  4AFF A;  4J9N A;  4Q8E A;  2V9K A;  4NX9 A;  5KFK A;  2X3G A;  5F8H A;  1HQ2 A;  2EK1 A;  2I0X A;  3NNC A;  2C2D A;  1KLN A;  5GAG I;  1RAA B;  2MLX A;  4KGK A;  2DHH A;  4O23 A;  2APO A;  3FQK A;  1M5V C;  2GMH A;  2XBP A;  3PDN A;  5LOQ A;  4U96 A;  2XM3 A;  2BKN A;  4J9M A;  1TP7 A;  2VA2 A;  2AGQ A;  2RQC A;  1TUW A;  3CCZ A;  2VJV A;  2H4Y B;  3ZTR A;  3I5C A;  2GAH C;  4Z7Y A;  1JJ2 R;  1ACM B;  1P9Y A;  1EAR A;  2LA6 A;  3I87 A;  3SMZ A;  5DG8 A;  4DL7 A;  3BGR B;  5KG2 A;  3ELH A;  1S7H A;  1HQU A;  4ECX A;  3BBB A;  3TAM B;  3MHY A;  5F0U A;  2HS3 A;  4K7Q A;  1FFW B;  3SDE A;  2OLW A;  4DV4 J;  1LOU A;  2CYY A;  1PAE X;  3EXC X;  1ED8 A;  3TZY A;  1WHW A;  4CH1 A;  2DNR A;  2E7V A;  5LMU F;  3HK2 A;  2EWH A;  5DDR C;  2ZOM A;  4DV7 F;  3NKP A;  2ILY A;  1IR2 A;  3Q24 A;  3F44 A;  1EKS A;  1U0H A;  4BCA A;  3L4B C;  4DX7 A;  3MTK A;  1UVL A;  1DJ0 A;  2DXE A;  1B0V A;  3UDC A;  4I6Y A;  1OS5 A;  3R2D J;  3MM7 B;  3FK4 A;  4USK A;  2DPJ A;  4GC6 A;  3NXZ A;  2JZ5 A;  1WG4 A;  2VFV A;  1S1W A;  2CNO B;  3QLH A;  3VGT A;  2VBX A;  3QZ8 A;  3N6L A;  5F8G A;  1AZS A;  3QGI A;  4Q45 A;  1GMU A;  2HHU A;  2W5Q A;  5I3U B;  2IA6 A;  2F8M A;  4AND A;  2HHH J;  3SSQ A;  2GFF A;  3DFE A;  4NXM F;  2HZC A;  3HF5 A;  3POT B;  2L08 A;  3KTQ A;  5GME A;  5C42 A;  5DM6 Q;  4O0N A;  3BN4 A;  2PC6 A;  1RWU A;  2W2P P;  4GVL A;  2LQ5 A;  1WC0 A;  2V68 A;  1ALJ A;  3DLH A;  2M88 A;  3EYZ A;  2VQE F;  4PG7 A;  3J7Y U;  2C2E A;  4ES1 A;  4Y0F A;  4GKJ J;  5T7L A;  4DL0 C;  2Q6C A;  3IO1 A;  3M8R A;  1IBM F;  1WUU A;  2JL9 A;  4X4O A;  4X62 J;  5KXA A;  3W9H A;  2NPI A;  4OYM A;  2F4V F;  1HPZ B;  5G4D A;  2V8D A;  4Z37 A;  4LQY A;  1KH5 A;  2ZHO A;  2XZD B;  3L3C A;  1BWE A;  2ZVI A;  5E3R A;  4PWD A;  1CUL A;  1DQ8 A;  1FJC A;  1W2I A;  2VDH A;  1I51 B;  4B3O B;  2Z2Z A;  4CQ1 A;  4DR1 J;  5IQQ A;  1GAO A;  1DQA A;  2GC8 A;  2BM1 A;  1U1K A;  5L1I A;  2DK2 A;  3GR0 A;  3LW5 C;  4MK9 A;  3NMR A;  2HHX A;  1KR4 A;  1ZA1 B;  2Y0B B;  1TK5 A;  1S0M A;  4W90 B;  4N8O A;  1TV6 A;  2FJE B;  3F73 A;  1Y9O A;  2MKC A;  4OX7 A;  3TZW A;  3JYT A;  4AXI A;  4C48 A;  3NBP B;  2VBW A;  1U4B A;  2PGC A;  3ENQ A;  2WCX A;  1VOM A;  3JAM U;  3PJ9 A;  3IAM 9;  3VQT A;  4FPI A;  1U6F A;  2VOO A;  4OI0 A;  1XMO J;  3Q8Q B;  4LQ3 A;  2K7K A;  3B54 A;  3OLA A;  3PKM A;  5GVQ A;  3PFO A;  2B8Q A;  4ES3 A;  2MY8 A;  1GXT A;  3DDK A;  5LSL A;  3UNY A;  1IJF B;  3CMA S;  5E3A A;  2NYH A;  5U47 A;  2BRK A;  4NYO A;  3EVO A;  3ZTP A;  5MAO A;  3J80 Y;  1IUJ A;  1L3K A;  3PR4 A;  2YKQ A;  5E5N A;  3UDE A;  3RGI A;  1RTH B;  2ZM6 J;  1X4B A;  4PEO A;  2QSF A;  1NK9 A;  2GZO A;  1EQJ A;  2AU0 A;  2HS4 A;  3M30 B;  4QIW D;  1YKW A;  3DXB A;  5KFC A;  3K58 A;  2XSJ A;  2CPZ A;  3ONQ A;  1LW2 A;  4TKT A;  1QAY A;  2OFH X;  2J9C A;  1U0S A;  3LP0 A;  1B64 A;  2ZZM A;  3Q0A A;  3VTI A;  1MWY A;  5D0E A;  1TR0 A;  2B9W A;  3CCT A;  2GO8 A;  1UTA A;  4KGV B;  2W2N P;  4KR0 B;  5KFA A;  3DRP A;  2J8S A;  2R2R A;  2VPW B;  4A8Y A;  5EX3 A;  3DOL B;  1AXQ A;  2KT2 A;  2VBY A;  3H0P A;  4HVZ A;  1TFY A;  4B3R J;  3FBB A;  1E33 P;  4YS2 A;  2XS5 A;  3P4U B;  5B0E A;  5GAG U;  3CTR A;  1GMV A;  5IM0 A;  2VFT A;  3BGL A;  1TUV A;  2X1B A;  1C1B B;  1BUX A;  2CIM A;  3JSM B;  1NME B;  2HND B;  1ZYQ A;  1FJ7 A;  1WOP A;  3OUY A;  5HAO A;  4LQ9 A;  3DM2 B;  3O44 A;  2B4U A;  1JNZ B;  4NRT A;  1JIH A;  4QYR A;  2B9E A;  2XHC A;  2E5G A;  1M1K T;  3NWG A;  1PBA A;  2QT7 A;  4LMZ A;  3R1H A;  2YNG B;  5KFY A;  2G0I A;  2F8H A;  3BQ1 A;  1L5U A;  3N5B A;  5DDP C;  1FA0 A;  5LT5 A;  2YWW A;  4C7Q A;  1APS A;  2H1Y A;  4FYD A;  4XDC A;  2VFS A;  4IG0 A;  5A0Y B;  1SUQ B;  2GIR A;  3G8T A;  5D4P A;  3AJD A;  4LSL B;  3VVU A;  4H4K A;  2AEM A;  1E1Z P;  2DNK A;  2MZ1 A;  1H74 A;  4C8N A;  3NGK A;  3CED A;  2BUN A;  4UOO A;  1S9G B;  3BGU A;  3UI3 A;  2E1A A;  1HL6 A;  3R5B A;  1VC6 A;  3B5Q A;  3MM6 B;  2UXC J;  5DM7 Q;  3R97 A;  4DDF A;  3P5B P;  1UEK A;  1R0C B;  1JXL A;  1W26 A;  3IFE A;  4NLW A;  4I2Q A;  3AHP A;  4ZGA A;  2HFV A;  3MPW A;  5I3Q A;  4N76 A;  2KDO A;  3V5R A;  1EZZ B;  3PG9 A;  3QSI A;  1HR0 J;  3HVW A;  2CQC A;  3PEH A;  4HTJ A;  1RWN B;  4WFZ A;  4DSL A;  1MMD A;  3D9B A;  3MMA A;  1T05 A;  1C2P A;  2MYF A;  1G6B A;  1V3S A;  4F36 A;  2ZZT A;  1MMN A;  3MD1 A;  3NMA A;  1EX8 A;  3CO0 P;  2H9Z A;  5AJ9 A;  3GB0 A;  5L8R C;  3QRQ A;  4PWU A;  1RAE B;  4CO5 A;  4A8O A;  5ADZ A;  2ZBQ A;  5A6P A;  3SQO P;  3HSJ A;  2KKH A;  3WHI A;  4IDK A;  4P2S A;  1HNX F;  1U49 A;  3HHN B;  3VCD A;  1KD1 T;  1FNO A;  3O1L A;  2UUC F;  2GS8 A;  3OVS A;  1FRX A;  2NCK L;  2R7W A;  3OR1 A;  1Y4Z B;  4JI2 J;  2RHQ B;  3PZP A;  1HQU B;  2R7V A;  2UU9 F;  2MQ8 A;  4EWT A;  3K5L A;  2C2R A;  2YQ3 A;  2FJD B;  4OX6 A;  1S6U A;  5HVF A;  4ZHR A;  4LVO P;  5HK4 A;  2W8K A;  3D6M B;  4LBH A;  2G1D A;  3R1L A;  5F41 A;  3H4D A;  2KFZ A;  2K3I A;  4DSK A;  1UWB B;  1WKL A;  4PCQ A;  4KB7 A;  2F4F A;  2OD4 A;  2ZHB A;  4ZVP B;  4DLG A;  4R25 A;  5CD4 A;  1R7I A;  2H51 B;  4CNZ A;  3HHL D;  3JQM A;  4C8Y A;  1HWK A;  4QPT A;  1LKZ A;  3QLH B;  3T6J A;  2HRT A;  3EE3 A;  1WTB A;  5EDW A;  1AZS B;  4QR0 A;  4ATN A;  1KQK A;  3QNW B;  5L1L A;  1Q16 B;  1OYD A;  4N7T A;  1TQL A;  3ET6 B;  2V8P A;  4GVB A;  2MPU A;  1F5A A;  1SJ3 P;  1HMV A;  5C42 B;  1ZTW A;  4WKY A;  2ROE A;  5F3Z A;  2NR0 A;  3Q8P B;  2VQF J;  5HVG A;  3TA0 A;  1V6H A;  2B9Y A;  2CZ9 A;  1AUD A;  3ZZZ A;  3NKR A;  3D3C J;  2F65 A;  3D7S B;  4C98 A;  2UVU A;  5IOL A;  1QVG R;  2ILZ A;  2IVY A;  1FK9 A;  7AT1 B;  3MM5 B;  2CZV C;  3ITH B;  1CC7 A;  1NUE A;  4DCP B;  3JXO A;  2P6S A;  1VMB A;  1WC4 A;  2HEK A;  3R7B B;  5D78 A;  1KOH A;  5DS7 A;  4B9S A;  1P1L A;  2AYE A;  2OUG A;  3OVA A;  4CYU A;  1KTQ A;  2MXY A;  3IA0 A;  5LJ3 Y;  2E9T A;  3NCR A;  2X1A A;  3TAQ A;  2GIQ A;  3M8Z A;  3EPG A;  3HHK A;  2UUA F;  3CME S;  3QGG A;  3VGU A;  2QJ3 A;  3KK1 B;  4MFB A;  1TL4 A;  4J9U E;  4UY8 5;  3F56 A;  1S0O A;  5D0H A;  4O3N A;  4W4M A;  2KFN A;  3H2V E;  2IC3 A;  4OI2 A;  2ZBI A;  4ZMM A;  4M5G A;  3G6E S;  2ZJQ Q;  2KRR A;  1FEE A;  3VAK A;  3AFG A;  1N6Q B;  4IUF A;  1QVF R;  5A6W A;  2WVB A;  5DZ7 A;  3EPI A;  5DQG A;  1T03 A;  2W5S A;  1EAY C;  4EO6 A;  3GV8 B;  4M5I A;  1BQM A;  1RBA A;  3OR2 A;  3KLV A;  4Q2M A;  3DRS A;  2MHE A;  2XYP B;  1H0H B;  1TFW A;  2DO4 A;  2HVE A;  1TZ0 A;  5CXT A;  3M6W A;  1XIQ A;  3V2U C;  4ZP8 A;  3EDR B;  1KBR A;  5KFQ A;  1RT6 A;  1MNE A;  1HIY A;  1TL1 B;  5L38 A;  3TZX A;  2DBB A;  3N4W A;  2C3O A;  4J9S A;  3T1H F;  3KHL A;  2RF2 A;  5ETL A;  1VQM S;  4WP8 A;  1FRM A;  2ZH5 A;  3M9O B;  1KHW A;  5KFO A;  2QEX S;  3ZZO A;  4FXV A;  1FER A;  3M2R B;  1SKS A;  2MMY A;  3M2V A;  3G4S S;  3N28 A;  1EKR A;  3HHL B;  5EHH A;  4URG A;  2JH3 A;  1PJ7 A;  4UZC A;  5HQM A;  3M7V A;  3LP0 B;  2AX0 A;  5LMU J;  4HR2 A;  1U1L A;  1REV B;  1S6O A;  4RW8 B;  2FVS A;  3D0H E;  2ASD A;  3DRR B;  3H59 A;  2YWF A;  2HIQ A;  1F6T A;  2HBQ B;  1FCA A;  5B0B A;  4UZB A;  3O6Q A;  4OYB A;  4C8Z A;  2R2U A;  3A12 A;  2Z58 B;  3TUZ C;  3HX9 A;  2O66 A;  3MZI A;  2UVR A;  2DR7 A;  4DU7 A;  3D5M A;  1VQ4 S;  1NPP A;  3DRP B;  3UE2 A;  5KFV A;  2BJE A;  4DX6 A;  2CJX B;  5EX0 A;  1VQO S;  1SJQ A;  1KHK A;  1KH4 A;  4F4W A;  1JLF A;  1CS4 A;  3E01 A;  1Y10 A;  1QTN B;  3W64 A;  2UUT A;  3A1Y G;  2VFU A;  3DN9 A;  3F41 A;  3OFF A;  3MM8 B;  5G0R B;  1QSL A;  1FRH A;  2QL5 B;  1RT7 A;  3FZ2 A;  3M8P B;  4F50 A;  5BYS A;  4M5L A;  5J2P A;  1NO8 A;  3OUY B;  3U02 A;  4P7V A;  4RZR A;  4TYB A;  2VQE J;  3NP5 A;  1IBK J;  1HQE A;  2D1G A;  1N5S A;  3VAG A;  2UV8 A;  1IBM J;  1SBR A;  1TAU A;  1Y7P A;  2NYI A;  1U2C A;  4P2F A;  4YN3 B;  1EJJ A;  1FJG J;  4PQU A;  3MDF A;  2EG2 A;  3L95 X;  1TVR A;  3SV4 A;  1U1O A;  4KH1 B;  4E2F B;  1P6T A;  4FXD A;  1O99 A;  1RKJ A;  5ETQ A;  3R6G B;  4RUH A;  1EP4 B;  4DG1 A;  2HBY B;  1HWU A;  1Q81 T;  1D09 B;  3GWC A;  3U27 A;  2MZQ A;  2E7W A;  4LSN A;  3OTO J;  3KLG A;  1TMJ A;  3FKB A;  2M5Y A;  5D0R A;  3TUI C;  2L48 A;  1IWA A;  2XWY A;  1IKY A;  5FD1 A;  1LK5 A;  1UEU A;  3UD5 A;  2FLP A;  1LEO A;  5J2Q B;  4EBE A;  4KGM A;  3T5K A;  3KJN B;  1XBW A;  2LQJ A;  3BZQ A;  2MKH A;  4YDD B;  2IBK A;  2UUB F;  1EET A;  1FTR A;  1XMQ J;  3MMA B;  4E98 A;  1BQN A;  3EZO A;  2FZK B;  5GAD U;  2L41 A;  4AQY F;  4HI1 A;  3CCS S;  1VQ6 S;  2XI3 A;  3EGN A;  3BO4 A;  4A8M P;  1WWH A;  3KLH A;  1HNV B;  2OGU A;  4F2S A;  1C0U B;  2IM3 A;  1RTI B;  4XTT A;  4QQB A;  3VAH A;  4AL5 A;  4EEY A;  2XZT B;  3T02 A;  2XC9 A;  1O5J A;  4DV6 F;  2R8I A;  2CKW A;  4YB6 A;  3OFH A;  3V81 A;  1BGX T;  3SZY A;  1T9U A;  4K59 A;  2OEJ A;  3KJQ B;  2ATL A;  1ELO A;  3CCQ S;  5HO4 A;  4P6Q A;  2B3T B;  3UVJ B;  4R5P B;  1KNZ A;  4PXD A;  4ZHR B;  3RAX A;  4OHX A;  4RW6 A;  2JFK A;  2AKW B;  5HLF A;  4UOH A;  2AGP A;  3MCS A;  4FPR A;  4RX6 A;  2M70 A;  1U24 A;  3VAJ A;  1RWW B;  1K0T A;  4NLP A;  1IWG A;  3M2U B;  2YWH A;  1RT2 A;  2GA7 A;  3W9I A;  4JBC A;  1KH7 A;  4NXN F;  1M90 T;  3BB5 A;  2CQ2 A;  2HNZ A;  2RQK A;  1TU0 B;  2J7U A;  2XYG B;  1PC5 A;  4Y28 C;  4R0J A;  4RW7 A;  4QYZ J;  2GVZ A;  3EX7 B;  3IM8 A;  4IRK A;  4K4T A;  4DBQ A;  1VHF A;  1GNK A;  3ZC4 A;  2J6U A;  1VRU A;  3TR5 A;  2RHS B;  4ID5 A;  1UCN A;  1RAB B;  2DNQ A;  2HYI B;  2HFS A;  4JUZ A;  3IAS 9;  4EUV A;  1KFS A;  4QZV B;  4HL9 A;  4DCO B;  3RBZ A;  2Q66 A;  4GVB B;  1MRO B;  1RHK B;  1HMV B;  3EWG A;  4WK3 A;  3CDA A;  3KG4 A;  1RTD B;  2BE9 B;  1AB8 A;  1Y5L B;  2R3V A;  1ZM3 A;  3R5A A;  1SKU B;  4NYP A;  1SQF A;  3I82 A;  1JQG A;  3ILJ A;  2QLJ B;  3AY0 A;  1R31 A;  2MGZ A;  2BKO A;  2JVR A;  2WRM A;  1UJ6 A;  5DG9 A;  1A9N B;  1RTZ A;  2R7Q A;  3AQP A;  4KO0 B;  1HNZ J;  4LR8 A;  2L9N A;  3OXL A;  2CJB A;  1L3U A;  3LXQ A;  3IBC B;  2A1B A;  3GJR B;  1G4C A;  1KVK A;  2VG5 B;  2DGQ A;  2DYA A;  4DOZ A;  1T11 A;  3UPF A;  1RXO B;  5BR8 F;  4DXL A;  1AJC A;  3H25 A;  4CYU B;  1W25 A;  1DHM A;  1QD1 A;  2Q43 A;  3RRK A;  1KHV A;  4XO0 A;  4MFB B;  4WU3 A;  3D3B J;  3JB9 k;  2J0X A;  1SL2 A;  3RTV A;  1UZH A;  1R6Y A;  5FJ4 A;  1VIS A;  5HP1 B;  1OY6 A;  2OKQ A;  2IM1 A;  1IJE B;  2WOM A;  3RBD A;  2VG6 A;  2RUG A;  3BKT A;  3LPE A;  2J0S D;  3QO9 B;  2YNI A;  4H4M B;  2ZH3 A;  2OI2 A;  3HXM A;  1VR6 A;  2VJU A;  1FKP B;  1YJR A;  1SHN A;  5C7P A;  2CAJ A;  4L6V 3;  1URR A;  3ICL A;  1AUK A;  1MML A;  2WVC A;  4QPX A;  3DOM B;  4USV A;  1X5O A;  4C6A A;  4PYD A;  5H1S V;  1TKT A;  2LEB A;  5ETR A;  1RT6 B;  1ZEF A;  4F0M A;  3DHW C;  1JXE A;  4OZN A;  1RU1 A;  3IR7 B;  3NNA A;  2FY8 A;  1PGZ A;  1CJU B;  5J2M A;  3DMJ A;  3S7R A;  2UUC J;  2CDR B;  4MKB A;  2YKM A;  3ISN C;  1Q7L B;  4QIF A;  4MT1 A;  3GLJ A;  3CIM A;  5H9E K;  2PT0 A;  2UU9 J;  1RTJ B;  5B09 A;  1REG X;  4JI5 F;  2R7X A;  4N5S A;  4N47 A;  1VQ7 S;  3PX4 A;  2OPP B;  3IS9 A;  4HAC B;  1J2V A;  4QU6 A;  3M8S A;  4ZG7 A;  4UT4 A;  1N48 A;  3R7S B;  4QWB A;  2CJQ A;  5D0G A;  2FD2 A;  3QAE A;  1UET A;  4CZC A;  5K14 A;  4ENO A;  4M5D B;  2E5J A;  5AXM A;  1YRU A;  3WBZ A;  5I4M A;  2MLZ A;  4MIA A;  3DLK A;  3BO3 A;  3KHH A;  1ROF A;  1N2L A;  1Y3J A;  4DI6 A;  5CHC B;  2W2M P;  4NOH A;  1WC1 A;  3CUL A;  1Q5V A;  4M8L A;  2UXD J;  2HNY A;  3FRZ A;  4DU8 A;  1CS4 B;  3BKU A;  3E01 B;  4MAK A;  1DRZ A;  4OI4 A;  4MIW A;  1T0T V;  1HLW A;  1NJI T;  4HYK A;  2L9W A;  2GAG C;  1RKI A;  4NA3 A;  2YPZ A;  2W7O A;  2WB4 A;  4HKQ A;  4G6V B;  4FF3 A;  4WWS A;  5MLC V;  2VG7 A;  4RLE A;  4DR2 J;  4OLO A;  1K7H A;  3KYL A;  4KFB B;  3D66 A;  1E2S P;  5J2P B;  3K89 A;  1FEH A;  2NS1 B;  1J5O A;  1HQE B;  5L0E A;  3D1H A;  2W4C A;  3RW7 A;  3VGV A;  5TJ3 A;  4LIW A;  2XWX A;  1AUS L;  3IG1 A;  4EO8 A;  3J81 j;  2XLI A;  3KKF A;  5I42 B;  4DFK A;  5DLW A;  2CPX A;  1VIX A;  1GK8 A;  1OO0 B;  4IFV A;  1L3S A;  2XGP A;  1M5P C;  3R5J B;  2UUA J;  4QOT A;  3GYX B;  2F9J A;  1UP1 A;  4G1Q A;  4LSN B;  2ROP A;  3HHD A;  4I7F A;  1UMJ A;  3KLG B;  3VZI A;  3HFV A;  2JRS A;  4D3G A;  3SCJ E;  4IKA A;  3FBF A;  3MUT P;  4LF7 F;  1IBC B;  4MKA A;  2J9D A;  5CCM A;  3ZZP A;  2E9R X;  2J7K A;  1X5P A;  4WZQ A;  5A8K B;  5DDO C;  3Q8Y A;  3K5N A;  1X5S A;  1N5Y A;  1V9O A;  1HNI A;  2LP4 A;  1BQN B;  2R8K A;  2ZH6 A;  2YNH A; 
#chains in the Genus database with same CATH homology
 3T00 A;  3M8Z A;  3IDD A;  4MHX A;  1ALH A;  3TG0 A;  5KXA A;  3BDG A;  4CXK A;  3IGZ B;  3TX0 A;  4B56 A;  4KAY A;  2GLQ A;  3NKM A;  3NKN A;  4LRF A;  2GSO A;  2W8D A;  5LQQ A;  2W5T A;  5DLW A;  5L0K A;  2ZKT A;  1KH9 A;  4UPI A;  4LRA A;  4LQY A;  4FDI A;  4LRC A;  1KH5 A;  3NKO A;  5LRM A;  4GTZ A;  1E1Z P;  1SHN A;  2XRG A;  4UPK A;  3UNY A;  3DYC A;  1ZED A;  4N7T A;  5EGE A;  2ANH A;  2W5V A;  1Y6V A;  4YR1 A;  1AJA A;  3ED4 A;  3BDH A;  1KHL A;  3M7V A;  1AUK A;  3Q3Q A;  1Y7A A;  1HQA A;  1KHN A;  1SHQ A;  1N2L A;  4UOO A;  5HRT A;  4KJD A;  4LR8 A;  1E33 P;  2D1G A;  4MY4 A;  1ANI A;  4CXS A;  5GRR A;  4LR2 A;  3M8Y A;  3UN3 A;  1B8J A;  3CMR A;  1AJB A;  3LXQ A;  4LRD A;  5DLT A;  1N2K A;  1KH7 A;  1EW9 A;  5EGH A;  1ELX A;  3B5Q A;  5LIA A;  2GSN A;  5C66 A;  1ZEF A;  1HJK A;  1EJJ A;  1ZEB A;  3DPC A;  2W8S A;  3SZZ A;  5IJS A;  3NKR A;  1URB A;  4LR7 A;  3MK1 A;  1ELY A;  2W5S A;  2XR9 A;  2IFY A;  4CYR A;  1AJC A;  4KAV A;  3MK2 A;  5INH A;  4ZGA A;  1KHJ A;  1ELZ A;  1EQJ A;  4UPL A;  2W5Q A;  2W5X A;  3NKQ A;  2W5W A;  2GA3 A;  4TN0 A;  4GTY A;  1FSU A;  3WAY A;  4GTW A;  3WAX A;  2IUC B;  3MK0 A;  3M8W A;  4UOR A;  5IJQ A;  4UOP A;  1O99 A;  3BDF A;  4ZG6 A;  2QZU A;  2G9Y A;  3KD8 A;  1K7H A;  4LRB A;  1ALK A;  5K4P A;  4QAX A;  4CXU A;  4ZG9 A;  4LR9 A;  4KM4 A;  1E2S P;  1E3C P;  1ALI A;  3WAW A;  1KHK A;  1EI6 A;  3WAV A;  5LRN A;  2X98 A;  1ALJ A;  3A52 A;  1KH4 A;  1HDH A;  1ANJ A;  1O98 A;  2VQR A;  4KJG A;  3T02 A;  2RH6 A;  4FDJ A;  5GOV A;  3TWZ A;  1ED9 A;  3UN2 A;  1EW2 A;  4NWX A;  1ED8 A;  2W5R A;  2GSU A;  1URA A;  5AJ9 A;  4LRE A;  4ZG7 A;  3T01 A;  5L0E A;  3BDG B;  5DLV A;  3UN5 A;  3OT9 A;  3WBH A;  1AJD A;  3NVL A;  3SZY A;  5TJ3 A;  4GTX A;  3UO0 A;  3NKP A;  5L0B A;  4UPH A;  3IGY B;  4MIV A;  3E2D A;  4CYS A;  4NWJ A;  1EW8 A;  1P49 A;  2IUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...