4LREA

Phosphopentomutase soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lreA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lreA01
1E1ZP 3MK1A 4CYSA 2IUCA 4NWXA 2GSNA 2W5VA 3DYCA 1E33P 3OT9A 1E2SP 4TN0A 5GRRA 2ANHA 5DLTA 3NKMA 1N2KA 4B56A 3TX0A 4ZGAA 3NVLA 1N2LA 1KHLA 1ANJA 1HQAA 3T00A 3DPCA 3NKNA 1KHNA 4LR7A 4MY4A 3TWZA 1Y6VA 3T01A 3WAWA 4KJGA 1KH7A 3M8WA 2W5SA 1EW8A 5TJ3A 4ZG6A 1K7HA 1URAA 4MIVA 4LREA 2W5TA 2GSUA 2W8SA 3T02A 3WAXA 3M7VA 1ED8A 2GSOA 3IGYB 5LRNA 1SHNA 5LQQA 1O98A 2W5XA 3NKRA 4CYRA 1ED9A 1ELYA 4UPIA 1E3CP 2ZKTA 2G9YA 5IJSA 5K4PA 3WBHA 1KH5A 5INHA 1EW2A 5L0EA 3NKOA 3BDFA 2IUCB 3MK2A 3SZZA 3IDDA 3M8YA 3BDGA 5DLVA 4LRFA 1KH9A 4N7TA 1EQJA 1ELZA 4LRAA 4LR9A 1O99A 1HJKA 1ALIA 3UN2A 3NKPA 3WAVA 1Y7AA 4MHXA 5HRTA 1ANIA 2GA3A 5L0BA 4CXUA 4CXKA 2W8DA 4UPKA 5C66A 3ED4A 1URBA 5EGHA 1ALHA 3KD8A 3LXQA 4CXSA 4LRCA 4ZG7A 4FDJA 3B5QA 4FDIA 1AJDA 1KHJA 1ZEFA 4LRDA 1P49A 2XRGA 4NWJA 3UO0A 1ALKA 4GTXA 4UPLA 1KHKA 4KAYA 4LRBA 4GTZA 1ALJA 4UORA 4GTWA 2XR9A 1FSUA 3UNYA 4LR8A 2IFYA 5LIAA 3CMRA 4KJDA 3MK0A 4LQYA 1AJBA 1EW9A 3BDGB 3BDHA 1HDHA 3UN3A 1ZEBA 4GTYA 1SHQA 4UOOA 5KXAA 4KM4A 2GLQA 4LR2A 2W5WA 5AJ9A 5DLWA 1EJJA 3M8ZA 2D1GA 2QZUA 1AUKA 1AJCA 4KAVA 1ZEDA 4UOPA 5L0KA 1EI6A 3NKQA 5EGEA 2X98A 5GOVA 3UN5A 4UPHA 3SZYA 4YR1A 3A52A 2RH6A 1KH4A 3E2DA 1B8JA 4QAXA 1ELXA 1AJAA 3Q3QA 3WAYA 4ZG9A 3IGZB 5IJQA 2W5QA 2W5RA 3TG0A 5LRMA 2VQRA
chains in the Genus database with same CATH superfamily
3Q24A 2Q6CA 2K3IA 3K7RA 4C8OA 3OTCA 4FF2A 2HGLA 3TAMB 2AEJA 3SFGA 1RU2A 2N4CA 2E1AA 2XNRA 3R1HA 2MQMA 2YKNB 1HNVA 3DGVA 4B3OB 3FSYA 4LREA 5EGYA 3AH6A 5L39A 1O98A 4RZRA 4K7QA 1R0AA 5K4PA 1N5QA 2JEJA 2BQUA 4TU8A 4U7CA 1JLAB 3D68A 4K8RA 4IKAA 1ZZNA 1U1QA 1TKZA 1Q7LB 2F8EX 2XY6A 5HRTA 1TL7A 2QL7B 3LAKA 4X65F 5AXLA 2ZEJA 1L3TA 2L08A 2NYHA 2BACA 3CMQA 3SQOP 5D4OA 3OVBA 1PYTA 2F4FA 3TUZC 1HI1A 2IBKA 3W9HA 3PW2A 3V2UC 4KHPF 3OFHA 2XWXA 1U48A 1HNZF 2G2OA 1FRLA 1FEEA 3U02A 4UUWA 1PC5A 3GP9A 2MXYA 2ZDOA 3MK1A 5GADU 2CXEA 2F1FA 1ZBTA 2J9DA 2MMYA 5M2RA 4ZP9A 1IKXA 3S8SA 2FLOA 1LEOA 3A13A 2BM0A 2HPUA 1WTBA 4ES3A 2NUUG 5KG0A 4F26A 2N3LA 2GVDB 1URAA 1N56A 5D0RA 4J9SA 1YRUA 1X60A 2W5XA 1NDPA 4DFMA 4E98A 5CAAA 1FKAF 3W63A 4DSKA 5KFGA 4F8RA 1U02A 5EHHA 2VFTA 2GA3A 1X7VA 3IRXB 4RUBA 2OFGX 2WOMB 4JI1F 4C8ZA 3MM9B 3M8SA 4FYXB 2FVPA 2YNHA 3PXGa 4LF2A 1LQ9A 4KFBA 5IQ6A 3A1YG 2XM3A 2ZBIA 1AUKA 2J0QD 3CTRA 4X62F 3DLHA 5KFUA 1OMSA 4CTAA 4LFBJ 1KBRA 2KG1A 4WBFA 2EC2A 3D5MA 1RKIA 1BXNA 2KM8C 2M4MA 2PSZA 5HBMA 3DLEB 2LP4A 2F3JA 4ZJQA 2AW0A 2MDAA 3E01B 1GQEA 3GFZA 1SKUB 4BWJA 2HHVA 4DV2J 2Q66A 4U6PA 3SIPB 1R0CB 4KKOB 4WTOB 1KONA 2VKZG 5C2CA 2PDAA 4CYUB 4F7VA 1Q5YA 2FZKB 3OL7A 1Q8BA 2R7TA 2UVVA 4LF5F 1S0MA 1SH0A 4ZOSA 2QMUB 4WE1B 2DHAA 5J2NA 4DCPB 3NWGA 4NXMF 3HCXA 2OAUA 2DGVA 4MKVA 2ROPA 3HFZB 2HZAA 2QA4G 5U47A 4B3MF 5RUBA 3TVYA 1TK5A 1C4CA 2CQBA 2X3DA 4LIRA 1JXVA 1VYAA 4AQYF 2WONA 1IKWB 4U67Q 3KHRA 3PACA 3LALA 4DS5A 1IR1A 1HD0A 2FLNA 4ZVTB 1UWBA 1KS2A 2DH7A 4AXJA 1XNQJ 1J27A 4FYWB 3W61A 1VDHA 3T01A 2BR0A 4QW9A 3MCMA 1EP4B 5K8PA 1SL0A 4OZ1A 4CP5A 2EC0A 3KUHA 3POTA 4N7TA 2V4QA 4LIWA 3GJTB 2B9YA 5CABA 3MUTP 1HBOA 1FWLA 2IRYA 1KN6A 2V4JB 2UVUA 1X31C 3K8WA 3FQLA 4HTJA 4I1TA 3T6JA 4DQSA 3HVRA 2K7JA 4UUXA 2QTWA 4K4VA 5HP1B 4LF8J 1S1XA 4DS4A 3CJ5A 2BM1A 2KT5A 1WEYA 1TUGB 1JXEA 4Y2IA 2XYPB 1NDLA 1DAXA 4MT1A 1K1QA 1D09B 2RKIB 3S1TA 1M5VC 1RT7A 1OO0B 2N7YA 1YJRA 1KOOA 4DPWA 4W4MA 5G4DA 3O1LA 2N7CA 1ZTTA 1WSVA 4MH8A 4O23A 2DNYA 1ITPA 1L3SA 3D0IE 2R8GA 2HFZA 4QU7A 3KDNA 2H54B 4PG4A 2GA7A 3P4UB 2CQ3A 3V5RA 1E3CP 3HPOA 1RWXB 1X5SA 5LSOA 3R5AA 2MKKA 3NKOA 4I6YA 2ASYA 2I38A 4YDDB 2HQDA 4HT7A 3T1HJ 1YLXA 1BGXT 1JQGA 4P2SA 3AXMA 3C19A 5C66A 1GX5A 1I3OB 1HPZA 3SCLE 4BC9A 2RQKA 4A8WA 4ED3A 2R8HA 5D4PA 3Q2TC 4FKXA 1M5OC 3DDIA 4FNIA 2XR9A 3R2DJ 4OV1A 2RILA 4UOOA 2HHWA 3NS6A 1PBAA 2XMVA 5I3UB 1KH4A 3HXMA 4P2MA 2JDJA 3KLEB 2GMJA 2VOOA 4JI5J 1CS4B 3UVJB 5D0EA 2JHEA 3LWLA 5BR8F 1FJCA 1JB0C 3MMAB 2O3DA 1N2LA 4K59A 3PO4A 2DEIA 5I3PA 2X51A 2NR0A 1ZTWA 2GAGC 2WBMA 3CJTA 3NS5A 3R5GA 5DLFA 1EETA 5T14A 4Q5VA 1VQ9S 3LP0A 4RUCA 2DR5A 2IRXA 1H3DA 3LPEA 1QAXA 3GWCA 2M7SA 2UUWA 2E44A 2MY7A 3HP6A 2H9ZA 4DR6J 2ACYA 4DG1B 2PN6A 1S9GB 1ZM4A 3JXOA 3D54A 4A8QA 3PKYA 3CJ3A 3B8HA 3PRVA 3CMRA 4ICLA 3NMRA 3DRPB 3B4MA 3JS9A 4B3TF 2VHGA 2ZDPA 5ETNA 1HFEL 4J9LA 1F3VA 1RCOB 4LFBF 2VFRA 2QMXA 3PYGA 5A8KB 4KTQA 2P9EA 1NHVA 3VTIA 4H4OB 4URSA 1KVJA 2P8IA 4J90A 5HO4A 1B3TA 2CPHA 3CNQP 5A8WB 4IH5A 4PWWA 1G6BA 3OFEA 4B9SA 3MMCB 4DPUA 4DV2F 2JLGA 2ZZTA 1AFJA 5J1EA 3TZZA 2VICA 5GAHI 2RQ4A 1TAUA 3FNNA 3I0SA 1RT4A 4YB7A 5KT7A 3IGVA 5DG7A 3HHLA 3GFXA 1X4GA 1XMOJ 4RW6A 2A0FB 1J5EJ 5F8NA 1FKPA 5E3QA 4A8SA 2VONA 3EGVA 5ETLA 2B4OA 2DGOA 4YS2A 2VUGA 1FSUA 2F4VJ 4DLGA 2JL9A 1M5SA 1RABB 2FLPA 1PCAA 1YKWA 4OZ0A 5HJXA 2XWYA 2HMIB 2FPHX 5KFXA 1H38A 2R2RA 4KRWA 2QLXA 2DNKA 3EDRB 2HSEB 3UD3P 4JI2J 2M52A 1UJ5A 1TV6B 2KFZA 4Y34A 1WG5A 1WNEA 3CCTA 3FGVA 5HROA 1KOHA 4N77A 3S01A 1C0UB 4CLWA 2B9WA 2BMBA 2GIFA 3FVYA 3ITHB 1RWOB 4MY4A 2DGWA 4UQTA 5K14B 4PYAA 2W5SA 1EW8A 4CM0A 4DCJB 1P9YA 3MM6B 2ZOGA 1G4CA 4ZLJA 1DLOB 2E7XA 4DQIA 2K1RB 1LW0A 4KO0A 1KH5A 1WI6A 2OPPA 4NWBA 3BO2A 4EYHB 2ZNYA 2YVSA 1VIXA 5KFPA 3VAKA 4U96A 4C8MA 2AWZA 2CQPA 2LA4A 4NXNJ 2BE2A 3TQEA 4LF8F 2DH8A 4XDCA 4TU7A 2VDIA 2ZHOA 2EBEA 2JVOA 3BBCA 3DHXA 3FFIB 4FDFA 5KFHA 1DJ0A 4WFXA 3MM7B 3LO3A 2LEAA 3GG1A 4WXOA 1RUSA 2AIRB 4ZLLA 3ISZA 2CNOB 3GILA 1A9NB 1S12A 4PKDB 1X4CA 3OD2A 2FLLA 5KFAA 2YNGB 3MF5A 3MAQA 2GVZA 1LWXA 1JKHB 4X4RA 4R8UB 1YJNS 2L48A 1JK9B 4I2QA 3E51A 2AJ4A 5B0GA 2HIQA 3F56A 4UPIA 1DTQA 4ZIVA 1R8BA 1KDNA 4GKJJ 2EEYA 3T1HF 3BN4A 3HHEA 3D6HB 1VQ5S 4X4QA 3GIKA 1URNA 3OR2B 4TN2A 3TUPA 2DPJA 2VG6A 1N0VC 3HMJG 5IC6B 2ZVIA 3UCZP 1C1CB 5EDWA 2D9OA 1AZSB 4AUKA 3CCRS 4DSIA 4WK3A 3TZXA 5CZXA 2GO9A 2DR7A 3MM5A 2D74B 4P72A 1S9EA 3EWGA 3QLHB 4RNHA 2E5LJ 2YTCA 2E1PA 4IG3B 5KFVA 4KJIA 2CQ1A 4MKAA 4WIQA 2GQCA 1JJ2R 4NX9A 3UD4P 3SCIE 2GZOA 4BLGA 2MJNA 4WJBA 2VV5A 3KHLA 3GTYX 1EW2A 1V9OA 5LXRA 2R8JA 1IBLJ 1IJFB 2IA0A 1VQMS 4DR6F 2HQCA 2GC8A 1N33F 4F50A 4UOFA 3TJAA 2IPOB 4GTXA 3HT3A 2J0WA 2VJVA 2V8HA 3MTKA 1VQNS 3M9OB 5ETRA 2MZ1A 2MEWA 2MLYA 5F0WA 1M0SA 2MJUA 2NPIA 2MHNA 3CMES 3BEGB 1TL3A 1VRTA 3CDEA 1Z4UA 1S57A 2ASJA 1NK0A 5D8HB 2VC0A 1RB0A 4NI2B 4RW4B 4DI6A 1T3OA 1A7GE 3AD7C 3CD0A 2AJFE 1B0VA 4Z7YA 4TNOA 4PR6A 2DR8A 4WP8A 4OX9J 1W26A 4F4XA 1NPPA 2HQIA 5DG8A 1Y6VA 2YNFA 1S76D 3CCJS 4KHMA 1KH7A 1VQ8S 2KXHA 5KT3A 5KG6A 1ICEB 1TVRA 4JV0A 1HQUB 4ZHRA 3N5BA 3CCES 5T7LB 2C2MB 4JUZA 2FC9A 4JV1A 2A6MA 5GAEI 2HNYB 3BDGA 1FTRA 3AOCA 2AJQA 1XMOF 5K8OA 1HQ2A 1J5EF 4UPKA 3W2WA 6AT1B 2B6AA 4WZMA 2CWXA 3Q86A 2J6UA 4DSJA 2NXUA 3G82A 1RWVB 3MM8A 2UP1A 3MR6A 1HDHA 2MQOA 4X66F 4ANCA 2RD5C 4F0HA 2GAHC 5KTQA 2MKHA 4J9KA 3FK4A 4WPAA 2BE7D 4RW9A 4DN9A 2BEFA 2VU5A 4O3NA 3A3PB 3Q8PB 3J80U 1SJFA 1GXLA 2JZ5A 2WRMA 5LXYA 3BBBA 2YKQA 1T05A 4WFBQ 1UEUA 2OTLS 3KK3B 1ED9A 2O1PA 1ELYA 2LQ9A 5IOLA 4KGZB 2R7SA 4NRTA 4PYDA 4Q0BA 2X7IA 3T41A 2HS3A 4DV0J 4NXNF 2EBGA 1REGX 2J76E 3NLCA 4ZG7A 4J9OA 3C2PA 2YKOA 3QRPA 1O51A 2RDDA 2P2CB 3ET6A 2XZTB 1P8GA 4LFAF 2W2OP 1IR2A 2OPRB 4USUA 4J9VA 4DPXA 4LSZB 1PAUB 1FA0A 4LF4J 4AFFA 1GFWB 2HW3A 3ULHA 2UV8A 3LAMA 4Z7CA 1Q82T 4AE5A 3AHPA 3AJDA 3NGRA 2BE9B 5E3AA 4QCLA 1REVA 3P49B 3FZBA 5CYMA 5ETTA 4E8UA 3R3TA 3THVA 3UWTA 4YY3J 2A1BA 3FCWA 1FK9B 4ID5B 2LXFA 4GKJF 2HGNA 1YGYA 2VG7A 2XMMA 2HRTA 1UJ6A 3EICA 1XK8A 3UN2A 1WG1A 4DR5J 1O0PA 1FJGJ 4C3LA 2W8DA 2BRKA 3US5A 1HBMB 1A6LA 4NMLA 1RAOA 3VAHA 3NWRA 2H51B 2A2DA 3M8PB 3BR8A 4GC7A 3GU0A 4ECXA 3FMWA 4KJDA 3MDFA 1H6KX 1UVKA 1U47A 1ZEBA 4KM4A 1HA1A 3RAQA 3C6TA 1UP1A 2KYXA 5HMZA 3H2LA 4ECTA 4RNOA 2Y1IA 4DBQA 3H2UB 4PRFA 1Q5VA 2MGZA 2IDLA 2E5LF 3HSGA 4CYSA 1U7LA 4J91A 1S77D 3F0NA 4WZQA 1S10A 1T3NA 2PFFB 2K7KA 3NKMA 1W2BR 4DR2J 2AMCB 3H40A 3F73A 3R8YA 3F44A 4DV4J 2RH3A 3IBFB 4TKTA 2R7UA 1UPPA 1ZM2A 4IOAQ 3NAIA 2XCAA 1WJ9A 3MWBA 1IBLF 3VQTA 3EM1A 4MYTA 5G0RA 3A3OB 2E29A 3EXYA 1ZA1B 3I82A 3MECA 2JVRA 4P7TA 5DGBA 4CXSA 1VBXA 4URGA 3DI6A 2E66A 1OY8A 2AX1A 5ADZA 1RTHA 4QIWD 2LEPA 5H9EJ 1AT1B 1I6JA 1QDUB 2M3DA 2MKYA 1DTTA 2PI4A 1SHQA 2UV8G 1U26A 4EWTA 4KV8B 3AOBA 1FJ7A 3HHKA 1XBWA 4ILRA 4LQ9A 1PG5B 5DLGA 1NAQA 2OPSA 1QSSA 2ZM6J 4MKYA 2HURA 4OX9F 3ZTSA 1SV5A 4LF1A 1LWCB 2ROGA 3R7SB 3AB2B 2KYZA 3D7SB 1N8RT 2VQEJ 4JI6J 3K58A 1HQAA 2VIHA 4I7FA 5DJBA 4TY8A 3GB0A 2AJ1A 2E5JA 4DX8H 1GNKA 4DFJA 3CCZA 2JJ4D 1S6PA 2JEIA 2E5IA 2H4YB 4UW2A 2GHPA 4D3GA 3FRYA 1CJVA 2DGXA 2ZITA 3TO8A 3RAMA 1VRQC 1H2VZ 1KR4A 1UFWA 3NCRA 2KZZA 2YWEA 1HR0J 3K59A 3M2UB 5A2QU 2LYVA 2QN6B 2NS1B 4WYLA 3M1VB 4NLXA 2I5JB 2Y0SD 1B0PA 3AT1B 2OPQA 3M8QB 1KLMB 4IO9Q 2KXFA 2CG8A 4RW7A 1RT1A 1JLEB 1LWFA 2HVZA 1YRXA 4X64J 5CCLA 2DIVA 3M30B 1FX2A 3UR3C 1YTYA 2X98A 2OGUA 2CQ2A 1WHWA 2F5GA 3WDOA 4HEA9 3I96A 4KBIA 2GJIA 5IXUA 2R3VA 1RT6A 2MSTA 3BPDA 4NLSA 4OYZA 3OTBA 4I67A 2ZNZA 1SXLA 3GR0A 1RACB 1GTEA 2DCLA 1C2PA 5AT1B 2HVDA 5C25A 5IS2A 4LJMA 5C5JA 2XS7A 2V94A 1CJUA 2AGQA 2BJ1A 5INHA 2HBYB 1S5ZA 5J2QA 1CJTA 1S6QA 3UFCX 4DV0F 4NEZA 3DC2A 3MTJA 3DLJA 1RHKB 1YBUA 2AJ0A 5JUMA 2QZ8A 4GKKJ 4CCHA 2DO4A 2DGQA 3DOMB 5B0EA 4MMOA 1JJ4A 1Q8IA 1MSWD 4C8YA 2XHWA 4CO4A 5HL7Q 1E6YB 2IC3B 4Q44A 2ZE2B 1U45A 3TAPA 2XMJA 4WU3A 3VGTA 4QPTA 2GQ2A 2AP6A 3W9IA 3DXBA 2FJVA 1R8HA 2RHQB 3MMJA 2F40A 4DR7J 1HBNA 1AUDA 3UI3A 4C4WA 2QLJB 4PWDA 1V5IB 1NCLA 1SUQB 1A0OB 2B43A 2VBYA 1RKJA 4LR7A 3KLFA 3NGKA 2EI5A 3KG1A 1HNWF 6FDRA 1SC4B 4YY3F 5F41A 5TJ3A 2P9GA 2W5TA 2VJUA 4DV6J 3NKRA 1R6YA 4DQQA 1Q53A 2GO8A 4QIEA 1RLDA 1I51B 4DR5F 1FJGF 2E7WA 4GVBA 1UZHA 2KN4A 2J6TA 4QYZJ 1RAAB 3IO1A 1CQMA 1DURA 3W3SA 4PG5A 5HLFB 2BQRA 2XB2D 2YXLA 4PQUB 3UQSA 2IAJB 1IBMJ 2XZDB 4X4OA 1IUJA 5LJ3Y 1VQ4S 2V5HG 2E1RA 5JJBA 2VQFJ 1DY3A 3LP1B 3T5JA 3J7YI 2CQIA 3SCKE 5D4NA 3W2VA 3HJFA 2FHJA 4Y28C 4O3SA 4F2RA 1EAYC 2HQ3A 3MXHP 2I8EA 4LBHA 4RNMA 1MN9A 5FD1A 2OMLA 4RBUA 2DPIA 2Q79A 1CJKB 3SBMA 3VF0B 1WHXA 4DV4F 1RT2B 3JTNA 3TI0A 4JI8J 3CCLS 9RUBA 3KG0A 1O5JA 2FJAB 4C97A 2XI3A 3Q8YA 3LPYA 2XC9A 1D8ZA 4IDKB 1VOMA 1XWLA 2PMHA 2W9BA 3H2VE 2EKYA 3PIPQ 4DV5F 4C8KA 4FYVB 2JSXA 2EFQA 3KJFB 1S1TA 3BPSP 2DNGA 1EZZB 1DFDA 2OEKA 2FC8A 4QYZK 4NL5A 4ZK7M 1HHTP 1F6TA 2HQFA 3T9NA 3RTVA 5H1SV 3RBEA 3W60A 4L3KA 3UCGA 1LXNA 1T9VA 1BQMB 5MAOA 1JNZB 4OI2A 2JEGA 1NPRA 4ZVGA 1X4FA 2YKNA 4KE5A 4B3OA 2KRBA 4URQU 3E2DA 2W9AA 2ZM6F 1TKTB 1QAYA 1E1ZP 1JLAA 5F8JA 3K5OA 2VQEF 4JI6F 2VL1A 4R0EA 4PXCA 4OI1A 2J9DE 3CDWA 1SBRA 3GV7B 2J8SA 2D3ZA 1L5UA 2CPDA 5T41A 5B0AA 2DGUA 3DLKB 3VZHA 2MQLA 2JC0A 2MYFA 3MI7X 1HR0F 2GX8A 3RRKA 2W1BA 3K5LA 5L0EA 2IUCB 1VK3A 3IR7B 2LDIA 2WVEA 4F4AA 1HJKA 1ZPWX 2Y3YA 2BV3A 3ENVA 1EKRA 2J7KA 2X1FA 4RNFA 2ZUGA 3ILJA 3MEGB 4Z37A 2CQHA 2ILZA 4X64F 3EUNA 1WKKA 5E2QA 1RTJB 2LU1A 2HGMA 4WP3A 5AJ9A 1V6HA 3GYXB 3NS7B 3IMQJ 3GJRB 4NZ7A 3R5BA 2GVDA 1I5OB 4NEYA 2Z2LA 1QJHA 3GPAA 4HHJA 4CO2A 2L3MA 5IJQA 5ETQA 3BKFA 2QT7A 2XULA 1MU2B 4U8YA 1SJ4P 3GIIA 4NASA 3IG1B 4HT5A 4CNZA 2KHCA 2XI2A 2Q6BA 4CT9A 4BCAA 4I6WA 2WOMA 2CJBA 3MM9A 3VGSA 3IWLA 4OYMA 1R27B 4YB6A 1H74A 5ETPA 1LV5A 5L9XA 3AQOA 1RYSA 5CH7B 2QV6A 1FKOB 3IN5A 1CG2A 2DNHA 4MK8A 2Y1LB 4GKKF 1TUVA 1NHKL 3BGLA 2DHHA 2EVZA 2R42A 5K8NA 1EB0A 1QTMA 2RMLA 1WC3A 3K0JA 3QFHA 4TLQA 2W25A 3NGSA 2ZFHA 2V68A 4ECQA 5SZTA 2HHHJ 3CC2S 3RB3A 3DLEA 2EPIA 2ZJPQ 2I6WA 1E6VB 3E01A 1X8DA 5KOXA 1UW4A 4DMZA 1RBAA 1K73T 1R0AB 2UUAJ 4DR7F 2E5GA 4K2XA 4KKOA 2RUSA 1JX4A 2RJZA 3DU6A 2ERRA 3PJ9A 2UXBJ 4WKRA 2V2QA 4OYIA 5F0UA 4CYUA 3LF0A 1OYEA 3G6YA 2Z4PA 3PG9A 4CLKA 3GYNA 1NDKA 3ENQA 4DV6F 1J5OB 2WAQD 2KU7A 4WE1A 2JEFA 2LQBA 1ZPVA 2K3KA 4J9MA 1FDDA 2R7VA 2C2OB 3H5YA 4OHYA 1UAWA 4TLRA 4I2PA 3ISNC 2UZAA 1QSYA 1RHRB 4MHXA 2NLWA 3RW7A 4YHHJ 1RAGB 2GGPB 4N8OA 1VC5A 1VISA 2ZWPA 1IBMF 4OMFG 1XC9A 2VQFF 3K57A 2XLJA 4DV3F 1U2CA 2G13A 4JP8A 2B7BB 3OR1B 3GR1A 3UDEA 1SKRA 1ZEDA 5GOVA 4LF6J 3I0RA 3Q22A 2DY1A 4YP3A 3LQVA 3R5DA 1U6BA 2GJFA 3O5TB 5CQGA 3MOZA 4O3RA 1PJ5A 3QATA 3WQPA 2W01A 3PFEA 2DNNA 4TQSA 4LQ3A 4ZPWR 2W2MP 2HHPA 1RHJB 1P6TA 1Y3KA 1FWPA 2V4JA 3BGUA 2FYXA 4ED4A 5F8MA 4JI8F 1GK8A 3ZXWA 5C2GA 4NLDA 4F4KA 4ECYA 1FO1A 1U8WA 5HP1A 2XHCA 2ZBRA 4YR3A 3CD6S 3D9BA 1SKWA 3TJ8A 2EFGA 1QLNA 3CULA 2HLUA 4O44B 1BC6A 3GSIA 3I5CA 1AROP 4J9NA 4OYPA 3AA9A 3M2VB 4EO8A 3VAMA 5KFDA 3R7NB 5IT4A 3ZZUA 3HHLD 5ETVA 4ZPTR 5KFBA 1VQSA 1U24A 1WKJA 5E5NA 4QR0A 3ZNJ1 4WTYA 3S6EA 5DDOC 2D3O1 4UPHA 2CPXA 5IM0B 2XGQA 2VASA 2OH2A 3M32B 3DRYA 1XEZA 1VQ7S 3D6TB 4HACB 2GMLA 1MNEA 1UCNA 2KG0A 3QZ8A 3EVWA 1S6UA 4ZP7A 4U9RA 3OQ2A 2RB7A 2RDJA 1Q95G 3I55S 1MWQA 2K06A 1DARA 2OLWA 1HNIB 3VAFA 1QE1B 5J2NB 1JLCB 3RBXA 5IT9Y 2RT3A 4QWBA 4Y6IA 3PJWA 2QX0A 1YRTA 2VH7A 3TW0A 3P6YC 3HULA 4LRFA 3KJVB 3CUNA 4NLVA 3KLHB 3BSOA 4ZLNA 3CWJA 4DUZF 1S0OA 2KO1A 5I3UA 4UZBA 2DXDA 3KLEA 5LSRA 4O0NA 3CCMS 1CS4A 1R8PA 2ZD1B 3UVJA 4NCAA 2C2ZB 2HKEA 4RBTA 3LA0A 5F3ZA 1UWBB 4FN5A 4JI4J 3MMAA 2DITA 4PXDA 1CC7A 2QLFB 1YJ7A 2L41A 3KK1B 2MB0B 3QYYA 1P1LA 3E2EA 2ZC3A 2G0IA 3IRWP 2VODA 1D9DA 3FEZA 2KI2A 1U2FA 2OO4A 2MY8A 2CPYA 1FF2A 3MD1A 1FNOA 4C8LA 2HVIA 3NOCA 4Y2AA 1N5YB 2RQMA 2X1BA 1NUEA 3EE3A 1VJWA 5CYQB 4DG1A 1S9GA 3A12A 4IR9A 2XO7A 2G9OA 2YKMB 2W8SA 2CQ4A 5IJSA 2W8LA 2YPZA 3EVMA 2XYGB 5A76A 4GRSA 3PX6A 4GO7X 3DRPA 3SZ2A 3QT6A 1CULB 1O99A 4C2MA 1TL1B 4EBCA 3MPUB 4QIVA 1NRKA 1F5AA 4Q8EA 3H5XA 5A8KA 1NU4A 2RRBA 4OZ5A 1FRJA 3EZUA 2QSWA 1FDAA 3N0VA 4H4OA 2C3MA 1NPKA 2V9KA 3OPKA 2HHHF 3VGVA 3T1YJ 1FNXH 1N5VA 1NJIT 4GTYA 2W5WA 3JSBA 4USVA 2XY7A 2MKIA 4ER8A 2QC3A 4ANDA 2KH9A 3HVAA 4A8KA 2UUAF 1C4AA 3G6ES 2CAJA 4LF7F 5KFQA 2CNKB 3T9ZA 1WC5A 4X4PA 4PQAA 2VQRA 1EJ7L 1T9YA 2CPEA 5C7PA 4B56A 2F7VA 1QAIA 4ED7A 3EZOA 4NE9C 4CI0B 7AT1B 3DFEA 3AD9C 2OD6A 2I0XA 2IM3A 5GAGU 3M6WA 3MPWA 1FD8A 4Y65A 2FGOA 2OUGA 4HTIA 3UDVA 4AL6A 2Z8QA 5B09A 2ZH6A 4YHHF 1X4HA 2MZJA 3EPIA 1WC1A 3H90A 3QT5A 3E8OA 4B9MA 1TTHB 2DNLA 5E33A 3UW1A 4IFYB 1B7FA 2NPFA 3RBZA 1XMQJ 2ILYA 5DDRC 1TV6A 2A10A 1VBZA 2RQCA 1C0UA 4C8NA 2H4WB 1YITS 3IAM9 3ITHA 5DLWA 4Z2XA 4LF6F 5K14A 1VGYA 3X3UA 1MROB 2EWHA 3MM6A 5L1IA 2WB1D 4DCOB 2HFUA 1GEHA 2K1RA 2LFVA 1XNRJ 1X0PA 3NRBA 4TN0A 3DLGB 5HN0A 3E3XA 1TU0B 3IFEA 3HI9A 4P10A 2O66A 3A8IA 2OIHA 4OYWA 3KYLA 3RR7A 5GMEA 1OS5A 3WC2A 1F5CA 1FDNA 3HJVA 4C6AA 1MMNA 2XGPA 3OUYB 3FFIA 1VLOA 5DLVA 4QJVA 1PYSB 1WC0A 3DLLQ 3MM7A 5HMYA 1KP6A 5KT2A 2PC6A 1GAOA 2MLZA 4LMZA 4Q2LA 1U8SA 1QY7A 2AHOB 2YNGA 1ZETA 3M6UA 4PG7A 4CZCA 2RSQA 3Q8UA 4M5HA 3UCUP 3HSJA 5CHCB 2FDNA 1JKHA 2CQ0A 3O44A 1X5OA 4O0IA 3G9CA 3I4HX 2O5DA 2C1EB 1IR0A 3WAYA 3V6DB 5F3TA 2F8MA 4UY8T 4YR2A 3A3NB 3QWPA 4QR1A 3HHLB 2FJBB 2AQ4A 1RCXB 1R0BG 3BZQA 5LSLA 3OR2A 1KHNA 4RX6A 4K4ZA 1HQEA 3BDEA 4FF1A 3IC1A 3QBCA 2ATLA 3PYDA 4BS2A 5HQ8A 2P5VA 3W5ZA 1C1CA 1WHYA 3OXLA 1C0TA 4ZVOB 1AZSA 1ELZA 5KFEA 2YNIA 4J7CA 2ADBA 2VOPA 5D78A 3OW2R 4M5JA 2APOA 2VPWB 3ONQA 3CC4S 1JLQA 5EGHA 2XMTA 2HAIA 4X84A 1AJDA 1Q78A 3QLHA 2MQNA 2GIRA 1NKEA 4JI4F 4GTZA 1HBUB 3H20A 2KJWA 1SVDA 3UDCA 3BQ0A 4QOTA 1K44A 3TRGA 2KXNB 3OTEA 5KFZA 3BDHA 4ED5A 2DBBA 4DL2A 2QYGA 2QZUA 2K2PA 3MURP 2F8HA 3BBFA 2HQGA 4ZKAA 4E0DA 1D8YA 1HHSA 4UOHA 3A52A 5AE2A 5KFNA 4KO0B 2W5RA 2W9CB 2WW4A 4FS1A 3B54A 4KGVB 5IV4A 2B4PA 1IBKJ 4GC6A 3V4IB 3AXKA 3NEKA 4NLGA 2ZZNA 1CSJA 3I9V9 1NK5A 5L9NA 5D0HA 4DR4F 1NZ8A 2WSCC 3BQ2A 1EHWA 2HAFA 4OZ2A 2HBRB 2V8GA 2QLWA 1UVIA 4OYBA 5AJ3J 3QT8A 3ZTPA 4N76A 3MCOA 5A0YA 3PTWA 4DX5A 2CZ4A 1HYSA 3BO3A 2HBZB 3H5UA 3HFKA 3LXQA 2VFUA 3ZTOA 2VA2A 4RW4A 1P49A 2G2YA 3PW7A 1ALKA 2IMWP 3M4XA 4ZCKA 3SFUA 3J81Y 3T1YF 2YX7A 2C28A 5IQQA 2AGOA 3KTQA 4DWIA 4X2BA 3SDEA 4HI2A 3Q8QB 1W2IA 5EGEA 2FVRA 1VCTA 2DK2A 5T7LA 3R5CA 2CIMA 1JLFB 2HNYA 2C2KB 3KUGA 3IR6B 1KQKA 4RUAA 3I32A 3NY0A 5BYRA 3PZPA 3TUJC 1OSDA 4JYAJ 4H4MB 1G7CB 5CCMA 2IA6A 1B70B 1SIWB 3CJSA 1FCAA 2DO0A 4ZPVR 3HO1A 2XLIA 4TXSA 1LXJA 1NJXA 4MTPA 1H73A 1KVKA 1NSQA 2NZCA 2V8PA 4ZJLA 3W64A 3DU5A 3LANA 2PO4A 2OHDA 3VALA 1GX6A 1BMQB 1R8CA 1IQZA 3W62A 3RU0A 3GFYA 4DL4A 4OJ3A 1Q8KA 1APSA 3MEDB 1XMQF 1TKXB 2HS4A 3QT7A 5HMXA 4OI6A 5J2MB 2DISA 4OHVA 3ELHA 3LUYA 3ZC4A 4Q7AA 2BXJA 4DL0C 1GMWA 2FHMA 3W8PA 4CLYA 2RS2A 1XNRF 3KK3A 5EWEA 2KB2A 3I87A 3CT9A 3UD5A 1NJYA 1UW9A 1TP7A 4OJHA 4DN0A 3MEKA 4ZPAA 1IM6A 3D6FB 2LXIA 5CD4H 4IOBA 1VJQA 3CE8A 4YDXA 5DQIA 2CQGA 2EK1A 4IRCA 5DO2A 4AXIA 1FRMA 2WVBA 4ILLA 1U1RA 3HM9A 4CO3A 2BW2A 2KKHA 1U1KA 2E5HA 3KMQA 3ETMA 4O3QA 3R1LA 3CO0P 3NKPA 3K2YA 3IGNA 2QEXS 3TVKA 2XLKA 3Q23A 2OPRA 1KVIA 3M6VA 4R5PB 1X4AA 4OYXA 4ZCMA 2CG4A 2CQCA 4X4UA 4ANEA 1KTQA 1N6QA 5KG1A 2D1CA 3PEJA 1SQGA 3MR5A 3SSRA 3KNGA 3BDPA 2ADCA 2BDPA 2GLQA 2YBVA 2QJ3A 2VG5B 5LMNJ 4DR3F 4OZJA 2P6SA 2HHUA 2VC1A 4WIIA 4ZHRB 1AJAA 4FYDA 1FK9A 4ID5A 4CLFA 4A47A 5HQLA 2JX2A 4M5NA 4ENOA 5D6GA 4MIBA 1HBMA 1KC8T 3ZZPA 1H7WA 4HDGA 3CMAS 3WIUA 3K89A 2PI5A 3PKMA 1XR5A 2DNQA 3M8PA 1YQHA 3CJ4A 4F67A 3SI8A 3KKFA 2KVQE 2EFVA 1SQEA 5ITHA 3CXCR 3K17A 2RRAA 3ILIA 3RRHA 4UF4A 4OX8A 1WWHA 1MW7A 2QLBB 1O8BA 2C3PA 2I1RA 4KR0B 5LM7E 1LWEA 3KFWX 4TYAA 1VQYA 1S4FA 3DXSX 4W90B 4M5LA 2ZHAA 4L72B 1DZ5A 3OBIA 2BRLA 5CYJA 3G6VA 2Z30B 4CM2A 1D9AA 1T05B 1HWJA 5L1LA 3HVTB 2FUG9 3WX8A 2OELA 4WKYA 4UOGA 1X0FA 3DYAB 3M2RA 1IBKF 5KFTA 4B3SJ 2HS0A 1OWXA 2BJ9A 1U25A 2HHSA 4A4JA 3JAMU 4B9LA 1Z2ZA 1F9HA 1S4EA 2YKAA 5LMUJ 2CPZA 2AYMA 4K4WA 4RU9A 3WAXA 5AXKA 3BM7A 5KFKA 2G9YA 1YZ6A 5DGAA 5AJ3F 3KHGA 5K5MA 4N47A 5GAHU 4FBTA 4KV8A 3W65A 2F63A 1ALIA 1RTIB 1G3OA 2QFIA 4P74A 1SL1A 4KH1B 1CVJA 2FVCA 4LSNB 2MQ8A 1NLKL 3GSDA 3I5BA 5AXNA 1LWCA 3BH6B 1T03B 1RAFB 3PYEA 1FXDA 3ZZ0A 2OKQA 1WD6A 4XK8C 4DZDA 1FESA 2CFXA 3OFGA 4P52A 4LBPA 4HHUA 2YWHA 2QSFA 4DF4A 1KFDA 1PJ7A 3D3BJ 3M2UA 4NYOA 5EWGA 3A8JA 1FRHA 2WSEC 3M1VA 1VQ6S 1XR7A 2FHJD 4MFBB 2I5JA 3RBDA 4JYAF 4FPRA 4KSEB 2FJEB 2HRUA 3JTPA 1V5VA 1KLMA 2YWGA 4L3NA 2ZKTA 1KKHA 3MHYA 4UT4A 2VKRA 1JLEA 3R6LB 5H9FJ 4A8YA 3G8QA 2ZH5A 4M5KA 3PW0A 3M30A 2GQQA 4ECVA 4NZ0A 2R2SA 1Q0NA 2OD4A 3KMSA 3CJ0A 5C24A 4LRBA 4OQJA 4JOUA 4PABA 4DU8A 1NBEB 4NYZA 2HZCA 2V2ZA 4KAVA 3DLBA 2LCWA 2IFXA 2U2FA 1EI6A 1Y00A 1GT8A 4YR1A 2Z58B 2HHXA 3KJNB 3H25A 5F9LA 3VAGA 2WSFC 3QMQA 4Y00A 1RDRA 3P45B 1SC1B 1ZA2B 2F9JA 4IFVB 3T5HA 3GJSB 2CDQA 3CIZA 3DOMA 1QVGR 4IG0A 3GZ7A 2B0GA 2Y0BB 1M5HA 3P8BB 1U2RA 3T6BA 3I6PA 1YG0A 2CNLB 1FRIA 2M5YA 3SV4A 1E6YA 4E2FB 4M63A 2ZE2A 3SQGB 4DEZA 1Y3JA 4JI7J 4PUOB 1WOOA 4F2SA 3ICLA 2KT3A 5M2UA 4B02A 2FJWA 3VZIA 5H9FK 4QWCA 4QU6A 3H59A 4ZCLA 1KQFB 3I5AA 2F9DA 4OFZA 3DDKA 1UEVA 1NJWA 4ERDA 1UEKA 2OJ3A 1RA7A 5LMNF 5IT9U 1CBKA 4I7FB 3DM2B 1XNQF 2J0SD 3LP2B 5JMNA 1CJVB 4MK9A 1FERA 3O3LA 1LKZA 3H5SA 3JQMA 1QTNB 3DOLB 3PNIA 3MPDA 5KG5A 1U49A 1IKVA 4JI3J 4OI3A 4ETXA 1TAQA 1NEEA 5F9NA 4EMDA 3C6UB 4EBEA 3D28A 1JJHA 2C3YA 1UZDA 3GMGA 4U7UD 3B82A 1F2HA 4PQUA 4RW7B 3N6LA 2IAJA 2G1HA 4WFYA 3R97A 3WX4A 3QJJA 2HWTA 2D3UA 1UFKA 3LP1A 5B7WA 4ZJOA 1TUWA 4ED8A 1U1LA 3CDBA 2WW8A 2XMAA 1O6XA 4NLTA 2BW7A 2V9WA 3IR5B 2G4BA 2CPJA 1CJKA 5LIAA 2JWNA 3EX7B 1LNQA 5IZHA 3NBPB 4NRUA 4CO1A 1QD1A 4ZDNA 3K8VA 3NGTA 3AA8A 2OFHX 1N88A 2CA9A 5LJ5Y 3M8RA 4XPEA 1NH8A 1PSDA 2MTLA 2GCFA 2ZBQA 4B3SF 1QUPA 1S6QB 5KFOA 1S1WB 1T7PA 4CLLA 2W8KA 4HDHA 5J2PB 3FRZA 1C1BB 2AEMA 6FD1A 2OSRA 1RLCL 3EJMA 1LK7A 2QMWA 3NG8A 3WIVA 5DRKA 3VR1A 1TELA 4D3HA 2GSOA 4CLPA 4CO5A 1Y0HA 1WDDA 3QWUA 2MSSA 2IRUA 1S49A 3KLGB 1BQMA 4OX7A 3M8YA 1F5BA 1KH9A 5B08A 3MUVP 2W2PP 5J1NA 3L9ZA 3GFHA 2RS8A 4DL5A 5L8RC 3M9NB 1X4BA 1T02A 2R9LA 1QUVA 3W9JA 1AFIA 3HF5A 2KDOA 4WXWA 3MFIA 3MCNA 2PE8A 2KTQA 2QA1A 1KHJA 2XS2A 1TKTA 2HFNA 2IVYA 4UPLA 3BH7B 4QWAA 4JI5F 3PVXA 1ALJA 3HHNB 3O8WA 2C42A 5IV3A 3V6HA 2HFOA 3C14B 3MAHA 5KFJA 4KT0C 2NXNA 2ACMA 3MEEB 1GH8A 3PRDA 2JFDA 1FDBA 3DLKA 2J7WA 4P2FA 5I42B 1ELXA 4OLPA 1X4EA 2RF2B 2IUCA 2VBWA 4NLWA 3UR0A 2CJQA 2XMUA 4EFAC 3CCSS 3IWNC 2BBEA 2BANB 2B4VA 4QIGA 3M8WA 1NSAA 4MIWA 4G1PA 3HKZD 2PMWA 1KLNA 2B5JB 1T9XA 3MEGA 1D0EA 1HWIA 4C98A 4L6V3 3UE2A 3OL6A 1YJUA 1X9MA 1HIYA 2LKZA 1EQJA 5E3CA 1T9WA 3B6BA 4H54A 3CO9A 3ZO7A 2W2QP 2W7OA 1BWVA 1NNDA 1HNXJ 3DRXA 1MU2A 1UPMB 1VHIA 4PPZA 2HVEA 2Z57B 3UN3A 2Y9HA 2I2YA 3BF4A 4QIFA 4OHWA 2MKSA 4C11B 1RJJA 1BQXA 3JB9k 4C0HA 5CD4A 1BHNA 3J80Y 1NMEB 1G2EA 3CJKA 4B9VA 1S1UB 1Q8LA 5KG3A 5K9FA 1FKOA 3I56S 1HL6A 3VAIA 2RVJA 1RWUA 5HAOA 1OQ6A 1RA6A 2IBOA 1NB2A 3PRBA 4CIOA 5DM7Q 4IUFA 2PFDA 1XR6A 4NOHA 3AY0A 3WBHA 4KPCA 1S0VA 2DB1A 3ZZTA 4KAIA 2F4VF 4JI7F 3DRSA 4RLEA 4OI4A 3AFGA 3CCQS 1E6VA 2LXUA 2CKWA 1S48A 1PBUA 1P9QC 3HZEA 3TYTA 1ZEFA 4JI2F 1TMMA 2DH9A 5EN1A 1BY9A 5FDLB 3T5LA 5KXAA 2ZBCA 2DXFA 2AYBA 1J5OA 4PEOA 1YBAA 2XSFA 3PX0A 3TZWA 1HWUA 2PIIA 1S1VB 1SJRA 4JI3F 2PEHA 3MAAA 1RE1B 1BQNA 5HANA 1YK9A 4Y3CA 2DNZA 2NZ4A 2CJ9A 3TR5A 4IH7A 1BUXA 3TEHB 2DD8S 2HFSA 1U09A 2IHR1 3NCQA 4GMKA 1RT3B 3QIDA 1WTFA 3GYGA 1NXIA 2OI2A 4NLPA 2NXCA 3BYRA 3D3CJ 1VIOA 2GGPA 3M7VA 3KLVA 3S7RA 5I3QA 3EYZA 3V6KA 2ALYB 1W7WA 5BR8J 2PEBA 1WACA 4V19X 3OR1A 1WC6A 1L3UA 4ID8A 2GMHA 4LRAA 4X4TA 3KNAA 3N9UC 1SKSA 4N8NA 3LTOA 5BXIA 1R6VA 2DNRA 5GMDA 3ED4A 1YJ9S 2CYYA 5GMKa 8AT1B 4K4UA 1SB6A 2M88A 4NPOA 3KLIB 1U0HB 4C9DA 1Y5NB 4UZCA 3FJ2A 2NSCA 4YR0A 3GCXP 2AX0A 3RG6A 4DX7A 5DQHA 1D1UA 2RE1A 1HMVB 3ZZRA 1YWXA 4XIUA 2CNNB 2JNJA 3G86A 3L09A 4OYAA 1UA0A 3MR3A 3MMBA 5D4LA 3JQJA 1H72C 3FDSA 1FX4A 4LFCJ 3C15A 1VBKA 4OHXA 3OV7A 3QO9B 2CZ9A 4DL7A 1H2TZ 3QFWA 4ZPBA 4O44A 3J81U 3FSXA 4B3TJ 3N01A 2H5IB 3M2VA 3HHLC 4MIVA 4YUDA 2VBZA 1U1OA 2VFVA 4ELVA 4CLSA 3JTOA 1FEHA 4JI0J 2BJ7A 2FHKA 2HYIB 4DF8A 3IAS9 4FF3A 2B56A 4P6QA 3FSIA 2VZ9A 1U1MA 3T19A 1B0TA 5IM0A 1ZAWA 3D4JA 2YPYA 1AYEA 3M32A 2UUTA 3HD2A 1EIYB 3PYFA 2CWKA 4F4YA 2E1CA 4HACA 4O3OA 2G2ZA 3KJQB 1TZ0A 4ZVHA 2VF3A 2LLZA 5HI7A 3WHIA 1RHQB 1YVFA 1WORA 2FVSA 3G6XA 3MOJB 1HNIA 2VB6A 5GADI 5DS7A 1QE1A 1JLCA 2HNZB 1Q86T 3Q3QA 3IWXA 5IFMA 2XY5A 4K50A 2G0CA 2IYGA 4IYQA 2F65A 4I2PB 4ZP6A 2HLTA 4ECUA 3R7BB 3KJVA 4OIXA 4USHA 1YDLA 3FUYA 3KLHA 2HIYA 2V2KA 3ISND 3G4SS 2JC1A 1WG4A 5A2QY 1JLGA 4IRDA 1HWKA 3V81A 3AAWB 4FPIA 1NKCA 3KOAA 3OJUA 4F4ZA 4YOEA 2ZD1A 3JYTB 1P27B 1JXLA 2UUCJ 3MGJA 1ZH5A 3MUMP 2N82B 2Z0GA 2QFJA 3RB0A 4FBUA 3KK1A 1NSKL 4K4SA 4PXEA 2J9CA 3I0RB 1FFWB 3Q2SC 4C3KA 4X4VA 4I0WA 4L75A 1HNXF 3QJLA 2WZ1A 1DQ8A 3NCPA 4NZ6A 3PR4A 1HKAA 2IM1A 2MZQA 3QPIA 4EU0A 5KFMA 1CC8A 2BABA 3QIPB 4DSEA 2V4RA 1Q1KA 3BKTA 1N5YA 4EO6A 1PJ6A 4NCGB 4RPFA 1RP5A 5A6PA 5C42B 5CYQA 1K0TA 4OJ1A 2HNDB 3NKQA 2EK6A 2L9WA 2JLEA 1M1HA 2YKMA 1EX8A 2ZWOA 4USMA 2ATCB 3FEXB 3NKYA 4K4TA 1UL3A 4K4YA 4NMXA 1CULA 1TL1A 2XQCA 3BGFA 5D15A 2BJEA 1U0SA 3QAUA 3G87A 3NMAA 1KFSA 4RNNA 3KG4A 1F0XA 4M5GA 3QAEA 4DZ6A 4C3MA 5IT0A 2ZKUA 5A8RB 3CCVS 1OY6A 3J7ZT 4WK1A 1UVNA 1UMJA 3U7JA 4XDDA 2W7AA 3THPA 1EKSA 4XTTA 1EQ0A 3GG0A 3B78A 3TARA 3ILOA 4I69A 4TYBA 5ETOA 3KD8A 2KL8A 3OL9A 2B9XA 4PPDA 4JV2A 3BREA 4LRDA 1S6OA 3NL0A 4KAYA 1FFSB 1GXTA 3IS9B 3RAXA 3CC7S 4G3IA 1WSRA 1YJTA 1VQKS 1H0HB 2EFOA 3VWSA 2W24A 2IJRA 1UFLA 3J7YU 3QGPA 4HVZA 4ES1A 2B3TB 2EW9A 2DNOA 3DMJB 2W7PA 3X1LB 2CJAA 1N32J 1N2KA 4WCEQ 4ZGAA 4DPYA 3UNGC 3DOKB 1RI7A 3CEDA 4M5IA 4IFYA 5D3GB 3DRRB 2JH3A 1IKYB 2FVQA 4NLUA 5B0DA 2ZZMA 3JSYA 2QG9B 1IWAA 5E41A 2YH1A 3OLAA 3AOAA 1ANIA 2CRLA 5SUHA 4BWMA 2COLA 1MROA 2GHVC 1FVSA 3H4BA 5DM6Q 3IM8A 4AD6A 4EYIB 3UDLA 4LF4F 2DHSA 4HLBA 3KHHA 2ALZA 3M6XA 2H5EA 4QPXA 3DLGA 2ZJQQ 3UNYA 4HR2A 2MKJA 4RR5A 3BKUA 5CZVA 1EJJA 3CDAA 2GW8A 4PCQA 1N33J 1X9WA 5B0CA 4LFCF 2H48B 4KHRA 2Y8YA 4HI1A 3QSIA 3OUYA 1RBLA 2BJ8A 1MLAA 3D1QA 1KQSR 2FHOB 4ZCIA 2MZSA 4O4GB 3NVLA 1FVQA 2QO3A 1YI2S 4KH0B 1BD6A 2FIUA 1KWMA 4DJBA 4OJGA 1B7YB 1XN9A 4G1QB 4ZMMA 4FS2A 2R7QA 4C0OC 1S72S 4M5DB 4JI0F 3BN7A 1D3WA 5M2PA 3JQKA 4LUBA 3T1AA 4C48A 1KNZA 2L9NA 2P6TA 3PY8A 3CJQA 4DX6A 4LSLB 2BJ3A 2WK4A 4J9UE 1RTDB 1IM4A 2O67A 2UXCJ 4B17A 2BKPA 3V6DA 1IXKA 3N28A 5THWA 1HARA 2ZJRQ 2CVEA 2UU9J 1RHMB 1UVMA 2GNKA 4CRJA 3DHWC 2BZ2A 3BGOP 2LA6A 3NGUA 2DNMA 2H3EB 1HI8A 4DR2F 4QBUA 1JLBB 3EDQB 3VAJA 4YQWA 4IH6A 3EZ5A 2FJXA 4V1Ak 2R7XA 3C8YA 2IM2A 2POKA 1GMWD 4X66J 3A8KA 1URRA 1VK8A 2AEFA 3C66A 5KG4A 4A8MP 2UUCF 2DT9A 3DGPA 4IQXA 2JFKA 5FLXY 3C16B 1EQMA 1K0VA 1HBUA 1Y10A 3K5PA 4RWXA 4NYPA 1ZS6A 4AL5A 3L7OA 3BB5A 2EG2A 4KGMA 1FD2A 4CLTA 2DYAA 2CJYB 1OSCA 3TAMA 3GV5B 4USTA 3KK2B 2LEBA 3M05A 1Z1ZA 3EGWB 4K5SA 2ZH4A 2W9CA 4J9RA 2AYGA 1VC6A 2C22A 3DNCA 1OPZA 4WFZA 2YQ0A 7FD1A 3VV2B 2UVRA 3V4IA 4HHHA 3SCJE 3BGRB 2DJWA 1OYDA 3TA2A 5L0KA 5MLCV 3HHDA 3OTDA 2V34A 3CJ2A 2RUGA 3TG0A 5K8MA 3PW4A 2KJVA 3EMTA 3BJYA 2XSJB 5E3RA 2QA4S 1HD1A 4MAKA 5FJ4A 2ANHA 4NA3A 4ZVPB 2EG1A 4Q43A 3PFOA 1NK8A 1LW2B 1Q4RA 1RISA 4LFAJ 5AE1A 1N5SA 4ZG6A 1QSLA 1XIQA 3VHQA 2MHEA 1FE0A 2HRYA 4CLUA 4P7VA 3G8TA 3C3LA 3HX9A 2X1AA 4FP9A 1ROFA 1N0UA 5DG9A 3RRGA 2FGCA 4DQRA 5HMWA 4RW8B 4JV5J 2VFSA 4CH0S 1FXLA 3OXFA 4HH1A 3JSMB 4NLOA 1R3NA 3CCUS 3R27A 1JLFA 5B0BA 1WF1A 3JSRA 1WEZA 2ZVSA 1VRUB 4TVAB 2LVWA 5JVGQ 2MKCA 1N4LA 1PAEX 1HQEB 3P96A 4AT1B 4YEAA 4NLRA 3WBZA 4K0KJ 4H4MA 4UY85 3IRXA 4JBCA 1N32F 4I56A 1C0TB 1WF2A 4M1KA 2ZC4A 4NCBA 2FQQB 2YNIB 3OVAA 5KFRA 3THTA 4F3MA 1JLQB 4KPYA 4DHVA 3WAWA 2ZH3A 3RJMB 4UOCA 1RT5B 3MEDA 1TKXA 4YMEA 2D41A 3OHBA 4WYWA 1F2GA 4OZNA 2ZH7A 3SMZA 5J2MA 2XZWA 2R7OA 3B4DA 3LGMA 2R4FA 2FZGB 2E9TA 4XO0A 2KFYA 2NXJA 1DBDA 4A46A 2QYCA 2NQPA 1Y5LB 1NDCA 4FXWA 1HNVB 2J0XA 1UTAA 3Q0AA 2XRGA 5EUHA 1SC3B 2YH0A 1NH7A 2ZH8A 5GVQA 4LQYA 4O4RA 1MG7A 3MPYA 2NXEA 3N6MA 1IWGA 1SJ1A 1TKZB 2J7UA 1VMBA 4LR2A 2AZ3A 1TL7B 2M70A 2MZRA 2EKNA 1V3RA 2YWWA 3BR9A 3FQKA 3FBFA 1R8AA 2QRRA 3HK2A 1TMJA 5FIIA 3CF5Q 4CWBA 2E7VA 4HH0A 3LW5C 2HG4A 4ZVQB 5A0YB 1ANJA 1HYSB 3RUBL 4ZVEA 3C46A 4R5PA 1BWEA 4ZP8A 4PWUA 5LQQA 1IKWA 1VFJA 3W66A 2X1GA 1B4SA 4YFUA 3TJ9A 1IKXB 1FE4A 3SDEB 3EGZA 1QAJA 2VG5A 1LFPA 2V2VA 3PW5A 4FNHA 2UXCF 2Y8WA 4RUHA 3GLJA 1H2UX 2UU9F 1EP4A 4FXVA 4LT6A 2ZHBA 3LOUA 4PZVA 5E7OB 2PA3A 8ATCB 2CZVC 1IBCB 3GONA 1ULRA 3R6GB 4DDFA 3EVOA 1DHMA 2FD2A 2WVFA 3TVZA 5ETMA 1R89A 4XAKA 3MD3A 5BJRA 2YNHB 1RWKB 4CT8A 4KFBB 3VCDA 1AW0A 2LQJA 2RKIA 1CLFA 3QNWB 4CTAB 3WC0A 4P75A 2WHOA 5DQGA 4EBDA 1GTHA 1YJVA 5HQMA 1TL5A 5HBMB 4CXKA 1IVZA 1FXRA 4ETZA 2RU3A 3HVTA 2R7RA 3Q89A 3HVWA 2ZOMA 3P5BP 2DNPA 3DYAA 1RWPB 3HKWA 1FTCA 2NUHA 1FT8A 3QRRA 1MWZA 4N56A 4ED6A 3FZ2A 2B51A 3M8ZA 1NM2A 3QSYB 1CEZA 4F4WA 1PGZA 4QAXA 4ZG9A 4CDIA 3ZFVA 3AB4B 3EXCX 2JLFA 4PAAA 1Y11A 2B4UA 2C2RA 4MJKA 4NA1A 2A3JA 2XTJP 4KGXB 1ZM3A 2M9KA 3D0HE 1RTIA 2XMWA 4A8OA 4C7QA 2EXUA 3T00A 5ETSA 3RB6A 4DL6A 4F02A 4LSNA 2XCPA 2WONB 2SXLA 1L3KA 4M8LA 2BX6A 1N6QB 3N6NA 1T03A 2WCXA 2DGTA 2W2NP 2LDYA 2N4DA 1Y9OA 4Y2MA 4LF9J 1Y7AA 3PJXA 2FY1A 4JV5F 1HNWJ 2X3GA 3O6QA 1NHUA 3IBWA 3WZ0A 5KT5A 3Q83A 1V3SA 2KZMA 2YY3A 3RB4A 3B5QA 4EK2A 5DDQC 3HSZA 2CDRB 4DOZA 3CW2C 1KRPA 4BBYA 4HL9A 5BYQA 4LR8A 3FEYB 9ATCB 3POTB 2V6AA 4Q8FA 2M8DB 4MFBA 2V8VA 2XEXA 1SQFA 4EZ9A 1HBOB 4K0KF 1T9UA 3P5TL 5EWFA 3QGHA 4X4SA 3QRQA 1HW8A 3CPWR 1VQOS 3U27A 5DZ7A 1M1GA 3RW6A 3ZZZA 1N36J 2B8QA 3V4MA 1TKDA 1I1GA 1S1XB 2DXEA 3TX0A 4J5OA 3D0GE 3ZTRA 1P1TA 1K7HA 4P71A 4ZN3A 3BO4A 1LWEB 1RT7B 2IVMA 4O3PA 1N5TA 3MR7A 4EZ6A 3T3FA 4F0MA 4DU7A 7FDRA 4OLOA 2GJ2A 2W4PA 2XG8A 5EX3A 2AV5A 5A8WA 4PXBA 4L73A 4M5MA 3MMCA 2HVHA 4FVCA 1KD1T 1HHQA 4FDIA 2IJFA 1XERA 1DQ9A 3M2RB 4DR1J 4ZVFA 2UXBF 3FC9A 2W4DA 4IFVA 4DV5J 1AJCA 2OEJA 3IP0A 1JMTA 1WDTA 4KIAA 1HPZB 4ECRA 4AL7A 1LK5A 3R5JB 2ZOFA 5L1JA 3HFVA 3FBBA 3PR5B 4DLEA 5HK4A 4MIAA 2V8DA 3SQGA 4ITSA 1RXOB 1KHLA 3OJSA 4PUOA 1FRKA 3NNHA 1M90T 3SV3A 2DKOB 4DUTA 5I4MA 4G65A 2HMIA 2V0NA 4KJGA 4IR1A 2H5JB 4I64A 4DFKA 3G8SA 4BDPA 1KQGB 3LH2S 5KFIA 1VR6A 5K20B 2W4CA 3ZZYA 2DIUA 1OPIA 3QGIA 4EEYA 2ZBPA 2Z2MA 3DM2A 2HHQA 1NK6A 3LP2A 3NP5A 2J9EA 3TA0A 1ACMB 4MKBA 2DRAA 1VI7A 3L7UA 2Q43A 1EETB 4NWJA 4FZVA 1DLOA 3DOLA 4FXDA 1K9MT 1XQIA 3KWMA 3LP0B 4PG6A 3W5YA 3EGNA 4DFPA 2HK3A 2FZCB 3PX4A 1RWNB 3CD5A 3C6UA 4C0BA 4F25A 2NSBA 1ELOA 4RWWA 1WOPA 1JWWA 1WI8A 2UUBJ 4K5RA 4P9SA 5IWAJ 4IOCQ 2BKOA 4M95A 1AUSL 2JRSA 1SH2A 3CGIA 1B99A 4I4BA 4B08A 4ICLB 2MPUA 2FTRA 3D2WA 2IMOA 5H9EK 3PV8A 3TX8A 4ZN1A 1NSPA 3W1YC 3TNVA 4U95A 5C24B 3HDSA 2XMKA 5F8IA 2QL5B 3NNCA 2C3UA 2WBRA 3TP2A 5E3PA 3NBPA 3UPFA 3PIOQ 2JOQA 3FMBA 1M5KC 4LR9A 1RYRA 3D1HA 4TU9A 5L0BA 3BSAA 1UJ4A 1ALHA 2BKNA 3EPGA 4R8UA 5D0GA 3QJPA 5J1EB 4OV6A 1KHKA 1KHVA 1S1WA 2IYIA 1BE4A 1X4DA 3I0SB 1RAJA 2P9CA 4KQZA 5J2PA 4P73A 1RT4B 1EARA 1C1BA 2QIFA 1GMVA 4CO0A 8RUCA 4YN3B 5HVGA 3IM9A 2GS8A 4B3RJ 3SZYA 4IG0B 4RW6B 1FKPB 1S7HA 2KM8B 4DPTA 1NK9A 4CNYA 3KLGA 1SC6A 1N34J 3Q8SB 4KY3A 1NO8A 1XTZA 1SJQA 1TR0A 1B64A 2VBXA 4ATNA 2XYHB 4CH1A 5KT6A 4RU2A 4WWSA 1NZAA 2CADA 4CH7A 3BDFA 3C14A 1H7XA 4LF9F 3LGHA 5HROB 2MZTA 3MZIA 2VD3A 3MEEA 4IG3A 4KYZA 3ENWA 1N54B 4QQBA 2Y1JA 2OP5A 2B9EA 2IM0A 3P3DA 5I42A 4KGKA 2AKWB 4AYBD 2B7CB 2RF2A 3TEGA 1LW0B 1IKVB 4GTWA 1J2VA 3OVSA 2OPPB 1LOUA 1F60B 3ENAA 3DN9A 3HZGA 2BANA 2FY8A 1W25A 2BJDA 1PILA 3TANA 1F3FA 2DCUB 4Q2MA 1N36F 2B5JA 2PA8D 1PO6A 2BE2B 1YHQS 2RDIA 4GO5X 4F36A 4DUYJ 4B9NA 1HWLA 4J9QA 2NCKL 4DV3J 1RSCA 3HD1A 2ZH9A 1T8EA 2WTFA 5KFYA 2EFPA 3AODA 5D77A 1X5TA 2D69A 1ED8A 1SHNA 3ADAC 1U1NA 1U4BA 5HSPA 4NI2A 2D9PA 2YQ1A 2ASLA 2PMZD 3H4DA 1WUUA 2CJKA 1X9SA 5LT5A 4C11A 5EX0A 1MWYA 3WAVA 2UXDJ 2GVZB 2XNQA 3OXGA 3R2CJ 3MR2A 4ZLPA 1S1UA 4I2QB 3W5XA 3BV8A 4DR1F 2GHWA 3KUEA 4JB8B 1DTQB 1HQUA 2IDEA 3BSCA 4QYRA 2OEMA 4R25A 2V69A 4USKA 4B9UA 2KVIA 1RWWB 1R43A 2M8HA 2PGCA 2VG6B 2XBPA 3M9MB 2C2NA 4NWXA 3ILLA 2A2CA 5GRRA 1ZM9A 4ED1A 1N52B 2J5AA 2YQ3A 4QWDA 4ED0A 1UETA 3OSNA 4K2JA 5KT4A 3CDUA 5DETA 4A8FA 2VA3A 4FF4A 3MM5B 2R2TA 1YZ7A 2ZH1A 4CYRA 3CCWA 2V63A 1S9EB 3OL8A 4RBVA 2PT0A 4WFNQ 5FDLA 4ECZA 4EGLA 2CJXB 4J9PA 4DV7J 2FJDB 4IQMA 2D3OR 2WB4A 4FDJA 1Q79A 1RBOB 4UTGA 1S1VA 1KHWA 3CIMA 3J7A1 2DGSA 2D7SA 3PHTA 4UORA 1PYOB 3SEOA 4LVNP 4Y0FA 1OQ3A 3PDNA 1JNRB 2AT1B 5FLXU 4S0MA 1SPBP 3R9LA 2NYIA 2UUBF 1NK4A 4DUZJ 1RT3A 1IJEB 1S97A 2YKPA 1RAHB 1NK7A 5IWAF 2J6SA 1VBYA 2VPXB 4ZIWA 4DQPA 2HWIA 2E9RX 4ELUA 2LMIA 3V6JA 4RJVA 3GV8B 5IC4B 2L9DA 1K1SA 4FKYA 4ILMA 2HWHA 3DYCA 2YWKA 3OT9A 5DLTA 2I9SA 1HI0P 2QA2A 5CXTA 4IO1A 5E0OA 1TL3B 5A6WA 2CVIA 1VRTB 4W98A 3PEHA 4A48A 4LVOP 2GSUA 2LECA 4BHQA 3I9ZA 5LRNA 1TFWA 3KLIA 1U0HA 3SZZA 1M1KT 1I94J 4QZVB 1HMVA 3CJKB 3U1NA 4DSFA 2YNFB 3H98A 4ALZA 2MQPA 1XMBA 3ZTQA 1TVRB 1M5PC 3OTOJ 1K47A 3QO9A 1RWMB 3FCHA 1RQ0A 2HK2A 2ASDA 3GJQB 3BDGB 3TQ1A 1KTVA 1IN0A 2CQDA 2RRNA 1S0NA 3TAQA 4B3RF 3J81j 3F41A 1U6FA 3CJRA 1UVJA 1RZMA 4ZVRB 3W2WB 4G6VB 2DVIA 3JAMY 2B6AB 2R2UA 1N34F 2W5QA 2U1AA 4N41A 5LRMA 1R7IA 1S79A 3OSPA 3G96A 3DRSB 4FYYB 5DDPC 3G82B 3MM8B 1SL2A 5AXMA 2EFNA 2BOAA 4WF9Q 4DL3A 2DRDA 4XPCA 1Y4ZB 2M2BA 2KRRA 1HW9A 3DDNA 1N48A 4LF7J 1T94A 2AJ2A 3D1OA 4RW9B 5HJYA 5JVHQ 4F0KA 1YJWS 2Q1LA 4R0JA 2R7WA 1WHVA 2HNZA 4W92B 1GMUA 4EI2A 1WF0A 1SCJB 2BYCA 3J7AN 4OZ3A 3LGNA 3MAAB 1BQNB 1FRXA 1Y5IB 2DHXA 2V50A 1EW9A 4YB1P 4H4KC 1U1PA 4EUVA 4Q0BB 4QW8A 1D9FA 1Q16B 3AJ1A 4Y2CA 1WKLA 2ROEA 3JYTA 4DV1J 2J8AA 4DUYF 4OI0A 3AD8C 4NLYA 3QZ7A 2VDHA 4V19J 2GSNA 1T9TA 2VPYB 5KFLA 4ZITA 2E9ZA 1JJCB 1S59A 2XO6A 2ZUAA 3ET6B 2RNEA 5HVHA 3RGIA 3H7HB 2QE5A 3ZZOA 4N5SA 2AZ1A 1OY9A 1T95A 2Q3PA 2LQ8A 4RO0A 3T5KA 4OL8A 1RK8A 2KFNA 2C3OA 2MQQA 2YX4A 5KG7A 2V67A 2M0GB 4USJC 3QIPA 3W8GA 1RADB 5HATA 2UXDF 3NAHA 2OSQA 4LBIA 4NCGA 5C42A 1UA1A 2HNDA 2Z2YB 4HKQA 2AGPA 4WFAQ 1REVB 3MMBB 3I31A 3O2IA 5CYMB 4DPOA 3ETOA 2OTJS 3LWMA 3C15B 3UO0A 2H65B 5JXSA 4M94A 3DCAA 2HZVA 4ECWA 4F3QA 2Z56B 5F8LA 5AE3A 4ZVSB 2VG7B 2HFVA 2CPFA 3CVKA 4ZPDA 1YBTA 3BS9A 4ELTA 4P2XA 1OIAA 1VLYA 3GE9A 3GIJA 2KHDA 5A8RA 4U7UK 1DQAA 1G1XA 3IGZB 3N79A 1H98A 3KXDA 3M8QA 2WVCA 1E2SP 4ED2A 3PO5A 5B0FA 2AYEA 3C6TB 3DPCA 2AF6A 3VVTA 1WOSA 3HSDA 2G1DA 3T02A 2VPZB 2FB0A 2MGZB 4GVLA 3IS9A 2RHSB 3I4PA 3BQ1A 1UKUA 3MK2A 3IDDA 3DKDA 4DV7F 1XJWB 2R8IA 3GQCA 2ZH2A 3H0PA 2MLXA 4RKUC 3IXQA 1PIEA 1FHTA 1CQNA 5KAKA 1VS3A 3FCVA 3OFFA 1SI9A 2QL9B 5KFWA 1FWKA 1KSPA 4U8VA 4RL1A 3DMJA 2GIQA 3VGUA 3CB4A 4TY9A 2NREA 1NB7A 4ZVUB 5G0RB 3DOKA 3RYLA 1JLGB 3CD7A 3V81B 3N4WA 1MMDA 1KEKA 1L3VA 2BVZA 3MECB 3PCOB 5D3GA 3H8YA 3DRRA 1K8AT 2LU2A 1IKYA 3DI6B 5KFCA 1FFGB 1WEXA 3U1LA 3NOGA 1RTHB 1SIZA 1DTTB 2IC3A 4B9TA 2QGFB 4G1IA 3HLUA 1YIJS 5LOQA 1GXUA 2OPSB 4WU2A 3SSSA 2Z2ZA 5KG2A 3N5FA 4IRKA 1QVFR 1I94F 1SV5B 4TQRA 3CSKA 4MK7A 1WELA 3VVUA 1SUQA 2BUNA 1RHUB 4TY8B 4DR4J 3BYPA 4DSLA 2BQ3A 1Q7YT 4J37A 1R31A 4LRCA 1S6PB 4X65J 3OTOF 3A4TA 3L95X 2Y1RI 3MFHA 3RZAA 1Y7PA 1F9EB 4I68A 4O4GA 3L3CA 1UVLA 1ZOTA 5F8HA 4USIA 1MMLA 1AB8A 3ZNUA 1RAEB 4L76A 2DR9A 4G1QA 5HVFA 4ES2A 3RR8A 4KHPJ 4M5DA 2R8KA 2BA9A 5HLFA 1HNZJ 5KOWA 2OPQB 3OHAA 1E33P 4DXLA 3SXLA 1ZAXA 2DY9A 2H1YA 4QWEA 1RT1B 1MN7A 1LFWA 1LWFB 3D6MB 3FBCA 4LSLA 4BC7A 4CQ1A 3CJ8A 1RTDA 2IJNA 1NKBA 4OX6A 3J7Z5 2UVWA 1T0TV 1RTZA 2HHTA 4OYOA 3A8EA 1RAIB 2RIJA 4CLZA 4ZA1A 4Q45A 1RT6B 4ZS6A 2N3OA 1TK0A 1JLBA 4MYUA 3TZYA 4F3OA 3KDOA 1SH3A 2YX1A 1ZYQA 5DZ6A 1RT2A 1V3ZA 1BLUA 1HLWA 5C25B 1RGVA 4HYKA 1Q81T 4JI1J 1CJUB 3NNAA 5J2QB 1IQTA 3MK0A 2B8PA 1CJTB 4IDKA 4A8XA 3W7BA 3IA0A 2DHGA 4DV1F 5LMUF 2RH6A 4FVMA 2O01C 3C16A 5KFSA 1TL4A 4X62J 4X4NA 3D67A 2C2DA 2GV1A 2W5VA 4PG8A 2BOPA 3AJ2A 3MPVA 4NLQA 3Q8VA 2RU9A 2DTJA 1ZAVA 3OLBA 3AQPA 2HEKA 3NKNA 3KK2A 1F9FA 2WVDA 1YSJA 2G0JA 1YX2A 2IIHA 5GAEU 4H4KA 3H42A 4KB7A 3IGYB 2A6OA 2CPIA 1TQLA 4YB5A 4L74A 1FNMA 3PHEA 4KC5A 1U6ZA 1HBNB 5CA5A 2RAQA 1S9FA 3BGRA 4PWDB 2C2EA 4UQGA 5L46A 4Y2KA 3FBEA 4WP9A 4CXUA 3KLFB 3BSNA 1URBA 3G2XA 4ZPCA 3G71S 5ETKA 4LF5J 1FJEB 2XSJA 2OMOA 3K5NA 3HT0A 5F8GA 1S99A 5L38A 3TOQA 3PM9A 4NXMJ 2E1MC 2DR6A 1AJBA 2DEJA 4ECSA 3QQCD 4GVBB 3NGDA 1ZZFA 1LW2A 1VC0A 3IBCB 2D1GA 2LQ5A 4UOPA 2HBQB 4B3MJ 5KFFA 3SSQA 1DRZA 4AQYJ 1B8JA 1QM9A 5L1KA 1VQLS 1PKUA 4NA2A 3K5MA 4K4XA 2DRBA 3GCWP 2KT2A 2IVFB 1RTJA 5J1PA 1TFYA 4DR3J 2IY5B 3TWZA 5GAGI 3SYZA 4RW8A 2CUYA 1AXQA 3Q8RB 1T11A 2XS5A 4QR2A 3W2VB 3D66A 4F04B 1NJZA 2GFFA 3JSMA 3MCSA 1CPZA 1TK8A 1RU1A 1F1BB 3FKBA 3GIMA 1VRUA 4OZLA 1SJ3P 3TUIC 1S7IA 4USWA 3IG1A 1OJ4A 4OHZA 2ABYA 2K8GA 4I6AA 3L4BC 2AD9A 1VHFA 1AA1B 1VQPS 1PC4A 1UWAA 2IFYA 1FI4A 1X5PA 5BYSA 2AU0A 2YWFA 3U1MA 2A18A 3GIRA 3QGGA 2W9BB 1RT5A 3L7PA 3DGPB 5LL6d 3UN5A 2PD1A 3NXZA 1S1TB 1JIHA 1Z2LA 3VQSA 1WC4A 3TA1A
chains in the Genus database with same CATH topology
1E1ZP 3MK1A 4CYSA 2IUCA 4NWXA 2GSNA 2W5VA 3DYCA 1E33P 3OT9A 1E2SP 4TN0A 5GRRA 2ANHA 5DLTA 3NKMA 1N2KA 4B56A 3TX0A 4ZGAA 3NVLA 1N2LA 1KHLA 1ANJA 1HQAA 3T00A 3DPCA 3NKNA 1KHNA 4LR7A 4MY4A 3TWZA 1Y6VA 3T01A 3WAWA 4KJGA 1KH7A 3M8WA 2W5SA 1EW8A 5TJ3A 4ZG6A 1K7HA 1URAA 4MIVA 4LREA 2W5TA 2GSUA 2W8SA 3T02A 3WAXA 3M7VA 1ED8A 2GSOA 3IGYB 5LRNA 1SHNA 5LQQA 1O98A 2W5XA 3NKRA 4CYRA 1ED9A 1ELYA 4UPIA 1E3CP 2ZKTA 2G9YA 5IJSA 5K4PA 3WBHA 1KH5A 5INHA 1EW2A 5L0EA 3NKOA 3BDFA 2IUCB 3MK2A 3SZZA 3IDDA 3M8YA 3BDGA 5DLVA 4LRFA 1KH9A 4N7TA 1EQJA 1ELZA 4LRAA 4LR9A 1O99A 1HJKA 1ALIA 3UN2A 3NKPA 3WAVA 1Y7AA 4MHXA 5HRTA 1ANIA 2GA3A 5L0BA 4CXUA 4CXKA 2W8DA 4UPKA 5C66A 3ED4A 1URBA 5EGHA 1ALHA 3KD8A 3LXQA 4CXSA 4LRCA 4ZG7A 4FDJA 3B5QA 4FDIA 1AJDA 1KHJA 1ZEFA 4LRDA 1P49A 2XRGA 4NWJA 3UO0A 1ALKA 4GTXA 4UPLA 1KHKA 4KAYA 4LRBA 4GTZA 1ALJA 4UORA 4GTWA 2XR9A 1FSUA 3UNYA 4LR8A 2IFYA 5LIAA 3CMRA 4KJDA 3MK0A 4LQYA 1AJBA 1EW9A 3BDGB 3BDHA 1HDHA 3UN3A 1ZEBA 4GTYA 1SHQA 4UOOA 5KXAA 4KM4A 2GLQA 4LR2A 2W5WA 5AJ9A 5DLWA 1EJJA 3M8ZA 2D1GA 2QZUA 1AUKA 1AJCA 4KAVA 1ZEDA 4UOPA 5L0KA 1EI6A 3NKQA 5EGEA 2X98A 5GOVA 3UN5A 4UPHA 3SZYA 4YR1A 3A52A 2RH6A 1KH4A 3E2DA 1B8JA 4QAXA 1ELXA 1AJAA 3Q3QA 3WAYA 4ZG9A 3IGZB 5IJQA 2W5QA 2W5RA 3TG0A 5LRMA 2VQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1Z P;  3MK1 A;  4CYS A;  2IUC A;  4NWX A;  2GSN A;  2W5V A;  3DYC A;  1E33 P;  3OT9 A;  1E2S P;  4TN0 A;  5GRR A;  2ANH A;  5DLT A;  3NKM A;  1N2K A;  4B56 A;  3TX0 A;  4ZGA A;  3NVL A;  1N2L A;  1KHL A;  1ANJ A;  1HQA A;  3T00 A;  3DPC A;  3NKN A;  1KHN A;  4LR7 A;  4MY4 A;  3TWZ A;  1Y6V A;  3T01 A;  3WAW A;  4KJG A;  1KH7 A;  3M8W A;  2W5S A;  1EW8 A;  5TJ3 A;  4ZG6 A;  1K7H A;  1URA A;  4MIV A;  4LRE A;  2W5T A;  2GSU A;  2W8S A;  3T02 A;  3WAX A;  3M7V A;  1ED8 A;  2GSO A;  3IGY B;  5LRN A;  1SHN A;  5LQQ A;  1O98 A;  2W5X A;  3NKR A;  4CYR A;  1ED9 A;  1ELY A;  4UPI A;  1E3C P;  2ZKT A;  2G9Y A;  5IJS A;  5K4P A;  3WBH A;  1KH5 A;  5INH A;  1EW2 A;  5L0E A;  3NKO A;  3BDF A;  2IUC B;  3MK2 A;  3SZZ A;  3IDD A;  3M8Y A;  3BDG A;  5DLV A;  4LRF A;  1KH9 A;  4N7T A;  1EQJ A;  1ELZ A;  4LRA A;  4LR9 A;  1O99 A;  1HJK A;  1ALI A;  3UN2 A;  3NKP A;  3WAV A;  1Y7A A;  4MHX A;  5HRT A;  1ANI A;  2GA3 A;  5L0B A;  4CXU A;  4CXK A;  2W8D A;  4UPK A;  5C66 A;  3ED4 A;  1URB A;  5EGH A;  1ALH A;  3KD8 A;  3LXQ A;  4CXS A;  4LRC A;  4ZG7 A;  4FDJ A;  3B5Q A;  4FDI A;  1AJD A;  1KHJ A;  1ZEF A;  4LRD A;  1P49 A;  2XRG A;  4NWJ A;  3UO0 A;  1ALK A;  4GTX A;  4UPL A;  1KHK A;  4KAY A;  4LRB A;  4GTZ A;  1ALJ A;  4UOR A;  4GTW A;  2XR9 A;  1FSU A;  3UNY A;  4LR8 A;  2IFY A;  5LIA A;  3CMR A;  4KJD A;  3MK0 A;  4LQY A;  1AJB A;  1EW9 A;  3BDG B;  3BDH A;  1HDH A;  3UN3 A;  1ZEB A;  4GTY A;  1SHQ A;  4UOO A;  5KXA A;  4KM4 A;  2GLQ A;  4LR2 A;  2W5W A;  5AJ9 A;  5DLW A;  1EJJ A;  3M8Z A;  2D1G A;  2QZU A;  1AUK A;  1AJC A;  4KAV A;  1ZED A;  4UOP A;  5L0K A;  1EI6 A;  3NKQ A;  5EGE A;  2X98 A;  5GOV A;  3UN5 A;  4UPH A;  3SZY A;  4YR1 A;  3A52 A;  2RH6 A;  1KH4 A;  3E2D A;  1B8J A;  4QAX A;  1ELX A;  1AJA A;  3Q3Q A;  3WAY A;  4ZG9 A;  3IGZ B;  5IJQ A;  2W5Q A;  2W5R A;  3TG0 A;  5LRM A;  2VQR A; 
#chains in the Genus database with same CATH topology
 3Q24 A;  2Q6C A;  2K3I A;  3K7R A;  4C8O A;  3OTC A;  4FF2 A;  2HGL A;  3TAM B;  2AEJ A;  3SFG A;  1RU2 A;  2N4C A;  2E1A A;  2XNR A;  3R1H A;  2MQM A;  2YKN B;  1HNV A;  3DGV A;  4B3O B;  3FSY A;  4LRE A;  5EGY A;  3AH6 A;  5L39 A;  1O98 A;  4RZR A;  4K7Q A;  1R0A A;  5K4P A;  1N5Q A;  2JEJ A;  2BQU A;  4TU8 A;  4U7C A;  1JLA B;  3D68 A;  4K8R A;  4IKA A;  1ZZN A;  1U1Q A;  1TKZ A;  1Q7L B;  2F8E X;  2XY6 A;  5HRT A;  1TL7 A;  2QL7 B;  3LAK A;  4X65 F;  5AXL A;  2ZEJ A;  1L3T A;  2L08 A;  2NYH A;  2BAC A;  3CMQ A;  3SQO P;  5D4O A;  3OVB A;  1PYT A;  2F4F A;  3TUZ C;  1HI1 A;  2IBK A;  3W9H A;  3PW2 A;  3V2U C;  4KHP F;  3OFH A;  2XWX A;  1U48 A;  1HNZ F;  2G2O A;  1FRL A;  1FEE A;  3U02 A;  4UUW A;  1PC5 A;  3GP9 A;  2MXY A;  2ZDO A;  3MK1 A;  5GAD U;  2CXE A;  2F1F A;  1ZBT A;  2J9D A;  2MMY A;  5M2R A;  4ZP9 A;  1IKX A;  3S8S A;  2FLO A;  1LEO A;  3A13 A;  2BM0 A;  2HPU A;  1WTB A;  4ES3 A;  2NUU G;  5KG0 A;  4F26 A;  2N3L A;  2GVD B;  1URA A;  1N56 A;  5D0R A;  4J9S A;  1YRU A;  1X60 A;  2W5X A;  1NDP A;  4DFM A;  4E98 A;  5CAA A;  1FKA F;  3W63 A;  4DSK A;  5KFG A;  4F8R A;  1U02 A;  5EHH A;  2VFT A;  2GA3 A;  1X7V A;  3IRX B;  4RUB A;  2OFG X;  2WOM B;  4JI1 F;  4C8Z A;  3MM9 B;  3M8S A;  4FYX B;  2FVP A;  2YNH A;  3PXG a;  4LF2 A;  1LQ9 A;  4KFB A;  5IQ6 A;  3A1Y G;  2XM3 A;  2ZBI A;  1AUK A;  2J0Q D;  3CTR A;  4X62 F;  3DLH A;  5KFU A;  1OMS A;  4CTA A;  4LFB J;  1KBR A;  2KG1 A;  4WBF A;  2EC2 A;  3D5M A;  1RKI A;  1BXN A;  2KM8 C;  2M4M A;  2PSZ A;  5HBM A;  3DLE B;  2LP4 A;  2F3J A;  4ZJQ A;  2AW0 A;  2MDA A;  3E01 B;  1GQE A;  3GFZ A;  1SKU B;  4BWJ A;  2HHV A;  4DV2 J;  2Q66 A;  4U6P A;  3SIP B;  1R0C B;  4KKO B;  4WTO B;  1KON A;  2VKZ G;  5C2C A;  2PDA A;  4CYU B;  4F7V A;  1Q5Y A;  2FZK B;  3OL7 A;  1Q8B A;  2R7T A;  2UVV A;  4LF5 F;  1S0M A;  1SH0 A;  4ZOS A;  2QMU B;  4WE1 B;  2DHA A;  5J2N A;  4DCP B;  3NWG A;  4NXM F;  3HCX A;  2OAU A;  2DGV A;  4MKV A;  2ROP A;  3HFZ B;  2HZA A;  2QA4 G;  5U47 A;  4B3M F;  5RUB A;  3TVY A;  1TK5 A;  1C4C A;  2CQB A;  2X3D A;  4LIR A;  1JXV A;  1VYA A;  4AQY F;  2WON A;  1IKW B;  4U67 Q;  3KHR A;  3PAC A;  3LAL A;  4DS5 A;  1IR1 A;  1HD0 A;  2FLN A;  4ZVT B;  1UWB A;  1KS2 A;  2DH7 A;  4AXJ A;  1XNQ J;  1J27 A;  4FYW B;  3W61 A;  1VDH A;  3T01 A;  2BR0 A;  4QW9 A;  3MCM A;  1EP4 B;  5K8P A;  1SL0 A;  4OZ1 A;  4CP5 A;  2EC0 A;  3KUH A;  3POT A;  4N7T A;  2V4Q A;  4LIW A;  3GJT B;  2B9Y A;  5CAB A;  3MUT P;  1HBO A;  1FWL A;  2IRY A;  1KN6 A;  2V4J B;  2UVU A;  1X31 C;  3K8W A;  3FQL A;  4HTJ A;  4I1T A;  3T6J A;  4DQS A;  3HVR A;  2K7J A;  4UUX A;  2QTW A;  4K4V A;  5HP1 B;  4LF8 J;  1S1X A;  4DS4 A;  3CJ5 A;  2BM1 A;  2KT5 A;  1WEY A;  1TUG B;  1JXE A;  4Y2I A;  2XYP B;  1NDL A;  1DAX A;  4MT1 A;  1K1Q A;  1D09 B;  2RKI B;  3S1T A;  1M5V C;  1RT7 A;  1OO0 B;  2N7Y A;  1YJR A;  1KOO A;  4DPW A;  4W4M A;  5G4D A;  3O1L A;  2N7C A;  1ZTT A;  1WSV A;  4MH8 A;  4O23 A;  2DNY A;  1ITP A;  1L3S A;  3D0I E;  2R8G A;  2HFZ A;  4QU7 A;  3KDN A;  2H54 B;  4PG4 A;  2GA7 A;  3P4U B;  2CQ3 A;  3V5R A;  1E3C P;  3HPO A;  1RWX B;  1X5S A;  5LSO A;  3R5A A;  2MKK A;  3NKO A;  4I6Y A;  2ASY A;  2I38 A;  4YDD B;  2HQD A;  4HT7 A;  3T1H J;  1YLX A;  1BGX T;  1JQG A;  4P2S A;  3AXM A;  3C19 A;  5C66 A;  1GX5 A;  1I3O B;  1HPZ A;  3SCL E;  4BC9 A;  2RQK A;  4A8W A;  4ED3 A;  2R8H A;  5D4P A;  3Q2T C;  4FKX A;  1M5O C;  3DDI A;  4FNI A;  2XR9 A;  3R2D J;  4OV1 A;  2RIL A;  4UOO A;  2HHW A;  3NS6 A;  1PBA A;  2XMV A;  5I3U B;  1KH4 A;  3HXM A;  4P2M A;  2JDJ A;  3KLE B;  2GMJ A;  2VOO A;  4JI5 J;  1CS4 B;  3UVJ B;  5D0E A;  2JHE A;  3LWL A;  5BR8 F;  1FJC A;  1JB0 C;  3MMA B;  2O3D A;  1N2L A;  4K59 A;  3PO4 A;  2DEI A;  5I3P A;  2X51 A;  2NR0 A;  1ZTW A;  2GAG C;  2WBM A;  3CJT A;  3NS5 A;  3R5G A;  5DLF A;  1EET A;  5T14 A;  4Q5V A;  1VQ9 S;  3LP0 A;  4RUC A;  2DR5 A;  2IRX A;  1H3D A;  3LPE A;  1QAX A;  3GWC A;  2M7S A;  2UUW A;  2E44 A;  2MY7 A;  3HP6 A;  2H9Z A;  4DR6 J;  2ACY A;  4DG1 B;  2PN6 A;  1S9G B;  1ZM4 A;  3JXO A;  3D54 A;  4A8Q A;  3PKY A;  3CJ3 A;  3B8H A;  3PRV A;  3CMR A;  4ICL A;  3NMR A;  3DRP B;  3B4M A;  3JS9 A;  4B3T F;  2VHG A;  2ZDP A;  5ETN A;  1HFE L;  4J9L A;  1F3V A;  1RCO B;  4LFB F;  2VFR A;  2QMX A;  3PYG A;  5A8K B;  4KTQ A;  2P9E A;  1NHV A;  3VTI A;  4H4O B;  4URS A;  1KVJ A;  2P8I A;  4J90 A;  5HO4 A;  1B3T A;  2CPH A;  3CNQ P;  5A8W B;  4IH5 A;  4PWW A;  1G6B A;  3OFE A;  4B9S A;  3MMC B;  4DPU A;  4DV2 F;  2JLG A;  2ZZT A;  1AFJ A;  5J1E A;  3TZZ A;  2VIC A;  5GAH I;  2RQ4 A;  1TAU A;  3FNN A;  3I0S A;  1RT4 A;  4YB7 A;  5KT7 A;  3IGV A;  5DG7 A;  3HHL A;  3GFX A;  1X4G A;  1XMO J;  4RW6 A;  2A0F B;  1J5E J;  5F8N A;  1FKP A;  5E3Q A;  4A8S A;  2VON A;  3EGV A;  5ETL A;  2B4O A;  2DGO A;  4YS2 A;  2VUG A;  1FSU A;  2F4V J;  4DLG A;  2JL9 A;  1M5S A;  1RAB B;  2FLP A;  1PCA A;  1YKW A;  4OZ0 A;  5HJX A;  2XWY A;  2HMI B;  2FPH X;  5KFX A;  1H38 A;  2R2R A;  4KRW A;  2QLX A;  2DNK A;  3EDR B;  2HSE B;  3UD3 P;  4JI2 J;  2M52 A;  1UJ5 A;  1TV6 B;  2KFZ A;  4Y34 A;  1WG5 A;  1WNE A;  3CCT A;  3FGV A;  5HRO A;  1KOH A;  4N77 A;  3S01 A;  1C0U B;  4CLW A;  2B9W A;  2BMB A;  2GIF A;  3FVY A;  3ITH B;  1RWO B;  4MY4 A;  2DGW A;  4UQT A;  5K14 B;  4PYA A;  2W5S A;  1EW8 A;  4CM0 A;  4DCJ B;  1P9Y A;  3MM6 B;  2ZOG A;  1G4C A;  4ZLJ A;  1DLO B;  2E7X A;  4DQI A;  2K1R B;  1LW0 A;  4KO0 A;  1KH5 A;  1WI6 A;  2OPP A;  4NWB A;  3BO2 A;  4EYH B;  2ZNY A;  2YVS A;  1VIX A;  5KFP A;  3VAK A;  4U96 A;  4C8M A;  2AWZ A;  2CQP A;  2LA4 A;  4NXN J;  2BE2 A;  3TQE A;  4LF8 F;  2DH8 A;  4XDC A;  4TU7 A;  2VDI A;  2ZHO A;  2EBE A;  2JVO A;  3BBC A;  3DHX A;  3FFI B;  4FDF A;  5KFH A;  1DJ0 A;  4WFX A;  3MM7 B;  3LO3 A;  2LEA A;  3GG1 A;  4WXO A;  1RUS A;  2AIR B;  4ZLL A;  3ISZ A;  2CNO B;  3GIL A;  1A9N B;  1S12 A;  4PKD B;  1X4C A;  3OD2 A;  2FLL A;  5KFA A;  2YNG B;  3MF5 A;  3MAQ A;  2GVZ A;  1LWX A;  1JKH B;  4X4R A;  4R8U B;  1YJN S;  2L48 A;  1JK9 B;  4I2Q A;  3E51 A;  2AJ4 A;  5B0G A;  2HIQ A;  3F56 A;  4UPI A;  1DTQ A;  4ZIV A;  1R8B A;  1KDN A;  4GKJ J;  2EEY A;  3T1H F;  3BN4 A;  3HHE A;  3D6H B;  1VQ5 S;  4X4Q A;  3GIK A;  1URN A;  3OR2 B;  4TN2 A;  3TUP A;  2DPJ A;  2VG6 A;  1N0V C;  3HMJ G;  5IC6 B;  2ZVI A;  3UCZ P;  1C1C B;  5EDW A;  2D9O A;  1AZS B;  4AUK A;  3CCR S;  4DSI A;  4WK3 A;  3TZX A;  5CZX A;  2GO9 A;  2DR7 A;  3MM5 A;  2D74 B;  4P72 A;  1S9E A;  3EWG A;  3QLH B;  4RNH A;  2E5L J;  2YTC A;  2E1P A;  4IG3 B;  5KFV A;  4KJI A;  2CQ1 A;  4MKA A;  4WIQ A;  2GQC A;  1JJ2 R;  4NX9 A;  3UD4 P;  3SCI E;  2GZO A;  4BLG A;  2MJN A;  4WJB A;  2VV5 A;  3KHL A;  3GTY X;  1EW2 A;  1V9O A;  5LXR A;  2R8J A;  1IBL J;  1IJF B;  2IA0 A;  1VQM S;  4DR6 F;  2HQC A;  2GC8 A;  1N33 F;  4F50 A;  4UOF A;  3TJA A;  2IPO B;  4GTX A;  3HT3 A;  2J0W A;  2VJV A;  2V8H A;  3MTK A;  1VQN S;  3M9O B;  5ETR A;  2MZ1 A;  2MEW A;  2MLY A;  5F0W A;  1M0S A;  2MJU A;  2NPI A;  2MHN A;  3CME S;  3BEG B;  1TL3 A;  1VRT A;  3CDE A;  1Z4U A;  1S57 A;  2ASJ A;  1NK0 A;  5D8H B;  2VC0 A;  1RB0 A;  4NI2 B;  4RW4 B;  4DI6 A;  1T3O A;  1A7G E;  3AD7 C;  3CD0 A;  2AJF E;  1B0V A;  4Z7Y A;  4TNO A;  4PR6 A;  2DR8 A;  4WP8 A;  4OX9 J;  1W26 A;  4F4X A;  1NPP A;  2HQI A;  5DG8 A;  1Y6V A;  2YNF A;  1S76 D;  3CCJ S;  4KHM A;  1KH7 A;  1VQ8 S;  2KXH A;  5KT3 A;  5KG6 A;  1ICE B;  1TVR A;  4JV0 A;  1HQU B;  4ZHR A;  3N5B A;  3CCE S;  5T7L B;  2C2M B;  4JUZ A;  2FC9 A;  4JV1 A;  2A6M A;  5GAE I;  2HNY B;  3BDG A;  1FTR A;  3AOC A;  2AJQ A;  1XMO F;  5K8O A;  1HQ2 A;  1J5E F;  4UPK A;  3W2W A;  6AT1 B;  2B6A A;  4WZM A;  2CWX A;  3Q86 A;  2J6U A;  4DSJ A;  2NXU A;  3G82 A;  1RWV B;  3MM8 A;  2UP1 A;  3MR6 A;  1HDH A;  2MQO A;  4X66 F;  4ANC A;  2RD5 C;  4F0H A;  2GAH C;  5KTQ A;  2MKH A;  4J9K A;  3FK4 A;  4WPA A;  2BE7 D;  4RW9 A;  4DN9 A;  2BEF A;  2VU5 A;  4O3N A;  3A3P B;  3Q8P B;  3J80 U;  1SJF A;  1GXL A;  2JZ5 A;  2WRM A;  5LXY A;  3BBB A;  2YKQ A;  1T05 A;  4WFB Q;  1UEU A;  2OTL S;  3KK3 B;  1ED9 A;  2O1P A;  1ELY A;  2LQ9 A;  5IOL A;  4KGZ B;  2R7S A;  4NRT A;  4PYD A;  4Q0B A;  2X7I A;  3T41 A;  2HS3 A;  4DV0 J;  4NXN F;  2EBG A;  1REG X;  2J76 E;  3NLC A;  4ZG7 A;  4J9O A;  3C2P A;  2YKO A;  3QRP A;  1O51 A;  2RDD A;  2P2C B;  3ET6 A;  2XZT B;  1P8G A;  4LFA F;  2W2O P;  1IR2 A;  2OPR B;  4USU A;  4J9V A;  4DPX A;  4LSZ B;  1PAU B;  1FA0 A;  4LF4 J;  4AFF A;  1GFW B;  2HW3 A;  3ULH A;  2UV8 A;  3LAM A;  4Z7C A;  1Q82 T;  4AE5 A;  3AHP A;  3AJD A;  3NGR A;  2BE9 B;  5E3A A;  4QCL A;  1REV A;  3P49 B;  3FZB A;  5CYM A;  5ETT A;  4E8U A;  3R3T A;  3THV A;  3UWT A;  4YY3 J;  2A1B A;  3FCW A;  1FK9 B;  4ID5 B;  2LXF A;  4GKJ F;  2HGN A;  1YGY A;  2VG7 A;  2XMM A;  2HRT A;  1UJ6 A;  3EIC A;  1XK8 A;  3UN2 A;  1WG1 A;  4DR5 J;  1O0P A;  1FJG J;  4C3L A;  2W8D A;  2BRK A;  3US5 A;  1HBM B;  1A6L A;  4NML A;  1RAO A;  3VAH A;  3NWR A;  2H51 B;  2A2D A;  3M8P B;  3BR8 A;  4GC7 A;  3GU0 A;  4ECX A;  3FMW A;  4KJD A;  3MDF A;  1H6K X;  1UVK A;  1U47 A;  1ZEB A;  4KM4 A;  1HA1 A;  3RAQ A;  3C6T A;  1UP1 A;  2KYX A;  5HMZ A;  3H2L A;  4ECT A;  4RNO A;  2Y1I A;  4DBQ A;  3H2U B;  4PRF A;  1Q5V A;  2MGZ A;  2IDL A;  2E5L F;  3HSG A;  4CYS A;  1U7L A;  4J91 A;  1S77 D;  3F0N A;  4WZQ A;  1S10 A;  1T3N A;  2PFF B;  2K7K A;  3NKM A;  1W2B R;  4DR2 J;  2AMC B;  3H40 A;  3F73 A;  3R8Y A;  3F44 A;  4DV4 J;  2RH3 A;  3IBF B;  4TKT A;  2R7U A;  1UPP A;  1ZM2 A;  4IOA Q;  3NAI A;  2XCA A;  1WJ9 A;  3MWB A;  1IBL F;  3VQT A;  3EM1 A;  4MYT A;  5G0R A;  3A3O B;  2E29 A;  3EXY A;  1ZA1 B;  3I82 A;  3MEC A;  2JVR A;  4P7T A;  5DGB A;  4CXS A;  1VBX A;  4URG A;  3DI6 A;  2E66 A;  1OY8 A;  2AX1 A;  5ADZ A;  1RTH A;  4QIW D;  2LEP A;  5H9E J;  1AT1 B;  1I6J A;  1QDU B;  2M3D A;  2MKY A;  1DTT A;  2PI4 A;  1SHQ A;  2UV8 G;  1U26 A;  4EWT A;  4KV8 B;  3AOB A;  1FJ7 A;  3HHK A;  1XBW A;  4ILR A;  4LQ9 A;  1PG5 B;  5DLG A;  1NAQ A;  2OPS A;  1QSS A;  2ZM6 J;  4MKY A;  2HUR A;  4OX9 F;  3ZTS A;  1SV5 A;  4LF1 A;  1LWC B;  2ROG A;  3R7S B;  3AB2 B;  2KYZ A;  3D7S B;  1N8R T;  2VQE J;  4JI6 J;  3K58 A;  1HQA A;  2VIH A;  4I7F A;  5DJB A;  4TY8 A;  3GB0 A;  2AJ1 A;  2E5J A;  4DX8 H;  1GNK A;  4DFJ A;  3CCZ A;  2JJ4 D;  1S6P A;  2JEI A;  2E5I A;  2H4Y B;  4UW2 A;  2GHP A;  4D3G A;  3FRY A;  1CJV A;  2DGX A;  2ZIT A;  3TO8 A;  3RAM A;  1VRQ C;  1H2V Z;  1KR4 A;  1UFW A;  3NCR A;  2KZZ A;  2YWE A;  1HR0 J;  3K59 A;  3M2U B;  5A2Q U;  2LYV A;  2QN6 B;  2NS1 B;  4WYL A;  3M1V B;  4NLX A;  2I5J B;  2Y0S D;  1B0P A;  3AT1 B;  2OPQ A;  3M8Q B;  1KLM B;  4IO9 Q;  2KXF A;  2CG8 A;  4RW7 A;  1RT1 A;  1JLE B;  1LWF A;  2HVZ A;  1YRX A;  4X64 J;  5CCL A;  2DIV A;  3M30 B;  1FX2 A;  3UR3 C;  1YTY A;  2X98 A;  2OGU A;  2CQ2 A;  1WHW A;  2F5G A;  3WDO A;  4HEA 9;  3I96 A;  4KBI A;  2GJI A;  5IXU A;  2R3V A;  1RT6 A;  2MST A;  3BPD A;  4NLS A;  4OYZ A;  3OTB A;  4I67 A;  2ZNZ A;  1SXL A;  3GR0 A;  1RAC B;  1GTE A;  2DCL A;  1C2P A;  5AT1 B;  2HVD A;  5C25 A;  5IS2 A;  4LJM A;  5C5J A;  2XS7 A;  2V94 A;  1CJU A;  2AGQ A;  2BJ1 A;  5INH A;  2HBY B;  1S5Z A;  5J2Q A;  1CJT A;  1S6Q A;  3UFC X;  4DV0 F;  4NEZ A;  3DC2 A;  3MTJ A;  3DLJ A;  1RHK B;  1YBU A;  2AJ0 A;  5JUM A;  2QZ8 A;  4GKK J;  4CCH A;  2DO4 A;  2DGQ A;  3DOM B;  5B0E A;  4MMO A;  1JJ4 A;  1Q8I A;  1MSW D;  4C8Y A;  2XHW A;  4CO4 A;  5HL7 Q;  1E6Y B;  2IC3 B;  4Q44 A;  2ZE2 B;  1U45 A;  3TAP A;  2XMJ A;  4WU3 A;  3VGT A;  4QPT A;  2GQ2 A;  2AP6 A;  3W9I A;  3DXB A;  2FJV A;  1R8H A;  2RHQ B;  3MMJ A;  2F40 A;  4DR7 J;  1HBN A;  1AUD A;  3UI3 A;  4C4W A;  2QLJ B;  4PWD A;  1V5I B;  1NCL A;  1SUQ B;  1A0O B;  2B43 A;  2VBY A;  1RKJ A;  4LR7 A;  3KLF A;  3NGK A;  2EI5 A;  3KG1 A;  1HNW F;  6FDR A;  1SC4 B;  4YY3 F;  5F41 A;  5TJ3 A;  2P9G A;  2W5T A;  2VJU A;  4DV6 J;  3NKR A;  1R6Y A;  4DQQ A;  1Q53 A;  2GO8 A;  4QIE A;  1RLD A;  1I51 B;  4DR5 F;  1FJG F;  2E7W A;  4GVB A;  1UZH A;  2KN4 A;  2J6T A;  4QYZ J;  1RAA B;  3IO1 A;  1CQM A;  1DUR A;  3W3S A;  4PG5 A;  5HLF B;  2BQR A;  2XB2 D;  2YXL A;  4PQU B;  3UQS A;  2IAJ B;  1IBM J;  2XZD B;  4X4O A;  1IUJ A;  5LJ3 Y;  1VQ4 S;  2V5H G;  2E1R A;  5JJB A;  2VQF J;  1DY3 A;  3LP1 B;  3T5J A;  3J7Y I;  2CQI A;  3SCK E;  5D4N A;  3W2V A;  3HJF A;  2FHJ A;  4Y28 C;  4O3S A;  4F2R A;  1EAY C;  2HQ3 A;  3MXH P;  2I8E A;  4LBH A;  4RNM A;  1MN9 A;  5FD1 A;  2OML A;  4RBU A;  2DPI A;  2Q79 A;  1CJK B;  3SBM A;  3VF0 B;  1WHX A;  4DV4 F;  1RT2 B;  3JTN A;  3TI0 A;  4JI8 J;  3CCL S;  9RUB A;  3KG0 A;  1O5J A;  2FJA B;  4C97 A;  2XI3 A;  3Q8Y A;  3LPY A;  2XC9 A;  1D8Z A;  4IDK B;  1VOM A;  1XWL A;  2PMH A;  2W9B A;  3H2V E;  2EKY A;  3PIP Q;  4DV5 F;  4C8K A;  4FYV B;  2JSX A;  2EFQ A;  3KJF B;  1S1T A;  3BPS P;  2DNG A;  1EZZ B;  1DFD A;  2OEK A;  2FC8 A;  4QYZ K;  4NL5 A;  4ZK7 M;  1HHT P;  1F6T A;  2HQF A;  3T9N A;  3RTV A;  5H1S V;  3RBE A;  3W60 A;  4L3K A;  3UCG A;  1LXN A;  1T9V A;  1BQM B;  5MAO A;  1JNZ B;  4OI2 A;  2JEG A;  1NPR A;  4ZVG A;  1X4F A;  2YKN A;  4KE5 A;  4B3O A;  2KRB A;  4URQ U;  3E2D A;  2W9A A;  2ZM6 F;  1TKT B;  1QAY A;  1E1Z P;  1JLA A;  5F8J A;  3K5O A;  2VQE F;  4JI6 F;  2VL1 A;  4R0E A;  4PXC A;  4OI1 A;  2J9D E;  3CDW A;  1SBR A;  3GV7 B;  2J8S A;  2D3Z A;  1L5U A;  2CPD A;  5T41 A;  5B0A A;  2DGU A;  3DLK B;  3VZH A;  2MQL A;  2JC0 A;  2MYF A;  3MI7 X;  1HR0 F;  2GX8 A;  3RRK A;  2W1B A;  3K5L A;  5L0E A;  2IUC B;  1VK3 A;  3IR7 B;  2LDI A;  2WVE A;  4F4A A;  1HJK A;  1ZPW X;  2Y3Y A;  2BV3 A;  3ENV A;  1EKR A;  2J7K A;  2X1F A;  4RNF A;  2ZUG A;  3ILJ A;  3MEG B;  4Z37 A;  2CQH A;  2ILZ A;  4X64 F;  3EUN A;  1WKK A;  5E2Q A;  1RTJ B;  2LU1 A;  2HGM A;  4WP3 A;  5AJ9 A;  1V6H A;  3GYX B;  3NS7 B;  3IMQ J;  3GJR B;  4NZ7 A;  3R5B A;  2GVD A;  1I5O B;  4NEY A;  2Z2L A;  1QJH A;  3GPA A;  4HHJ A;  4CO2 A;  2L3M A;  5IJQ A;  5ETQ A;  3BKF A;  2QT7 A;  2XUL A;  1MU2 B;  4U8Y A;  1SJ4 P;  3GII A;  4NAS A;  3IG1 B;  4HT5 A;  4CNZ A;  2KHC A;  2XI2 A;  2Q6B A;  4CT9 A;  4BCA A;  4I6W A;  2WOM A;  2CJB A;  3MM9 A;  3VGS A;  3IWL A;  4OYM A;  1R27 B;  4YB6 A;  1H74 A;  5ETP A;  1LV5 A;  5L9X A;  3AQO A;  1RYS A;  5CH7 B;  2QV6 A;  1FKO B;  3IN5 A;  1CG2 A;  2DNH A;  4MK8 A;  2Y1L B;  4GKK F;  1TUV A;  1NHK L;  3BGL A;  2DHH A;  2EVZ A;  2R42 A;  5K8N A;  1EB0 A;  1QTM A;  2RML A;  1WC3 A;  3K0J A;  3QFH A;  4TLQ A;  2W25 A;  3NGS A;  2ZFH A;  2V68 A;  4ECQ A;  5SZT A;  2HHH J;  3CC2 S;  3RB3 A;  3DLE A;  2EPI A;  2ZJP Q;  2I6W A;  1E6V B;  3E01 A;  1X8D A;  5KOX A;  1UW4 A;  4DMZ A;  1RBA A;  1K73 T;  1R0A B;  2UUA J;  4DR7 F;  2E5G A;  4K2X A;  4KKO A;  2RUS A;  1JX4 A;  2RJZ A;  3DU6 A;  2ERR A;  3PJ9 A;  2UXB J;  4WKR A;  2V2Q A;  4OYI A;  5F0U A;  4CYU A;  3LF0 A;  1OYE A;  3G6Y A;  2Z4P A;  3PG9 A;  4CLK A;  3GYN A;  1NDK A;  3ENQ A;  4DV6 F;  1J5O B;  2WAQ D;  2KU7 A;  4WE1 A;  2JEF A;  2LQB A;  1ZPV A;  2K3K A;  4J9M A;  1FDD A;  2R7V A;  2C2O B;  3H5Y A;  4OHY A;  1UAW A;  4TLR A;  4I2P A;  3ISN C;  2UZA A;  1QSY A;  1RHR B;  4MHX A;  2NLW A;  3RW7 A;  4YHH J;  1RAG B;  2GGP B;  4N8O A;  1VC5 A;  1VIS A;  2ZWP A;  1IBM F;  4OMF G;  1XC9 A;  2VQF F;  3K57 A;  2XLJ A;  4DV3 F;  1U2C A;  2G13 A;  4JP8 A;  2B7B B;  3OR1 B;  3GR1 A;  3UDE A;  1SKR A;  1ZED A;  5GOV A;  4LF6 J;  3I0R A;  3Q22 A;  2DY1 A;  4YP3 A;  3LQV A;  3R5D A;  1U6B A;  2GJF A;  3O5T B;  5CQG A;  3MOZ A;  4O3R A;  1PJ5 A;  3QAT A;  3WQP A;  2W01 A;  3PFE A;  2DNN A;  4TQS A;  4LQ3 A;  4ZPW R;  2W2M P;  2HHP A;  1RHJ B;  1P6T A;  1Y3K A;  1FWP A;  2V4J A;  3BGU A;  2FYX A;  4ED4 A;  5F8M A;  4JI8 F;  1GK8 A;  3ZXW A;  5C2G A;  4NLD A;  4F4K A;  4ECY A;  1FO1 A;  1U8W A;  5HP1 A;  2XHC A;  2ZBR A;  4YR3 A;  3CD6 S;  3D9B A;  1SKW A;  3TJ8 A;  2EFG A;  1QLN A;  3CUL A;  2HLU A;  4O44 B;  1BC6 A;  3GSI A;  3I5C A;  1ARO P;  4J9N A;  4OYP A;  3AA9 A;  3M2V B;  4EO8 A;  3VAM A;  5KFD A;  3R7N B;  5IT4 A;  3ZZU A;  3HHL D;  5ETV A;  4ZPT R;  5KFB A;  1VQS A;  1U24 A;  1WKJ A;  5E5N A;  4QR0 A;  3ZNJ 1;  4WTY A;  3S6E A;  5DDO C;  2D3O 1;  4UPH A;  2CPX A;  5IM0 B;  2XGQ A;  2VAS A;  2OH2 A;  3M32 B;  3DRY A;  1XEZ A;  1VQ7 S;  3D6T B;  4HAC B;  2GML A;  1MNE A;  1UCN A;  2KG0 A;  3QZ8 A;  3EVW A;  1S6U A;  4ZP7 A;  4U9R A;  3OQ2 A;  2RB7 A;  2RDJ A;  1Q95 G;  3I55 S;  1MWQ A;  2K06 A;  1DAR A;  2OLW A;  1HNI B;  3VAF A;  1QE1 B;  5J2N B;  1JLC B;  3RBX A;  5IT9 Y;  2RT3 A;  4QWB A;  4Y6I A;  3PJW A;  2QX0 A;  1YRT A;  2VH7 A;  3TW0 A;  3P6Y C;  3HUL A;  4LRF A;  3KJV B;  3CUN A;  4NLV A;  3KLH B;  3BSO A;  4ZLN A;  3CWJ A;  4DUZ F;  1S0O A;  2KO1 A;  5I3U A;  4UZB A;  2DXD A;  3KLE A;  5LSR A;  4O0N A;  3CCM S;  1CS4 A;  1R8P A;  2ZD1 B;  3UVJ A;  4NCA A;  2C2Z B;  2HKE A;  4RBT A;  3LA0 A;  5F3Z A;  1UWB B;  4FN5 A;  4JI4 J;  3MMA A;  2DIT A;  4PXD A;  1CC7 A;  2QLF B;  1YJ7 A;  2L41 A;  3KK1 B;  2MB0 B;  3QYY A;  1P1L A;  3E2E A;  2ZC3 A;  2G0I A;  3IRW P;  2VOD A;  1D9D A;  3FEZ A;  2KI2 A;  1U2F A;  2OO4 A;  2MY8 A;  2CPY A;  1FF2 A;  3MD1 A;  1FNO A;  4C8L A;  2HVI A;  3NOC A;  4Y2A A;  1N5Y B;  2RQM A;  2X1B A;  1NUE A;  3EE3 A;  1VJW A;  5CYQ B;  4DG1 A;  1S9G A;  3A12 A;  4IR9 A;  2XO7 A;  2G9O A;  2YKM B;  2W8S A;  2CQ4 A;  5IJS A;  2W8L A;  2YPZ A;  3EVM A;  2XYG B;  5A76 A;  4GRS A;  3PX6 A;  4GO7 X;  3DRP A;  3SZ2 A;  3QT6 A;  1CUL B;  1O99 A;  4C2M A;  1TL1 B;  4EBC A;  3MPU B;  4QIV A;  1NRK A;  1F5A A;  4Q8E A;  3H5X A;  5A8K A;  1NU4 A;  2RRB A;  4OZ5 A;  1FRJ A;  3EZU A;  2QSW A;  1FDA A;  3N0V A;  4H4O A;  2C3M A;  1NPK A;  2V9K A;  3OPK A;  2HHH F;  3VGV A;  3T1Y J;  1FNX H;  1N5V A;  1NJI T;  4GTY A;  2W5W A;  3JSB A;  4USV A;  2XY7 A;  2MKI A;  4ER8 A;  2QC3 A;  4AND A;  2KH9 A;  3HVA A;  4A8K A;  2UUA F;  1C4A A;  3G6E S;  2CAJ A;  4LF7 F;  5KFQ A;  2CNK B;  3T9Z A;  1WC5 A;  4X4P A;  4PQA A;  2VQR A;  1EJ7 L;  1T9Y A;  2CPE A;  5C7P A;  4B56 A;  2F7V A;  1QAI A;  4ED7 A;  3EZO A;  4NE9 C;  4CI0 B;  7AT1 B;  3DFE A;  3AD9 C;  2OD6 A;  2I0X A;  2IM3 A;  5GAG U;  3M6W A;  3MPW A;  1FD8 A;  4Y65 A;  2FGO A;  2OUG A;  4HTI A;  3UDV A;  4AL6 A;  2Z8Q A;  5B09 A;  2ZH6 A;  4YHH F;  1X4H A;  2MZJ A;  3EPI A;  1WC1 A;  3H90 A;  3QT5 A;  3E8O A;  4B9M A;  1TTH B;  2DNL A;  5E33 A;  3UW1 A;  4IFY B;  1B7F A;  2NPF A;  3RBZ A;  1XMQ J;  2ILY A;  5DDR C;  1TV6 A;  2A10 A;  1VBZ A;  2RQC A;  1C0U A;  4C8N A;  2H4W B;  1YIT S;  3IAM 9;  3ITH A;  5DLW A;  4Z2X A;  4LF6 F;  5K14 A;  1VGY A;  3X3U A;  1MRO B;  2EWH A;  3MM6 A;  5L1I A;  2WB1 D;  4DCO B;  2HFU A;  1GEH A;  2K1R A;  2LFV A;  1XNR J;  1X0P A;  3NRB A;  4TN0 A;  3DLG B;  5HN0 A;  3E3X A;  1TU0 B;  3IFE A;  3HI9 A;  4P10 A;  2O66 A;  3A8I A;  2OIH A;  4OYW A;  3KYL A;  3RR7 A;  5GME A;  1OS5 A;  3WC2 A;  1F5C A;  1FDN A;  3HJV A;  4C6A A;  1MMN A;  2XGP A;  3OUY B;  3FFI A;  1VLO A;  5DLV A;  4QJV A;  1PYS B;  1WC0 A;  3DLL Q;  3MM7 A;  5HMY A;  1KP6 A;  5KT2 A;  2PC6 A;  1GAO A;  2MLZ A;  4LMZ A;  4Q2L A;  1U8S A;  1QY7 A;  2AHO B;  2YNG A;  1ZET A;  3M6U A;  4PG7 A;  4CZC A;  2RSQ A;  3Q8U A;  4M5H A;  3UCU P;  3HSJ A;  5CHC B;  2FDN A;  1JKH A;  2CQ0 A;  3O44 A;  1X5O A;  4O0I A;  3G9C A;  3I4H X;  2O5D A;  2C1E B;  1IR0 A;  3WAY A;  3V6D B;  5F3T A;  2F8M A;  4UY8 T;  4YR2 A;  3A3N B;  3QWP A;  4QR1 A;  3HHL B;  2FJB B;  2AQ4 A;  1RCX B;  1R0B G;  3BZQ A;  5LSL A;  3OR2 A;  1KHN A;  4RX6 A;  4K4Z A;  1HQE A;  3BDE A;  4FF1 A;  3IC1 A;  3QBC A;  2ATL A;  3PYD A;  4BS2 A;  5HQ8 A;  2P5V A;  3W5Z A;  1C1C A;  1WHY A;  3OXL A;  1C0T A;  4ZVO B;  1AZS A;  1ELZ A;  5KFE A;  2YNI A;  4J7C A;  2ADB A;  2VOP A;  5D78 A;  3OW2 R;  4M5J A;  2APO A;  2VPW B;  3ONQ A;  3CC4 S;  1JLQ A;  5EGH A;  2XMT A;  2HAI A;  4X84 A;  1AJD A;  1Q78 A;  3QLH A;  2MQN A;  2GIR A;  1NKE A;  4JI4 F;  4GTZ A;  1HBU B;  3H20 A;  2KJW A;  1SVD A;  3UDC A;  3BQ0 A;  4QOT A;  1K44 A;  3TRG A;  2KXN B;  3OTE A;  5KFZ A;  3BDH A;  4ED5 A;  2DBB A;  4DL2 A;  2QYG A;  2QZU A;  2K2P A;  3MUR P;  2F8H A;  3BBF A;  2HQG A;  4ZKA A;  4E0D A;  1D8Y A;  1HHS A;  4UOH A;  3A52 A;  5AE2 A;  5KFN A;  4KO0 B;  2W5R A;  2W9C B;  2WW4 A;  4FS1 A;  3B54 A;  4KGV B;  5IV4 A;  2B4P A;  1IBK J;  4GC6 A;  3V4I B;  3AXK A;  3NEK A;  4NLG A;  2ZZN A;  1CSJ A;  3I9V 9;  1NK5 A;  5L9N A;  5D0H A;  4DR4 F;  1NZ8 A;  2WSC C;  3BQ2 A;  1EHW A;  2HAF A;  4OZ2 A;  2HBR B;  2V8G A;  2QLW A;  1UVI A;  4OYB A;  5AJ3 J;  3QT8 A;  3ZTP A;  4N76 A;  3MCO A;  5A0Y A;  3PTW A;  4DX5 A;  2CZ4 A;  1HYS A;  3BO3 A;  2HBZ B;  3H5U A;  3HFK A;  3LXQ A;  2VFU A;  3ZTO A;  2VA2 A;  4RW4 A;  1P49 A;  2G2Y A;  3PW7 A;  1ALK A;  2IMW P;  3M4X A;  4ZCK A;  3SFU A;  3J81 Y;  3T1Y F;  2YX7 A;  2C28 A;  5IQQ A;  2AGO A;  3KTQ A;  4DWI A;  4X2B A;  3SDE A;  4HI2 A;  3Q8Q B;  1W2I A;  5EGE A;  2FVR A;  1VCT A;  2DK2 A;  5T7L A;  3R5C A;  2CIM A;  1JLF B;  2HNY A;  2C2K B;  3KUG A;  3IR6 B;  1KQK A;  4RUA A;  3I32 A;  3NY0 A;  5BYR A;  3PZP A;  3TUJ C;  1OSD A;  4JYA J;  4H4M B;  1G7C B;  5CCM A;  2IA6 A;  1B70 B;  1SIW B;  3CJS A;  1FCA A;  2DO0 A;  4ZPV R;  3HO1 A;  2XLI A;  4TXS A;  1LXJ A;  1NJX A;  4MTP A;  1H73 A;  1KVK A;  1NSQ A;  2NZC A;  2V8P A;  4ZJL A;  3W64 A;  3DU5 A;  3LAN A;  2PO4 A;  2OHD A;  3VAL A;  1GX6 A;  1BMQ B;  1R8C A;  1IQZ A;  3W62 A;  3RU0 A;  3GFY A;  4DL4 A;  4OJ3 A;  1Q8K A;  1APS A;  3MED B;  1XMQ F;  1TKX B;  2HS4 A;  3QT7 A;  5HMX A;  4OI6 A;  5J2M B;  2DIS A;  4OHV A;  3ELH A;  3LUY A;  3ZC4 A;  4Q7A A;  2BXJ A;  4DL0 C;  1GMW A;  2FHM A;  3W8P A;  4CLY A;  2RS2 A;  1XNR F;  3KK3 A;  5EWE A;  2KB2 A;  3I87 A;  3CT9 A;  3UD5 A;  1NJY A;  1UW9 A;  1TP7 A;  4OJH A;  4DN0 A;  3MEK A;  4ZPA A;  1IM6 A;  3D6F B;  2LXI A;  5CD4 H;  4IOB A;  1VJQ A;  3CE8 A;  4YDX A;  5DQI A;  2CQG A;  2EK1 A;  4IRC A;  5DO2 A;  4AXI A;  1FRM A;  2WVB A;  4ILL A;  1U1R A;  3HM9 A;  4CO3 A;  2BW2 A;  2KKH A;  1U1K A;  2E5H A;  3KMQ A;  3ETM A;  4O3Q A;  3R1L A;  3CO0 P;  3NKP A;  3K2Y A;  3IGN A;  2QEX S;  3TVK A;  2XLK A;  3Q23 A;  2OPR A;  1KVI A;  3M6V A;  4R5P B;  1X4A A;  4OYX A;  4ZCM A;  2CG4 A;  2CQC A;  4X4U A;  4ANE A;  1KTQ A;  1N6Q A;  5KG1 A;  2D1C A;  3PEJ A;  1SQG A;  3MR5 A;  3SSR A;  3KNG A;  3BDP A;  2ADC A;  2BDP A;  2GLQ A;  2YBV A;  2QJ3 A;  2VG5 B;  5LMN J;  4DR3 F;  4OZJ A;  2P6S A;  2HHU A;  2VC1 A;  4WII A;  4ZHR B;  1AJA A;  4FYD A;  1FK9 A;  4ID5 A;  4CLF A;  4A47 A;  5HQL A;  2JX2 A;  4M5N A;  4ENO A;  5D6G A;  4MIB A;  1HBM A;  1KC8 T;  3ZZP A;  1H7W A;  4HDG A;  3CMA S;  3WIU A;  3K89 A;  2PI5 A;  3PKM A;  1XR5 A;  2DNQ A;  3M8P A;  1YQH A;  3CJ4 A;  4F67 A;  3SI8 A;  3KKF A;  2KVQ E;  2EFV A;  1SQE A;  5ITH A;  3CXC R;  3K17 A;  2RRA A;  3ILI A;  3RRH A;  4UF4 A;  4OX8 A;  1WWH A;  1MW7 A;  2QLB B;  1O8B A;  2C3P A;  2I1R A;  4KR0 B;  5LM7 E;  1LWE A;  3KFW X;  4TYA A;  1VQY A;  1S4F A;  3DXS X;  4W90 B;  4M5L A;  2ZHA A;  4L72 B;  1DZ5 A;  3OBI A;  2BRL A;  5CYJ A;  3G6V A;  2Z30 B;  4CM2 A;  1D9A A;  1T05 B;  1HWJ A;  5L1L A;  3HVT B;  2FUG 9;  3WX8 A;  2OEL A;  4WKY A;  4UOG A;  1X0F A;  3DYA B;  3M2R A;  1IBK F;  5KFT A;  4B3S J;  2HS0 A;  1OWX A;  2BJ9 A;  1U25 A;  2HHS A;  4A4J A;  3JAM U;  4B9L A;  1Z2Z A;  1F9H A;  1S4E A;  2YKA A;  5LMU J;  2CPZ A;  2AYM A;  4K4W A;  4RU9 A;  3WAX A;  5AXK A;  3BM7 A;  5KFK A;  2G9Y A;  1YZ6 A;  5DGA A;  5AJ3 F;  3KHG A;  5K5M A;  4N47 A;  5GAH U;  4FBT A;  4KV8 A;  3W65 A;  2F63 A;  1ALI A;  1RTI B;  1G3O A;  2QFI A;  4P74 A;  1SL1 A;  4KH1 B;  1CVJ A;  2FVC A;  4LSN B;  2MQ8 A;  1NLK L;  3GSD A;  3I5B A;  5AXN A;  1LWC A;  3BH6 B;  1T03 B;  1RAF B;  3PYE A;  1FXD A;  3ZZ0 A;  2OKQ A;  1WD6 A;  4XK8 C;  4DZD A;  1FES A;  2CFX A;  3OFG A;  4P52 A;  4LBP A;  4HHU A;  2YWH A;  2QSF A;  4DF4 A;  1KFD A;  1PJ7 A;  3D3B J;  3M2U A;  4NYO A;  5EWG A;  3A8J A;  1FRH A;  2WSE C;  3M1V A;  1VQ6 S;  1XR7 A;  2FHJ D;  4MFB B;  2I5J A;  3RBD A;  4JYA F;  4FPR A;  4KSE B;  2FJE B;  2HRU A;  3JTP A;  1V5V A;  1KLM A;  2YWG A;  4L3N A;  2ZKT A;  1KKH A;  3MHY A;  4UT4 A;  2VKR A;  1JLE A;  3R6L B;  5H9F J;  4A8Y A;  3G8Q A;  2ZH5 A;  4M5K A;  3PW0 A;  3M30 A;  2GQQ A;  4ECV A;  4NZ0 A;  2R2S A;  1Q0N A;  2OD4 A;  3KMS A;  3CJ0 A;  5C24 A;  4LRB A;  4OQJ A;  4JOU A;  4PAB A;  4DU8 A;  1NBE B;  4NYZ A;  2HZC A;  2V2Z A;  4KAV A;  3DLB A;  2LCW A;  2IFX A;  2U2F A;  1EI6 A;  1Y00 A;  1GT8 A;  4YR1 A;  2Z58 B;  2HHX A;  3KJN B;  3H25 A;  5F9L A;  3VAG A;  2WSF C;  3QMQ A;  4Y00 A;  1RDR A;  3P45 B;  1SC1 B;  1ZA2 B;  2F9J A;  4IFV B;  3T5H A;  3GJS B;  2CDQ A;  3CIZ A;  3DOM A;  1QVG R;  4IG0 A;  3GZ7 A;  2B0G A;  2Y0B B;  1M5H A;  3P8B B;  1U2R A;  3T6B A;  3I6P A;  1YG0 A;  2CNL B;  1FRI A;  2M5Y A;  3SV4 A;  1E6Y A;  4E2F B;  4M63 A;  2ZE2 A;  3SQG B;  4DEZ A;  1Y3J A;  4JI7 J;  4PUO B;  1WOO A;  4F2S A;  3ICL A;  2KT3 A;  5M2U A;  4B02 A;  2FJW A;  3VZI A;  5H9F K;  4QWC A;  4QU6 A;  3H59 A;  4ZCL A;  1KQF B;  3I5A A;  2F9D A;  4OFZ A;  3DDK A;  1UEV A;  1NJW A;  4ERD A;  1UEK A;  2OJ3 A;  1RA7 A;  5LMN F;  5IT9 U;  1CBK A;  4I7F B;  3DM2 B;  1XNQ F;  2J0S D;  3LP2 B;  5JMN A;  1CJV B;  4MK9 A;  1FER A;  3O3L A;  1LKZ A;  3H5S A;  3JQM A;  1QTN B;  3DOL B;  3PNI A;  3MPD A;  5KG5 A;  1U49 A;  1IKV A;  4JI3 J;  4OI3 A;  4ETX A;  1TAQ A;  1NEE A;  5F9N A;  4EMD A;  3C6U B;  4EBE A;  3D28 A;  1JJH A;  2C3Y A;  1UZD A;  3GMG A;  4U7U D;  3B82 A;  1F2H A;  4PQU A;  4RW7 B;  3N6L A;  2IAJ A;  2G1H A;  4WFY A;  3R97 A;  3WX4 A;  3QJJ A;  2HWT A;  2D3U A;  1UFK A;  3LP1 A;  5B7W A;  4ZJO A;  1TUW A;  4ED8 A;  1U1L A;  3CDB A;  2WW8 A;  2XMA A;  1O6X A;  4NLT A;  2BW7 A;  2V9W A;  3IR5 B;  2G4B A;  2CPJ A;  1CJK A;  5LIA A;  2JWN A;  3EX7 B;  1LNQ A;  5IZH A;  3NBP B;  4NRU A;  4CO1 A;  1QD1 A;  4ZDN A;  3K8V A;  3NGT A;  3AA8 A;  2OFH X;  1N88 A;  2CA9 A;  5LJ5 Y;  3M8R A;  4XPE A;  1NH8 A;  1PSD A;  2MTL A;  2GCF A;  2ZBQ A;  4B3S F;  1QUP A;  1S6Q B;  5KFO A;  1S1W B;  1T7P A;  4CLL A;  2W8K A;  4HDH A;  5J2P B;  3FRZ A;  1C1B B;  2AEM A;  6FD1 A;  2OSR A;  1RLC L;  3EJM A;  1LK7 A;  2QMW A;  3NG8 A;  3WIV A;  5DRK A;  3VR1 A;  1TEL A;  4D3H A;  2GSO A;  4CLP A;  4CO5 A;  1Y0H A;  1WDD A;  3QWU A;  2MSS A;  2IRU A;  1S49 A;  3KLG B;  1BQM A;  4OX7 A;  3M8Y A;  1F5B A;  1KH9 A;  5B08 A;  3MUV P;  2W2P P;  5J1N A;  3L9Z A;  3GFH A;  2RS8 A;  4DL5 A;  5L8R C;  3M9N B;  1X4B A;  1T02 A;  2R9L A;  1QUV A;  3W9J A;  1AFI A;  3HF5 A;  2KDO A;  4WXW A;  3MFI A;  3MCN A;  2PE8 A;  2KTQ A;  2QA1 A;  1KHJ A;  2XS2 A;  1TKT A;  2HFN A;  2IVY A;  4UPL A;  3BH7 B;  4QWA A;  4JI5 F;  3PVX A;  1ALJ A;  3HHN B;  3O8W A;  2C42 A;  5IV3 A;  3V6H A;  2HFO A;  3C14 B;  3MAH A;  5KFJ A;  4KT0 C;  2NXN A;  2ACM A;  3MEE B;  1GH8 A;  3PRD A;  2JFD A;  1FDB A;  3DLK A;  2J7W A;  4P2F A;  5I42 B;  1ELX A;  4OLP A;  1X4E A;  2RF2 B;  2IUC A;  2VBW A;  4NLW A;  3UR0 A;  2CJQ A;  2XMU A;  4EFA C;  3CCS S;  3IWN C;  2BBE A;  2BAN B;  2B4V A;  4QIG A;  3M8W A;  1NSA A;  4MIW A;  4G1P A;  3HKZ D;  2PMW A;  1KLN A;  2B5J B;  1T9X A;  3MEG A;  1D0E A;  1HWI A;  4C98 A;  4L6V 3;  3UE2 A;  3OL6 A;  1YJU A;  1X9M A;  1HIY A;  2LKZ A;  1EQJ A;  5E3C A;  1T9W A;  3B6B A;  4H54 A;  3CO9 A;  3ZO7 A;  2W2Q P;  2W7O A;  1BWV A;  1NND A;  1HNX J;  3DRX A;  1MU2 A;  1UPM B;  1VHI A;  4PPZ A;  2HVE A;  2Z57 B;  3UN3 A;  2Y9H A;  2I2Y A;  3BF4 A;  4QIF A;  4OHW A;  2MKS A;  4C11 B;  1RJJ A;  1BQX A;  3JB9 k;  4C0H A;  5CD4 A;  1BHN A;  3J80 Y;  1NME B;  1G2E A;  3CJK A;  4B9V A;  1S1U B;  1Q8L A;  5KG3 A;  5K9F A;  1FKO A;  3I56 S;  1HL6 A;  3VAI A;  2RVJ A;  1RWU A;  5HAO A;  1OQ6 A;  1RA6 A;  2IBO A;  1NB2 A;  3PRB A;  4CIO A;  5DM7 Q;  4IUF A;  2PFD A;  1XR6 A;  4NOH A;  3AY0 A;  3WBH A;  4KPC A;  1S0V A;  2DB1 A;  3ZZT A;  4KAI A;  2F4V F;  4JI7 F;  3DRS A;  4RLE A;  4OI4 A;  3AFG A;  3CCQ S;  1E6V A;  2LXU A;  2CKW A;  1S48 A;  1PBU A;  1P9Q C;  3HZE A;  3TYT A;  1ZEF A;  4JI2 F;  1TMM A;  2DH9 A;  5EN1 A;  1BY9 A;  5FDL B;  3T5L A;  5KXA A;  2ZBC A;  2DXF A;  2AYB A;  1J5O A;  4PEO A;  1YBA A;  2XSF A;  3PX0 A;  3TZW A;  1HWU A;  2PII A;  1S1V B;  1SJR A;  4JI3 F;  2PEH A;  3MAA A;  1RE1 B;  1BQN A;  5HAN A;  1YK9 A;  4Y3C A;  2DNZ A;  2NZ4 A;  2CJ9 A;  3TR5 A;  4IH7 A;  1BUX A;  3TEH B;  2DD8 S;  2HFS A;  1U09 A;  2IHR 1;  3NCQ A;  4GMK A;  1RT3 B;  3QID A;  1WTF A;  3GYG A;  1NXI A;  2OI2 A;  4NLP A;  2NXC A;  3BYR A;  3D3C J;  1VIO A;  2GGP A;  3M7V A;  3KLV A;  3S7R A;  5I3Q A;  3EYZ A;  3V6K A;  2ALY B;  1W7W A;  5BR8 J;  2PEB A;  1WAC A;  4V19 X;  3OR1 A;  1WC6 A;  1L3U A;  4ID8 A;  2GMH A;  4LRA A;  4X4T A;  3KNA A;  3N9U C;  1SKS A;  4N8N A;  3LTO A;  5BXI A;  1R6V A;  2DNR A;  5GMD A;  3ED4 A;  1YJ9 S;  2CYY A;  5GMK a;  8AT1 B;  4K4U A;  1SB6 A;  2M88 A;  4NPO A;  3KLI B;  1U0H B;  4C9D A;  1Y5N B;  4UZC A;  3FJ2 A;  2NSC A;  4YR0 A;  3GCX P;  2AX0 A;  3RG6 A;  4DX7 A;  5DQH A;  1D1U A;  2RE1 A;  1HMV B;  3ZZR A;  1YWX A;  4XIU A;  2CNN B;  2JNJ A;  3G86 A;  3L09 A;  4OYA A;  1UA0 A;  3MR3 A;  3MMB A;  5D4L A;  3JQJ A;  1H72 C;  3FDS A;  1FX4 A;  4LFC J;  3C15 A;  1VBK A;  4OHX A;  3OV7 A;  3QO9 B;  2CZ9 A;  4DL7 A;  1H2T Z;  3QFW A;  4ZPB A;  4O44 A;  3J81 U;  3FSX A;  4B3T J;  3N01 A;  2H5I B;  3M2V A;  3HHL C;  4MIV A;  4YUD A;  2VBZ A;  1U1O A;  2VFV A;  4ELV A;  4CLS A;  3JTO A;  1FEH A;  4JI0 J;  2BJ7 A;  2FHK A;  2HYI B;  4DF8 A;  3IAS 9;  4FF3 A;  2B56 A;  4P6Q A;  3FSI A;  2VZ9 A;  1U1M A;  3T19 A;  1B0T A;  5IM0 A;  1ZAW A;  3D4J A;  2YPY A;  1AYE A;  3M32 A;  2UUT A;  3HD2 A;  1EIY B;  3PYF A;  2CWK A;  4F4Y A;  2E1C A;  4HAC A;  4O3O A;  2G2Z A;  3KJQ B;  1TZ0 A;  4ZVH A;  2VF3 A;  2LLZ A;  5HI7 A;  3WHI A;  1RHQ B;  1YVF A;  1WOR A;  2FVS A;  3G6X A;  3MOJ B;  1HNI A;  2VB6 A;  5GAD I;  5DS7 A;  1QE1 A;  1JLC A;  2HNZ B;  1Q86 T;  3Q3Q A;  3IWX A;  5IFM A;  2XY5 A;  4K50 A;  2G0C A;  2IYG A;  4IYQ A;  2F65 A;  4I2P B;  4ZP6 A;  2HLT A;  4ECU A;  3R7B B;  3KJV A;  4OIX A;  4USH A;  1YDL A;  3FUY A;  3KLH A;  2HIY A;  2V2K A;  3ISN D;  3G4S S;  2JC1 A;  1WG4 A;  5A2Q Y;  1JLG A;  4IRD A;  1HWK A;  3V81 A;  3AAW B;  4FPI A;  1NKC A;  3KOA A;  3OJU A;  4F4Z A;  4YOE A;  2ZD1 A;  3JYT B;  1P27 B;  1JXL A;  2UUC J;  3MGJ A;  1ZH5 A;  3MUM P;  2N82 B;  2Z0G A;  2QFJ A;  3RB0 A;  4FBU A;  3KK1 A;  1NSK L;  4K4S A;  4PXE A;  2J9C A;  3I0R B;  1FFW B;  3Q2S C;  4C3K A;  4X4V A;  4I0W A;  4L75 A;  1HNX F;  3QJL A;  2WZ1 A;  1DQ8 A;  3NCP A;  4NZ6 A;  3PR4 A;  1HKA A;  2IM1 A;  2MZQ A;  3QPI A;  4EU0 A;  5KFM A;  1CC8 A;  2BAB A;  3QIP B;  4DSE A;  2V4R A;  1Q1K A;  3BKT A;  1N5Y A;  4EO6 A;  1PJ6 A;  4NCG B;  4RPF A;  1RP5 A;  5A6P A;  5C42 B;  5CYQ A;  1K0T A;  4OJ1 A;  2HND B;  3NKQ A;  2EK6 A;  2L9W A;  2JLE A;  1M1H A;  2YKM A;  1EX8 A;  2ZWO A;  4USM A;  2ATC B;  3FEX B;  3NKY A;  4K4T A;  1UL3 A;  4K4Y A;  4NMX A;  1CUL A;  1TL1 A;  2XQC A;  3BGF A;  5D15 A;  2BJE A;  1U0S A;  3QAU A;  3G87 A;  3NMA A;  1KFS A;  4RNN A;  3KG4 A;  1F0X A;  4M5G A;  3QAE A;  4DZ6 A;  4C3M A;  5IT0 A;  2ZKU A;  5A8R B;  3CCV S;  1OY6 A;  3J7Z T;  4WK1 A;  1UVN A;  1UMJ A;  3U7J A;  4XDD A;  2W7A A;  3THP A;  1EKS A;  4XTT A;  1EQ0 A;  3GG0 A;  3B78 A;  3TAR A;  3ILO A;  4I69 A;  4TYB A;  5ETO A;  3KD8 A;  2KL8 A;  3OL9 A;  2B9X A;  4PPD A;  4JV2 A;  3BRE A;  4LRD A;  1S6O A;  3NL0 A;  4KAY A;  1FFS B;  1GXT A;  3IS9 B;  3RAX A;  3CC7 S;  4G3I A;  1WSR A;  1YJT A;  1VQK S;  1H0H B;  2EFO A;  3VWS A;  2W24 A;  2IJR A;  1UFL A;  3J7Y U;  3QGP A;  4HVZ A;  4ES1 A;  2B3T B;  2EW9 A;  2DNO A;  3DMJ B;  2W7P A;  3X1L B;  2CJA A;  1N32 J;  1N2K A;  4WCE Q;  4ZGA A;  4DPY A;  3UNG C;  3DOK B;  1RI7 A;  3CED A;  4M5I A;  4IFY A;  5D3G B;  3DRR B;  2JH3 A;  1IKY B;  2FVQ A;  4NLU A;  5B0D A;  2ZZM A;  3JSY A;  2QG9 B;  1IWA A;  5E41 A;  2YH1 A;  3OLA A;  3AOA A;  1ANI A;  2CRL A;  5SUH A;  4BWM A;  2COL A;  1MRO A;  2GHV C;  1FVS A;  3H4B A;  5DM6 Q;  3IM8 A;  4AD6 A;  4EYI B;  3UDL A;  4LF4 F;  2DHS A;  4HLB A;  3KHH A;  2ALZ A;  3M6X A;  2H5E A;  4QPX A;  3DLG A;  2ZJQ Q;  3UNY A;  4HR2 A;  2MKJ A;  4RR5 A;  3BKU A;  5CZV A;  1EJJ A;  3CDA A;  2GW8 A;  4PCQ A;  1N33 J;  1X9W A;  5B0C A;  4LFC F;  2H48 B;  4KHR A;  2Y8Y A;  4HI1 A;  3QSI A;  3OUY A;  1RBL A;  2BJ8 A;  1MLA A;  3D1Q A;  1KQS R;  2FHO B;  4ZCI A;  2MZS A;  4O4G B;  3NVL A;  1FVQ A;  2QO3 A;  1YI2 S;  4KH0 B;  1BD6 A;  2FIU A;  1KWM A;  4DJB A;  4OJG A;  1B7Y B;  1XN9 A;  4G1Q B;  4ZMM A;  4FS2 A;  2R7Q A;  4C0O C;  1S72 S;  4M5D B;  4JI0 F;  3BN7 A;  1D3W A;  5M2P A;  3JQK A;  4LUB A;  3T1A A;  4C48 A;  1KNZ A;  2L9N A;  2P6T A;  3PY8 A;  3CJQ A;  4DX6 A;  4LSL B;  2BJ3 A;  2WK4 A;  4J9U E;  1RTD B;  1IM4 A;  2O67 A;  2UXC J;  4B17 A;  2BKP A;  3V6D A;  1IXK A;  3N28 A;  5THW A;  1HAR A;  2ZJR Q;  2CVE A;  2UU9 J;  1RHM B;  1UVM A;  2GNK A;  4CRJ A;  3DHW C;  2BZ2 A;  3BGO P;  2LA6 A;  3NGU A;  2DNM A;  2H3E B;  1HI8 A;  4DR2 F;  4QBU A;  1JLB B;  3EDQ B;  3VAJ A;  4YQW A;  4IH6 A;  3EZ5 A;  2FJX A;  4V1A k;  2R7X A;  3C8Y A;  2IM2 A;  2POK A;  1GMW D;  4X66 J;  3A8K A;  1URR A;  1VK8 A;  2AEF A;  3C66 A;  5KG4 A;  4A8M P;  2UUC F;  2DT9 A;  3DGP A;  4IQX A;  2JFK A;  5FLX Y;  3C16 B;  1EQM A;  1K0V A;  1HBU A;  1Y10 A;  3K5P A;  4RWX A;  4NYP A;  1ZS6 A;  4AL5 A;  3L7O A;  3BB5 A;  2EG2 A;  4KGM A;  1FD2 A;  4CLT A;  2DYA A;  2CJY B;  1OSC A;  3TAM A;  3GV5 B;  4UST A;  3KK2 B;  2LEB A;  3M05 A;  1Z1Z A;  3EGW B;  4K5S A;  2ZH4 A;  2W9C A;  4J9R A;  2AYG A;  1VC6 A;  2C22 A;  3DNC A;  1OPZ A;  4WFZ A;  2YQ0 A;  7FD1 A;  3VV2 B;  2UVR A;  3V4I A;  4HHH A;  3SCJ E;  3BGR B;  2DJW A;  1OYD A;  3TA2 A;  5L0K A;  5MLC V;  3HHD A;  3OTD A;  2V34 A;  3CJ2 A;  2RUG A;  3TG0 A;  5K8M A;  3PW4 A;  2KJV A;  3EMT A;  3BJY A;  2XSJ B;  5E3R A;  2QA4 S;  1HD1 A;  4MAK A;  5FJ4 A;  2ANH A;  4NA3 A;  4ZVP B;  2EG1 A;  4Q43 A;  3PFO A;  1NK8 A;  1LW2 B;  1Q4R A;  1RIS A;  4LFA J;  5AE1 A;  1N5S A;  4ZG6 A;  1QSL A;  1XIQ A;  3VHQ A;  2MHE A;  1FE0 A;  2HRY A;  4CLU A;  4P7V A;  3G8T A;  3C3L A;  3HX9 A;  2X1A A;  4FP9 A;  1ROF A;  1N0U A;  5DG9 A;  3RRG A;  2FGC A;  4DQR A;  5HMW A;  4RW8 B;  4JV5 J;  2VFS A;  4CH0 S;  1FXL A;  3OXF A;  4HH1 A;  3JSM B;  4NLO A;  1R3N A;  3CCU S;  3R27 A;  1JLF A;  5B0B A;  1WF1 A;  3JSR A;  1WEZ A;  2ZVS A;  1VRU B;  4TVA B;  2LVW A;  5JVG Q;  2MKC A;  1N4L A;  1PAE X;  1HQE B;  3P96 A;  4AT1 B;  4YEA A;  4NLR A;  3WBZ A;  4K0K J;  4H4M A;  4UY8 5;  3IRX A;  4JBC A;  1N32 F;  4I56 A;  1C0T B;  1WF2 A;  4M1K A;  2ZC4 A;  4NCB A;  2FQQ B;  2YNI B;  3OVA A;  5KFR A;  3THT A;  4F3M A;  1JLQ B;  4KPY A;  4DHV A;  3WAW A;  2ZH3 A;  3RJM B;  4UOC A;  1RT5 B;  3MED A;  1TKX A;  4YME A;  2D41 A;  3OHB A;  4WYW A;  1F2G A;  4OZN A;  2ZH7 A;  3SMZ A;  5J2M A;  2XZW A;  2R7O A;  3B4D A;  3LGM A;  2R4F A;  2FZG B;  2E9T A;  4XO0 A;  2KFY A;  2NXJ A;  1DBD A;  4A46 A;  2QYC A;  2NQP A;  1Y5L B;  1NDC A;  4FXW A;  1HNV B;  2J0X A;  1UTA A;  3Q0A A;  2XRG A;  5EUH A;  1SC3 B;  2YH0 A;  1NH7 A;  2ZH8 A;  5GVQ A;  4LQY A;  4O4R A;  1MG7 A;  3MPY A;  2NXE A;  3N6M A;  1IWG A;  1SJ1 A;  1TKZ B;  2J7U A;  1VMB A;  4LR2 A;  2AZ3 A;  1TL7 B;  2M70 A;  2MZR A;  2EKN A;  1V3R A;  2YWW A;  3BR9 A;  3FQK A;  3FBF A;  1R8A A;  2QRR A;  3HK2 A;  1TMJ A;  5FII A;  3CF5 Q;  4CWB A;  2E7V A;  4HH0 A;  3LW5 C;  2HG4 A;  4ZVQ B;  5A0Y B;  1ANJ A;  1HYS B;  3RUB L;  4ZVE A;  3C46 A;  4R5P A;  1BWE A;  4ZP8 A;  4PWU A;  5LQQ A;  1IKW A;  1VFJ A;  3W66 A;  2X1G A;  1B4S A;  4YFU A;  3TJ9 A;  1IKX B;  1FE4 A;  3SDE B;  3EGZ A;  1QAJ A;  2VG5 A;  1LFP A;  2V2V A;  3PW5 A;  4FNH A;  2UXC F;  2Y8W A;  4RUH A;  3GLJ A;  1H2U X;  2UU9 F;  1EP4 A;  4FXV A;  4LT6 A;  2ZHB A;  3LOU A;  4PZV A;  5E7O B;  2PA3 A;  8ATC B;  2CZV C;  1IBC B;  3GON A;  1ULR A;  3R6G B;  4DDF A;  3EVO A;  1DHM A;  2FD2 A;  2WVF A;  3TVZ A;  5ETM A;  1R89 A;  4XAK A;  3MD3 A;  5BJR A;  2YNH B;  1RWK B;  4CT8 A;  4KFB B;  3VCD A;  1AW0 A;  2LQJ A;  2RKI A;  1CLF A;  3QNW B;  4CTA B;  3WC0 A;  4P75 A;  2WHO A;  5DQG A;  4EBD A;  1GTH A;  1YJV A;  5HQM A;  1TL5 A;  5HBM B;  4CXK A;  1IVZ A;  1FXR A;  4ETZ A;  2RU3 A;  3HVT A;  2R7R A;  3Q89 A;  3HVW A;  2ZOM A;  3P5B P;  2DNP A;  3DYA A;  1RWP B;  3HKW A;  1FTC A;  2NUH A;  1FT8 A;  3QRR A;  1MWZ A;  4N56 A;  4ED6 A;  3FZ2 A;  2B51 A;  3M8Z A;  1NM2 A;  3QSY B;  1CEZ A;  4F4W A;  1PGZ A;  4QAX A;  4ZG9 A;  4CDI A;  3ZFV A;  3AB4 B;  3EXC X;  2JLF A;  4PAA A;  1Y11 A;  2B4U A;  2C2R A;  4MJK A;  4NA1 A;  2A3J A;  2XTJ P;  4KGX B;  1ZM3 A;  2M9K A;  3D0H E;  1RTI A;  2XMW A;  4A8O A;  4C7Q A;  2EXU A;  3T00 A;  5ETS A;  3RB6 A;  4DL6 A;  4F02 A;  4LSN A;  2XCP A;  2WON B;  2SXL A;  1L3K A;  4M8L A;  2BX6 A;  1N6Q B;  3N6N A;  1T03 A;  2WCX A;  2DGT A;  2W2N P;  2LDY A;  2N4D A;  1Y9O A;  4Y2M A;  4LF9 J;  1Y7A A;  3PJX A;  2FY1 A;  4JV5 F;  1HNW J;  2X3G A;  3O6Q A;  1NHU A;  3IBW A;  3WZ0 A;  5KT5 A;  3Q83 A;  1V3S A;  2KZM A;  2YY3 A;  3RB4 A;  3B5Q A;  4EK2 A;  5DDQ C;  3HSZ A;  2CDR B;  4DOZ A;  3CW2 C;  1KRP A;  4BBY A;  4HL9 A;  5BYQ A;  4LR8 A;  3FEY B;  9ATC B;  3POT B;  2V6A A;  4Q8F A;  2M8D B;  4MFB A;  2V8V A;  2XEX A;  1SQF A;  4EZ9 A;  1HBO B;  4K0K F;  1T9U A;  3P5T L;  5EWF A;  3QGH A;  4X4S A;  3QRQ A;  1HW8 A;  3CPW R;  1VQO S;  3U27 A;  5DZ7 A;  1M1G A;  3RW6 A;  3ZZZ A;  1N36 J;  2B8Q A;  3V4M A;  1TKD A;  1I1G A;  1S1X B;  2DXE A;  3TX0 A;  4J5O A;  3D0G E;  3ZTR A;  1P1T A;  1K7H A;  4P71 A;  4ZN3 A;  3BO4 A;  1LWE B;  1RT7 B;  2IVM A;  4O3P A;  1N5T A;  3MR7 A;  4EZ6 A;  3T3F A;  4F0M A;  4DU7 A;  7FDR A;  4OLO A;  2GJ2 A;  2W4P A;  2XG8 A;  5EX3 A;  2AV5 A;  5A8W A;  4PXB A;  4L73 A;  4M5M A;  3MMC A;  2HVH A;  4FVC A;  1KD1 T;  1HHQ A;  4FDI A;  2IJF A;  1XER A;  1DQ9 A;  3M2R B;  4DR1 J;  4ZVF A;  2UXB F;  3FC9 A;  2W4D A;  4IFV A;  4DV5 J;  1AJC A;  2OEJ A;  3IP0 A;  1JMT A;  1WDT A;  4KIA A;  1HPZ B;  4ECR A;  4AL7 A;  1LK5 A;  3R5J B;  2ZOF A;  5L1J A;  3HFV A;  3FBB A;  3PR5 B;  4DLE A;  5HK4 A;  4MIA A;  2V8D A;  3SQG A;  4ITS A;  1RXO B;  1KHL A;  3OJS A;  4PUO A;  1FRK A;  3NNH A;  1M90 T;  3SV3 A;  2DKO B;  4DUT A;  5I4M A;  4G65 A;  2HMI A;  2V0N A;  4KJG A;  4IR1 A;  2H5J B;  4I64 A;  4DFK A;  3G8S A;  4BDP A;  1KQG B;  3LH2 S;  5KFI A;  1VR6 A;  5K20 B;  2W4C A;  3ZZY A;  2DIU A;  1OPI A;  3QGI A;  4EEY A;  2ZBP A;  2Z2M A;  3DM2 A;  2HHQ A;  1NK6 A;  3LP2 A;  3NP5 A;  2J9E A;  3TA0 A;  1ACM B;  4MKB A;  2DRA A;  1VI7 A;  3L7U A;  2Q43 A;  1EET B;  4NWJ A;  4FZV A;  1DLO A;  3DOL A;  4FXD A;  1K9M T;  1XQI A;  3KWM A;  3LP0 B;  4PG6 A;  3W5Y A;  3EGN A;  4DFP A;  2HK3 A;  2FZC B;  3PX4 A;  1RWN B;  3CD5 A;  3C6U A;  4C0B A;  4F25 A;  2NSB A;  1ELO A;  4RWW A;  1WOP A;  1JWW A;  1WI8 A;  2UUB J;  4K5R A;  4P9S A;  5IWA J;  4IOC Q;  2BKO A;  4M95 A;  1AUS L;  2JRS A;  1SH2 A;  3CGI A;  1B99 A;  4I4B A;  4B08 A;  4ICL B;  2MPU A;  2FTR A;  3D2W A;  2IMO A;  5H9E K;  3PV8 A;  3TX8 A;  4ZN1 A;  1NSP A;  3W1Y C;  3TNV A;  4U95 A;  5C24 B;  3HDS A;  2XMK A;  5F8I A;  2QL5 B;  3NNC A;  2C3U A;  2WBR A;  3TP2 A;  5E3P A;  3NBP A;  3UPF A;  3PIO Q;  2JOQ A;  3FMB A;  1M5K C;  4LR9 A;  1RYR A;  3D1H A;  4TU9 A;  5L0B A;  3BSA A;  1UJ4 A;  1ALH A;  2BKN A;  3EPG A;  4R8U A;  5D0G A;  3QJP A;  5J1E B;  4OV6 A;  1KHK A;  1KHV A;  1S1W A;  2IYI A;  1BE4 A;  1X4D A;  3I0S B;  1RAJ A;  2P9C A;  4KQZ A;  5J2P A;  4P73 A;  1RT4 B;  1EAR A;  1C1B A;  2QIF A;  1GMV A;  4CO0 A;  8RUC A;  4YN3 B;  5HVG A;  3IM9 A;  2GS8 A;  4B3R J;  3SZY A;  4IG0 B;  4RW6 B;  1FKP B;  1S7H A;  2KM8 B;  4DPT A;  1NK9 A;  4CNY A;  3KLG A;  1SC6 A;  1N34 J;  3Q8S B;  4KY3 A;  1NO8 A;  1XTZ A;  1SJQ A;  1TR0 A;  1B64 A;  2VBX A;  4ATN A;  2XYH B;  4CH1 A;  5KT6 A;  4RU2 A;  4WWS A;  1NZA A;  2CAD A;  4CH7 A;  3BDF A;  3C14 A;  1H7X A;  4LF9 F;  3LGH A;  5HRO B;  2MZT A;  3MZI A;  2VD3 A;  3MEE A;  4IG3 A;  4KYZ A;  3ENW A;  1N54 B;  4QQB A;  2Y1J A;  2OP5 A;  2B9E A;  2IM0 A;  3P3D A;  5I42 A;  4KGK A;  2AKW B;  4AYB D;  2B7C B;  2RF2 A;  3TEG A;  1LW0 B;  1IKV B;  4GTW A;  1J2V A;  3OVS A;  2OPP B;  1LOU A;  1F60 B;  3ENA A;  3DN9 A;  3HZG A;  2BAN A;  2FY8 A;  1W25 A;  2BJD A;  1PIL A;  3TAN A;  1F3F A;  2DCU B;  4Q2M A;  1N36 F;  2B5J A;  2PA8 D;  1PO6 A;  2BE2 B;  1YHQ S;  2RDI A;  4GO5 X;  4F36 A;  4DUY J;  4B9N A;  1HWL A;  4J9Q A;  2NCK L;  4DV3 J;  1RSC A;  3HD1 A;  2ZH9 A;  1T8E A;  2WTF A;  5KFY A;  2EFP A;  3AOD A;  5D77 A;  1X5T A;  2D69 A;  1ED8 A;  1SHN A;  3ADA C;  1U1N A;  1U4B A;  5HSP A;  4NI2 A;  2D9P A;  2YQ1 A;  2ASL A;  2PMZ D;  3H4D A;  1WUU A;  2CJK A;  1X9S A;  5LT5 A;  4C11 A;  5EX0 A;  1MWY A;  3WAV A;  2UXD J;  2GVZ B;  2XNQ A;  3OXG A;  3R2C J;  3MR2 A;  4ZLP A;  1S1U A;  4I2Q B;  3W5X A;  3BV8 A;  4DR1 F;  2GHW A;  3KUE A;  4JB8 B;  1DTQ B;  1HQU A;  2IDE A;  3BSC A;  4QYR A;  2OEM A;  4R25 A;  2V69 A;  4USK A;  4B9U A;  2KVI A;  1RWW B;  1R43 A;  2M8H A;  2PGC A;  2VG6 B;  2XBP A;  3M9M B;  2C2N A;  4NWX A;  3ILL A;  2A2C A;  5GRR A;  1ZM9 A;  4ED1 A;  1N52 B;  2J5A A;  2YQ3 A;  4QWD A;  4ED0 A;  1UET A;  3OSN A;  4K2J A;  5KT4 A;  3CDU A;  5DET A;  4A8F A;  2VA3 A;  4FF4 A;  3MM5 B;  2R2T A;  1YZ7 A;  2ZH1 A;  4CYR A;  3CCW A;  2V63 A;  1S9E B;  3OL8 A;  4RBV A;  2PT0 A;  4WFN Q;  5FDL A;  4ECZ A;  4EGL A;  2CJX B;  4J9P A;  4DV7 J;  2FJD B;  4IQM A;  2D3O R;  2WB4 A;  4FDJ A;  1Q79 A;  1RBO B;  4UTG A;  1S1V A;  1KHW A;  3CIM A;  3J7A 1;  2DGS A;  2D7S A;  3PHT A;  4UOR A;  1PYO B;  3SEO A;  4LVN P;  4Y0F A;  1OQ3 A;  3PDN A;  1JNR B;  2AT1 B;  5FLX U;  4S0M A;  1SPB P;  3R9L A;  2NYI A;  2UUB F;  1NK4 A;  4DUZ J;  1RT3 A;  1IJE B;  1S97 A;  2YKP A;  1RAH B;  1NK7 A;  5IWA F;  2J6S A;  1VBY A;  2VPX B;  4ZIW A;  4DQP A;  2HWI A;  2E9R X;  4ELU A;  2LMI A;  3V6J A;  4RJV A;  3GV8 B;  5IC4 B;  2L9D A;  1K1S A;  4FKY A;  4ILM A;  2HWH A;  3DYC A;  2YWK A;  3OT9 A;  5DLT A;  2I9S A;  1HI0 P;  2QA2 A;  5CXT A;  4IO1 A;  5E0O A;  1TL3 B;  5A6W A;  2CVI A;  1VRT B;  4W98 A;  3PEH A;  4A48 A;  4LVO P;  2GSU A;  2LEC A;  4BHQ A;  3I9Z A;  5LRN A;  1TFW A;  3KLI A;  1U0H A;  3SZZ A;  1M1K T;  1I94 J;  4QZV B;  1HMV A;  3CJK B;  3U1N A;  4DSF A;  2YNF B;  3H98 A;  4ALZ A;  2MQP A;  1XMB A;  3ZTQ A;  1TVR B;  1M5P C;  3OTO J;  1K47 A;  3QO9 A;  1RWM B;  3FCH A;  1RQ0 A;  2HK2 A;  2ASD A;  3GJQ B;  3BDG B;  3TQ1 A;  1KTV A;  1IN0 A;  2CQD A;  2RRN A;  1S0N A;  3TAQ A;  4B3R F;  3J81 j;  3F41 A;  1U6F A;  3CJR A;  1UVJ A;  1RZM A;  4ZVR B;  3W2W B;  4G6V B;  2DVI A;  3JAM Y;  2B6A B;  2R2U A;  1N34 F;  2W5Q A;  2U1A A;  4N41 A;  5LRM A;  1R7I A;  1S79 A;  3OSP A;  3G96 A;  3DRS B;  4FYY B;  5DDP C;  3G82 B;  3MM8 B;  1SL2 A;  5AXM A;  2EFN A;  2BOA A;  4WF9 Q;  4DL3 A;  2DRD A;  4XPC A;  1Y4Z B;  2M2B A;  2KRR A;  1HW9 A;  3DDN A;  1N48 A;  4LF7 J;  1T94 A;  2AJ2 A;  3D1O A;  4RW9 B;  5HJY A;  5JVH Q;  4F0K A;  1YJW S;  2Q1L A;  4R0J A;  2R7W A;  1WHV A;  2HNZ A;  4W92 B;  1GMU A;  4EI2 A;  1WF0 A;  1SCJ B;  2BYC A;  3J7A N;  4OZ3 A;  3LGN A;  3MAA B;  1BQN B;  1FRX A;  1Y5I B;  2DHX A;  2V50 A;  1EW9 A;  4YB1 P;  4H4K C;  1U1P A;  4EUV A;  4Q0B B;  4QW8 A;  1D9F A;  1Q16 B;  3AJ1 A;  4Y2C A;  1WKL A;  2ROE A;  3JYT A;  4DV1 J;  2J8A A;  4DUY F;  4OI0 A;  3AD8 C;  4NLY A;  3QZ7 A;  2VDH A;  4V19 J;  2GSN A;  1T9T A;  2VPY B;  5KFL A;  4ZIT A;  2E9Z A;  1JJC B;  1S59 A;  2XO6 A;  2ZUA A;  3ET6 B;  2RNE A;  5HVH A;  3RGI A;  3H7H B;  2QE5 A;  3ZZO A;  4N5S A;  2AZ1 A;  1OY9 A;  1T95 A;  2Q3P A;  2LQ8 A;  4RO0 A;  3T5K A;  4OL8 A;  1RK8 A;  2KFN A;  2C3O A;  2MQQ A;  2YX4 A;  5KG7 A;  2V67 A;  2M0G B;  4USJ C;  3QIP A;  3W8G A;  1RAD B;  5HAT A;  2UXD F;  3NAH A;  2OSQ A;  4LBI A;  4NCG A;  5C42 A;  1UA1 A;  2HND A;  2Z2Y B;  4HKQ A;  2AGP A;  4WFA Q;  1REV B;  3MMB B;  3I31 A;  3O2I A;  5CYM B;  4DPO A;  3ETO A;  2OTJ S;  3LWM A;  3C15 B;  3UO0 A;  2H65 B;  5JXS A;  4M94 A;  3DCA A;  2HZV A;  4ECW A;  4F3Q A;  2Z56 B;  5F8L A;  5AE3 A;  4ZVS B;  2VG7 B;  2HFV A;  2CPF A;  3CVK A;  4ZPD A;  1YBT A;  3BS9 A;  4ELT A;  4P2X A;  1OIA A;  1VLY A;  3GE9 A;  3GIJ A;  2KHD A;  5A8R A;  4U7U K;  1DQA A;  1G1X A;  3IGZ B;  3N79 A;  1H98 A;  3KXD A;  3M8Q A;  2WVC A;  1E2S P;  4ED2 A;  3PO5 A;  5B0F A;  2AYE A;  3C6T B;  3DPC A;  2AF6 A;  3VVT A;  1WOS A;  3HSD A;  2G1D A;  3T02 A;  2VPZ B;  2FB0 A;  2MGZ B;  4GVL A;  3IS9 A;  2RHS B;  3I4P A;  3BQ1 A;  1UKU A;  3MK2 A;  3IDD A;  3DKD A;  4DV7 F;  1XJW B;  2R8I A;  3GQC A;  2ZH2 A;  3H0P A;  2MLX A;  4RKU C;  3IXQ A;  1PIE A;  1FHT A;  1CQN A;  5KAK A;  1VS3 A;  3FCV A;  3OFF A;  1SI9 A;  2QL9 B;  5KFW A;  1FWK A;  1KSP A;  4U8V A;  4RL1 A;  3DMJ A;  2GIQ A;  3VGU A;  3CB4 A;  4TY9 A;  2NRE A;  1NB7 A;  4ZVU B;  5G0R B;  3DOK A;  3RYL A;  1JLG B;  3CD7 A;  3V81 B;  3N4W A;  1MMD A;  1KEK A;  1L3V A;  2BVZ A;  3MEC B;  3PCO B;  5D3G A;  3H8Y A;  3DRR A;  1K8A T;  2LU2 A;  1IKY A;  3DI6 B;  5KFC A;  1FFG B;  1WEX A;  3U1L A;  3NOG A;  1RTH B;  1SIZ A;  1DTT B;  2IC3 A;  4B9T A;  2QGF B;  4G1I A;  3HLU A;  1YIJ S;  5LOQ A;  1GXU A;  2OPS B;  4WU2 A;  3SSS A;  2Z2Z A;  5KG2 A;  3N5F A;  4IRK A;  1QVF R;  1I94 F;  1SV5 B;  4TQR A;  3CSK A;  4MK7 A;  1WEL A;  3VVU A;  1SUQ A;  2BUN A;  1RHU B;  4TY8 B;  4DR4 J;  3BYP A;  4DSL A;  2BQ3 A;  1Q7Y T;  4J37 A;  1R31 A;  4LRC A;  1S6P B;  4X65 J;  3OTO F;  3A4T A;  3L95 X;  2Y1R I;  3MFH A;  3RZA A;  1Y7P A;  1F9E B;  4I68 A;  4O4G A;  3L3C A;  1UVL A;  1ZOT A;  5F8H A;  4USI A;  1MML A;  1AB8 A;  3ZNU A;  1RAE B;  4L76 A;  2DR9 A;  4G1Q A;  5HVF A;  4ES2 A;  3RR8 A;  4KHP J;  4M5D A;  2R8K A;  2BA9 A;  5HLF A;  1HNZ J;  5KOW A;  2OPQ B;  3OHA A;  1E33 P;  4DXL A;  3SXL A;  1ZAX A;  2DY9 A;  2H1Y A;  4QWE A;  1RT1 B;  1MN7 A;  1LFW A;  1LWF B;  3D6M B;  3FBC A;  4LSL A;  4BC7 A;  4CQ1 A;  3CJ8 A;  1RTD A;  2IJN A;  1NKB A;  4OX6 A;  3J7Z 5;  2UVW A;  1T0T V;  1RTZ A;  2HHT A;  4OYO A;  3A8E A;  1RAI B;  2RIJ A;  4CLZ A;  4ZA1 A;  4Q45 A;  1RT6 B;  4ZS6 A;  2N3O A;  1TK0 A;  1JLB A;  4MYU A;  3TZY A;  4F3O A;  3KDO A;  1SH3 A;  2YX1 A;  1ZYQ A;  5DZ6 A;  1RT2 A;  1V3Z A;  1BLU A;  1HLW A;  5C25 B;  1RGV A;  4HYK A;  1Q81 T;  4JI1 J;  1CJU B;  3NNA A;  5J2Q B;  1IQT A;  3MK0 A;  2B8P A;  1CJT B;  4IDK A;  4A8X A;  3W7B A;  3IA0 A;  2DHG A;  4DV1 F;  5LMU F;  2RH6 A;  4FVM A;  2O01 C;  3C16 A;  5KFS A;  1TL4 A;  4X62 J;  4X4N A;  3D67 A;  2C2D A;  2GV1 A;  2W5V A;  4PG8 A;  2BOP A;  3AJ2 A;  3MPV A;  4NLQ A;  3Q8V A;  2RU9 A;  2DTJ A;  1ZAV A;  3OLB A;  3AQP A;  2HEK A;  3NKN A;  3KK2 A;  1F9F A;  2WVD A;  1YSJ A;  2G0J A;  1YX2 A;  2IIH A;  5GAE U;  4H4K A;  3H42 A;  4KB7 A;  3IGY B;  2A6O A;  2CPI A;  1TQL A;  4YB5 A;  4L74 A;  1FNM A;  3PHE A;  4KC5 A;  1U6Z A;  1HBN B;  5CA5 A;  2RAQ A;  1S9F A;  3BGR A;  4PWD B;  2C2E A;  4UQG A;  5L46 A;  4Y2K A;  3FBE A;  4WP9 A;  4CXU A;  3KLF B;  3BSN A;  1URB A;  3G2X A;  4ZPC A;  3G71 S;  5ETK A;  4LF5 J;  1FJE B;  2XSJ A;  2OMO A;  3K5N A;  3HT0 A;  5F8G A;  1S99 A;  5L38 A;  3TOQ A;  3PM9 A;  4NXM J;  2E1M C;  2DR6 A;  1AJB A;  2DEJ A;  4ECS A;  3QQC D;  4GVB B;  3NGD A;  1ZZF A;  1LW2 A;  1VC0 A;  3IBC B;  2D1G A;  2LQ5 A;  4UOP A;  2HBQ B;  4B3M J;  5KFF A;  3SSQ A;  1DRZ A;  4AQY J;  1B8J A;  1QM9 A;  5L1K A;  1VQL S;  1PKU A;  4NA2 A;  3K5M A;  4K4X A;  2DRB A;  3GCW P;  2KT2 A;  2IVF B;  1RTJ A;  5J1P A;  1TFY A;  4DR3 J;  2IY5 B;  3TWZ A;  5GAG I;  3SYZ A;  4RW8 A;  2CUY A;  1AXQ A;  3Q8R B;  1T11 A;  2XS5 A;  4QR2 A;  3W2V B;  3D66 A;  4F04 B;  1NJZ A;  2GFF A;  3JSM A;  3MCS A;  1CPZ A;  1TK8 A;  1RU1 A;  1F1B B;  3FKB A;  3GIM A;  1VRU A;  4OZL A;  1SJ3 P;  3TUI C;  1S7I A;  4USW A;  3IG1 A;  1OJ4 A;  4OHZ A;  2ABY A;  2K8G A;  4I6A A;  3L4B C;  2AD9 A;  1VHF A;  1AA1 B;  1VQP S;  1PC4 A;  1UWA A;  2IFY A;  1FI4 A;  1X5P A;  5BYS A;  2AU0 A;  2YWF A;  3U1M A;  2A18 A;  3GIR A;  3QGG A;  2W9B B;  1RT5 A;  3L7P A;  3DGP B;  5LL6 d;  3UN5 A;  2PD1 A;  3NXZ A;  1S1T B;  1JIH A;  1Z2L A;  3VQS A;  1WC4 A;  3TA1 A; 
#chains in the Genus database with same CATH homology
 1E1Z P;  3MK1 A;  4CYS A;  2IUC A;  4NWX A;  2GSN A;  2W5V A;  3DYC A;  1E33 P;  3OT9 A;  1E2S P;  4TN0 A;  5GRR A;  2ANH A;  5DLT A;  3NKM A;  1N2K A;  4B56 A;  3TX0 A;  4ZGA A;  3NVL A;  1N2L A;  1KHL A;  1ANJ A;  1HQA A;  3T00 A;  3DPC A;  3NKN A;  1KHN A;  4LR7 A;  4MY4 A;  3TWZ A;  1Y6V A;  3T01 A;  3WAW A;  4KJG A;  1KH7 A;  3M8W A;  2W5S A;  1EW8 A;  5TJ3 A;  4ZG6 A;  1K7H A;  1URA A;  4MIV A;  4LRE A;  2W5T A;  2GSU A;  2W8S A;  3T02 A;  3WAX A;  3M7V A;  1ED8 A;  2GSO A;  3IGY B;  5LRN A;  1SHN A;  5LQQ A;  1O98 A;  2W5X A;  3NKR A;  4CYR A;  1ED9 A;  1ELY A;  4UPI A;  1E3C P;  2ZKT A;  2G9Y A;  5IJS A;  5K4P A;  3WBH A;  1KH5 A;  5INH A;  1EW2 A;  5L0E A;  3NKO A;  3BDF A;  2IUC B;  3MK2 A;  3SZZ A;  3IDD A;  3M8Y A;  3BDG A;  5DLV A;  4LRF A;  1KH9 A;  4N7T A;  1EQJ A;  1ELZ A;  4LRA A;  4LR9 A;  1O99 A;  1HJK A;  1ALI A;  3UN2 A;  3NKP A;  3WAV A;  1Y7A A;  4MHX A;  5HRT A;  1ANI A;  2GA3 A;  5L0B A;  4CXU A;  4CXK A;  2W8D A;  4UPK A;  5C66 A;  3ED4 A;  1URB A;  5EGH A;  1ALH A;  3KD8 A;  3LXQ A;  4CXS A;  4LRC A;  4ZG7 A;  4FDJ A;  3B5Q A;  4FDI A;  1AJD A;  1KHJ A;  1ZEF A;  4LRD A;  1P49 A;  2XRG A;  4NWJ A;  3UO0 A;  1ALK A;  4GTX A;  4UPL A;  1KHK A;  4KAY A;  4LRB A;  4GTZ A;  1ALJ A;  4UOR A;  4GTW A;  2XR9 A;  1FSU A;  3UNY A;  4LR8 A;  2IFY A;  5LIA A;  3CMR A;  4KJD A;  3MK0 A;  4LQY A;  1AJB A;  1EW9 A;  3BDG B;  3BDH A;  1HDH A;  3UN3 A;  1ZEB A;  4GTY A;  1SHQ A;  4UOO A;  5KXA A;  4KM4 A;  2GLQ A;  4LR2 A;  2W5W A;  5AJ9 A;  5DLW A;  1EJJ A;  3M8Z A;  2D1G A;  2QZU A;  1AUK A;  1AJC A;  4KAV A;  1ZED A;  4UOP A;  5L0K A;  1EI6 A;  3NKQ A;  5EGE A;  2X98 A;  5GOV A;  3UN5 A;  4UPH A;  3SZY A;  4YR1 A;  3A52 A;  2RH6 A;  1KH4 A;  3E2D A;  1B8J A;  4QAX A;  1ELX A;  1AJA A;  3Q3Q A;  3WAY A;  4ZG9 A;  3IGZ B;  5IJQ A;  2W5Q A;  2W5R A;  3TG0 A;  5LRM A;  2VQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...