4LREA

Phosphopentomutase soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lreA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lreA01
1HJKA 4LR7A 2RH6A 5LQQA 1KHNA 1ZEFA 1EJJA 2W5WA 3NKRA 4GTYA 4UPKA 4UOOA 3BDHA 1URAA 4MIVA 4UPHA 4ZG6A 3WAVA 3Q3QA 4FDIA 5INHA 4B56A 1ANIA 3SZYA 2W8DA 5C66A 2QZUA 2X98A 1AUKA 1EW8A 1AJAA 3CMRA 3B5QA 3M8YA 4ZG7A 1AJBA 3NKOA 3NKMA 4NWXA 3T00A 1ELYA 3T01A 5DLTA 2XRGA 3NKNA 5GRRA 1FSUA 2W5SA 4GTWA 1Y6VA 4CXSA 1KH9A 4QAXA 2GA3A 3IGYB 3M7VA 5LIAA 1ED8A 3M8WA 4LRDA 2W5VA 3MK2A 3UO0A 2G9YA 1KHKA 1ELXA 1ELZA 3DYCA 1E33P 4ZGAA 2ZKTA 3KD8A 4UOPA 1EI6A 5DLVA 1EQJA 5LRNA 4LRAA 1ALIA 5L0BA 1ZEDA 3WAXA 4CXKA 1HDHA 3OT9A 2W8SA 5L0KA 4CYSA 1HQAA 5IJSA 4GTXA 2D1GA 2IUCA 2GSOA 1ZEBA 3UN3A 1E2SP 3BDFA 3NVLA 5GOVA 4LQYA 1Y7AA 5HRTA 1ALHA 1P49A 2IFYA 3TWZA 1KHJA 2W5RA 5AJ9A 4GTZA 1ANJA 3UNYA 2GLQA 5L0EA 3NKQA 1ALKA 1K7HA 4LR2A 3WBHA 4KJGA 2W5XA 1KH7A 1AJDA 3LXQA 2ANHA 3E2DA 3TX0A 5LRMA 2GSUA 3A52A 4TN0A 3WAWA 3IDDA 3TG0A 1EW2A 3SZZA 2XR9A 3ED4A 4UPIA 4FDJA 1URBA 1SHNA 2W5QA 4LREA 4LRCA 2IUCB 3NKPA 4CXUA 1ALJA 1E3CP 1EW9A 4KJDA 1O99A 3MK1A 1B8JA 4LR8A 4CYRA 1AJCA 1ED9A 5IJQA 1N2LA 4NWJA 3UN5A 2GSNA 3MK0A 5KXAA 1E1ZP 3DPCA 3T02A 5TJ3A 4UPLA 2VQRA 3WAYA 4YR1A 1KH4A 1SHQA 4KM4A 4KAVA 4MHXA 3UN2A 1N2KA 5DLWA 5K4PA 3IGZB 4LRFA 4KAYA 3BDGA 3BDGB 5EGEA 4UORA 4LRBA 1O98A 4MY4A 4N7TA 1KHLA 1KH5A 2W5TA 4LR9A 4ZG9A 5EGHA 3M8ZA
chains in the Genus database with same CATH superfamily
4DDFA 4KHPJ 5CYJA 3OXGA 4B3SF 4B56A 1KBRA 1FERA 4JI1F 3W2VA 1RACB 4ILLA 1L3VA 4CO2A 4X62J 4JI2F 2CDRB 5EN1A 4ZITA 3CXCR 5DQHA 3M7VA 3M8WA 4JV0A 1ZZNA 3CJ5A 1RLCL 3GFHA 2IHR1 2DH9A 2GO9A 3R3TA 5E3PA 3T1HF 2EXUA 3AAWB 1HPZA 4WFZA 3CJTA 3T6JA 4DR1F 3MR5A 3BKUA 3KLHB 1NKCA 2UUBF 5EWFA 1FRJA 1P49A 4C8NA 2RRBA 2V67A 5KT7A 3PW7A 3TO8A 4BC7A 1SCJB 4ZLJA 4TYBA 3BR8A 3TUJC 3ZZPA 3A8EA 2IUCB 1CBKA 4PWWA 2D1CA 3DRRB 1TL7A 1S48A 4OJ1A 2Z2YB 1CJVB 1HNWJ 1NPRA 5I3UA 4KPYA 3P96A 2IJRA 4N7TA 2XY7A 3KYLA 1T9XA 2KFZA 4F67A 2MQ8A 4KB7A 3GG1A 2R4FA 3R5GA 1RWKB 4UT4A 3IRXA 5DO2A 3KTQA 2HZAA 1CG2A 3QWPA 3W9HA 1GFWB 3ZZOA 1M5VC 3AXMA 1XMQJ 2G9YA 2CQHA 1FWPA 2DH8A 4DR6F 5CQGA 4YB5A 5KFHA 1SJ1A 2DR5A 3AJ2A 2D1GA 4EUVA 1U2FA 4WJBA 2DNOA 4P52A 3UD4P 2DHGA 1M5PC 4GRSA 1H0HB 3H2VE 3MR7A 3QT8A 3M8QA 3VGSA 2XY6A 3TQ1A 2W01A 2B8QA 2HURA 1RQ0A 3WZ0A 2GJFA 1YWXA 2G4BA 4KO0B 3BGFA 4FVCA 2CQ0A 4I2QB 3W9JA 5D4OA 1IKXB 2COLA 1SHQA 4NWBA 3KLIB 4D3HA 3QJPA 4B3RF 1VIXA 1VQOS 3DU5A 1YKWA 4ZJLA 2EPIA 2IBKA 3BYRA 5AXMA 1S1VA 4YS2A 3TZZA 2K2PA 2WONA 4C3LA 1WHVA 1VHFA 3OTEA 3H2UB 1ZZFA 4J90A 3QLHB 1CS4A 4EEYA 3QZ8A 5L0BA 5HQ8A 4C9DA 4FPIA 4O3NA 5EX0A 2PEBA 3S6EA 3EM1A 1WF1A 4X65J 2GAHC 3MMBA 4MAKA 4DF4A 1JLQA 3NKYA 1NSAA 2I5JB 2MQMA 4NRTA 5F0UA 3GR0A 3SV4A 4NLDA 4RBTA 1CVJA 3EZUA 1R8HA 3MCSA 4NLVA 3TJ9A 3CCJS 3M4XA 4JI7F 4ETXA 4K0KJ 4KRWA 4CM2A 1OQ6A 3EYZA 4X4VA 1ZAXA 2D9PA 4HI2A 1FO1A 1HNVA 3CO9A 3EX7B 1HBOA 3TNVA 5L1LA 2HNZA 1D8ZA 3ET6A 3UDLA 1UWBA 3BREA 2R2UA 3VVUA 4IO9Q 3NNAA 3CDEA 2W7OA 3CCLS 2NYIA 4ZHRB 3PIOQ 1IBMF 4PQUA 4DN0A 4OX7A 1I3OB 5CCMA 2V68A 2VIHA 1WEYA 3E8OA 1CJUB 1VISA 2CFXA 3NRBA 4CO1A 4CNZA 5C42A 4L76A 3CJ0A 2HGMA 2ZVSA 3HULA 4M5MA 3DLEB 2Z4PA 2HVIA 2Q66A 1FD2A 1AZSA 2MKKA 2R8IA 1BLUA 2ABYA 2XR9A 1F5AA 2FLLA 2AJFE 2EK6A 5IV4A 1ZTTA 4QIFA 3MK0A 2BRLA 3JQKA 1FRHA 3I87A 2JL9A 4X64J 2B3TB 1U1MA 5E33A 2FZGB 3C14A 3KJVB 1BWEA 5H9FJ 3ILLA 3OFHA 1DTTA 4RR5A 3MEKA 5BJRA 2V0NA 1WEXA 2H54B 5HVFA 1MWYA 1X8DA 4PABA 1GMUA 2AKWB 4YMEA 4HH0A 3US5A 1HNZF 2O5DA 4RNOA 3QGHA 4NYZA 2W8LA 1RAOA 3IGVA 2JNJA 4NCBA 2RUGA 1CJTA 1SQEA 4DR5J 2QSFA 2GHVC 3NBPB 2AX1A 1VBKA 4PUOA 1R7IA 2PSZA 1C1BA 1NK6A 3OW2R 1VHIA 1PBUA 1XK8A 5DDPC 3LGMA 4OZLA 3W8GA 2CWKA 2FYXA 5D3GB 1DZ5A 1TMJA 3CCWA 1UMJA 2VBZA 2RHSB 3BBCA 3TVYA 3HMJG 2AEMA 4QWCA 1CLFA 3KKFA 2CKWA 1T7PA 4P75A 2MHNA 1SJFA 1HW8A 4K5SA 4Q2LA 3MF5A 5ETSA 4W98A 1ITPA 3SSSA 5D4NA 1WG1A 4DZ6A 2GQ2A 2GIQA 1QTNB 3PFOA 3M2VB 3AQOA 1LWCA 4Y65A 2K7KA 3KMSA 1NB7A 3VCDA 1YVFA 1UFLA 3TARA 3KNAA 3VAHA 3FUYA 3IBFB 3L09A 1XEZA 2RS8A 2EG1A 1WI6A 1VRUA 4RNNA 1EIYB 2ZJPQ 4DV2F 5C24B 3HO1A 4CH7A 3NMAA 2HNYA 4I1TA 1S7HA 4RLEA 3J81Y 3TOQA 2W5XA 5KFYA 2ANHA 4M5DA 2UV8G 3MOZA 5EX3A 3R1HA 2I2YA 3CDBA 5CYQA 3MUMP 3SSRA 3PM9A 3MM6B 4F0HA 2VB6A 2AU0A 3D4JA 4A8YA 2H5IB 2D3O1 3CDWA 5B09A 3TA0A 3W2WA 2HHPA 5E3QA 3C8YA 3DM2A 3Q8RB 1S9EA 4N5SA 4DR4F 3NEKA 1SC3B 2QFIA 3HLUA 3SI8A 2B43A 7AT1B 2WB1D 2Z2ZA 4UPHA 4FDIA 5INHA 3N9UC 1QAXA 3PY8A 3B5QA 1S6QA 4TLQA 1X4AA 1X5PA 4K4SA 2DGQA 1HA1A 4GC6A 5CYMB 2IVFB 1X9MA 2UUCF 2BE9B 2JVOA 1VK3A 4NPOA 1UJ4A 4OV1A 4AFFA 2QL9B 2Z2MA 1C0UA 3HP6A 5EWGA 3CT9A 3CWJA 2R7OA 1WORA 3UDCA 1GX6A 3G87A 1N34J 2J0SD 1MW7A 2MLYA 2HQGA 4X4RA 2PC6A 1NEEA 2HQIA 1ZM4A 4QPTA 4UW2A 1QDUB 4WKYA 1JLGA 2B4PA 1X9SA 1OY9A 2K1RB 3W63A 3HHEA 1VBZA 1O0PA 3OL8A 2QG9B 1BQMB 2YQ3A 3KOAA 3ZTRA 2O3DA 3FEYB 1RT3A 4RL1A 2AEJA 3PHEA 4I7FB 5DLGA 5H9FK 1U25A 4LRBA 2XNRA 5B0AA 2VA2A 4KJIA 2W2NP 4ECUA 5ADZA 4EK2A 3Q8SB 5GAEI 3SIPB 4ZVOB 4X66F 2RQ4A 2HZVA 3V81B 1PYSB 3PIPQ 2KKHA 1SJQA 2LEAA 2OO4A 1R27B 4FYDA 1H72C 4DBQA 2C2NA 3KJFB 4LBPA 3RBZA 2P9EA 1QSLA 4RW9A 4J9UE 2IRYA 3OQ2A 1WOSA 2F4VJ 4IFYA 3M2UB 1TV6A 2DY1A 3ZFVA 3KHLA 5K8PA 4OQJA 2X1GA 2AJ2A 3MGJA 2MY8A 1AYEA 1K44A 2LXFA 1LWEB 1M5HA 4P2SA 4DUYF 2CPXA 3CMQA 4YY3J 4MT1A 3K59A 2RU3A 4I56A 3AB2B 4JI8F 2E7XA 1N36F 4IO1A 4O4GB 2DXDA 5KT3A 3PEHA 1SV5B 4R5PA 1X4CA 1X0FA 1J5EF 5CABA 4HACA 3MM7B 1S1UB 2W2MP 4F3QA 2HAFA 1OPIA 5GMKa 1FF2A 1PJ5A 4NL5A 2DGXA 5KFNA 2C3YA 2JH3A 4WYWA 5EDWA 1UWAA 2HHHJ 4PXBA 4WZQA 3LWMA 5CZXA 3GIJA 3SMZA 1F1BB 1RT6A 1NRKA 1SL0A 2WW8A 4E98A 3VQTA 3NVLA 1KQSR 4WTYA 5ETLA 1FXDA 1NUEA 4ED3A 1GMWD 3TAMB 1WC1A 2N82B 2NXEA 2Y1IA 1K8AT 3CW2C 4N76A 2WVFA 2ZNZA 2YQ0A 4JYAF 2AIRB 4DL6A 2H48B 4N41A 3O3LA 4A46A 5LMUJ 2XWXA 3DYAA 1S1XA 2MQLA 3I5AA 1GX5A 2AF6A 1FK9A 1CC8A 4RUHA 4UOOA 4MIAA 4BBYA 2WVBA 3BGUA 2Z57B 2VL1A 3BV8A 1EW8A 3RAQA 4MFBB 3W7BA 3QO9B 1JLAA 1JX4A 3DGPA 4KBIA 2JJ4D 5J2NB 1HR0F 2R7RA 2HK2A 4RW6B 1Q7YT 4ZN1A 4LQ3A 4PYAA 3A4TA 3BSAA 1YJ9S 1NK8A 2HHQA 2BABA 1C1CB 2B4UA 3GG0A 1N4LA 2VPWB 3UFCX 1S6PB 1MMLA 3I31A 4NOHA 4NA3A 4DV1J 4DV4F 3PCOB 2DVIA 1UVNA 5T14A 3IDDA 1Y5NB 3OFEA 4FDJA 1EAYC 2V8GA 3VR1A 2XCAA 1FDNA 2XGQA 3KHRA 4Z7YA 1IKWA 5HROA 1MMNA 1VC5A 2ALYB 3WAYA 1L3TA 3TZWA 3HVTB 3ZTOA 4JI6F 5J1EB 5A8RA 4NI2A 1VQPS 3AXKA 3M8ZA 4WTOB 1WNEA 3DRSB 2FHJD 2I9SA 3P45B 4WP9A 3ENQA 2A3JA 2W8DA 2UXBJ 1U09A 1IKVB 1O5JA 4RBVA 4ZVPB 4E0DA 1XNRJ 1URRA 3JAMY 3GYNA 2F9JA 1NDCA 1VS3A 2CQ2A 2B6AB 2XO7A 3IRWP 1S77D 3ELHA 2D3OR 2HFZA 5IJSA 4ED0A 3POTA 4R8UA 1SKSA 2W7AA 3V6JA 4OJHA 2W9BB 2IA0A 3PO4A 4K4XA 5D6GA 2E9RX 1TUWA 2OSRA 3NXZA 2Y0BB 4OX9F 3QAUA 1IKYA 3R5AA 4ILRA 1N5TA 3GB0A 4UPIA 1TU0B 4P71A 4ELTA 4RW4A 1U2RA 3D6MB 3RRHA 2AJ4A 1KWMA 1SUQB 2GC8A 4GMKA 3KK2B 2X3GA 1RHUB 2QIFA 3ETMA 3O6QA 1SVDA 3NGTA 1PGZA 3QJLA 3CUNA 5L9XA 5L38A 1H2VZ 3CJRA 1RJJA 3DI6A 2DO4A 3OTBA 1LW0A 1SXLA 1AFJA 2XZTB 3T01A 1JJ2R 1UJ6A 4X4TA 1NKBA 4C8KA 1VYAA 3HKWA 3N6LA 2WOMB 1LQ9A 4DCJB 3K5NA 2UP1A 4ZP8A 3N5BA 3BF4A 3MR6A 1RAHB 4PPZA 4P9SA 4PRFA 1M0SA 3GMGA 3L3CA 1X4BA 4A8FA 1FRXA 4KC5A 4CYSA 4EZ6A 2IPOB 3IM8A 2GNKA 2VFVA 3SCLE 1E2SP 3EWGA 1E6YA 3T41A 5GMEA 3TZYA 5KFQA 4FXDA 4I2PA 4AQYJ 3LO3A 1LK5A 2H5EA 3QFHA 2UU9J 1UW9A 3QIPB 3HFKA 4DWIA 4XPEA 4DG1B 3RJMB 2VV5A 2MKJA 4G3IA 3SDEA 3R8YA 3R6GB 1I94F 1VJQA 3EXYA 4GVLA 1IJEB 3GE9A 3GONA 1S76D 3OHAA 4ED5A 2M9KA 1YITS 5LQQA 3ISZA 1U0SA 2D3ZA 2DD8S 2HHSA 2ACMA 5KT6A 5F8MA 1NSPA 3NOGA 3ZTQA 2YNHB 1QE1A 2BYCA 5LSOA 2F9DA 2CZVC 1MSWD 1RT2A 3BH7B 1NPKA 2YKAA 1Y3KA 2ILYA 1J5OA 3W2VB 3H2LA 1Q78A 3F73A 3LW5C 3K5PA 3M9NB 1X5SA 3E2EA 1KHJA 5LMNF 4M5HA 5HMXA 1ALKA 2R7WA 4ZLNA 1D3WA 2ATLA 2C22A 4W92B 1Q95G 4I6AA 1LWFA 4ID5A 1REGX 4DV7F 4DFJA 2DEJA 5D8HB 1HPZB 1RWUA 3D66A 2AEFA 3BGRA 4WE1B 2CQBA 1CC7A 2RAQA 5F9NA 1VRQC 2KL8A 3LP2A 1HQ2A 1UVKA 2RVJA 3TQEA 1NSKL 1VOMA 3BKTA 2MKYA 4NCGB 1FNOA 4LBHA 1GAOA 3KDOA 5LSRA 5I3UB 4ZPBA 2OFHX 2OD4A 4J9LA 4QU7A 3CNQP 5K8OA 5E5NA 3RRKA 4GKJJ 2L3MA 4XK8C 4ECSA 2GGPA 3RRGA 3DLKA 4CLSA 5IZHA 1D0EA 3IAM9 5J1NA 4G1QA 5DG7A 1WC4A 4B3OA 2YWKA 4B3SJ 4F4XA 5LJ3Y 2MZQA 3QWUA 4I6YA 3PRVA 2MQPA 1NNDA 4JI1J 4YOEA 4I0WA 2ALZA 2JOQA 1KS2A 3RBDA 2ZNYA 4JI2J 2BQ3A 4ITSA 2MMYA 5IWAF 4QBUA 3PX4A 4ZPVR 4C8LA 1GNKA 1CEZA 3QIDA 4ELUA 2E9TA 2MTLA 4LF5F 1F9FA 1C2PA 4BWMA 1LKZA 3T1HJ 4KHMA 3M8QB 3TJ8A 5D0HA 3GLJA 2QTWA 3PJ9A 1KQKA 3DDKA 2UUBJ 2ZC4A 3EVWA 1W7WA 1UKUA 3KUEA 2HSEB 1SKWA 1IM4A 5HMYA 3C6UB 3PVXA 4GKKJ 5KFCA 2HZCA 1VLOA 2KVIA 1WDDA 3UI3A 1S1VB 3UO0A 2ASYA 1FESA 2HNDB 3DLHA 1FXLA 4HT5A 2CZ4A 5J2MA 4HTJA 1KHVA 1REVB 1S9GA 4LSLA 3UN3A 1JKHA 3MZIA 4DU7A 3DHWC 4RW8A 2AYMA 1HNXF 1HWUA 1CS4B 4IFVB 2BACA 2D3UA 5BXIA 4MKVA 1TK8A 1R8BA 3JSBA 3MMBB 4U9RA 2ZH6A 4KV8A 1MG7A 1JLQB 3MM5A 3GTYX 3MPDA 3CMAS 3J80U 1D9DA 3PX0A 2XLKA 4DR6J 3L7PA 2B5JA 2C3UA 3HHLB 1V3SA 2VBXA 2C42A 3AD8C 3WQPA 2VFTA 1RCXB 1HNVB 3BDPA 5B0GA 4YFUA 1GT8A 1T9UA 1KSPA 4KTQA 1HHQA 2KRRA 2GO8A 5DETA 2L9WA 1QAIA 1UWBB 2E1PA 3OTDA 4OHZA 5GAGU 1AFIA 2MHEA 1R43A 3MEDB 1F6TA 3BQ2A 2DTJA 3WC2A 4L74A 4PQUB 1SBRA 3OXFA 4B3RJ 2I0XA 1QM9A 2Z0GA 4TN2A 3BM7A 5B0DA 4HVZA 3I0RA 5CD4A 1L3KA 3QT6A 3DOKA 1QY7A 2QA4G 2GMLA 4KJDA 4ZJQA 4OX8A 1N5SA 3ZO7A 4FKXA 5JJBA 1FRMA 1DLOA 1OY8A 3FZBA 4FP9A 3KLFA 2YWHA 3W61A 4EFAC 2ZH7A 3IFEA 5HBMA 1JNRB 3Q8YA 1SJRA 5KFAA 4O4RA 1FRLA 2YWGA 2XEXA 3BDHA 2JZ5A 3J7A1 1MLAA 4YEAA 3H5YA 4RW7A 2OMLA 4KHRA 4USUA 4ER8A 5A8WB 2KTQA 4WZMA 2GVDA 4YR0A 2W8KA 1P1LA 3KHGA 2VQFF 3IS9A 2W5VA 4JOUA 3CF5Q 4XAKA 2CJQA 2LCWA 4JI7J 1F0XA 3AJDA 2V2KA 1KTVA 2GA7A 1Z2ZA 1S0OA 1HWLA 3DMJB 1RABB 2XMAA 4WIIA 2AYBA 2B8PA 3C46A 2H65B 5FD1A 1V6HA 4OJGA 2X7IA 4FYVB 2R7QA 1OPZA 3NNCA 4JI5F 1RU2A 3ED4A 3GYGA 3VTIA 1IBMJ 4A8SA 3HI9A 3R5DA 2L08A 4DL3A 2CAJA 3E51A 4OFZA 3VV2B 2QLJB 2RQMA 2V4QA 5KFTA 1C1BB 2HHWA 2KB2A 5KFXA 1KH5A 4DFKA 1IR1A 1KQGB 2MKHA 3UR0A 4IDKA 3V6DB 1NK0A 5IV3A 2CPJA 1X60A 1JMTA 1Y7PA 2K8GA 1R31A 2RDIA 2OD6A 1AJBA 3M32B 4NWXA 1SQFA 5ETQA 3V4IB 1HI1A 4HR2A 3RZAA 2OTLS 3TUPA 4KGXB 2QSWA 1XMBA 4O23A 4USIA 1KH9A 4OYIA 4ZVUB 2CUYA 4J5OA 1T8EA 4UOHA 1FNXH 2W4PA 3F56A 1DTQA 5F8NA 3DLLQ 1U02A 4DSJA 4H4KA 3CCRS 1AUDA 1JLBA 4C97A 4P2MA 1S12A 2J6TA 1RSCA 4DSIA 4PWDB 5MLCV 5J2QB 2KH9A 5J1PA 1RCOB 3G8TA 4OYWA 3J81U 5EUHA 1DRZA 1RISA 1VK8A 1VGYA 3AA9A 2FVPA 3ZTPA 1XIQA 2QN6B 2MYFA 2CDQA 2IDEA 2EVZA 3DCAA 5AE3A 4ZCKA 3GCXP 4AL6A 2RQCA 4CRJA 4CIOA 2ZVIA 1ZAVA 4NZ6A 2W9AA 2RT3A 2QZUA 2DNZA 2JLFA 5I42B 1I1GA 4C0OC 4GTWA 1U2CA 3W2WB 5DS7A 5LXYA 3H5XA 3KWMA 1Y9OA 1S9EB 3NGDA 2HHTA 2FGCA 5CHCB 1PIEA 3H42A 4QOTA 4YHHF 4YB7A 5DLFA 4F4WA 2HVHA 4I6WA 2HMIA 3GJQB 4JB8B 3UPFA 3ZZRA 4OZ1A 3SBMA 3M6WA 4P7TA 4GTZA 1S9FA 2J0WA 4CTAA 3LQVA 1EETA 1RAAB 4L6V3 1U0HA 3M2RB 4CZCA 1HBNA 3IXQA 1N5YA 2W2QP 1B0VA 1VQYA 4OYAA 3DOLA 2IMWP 3QQCD 3HXMA 2NXUA 4FZVA 2AZ1A 3H59A 3AA8A 4EI2A 4F2SA 5HO4A 1RKIA 3WIUA 4WWSA 3H5UA 1VIOA 1T9YA 1KH4A 3LUYA 3CJKA 1JLGB 2CG4A 2EI5A 1GQEA 2Q79A 2WSFC 3HHLD 1WKJA 1FDDA 2KYXA 4DV2J 1BXNA 3I9ZA 2EC0A 2C2MB 3K5OA 4Y0FA 4NXMF 1RT3B 3CCES 2B4VA 1BQNA 2V2ZA 1BC6A 1RTJA 3AT1B 3JYTA 4U7UD 2IY5B 2GA3A 2XYGB 1X7VA 1X5TA 3LP1A 3P49B 3FBEA 3MUTP 3R6LB 1ZEDA 4OI1A 3GZ7A 1RWPB 1V9OA 1YX2A 1Y7AA 4DR4J 2XNQA 4FYWB 3C6TB 4IG3A 4U67Q 2HFOA 4OYXA 4ICLA 3PO5A 1TL1A 4FS2A 4RW9B 2ZD1B 3PW0A 1R8PA 4MYTA 3V2UC 1T05B 5KFRA 3HVRA 4G1PA 4F4YA 4KPCA 4ZA1A 3TRGA 4U7UK 1TK5A 5DDOC 2DNHA 2IMOA 4DCPB 2XZDB 3QT7A 3Q0AA 4WP3A 4P74A 4ED4A 1HD0A 3LPYA 4CO4A 4A8KA 2GAGC 5D4LA 2ZUAA 2CNOB 5L8RC 5KG7A 3HM9A 1S1TA 1NJZA 4O0NA 5E3RA 2RDJA 3D3BJ 3CJ2A 2XM3A 2GCFA 1YJRA 3PDNA 3E01A 2XSJA 3IAS9 3HK2A 1RU1A 1W2BR 5T7LB 5KG5A 1ZM9A 3JQJA 5KFIA 2H51B 2YX7A 4QWBA 1IUJA 4EBEA 3A3PB 1AT1B 3IR5B 2HFVA 3A8KA 4KR0B 2FVSA 3LF0A 4X66J 4CWBA 4WP8A 3VGUA 1RT6B 3GILA 1KLNA 2JRSA 4UF4A 2VHGA 3MM8A 1EQMA 3GQCA 4CYRA 4NYPA 1LOUA 1OYEA 2BE7D 5GADU 3QGGA 5TJ3A 1PJ6A 3EGVA 3NWGA 5FJ4A 3KDNA 1U8WA 4OYPA 3C19A 4JI0F 2BDPA 1XR7A 4G1IA 2VG7A 4RNFA 4LR7A 4CLFA 3VAMA 3AFGA 1ZA1B 1H7WA 2XC9A 1RT7B 1DURA 1UEUA 3NS7B 2DITA 1YLXA 4NLSA 2RS2A 5G0RA 4YN3B 2CQPA 1S1XB 5H1SV 1WC3A 1K9MT 3MPYA 4WBFA 4DUYJ 3N4WA 1YJVA 1M5SA 2E44A 2MQOA 5CA5A 2C3MA 4URGA 1N36J 4K2XA 1R6VA 1HBMA 4PR6A 3C16B 5D0EA 2MKCA 2HLTA 3GIKA 1J5EJ 3DGPB 2CJKA 3PHTA 3H4BA 1KONA 4KT0C 1S1WB 3VQSA 4I64A 4F4ZA 2V94A 4USJC 4DQPA 2DNYA 2ZE2A 2MGZA 1TFWA 4B08A 2GV1A 3S01A 3OSPA 3CJ8A 3MAQA 4YP3A 2G0JA 5KFBA 4V19J 3B8HA 4A47A 4X4QA 1FA0A 2VOPA 2RB7A 1KFDA 4FN5A 4H4MA 2BA9A 4NEZA 1ZOTA 5KAKA 1ZAWA 4XTTA 4EYHB 3JAMU 4KAIA 3A3OB 4HTIA 2IC3A 2Y1RI 4JYAJ 4X4NA 3D9BA 4TY8A 1NSQA 2CJAA 1TKTA 7FD1A 2FDNA 4OYZA 2V9KA 3D28A 3R1LA 2NCKL 4UY8T 2OKQA 3CJQA 2XMUA 2B9EA 1RTZA 2AWZA 3T5JA 2FZCB 4M5JA 1SC6A 2ZOMA 1UEKA 4DL7A 3POTB 1P9YA 2YKMB 3DOMA 2WRMA 2GVZA 3VZIA 2G13A 3H90A 3R9LA 2Y3YA 2VG6A 1HR0J 1UJ5A 2CG8A 2F63A 3ITHB 3UNGC 3G6VA 4MY4A 3FBFA 1HJKA 4GO5X 3AD7C 3IR6B 1B3TA 4RW4B 1U24A 1YJNS 3CVKA 4F0MA 2LP4A 2MLXA 4N56A 1ZA2B 2N7CA 4OJ3A 2MY7A 4DV4J 3CD7A 4DHVA 4DZDA 1VDHA 1S0MA 2CPZA 5IS2A 3CD0A 5DM7Q 2RKIA 1RT4A 2UXBF 4UZBA 3JQMA 3FGVA 1RT1A 3DYCA 3DI6B 3PRDA 4F7VA 4H4OA 1UA0A 2J0XA 1RYRA 1RHQB 4JI6J 5DZ6A 2NPIA 4Q43A 1E6VB 4C8ZA 4J37A 3LP0A 5A6WA 4PWUA 1HQUB 4ZLLA 1N52B 3GV5B 1HYSA 3IG1A 1EW9A 6FDRA 1RI7A 5I3QA 1E6YB 4DL2A 3P5TL 4HDHA 4WU2A 4J9OA 1Y0HA 4YR1A 3SSQA 5DLWA 1EX8A 1Y11A 2JVRA 3W62A 2DT9A 3KLGB 5KT2A 2ZBCA 2FIUA 3BQ0A 5L1JA 2F1FA 1A6LA 4WFYA 3SDEB 4MIWA 2J9EA 2Y1LB 1RHKB 1WEZA 4DV5F 5FDLA 3H20A 3UVJB 3I96A 2MZ1A 2JSXA 2AGQA 2E1RA 4Z2XA 1EHWA 1NZAA 2KI2A 5IQQA 1FFWB 1G4CA 4ZLPA 3ILIA 3HSGA 2LDIA 2HVDA 2KO1A 1JB0C 1QUPA 3RR8A 3CCZA 4KE5A 5H9EJ 3QFWA 2QLFB 3QSIA 1Q53A 1YJTA 1QE1B 2XMTA 2M70A 5K14A 5DG8A 1NDLA 1FHTA 1VQ8S 1NJYA 1RT2B 1YJ7A 3T1AA 5L46A 1J5OB 5KFZA 3UW1A 3T1YF 5DDQC 3CCUS 1VQ5S 2QT7A 3KMQA 3TAPA 4AQYF 3IO1A 2B51A 2P6TA 5KG2A 3AOAA 4OLOA 1H7XA 2UU9F 1UP1A 2BJ8A 2OEJA 2VFRA 3IGZB 3BDGA 2Y8WA 4ZVFA 1O98A 2LQBA 4UOGA 1FKOB 5EGHA 3BZQA 4CO3A 4RZRA 1RAEB 2ROPA 3CB4A 4IQMA 1HNIB 3TUIC 1FD8A 4R0JA 4OL8A 3H25A 2FJXA 5BR8F 2UVRA 4V1Ak 5HLFB 5K8NA 1VQ9S 3ZZ0A 5ETKA 4H54A 1IXKA 2L9DA 1Q82T 4KY3A 1OQ3A 3MD1A 2VBWA 1F5BA 1I94J 4U8VA 4ED6A 4DPYA 2CQGA 5IM0A 2RUSA 3KLHA 1B0TA 1YSJA 2J5AA 2YNIA 3OVBA 3CO0P 1Z2LA 2RF2A 4DR3F 5E3AA 3M05A 1M1HA 3WAWA 3DLKB 3BGLA 1T3OA 5KFGA 3THTA 1O99A 1L5UA 1IR0A 1CJVA 5HAOA 3BO4A 4PG4A 1HMVA 2LECA 2MZJA 3LPEA 3H0PA 2W5TA 4F0KA 1TL4A 4F02A 1URAA 4YB6A 2RNEA 1RA6A 5L9NA 1XWLA 2HQCA 4LBIA 5LMNJ 1RHMB 1YBAA 5IT4A 1G1XA 4EYIB 4ZPTR 2SXLA 1FT8A 1CULA 2QO3A 2CA9A 3I9V9 3IWNC 2DHXA 4RO0A 1TAUA 4OX6A 4CXKA 2VKRA 5HQLA 4NCAA 2HLUA 2IM0A 3G4SS 3MUVP 3FSIA 3Q8PB 4A8WA 5B08A 2A6MA 2EKYA 1EP4B 3VVTA 2ZH1A 3CC4S 2W24A 1FWKA 2XY5A 4LREA 5J2MB 1ALJA 4LSLB 4KO0A 2HS3A 3W66A 4M5LA 4I2QA 1JQGA 1IKXA 4M63A 5KXAA 1S4EA 2JFKA 3KLIA 4HT7A 4WCEQ 1EARA 2HIQA 1GEHA 3RU0A 4J9VA 2ROGA 3UCZP 1TP7A 3NL0A 3MM5B 2XGPA 1VQ6S 4HHHA 3LANA 1O6XA 3IGYB 4CLZA 1U48A 2B5JB 1NH8A 3QLHA 4A8MP 2X1FA 5IWAJ 4KGKA 1UPMB 2GJ2A 1TKZB 4GKKF 5H9EK 1YQHA 2XCPA 3QAEA 1HI8A 3PEJA 1APSA 3ENAA 4LF5J 2LXIA 3G8SA 1ANJA 4KYZA 2DBBA 2V8VA 2MLZA 1FE0A 3PNIA 2I5JA 1FJCA 1VMBA 5DQIA 1TQLA 1PC5A 2HVEA 3CD6S 2DGOA 3V5RA 2I6WA 2XI3A 3MM9B 4LFBF 4PQAA 2DISA 4OZ5A 2PO4A 1WC0A 5ETPA 3W60A 5KG3A 1KHNA 1IBLF 4ZG6A 2V8DA 1B4SA 3P3DA 5KFEA 1HNXJ 3Q23A 4ZHRA 1F9HA 4JUZA 2XS2A 3DLGB 2HQ3A 2G2OA 1SIZA 2DNLA 1OSDA 3EVMA 1CJUA 1T0TV 2QFJA 4RW7B 2OPRB 1CQMA 3N6NA 1JXLA 5KFJA 4M8LA 2LQ5A 2FJWA 3MD3A 3I82A 4O44B 2GVDB 3NAIA 4UUWA 4F36A 5LT5A 1RWNB 2V34A 4Q7AA 1EQ0A 3NS5A 2M88A 3A12A 4L72B 3PACA 2GSNA 5AE1A 2IM1A 1PJ7A 1UETA 2W4DA 2HFSA 3MCMA 5DZ7A 4RUBA 2B9XA 2NXCA 3KFWX 4NLPA 3HHNB 4C2MA 2MSTA 2LQ9A 1ZTWA 2VASA 4DPUA 3DNCA 3CCMS 2V50A 4WIQA 3FEXB 5GAHU 3VAKA 4G6VB 3RAXA 3HFZB 1SKUB 2NQPA 1TL3A 3HF5A 3J7YI 3RTVA 2E1MC 1N0VC 2VICA 4L75A 2C2EA 4ATNA 2LU1A 4RNMA 3PR4A 1NO8A 2W2OP 5KOWA 3OT9A 4DEZA 1NM2A 1WKKA 4WYLA 3NBPA 3CJ3A 3VGVA 3BN4A 1UL3A 2B9YA 2FC8A 3TW0A 2IFYA 2YTCA 1Q8IA 1GMWA 5GAEU 2FJAB 1WKLA 4TKTA 3TX0A 5MAOA 3RB6A 5KFMA 3NKPA 5D3GA 3LAMA 2HBRB 3BSCA 2VQFJ 3C15B 2QMWA 2EEYA 1N6QA 1HFEL 3TA1A 4A48A 4K4TA 3PX6A 2MEWA 4ZOSA 2NR0A 2DHHA 1H2UX 3WC0A 2KT2A 4B9NA 1T03A 1S6OA 2GMHA 3SFGA 2RQKA 1R8AA 4EZ9A 1M5KC 1SC1B 3M2VA 5C25B 5IXUA 2A6OA 3P5BP 4JI5J 2C3OA 4CNYA 4OLPA 3U1NA 2V9WA 2BM1A 1ED8A 4CI0B 1TL5A 1P9QC 5AE2A 2YNGA 2ZHAA 4LRDA 4YDDB 1FNMA 4TU7A 2DGTA 3NS6A 4IQXA 2V6AA 4KKOB 5M2RA 3DKDA 3UCUP 2K3IA 4NLYA 2QLWA 5FIIA 4J9PA 4LQYA 2LEBA 5C24A 1FKPB 3EZ5A 1JK9B 2P9CA 1WSRA 2LVWA 2IJNA 4LIRA 4CO5A 2YKOA 4ENOA 1X31C 2QX0A 1WTFA 5SZTA 4ZDNA 2Z8QA 3WX8A 5B0FA 2CRLA 2YX4A 1VQMS 2GSUA 1UFKA 4WFNQ 4GVBB 4ZJOA 2YPYA 4ECQA 3H5SA 2O01C 4B9UA 1NJXA 2HRTA 2VC0A 4K4VA 5BYSA 2C3PA 1U1LA 4J9MA 1EETB 2NUHA 1U0HB 2GHPA 1HBNB 1N5YB 3O1LA 2HAIA 4IUFA 3GV8B 5AT1B 3HHKA 1S10A 4UPKA 3MOJB 4MIVA 3WAVA 2FLOA 2FHJA 4TU8A 3IBWA 3SZYA 3DXBA 2DIVA 3BJYA 1GTHA 1QVGR 2JLGA 1ULRA 3FSYA 3GIIA 5A0YB 3ISNC 2CQIA 2DHAA 3CJKB 2UVWA 3DGVA 5CYMA 4C11B 5F8LA 1YZ6A 2NSBA 2CQ3A 1S59A 3HSDA 2R7XA 4LF9F 2W1BA 1ZBTA 4HLBA 3T9ZA 4CLWA 4FKYA 4ED2A 4FYXB 4OZ3A 6AT1B 3OR2B 2LQ8A 4R0EA 2RRAA 2ADCA 3JYTB 3ZTSA 3EDRB 3SZ2A 2UXCJ 1V5VA 2HRUA 2PE8A 2R3VA 3KJNB 4DL4A 2F8HA 3RW6A 2QLBB 4NLQA 4FDFA 1KVKA 3GFZA 4HHUA 2DRDA 3MEGA 3W1YC 3WIVA 1K1SA 4J9QA 3BO2A 1BQMA 1R0AA 2DYAA 1RTHA 2FHOB 4YHHJ 4IG3B 3B54A 3Q8VA 2CIMA 4I7FA 1A9NB 4X4SA 1TL1B 4C6AA 4G65A 4NX9A 1BD6A 2WVCA 2CJYB 1NH7A 1NKEA 1S0NA 3UE2A 4RWXA 2CJ9A 3FCVA 1KFSA 5LOQA 4MKBA 5DQGA 5ETMA 4ZK7M 4ZVRB 2CPYA 2R8HA 3CMRA 5JVHQ 4WK1A 3V81A 3HSZA 2HFNA 1RB0A 2XG8A 1KN6A 1HKAA 2ZITA 1T9WA 2R42A 1Z4UA 2IJFA 1F2HA 1KOHA 1ZYQA 2WZ1A 2Z56B 3FC9A 3D0IE 3CPWR 4PG7A 2BE2A 2PMZD 1X4FA 2RJZA 2H1YA 1OIAA 3LA0A 4NA2A 1S1TB 3HHDA 1QSYA 1ZEBA 3M2UA 2Y0SD 3PJWA 1LW2A 5C2GA 1S99A 4ZVHA 1KLMA 5C5JA 4KJGA 4J91A 1LWEA 4ZP9A 4NXMJ 1B64A 4QPXA 3GFXA 3E01B 3O5TB 2V8PA 2VFSA 4NASA 4HH1A 1I5OB 3FJ2A 3THVA 3KLVA 1ZPVA 1SV5A 3PYFA 1JLFA 1VQLS 3CEDA 3MM7A 1UPPA 2KT5A 4QYRA 1RKJA 4DMZA 3HZEA 3N6MA 2PFDA 2MKSA 4P10A 3UDVA 3K2YA 1QJHA 2KG0A 2KG1A 2V2QA 4FBUA 2FVCA 4QU6A 2V4JA 2VG7B 3P6YC 2QL7B 1RYSA 1NK9A 1FKAF 2HK3A 3OJSA 2GHWA 3SCJE 2ZKUA 4DS5A 1K0VA 5KG0A 5A8KA 4NEYA 5LRNA 2O66A 2UUAF 5G0RB 4IH5A 3B6BA 3MAAA 4OYMA 2XLJA 4DFPA 5GAHI 2ASDA 4L3KA 4RU2A 3TAMA 2ZH9A 1GXUA 4PG5A 2DNQA 4ED1A 2UUWA 3PV8A 2CQDA 4QCLA 4QIEA 2LEPA 4DX8H 3ENVA 3U27A 4P2FA 3CD5A 2OHDA 1WUUA 8AT1B 1XN9A 5C7PA 4C7QA 3PG9A 2A2CA 2IYIA 2BVZA 3X1LB 4ZG9A 3M9OB 5KTQA 2RILA 4DCOB 3L7UA 3M30A 1TVRB 3S1TA 2ZE2B 2MGZB 5C66A 1R8CA 1SL1A 3T6BA 3R5BA 2XHCA 4MFBA 3V4MA 4USTA 3QO9A 2KHCA 5KG4A 1RA7A 3PW5A 5J2NA 1N54B 1RTDB 1FJGF 4WF9Q 2G0CA 5KT5A 2OP5A 2Y1JA 4FVMA 2VQEF 2J9DA 5LM7E 2AJQA 3T19A 2BMBA 3SCKE 2BXJA 2I8EA 1O51A 2BANA 1R0CB 4JI0J 4CLPA 3JXOA 2R2RA 5HRTA 3ZZTA 2IC3B 4Q0BB 2EBGA 4EU0A 5DGAA 5DDRC 1V3RA 4K8RA 4TY8B 1EJ7L 2D74B 2HHUA 2CPDA 5ETTA 1TKTB 3SZZA 2FUG9 5LSLA 2RU9A 2IYGA 3R27A 1FX2A 2DCLA 4ZVSB 1VBYA 1U1RA 3IM9A 1Q86T 2CPEA 4DXLA 2BEFA 3CC7S 2VC1A 1XBWA 4H4KC 2XMMA 1KHLA 2OEKA 4NLRA 3GSIA 3TYTA 2UVUA 3MWBA 2C2ZB 2GVZB 2XYHB 5LL6d 1VCTA 2QJ3A 4NLUA 3WBZA 4L73A 1IKVA 2IVMA 4MMOA 4M5GA 5HP1B 1JLEB 1VBXA 3G6XA 2HW3A 2JLEA 5HMZA 4ECTA 2ERRA 2B6AA 4CCHA 5EWEA 2LA4A 1GTEA 4U95A 2BKPA 2BUNA 5E3CA 1H38A 2W9BA 2W5RA 4KH1B 5HATA 2FGOA 3BKFA 3OBIA 4PPDA 1RT1B 2O67A 2P6SA 1JNZB 1LFWA 2OPPA 1KP6A 1RZMA 2CWXA 2EG2A 4Y2IA 1IBKF 2E29A 1V5IB 3FRZA 1U6BA 2GIRA 3FBBA 1TFYA 4D3GA 3M8PB 3D7SB 5L1IA 3UR3C 1SUQA 3LGNA 5K8MA 2ROEA 4ILMA 1JXVA 2B56A 3MEEA 1FRKA 1S0VA 5ITHA 2B9WA 3KK2A 2C2OB 4CLYA 2RDDA 4UQGA 3T5KA 1HYSB 4JV5F 3NKRA 3I0SA 3MXHP 3QBCA 2YKNA 1WOOA 2GFFA 1AUKA 4DPOA 4QZVB 2DR9A 3T00A 3I55S 5DJBA 3JSRA 3TEHB 2IM3A 3HFVA 2DIUA 3T9NA 3HDSA 5IFMA 1U1PA 1F60B 3D0GE 4PXCA 2CPFA 2KU7A 4ZGAA 2FJEB 1JLCA 2B4OA 4K4WA 2BJDA 1A7GE 1WI8A 1YJUA 5GOVA 4DUTA 2E5LF 2IM2A 2KJVA 4B3TF 2XMJA 2ZHOA 1TUGB 4USMA 1EW2A 4IG0B 3QIPA 1HIYA 2G2YA 3TA2A 4DG1A 2DK2A 2A0FB 2P9GA 3W5ZA 1NHUA 1TUVA 5D78A 2OPQB 3M1VB 4PXDA 3U1LA 4WK3A 2WHOA 3Q86A 4LQ9A 4DR7F 5LXRA 3ONQA 2HBQB 4Q44A 3OJUA 1U1OA 3QMQA 3ZNJ1 1ACMB 1U26A 4NXNF 3UWTA 5HN0A 1SIWB 2YNHA 5CCLA 3IWXA 3TX8A 3J7Z5 2ZUGA 3CDAA 2OEMA 3NCQA 1PAEX 2XS5A 1OJ4A 4NLWA 1H73A 1HHTP 5DGBA 1FDAA 3GU0A 3OV7A 3U02A 2IDLA 4F3OA 4EMDA 3HX9A 1WJ9A 3ZZZA 3JSMB 4A8OA 1WELA 2LDYA 3SQGB 3KUGA 3MPUB 4JI3F 2QA2A 1YIJS 1G6BA 1I51B 1XR6A 3PKMA 5IM0B 1KKHA 2DNRA 3M6VA 4DV5J 4Y28C 4WE1A 4A8QA 1N2LA 3QRPA 3FRYA 3M6XA 4USWA 2LU2A 4AL7A 2E1CA 1SH0A 4HKQA 2VD3A 1FX4A 1KR4A 1MU2B 4UPLA 5J2PB 2YNIB 2VPXB 2RF2B 2XZWA 1N2KA 1VI7A 3OXLA 3BH6B 2CJXB 1U47A 4TQRA 1P6TA 1VRTA 3MECA 4IRKA 3KNGA 2M3DA 1QAJA 4ED7A 4NCGA 2ZBPA 3L7OA 4IH6A 2R7SA 1HMVB 2VF3A 4LSZB 2ZJRQ 3MAHA 3T1YJ 2L9NA 3N79A 5LIAA 2GIFA 2CPHA 4RWWA 2PI4A 1MROB 1IQTA 1ZETA 3C3LA 3WAXA 2ZWOA 4OI3A 3UDEA 2W8SA 3LALA 3K89A 1TZ0A 3BR9A 1CULB 4CYUA 1C4CA 4JV1A 1K7HA 3X3UA 4V19X 3LXQA 4Y34A 4AXIA 2FZKB 2PMHA 1J27A 1OS5A 3HT0A 2QC3A 1RAGB 5BR8J 4DX7A 2N4CA 5F8HA 2DXEA 2R8JA 1H6KX 2OIHA 3GWCA 4DV0F 3DRXA 1ZPWX 2M4MA 4AUKA 3D6HB 2ZEJA 3M8RA 1X5OA 2O1PA 2A2DA 4F3MA 4X4OA 2HHVA 4UOFA 4DPWA 4B3MF 4HEA9 4M94A 3A8IA 2EK1A 2BKOA 5LJ5Y 2X98A 2J6SA 4HL9A 2YKPA 5JXSA 2XRGA 4F4KA 1D09B 4DR3J 2BZ2A 1W25A 2YX1A 2EBEA 3C6UA 1XNQF 1W2IA 1PYOB 1RAFB 4ED8A 1ELOA 4ERDA 1AUSL 1E33P 2HNDA 4F4AA 2WVEA 4QYZJ 3JSYA 2BM0A 3I5CA 3MFIA 5THWA 2IIHA 4B02A 3QGPA 1REVA 2XQCA 1X4GA 3KK1A 4LJMA 4IRCA 3H8YA 2FVRA 1NK4A 4IFVA 4M5IA 2DO0A 1RWXB 4NZ0A 4DJBA 2WK4A 3AB4B 1TMMA 3K17A 1MN7A 3BSNA 4MTPA 2W7PA 4LF7F 1TL7B 1FEEA 2WB4A 5E7OB 3GJTB 2ZOGA 5HK4A 1NLKL 2GMJA 2KM8B 1NHVA 2NXJA 3EUNA 1WTBA 2Q6CA 3HHLA 4ZCLA 4R25A 1TAQA 2JEJA 2LKZA 1JIHA 4MYUA 4JBCA 3PYDA 2AP6A 5IT9Y 3IRXB 4Q8FA 3J80Y 3RW7A 1T9TA 1R89A 4YQWA 4KQZA 2E7VA 3GJSB 2C1EB 1GXLA 2Q1LA 3MEDA 4UZCA 2KXFA 2L41A 2QE5A 3A1YG 2KJWA 5F0WA 4PEOA 2HFUA 4Y2AA 4ZPCA 2JC0A 4DV6F 4C48A 3UD5A 1K73T 2R2SA 4CO0A 2Y8YA 1BQXA 4UTGA 3D2WA 4RU9A 1WF2A 1KTQA 2BKNA 4ZVQB 3RBEA 2DNMA 4DQQA 5HVGA 4HYKA 3QRQA 5IC6B 4F2RA 2KFNA 2YKQA 3MMAA 2Q43A 4OHYA 3BEGB 2AMCB 2R2TA 3FFIA 3O44A 2R7VA 1UW4A 2VDIA 4QW8A 4OHVA 2MPUA 2WONB 4CM0A 5A8WA 2BJ3A 2F5GA 2QV6A 5GVQA 3F41A 2A18A 3G71S 4YB1P 2M2BA 1NK5A 3RYLA 2HRYA 4QR1A 3Q8QB 2XHWA 3FDSA 1ZM2A 4BS2A 2DR6A 1JJHA 4I68A 2NYHA 2YH0A 4LFBJ 3QSYB 4LF8J 1UVMA 5F3ZA 4U7CA 1NJWA 3DMJA 1IBLJ 1VLYA 1NPPA 2NUUG 5B0EA 4QIGA 1TL3B 2YNFA 2GZOA 3BO3A 5K20B 3E3XA 2FB0A 3QPIA 3NLCA 4KFBA 2AYGA 3QRRA 3I32A 3ENWA 3BS9A 4LF4J 3EICA 4USHA 1RHJB 3T5LA 5KG6A 1Q5YA 2RSQA 2I38A 2G1DA 4PCQA 5M2PA 1HBOB 2VODA 4LR9A 3V6DA 2HNZB 4UY85 3I4HX 3ET6B 1NHKL 3TVZA 5HQMA 2KRBA 3H7HB 4EGLA 4A8XA 1FTRA 2WW4A 3M32A 1LNQA 5KFUA 3TZXA 3V4IA 3G82A 1N6QB 1CPZA 4ES1A 4TNOA 8ATCB 3K5MA 3RB3A 5C2CA 4ZP6A 3HJFA 4Y3CA 5BYQA 3D1HA 1T03B 4QYZK 1NCLA 3TVKA 1ELZA 3OTCA 1DBDA 4OV6A 3N28A 3D54A 1FJEB 2ZBRA 2W25A 5C42B 1N33F 1HQAA 4PWDA 5J2QA 1SQGA 3SYZA 1NMEB 3BSOA 3MR2A 4K59A 4USKA 3OR1A 4WPAA 2YNGB 4J9NA 1JXEA 3TAQA 4DFMA 2KVQE 1AZSB 3OSNA 4GO7X 2M8HA 3EZOA 1V3ZA 1K0TA 2DGSA 3QATA 1N48A 3NAHA 2N3LA 2X1AA 1WACA 3GYXB 1U6FA 2A1BA 2NZ4A 3G8QA 3OFGA 1VQ7S 1YRXA 3C14B 4DQSA 1DTTB 1DARA 2DCUB 4FF1A 1AB8A 2WSCC 1B7YB 3DDNA 1MWQA 2FJVA 1KDNA 5I42A 3LOUA 2XBPA 2WBMA 2YWWA 1LFPA 2VZ9A 2EFVA 3OTOJ 1QLNA 4QJVA 2ZDPA 3R7BB 4OZJA 1FI4A 2CVEA 2CQCA 3QJJA 1GXTA 4B9MA 2VONA 2AGPA 4OYOA 1KQFB 4HI1A 4PXEA 2DHSA 1J2VA 1CJTB 1UVJA 3GCWP 2MJNA 4URSA 4PZVA 3UNYA 5L0EA 4PUOB 3QNWB 2ZC3A 3FNNA 3M2RA 3NNHA 2E5HA 2MZSA 1XR5A 2KYZA 5KG1A 1Q16B 3M8SA 4AYBD 2OPSA 3HT3A 2KZMA 1RUSA 4UQTA 4DS4A 2J8SA 4BWJA 4LFCF 4ZCIA 4LFAF 1RT5A 2UUTA 4OHWA 1C4AA 1VQ4S 1Q8LA 5AXLA 3MEGB 1F3VA 1ZEFA 1RWWB 3H98A 5AJ3F 4Q5VA 1R0AB 1RTHB 1XTZA 1S57A 4IH7A 1WG5A 2VJUA 1PO6A 3AOBA 3G6YA 1RE1B 1LWCB 2LLZA 3NY0A 1F9EB 1YBUA 2IRXA 2QEXS 4DQIA 3LTOA 1NAQA 5DRKA 2AJ0A 1RWMB 4CLTA 3R7SB 4CP5A 1YDLA 1ALIA 2QA1A 1GH8A 1VRUB 2GSOA 2LMIA 3AY0A 2DKOB 1VC0A 3J7ZT 3C6TA 4FNIA 2HNYB 2XTJP 4QIVA 3MCOA 1UZDA 1RTIA 2HWTA 4M5DB 2BE2B 1PILA 5T41A 1T3NA 2ZD1A 5CYQB 2UXCF 3JTOA 1T05A 1OY6A 3L4BC 2BW2A 3A8JA 4OMFG 1HW9A 1LW2B 2KXHA 3ZZUA 5A76A 4LF9J 4CQ1A 1KLMB 2JC1A 2ZDOA 4J9SA 4KM4A 1YRTA 3C66A 3W5YA 4P2XA 2E66A 2H5JB 3DM2B 3TANA 5E0OA 2F8MA 2CADA 2F7VA 2PIIA 2EFPA 3PW2A 5JUMA 3GJRB 4EWTA 1K1QA 3DDIA 2OMOA 1LXNA 1HWKA 1S6QB 4ZN3A 4XDDA 1JLFB 1SH2A 5F8GA 4Q45A 3EPIA 3K7RA 3DXSX 4DX6A 3SXLA 2KM8C 3FK4A 3BPDA 3OPKA 1C0UB 2C2RA 4ETZA 5L39A 1RADB 4LIWA 4MH8A 2FJDB 4O3RA 4U6PA 3BDFA 5T7LA 2V4JB 1ALHA 4ZPAA 4DU8A 1SJ4P 1QAYA 3QYYA 5A8KB 4YUDA 4PYDA 5DG9A 4DSLA 1S4FA 3MCNA 1URBA 3MAAB 2UV8A 1HL6A 2ZH5A 5BYRA 4YR2A 2YXLA 2ZFHA 2VDHA 3TUZC 5EGEA 4S0MA 3OD2A 2OSQA 4FXVA 4OZ2A 4ES3A 3CCQS 4DR2F 1RT7A 1RWVB 4QR0A 2ZM6F 4M5KA 2IA6A 3NKOA 3CSKA 5JVGQ 3NCPA 5KFWA 2DGUA 1OMSA 1CJKA 3MK2A 3M30B 3HVAA 1AXQA 1DJ0A 4E2FB 3VAIA 3C16A 4IFYB 2ZH2A 2CNLB 3IC1A 1TV6B 1RWOB 1PKUA 5AXNA 4FS1A 4RBUA 1S1WA 4LR2A 3L9ZA 4WFBQ 3HZGA 1BE4A 3TG0A 5G4DA 1YG0A 1SHNA 1Y00A 2BANB 1SH3A 2PDAA 2JDJA 4TLRA 2OH2A 1X4HA 4ZMMA 5JMNA 1Q5VA 4LT6A 3GR1A 5HJYA 4E8UA 4EO8A 4R5PB 1ZM3A 2AD9A 1WG4A 3D67A 2UUAJ 1CQNA 1Q4RA 4HACB 1YZ7A 1RBOB 2OUGA 3B82A 2F3JA 2NREA 3VHQA 1VQNS 3N5FA 2FTRA 3BYPA 4X4UA 1N5QA 2PN6A 3IMQJ 3PW4A 4DSKA 2KDOA 3KG1A 1RXOB 3HVWA 5F41A 1TR0A 4OIXA 4CT9A 5L1KA 3Q2TC 1GK8A 1WSVA 2CNKB 5DLVA 1KC8T 3M9MB 3RBXA 5B0CA 2QYCA 1AA1B 4ZCMA 1T11A 3IWLA 2JEFA 1UTAA 3D1QA 4F25A 5FLXY 3T5HA 4IR1A 1IWAA 3ZZYA 2F40A 4LVNP 2VKZG 3OL6A 2DNNA 2VA3A 4QQBA 2MQQA 4Y00A 2XMVA 2YKMA 1S7IA 4J7CA 1FJGJ 1UCNA 1E1ZP 3K58A 3ITHA 3UN2A 2FQQB 3DYAB 2OPPB 3MMCA 2CQ1A 3EXCX 2VQEJ 1DQAA 2QL5B 4BLGA 4XIUA 1FK9B 2Z2LA 1P27B 2HBZB 2ASJA 1RP5A 4RPFA 3MEEB 1QD1A 6FD1A 3I56S 1JLAB 4DV3F 2WTFA 1T94A 4OI0A 2V2VA 4JI4F 3I0SB 2GJIA 1AW0A 3K8WA 4C98A 2YKNB 2Z58B 1PG5B 4BHQA 3V6KA 3Q22A 2NZCA 5M2UA 3NG8A 4ECWA 4C0HA 4M1KA 1EB0A 1XQIA 3CMES 3HSJA 2K3KA 3OL7A 3DU6A 3IP0A 1SPBP 1E6VA 1EKRA 2DNGA 1M1GA 1U6ZA 4C8YA 4RJVA 1RK8A 3A52A 1DQ8A 1JLCB 1HQUA 3B4DA 2X51A 4JP8A 3A13A 2HKEA 3VF0B 2W9CA 4LF6F 5D4PA 1YBTA 4NLXA 4QIWD 5DM6Q 3LAKA 1AJCA 4NMXA 3I4PA 4Q8EA 1IWGA 1VQKS 4IKAA 1IKWB 1EKSA 3KK3A 5HROB 4IRDA 1C0TA 3JB9k 1NBEB 4B9TA 4MHXA 4KAYA 5IC4B 5A8RB 5KOXA 4NI2B 1TTHB 1XMOF 3KLGA 4EBDA 3QT5A 3DRPA 3C2PA 4AXJA 1H3DA 3JTPA 3N0VA 2WSEC 4X4PA 5A2QY 4DF8A 2IVYA 3DRYA 1HQEA 2XYPB 3UVJA 1WHWA 2WCXA 1IBKJ 2PMWA 3TEGA 2V5HG 1IBCB 2AV5A 4YR3A 5CD4H 4B17A 4RX6A 3GIMA 2ZOFA 2FD2A 5HANA 1UFWA 5D77A 4R8UB 1KRPA 1LXJA 4O0IA 1F2GA 3OVAA 4QWEA 4JV5J 1TKXA 3KLEA 2ZH4A 3WBHA 2EW9A 3JS9A 3EDQB 4L3NA 1IKYB 4ZP7A 5LRMA 1NZ8A 4Y6IA 2IAJA 2MB0B 3U1MA 4MJKA 3CIZA 1WC6A 2A10A 2C2KB 1Q8KA 4AD6A 2UXDF 1N32F 1JWWA 3VAGA 4ID8A 4ZIWA 2HBYB 4QR2A 4KGMA 4DUZF 1FKOA 5CZVA 1UAWA 3I5BA 4KIAA 2E5LJ 1D9AA 3LWLA 1LW0B 2WBRA 1HNIA 4B3TJ 3ICLA 1S97A 2KN4A 2VG5A 1U1QA 5HLFA 4QAXA 4LUBA 1QTMA 1BY9A 1VRTB 3MECB 3G2XA 2YWEA 2YH1A 2E7WA 2F8EX 5RUBA 8RUCA 2HQFA 2JFDA 1SB6A 2OTJS 1U1NA 1HDHA 4KHPF 3R5JB 2HIYA 3H4DA 2R8GA 1S5ZA 2EFGA 3SCIE 4I2PB 1M5OC 3BDEA 4XO0A 4DR7J 2ZZTA 4URQU 2FHKA 4NYOA 4X62F 3D6TB 3QZ7A 3EE3A 3Q2SC 2OELA 1BWVA 4Z7CA 4C8OA 4N47A 4NLTA 1TK0A 2G1HA 4WFAQ 4NXNJ 4ZVEA 1SKRA 2HPUA 1ROFA 3SQOP 5IJQA 2J9DE 4CYUB 4O3OA 3G9CA 2M8DB 1XJWB 1HHSA 4F8RA 2YVSA 2KHDA 4N8OA 1FDBA 3MDFA 3OLAA 2KXNB 1IM6A 3IR7B 1FCAA 4ECYA 4Y2CA 4B9VA 2HGNA 3S7RA 4GC7A 2BOPA 1RBLA 5GRRA 3R2DJ 4OZNA 4TQSA 2R7UA 4JI3J 2APOA 5D0RA 3TJAA 2WAQD 3OUYA 4LMZA 2FPHX 1HNWF 2POKA 4DR1J 1HBUA 9RUBA 3A3NB 1D1UA 3KG4A 2ASLA 2N3OA 5ETOA 5KFOA 3GV7B 2XS7A 1U7LA 3T3FA 2AZ3A 2P5VA 3PYEA 2MZTA 1SJ3P 1EP4A 1U4BA 1AJDA 2F4FA 4LSNA 2FC9A 4ID5B 1LWFB 2PFFB 1N8RT 1Y10A 4K50A 3K57A 3RB0A 2DGWA 2J6UA 4LRCA 2E5GA 2BBEA 1XMQF 3KK1B 3ETOA 3Q24A 3BGRB 4C4WA 2J0QD 3CJ4A 3W64A 3J7YU 3D0HE 3HCXA 3RGIA 4ALZA 2FVQA 2BW7A 2E5IA 2VPYB 3LP2B 4Q2MA 4W90B 5F8JA 4K2JA 3R2CJ 2C2DA 4C0BA 5IT9U 3DHXA 4ES2A 5K5MA 3GFYA 2F65A 1RBAA 1WF0A 2VH7A 1UA1A 1IQZA 2XMWA 4ELVA 2HQDA 1WDTA 4UUXA 1TKZA 2GGPB 2CVIA 2ZZNA 4DV0J 3FMWA 1X4DA 2J7WA 4ZVGA 2IUCA 2CXEA 2HVZA 3DRRA 2PA8D 3R7NB 2QZ8A 4WFXA 4G1QB 4B3OB 1YRUA 4FF4A 4B3MJ 2CYYA 2YQ1A 3NMRA 4B9SA 3BPSP 2IRUA 5EHHA 1XNQJ 4KGVB 2MDAA 3GSDA 3IGNA 4K7QA 3MM9A 3B78A 4TY9A 4XDCA 5K4PA 1U45A 2CNNB 4X65F 1QUVA 4MKYA 1EJJA 2QRRA 4FF2A 4OI2A 4HHJA 4CT8A 2DXFA 2BJ9A 4WKRA 2AYEA 3MMAB 1H74A 3FCWA 2DR7A 3DLGA 4ZVTB 4K0KF 1WWHA 4PG6A 3FFIB 3G86A 2KZZA 2V4RA 1PSDA 3FCHA 3J81j 1U8SA 4LF7J 1KHKA 4ZPWR 2OPRA 2ZKTA 2QA4S 2HS4A 1G7CB 2KT3A 2GQCA 1ZS6A 4O44A 5F9LA 4WXOA 3ADAC 4QW9A 1S9GB 1JKHB 2M52A 3OL9A 5AJ9A 4RW8B 5I3PA 4RKUC 4NZ7A 2QMUB 1KH7A 1M1KT 4OHXA 3NOCA 3W9IA 2MQNA 3NP5A 3W5XA 3DLBA 2W5QA 1IN0A 2DR8A 2B0GA 4KV8B 5F8IA 2ZBIA 2YNFB 2J7UA 2RIJA 4UORA 1FWLA 1SI9A 4TVAB 4MK8A 4KFBB 4CLUA 2N7YA 1YJWS 3WHIA 1MN9A 3CGIA 5D0GA 1NDPA 2LFVA 4N8NA 3ZC4A 2BJEA 4DV6J 5KFVA 1GMVA 1Y5IB 4BDPA 2G2ZA 1K47A 3HD1A 3I6PA 4X64F 3UCGA 1F3FA 2BJ7A 3MHYA 3G82B 2FLNA 4A4JA 4O3PA 1KNZA 4CLLA 2HG4A 1G3OA 2OI2A 2ZBQA 3PRBA 3I0RB 3E2DA 1FXRA 1Y3JA 2QLXA 4LF8F 1Y4ZB 1TKDA 3DOKB 3EPGA 2DY9A 3KJQB 1FEHA 1PYTA 2BQRA 2GW8A 1TELA 2D69A 3U7JA 1ED9A 5ETRA 3AOCA 3C15A 3OR1B 1DLOB 2R7TA 2LYVA 9ATCB 3KLFB 3MURP 4DR5F 4U8YA 5HBMB 4LF4F 3SFUA 4WXWA 2M5YA 1SC4B 2W5WA 1Z1ZA 4ECZA 3JTNA 2HEKA 1HNZJ 2GQQA 3FBCA 4OZ0A 2IFXA 5D15A 4NA1A 1FSUA 1URNA 4CH1A 5C25A 5HI7A 4DL5A 4FXWA 3DLEA 1H98A 2ZH8A 5ETVA 5HVHA 3IS9B 2ZH3A 3QGIA 4KKOA 3VGTA 1U49A 3IN5A 1JJ4A 3K8VA 1LWXA 4UOCA 2UZAA 1FKPA 3AQPA 1NJIT 1IJFB 3RB4A 4RUAA 4ANCA 3MTKA 1UVIA 4GVBA 3NGRA 3KJVA 2G0IA 2CZ9A 2J8AA 2XULA 4P6QA 4P7VA 1L3SA 2NSCA 4MK7A 1VJWA 3TR5A 3AHPA 2FY1A 2M0GB 3K0JA 1FRIA 4C3KA 4J9KA 4DOZA 1N33J 3KHHA 4IDKB 3ZXWA 2OPSB 3CCVS 3D5MA 3Q3QA 3THPA 1T95A 1RAIB 5A0YA 1IVZA 3NKNA 4EBCA 1Q79A 1RT5B 2VJVA 4C11A 2OFGX 2DRAA 1WD6A 3MI7X 2BX6A 3KUHA 2MXYA 2ZZMA 1RAJA 1DTQB 2LXUA 3CTRA 1M90T 2P2CB 2ATCB 4KH0B 1YI2S 2X3DA 1JLBB 4LRAA 3OTOF 3OR2A 2AQ4A 2D41A 2U1AA 2RMLA 1VC6A 3ISND 2RE1A 3RR7A 5CAAA 2UVVA 2VUGA 2PI5A 1B99A 2XSFA 4AT1B 4O3QA 4ECRA 2KFYA 1P8GA 5KT4A 2HS0A 2C28A 5GAGI 1NDKA 2CJBA 1RTIB 1FTCA 1N34F 5B0BA 5CH7B 3RAMA 2XLIA 3CCTA 3CULA 3EVOA 3HPOA 2DPJA 2NXNA 2UUCJ 2DH7A 2Z30B 1NXIA 3AD9C 4OI4A 1YHQS 3M8YA 1MWZA 1JJCB 2BQUA 2AW0A 3OLBA 3O2IA 2BV3A 1Q0NA 2HYIB 5KFPA 1XC9A 5KFFA 3K5LA 1B0PA 4QWAA 4RNHA 1EQJA 2BRKA 2VPZB 4LFCJ 2HMIB 3TI0A 4LFAJ 3MM6A 3GP9A 4C3MA 5U47A 5A6PA 2E5JA 4DPTA 2P8IA 1LK7A 4CTAB 5AJ3J 3HHLC 3AJ1A 1RHRB 4J9RA 3ILJA 4TN0A 3OVSA 3AH6A 2RD5C 1KVIA 3DFEA 1Q8BA 3DOLB 1VR6A 4CXUA 4USVA 4XPCA 2LQJA 1QSSA 1E3CP 1U1KA 2M7SA 4F50A 3CCSS 4U96A 4NLOA 3R5CA 3D6FB 1FVSA 1MMDA 2AT1B 2VBYA 3LGHA 4KAVA 2F4VF 4LRFA 2J76E 4TU9A 2YY3A 3PTWA 3VWSA 2HWIA 2N4DA 4ZKAA 4ZPDA 2RH3A 1BQNB 4YY3F 1Y6VA 1Y5LB 4IOBA 1RTJB 1B70B 1BHNA 3BGOP 3FSXA 3ZNUA 3LP1B 4DI6A 1DFDA 1N0UA 4O3SA 3VAJA 3UD3P 2QYGA 2L48A 2K1RA 5E41A 4JV2A 3MMJA 4NE9C 4Y2MA 4FPRA 4GTXA 1T02A 3TWZA 2NPFA 1WOPA 3BN7A 1CJKB 2GLQA 4NRUA 1Q7LB 4NMLA 4JI8J 4ICLB 1N88A 3AODA 2K7JA 3Q89A 2PD1A 2HHHF 4IOAQ 1IR2A 1F5CA 2AX0A 3BBFA 3MTJA 3VAFA 2G9OA 4NWJA 5HMWA 3FEZA 1BUXA 3W8PA 4TXSA 1VFJA 1X9WA 4N77A 1HD1A 1A0OB 3WX4A 1BMQB 3HD2A 3CDUA 1TVRA 2NS1B 1ZH5A 1FFGB 2ACYA 3F44A 1CSJA 1EZZB 3PZPA 3HKZD 2W5SA 1DHMA 4ZS6A 1G2EA 1UEVA 4CXSA 4K4ZA 2X1BA 1KOOA 3F0NA 2EFNA 3P8BB 1RTDA 5HL7Q 3FQKA 1D8YA 3LH2S 4F04B 5LMUF 3MPVA 4RUCA 4Y2KA 1LV5A 4AL5A 3NCRA 1L3UA 2JEGA 1BGXT 1DAXA 3UQSA 2ILZA 5AXKA 2XSJB 1YTYA 1PC4A 4IOCQ 4HDGA 1WHYA 5F3TA 3CC2S 5KFLA 4O4GA 1X4EA 4Q0BA 5FLXU 4DR2J 4FBTA 2ZM6J 2RHQB 2JWNA 4DPXA 1S1UA 3KXDA 1XERA 1FFSB 3MM8B 2LA6A 3BQ1A 2XI2A 2W4CA 4CH0S 3VALA 2E1AA 1R3NA 3NGUA 1W26A 2XMKA 4X2BA 2EWHA 4PG8A 5E2QA 4ANDA 3FKBA 4CLKA 3Q8UA 4DV1F 4P73A 1WC5A 2ADBA 1AJAA 5KFKA 4ZG7A 4IR9A 1O8BA 5HP1A 2DJWA 1LEOA 4K5RA 1JLEA 3MMCB 2PEHA 3OFFA 2JEIA 3OHBA 4F26A 4YDXA 1T9VA 1DY3A 2OGUA 1HWIA 3FQLA 5K9FA 3KD8A 3EMTA 4UOPA 3D1OA 4I69A 1HBMB 2HHXA 2CQ4A 3SV3A 3DN9A 2E9ZA 2PT0A 4X84A 4BC9A 1PAUB 5CXTA 1Q81T 2QGFB 2VFUA 2DGVA 2FLPA 4ECVA 5IT0A 4LF2A 1XNRF 1RDRA 1D9FA 4K4UA 3ULHA 3TP2A 2W2PP 3M8PA 4PAAA 3NGSA 2K06A 1R6YA 1KHWA 2OLWA 3DPCA 4M5NA 1S72S 4IYQA 1NK7A 2H4WB 4DN9A 2DEIA 1PBAA 3RG6A 4Z37A 2W9CB 4I4BA 3HJVA 1NU4A 2YBVA 5A2QU 1ANIA 4RW6A 1UVLA 2DRBA 2B7BB 1HARA 3KK3B 4ZIVA 2FJBB 4H4MB 4B9LA 1ELYA 5DLTA 1C0TB 3L95X 3M6UA 1C1CA 4LF1A 2R9LA 1S6PA 2WVDA 5ETNA 3DRPB 2V8HA 3J7AN 5KFSA 2CPIA 2D9OA 4ECXA 2H3EB 1OWXA 2EC2A 2R8KA 1YK9A 5HJXA 4OX9J 4KGZB 2H4YB 1HQEB 3MR3A 1P1TA 3PKYA 4WU3A 1N5VA 4DSFA 4W4MA 4FNHA 5IQ6A 3D68A 3HVTA 5J1EA 1RLDA 2JX2A 1N56A 1S6UA 4IG0A 1YGYA 2FY8A 3BBBA 4P72A 3DRSA 2MJUA 4DLEA 3DLJA 2VU5A 4LR8A 3GPAA 3DOMB 4DV3J 4JI4J 1TKXB 3IA0A 3KLEB 4LVOP 3G6ES 4DL0C 2VG6B 4KSEB 4MIBA 2OPQA 1HWJA 3M1VA 2JHEA 2IAJB 3CIMA 4FYYB 2V69A 2RRNA 2XWYA 1QVFR 4C8MA 4DSEA 4GTYA 1KVJA 3KG0A 3S8SA 3NGKA 1AROP 5B7WA 1S79A 2J9CA 1DQ9A 2YPZA 2I1RA 3G96A 2BR0A 1B7FA 2BOAA 1ICEB 4LF6J 3RUBL 2RKIB 1RT4B 1FE4A 2AGOA 3CJSA 2VOOA 4MKAA 1ELXA 5IOLA 2FHMA 2QMXA 5GADI 1PCAA 1EI6A 1UZHA 1I6JA 3PXGa 4H4OB 7FDRA 4DQRA 2VG5B 2PGCA 1WHXA 5L0KA 4AE5A 1NB2A 1Q1KA 4I67A 2EKNA 4NLGA 1XMOJ 3MFHA 1HI0P 5SUHA 3JSMA 4DLGA 3NKQA 3SQGA 2MSSA 3WDOA 3FMBA 2OAUA 3LP0B 3P4UB 2AHOB 3PYGA 2H9ZA 4M95A 3W3SA 3CE8A 3NWRA 3EGWB 3IG1B 2D7SA 5I4MA 1RGVA 4OI6A 3B4MA 3R97A 2PA3A 3GIRA 1MU2A 3T02A 5J2PA 3SEOA 2VQRA 1VQSA 2U2FA 3PJXA 3H40A 2WOMA 1OSCA 3D3CJ 2Q6BA 2XO6A 2RH6A 2GX8A 1OO0B 2BJ1A 3PFEA 1FVQA 2HGLA 5KFDA 1X0PA 3DC2A 3NKMA 4TYAA 2DPIA 2ZWPA 1HLWA 2J7KA 1KEKA 2GS8A 5FDLB 4OYBA 4CDIA 1MROA 3FVYA 3W65A 3VZHA 2EFQA 3Q83A 4BCAA 5GMDA 4ANEA 4MK9A 2UXDJ 1OYDA 1MNEA 1N32J 5HSPA 2B7CB 3O8WA 3BB5A 4K4YA 3MPWA 4DV7J 4FF3A 2Y9HA 3EGNA 3OUYB 4DUZJ 2NLWA 2YWFA 2ZHBA 3N01A 3V6HA 3ILOA 5K14B 1HBUB 3PR5B 1S49A 1H2TZ 3EGZA 3FZ2A 2MZRA 1SL2A 2OJ3A 2V63A 3IBCB 2ZJQQ 3MK1A 1B8JA 2XB2D 4GKJF 2HWHA 2AJ1A 3UN5A 5EGYA 1R0BG 4EO6A 2EFOA 2DNKA 1FJ7A 2IBOA 4PKDB 4DX5A 4LSNB 2DNPA 3BDGB 4QWDA 2Q3PA 3EJMA 2DB1A 1KD1T 2MKIA
chains in the Genus database with same CATH topology
1HJKA 4LR7A 2RH6A 5LQQA 1KHNA 1ZEFA 1EJJA 2W5WA 3NKRA 4GTYA 4UPKA 4UOOA 3BDHA 1URAA 4MIVA 4UPHA 4ZG6A 3WAVA 3Q3QA 4FDIA 5INHA 4B56A 1ANIA 3SZYA 2W8DA 5C66A 2QZUA 2X98A 1AUKA 1EW8A 1AJAA 3CMRA 3B5QA 3M8YA 4ZG7A 1AJBA 3NKOA 3NKMA 4NWXA 3T00A 1ELYA 3T01A 5DLTA 2XRGA 3NKNA 5GRRA 1FSUA 2W5SA 4GTWA 1Y6VA 4CXSA 1KH9A 4QAXA 2GA3A 3IGYB 3M7VA 5LIAA 1ED8A 3M8WA 4LRDA 2W5VA 3MK2A 3UO0A 2G9YA 1KHKA 1ELXA 1ELZA 3DYCA 1E33P 4ZGAA 2ZKTA 3KD8A 4UOPA 1EI6A 5DLVA 1EQJA 5LRNA 4LRAA 1ALIA 5L0BA 1ZEDA 3WAXA 4CXKA 1HDHA 3OT9A 2W8SA 5L0KA 4CYSA 1HQAA 5IJSA 4GTXA 2D1GA 2IUCA 2GSOA 1ZEBA 3UN3A 1E2SP 3BDFA 3NVLA 5GOVA 4LQYA 1Y7AA 5HRTA 1ALHA 1P49A 2IFYA 3TWZA 1KHJA 2W5RA 5AJ9A 4GTZA 1ANJA 3UNYA 2GLQA 5L0EA 3NKQA 1ALKA 1K7HA 4LR2A 3WBHA 4KJGA 2W5XA 1KH7A 1AJDA 3LXQA 2ANHA 3E2DA 3TX0A 5LRMA 2GSUA 3A52A 4TN0A 3WAWA 3IDDA 3TG0A 1EW2A 3SZZA 2XR9A 3ED4A 4UPIA 4FDJA 1URBA 1SHNA 2W5QA 4LREA 4LRCA 2IUCB 3NKPA 4CXUA 1ALJA 1E3CP 1EW9A 4KJDA 1O99A 3MK1A 1B8JA 4LR8A 4CYRA 1AJCA 1ED9A 5IJQA 1N2LA 4NWJA 3UN5A 2GSNA 3MK0A 5KXAA 1E1ZP 3DPCA 3T02A 5TJ3A 4UPLA 2VQRA 3WAYA 4YR1A 1KH4A 1SHQA 4KM4A 4KAVA 4MHXA 3UN2A 1N2KA 5DLWA 5K4PA 3IGZB 4LRFA 4KAYA 3BDGA 3BDGB 5EGEA 4UORA 4LRBA 1O98A 4MY4A 4N7TA 1KHLA 1KH5A 2W5TA 4LR9A 4ZG9A 5EGHA 3M8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJK A;  4LR7 A;  2RH6 A;  5LQQ A;  1KHN A;  1ZEF A;  1EJJ A;  2W5W A;  3NKR A;  4GTY A;  4UPK A;  4UOO A;  3BDH A;  1URA A;  4MIV A;  4UPH A;  4ZG6 A;  3WAV A;  3Q3Q A;  4FDI A;  5INH A;  4B56 A;  1ANI A;  3SZY A;  2W8D A;  5C66 A;  2QZU A;  2X98 A;  1AUK A;  1EW8 A;  1AJA A;  3CMR A;  3B5Q A;  3M8Y A;  4ZG7 A;  1AJB A;  3NKO A;  3NKM A;  4NWX A;  3T00 A;  1ELY A;  3T01 A;  5DLT A;  2XRG A;  3NKN A;  5GRR A;  1FSU A;  2W5S A;  4GTW A;  1Y6V A;  4CXS A;  1KH9 A;  4QAX A;  2GA3 A;  3IGY B;  3M7V A;  5LIA A;  1ED8 A;  3M8W A;  4LRD A;  2W5V A;  3MK2 A;  3UO0 A;  2G9Y A;  1KHK A;  1ELX A;  1ELZ A;  3DYC A;  1E33 P;  4ZGA A;  2ZKT A;  3KD8 A;  4UOP A;  1EI6 A;  5DLV A;  1EQJ A;  5LRN A;  4LRA A;  1ALI A;  5L0B A;  1ZED A;  3WAX A;  4CXK A;  1HDH A;  3OT9 A;  2W8S A;  5L0K A;  4CYS A;  1HQA A;  5IJS A;  4GTX A;  2D1G A;  2IUC A;  2GSO A;  1ZEB A;  3UN3 A;  1E2S P;  3BDF A;  3NVL A;  5GOV A;  4LQY A;  1Y7A A;  5HRT A;  1ALH A;  1P49 A;  2IFY A;  3TWZ A;  1KHJ A;  2W5R A;  5AJ9 A;  4GTZ A;  1ANJ A;  3UNY A;  2GLQ A;  5L0E A;  3NKQ A;  1ALK A;  1K7H A;  4LR2 A;  3WBH A;  4KJG A;  2W5X A;  1KH7 A;  1AJD A;  3LXQ A;  2ANH A;  3E2D A;  3TX0 A;  5LRM A;  2GSU A;  3A52 A;  4TN0 A;  3WAW A;  3IDD A;  3TG0 A;  1EW2 A;  3SZZ A;  2XR9 A;  3ED4 A;  4UPI A;  4FDJ A;  1URB A;  1SHN A;  2W5Q A;  4LRE A;  4LRC A;  2IUC B;  3NKP A;  4CXU A;  1ALJ A;  1E3C P;  1EW9 A;  4KJD A;  1O99 A;  3MK1 A;  1B8J A;  4LR8 A;  4CYR A;  1AJC A;  1ED9 A;  5IJQ A;  1N2L A;  4NWJ A;  3UN5 A;  2GSN A;  3MK0 A;  5KXA A;  1E1Z P;  3DPC A;  3T02 A;  5TJ3 A;  4UPL A;  2VQR A;  3WAY A;  4YR1 A;  1KH4 A;  1SHQ A;  4KM4 A;  4KAV A;  4MHX A;  3UN2 A;  1N2K A;  5DLW A;  5K4P A;  3IGZ B;  4LRF A;  4KAY A;  3BDG A;  3BDG B;  5EGE A;  4UOR A;  4LRB A;  1O98 A;  4MY4 A;  4N7T A;  1KHL A;  1KH5 A;  2W5T A;  4LR9 A;  4ZG9 A;  5EGH A;  3M8Z A; 
#chains in the Genus database with same CATH topology
 4DDF A;  4KHP J;  5CYJ A;  3OXG A;  4B3S F;  4B56 A;  1KBR A;  1FER A;  4JI1 F;  3W2V A;  1RAC B;  4ILL A;  1L3V A;  4CO2 A;  4X62 J;  4JI2 F;  2CDR B;  5EN1 A;  4ZIT A;  3CXC R;  5DQH A;  3M7V A;  3M8W A;  4JV0 A;  1ZZN A;  3CJ5 A;  1RLC L;  3GFH A;  2IHR 1;  2DH9 A;  2GO9 A;  3R3T A;  5E3P A;  3T1H F;  2EXU A;  3AAW B;  1HPZ A;  4WFZ A;  3CJT A;  3T6J A;  4DR1 F;  3MR5 A;  3BKU A;  3KLH B;  1NKC A;  2UUB F;  5EWF A;  1FRJ A;  1P49 A;  4C8N A;  2RRB A;  2V67 A;  5KT7 A;  3PW7 A;  3TO8 A;  4BC7 A;  1SCJ B;  4ZLJ A;  4TYB A;  3BR8 A;  3TUJ C;  3ZZP A;  3A8E A;  2IUC B;  1CBK A;  4PWW A;  2D1C A;  3DRR B;  1TL7 A;  1S48 A;  4OJ1 A;  2Z2Y B;  1CJV B;  1HNW J;  1NPR A;  5I3U A;  4KPY A;  3P96 A;  2IJR A;  4N7T A;  2XY7 A;  3KYL A;  1T9X A;  2KFZ A;  4F67 A;  2MQ8 A;  4KB7 A;  3GG1 A;  2R4F A;  3R5G A;  1RWK B;  4UT4 A;  3IRX A;  5DO2 A;  3KTQ A;  2HZA A;  1CG2 A;  3QWP A;  3W9H A;  1GFW B;  3ZZO A;  1M5V C;  3AXM A;  1XMQ J;  2G9Y A;  2CQH A;  1FWP A;  2DH8 A;  4DR6 F;  5CQG A;  4YB5 A;  5KFH A;  1SJ1 A;  2DR5 A;  3AJ2 A;  2D1G A;  4EUV A;  1U2F A;  4WJB A;  2DNO A;  4P52 A;  3UD4 P;  2DHG A;  1M5P C;  4GRS A;  1H0H B;  3H2V E;  3MR7 A;  3QT8 A;  3M8Q A;  3VGS A;  2XY6 A;  3TQ1 A;  2W01 A;  2B8Q A;  2HUR A;  1RQ0 A;  3WZ0 A;  2GJF A;  1YWX A;  2G4B A;  4KO0 B;  3BGF A;  4FVC A;  2CQ0 A;  4I2Q B;  3W9J A;  5D4O A;  1IKX B;  2COL A;  1SHQ A;  4NWB A;  3KLI B;  4D3H A;  3QJP A;  4B3R F;  1VIX A;  1VQO S;  3DU5 A;  1YKW A;  4ZJL A;  2EPI A;  2IBK A;  3BYR A;  5AXM A;  1S1V A;  4YS2 A;  3TZZ A;  2K2P A;  2WON A;  4C3L A;  1WHV A;  1VHF A;  3OTE A;  3H2U B;  1ZZF A;  4J90 A;  3QLH B;  1CS4 A;  4EEY A;  3QZ8 A;  5L0B A;  5HQ8 A;  4C9D A;  4FPI A;  4O3N A;  5EX0 A;  2PEB A;  3S6E A;  3EM1 A;  1WF1 A;  4X65 J;  2GAH C;  3MMB A;  4MAK A;  4DF4 A;  1JLQ A;  3NKY A;  1NSA A;  2I5J B;  2MQM A;  4NRT A;  5F0U A;  3GR0 A;  3SV4 A;  4NLD A;  4RBT A;  1CVJ A;  3EZU A;  1R8H A;  3MCS A;  4NLV A;  3TJ9 A;  3CCJ S;  3M4X A;  4JI7 F;  4ETX A;  4K0K J;  4KRW A;  4CM2 A;  1OQ6 A;  3EYZ A;  4X4V A;  1ZAX A;  2D9P A;  4HI2 A;  1FO1 A;  1HNV A;  3CO9 A;  3EX7 B;  1HBO A;  3TNV A;  5L1L A;  2HNZ A;  1D8Z A;  3ET6 A;  3UDL A;  1UWB A;  3BRE A;  2R2U A;  3VVU A;  4IO9 Q;  3NNA A;  3CDE A;  2W7O A;  3CCL S;  2NYI A;  4ZHR B;  3PIO Q;  1IBM F;  4PQU A;  4DN0 A;  4OX7 A;  1I3O B;  5CCM A;  2V68 A;  2VIH A;  1WEY A;  3E8O A;  1CJU B;  1VIS A;  2CFX A;  3NRB A;  4CO1 A;  4CNZ A;  5C42 A;  4L76 A;  3CJ0 A;  2HGM A;  2ZVS A;  3HUL A;  4M5M A;  3DLE B;  2Z4P A;  2HVI A;  2Q66 A;  1FD2 A;  1AZS A;  2MKK A;  2R8I A;  1BLU A;  2ABY A;  2XR9 A;  1F5A A;  2FLL A;  2AJF E;  2EK6 A;  5IV4 A;  1ZTT A;  4QIF A;  3MK0 A;  2BRL A;  3JQK A;  1FRH A;  3I87 A;  2JL9 A;  4X64 J;  2B3T B;  1U1M A;  5E33 A;  2FZG B;  3C14 A;  3KJV B;  1BWE A;  5H9F J;  3ILL A;  3OFH A;  1DTT A;  4RR5 A;  3MEK A;  5BJR A;  2V0N A;  1WEX A;  2H54 B;  5HVF A;  1MWY A;  1X8D A;  4PAB A;  1GMU A;  2AKW B;  4YME A;  4HH0 A;  3US5 A;  1HNZ F;  2O5D A;  4RNO A;  3QGH A;  4NYZ A;  2W8L A;  1RAO A;  3IGV A;  2JNJ A;  4NCB A;  2RUG A;  1CJT A;  1SQE A;  4DR5 J;  2QSF A;  2GHV C;  3NBP B;  2AX1 A;  1VBK A;  4PUO A;  1R7I A;  2PSZ A;  1C1B A;  1NK6 A;  3OW2 R;  1VHI A;  1PBU A;  1XK8 A;  5DDP C;  3LGM A;  4OZL A;  3W8G A;  2CWK A;  2FYX A;  5D3G B;  1DZ5 A;  1TMJ A;  3CCW A;  1UMJ A;  2VBZ A;  2RHS B;  3BBC A;  3TVY A;  3HMJ G;  2AEM A;  4QWC A;  1CLF A;  3KKF A;  2CKW A;  1T7P A;  4P75 A;  2MHN A;  1SJF A;  1HW8 A;  4K5S A;  4Q2L A;  3MF5 A;  5ETS A;  4W98 A;  1ITP A;  3SSS A;  5D4N A;  1WG1 A;  4DZ6 A;  2GQ2 A;  2GIQ A;  1QTN B;  3PFO A;  3M2V B;  3AQO A;  1LWC A;  4Y65 A;  2K7K A;  3KMS A;  1NB7 A;  3VCD A;  1YVF A;  1UFL A;  3TAR A;  3KNA A;  3VAH A;  3FUY A;  3IBF B;  3L09 A;  1XEZ A;  2RS8 A;  2EG1 A;  1WI6 A;  1VRU A;  4RNN A;  1EIY B;  2ZJP Q;  4DV2 F;  5C24 B;  3HO1 A;  4CH7 A;  3NMA A;  2HNY A;  4I1T A;  1S7H A;  4RLE A;  3J81 Y;  3TOQ A;  2W5X A;  5KFY A;  2ANH A;  4M5D A;  2UV8 G;  3MOZ A;  5EX3 A;  3R1H A;  2I2Y A;  3CDB A;  5CYQ A;  3MUM P;  3SSR A;  3PM9 A;  3MM6 B;  4F0H A;  2VB6 A;  2AU0 A;  3D4J A;  4A8Y A;  2H5I B;  2D3O 1;  3CDW A;  5B09 A;  3TA0 A;  3W2W A;  2HHP A;  5E3Q A;  3C8Y A;  3DM2 A;  3Q8R B;  1S9E A;  4N5S A;  4DR4 F;  3NEK A;  1SC3 B;  2QFI A;  3HLU A;  3SI8 A;  2B43 A;  7AT1 B;  2WB1 D;  2Z2Z A;  4UPH A;  4FDI A;  5INH A;  3N9U C;  1QAX A;  3PY8 A;  3B5Q A;  1S6Q A;  4TLQ A;  1X4A A;  1X5P A;  4K4S A;  2DGQ A;  1HA1 A;  4GC6 A;  5CYM B;  2IVF B;  1X9M A;  2UUC F;  2BE9 B;  2JVO A;  1VK3 A;  4NPO A;  1UJ4 A;  4OV1 A;  4AFF A;  2QL9 B;  2Z2M A;  1C0U A;  3HP6 A;  5EWG A;  3CT9 A;  3CWJ A;  2R7O A;  1WOR A;  3UDC A;  1GX6 A;  3G87 A;  1N34 J;  2J0S D;  1MW7 A;  2MLY A;  2HQG A;  4X4R A;  2PC6 A;  1NEE A;  2HQI A;  1ZM4 A;  4QPT A;  4UW2 A;  1QDU B;  4WKY A;  1JLG A;  2B4P A;  1X9S A;  1OY9 A;  2K1R B;  3W63 A;  3HHE A;  1VBZ A;  1O0P A;  3OL8 A;  2QG9 B;  1BQM B;  2YQ3 A;  3KOA A;  3ZTR A;  2O3D A;  3FEY B;  1RT3 A;  4RL1 A;  2AEJ A;  3PHE A;  4I7F B;  5DLG A;  5H9F K;  1U25 A;  4LRB A;  2XNR A;  5B0A A;  2VA2 A;  4KJI A;  2W2N P;  4ECU A;  5ADZ A;  4EK2 A;  3Q8S B;  5GAE I;  3SIP B;  4ZVO B;  4X66 F;  2RQ4 A;  2HZV A;  3V81 B;  1PYS B;  3PIP Q;  2KKH A;  1SJQ A;  2LEA A;  2OO4 A;  1R27 B;  4FYD A;  1H72 C;  4DBQ A;  2C2N A;  3KJF B;  4LBP A;  3RBZ A;  2P9E A;  1QSL A;  4RW9 A;  4J9U E;  2IRY A;  3OQ2 A;  1WOS A;  2F4V J;  4IFY A;  3M2U B;  1TV6 A;  2DY1 A;  3ZFV A;  3KHL A;  5K8P A;  4OQJ A;  2X1G A;  2AJ2 A;  3MGJ A;  2MY8 A;  1AYE A;  1K44 A;  2LXF A;  1LWE B;  1M5H A;  4P2S A;  4DUY F;  2CPX A;  3CMQ A;  4YY3 J;  4MT1 A;  3K59 A;  2RU3 A;  4I56 A;  3AB2 B;  4JI8 F;  2E7X A;  1N36 F;  4IO1 A;  4O4G B;  2DXD A;  5KT3 A;  3PEH A;  1SV5 B;  4R5P A;  1X4C A;  1X0F A;  1J5E F;  5CAB A;  4HAC A;  3MM7 B;  1S1U B;  2W2M P;  4F3Q A;  2HAF A;  1OPI A;  5GMK a;  1FF2 A;  1PJ5 A;  4NL5 A;  2DGX A;  5KFN A;  2C3Y A;  2JH3 A;  4WYW A;  5EDW A;  1UWA A;  2HHH J;  4PXB A;  4WZQ A;  3LWM A;  5CZX A;  3GIJ A;  3SMZ A;  1F1B B;  1RT6 A;  1NRK A;  1SL0 A;  2WW8 A;  4E98 A;  3VQT A;  3NVL A;  1KQS R;  4WTY A;  5ETL A;  1FXD A;  1NUE A;  4ED3 A;  1GMW D;  3TAM B;  1WC1 A;  2N82 B;  2NXE A;  2Y1I A;  1K8A T;  3CW2 C;  4N76 A;  2WVF A;  2ZNZ A;  2YQ0 A;  4JYA F;  2AIR B;  4DL6 A;  2H48 B;  4N41 A;  3O3L A;  4A46 A;  5LMU J;  2XWX A;  3DYA A;  1S1X A;  2MQL A;  3I5A A;  1GX5 A;  2AF6 A;  1FK9 A;  1CC8 A;  4RUH A;  4UOO A;  4MIA A;  4BBY A;  2WVB A;  3BGU A;  2Z57 B;  2VL1 A;  3BV8 A;  1EW8 A;  3RAQ A;  4MFB B;  3W7B A;  3QO9 B;  1JLA A;  1JX4 A;  3DGP A;  4KBI A;  2JJ4 D;  5J2N B;  1HR0 F;  2R7R A;  2HK2 A;  4RW6 B;  1Q7Y T;  4ZN1 A;  4LQ3 A;  4PYA A;  3A4T A;  3BSA A;  1YJ9 S;  1NK8 A;  2HHQ A;  2BAB A;  1C1C B;  2B4U A;  3GG0 A;  1N4L A;  2VPW B;  3UFC X;  1S6P B;  1MML A;  3I31 A;  4NOH A;  4NA3 A;  4DV1 J;  4DV4 F;  3PCO B;  2DVI A;  1UVN A;  5T14 A;  3IDD A;  1Y5N B;  3OFE A;  4FDJ A;  1EAY C;  2V8G A;  3VR1 A;  2XCA A;  1FDN A;  2XGQ A;  3KHR A;  4Z7Y A;  1IKW A;  5HRO A;  1MMN A;  1VC5 A;  2ALY B;  3WAY A;  1L3T A;  3TZW A;  3HVT B;  3ZTO A;  4JI6 F;  5J1E B;  5A8R A;  4NI2 A;  1VQP S;  3AXK A;  3M8Z A;  4WTO B;  1WNE A;  3DRS B;  2FHJ D;  2I9S A;  3P45 B;  4WP9 A;  3ENQ A;  2A3J A;  2W8D A;  2UXB J;  1U09 A;  1IKV B;  1O5J A;  4RBV A;  4ZVP B;  4E0D A;  1XNR J;  1URR A;  3JAM Y;  3GYN A;  2F9J A;  1NDC A;  1VS3 A;  2CQ2 A;  2B6A B;  2XO7 A;  3IRW P;  1S77 D;  3ELH A;  2D3O R;  2HFZ A;  5IJS A;  4ED0 A;  3POT A;  4R8U A;  1SKS A;  2W7A A;  3V6J A;  4OJH A;  2W9B B;  2IA0 A;  3PO4 A;  4K4X A;  5D6G A;  2E9R X;  1TUW A;  2OSR A;  3NXZ A;  2Y0B B;  4OX9 F;  3QAU A;  1IKY A;  3R5A A;  4ILR A;  1N5T A;  3GB0 A;  4UPI A;  1TU0 B;  4P71 A;  4ELT A;  4RW4 A;  1U2R A;  3D6M B;  3RRH A;  2AJ4 A;  1KWM A;  1SUQ B;  2GC8 A;  4GMK A;  3KK2 B;  2X3G A;  1RHU B;  2QIF A;  3ETM A;  3O6Q A;  1SVD A;  3NGT A;  1PGZ A;  3QJL A;  3CUN A;  5L9X A;  5L38 A;  1H2V Z;  3CJR A;  1RJJ A;  3DI6 A;  2DO4 A;  3OTB A;  1LW0 A;  1SXL A;  1AFJ A;  2XZT B;  3T01 A;  1JJ2 R;  1UJ6 A;  4X4T A;  1NKB A;  4C8K A;  1VYA A;  3HKW A;  3N6L A;  2WOM B;  1LQ9 A;  4DCJ B;  3K5N A;  2UP1 A;  4ZP8 A;  3N5B A;  3BF4 A;  3MR6 A;  1RAH B;  4PPZ A;  4P9S A;  4PRF A;  1M0S A;  3GMG A;  3L3C A;  1X4B A;  4A8F A;  1FRX A;  4KC5 A;  4CYS A;  4EZ6 A;  2IPO B;  3IM8 A;  2GNK A;  2VFV A;  3SCL E;  1E2S P;  3EWG A;  1E6Y A;  3T41 A;  5GME A;  3TZY A;  5KFQ A;  4FXD A;  4I2P A;  4AQY J;  3LO3 A;  1LK5 A;  2H5E A;  3QFH A;  2UU9 J;  1UW9 A;  3QIP B;  3HFK A;  4DWI A;  4XPE A;  4DG1 B;  3RJM B;  2VV5 A;  2MKJ A;  4G3I A;  3SDE A;  3R8Y A;  3R6G B;  1I94 F;  1VJQ A;  3EXY A;  4GVL A;  1IJE B;  3GE9 A;  3GON A;  1S76 D;  3OHA A;  4ED5 A;  2M9K A;  1YIT S;  5LQQ A;  3ISZ A;  1U0S A;  2D3Z A;  2DD8 S;  2HHS A;  2ACM A;  5KT6 A;  5F8M A;  1NSP A;  3NOG A;  3ZTQ A;  2YNH B;  1QE1 A;  2BYC A;  5LSO A;  2F9D A;  2CZV C;  1MSW D;  1RT2 A;  3BH7 B;  1NPK A;  2YKA A;  1Y3K A;  2ILY A;  1J5O A;  3W2V B;  3H2L A;  1Q78 A;  3F73 A;  3LW5 C;  3K5P A;  3M9N B;  1X5S A;  3E2E A;  1KHJ A;  5LMN F;  4M5H A;  5HMX A;  1ALK A;  2R7W A;  4ZLN A;  1D3W A;  2ATL A;  2C22 A;  4W92 B;  1Q95 G;  4I6A A;  1LWF A;  4ID5 A;  1REG X;  4DV7 F;  4DFJ A;  2DEJ A;  5D8H B;  1HPZ B;  1RWU A;  3D66 A;  2AEF A;  3BGR A;  4WE1 B;  2CQB A;  1CC7 A;  2RAQ A;  5F9N A;  1VRQ C;  2KL8 A;  3LP2 A;  1HQ2 A;  1UVK A;  2RVJ A;  3TQE A;  1NSK L;  1VOM A;  3BKT A;  2MKY A;  4NCG B;  1FNO A;  4LBH A;  1GAO A;  3KDO A;  5LSR A;  5I3U B;  4ZPB A;  2OFH X;  2OD4 A;  4J9L A;  4QU7 A;  3CNQ P;  5K8O A;  5E5N A;  3RRK A;  4GKJ J;  2L3M A;  4XK8 C;  4ECS A;  2GGP A;  3RRG A;  3DLK A;  4CLS A;  5IZH A;  1D0E A;  3IAM 9;  5J1N A;  4G1Q A;  5DG7 A;  1WC4 A;  4B3O A;  2YWK A;  4B3S J;  4F4X A;  5LJ3 Y;  2MZQ A;  3QWU A;  4I6Y A;  3PRV A;  2MQP A;  1NND A;  4JI1 J;  4YOE A;  4I0W A;  2ALZ A;  2JOQ A;  1KS2 A;  3RBD A;  2ZNY A;  4JI2 J;  2BQ3 A;  4ITS A;  2MMY A;  5IWA F;  4QBU A;  3PX4 A;  4ZPV R;  4C8L A;  1GNK A;  1CEZ A;  3QID A;  4ELU A;  2E9T A;  2MTL A;  4LF5 F;  1F9F A;  1C2P A;  4BWM A;  1LKZ A;  3T1H J;  4KHM A;  3M8Q B;  3TJ8 A;  5D0H A;  3GLJ A;  2QTW A;  3PJ9 A;  1KQK A;  3DDK A;  2UUB J;  2ZC4 A;  3EVW A;  1W7W A;  1UKU A;  3KUE A;  2HSE B;  1SKW A;  1IM4 A;  5HMY A;  3C6U B;  3PVX A;  4GKK J;  5KFC A;  2HZC A;  1VLO A;  2KVI A;  1WDD A;  3UI3 A;  1S1V B;  3UO0 A;  2ASY A;  1FES A;  2HND B;  3DLH A;  1FXL A;  4HT5 A;  2CZ4 A;  5J2M A;  4HTJ A;  1KHV A;  1REV B;  1S9G A;  4LSL A;  3UN3 A;  1JKH A;  3MZI A;  4DU7 A;  3DHW C;  4RW8 A;  2AYM A;  1HNX F;  1HWU A;  1CS4 B;  4IFV B;  2BAC A;  2D3U A;  5BXI A;  4MKV A;  1TK8 A;  1R8B A;  3JSB A;  3MMB B;  4U9R A;  2ZH6 A;  4KV8 A;  1MG7 A;  1JLQ B;  3MM5 A;  3GTY X;  3MPD A;  3CMA S;  3J80 U;  1D9D A;  3PX0 A;  2XLK A;  4DR6 J;  3L7P A;  2B5J A;  2C3U A;  3HHL B;  1V3S A;  2VBX A;  2C42 A;  3AD8 C;  3WQP A;  2VFT A;  1RCX B;  1HNV B;  3BDP A;  5B0G A;  4YFU A;  1GT8 A;  1T9U A;  1KSP A;  4KTQ A;  1HHQ A;  2KRR A;  2GO8 A;  5DET A;  2L9W A;  1QAI A;  1UWB B;  2E1P A;  3OTD A;  4OHZ A;  5GAG U;  1AFI A;  2MHE A;  1R43 A;  3MED B;  1F6T A;  3BQ2 A;  2DTJ A;  3WC2 A;  4L74 A;  4PQU B;  1SBR A;  3OXF A;  4B3R J;  2I0X A;  1QM9 A;  2Z0G A;  4TN2 A;  3BM7 A;  5B0D A;  4HVZ A;  3I0R A;  5CD4 A;  1L3K A;  3QT6 A;  3DOK A;  1QY7 A;  2QA4 G;  2GML A;  4KJD A;  4ZJQ A;  4OX8 A;  1N5S A;  3ZO7 A;  4FKX A;  5JJB A;  1FRM A;  1DLO A;  1OY8 A;  3FZB A;  4FP9 A;  3KLF A;  2YWH A;  3W61 A;  4EFA C;  2ZH7 A;  3IFE A;  5HBM A;  1JNR B;  3Q8Y A;  1SJR A;  5KFA A;  4O4R A;  1FRL A;  2YWG A;  2XEX A;  3BDH A;  2JZ5 A;  3J7A 1;  1MLA A;  4YEA A;  3H5Y A;  4RW7 A;  2OML A;  4KHR A;  4USU A;  4ER8 A;  5A8W B;  2KTQ A;  4WZM A;  2GVD A;  4YR0 A;  2W8K A;  1P1L A;  3KHG A;  2VQF F;  3IS9 A;  2W5V A;  4JOU A;  3CF5 Q;  4XAK A;  2CJQ A;  2LCW A;  4JI7 J;  1F0X A;  3AJD A;  2V2K A;  1KTV A;  2GA7 A;  1Z2Z A;  1S0O A;  1HWL A;  3DMJ B;  1RAB B;  2XMA A;  4WII A;  2AYB A;  2B8P A;  3C46 A;  2H65 B;  5FD1 A;  1V6H A;  4OJG A;  2X7I A;  4FYV B;  2R7Q A;  1OPZ A;  3NNC A;  4JI5 F;  1RU2 A;  3ED4 A;  3GYG A;  3VTI A;  1IBM J;  4A8S A;  3HI9 A;  3R5D A;  2L08 A;  4DL3 A;  2CAJ A;  3E51 A;  4OFZ A;  3VV2 B;  2QLJ B;  2RQM A;  2V4Q A;  5KFT A;  1C1B B;  2HHW A;  2KB2 A;  5KFX A;  1KH5 A;  4DFK A;  1IR1 A;  1KQG B;  2MKH A;  3UR0 A;  4IDK A;  3V6D B;  1NK0 A;  5IV3 A;  2CPJ A;  1X60 A;  1JMT A;  1Y7P A;  2K8G A;  1R31 A;  2RDI A;  2OD6 A;  1AJB A;  3M32 B;  4NWX A;  1SQF A;  5ETQ A;  3V4I B;  1HI1 A;  4HR2 A;  3RZA A;  2OTL S;  3TUP A;  4KGX B;  2QSW A;  1XMB A;  4O23 A;  4USI A;  1KH9 A;  4OYI A;  4ZVU B;  2CUY A;  4J5O A;  1T8E A;  4UOH A;  1FNX H;  2W4P A;  3F56 A;  1DTQ A;  5F8N A;  3DLL Q;  1U02 A;  4DSJ A;  4H4K A;  3CCR S;  1AUD A;  1JLB A;  4C97 A;  4P2M A;  1S12 A;  2J6T A;  1RSC A;  4DSI A;  4PWD B;  5MLC V;  5J2Q B;  2KH9 A;  5J1P A;  1RCO B;  3G8T A;  4OYW A;  3J81 U;  5EUH A;  1DRZ A;  1RIS A;  1VK8 A;  1VGY A;  3AA9 A;  2FVP A;  3ZTP A;  1XIQ A;  2QN6 B;  2MYF A;  2CDQ A;  2IDE A;  2EVZ A;  3DCA A;  5AE3 A;  4ZCK A;  3GCX P;  4AL6 A;  2RQC A;  4CRJ A;  4CIO A;  2ZVI A;  1ZAV A;  4NZ6 A;  2W9A A;  2RT3 A;  2QZU A;  2DNZ A;  2JLF A;  5I42 B;  1I1G A;  4C0O C;  4GTW A;  1U2C A;  3W2W B;  5DS7 A;  5LXY A;  3H5X A;  3KWM A;  1Y9O A;  1S9E B;  3NGD A;  2HHT A;  2FGC A;  5CHC B;  1PIE A;  3H42 A;  4QOT A;  4YHH F;  4YB7 A;  5DLF A;  4F4W A;  2HVH A;  4I6W A;  2HMI A;  3GJQ B;  4JB8 B;  3UPF A;  3ZZR A;  4OZ1 A;  3SBM A;  3M6W A;  4P7T A;  4GTZ A;  1S9F A;  2J0W A;  4CTA A;  3LQV A;  1EET A;  1RAA B;  4L6V 3;  1U0H A;  3M2R B;  4CZC A;  1HBN A;  3IXQ A;  1N5Y A;  2W2Q P;  1B0V A;  1VQY A;  4OYA A;  3DOL A;  2IMW P;  3QQC D;  3HXM A;  2NXU A;  4FZV A;  2AZ1 A;  3H59 A;  3AA8 A;  4EI2 A;  4F2S A;  5HO4 A;  1RKI A;  3WIU A;  4WWS A;  3H5U A;  1VIO A;  1T9Y A;  1KH4 A;  3LUY A;  3CJK A;  1JLG B;  2CG4 A;  2EI5 A;  1GQE A;  2Q79 A;  2WSF C;  3HHL D;  1WKJ A;  1FDD A;  2KYX A;  4DV2 J;  1BXN A;  3I9Z A;  2EC0 A;  2C2M B;  3K5O A;  4Y0F A;  4NXM F;  1RT3 B;  3CCE S;  2B4V A;  1BQN A;  2V2Z A;  1BC6 A;  1RTJ A;  3AT1 B;  3JYT A;  4U7U D;  2IY5 B;  2GA3 A;  2XYG B;  1X7V A;  1X5T A;  3LP1 A;  3P49 B;  3FBE A;  3MUT P;  3R6L B;  1ZED A;  4OI1 A;  3GZ7 A;  1RWP B;  1V9O A;  1YX2 A;  1Y7A A;  4DR4 J;  2XNQ A;  4FYW B;  3C6T B;  4IG3 A;  4U67 Q;  2HFO A;  4OYX A;  4ICL A;  3PO5 A;  1TL1 A;  4FS2 A;  4RW9 B;  2ZD1 B;  3PW0 A;  1R8P A;  4MYT A;  3V2U C;  1T05 B;  5KFR A;  3HVR A;  4G1P A;  4F4Y A;  4KPC A;  4ZA1 A;  3TRG A;  4U7U K;  1TK5 A;  5DDO C;  2DNH A;  2IMO A;  4DCP B;  2XZD B;  3QT7 A;  3Q0A A;  4WP3 A;  4P74 A;  4ED4 A;  1HD0 A;  3LPY A;  4CO4 A;  4A8K A;  2GAG C;  5D4L A;  2ZUA A;  2CNO B;  5L8R C;  5KG7 A;  3HM9 A;  1S1T A;  1NJZ A;  4O0N A;  5E3R A;  2RDJ A;  3D3B J;  3CJ2 A;  2XM3 A;  2GCF A;  1YJR A;  3PDN A;  3E01 A;  2XSJ A;  3IAS 9;  3HK2 A;  1RU1 A;  1W2B R;  5T7L B;  5KG5 A;  1ZM9 A;  3JQJ A;  5KFI A;  2H51 B;  2YX7 A;  4QWB A;  1IUJ A;  4EBE A;  3A3P B;  1AT1 B;  3IR5 B;  2HFV A;  3A8K A;  4KR0 B;  2FVS A;  3LF0 A;  4X66 J;  4CWB A;  4WP8 A;  3VGU A;  1RT6 B;  3GIL A;  1KLN A;  2JRS A;  4UF4 A;  2VHG A;  3MM8 A;  1EQM A;  3GQC A;  4CYR A;  4NYP A;  1LOU A;  1OYE A;  2BE7 D;  5GAD U;  3QGG A;  5TJ3 A;  1PJ6 A;  3EGV A;  3NWG A;  5FJ4 A;  3KDN A;  1U8W A;  4OYP A;  3C19 A;  4JI0 F;  2BDP A;  1XR7 A;  4G1I A;  2VG7 A;  4RNF A;  4LR7 A;  4CLF A;  3VAM A;  3AFG A;  1ZA1 B;  1H7W A;  2XC9 A;  1RT7 B;  1DUR A;  1UEU A;  3NS7 B;  2DIT A;  1YLX A;  4NLS A;  2RS2 A;  5G0R A;  4YN3 B;  2CQP A;  1S1X B;  5H1S V;  1WC3 A;  1K9M T;  3MPY A;  4WBF A;  4DUY J;  3N4W A;  1YJV A;  1M5S A;  2E44 A;  2MQO A;  5CA5 A;  2C3M A;  4URG A;  1N36 J;  4K2X A;  1R6V A;  1HBM A;  4PR6 A;  3C16 B;  5D0E A;  2MKC A;  2HLT A;  3GIK A;  1J5E J;  3DGP B;  2CJK A;  3PHT A;  3H4B A;  1KON A;  4KT0 C;  1S1W B;  3VQS A;  4I64 A;  4F4Z A;  2V94 A;  4USJ C;  4DQP A;  2DNY A;  2ZE2 A;  2MGZ A;  1TFW A;  4B08 A;  2GV1 A;  3S01 A;  3OSP A;  3CJ8 A;  3MAQ A;  4YP3 A;  2G0J A;  5KFB A;  4V19 J;  3B8H A;  4A47 A;  4X4Q A;  1FA0 A;  2VOP A;  2RB7 A;  1KFD A;  4FN5 A;  4H4M A;  2BA9 A;  4NEZ A;  1ZOT A;  5KAK A;  1ZAW A;  4XTT A;  4EYH B;  3JAM U;  4KAI A;  3A3O B;  4HTI A;  2IC3 A;  2Y1R I;  4JYA J;  4X4N A;  3D9B A;  4TY8 A;  1NSQ A;  2CJA A;  1TKT A;  7FD1 A;  2FDN A;  4OYZ A;  2V9K A;  3D28 A;  3R1L A;  2NCK L;  4UY8 T;  2OKQ A;  3CJQ A;  2XMU A;  2B9E A;  1RTZ A;  2AWZ A;  3T5J A;  2FZC B;  4M5J A;  1SC6 A;  2ZOM A;  1UEK A;  4DL7 A;  3POT B;  1P9Y A;  2YKM B;  3DOM A;  2WRM A;  2GVZ A;  3VZI A;  2G13 A;  3H90 A;  3R9L A;  2Y3Y A;  2VG6 A;  1HR0 J;  1UJ5 A;  2CG8 A;  2F63 A;  3ITH B;  3UNG C;  3G6V A;  4MY4 A;  3FBF A;  1HJK A;  4GO5 X;  3AD7 C;  3IR6 B;  1B3T A;  4RW4 B;  1U24 A;  1YJN S;  3CVK A;  4F0M A;  2LP4 A;  2MLX A;  4N56 A;  1ZA2 B;  2N7C A;  4OJ3 A;  2MY7 A;  4DV4 J;  3CD7 A;  4DHV A;  4DZD A;  1VDH A;  1S0M A;  2CPZ A;  5IS2 A;  3CD0 A;  5DM7 Q;  2RKI A;  1RT4 A;  2UXB F;  4UZB A;  3JQM A;  3FGV A;  1RT1 A;  3DYC A;  3DI6 B;  3PRD A;  4F7V A;  4H4O A;  1UA0 A;  2J0X A;  1RYR A;  1RHQ B;  4JI6 J;  5DZ6 A;  2NPI A;  4Q43 A;  1E6V B;  4C8Z A;  4J37 A;  3LP0 A;  5A6W A;  4PWU A;  1HQU B;  4ZLL A;  1N52 B;  3GV5 B;  1HYS A;  3IG1 A;  1EW9 A;  6FDR A;  1RI7 A;  5I3Q A;  1E6Y B;  4DL2 A;  3P5T L;  4HDH A;  4WU2 A;  4J9O A;  1Y0H A;  4YR1 A;  3SSQ A;  5DLW A;  1EX8 A;  1Y11 A;  2JVR A;  3W62 A;  2DT9 A;  3KLG B;  5KT2 A;  2ZBC A;  2FIU A;  3BQ0 A;  5L1J A;  2F1F A;  1A6L A;  4WFY A;  3SDE B;  4MIW A;  2J9E A;  2Y1L B;  1RHK B;  1WEZ A;  4DV5 F;  5FDL A;  3H20 A;  3UVJ B;  3I96 A;  2MZ1 A;  2JSX A;  2AGQ A;  2E1R A;  4Z2X A;  1EHW A;  1NZA A;  2KI2 A;  5IQQ A;  1FFW B;  1G4C A;  4ZLP A;  3ILI A;  3HSG A;  2LDI A;  2HVD A;  2KO1 A;  1JB0 C;  1QUP A;  3RR8 A;  3CCZ A;  4KE5 A;  5H9E J;  3QFW A;  2QLF B;  3QSI A;  1Q53 A;  1YJT A;  1QE1 B;  2XMT A;  2M70 A;  5K14 A;  5DG8 A;  1NDL A;  1FHT A;  1VQ8 S;  1NJY A;  1RT2 B;  1YJ7 A;  3T1A A;  5L46 A;  1J5O B;  5KFZ A;  3UW1 A;  3T1Y F;  5DDQ C;  3CCU S;  1VQ5 S;  2QT7 A;  3KMQ A;  3TAP A;  4AQY F;  3IO1 A;  2B51 A;  2P6T A;  5KG2 A;  3AOA A;  4OLO A;  1H7X A;  2UU9 F;  1UP1 A;  2BJ8 A;  2OEJ A;  2VFR A;  3IGZ B;  3BDG A;  2Y8W A;  4ZVF A;  1O98 A;  2LQB A;  4UOG A;  1FKO B;  5EGH A;  3BZQ A;  4CO3 A;  4RZR A;  1RAE B;  2ROP A;  3CB4 A;  4IQM A;  1HNI B;  3TUI C;  1FD8 A;  4R0J A;  4OL8 A;  3H25 A;  2FJX A;  5BR8 F;  2UVR A;  4V1A k;  5HLF B;  5K8N A;  1VQ9 S;  3ZZ0 A;  5ETK A;  4H54 A;  1IXK A;  2L9D A;  1Q82 T;  4KY3 A;  1OQ3 A;  3MD1 A;  2VBW A;  1F5B A;  1I94 J;  4U8V A;  4ED6 A;  4DPY A;  2CQG A;  5IM0 A;  2RUS A;  3KLH A;  1B0T A;  1YSJ A;  2J5A A;  2YNI A;  3OVB A;  3CO0 P;  1Z2L A;  2RF2 A;  4DR3 F;  5E3A A;  3M05 A;  1M1H A;  3WAW A;  3DLK B;  3BGL A;  1T3O A;  5KFG A;  3THT A;  1O99 A;  1L5U A;  1IR0 A;  1CJV A;  5HAO A;  3BO4 A;  4PG4 A;  1HMV A;  2LEC A;  2MZJ A;  3LPE A;  3H0P A;  2W5T A;  4F0K A;  1TL4 A;  4F02 A;  1URA A;  4YB6 A;  2RNE A;  1RA6 A;  5L9N A;  1XWL A;  2HQC A;  4LBI A;  5LMN J;  1RHM B;  1YBA A;  5IT4 A;  1G1X A;  4EYI B;  4ZPT R;  2SXL A;  1FT8 A;  1CUL A;  2QO3 A;  2CA9 A;  3I9V 9;  3IWN C;  2DHX A;  4RO0 A;  1TAU A;  4OX6 A;  4CXK A;  2VKR A;  5HQL A;  4NCA A;  2HLU A;  2IM0 A;  3G4S S;  3MUV P;  3FSI A;  3Q8P B;  4A8W A;  5B08 A;  2A6M A;  2EKY A;  1EP4 B;  3VVT A;  2ZH1 A;  3CC4 S;  2W24 A;  1FWK A;  2XY5 A;  4LRE A;  5J2M B;  1ALJ A;  4LSL B;  4KO0 A;  2HS3 A;  3W66 A;  4M5L A;  4I2Q A;  1JQG A;  1IKX A;  4M63 A;  5KXA A;  1S4E A;  2JFK A;  3KLI A;  4HT7 A;  4WCE Q;  1EAR A;  2HIQ A;  1GEH A;  3RU0 A;  4J9V A;  2ROG A;  3UCZ P;  1TP7 A;  3NL0 A;  3MM5 B;  2XGP A;  1VQ6 S;  4HHH A;  3LAN A;  1O6X A;  3IGY B;  4CLZ A;  1U48 A;  2B5J B;  1NH8 A;  3QLH A;  4A8M P;  2X1F A;  5IWA J;  4KGK A;  1UPM B;  2GJ2 A;  1TKZ B;  4GKK F;  5H9E K;  1YQH A;  2XCP A;  3QAE A;  1HI8 A;  3PEJ A;  1APS A;  3ENA A;  4LF5 J;  2LXI A;  3G8S A;  1ANJ A;  4KYZ A;  2DBB A;  2V8V A;  2MLZ A;  1FE0 A;  3PNI A;  2I5J A;  1FJC A;  1VMB A;  5DQI A;  1TQL A;  1PC5 A;  2HVE A;  3CD6 S;  2DGO A;  3V5R A;  2I6W A;  2XI3 A;  3MM9 B;  4LFB F;  4PQA A;  2DIS A;  4OZ5 A;  2PO4 A;  1WC0 A;  5ETP A;  3W60 A;  5KG3 A;  1KHN A;  1IBL F;  4ZG6 A;  2V8D A;  1B4S A;  3P3D A;  5KFE A;  1HNX J;  3Q23 A;  4ZHR A;  1F9H A;  4JUZ A;  2XS2 A;  3DLG B;  2HQ3 A;  2G2O A;  1SIZ A;  2DNL A;  1OSD A;  3EVM A;  1CJU A;  1T0T V;  2QFJ A;  4RW7 B;  2OPR B;  1CQM A;  3N6N A;  1JXL A;  5KFJ A;  4M8L A;  2LQ5 A;  2FJW A;  3MD3 A;  3I82 A;  4O44 B;  2GVD B;  3NAI A;  4UUW A;  4F36 A;  5LT5 A;  1RWN B;  2V34 A;  4Q7A A;  1EQ0 A;  3NS5 A;  2M88 A;  3A12 A;  4L72 B;  3PAC A;  2GSN A;  5AE1 A;  2IM1 A;  1PJ7 A;  1UET A;  2W4D A;  2HFS A;  3MCM A;  5DZ7 A;  4RUB A;  2B9X A;  2NXC A;  3KFW X;  4NLP A;  3HHN B;  4C2M A;  2MST A;  2LQ9 A;  1ZTW A;  2VAS A;  4DPU A;  3DNC A;  3CCM S;  2V50 A;  4WIQ A;  3FEX B;  5GAH U;  3VAK A;  4G6V B;  3RAX A;  3HFZ B;  1SKU B;  2NQP A;  1TL3 A;  3HF5 A;  3J7Y I;  3RTV A;  2E1M C;  1N0V C;  2VIC A;  4L75 A;  2C2E A;  4ATN A;  2LU1 A;  4RNM A;  3PR4 A;  1NO8 A;  2W2O P;  5KOW A;  3OT9 A;  4DEZ A;  1NM2 A;  1WKK A;  4WYL A;  3NBP A;  3CJ3 A;  3VGV A;  3BN4 A;  1UL3 A;  2B9Y A;  2FC8 A;  3TW0 A;  2IFY A;  2YTC A;  1Q8I A;  1GMW A;  5GAE U;  2FJA B;  1WKL A;  4TKT A;  3TX0 A;  5MAO A;  3RB6 A;  5KFM A;  3NKP A;  5D3G A;  3LAM A;  2HBR B;  3BSC A;  2VQF J;  3C15 B;  2QMW A;  2EEY A;  1N6Q A;  1HFE L;  3TA1 A;  4A48 A;  4K4T A;  3PX6 A;  2MEW A;  4ZOS A;  2NR0 A;  2DHH A;  1H2U X;  3WC0 A;  2KT2 A;  4B9N A;  1T03 A;  1S6O A;  2GMH A;  3SFG A;  2RQK A;  1R8A A;  4EZ9 A;  1M5K C;  1SC1 B;  3M2V A;  5C25 B;  5IXU A;  2A6O A;  3P5B P;  4JI5 J;  2C3O A;  4CNY A;  4OLP A;  3U1N A;  2V9W A;  2BM1 A;  1ED8 A;  4CI0 B;  1TL5 A;  1P9Q C;  5AE2 A;  2YNG A;  2ZHA A;  4LRD A;  4YDD B;  1FNM A;  4TU7 A;  2DGT A;  3NS6 A;  4IQX A;  2V6A A;  4KKO B;  5M2R A;  3DKD A;  3UCU P;  2K3I A;  4NLY A;  2QLW A;  5FII A;  4J9P A;  4LQY A;  2LEB A;  5C24 A;  1FKP B;  3EZ5 A;  1JK9 B;  2P9C A;  1WSR A;  2LVW A;  2IJN A;  4LIR A;  4CO5 A;  2YKO A;  4ENO A;  1X31 C;  2QX0 A;  1WTF A;  5SZT A;  4ZDN A;  2Z8Q A;  3WX8 A;  5B0F A;  2CRL A;  2YX4 A;  1VQM S;  2GSU A;  1UFK A;  4WFN Q;  4GVB B;  4ZJO A;  2YPY A;  4ECQ A;  3H5S A;  2O01 C;  4B9U A;  1NJX A;  2HRT A;  2VC0 A;  4K4V A;  5BYS A;  2C3P A;  1U1L A;  4J9M A;  1EET B;  2NUH A;  1U0H B;  2GHP A;  1HBN B;  1N5Y B;  3O1L A;  2HAI A;  4IUF A;  3GV8 B;  5AT1 B;  3HHK A;  1S10 A;  4UPK A;  3MOJ B;  4MIV A;  3WAV A;  2FLO A;  2FHJ A;  4TU8 A;  3IBW A;  3SZY A;  3DXB A;  2DIV A;  3BJY A;  1GTH A;  1QVG R;  2JLG A;  1ULR A;  3FSY A;  3GII A;  5A0Y B;  3ISN C;  2CQI A;  2DHA A;  3CJK B;  2UVW A;  3DGV A;  5CYM A;  4C11 B;  5F8L A;  1YZ6 A;  2NSB A;  2CQ3 A;  1S59 A;  3HSD A;  2R7X A;  4LF9 F;  2W1B A;  1ZBT A;  4HLB A;  3T9Z A;  4CLW A;  4FKY A;  4ED2 A;  4FYX B;  4OZ3 A;  6AT1 B;  3OR2 B;  2LQ8 A;  4R0E A;  2RRA A;  2ADC A;  3JYT B;  3ZTS A;  3EDR B;  3SZ2 A;  2UXC J;  1V5V A;  2HRU A;  2PE8 A;  2R3V A;  3KJN B;  4DL4 A;  2F8H A;  3RW6 A;  2QLB B;  4NLQ A;  4FDF A;  1KVK A;  3GFZ A;  4HHU A;  2DRD A;  3MEG A;  3W1Y C;  3WIV A;  1K1S A;  4J9Q A;  3BO2 A;  1BQM A;  1R0A A;  2DYA A;  1RTH A;  2FHO B;  4YHH J;  4IG3 B;  3B54 A;  3Q8V A;  2CIM A;  4I7F A;  1A9N B;  4X4S A;  1TL1 B;  4C6A A;  4G65 A;  4NX9 A;  1BD6 A;  2WVC A;  2CJY B;  1NH7 A;  1NKE A;  1S0N A;  3UE2 A;  4RWX A;  2CJ9 A;  3FCV A;  1KFS A;  5LOQ A;  4MKB A;  5DQG A;  5ETM A;  4ZK7 M;  4ZVR B;  2CPY A;  2R8H A;  3CMR A;  5JVH Q;  4WK1 A;  3V81 A;  3HSZ A;  2HFN A;  1RB0 A;  2XG8 A;  1KN6 A;  1HKA A;  2ZIT A;  1T9W A;  2R42 A;  1Z4U A;  2IJF A;  1F2H A;  1KOH A;  1ZYQ A;  2WZ1 A;  2Z56 B;  3FC9 A;  3D0I E;  3CPW R;  4PG7 A;  2BE2 A;  2PMZ D;  1X4F A;  2RJZ A;  2H1Y A;  1OIA A;  3LA0 A;  4NA2 A;  1S1T B;  3HHD A;  1QSY A;  1ZEB A;  3M2U A;  2Y0S D;  3PJW A;  1LW2 A;  5C2G A;  1S99 A;  4ZVH A;  1KLM A;  5C5J A;  4KJG A;  4J91 A;  1LWE A;  4ZP9 A;  4NXM J;  1B64 A;  4QPX A;  3GFX A;  3E01 B;  3O5T B;  2V8P A;  2VFS A;  4NAS A;  4HH1 A;  1I5O B;  3FJ2 A;  3THV A;  3KLV A;  1ZPV A;  1SV5 A;  3PYF A;  1JLF A;  1VQL S;  3CED A;  3MM7 A;  1UPP A;  2KT5 A;  4QYR A;  1RKJ A;  4DMZ A;  3HZE A;  3N6M A;  2PFD A;  2MKS A;  4P10 A;  3UDV A;  3K2Y A;  1QJH A;  2KG0 A;  2KG1 A;  2V2Q A;  4FBU A;  2FVC A;  4QU6 A;  2V4J A;  2VG7 B;  3P6Y C;  2QL7 B;  1RYS A;  1NK9 A;  1FKA F;  2HK3 A;  3OJS A;  2GHW A;  3SCJ E;  2ZKU A;  4DS5 A;  1K0V A;  5KG0 A;  5A8K A;  4NEY A;  5LRN A;  2O66 A;  2UUA F;  5G0R B;  4IH5 A;  3B6B A;  3MAA A;  4OYM A;  2XLJ A;  4DFP A;  5GAH I;  2ASD A;  4L3K A;  4RU2 A;  3TAM A;  2ZH9 A;  1GXU A;  4PG5 A;  2DNQ A;  4ED1 A;  2UUW A;  3PV8 A;  2CQD A;  4QCL A;  4QIE A;  2LEP A;  4DX8 H;  3ENV A;  3U27 A;  4P2F A;  3CD5 A;  2OHD A;  1WUU A;  8AT1 B;  1XN9 A;  5C7P A;  4C7Q A;  3PG9 A;  2A2C A;  2IYI A;  2BVZ A;  3X1L B;  4ZG9 A;  3M9O B;  5KTQ A;  2RIL A;  4DCO B;  3L7U A;  3M30 A;  1TVR B;  3S1T A;  2ZE2 B;  2MGZ B;  5C66 A;  1R8C A;  1SL1 A;  3T6B A;  3R5B A;  2XHC A;  4MFB A;  3V4M A;  4UST A;  3QO9 A;  2KHC A;  5KG4 A;  1RA7 A;  3PW5 A;  5J2N A;  1N54 B;  1RTD B;  1FJG F;  4WF9 Q;  2G0C A;  5KT5 A;  2OP5 A;  2Y1J A;  4FVM A;  2VQE F;  2J9D A;  5LM7 E;  2AJQ A;  3T19 A;  2BMB A;  3SCK E;  2BXJ A;  2I8E A;  1O51 A;  2BAN A;  1R0C B;  4JI0 J;  4CLP A;  3JXO A;  2R2R A;  5HRT A;  3ZZT A;  2IC3 B;  4Q0B B;  2EBG A;  4EU0 A;  5DGA A;  5DDR C;  1V3R A;  4K8R A;  4TY8 B;  1EJ7 L;  2D74 B;  2HHU A;  2CPD A;  5ETT A;  1TKT B;  3SZZ A;  2FUG 9;  5LSL A;  2RU9 A;  2IYG A;  3R27 A;  1FX2 A;  2DCL A;  4ZVS B;  1VBY A;  1U1R A;  3IM9 A;  1Q86 T;  2CPE A;  4DXL A;  2BEF A;  3CC7 S;  2VC1 A;  1XBW A;  4H4K C;  2XMM A;  1KHL A;  2OEK A;  4NLR A;  3GSI A;  3TYT A;  2UVU A;  3MWB A;  2C2Z B;  2GVZ B;  2XYH B;  5LL6 d;  1VCT A;  2QJ3 A;  4NLU A;  3WBZ A;  4L73 A;  1IKV A;  2IVM A;  4MMO A;  4M5G A;  5HP1 B;  1JLE B;  1VBX A;  3G6X A;  2HW3 A;  2JLE A;  5HMZ A;  4ECT A;  2ERR A;  2B6A A;  4CCH A;  5EWE A;  2LA4 A;  1GTE A;  4U95 A;  2BKP A;  2BUN A;  5E3C A;  1H38 A;  2W9B A;  2W5R A;  4KH1 B;  5HAT A;  2FGO A;  3BKF A;  3OBI A;  4PPD A;  1RT1 B;  2O67 A;  2P6S A;  1JNZ B;  1LFW A;  2OPP A;  1KP6 A;  1RZM A;  2CWX A;  2EG2 A;  4Y2I A;  1IBK F;  2E29 A;  1V5I B;  3FRZ A;  1U6B A;  2GIR A;  3FBB A;  1TFY A;  4D3G A;  3M8P B;  3D7S B;  5L1I A;  3UR3 C;  1SUQ A;  3LGN A;  5K8M A;  2ROE A;  4ILM A;  1JXV A;  2B56 A;  3MEE A;  1FRK A;  1S0V A;  5ITH A;  2B9W A;  3KK2 A;  2C2O B;  4CLY A;  2RDD A;  4UQG A;  3T5K A;  1HYS B;  4JV5 F;  3NKR A;  3I0S A;  3MXH P;  3QBC A;  2YKN A;  1WOO A;  2GFF A;  1AUK A;  4DPO A;  4QZV B;  2DR9 A;  3T00 A;  3I55 S;  5DJB A;  3JSR A;  3TEH B;  2IM3 A;  3HFV A;  2DIU A;  3T9N A;  3HDS A;  5IFM A;  1U1P A;  1F60 B;  3D0G E;  4PXC A;  2CPF A;  2KU7 A;  4ZGA A;  2FJE B;  1JLC A;  2B4O A;  4K4W A;  2BJD A;  1A7G E;  1WI8 A;  1YJU A;  5GOV A;  4DUT A;  2E5L F;  2IM2 A;  2KJV A;  4B3T F;  2XMJ A;  2ZHO A;  1TUG B;  4USM A;  1EW2 A;  4IG0 B;  3QIP A;  1HIY A;  2G2Y A;  3TA2 A;  4DG1 A;  2DK2 A;  2A0F B;  2P9G A;  3W5Z A;  1NHU A;  1TUV A;  5D78 A;  2OPQ B;  3M1V B;  4PXD A;  3U1L A;  4WK3 A;  2WHO A;  3Q86 A;  4LQ9 A;  4DR7 F;  5LXR A;  3ONQ A;  2HBQ B;  4Q44 A;  3OJU A;  1U1O A;  3QMQ A;  3ZNJ 1;  1ACM B;  1U26 A;  4NXN F;  3UWT A;  5HN0 A;  1SIW B;  2YNH A;  5CCL A;  3IWX A;  3TX8 A;  3J7Z 5;  2ZUG A;  3CDA A;  2OEM A;  3NCQ A;  1PAE X;  2XS5 A;  1OJ4 A;  4NLW A;  1H73 A;  1HHT P;  5DGB A;  1FDA A;  3GU0 A;  3OV7 A;  3U02 A;  2IDL A;  4F3O A;  4EMD A;  3HX9 A;  1WJ9 A;  3ZZZ A;  3JSM B;  4A8O A;  1WEL A;  2LDY A;  3SQG B;  3KUG A;  3MPU B;  4JI3 F;  2QA2 A;  1YIJ S;  1G6B A;  1I51 B;  1XR6 A;  3PKM A;  5IM0 B;  1KKH A;  2DNR A;  3M6V A;  4DV5 J;  4Y28 C;  4WE1 A;  4A8Q A;  1N2L A;  3QRP A;  3FRY A;  3M6X A;  4USW A;  2LU2 A;  4AL7 A;  2E1C A;  1SH0 A;  4HKQ A;  2VD3 A;  1FX4 A;  1KR4 A;  1MU2 B;  4UPL A;  5J2P B;  2YNI B;  2VPX B;  2RF2 B;  2XZW A;  1N2K A;  1VI7 A;  3OXL A;  3BH6 B;  2CJX B;  1U47 A;  4TQR A;  1P6T A;  1VRT A;  3MEC A;  4IRK A;  3KNG A;  2M3D A;  1QAJ A;  4ED7 A;  4NCG A;  2ZBP A;  3L7O A;  4IH6 A;  2R7S A;  1HMV B;  2VF3 A;  4LSZ B;  2ZJR Q;  3MAH A;  3T1Y J;  2L9N A;  3N79 A;  5LIA A;  2GIF A;  2CPH A;  4RWW A;  2PI4 A;  1MRO B;  1IQT A;  1ZET A;  3C3L A;  3WAX A;  2ZWO A;  4OI3 A;  3UDE A;  2W8S A;  3LAL A;  3K89 A;  1TZ0 A;  3BR9 A;  1CUL B;  4CYU A;  1C4C A;  4JV1 A;  1K7H A;  3X3U A;  4V19 X;  3LXQ A;  4Y34 A;  4AXI A;  2FZK B;  2PMH A;  1J27 A;  1OS5 A;  3HT0 A;  2QC3 A;  1RAG B;  5BR8 J;  4DX7 A;  2N4C A;  5F8H A;  2DXE A;  2R8J A;  1H6K X;  2OIH A;  3GWC A;  4DV0 F;  3DRX A;  1ZPW X;  2M4M A;  4AUK A;  3D6H B;  2ZEJ A;  3M8R A;  1X5O A;  2O1P A;  2A2D A;  4F3M A;  4X4O A;  2HHV A;  4UOF A;  4DPW A;  4B3M F;  4HEA 9;  4M94 A;  3A8I A;  2EK1 A;  2BKO A;  5LJ5 Y;  2X98 A;  2J6S A;  4HL9 A;  2YKP A;  5JXS A;  2XRG A;  4F4K A;  1D09 B;  4DR3 J;  2BZ2 A;  1W25 A;  2YX1 A;  2EBE A;  3C6U A;  1XNQ F;  1W2I A;  1PYO B;  1RAF B;  4ED8 A;  1ELO A;  4ERD A;  1AUS L;  1E33 P;  2HND A;  4F4A A;  2WVE A;  4QYZ J;  3JSY A;  2BM0 A;  3I5C A;  3MFI A;  5THW A;  2IIH A;  4B02 A;  3QGP A;  1REV A;  2XQC A;  1X4G A;  3KK1 A;  4LJM A;  4IRC A;  3H8Y A;  2FVR A;  1NK4 A;  4IFV A;  4M5I A;  2DO0 A;  1RWX B;  4NZ0 A;  4DJB A;  2WK4 A;  3AB4 B;  1TMM A;  3K17 A;  1MN7 A;  3BSN A;  4MTP A;  2W7P A;  4LF7 F;  1TL7 B;  1FEE A;  2WB4 A;  5E7O B;  3GJT B;  2ZOG A;  5HK4 A;  1NLK L;  2GMJ A;  2KM8 B;  1NHV A;  2NXJ A;  3EUN A;  1WTB A;  2Q6C A;  3HHL A;  4ZCL A;  4R25 A;  1TAQ A;  2JEJ A;  2LKZ A;  1JIH A;  4MYU A;  4JBC A;  3PYD A;  2AP6 A;  5IT9 Y;  3IRX B;  4Q8F A;  3J80 Y;  3RW7 A;  1T9T A;  1R89 A;  4YQW A;  4KQZ A;  2E7V A;  3GJS B;  2C1E B;  1GXL A;  2Q1L A;  3MED A;  4UZC A;  2KXF A;  2L41 A;  2QE5 A;  3A1Y G;  2KJW A;  5F0W A;  4PEO A;  2HFU A;  4Y2A A;  4ZPC A;  2JC0 A;  4DV6 F;  4C48 A;  3UD5 A;  1K73 T;  2R2S A;  4CO0 A;  2Y8Y A;  1BQX A;  4UTG A;  3D2W A;  4RU9 A;  1WF2 A;  1KTQ A;  2BKN A;  4ZVQ B;  3RBE A;  2DNM A;  4DQQ A;  5HVG A;  4HYK A;  3QRQ A;  5IC6 B;  4F2R A;  2KFN A;  2YKQ A;  3MMA A;  2Q43 A;  4OHY A;  3BEG B;  2AMC B;  2R2T A;  3FFI A;  3O44 A;  2R7V A;  1UW4 A;  2VDI A;  4QW8 A;  4OHV A;  2MPU A;  2WON B;  4CM0 A;  5A8W A;  2BJ3 A;  2F5G A;  2QV6 A;  5GVQ A;  3F41 A;  2A18 A;  3G71 S;  4YB1 P;  2M2B A;  1NK5 A;  3RYL A;  2HRY A;  4QR1 A;  3Q8Q B;  2XHW A;  3FDS A;  1ZM2 A;  4BS2 A;  2DR6 A;  1JJH A;  4I68 A;  2NYH A;  2YH0 A;  4LFB J;  3QSY B;  4LF8 J;  1UVM A;  5F3Z A;  4U7C A;  1NJW A;  3DMJ A;  1IBL J;  1VLY A;  1NPP A;  2NUU G;  5B0E A;  4QIG A;  1TL3 B;  2YNF A;  2GZO A;  3BO3 A;  5K20 B;  3E3X A;  2FB0 A;  3QPI A;  3NLC A;  4KFB A;  2AYG A;  3QRR A;  3I32 A;  3ENW A;  3BS9 A;  4LF4 J;  3EIC A;  4USH A;  1RHJ B;  3T5L A;  5KG6 A;  1Q5Y A;  2RSQ A;  2I38 A;  2G1D A;  4PCQ A;  5M2P A;  1HBO B;  2VOD A;  4LR9 A;  3V6D A;  2HNZ B;  4UY8 5;  3I4H X;  3ET6 B;  1NHK L;  3TVZ A;  5HQM A;  2KRB A;  3H7H B;  4EGL A;  4A8X A;  1FTR A;  2WW4 A;  3M32 A;  1LNQ A;  5KFU A;  3TZX A;  3V4I A;  3G82 A;  1N6Q B;  1CPZ A;  4ES1 A;  4TNO A;  8ATC B;  3K5M A;  3RB3 A;  5C2C A;  4ZP6 A;  3HJF A;  4Y3C A;  5BYQ A;  3D1H A;  1T03 B;  4QYZ K;  1NCL A;  3TVK A;  1ELZ A;  3OTC A;  1DBD A;  4OV6 A;  3N28 A;  3D54 A;  1FJE B;  2ZBR A;  2W25 A;  5C42 B;  1N33 F;  1HQA A;  4PWD A;  5J2Q A;  1SQG A;  3SYZ A;  1NME B;  3BSO A;  3MR2 A;  4K59 A;  4USK A;  3OR1 A;  4WPA A;  2YNG B;  4J9N A;  1JXE A;  3TAQ A;  4DFM A;  2KVQ E;  1AZS B;  3OSN A;  4GO7 X;  2M8H A;  3EZO A;  1V3Z A;  1K0T A;  2DGS A;  3QAT A;  1N48 A;  3NAH A;  2N3L A;  2X1A A;  1WAC A;  3GYX B;  1U6F A;  2A1B A;  2NZ4 A;  3G8Q A;  3OFG A;  1VQ7 S;  1YRX A;  3C14 B;  4DQS A;  1DTT B;  1DAR A;  2DCU B;  4FF1 A;  1AB8 A;  2WSC C;  1B7Y B;  3DDN A;  1MWQ A;  2FJV A;  1KDN A;  5I42 A;  3LOU A;  2XBP A;  2WBM A;  2YWW A;  1LFP A;  2VZ9 A;  2EFV A;  3OTO J;  1QLN A;  4QJV A;  2ZDP A;  3R7B B;  4OZJ A;  1FI4 A;  2CVE A;  2CQC A;  3QJJ A;  1GXT A;  4B9M A;  2VON A;  2AGP A;  4OYO A;  1KQF B;  4HI1 A;  4PXE A;  2DHS A;  1J2V A;  1CJT B;  1UVJ A;  3GCW P;  2MJN A;  4URS A;  4PZV A;  3UNY A;  5L0E A;  4PUO B;  3QNW B;  2ZC3 A;  3FNN A;  3M2R A;  3NNH A;  2E5H A;  2MZS A;  1XR5 A;  2KYZ A;  5KG1 A;  1Q16 B;  3M8S A;  4AYB D;  2OPS A;  3HT3 A;  2KZM A;  1RUS A;  4UQT A;  4DS4 A;  2J8S A;  4BWJ A;  4LFC F;  4ZCI A;  4LFA F;  1RT5 A;  2UUT A;  4OHW A;  1C4A A;  1VQ4 S;  1Q8L A;  5AXL A;  3MEG B;  1F3V A;  1ZEF A;  1RWW B;  3H98 A;  5AJ3 F;  4Q5V A;  1R0A B;  1RTH B;  1XTZ A;  1S57 A;  4IH7 A;  1WG5 A;  2VJU A;  1PO6 A;  3AOB A;  3G6Y A;  1RE1 B;  1LWC B;  2LLZ A;  3NY0 A;  1F9E B;  1YBU A;  2IRX A;  2QEX S;  4DQI A;  3LTO A;  1NAQ A;  5DRK A;  2AJ0 A;  1RWM B;  4CLT A;  3R7S B;  4CP5 A;  1YDL A;  1ALI A;  2QA1 A;  1GH8 A;  1VRU B;  2GSO A;  2LMI A;  3AY0 A;  2DKO B;  1VC0 A;  3J7Z T;  3C6T A;  4FNI A;  2HNY B;  2XTJ P;  4QIV A;  3MCO A;  1UZD A;  1RTI A;  2HWT A;  4M5D B;  2BE2 B;  1PIL A;  5T41 A;  1T3N A;  2ZD1 A;  5CYQ B;  2UXC F;  3JTO A;  1T05 A;  1OY6 A;  3L4B C;  2BW2 A;  3A8J A;  4OMF G;  1HW9 A;  1LW2 B;  2KXH A;  3ZZU A;  5A76 A;  4LF9 J;  4CQ1 A;  1KLM B;  2JC1 A;  2ZDO A;  4J9S A;  4KM4 A;  1YRT A;  3C66 A;  3W5Y A;  4P2X A;  2E66 A;  2H5J B;  3DM2 B;  3TAN A;  5E0O A;  2F8M A;  2CAD A;  2F7V A;  2PII A;  2EFP A;  3PW2 A;  5JUM A;  3GJR B;  4EWT A;  1K1Q A;  3DDI A;  2OMO A;  1LXN A;  1HWK A;  1S6Q B;  4ZN3 A;  4XDD A;  1JLF B;  1SH2 A;  5F8G A;  4Q45 A;  3EPI A;  3K7R A;  3DXS X;  4DX6 A;  3SXL A;  2KM8 C;  3FK4 A;  3BPD A;  3OPK A;  1C0U B;  2C2R A;  4ETZ A;  5L39 A;  1RAD B;  4LIW A;  4MH8 A;  2FJD B;  4O3R A;  4U6P A;  3BDF A;  5T7L A;  2V4J B;  1ALH A;  4ZPA A;  4DU8 A;  1SJ4 P;  1QAY A;  3QYY A;  5A8K B;  4YUD A;  4PYD A;  5DG9 A;  4DSL A;  1S4F A;  3MCN A;  1URB A;  3MAA B;  2UV8 A;  1HL6 A;  2ZH5 A;  5BYR A;  4YR2 A;  2YXL A;  2ZFH A;  2VDH A;  3TUZ C;  5EGE A;  4S0M A;  3OD2 A;  2OSQ A;  4FXV A;  4OZ2 A;  4ES3 A;  3CCQ S;  4DR2 F;  1RT7 A;  1RWV B;  4QR0 A;  2ZM6 F;  4M5K A;  2IA6 A;  3NKO A;  3CSK A;  5JVG Q;  3NCP A;  5KFW A;  2DGU A;  1OMS A;  1CJK A;  3MK2 A;  3M30 B;  3HVA A;  1AXQ A;  1DJ0 A;  4E2F B;  3VAI A;  3C16 A;  4IFY B;  2ZH2 A;  2CNL B;  3IC1 A;  1TV6 B;  1RWO B;  1PKU A;  5AXN A;  4FS1 A;  4RBU A;  1S1W A;  4LR2 A;  3L9Z A;  4WFB Q;  3HZG A;  1BE4 A;  3TG0 A;  5G4D A;  1YG0 A;  1SHN A;  1Y00 A;  2BAN B;  1SH3 A;  2PDA A;  2JDJ A;  4TLR A;  2OH2 A;  1X4H A;  4ZMM A;  5JMN A;  1Q5V A;  4LT6 A;  3GR1 A;  5HJY A;  4E8U A;  4EO8 A;  4R5P B;  1ZM3 A;  2AD9 A;  1WG4 A;  3D67 A;  2UUA J;  1CQN A;  1Q4R A;  4HAC B;  1YZ7 A;  1RBO B;  2OUG A;  3B82 A;  2F3J A;  2NRE A;  3VHQ A;  1VQN S;  3N5F A;  2FTR A;  3BYP A;  4X4U A;  1N5Q A;  2PN6 A;  3IMQ J;  3PW4 A;  4DSK A;  2KDO A;  3KG1 A;  1RXO B;  3HVW A;  5F41 A;  1TR0 A;  4OIX A;  4CT9 A;  5L1K A;  3Q2T C;  1GK8 A;  1WSV A;  2CNK B;  5DLV A;  1KC8 T;  3M9M B;  3RBX A;  5B0C A;  2QYC A;  1AA1 B;  4ZCM A;  1T11 A;  3IWL A;  2JEF A;  1UTA A;  3D1Q A;  4F25 A;  5FLX Y;  3T5H A;  4IR1 A;  1IWA A;  3ZZY A;  2F40 A;  4LVN P;  2VKZ G;  3OL6 A;  2DNN A;  2VA3 A;  4QQB A;  2MQQ A;  4Y00 A;  2XMV A;  2YKM A;  1S7I A;  4J7C A;  1FJG J;  1UCN A;  1E1Z P;  3K58 A;  3ITH A;  3UN2 A;  2FQQ B;  3DYA B;  2OPP B;  3MMC A;  2CQ1 A;  3EXC X;  2VQE J;  1DQA A;  2QL5 B;  4BLG A;  4XIU A;  1FK9 B;  2Z2L A;  1P27 B;  2HBZ B;  2ASJ A;  1RP5 A;  4RPF A;  3MEE B;  1QD1 A;  6FD1 A;  3I56 S;  1JLA B;  4DV3 F;  2WTF A;  1T94 A;  4OI0 A;  2V2V A;  4JI4 F;  3I0S B;  2GJI A;  1AW0 A;  3K8W A;  4C98 A;  2YKN B;  2Z58 B;  1PG5 B;  4BHQ A;  3V6K A;  3Q22 A;  2NZC A;  5M2U A;  3NG8 A;  4ECW A;  4C0H A;  4M1K A;  1EB0 A;  1XQI A;  3CME S;  3HSJ A;  2K3K A;  3OL7 A;  3DU6 A;  3IP0 A;  1SPB P;  1E6V A;  1EKR A;  2DNG A;  1M1G A;  1U6Z A;  4C8Y A;  4RJV A;  1RK8 A;  3A52 A;  1DQ8 A;  1JLC B;  1HQU A;  3B4D A;  2X51 A;  4JP8 A;  3A13 A;  2HKE A;  3VF0 B;  2W9C A;  4LF6 F;  5D4P A;  1YBT A;  4NLX A;  4QIW D;  5DM6 Q;  3LAK A;  1AJC A;  4NMX A;  3I4P A;  4Q8E A;  1IWG A;  1VQK S;  4IKA A;  1IKW B;  1EKS A;  3KK3 A;  5HRO B;  4IRD A;  1C0T A;  3JB9 k;  1NBE B;  4B9T A;  4MHX A;  4KAY A;  5IC4 B;  5A8R B;  5KOX A;  4NI2 B;  1TTH B;  1XMO F;  3KLG A;  4EBD A;  3QT5 A;  3DRP A;  3C2P A;  4AXJ A;  1H3D A;  3JTP A;  3N0V A;  2WSE C;  4X4P A;  5A2Q Y;  4DF8 A;  2IVY A;  3DRY A;  1HQE A;  2XYP B;  3UVJ A;  1WHW A;  2WCX A;  1IBK J;  2PMW A;  3TEG A;  2V5H G;  1IBC B;  2AV5 A;  4YR3 A;  5CD4 H;  4B17 A;  4RX6 A;  3GIM A;  2ZOF A;  2FD2 A;  5HAN A;  1UFW A;  5D77 A;  4R8U B;  1KRP A;  1LXJ A;  4O0I A;  1F2G A;  3OVA A;  4QWE A;  4JV5 J;  1TKX A;  3KLE A;  2ZH4 A;  3WBH A;  2EW9 A;  3JS9 A;  3EDQ B;  4L3N A;  1IKY B;  4ZP7 A;  5LRM A;  1NZ8 A;  4Y6I A;  2IAJ A;  2MB0 B;  3U1M A;  4MJK A;  3CIZ A;  1WC6 A;  2A10 A;  2C2K B;  1Q8K A;  4AD6 A;  2UXD F;  1N32 F;  1JWW A;  3VAG A;  4ID8 A;  4ZIW A;  2HBY B;  4QR2 A;  4KGM A;  4DUZ F;  1FKO A;  5CZV A;  1UAW A;  3I5B A;  4KIA A;  2E5L J;  1D9A A;  3LWL A;  1LW0 B;  2WBR A;  1HNI A;  4B3T J;  3ICL A;  1S97 A;  2KN4 A;  2VG5 A;  1U1Q A;  5HLF A;  4QAX A;  4LUB A;  1QTM A;  1BY9 A;  1VRT B;  3MEC B;  3G2X A;  2YWE A;  2YH1 A;  2E7W A;  2F8E X;  5RUB A;  8RUC A;  2HQF A;  2JFD A;  1SB6 A;  2OTJ S;  1U1N A;  1HDH A;  4KHP F;  3R5J B;  2HIY A;  3H4D A;  2R8G A;  1S5Z A;  2EFG A;  3SCI E;  4I2P B;  1M5O C;  3BDE A;  4XO0 A;  4DR7 J;  2ZZT A;  4URQ U;  2FHK A;  4NYO A;  4X62 F;  3D6T B;  3QZ7 A;  3EE3 A;  3Q2S C;  2OEL A;  1BWV A;  4Z7C A;  4C8O A;  4N47 A;  4NLT A;  1TK0 A;  2G1H A;  4WFA Q;  4NXN J;  4ZVE A;  1SKR A;  2HPU A;  1ROF A;  3SQO P;  5IJQ A;  2J9D E;  4CYU B;  4O3O A;  3G9C A;  2M8D B;  1XJW B;  1HHS A;  4F8R A;  2YVS A;  2KHD A;  4N8O A;  1FDB A;  3MDF A;  3OLA A;  2KXN B;  1IM6 A;  3IR7 B;  1FCA A;  4ECY A;  4Y2C A;  4B9V A;  2HGN A;  3S7R A;  4GC7 A;  2BOP A;  1RBL A;  5GRR A;  3R2D J;  4OZN A;  4TQS A;  2R7U A;  4JI3 J;  2APO A;  5D0R A;  3TJA A;  2WAQ D;  3OUY A;  4LMZ A;  2FPH X;  1HNW F;  2POK A;  4DR1 J;  1HBU A;  9RUB A;  3A3N B;  1D1U A;  3KG4 A;  2ASL A;  2N3O A;  5ETO A;  5KFO A;  3GV7 B;  2XS7 A;  1U7L A;  3T3F A;  2AZ3 A;  2P5V A;  3PYE A;  2MZT A;  1SJ3 P;  1EP4 A;  1U4B A;  1AJD A;  2F4F A;  4LSN A;  2FC9 A;  4ID5 B;  1LWF B;  2PFF B;  1N8R T;  1Y10 A;  4K50 A;  3K57 A;  3RB0 A;  2DGW A;  2J6U A;  4LRC A;  2E5G A;  2BBE A;  1XMQ F;  3KK1 B;  3ETO A;  3Q24 A;  3BGR B;  4C4W A;  2J0Q D;  3CJ4 A;  3W64 A;  3J7Y U;  3D0H E;  3HCX A;  3RGI A;  4ALZ A;  2FVQ A;  2BW7 A;  2E5I A;  2VPY B;  3LP2 B;  4Q2M A;  4W90 B;  5F8J A;  4K2J A;  3R2C J;  2C2D A;  4C0B A;  5IT9 U;  3DHX A;  4ES2 A;  5K5M A;  3GFY A;  2F65 A;  1RBA A;  1WF0 A;  2VH7 A;  1UA1 A;  1IQZ A;  2XMW A;  4ELV A;  2HQD A;  1WDT A;  4UUX A;  1TKZ A;  2GGP B;  2CVI A;  2ZZN A;  4DV0 J;  3FMW A;  1X4D A;  2J7W A;  4ZVG A;  2IUC A;  2CXE A;  2HVZ A;  3DRR A;  2PA8 D;  3R7N B;  2QZ8 A;  4WFX A;  4G1Q B;  4B3O B;  1YRU A;  4FF4 A;  4B3M J;  2CYY A;  2YQ1 A;  3NMR A;  4B9S A;  3BPS P;  2IRU A;  5EHH A;  1XNQ J;  4KGV B;  2MDA A;  3GSD A;  3IGN A;  4K7Q A;  3MM9 A;  3B78 A;  4TY9 A;  4XDC A;  5K4P A;  1U45 A;  2CNN B;  4X65 F;  1QUV A;  4MKY A;  1EJJ A;  2QRR A;  4FF2 A;  4OI2 A;  4HHJ A;  4CT8 A;  2DXF A;  2BJ9 A;  4WKR A;  2AYE A;  3MMA B;  1H74 A;  3FCW A;  2DR7 A;  3DLG A;  4ZVT B;  4K0K F;  1WWH A;  4PG6 A;  3FFI B;  3G86 A;  2KZZ A;  2V4R A;  1PSD A;  3FCH A;  3J81 j;  1U8S A;  4LF7 J;  1KHK A;  4ZPW R;  2OPR A;  2ZKT A;  2QA4 S;  2HS4 A;  1G7C B;  2KT3 A;  2GQC A;  1ZS6 A;  4O44 A;  5F9L A;  4WXO A;  3ADA C;  4QW9 A;  1S9G B;  1JKH B;  2M52 A;  3OL9 A;  5AJ9 A;  4RW8 B;  5I3P A;  4RKU C;  4NZ7 A;  2QMU B;  1KH7 A;  1M1K T;  4OHX A;  3NOC A;  3W9I A;  2MQN A;  3NP5 A;  3W5X A;  3DLB A;  2W5Q A;  1IN0 A;  2DR8 A;  2B0G A;  4KV8 B;  5F8I A;  2ZBI A;  2YNF B;  2J7U A;  2RIJ A;  4UOR A;  1FWL A;  1SI9 A;  4TVA B;  4MK8 A;  4KFB B;  4CLU A;  2N7Y A;  1YJW S;  3WHI A;  1MN9 A;  3CGI A;  5D0G A;  1NDP A;  2LFV A;  4N8N A;  3ZC4 A;  2BJE A;  4DV6 J;  5KFV A;  1GMV A;  1Y5I B;  4BDP A;  2G2Z A;  1K47 A;  3HD1 A;  3I6P A;  4X64 F;  3UCG A;  1F3F A;  2BJ7 A;  3MHY A;  3G82 B;  2FLN A;  4A4J A;  4O3P A;  1KNZ A;  4CLL A;  2HG4 A;  1G3O A;  2OI2 A;  2ZBQ A;  3PRB A;  3I0R B;  3E2D A;  1FXR A;  1Y3J A;  2QLX A;  4LF8 F;  1Y4Z B;  1TKD A;  3DOK B;  3EPG A;  2DY9 A;  3KJQ B;  1FEH A;  1PYT A;  2BQR A;  2GW8 A;  1TEL A;  2D69 A;  3U7J A;  1ED9 A;  5ETR A;  3AOC A;  3C15 A;  3OR1 B;  1DLO B;  2R7T A;  2LYV A;  9ATC B;  3KLF B;  3MUR P;  4DR5 F;  4U8Y A;  5HBM B;  4LF4 F;  3SFU A;  4WXW A;  2M5Y A;  1SC4 B;  2W5W A;  1Z1Z A;  4ECZ A;  3JTN A;  2HEK A;  1HNZ J;  2GQQ A;  3FBC A;  4OZ0 A;  2IFX A;  5D15 A;  4NA1 A;  1FSU A;  1URN A;  4CH1 A;  5C25 A;  5HI7 A;  4DL5 A;  4FXW A;  3DLE A;  1H98 A;  2ZH8 A;  5ETV A;  5HVH A;  3IS9 B;  2ZH3 A;  3QGI A;  4KKO A;  3VGT A;  1U49 A;  3IN5 A;  1JJ4 A;  3K8V A;  1LWX A;  4UOC A;  2UZA A;  1FKP A;  3AQP A;  1NJI T;  1IJF B;  3RB4 A;  4RUA A;  4ANC A;  3MTK A;  1UVI A;  4GVB A;  3NGR A;  3KJV A;  2G0I A;  2CZ9 A;  2J8A A;  2XUL A;  4P6Q A;  4P7V A;  1L3S A;  2NSC A;  4MK7 A;  1VJW A;  3TR5 A;  3AHP A;  2FY1 A;  2M0G B;  3K0J A;  1FRI A;  4C3K A;  4J9K A;  4DOZ A;  1N33 J;  3KHH A;  4IDK B;  3ZXW A;  2OPS B;  3CCV S;  3D5M A;  3Q3Q A;  3THP A;  1T95 A;  1RAI B;  5A0Y A;  1IVZ A;  3NKN A;  4EBC A;  1Q79 A;  1RT5 B;  2VJV A;  4C11 A;  2OFG X;  2DRA A;  1WD6 A;  3MI7 X;  2BX6 A;  3KUH A;  2MXY A;  2ZZM A;  1RAJ A;  1DTQ B;  2LXU A;  3CTR A;  1M90 T;  2P2C B;  2ATC B;  4KH0 B;  1YI2 S;  2X3D A;  1JLB B;  4LRA A;  3OTO F;  3OR2 A;  2AQ4 A;  2D41 A;  2U1A A;  2RML A;  1VC6 A;  3ISN D;  2RE1 A;  3RR7 A;  5CAA A;  2UVV A;  2VUG A;  2PI5 A;  1B99 A;  2XSF A;  4AT1 B;  4O3Q A;  4ECR A;  2KFY A;  1P8G A;  5KT4 A;  2HS0 A;  2C28 A;  5GAG I;  1NDK A;  2CJB A;  1RTI B;  1FTC A;  1N34 F;  5B0B A;  5CH7 B;  3RAM A;  2XLI A;  3CCT A;  3CUL A;  3EVO A;  3HPO A;  2DPJ A;  2NXN A;  2UUC J;  2DH7 A;  2Z30 B;  1NXI A;  3AD9 C;  4OI4 A;  1YHQ S;  3M8Y A;  1MWZ A;  1JJC B;  2BQU A;  2AW0 A;  3OLB A;  3O2I A;  2BV3 A;  1Q0N A;  2HYI B;  5KFP A;  1XC9 A;  5KFF A;  3K5L A;  1B0P A;  4QWA A;  4RNH A;  1EQJ A;  2BRK A;  2VPZ B;  4LFC J;  2HMI B;  3TI0 A;  4LFA J;  3MM6 A;  3GP9 A;  4C3M A;  5U47 A;  5A6P A;  2E5J A;  4DPT A;  2P8I A;  1LK7 A;  4CTA B;  5AJ3 J;  3HHL C;  3AJ1 A;  1RHR B;  4J9R A;  3ILJ A;  4TN0 A;  3OVS A;  3AH6 A;  2RD5 C;  1KVI A;  3DFE A;  1Q8B A;  3DOL B;  1VR6 A;  4CXU A;  4USV A;  4XPC A;  2LQJ A;  1QSS A;  1E3C P;  1U1K A;  2M7S A;  4F50 A;  3CCS S;  4U96 A;  4NLO A;  3R5C A;  3D6F B;  1FVS A;  1MMD A;  2AT1 B;  2VBY A;  3LGH A;  4KAV A;  2F4V F;  4LRF A;  2J76 E;  4TU9 A;  2YY3 A;  3PTW A;  3VWS A;  2HWI A;  2N4D A;  4ZKA A;  4ZPD A;  2RH3 A;  1BQN B;  4YY3 F;  1Y6V A;  1Y5L B;  4IOB A;  1RTJ B;  1B70 B;  1BHN A;  3BGO P;  3FSX A;  3ZNU A;  3LP1 B;  4DI6 A;  1DFD A;  1N0U A;  4O3S A;  3VAJ A;  3UD3 P;  2QYG A;  2L48 A;  2K1R A;  5E41 A;  4JV2 A;  3MMJ A;  4NE9 C;  4Y2M A;  4FPR A;  4GTX A;  1T02 A;  3TWZ A;  2NPF A;  1WOP A;  3BN7 A;  1CJK B;  2GLQ A;  4NRU A;  1Q7L B;  4NML A;  4JI8 J;  4ICL B;  1N88 A;  3AOD A;  2K7J A;  3Q89 A;  2PD1 A;  2HHH F;  4IOA Q;  1IR2 A;  1F5C A;  2AX0 A;  3BBF A;  3MTJ A;  3VAF A;  2G9O A;  4NWJ A;  5HMW A;  3FEZ A;  1BUX A;  3W8P A;  4TXS A;  1VFJ A;  1X9W A;  4N77 A;  1HD1 A;  1A0O B;  3WX4 A;  1BMQ B;  3HD2 A;  3CDU A;  1TVR A;  2NS1 B;  1ZH5 A;  1FFG B;  2ACY A;  3F44 A;  1CSJ A;  1EZZ B;  3PZP A;  3HKZ D;  2W5S A;  1DHM A;  4ZS6 A;  1G2E A;  1UEV A;  4CXS A;  4K4Z A;  2X1B A;  1KOO A;  3F0N A;  2EFN A;  3P8B B;  1RTD A;  5HL7 Q;  3FQK A;  1D8Y A;  3LH2 S;  4F04 B;  5LMU F;  3MPV A;  4RUC A;  4Y2K A;  1LV5 A;  4AL5 A;  3NCR A;  1L3U A;  2JEG A;  1BGX T;  1DAX A;  3UQS A;  2ILZ A;  5AXK A;  2XSJ B;  1YTY A;  1PC4 A;  4IOC Q;  4HDG A;  1WHY A;  5F3T A;  3CC2 S;  5KFL A;  4O4G A;  1X4E A;  4Q0B A;  5FLX U;  4DR2 J;  4FBT A;  2ZM6 J;  2RHQ B;  2JWN A;  4DPX A;  1S1U A;  3KXD A;  1XER A;  1FFS B;  3MM8 B;  2LA6 A;  3BQ1 A;  2XI2 A;  2W4C A;  4CH0 S;  3VAL A;  2E1A A;  1R3N A;  3NGU A;  1W26 A;  2XMK A;  4X2B A;  2EWH A;  4PG8 A;  5E2Q A;  4AND A;  3FKB A;  4CLK A;  3Q8U A;  4DV1 F;  4P73 A;  1WC5 A;  2ADB A;  1AJA A;  5KFK A;  4ZG7 A;  4IR9 A;  1O8B A;  5HP1 A;  2DJW A;  1LEO A;  4K5R A;  1JLE A;  3MMC B;  2PEH A;  3OFF A;  2JEI A;  3OHB A;  4F26 A;  4YDX A;  1T9V A;  1DY3 A;  2OGU A;  1HWI A;  3FQL A;  5K9F A;  3KD8 A;  3EMT A;  4UOP A;  3D1O A;  4I69 A;  1HBM B;  2HHX A;  2CQ4 A;  3SV3 A;  3DN9 A;  2E9Z A;  2PT0 A;  4X84 A;  4BC9 A;  1PAU B;  5CXT A;  1Q81 T;  2QGF B;  2VFU A;  2DGV A;  2FLP A;  4ECV A;  5IT0 A;  4LF2 A;  1XNR F;  1RDR A;  1D9F A;  4K4U A;  3ULH A;  3TP2 A;  2W2P P;  3M8P A;  4PAA A;  3NGS A;  2K06 A;  1R6Y A;  1KHW A;  2OLW A;  3DPC A;  4M5N A;  1S72 S;  4IYQ A;  1NK7 A;  2H4W B;  4DN9 A;  2DEI A;  1PBA A;  3RG6 A;  4Z37 A;  2W9C B;  4I4B A;  3HJV A;  1NU4 A;  2YBV A;  5A2Q U;  1ANI A;  4RW6 A;  1UVL A;  2DRB A;  2B7B B;  1HAR A;  3KK3 B;  4ZIV A;  2FJB B;  4H4M B;  4B9L A;  1ELY A;  5DLT A;  1C0T B;  3L95 X;  3M6U A;  1C1C A;  4LF1 A;  2R9L A;  1S6P A;  2WVD A;  5ETN A;  3DRP B;  2V8H A;  3J7A N;  5KFS A;  2CPI A;  2D9O A;  4ECX A;  2H3E B;  1OWX A;  2EC2 A;  2R8K A;  1YK9 A;  5HJX A;  4OX9 J;  4KGZ B;  2H4Y B;  1HQE B;  3MR3 A;  1P1T A;  3PKY A;  4WU3 A;  1N5V A;  4DSF A;  4W4M A;  4FNH A;  5IQ6 A;  3D68 A;  3HVT A;  5J1E A;  1RLD A;  2JX2 A;  1N56 A;  1S6U A;  4IG0 A;  1YGY A;  2FY8 A;  3BBB A;  4P72 A;  3DRS A;  2MJU A;  4DLE A;  3DLJ A;  2VU5 A;  4LR8 A;  3GPA A;  3DOM B;  4DV3 J;  4JI4 J;  1TKX B;  3IA0 A;  3KLE B;  4LVO P;  3G6E S;  4DL0 C;  2VG6 B;  4KSE B;  4MIB A;  2OPQ A;  1HWJ A;  3M1V A;  2JHE A;  2IAJ B;  3CIM A;  4FYY B;  2V69 A;  2RRN A;  2XWY A;  1QVF R;  4C8M A;  4DSE A;  4GTY A;  1KVJ A;  3KG0 A;  3S8S A;  3NGK A;  1ARO P;  5B7W A;  1S79 A;  2J9C A;  1DQ9 A;  2YPZ A;  2I1R A;  3G96 A;  2BR0 A;  1B7F A;  2BOA A;  1ICE B;  4LF6 J;  3RUB L;  2RKI B;  1RT4 B;  1FE4 A;  2AGO A;  3CJS A;  2VOO A;  4MKA A;  1ELX A;  5IOL A;  2FHM A;  2QMX A;  5GAD I;  1PCA A;  1EI6 A;  1UZH A;  1I6J A;  3PXG a;  4H4O B;  7FDR A;  4DQR A;  2VG5 B;  2PGC A;  1WHX A;  5L0K A;  4AE5 A;  1NB2 A;  1Q1K A;  4I67 A;  2EKN A;  4NLG A;  1XMO J;  3MFH A;  1HI0 P;  5SUH A;  3JSM A;  4DLG A;  3NKQ A;  3SQG A;  2MSS A;  3WDO A;  3FMB A;  2OAU A;  3LP0 B;  3P4U B;  2AHO B;  3PYG A;  2H9Z A;  4M95 A;  3W3S A;  3CE8 A;  3NWR A;  3EGW B;  3IG1 B;  2D7S A;  5I4M A;  1RGV A;  4OI6 A;  3B4M A;  3R97 A;  2PA3 A;  3GIR A;  1MU2 A;  3T02 A;  5J2P A;  3SEO A;  2VQR A;  1VQS A;  2U2F A;  3PJX A;  3H40 A;  2WOM A;  1OSC A;  3D3C J;  2Q6B A;  2XO6 A;  2RH6 A;  2GX8 A;  1OO0 B;  2BJ1 A;  3PFE A;  1FVQ A;  2HGL A;  5KFD A;  1X0P A;  3DC2 A;  3NKM A;  4TYA A;  2DPI A;  2ZWP A;  1HLW A;  2J7K A;  1KEK A;  2GS8 A;  5FDL B;  4OYB A;  4CDI A;  1MRO A;  3FVY A;  3W65 A;  3VZH A;  2EFQ A;  3Q83 A;  4BCA A;  5GMD A;  4ANE A;  4MK9 A;  2UXD J;  1OYD A;  1MNE A;  1N32 J;  5HSP A;  2B7C B;  3O8W A;  3BB5 A;  4K4Y A;  3MPW A;  4DV7 J;  4FF3 A;  2Y9H A;  3EGN A;  3OUY B;  4DUZ J;  2NLW A;  2YWF A;  2ZHB A;  3N01 A;  3V6H A;  3ILO A;  5K14 B;  1HBU B;  3PR5 B;  1S49 A;  1H2T Z;  3EGZ A;  3FZ2 A;  2MZR A;  1SL2 A;  2OJ3 A;  2V63 A;  3IBC B;  2ZJQ Q;  3MK1 A;  1B8J A;  2XB2 D;  4GKJ F;  2HWH A;  2AJ1 A;  3UN5 A;  5EGY A;  1R0B G;  4EO6 A;  2EFO A;  2DNK A;  1FJ7 A;  2IBO A;  4PKD B;  4DX5 A;  4LSN B;  2DNP A;  3BDG B;  4QWD A;  2Q3P A;  3EJM A;  2DB1 A;  1KD1 T;  2MKI A; 
#chains in the Genus database with same CATH homology
 1HJK A;  4LR7 A;  2RH6 A;  5LQQ A;  1KHN A;  1ZEF A;  1EJJ A;  2W5W A;  3NKR A;  4GTY A;  4UPK A;  4UOO A;  3BDH A;  1URA A;  4MIV A;  4UPH A;  4ZG6 A;  3WAV A;  3Q3Q A;  4FDI A;  5INH A;  4B56 A;  1ANI A;  3SZY A;  2W8D A;  5C66 A;  2QZU A;  2X98 A;  1AUK A;  1EW8 A;  1AJA A;  3CMR A;  3B5Q A;  3M8Y A;  4ZG7 A;  1AJB A;  3NKO A;  3NKM A;  4NWX A;  3T00 A;  1ELY A;  3T01 A;  5DLT A;  2XRG A;  3NKN A;  5GRR A;  1FSU A;  2W5S A;  4GTW A;  1Y6V A;  4CXS A;  1KH9 A;  4QAX A;  2GA3 A;  3IGY B;  3M7V A;  5LIA A;  1ED8 A;  3M8W A;  4LRD A;  2W5V A;  3MK2 A;  3UO0 A;  2G9Y A;  1KHK A;  1ELX A;  1ELZ A;  3DYC A;  1E33 P;  4ZGA A;  2ZKT A;  3KD8 A;  4UOP A;  1EI6 A;  5DLV A;  1EQJ A;  5LRN A;  4LRA A;  1ALI A;  5L0B A;  1ZED A;  3WAX A;  4CXK A;  1HDH A;  3OT9 A;  2W8S A;  5L0K A;  4CYS A;  1HQA A;  5IJS A;  4GTX A;  2D1G A;  2IUC A;  2GSO A;  1ZEB A;  3UN3 A;  1E2S P;  3BDF A;  3NVL A;  5GOV A;  4LQY A;  1Y7A A;  5HRT A;  1ALH A;  1P49 A;  2IFY A;  3TWZ A;  1KHJ A;  2W5R A;  5AJ9 A;  4GTZ A;  1ANJ A;  3UNY A;  2GLQ A;  5L0E A;  3NKQ A;  1ALK A;  1K7H A;  4LR2 A;  3WBH A;  4KJG A;  2W5X A;  1KH7 A;  1AJD A;  3LXQ A;  2ANH A;  3E2D A;  3TX0 A;  5LRM A;  2GSU A;  3A52 A;  4TN0 A;  3WAW A;  3IDD A;  3TG0 A;  1EW2 A;  3SZZ A;  2XR9 A;  3ED4 A;  4UPI A;  4FDJ A;  1URB A;  1SHN A;  2W5Q A;  4LRE A;  4LRC A;  2IUC B;  3NKP A;  4CXU A;  1ALJ A;  1E3C P;  1EW9 A;  4KJD A;  1O99 A;  3MK1 A;  1B8J A;  4LR8 A;  4CYR A;  1AJC A;  1ED9 A;  5IJQ A;  1N2L A;  4NWJ A;  3UN5 A;  2GSN A;  3MK0 A;  5KXA A;  1E1Z P;  3DPC A;  3T02 A;  5TJ3 A;  4UPL A;  2VQR A;  3WAY A;  4YR1 A;  1KH4 A;  1SHQ A;  4KM4 A;  4KAV A;  4MHX A;  3UN2 A;  1N2K A;  5DLW A;  5K4P A;  3IGZ B;  4LRF A;  4KAY A;  3BDG A;  3BDG B;  5EGE A;  4UOR A;  4LRB A;  1O98 A;  4MY4 A;  4N7T A;  1KHL A;  1KH5 A;  2W5T A;  4LR9 A;  4ZG9 A;  5EGH A;  3M8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...