4LREA

Phosphopentomutase soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lreA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lreA01
3UO0A 4KM4A 3UNYA 1AUKA 1ZEFA 1AJDA 3WAVA 3NKOA 1KH5A 3LXQA 4MY4A 3WBHA 1ALHA 1KHKA 3IDDA 4NWJA 4KJDA 1ANIA 2W8SA 4LRAA 3T02A 3UN2A 3T01A 2ANHA 4LR8A 4ZG6A 2GSUA 3Q3QA 3BDGB 4UPHA 5LRNA 4LQYA 4KAYA 3NKQA 5AJ9A 1KH7A 2W5QA 1ELYA 4MHXA 1EW2A 1EW8A 4NWXA 4CXUA 2XR9A 3NVLA 5LIAA 3TWZA 3A52A 4FDIA 3MK1A 4B56A 1E3CP 2GA3A 2VQRA 5GOVA 3E2DA 4CXSA 5IJQA 4LRFA 4MIVA 3MK2A 4QAXA 2W5WA 3TG0A 4LRBA 1EJJA 4GTWA 1K7HA 4ZG9A 3OT9A 4LR9A 4ZG7A 3B5QA 3M8WA 4LRCA 5IJSA 3ED4A 1SHNA 1E2SP 5L0BA 3M7VA 1URBA 3TX0A 3NKPA 1EW9A 1HJKA 1ED9A 2W5VA 3WAYA 4TN0A 2W8DA 1EI6A 1E1ZP 3NKNA 1HQAA 1ED8A 1URAA 1ALJA 1KHNA 4N7TA 1AJCA 1ELXA 4GTZA 5EGHA 2W5XA 5HRTA 3BDGA 4FDJA 3SZYA 1ELZA 1KHJA 3IGZB 3DPCA 3IGYB 3SZZA 5LRMA 3KD8A 2G9YA 5KXAA 5L0KA 1O99A 5DLVA 1FSUA 3CMRA 2W5RA 2D1GA 3BDFA 1ZEBA 5DLWA 2IUCA 2IUCB 2W5SA 4GTYA 5LQQA 3M8YA 4LR2A 1ALKA 2GLQA 4UORA 4CYSA 1B8JA 3WAWA 1AJAA 1SHQA 4LREA 2QZUA 3NKMA 1KH4A 2ZKTA 5EGEA 1N2KA 3BDHA 5K4PA 1N2LA 4YR1A 4CYRA 5TJ3A 4ZGAA 1HDHA 4UOOA 3M8ZA 4UOPA 5L0EA 1O98A 4UPLA 2IFYA 4LR7A 3UN5A 4KAVA 4LRDA 5DLTA 4UPKA 3NKRA 4GTXA 1EQJA 4UPIA 1ALIA 3WAXA 1KH9A 2RH6A 1E33P 1Y7AA 2W5TA 2X98A 2XRGA 5GRRA 4KJGA 4CXKA 1ZEDA 1KHLA 1AJBA 1P49A 5C66A 2GSNA 3UN3A 3MK0A 5INHA 1Y6VA 1ANJA 2GSOA 3T00A 3DYCA
chains in the Genus database with same CATH superfamily
1WHWA 1X4EA 2FHJA 4W4MA 5ETTA 3NL0A 1T05B 3T6BA 1CJKA 2O3DA 2DH7A 2UXBJ 2UXDJ 3BH7B 2DRAA 2W2PP 3RBEA 1YZ7A 2CA9A 2VD3A 4G1QA 2EFVA 1UVJA 2R7TA 1YDLA 1CLFA 2Z2LA 3L7PA 3PHEA 3WBHA 1ZA1B 2DXDA 4NWXA 5HANA 4J9LA 4B9MA 1KFDA 3BR9A 3W8PA 4H4OA 1TK8A 1LKZA 4KJIA 2EKNA 2K3KA 2V4JA 1XJWB 4N8OA 3A8EA 2IJFA 5LRNA 2K1RA 1TAQA 4PWWA 2W9CA 1IM6A 4O4GA 4EK2A 4TU8A 2KVQE 1FESA 1Q4RA 5DS7A 5HMYA 2Y9HA 1PC5A 1NPPA 4DV4J 3SI8A 2BX6A 2E66A 2PFDA 4IG3B 3W65A 1P8GA 5I3UB 3GP9A 1LWCA 4LQ3A 4B3MF 4LSZB 4MKYA 3MK1A 1E3CP 4U8YA 3TAMB 5M2RA 2YQ3A 3WC2A 2KXHA 1TZ0A 3S7RA 4RUCA 2XLIA 4ID8A 4K4XA 3RBXA 1AUDA 5KFJA 2XULA 2RS2A 1XMOJ 4FF2A 2HGMA 1O8BA 2EK6A 1VFJA 3B54A 2JEJA 1X4BA 1C1CB 3SBMA 3VAGA 4DR5J 4ECVA 3IWNC 5E33A 1JNRB 1SV5A 3CPWR 9ATCB 5A2QY 1X60A 4NASA 3W2VB 3KLIB 4JI1J 2PMZD 1SQGA 3NGKA 1PKUA 4DR1J 5HBMA 3ZXWA 2XYPB 2UUBJ 4FXWA 2V2QA 2VPZB 3NGRA 4TN0A 2R3VA 2RRBA 1S49A 1ZM3A 4Q2LA 3SDEB 3QJLA 3P5TL 3QIPA 1P6TA 4CRJA 2UU9J 2HS4A 4ATNA 5C24B 3M05A 3U1LA 3RRHA 3H2LA 3W3SA 4QU6A 1KHJA 1HARA 4WYLA 4HTJA 3PO4A 1XMQF 3TUPA 3MD1A 5KFCA 2Q43A 1URRA 2ZBRA 3I9ZA 1MROB 5A76A 2W5RA 4WP8A 1ZEBA 1BQXA 5KFLA 2PMHA 4DQIA 2DGUA 3DLGB 3PJ9A 3EJMA 3LANA 4NL5A 4XAKA 2Y1LB 3M30B 2CG8A 1S4FA 4OX8A 2QRRA 3C8YA 4K4UA 3TAMA 1JLGB 1SC6A 3QZ8A 1U26A 3MAQA 4UZCA 4Z7CA 3HO1A 3SCLE 1BGXT 1WC1A 4AFFA 3I56S 1F0XA 4DJBA 2F4VJ 3QRRA 1WG5A 2BACA 1OYDA 1R27B 4M5NA 5F8LA 1NDLA 1YKWA 2ZKTA 3IAS9 5DDQC 2MQOA 4ZA1A 3UWTA 2ZDOA 2Q66A 4DL6A 2ZBPA 4O3QA 5HQLA 4Y2CA 2COLA 1P1TA 1L5UA 1XTZA 1IJFB 3IG1B 4DF8A 4DFKA 3KLIA 1F5AA 4QYZK 2EEYA 3G71S 3MF5A 4B17A 3NOCA 2HNZA 2BMBA 2IVFB 2A3JA 3UDLA 1W25A 5L0EA 4DL5A 2HLUA 1RWKB 4LRDA 1Q8KA 1SC3B 1XR6A 2ROEA 3UR0A 2AQ4A 4UPKA 2I0XA 2DHGA 4EBEA 3A3PB 9RUBA 3UDCA 4ZCIA 2HBZB 4F4YA 1RT2A 4ZJLA 4YOEA 4YY3J 3W62A 1HR0J 3OFFA 3G6XA 2NQPA 2DNPA 2CNKB 2C3OA 2KYZA 1TL5A 4A8WA 2AJFE 4ANCA 5IM0B 1T9VA 4S0MA 4DMZA 4IFYA 4YR2A 4DR1F 2GSOA 4LJMA 2NXCA 3KLGA 3RU0A 2PFFB 2GGPA 4CNZA 3IMQJ 3M8PA 4K8RA 1QM9A 3KLFA 2AT1B 3K5LA 3LUYA 3ICLA 3TARA 4HI2A 3MD3A 5KG7A 1JQGA 4F4XA 3ZTQA 3V81A 2UVRA 4I7FA 4OI2A 1BWVA 5KG0A 2HS0A 2OPSB 4WXOA 2AD9A 2YVSA 1EKRA 2IRYA 4DPYA 1JLQA 2F40A 3GIRA 1XMOF 1X9MA 1UCNA 3IR7B 5ETSA 4RNNA 2H48B 2D3OR 3GYXB 2UUCF 2KFZA 3WX4A 1IM4A 4X65J 5MLCV 3VAKA 2JEFA 3CJ3A 3EDRB 2AIRB 3I0SA 3KJQB 2VZ9A 2MKKA 4FS1A 3I55S 1X31C 3NKQA 3R7BB 3HFZB 3W9HA 2BV3A 3R5CA 1VQMS 3AA9A 2CDQA 5F41A 2BQRA 1DHMA 3ELHA 2F1FA 3VAJA 1CJVB 1U09A 3DRRB 2H65B 4OYMA 3GV7B 3F73A 1S0NA 1TP7A 2CQHA 1C1BB 2G1DA 4ZPCA 2VQRA 1SKWA 3THPA 4MKBA 2N3OA 2FJEB 4K7QA 3H4BA 3VZHA 2ZOMA 4RW6B 4Q8EA 2DNYA 5EGYA 2FHKA 3M9NB 1IBLF 2AEFA 5HJXA 3UE2A 2KT5A 4DCJB 3HFVA 1REVB 5AJ3F 1GEHA 3T1AA 4RX6A 2WONA 1RA6A 2QL5B 2XY7A 5E3PA 4IH5A 3MMAA 1OJ4A 3TX0A 4ZPWR 2NR0A 1Y9OA 1SI9A 1QJHA 4FDFA 3VGSA 1J5OA 3MM6B 3HX9A 4P2XA 3TZYA 3BO4A 1X4FA 1YJTA 2QMXA 3DRYA 2ZBQA 2CQ2A 3CXCR 1VIOA 1XBWA 3OFGA 5JXSA 2XHCA 4GKKF 2NXNA 5L38A 2MLZA 4CQ1A 3OXLA 2LA4A 2H9ZA 3D7SB 3P4UB 1H0HB 3MAAA 1FRKA 1Y5IB 1U1KA 4P74A 4YEAA 5L0KA 1DQ8A 1RYRA 4GKJF 2HNDB 3MM5B 4PG8A 1SIWB 3UW1A 3EXYA 5SUHA 4MK9A 2FJBB 2X3GA 2ZH7A 1VQSA 3H2UB 3NXZA 4WFXA 1ALKA 2OSRA 2OPQB 3IAM9 3MPVA 3CCTA 4P73A 1UPMB 5FDLB 1R7IA 2YKNA 1H7XA 4B08A 2FGCA 1RHRB 2AMCB 4M1KA 4A46A 2I6WA 4ECRA 3H0PA 2FJVA 2BEFA 2ZVSA 2XO6A 1VBKA 1WOPA 2RD5C 3GJTB 1M5KC 5FJ4A 4IFVA 2XMKA 4QW8A 3UCUP 4NLGA 4OFZA 4RPFA 2W9AA 1FNMA 1U49A 1HQUA 2DEIA 3BGOP 3M8ZA 3Q8YA 4YR3A 1VRUB 2R2SA 4F8RA 2P8IA 3RJMB 1U6BA 1O98A 2HK3A 2LDIA 2ZZNA 4KH1B 2WOMA 3EZOA 3HSZA 1IUJA 5BJRA 4DX8H 1MSWD 1IWGA 1XWLA 2DNOA 5CYJA 2OFHX 5A0YA 5KTQA 1SL2A 1TKDA 4C8OA 1AJBA 5E3RA 1NHUA 2OD4A 2X1FA 4DR4J 1AROP 3DI6B 4QPTA 1WHYA 3VAFA 1RACB 3ITHA 4OJ3A 4HACB 2C42A 1HPZA 1J5EJ 2LYVA 2E9TA 5DG7A 2D74B 5GMDA 5IM0A 4CXKA 1N56A 1LWEB 4LFAJ 2GSNA 1FKOA 2HQIA 2Y1RI 2CRLA 2UUBF 1FF2A 1HQEA 2QLXA 4B3OA 5D4PA 1NK7A 1Q86T 4Q8FA 1RTJB 2EC2A 1NSPA 3U1NA 3DYAB 3UNYA 1EHWA 5K20B 5DM7Q 3JTPA 2ZNZA 3D0GE 3EGWB 1RWXB 3V81B 1AJDA 1OQ6A 4AYBD 1R0BG 3NKOA 1K1QA 4TN2A 5HROA 4Y2KA 4ED6A 4C8MA 2XWYA 3E01B 1WACA 3ETOA 3GV5B 4LF7J 4F4AA 1L3UA 4LF9J 3IDDA 4NLXA 5EWGA 1KS2A 2RH3A 3LGMA 3O1LA 3M30A 3O5TB 3T9ZA 2R7WA 1TAUA 3R9LA 1V5IB 1FCAA 3KDNA 3PW5A 1WJ9A 2XMVA 4ZJOA 4FXDA 3IWLA 3RYLA 3B4MA 1X9WA 4YUDA 4LSLB 4R8UB 5BYRA 4LQYA 5L1JA 4CLTA 3C3LA 2Q79A 2XYHB 1YX2A 5G4DA 1ELYA 2XS7A 4DV6F 1RAGB 1RTDA 3MR7A 2F4VF 2MLYA 2IPOB 4RWWA 4TKTA 2KG1A 3NCRA 4CXUA 1AYEA 1U1QA 3IBCB 1KFSA 3IG1A 2Z58B 4LUBA 2MSSA 4O4GB 1TV6A 1K1SA 2I38A 2Q6BA 1PYSB 1CS4B 5J1NA 3RB4A 3G86A 1E6VB 3QWPA 5IJQA 4WFZA 4URSA 3OUYB 4A8SA 5LMUJ 5HP1B 2DR9A 2UVVA 3C6TB 1LWCB 4GKJJ 2BW7A 2H5JB 1SH3A 3OT9A 4ZG7A 2YQ1A 4B9LA 4NLOA 2HURA 2OFGX 3IFEA 4DR6J 1TL1A 2DYAA 4FVMA 1S57A 4HKQA 2MJUA 2NS1B 4L3KA 2KTQA 2M7SA 4P9SA 4U67Q 2VIHA 3OSNA 1E2SP 2Q3PA 2W4PA 3D2WA 4QCLA 1Q95G 3BGLA 1GXUA 2ZH8A 3CD6S 4X4VA 4J9VA 4ZLLA 2NZ4A 2GCFA 1YBTA 1YBAA 3Q8UA 2IM2A 4ZHRA 5D6GA 1WEXA 2QE5A 3OQ2A 1OO0B 3KLFB 2FVRA 4HDHA 5HRTA 1V3SA 4DS4A 5EGHA 2HKEA 2HVHA 1U0HA 4PQUA 2GHPA 3T6JA 3HP6A 1YIJS 4Q5VA 3CMAS 1HLWA 1ACMB 2YWEA 2F5GA 1U1RA 2WVEA 1AA1B 4ZVOB 3A12A 3D4JA 4K0KJ 2RIJA 1G7CB 1QE1B 3CJ2A 2QGFB 3GYGA 2PO4A 2A2CA 4CLWA 5F9LA 4LF4F 3PYGA 4ECXA 4I4BA 1SJ1A 2NPFA 1IBMF 1VQ9S 4PYDA 1LWXA 3SQGA 3G4SS 2PDAA 4B3MJ 1NBEB 3UDVA 5HK4A 3T41A 4WFAQ 4Y6IA 1T8EA 4NLUA 2FZGB 2B9WA 4ZCMA 3PYDA 1Y11A 4DV4F 3UD4P 2G2ZA 4QJVA 1FRJA 4P7VA 3UFCX 1RT5A 1HNIB 2VU5A 3KMSA 4MFBA 2GO8A 1YJ7A 1D9AA 2N7CA 4PAAA 5J2NA 2L08A 4W98A 2RUSA 5DG9A 3GYNA 2CDRB 3TRGA 2W8LA 1MN7A 4RR5A 4WP9A 4RW6A 1KR4A 3DOMA 2FQQB 2J6SA 2W7PA 3E3XA 4NE9C 3V4IA 4DPXA 4ZHRB 1M1KT 2QG9B 1SH0A 4GTXA 4DV0J 2ACMA 5E3AA 2GMJA 3OJSA 2PGCA 4ZJQA 2V2KA 2XS5A 2MZ1A 3MPDA 4RU2A 4HACA 3IO1A 4NA1A 1NSQA 3ZZTA 4ENOA 1JB0C 4C8NA 1SJQA 2GMLA 4PR6A 5C25B 2FTRA 1O51A 5L8RC 4C3KA 1EQ0A 2RU9A 4WF9Q 1FJ7A 2RAQA 1NB7A 2XWXA 2IYIA 4HT5A 5CD4H 2I2YA 1VGYA 2DY1A 5FLXU 3N79A 5B0FA 2UP1A 4NI2A 3DYAA 2ZHAA 4DV5J 3QFHA 5D78A 1GMUA 4OI4A 1I5OB 3OTOF 4LVOP 1WNEA 3HXMA 5IV3A 3M8RA 1QSLA 4LF5J 3H5XA 2V69A 4LQ9A 3THVA 1UEKA 2MY8A 3KUGA 1ZM9A 4NI2B 2ATCB 2KFNA 1HHSA 4F0KA 2FHJD 1Z4UA 4ZVEA 1R8HA 3T02A 2KHDA 4LR8A 4OJ1A 4AQYJ 1TK5A 1RA7A 3EVWA 2MKSA 1U1OA 5FDLA 2ERRA 4UPHA 4O3OA 4PG6A 3J7Z5 1SH2A 3EM1A 3N4WA 2W5QA 1HWUA 1VMBA 3DHXA 1KQFB 3GIMA 1K0VA 2DXFA 5GMEA 2C2NA 3P96A 4EGLA 3JSBA 3UD5A 2IDLA 1DARA 3TVZA 2EG1A 4NEZA 1S9EA 2YNIA 3O44A 3TWZA 4ELVA 1X5OA 3TUIC 5T14A 2O5DA 1FK9A 3OJUA 1H6KX 3E2DA 2QLFB 3DXBA 3QAUA 1KTQA 4AQYF 1TL7B 3CW2C 4EYIB 2GIRA 1FEHA 5KOWA 3O8WA 3BBCA 4KAIA 5HQ8A 3HHKA 3M2VB 4WE1A 4X4PA 4DUZF 4DDFA 5F0UA 3B4DA 4A8MP 1FRMA 2JX2A 4B9TA 4QR0A 4IQXA 3ZZZA 2X1AA 1QVFR 1FHTA 4TLRA 2OAUA 2D69A 1Y10A 1D8YA 4OX6A 2UU9F 1Q0NA 1S9FA 4LIRA 1S5ZA 4DV5F 4H54A 3N5FA 3SCJE 2WB1D 1WOOA 1JJHA 1FX2A 1EW9A 4JI0F 3Q86A 2HGLA 3I4PA 2YNHA 3KHGA 2YQ0A 2CJBA 3MM9B 5ADZA 2W8DA 4CLUA 2QT7A 4PG5A 1WI8A 4X4SA 3FDSA 3EX7B 3RBZA 1UA1A 1HQAA 4I2QB 3OHAA 2DK2A 3FVYA 4X66J 1GQEA 2Q1LA 3HT0A 4UZBA 1Z2ZA 5CABA 2EBEA 4U9RA 2J0XA 1HNWJ 2PN6A 3DC2A 2DIVA 3BGUA 3M2RA 3MOZA 4NCGB 4X62J 3KK3B 3K5NA 5L1LA 2GVZA 4ZPDA 1IKYB 1MMDA 4P10A 3M8QA 1KP6A 1FNOA 2HBQB 1C0UA 2ILYA 2L41A 4DZ6A 5RUBA 1HNXF 5IT9U 5CXTA 4OI1A 5C7PA 2E5JA 4NLVA 1WHVA 2Z8QA 3AJDA 2AHOB 1H73A 4OYZA 4QIEA 3V5RA 4O0IA 2RRAA 1U7LA 1X7VA 2CKWA 1HA1A 1R8CA 3HI9A 4DBQA 5KFKA 4RUBA 1WG1A 3CC7S 2GLQA 1RAAB 4JI2F 3TZWA 1N8RT 4GRSA 3IM8A 1SCJB 3CD7A 3TW0A 3NKMA 2UV8A 1RB0A 2JLEA 4YDDB 1FTRA 3D6MB 3BDHA 3DMJA 1NZAA 4FNIA 4I2PA 4ES3A 4B9NA 1RGVA 2R8JA 4KT0C 4DWIA 3CCQS 1VRTA 2VHGA 4CLZA 1EQMA 2FVCA 4DQQA 2AYMA 1M1GA 4Q0BB 4X4UA 4KE5A 3IXQA 4P52A 1SKSA 1NHKL 4O3NA 1Y00A 3OBIA 1IBMJ 4O44B 1BWEA 4IQMA 2G9OA 4OI3A 3PW0A 2DH8A 2VG7A 3WX8A 4A48A 1AZSB 3TQEA 3MR2A 2RQCA 4X4NA 5F8JA 4UPIA 4OZNA 3WAXA 2UXBF 1FDDA 4NLTA 1HBOB 2CQ4A 4YB7A 2ROPA 2VV5A 4R8UA 1IBCB 2O66A 2XY6A 2GQ2A 5KFIA 4DX7A 5KG5A 5HI7A 5D0GA 3GJSB 1CJTB 2MKHA 2KHCA 3KFWX 2EPIA 4M8LA 4RBTA 3E2EA 4NZ7A 2VQEF 1DTQA 4B9VA 2XBPA 3H5YA 4DQPA 3G6VA 4IRCA 2J9DE 1HBOA 3HSGA 3LPYA 5HAOA 3KLEA 2NXJA 2RQ4A 3ENQA 3ET6B 3HHDA 4ZVHA 3JTOA 3J7YI 3NKYA 1HPZB 1RWMB 1G1XA 3PRVA 2BM1A 4WK3A 1KSPA 2IDEA 4LIWA 2HBRB 3C14B 4OZJA 5KG3A 2D9OA 4USWA 4CLKA 3QRQA 3GV8B 2IY5B 2DD8S 4MY4A 3KJNB 2MZSA 4OLOA 4F25A 2X51A 1QUPA 4QPXA 4B3SJ 1N5SA 5CHCB 1KHKA 4NWJA 2HZCA 5HMZA 2XO7A 1VISA 4C2MA 4KHMA 4DR3J 4QIVA 4KSEB 4E2FB 4HT7A 4OYBA 4Q43A 4X2BA 1WF2A 3MM8B 3M1VA 5I3UA 1RADB 1K44A 2VBXA 4C0HA 3EXCX 4CO0A 1WC3A 4CO1A 1UWBA 4NXMF 2B3TB 1IR0A 3CO9A 4MFBB 5J2NB 1JLFA 2FY1A 1U6ZA 2HNYA 2MQLA 3FEYB 3DLGA 3O6QA 1U6FA 2OI2A 4JP8A 4CH1A 3DLBA 3A52A 2GNKA 2GA3A 2N4DA 1JLBA 3OSPA 1IKVB 5IXUA 4LFCF 5AE2A 3A4TA 1L3VA 4FYYB 5LT5A 3NLCA 2QLBB 1NK6A 1FWKA 3T5LA 1UW4A 1UFKA 3PR4A 4KIAA 5BR8F 5J2QA 3SYZA 4ID5A 1B0TA 3M8SA 1AFIA 1VBXA 3NBPB 3TEHB 4WK1A 4LRCA 1Q8LA 4PYAA 4AL5A 2H54B 3UI3A 2XHWA 5D0HA 5D0RA 5DQIA 3ED4A 2J8SA 1MMNA 2POKA 4KYZA 4FS2A 4K59A 1JIHA 4C7QA 3ITHB 1ED9A 4LFAF 3PKMA 1NH8A 5H9FK 3T9NA 1DQ9A 1U2FA 5C42B 3BSAA 1T9YA 4QZVB 1T9TA 4UF4A 1PCAA 3KYLA 4P2FA 1KBRA 4IR1A 1IVZA 2J0QD 3TVKA 3FBEA 2QA1A 3MCSA 1KLMA 3GPAA 3MMBB 4ZVQB 4RW9B 3U02A 3MXHP 2RDDA 5KT4A 3IGNA 4LF2A 5IT9Y 5GAHU 2VB6A 2YKPA 4PPDA 4WKYA 2HEKA 2VL1A 1U0HB 3P3DA 5LMUF 1O0PA 2QSFA 4CI0B 4FF3A 2AYBA 2ZUGA 2DPJA 4WIIA 4RW9A 1RAHB 2DT9A 1W2IA 3SEOA 2MXYA 3RGIA 3M9OB 1NO8A 4O3SA 1GXTA 1S59A 1TKXA 5IT0A 2KG0A 2CWXA 2HGNA 3CCUS 2QZUA 3FBFA 2IIHA 5A8RA 5GAGI 1NJWA 2P2CB 1SJ3P 4C4WA 2V0NA 2R7RA 4DSEA 3ENWA 2CQ3A 2VODA 5KFBA 2OTJS 1RLCL 3D68A 3J81j 2MEWA 2IHR1 3CCJS 1SL0A 3QRPA 1RTIA 4TY8A 4BHQA 2FC8A 1UVNA 3TA0A 1U47A 2UVUA 4NYZA 1NK9A 2BKPA 3NS6A 4KRWA 1RCOB 1IKXB 2DNKA 2NYHA 3IRXA 5ETQA 2VC0A 3IBFB 5E41A 2MZRA 3KJVB 3NKRA 3B82A 4HVZA 5E5NA 3EZ5A 4IO1A 2HZVA 4G6VB 3IM9A 2KRBA 3PO5A 1YRXA 3BS9A 2VKZG 3PYEA 4NPOA 3PNIA 1IR1A 5KOXA 4JI3F 3PHTA 2J76E 1YLXA 3N01A 3D1HA 3OVAA 2R2UA 2G0CA 1RTHB 3KHHA 2E9RX 1ANJA 3BBFA 3G87A 2VDHA 3BKFA 2UUAF 3MM7B 3T1HJ 1CEZA 3T00A 1TKTA 4BC7A 1LWFA 1YZ6A 2V8GA 4QR2A 2HHHJ 1AUKA 1HFEL 2DNZA 5J2MB 3FMBA 1T94A 2QLWA 3FZ2A 3LQVA 3BO2A 3M32B 4PQAA 1EKSA 1HI8A 5C24A 2C2DA 2IJNA 3I0SB 5LM7E 4YMEA 5BR8J 4A8XA 2XCAA 2F63A 2RSQA 2ZDPA 1DTTB 5B0DA 2QJ3A 4EMDA 3DRSB 3LGHA 3QGHA 2KB2A 3HZGA 1VHFA 1C4AA 1FDBA 4PABA 3JQJA 4IH6A 3FC9A 1QE1A 1EB0A 1XIQA 1CJVA 1YGYA 2K1RB 3HPOA 4ER8A 1UPPA 2CNOB 4FNHA 3PG9A 1F2HA 2CJYB 2V63A 4DXLA 1M0SA 5B7WA 3MFHA 1PO6A 1KH7A 4F26A 3BQ1A 3T3FA 3KTQA 3FSYA 3AA8A 2CJ9A 3DHWC 3GQCA 4DSIA 3CULA 4CTAA 4IG3A 2BANB 1TVRA 3R6GB 3CJ0A 4M5DB 4IDKA 4WIQA 1KVJA 3A3OB 2GJFA 1VC0A 1HWLA 2KKHA 4LRFA 3R2CJ 2KYXA 4QOTA 4MIVA 2Z2ZA 4O3PA 3U27A 3GIKA 3NNCA 2M52A 4C8ZA 4Y0FA 1MMLA 1AZSA 1RTHA 2GS8A 2MZJA 1UWAA 1N5YA 2Y1IA 4PKDB 4RBUA 5GAEU 1FVQA 1RWVB 2AGQA 2JEGA 2KU7A 1SBRA 4NA3A 4WJBA 4TY9A 4ZP8A 2Z0GA 4WE1B 1URBA 2D3UA 3US5A 2OEKA 1RP5A 3JTNA 4RUAA 2W5VA 3K89A 5ETPA 3PJWA 4XO0A 2B9EA 1VQPS 3OTEA 1UJ4A 5K5MA 2CVEA 1URAA 2IC3A 5LL6d 1AJCA 3KXDA 4CLLA 1QTNB 2J9DA 2Y8YA 2MGZB 4TQSA 3HT3A 4UY85 3QO9B 1K0TA 5AJ3J 1BXNA 2LQJA 3AOCA 5BYSA 3CGIA 2G9YA 3KD8A 1RHMB 2VICA 1O5JA 2VBZA 4I2QA 3F44A 2HVZA 4IO9Q 2CQBA 4JV1A 2HW3A 4WTYA 2AV5A 4ZOSA 2QV6A 1JLQB 1MROA 1SPBP 1R0AA 5DLWA 1OQ3A 2KI2A 1NK4A 2YWHA 4GTYA 1LXNA 2J9EA 2W9BA 1VIXA 1VK3A 5HMWA 4KPYA 2DGWA 4H4MB 3CB4A 4U7UD 1ZBTA 2BDPA 2DO0A 5LMNF 4CIOA 1IKWA 2MQNA 3JQMA 1AJAA 1FTCA 2HAFA 1H3DA 2CPXA 2MQMA 2KZMA 4E0DA 5KFGA 3V6JA 3R1LA 1G3OA 1PJ5A 3BGRB 2ZZMA 3ADAC 2V6AA 3VGUA 1I1GA 1NMEB 2DIUA 4MIWA 4ILLA 4CYRA 1T0TV 3MMCB 3BSCA 3BYPA 5IT4A 3K58A 1GX6A 4ED1A 4WFYA 2BUNA 2O1PA 4ZK7M 1H74A 4N41A 2LCWA 4WXWA 3RW7A 4WZMA 1HIYA 5D4OA 3GILA 4LF7F 1FJEB 4KV8B 1D0EA 4LF6J 1HNWF 1FFSB 2ZH3A 3EPIA 1KH9A 1HHTP 3CD0A 2V94A 1S6QA 1REVA 2GA7A 1ZYQA 1Q78A 3I5BA 5E0OA 1S1UA 2OIHA 3T1HF 4TXSA 2B51A 3J81U 1KHLA 5C66A 5IC4B 4OYWA 5I3PA 5EHHA 3UNGC 3K59A 1WUUA 1C0UB 2HAIA 3E8OA 3MMAB 2IAJB 3UQSA 3KLGB 1S0VA 4IFYB 1RT4A 1NUEA 1RU2A 4ED0A 3R27A 2ASJA 2Z2YB 2W9BB 1ZEFA 1QY7A 3GIIA 1CJTA 1FXDA 2CZ9A 2GIQA 3I4HX 1DTQB 4A4JA 1H72C 2BQ3A 3H90A 5IFMA 5LSRA 4LFBF 1KNZA 1ZAXA 2CJXB 4MYUA 3VTIA 1IR2A 1N33F 5FD1A 3J7YU 1IKYA 2VG6A 1RE1B 8RUCA 2HNDA 4QWBA 1R8BA 1RTDB 4ZG6A 4MKAA 1A0OB 3PKYA 3GTYX 3I87A 5IQQA 3BB5A 3BM7A 3WQPA 1D9FA 3RR8A 2AP6A 1RK8A 3NRBA 5C2CA 2FJDB 3FMWA 4PUOB 1SXLA 2QN6B 1JXEA 1TKZA 2G13A 3Q83A 1KQKA 3MTKA 1CC7A 4HHHA 4QQBA 4ALZA 4B3RJ 1E6VA 2XGQA 3D66A 1S6OA 2ZH6A 2PSZA 2AX0A 2BJ1A 1YITS 1S7HA 3POTA 1RT1B 3MCMA 4IFVB 3TZXA 4ZVPB 3IP0A 1TQLA 2XCPA 3TI0A 2V8PA 3K5OA 4LMZA 1UKUA 5CCLA 1TK0A 3KNAA 1NKEA 1QVGR 2W5WA 3TG0A 2E1RA 3CIMA 7FDRA 1RT6A 4IG0B 4ZG9A 4ZPAA 1VQ6S 2AU0A 2BQUA 4ZPTR 4R25A 3QPIA 4F4ZA 4NOHA 4MTPA 1UFLA 3GFHA 3C14A 3NGSA 2DNNA 4HR2A 1FRLA 1GMWA 2B6AB 4ZN1A 5L46A 3J7AN 3OR1B 2W25A 4MH8A 4ZVGA 4YP3A 2YNFB 4X64F 4NX9A 2DNRA 2VQEJ 1LW2A 2L3MA 1N0VC 3LP1A 5J2MA 2DRBA 2XI2A 3AD7C 5EN1A 3W63A 1M5VC 2YH1A 1GH8A 4JYAJ 1QAIA 1MG7A 2ZOFA 3SZYA 2H4YB 1YG0A 4QBUA 1Q5YA 1ZA2B 2W4DA 1R8AA 3AD8C 1DURA 3DRSA 2FVPA 1FWPA 2APOA 2JC0A 3MM5A 3NS5A 4I67A 1PSDA 3FFIA 1KVKA 3IS9B 3K5MA 4CLSA 2Z56B 3HD1A 1Y3JA 2CZVC 1CJUA 4LFCJ 3MMBA 4DI6A 2CPYA 3MCNA 2OKQA 3M8YA 2NLWA 1H7WA 2OPPA 1Y7PA 4DU8A 4FBTA 4UORA 3NP5A 2B5JB 3CDBA 4F2SA 2AJQA 2H3EB 1S1VB 1YSJA 3SXLA 2I5JB 3CT9A 1X4GA 2C3PA 1N5TA 4R5PB 1NJYA 3MOJB 1FA0A 2XRGA 1X4AA 2VASA 3DOMB 5CAAA 1LNQA 2LEAA 4RW4B 1N2KA 1JLGA 1OY9A 3OTCA 2MDAA 1BQNB 1C1CA 1WKLA 3AD9C 4M94A 3BR8A 4XK8C 4ZP7A 5KFWA 3NCPA 3P6YC 5A6PA 2M88A 3DU5A 2HNYB 3BYRA 3UVJA 4ELUA 4DL7A 4ZLPA 3FEZA 1VYAA 4ANDA 3PTWA 4E98A 3MK0A 1VRUA 1QSSA 4UPLA 4UOOA 3THTA 3W66A 3IC1A 2UXCJ 4IKAA 5KT2A 4CO3A 1B70B 2RH6A 3GG0A 2HNZB 4ZCLA 2ZC4A 3PYFA 4KQZA 4TYAA 2WHOA 1F3VA 2ZWPA 4X66F 3MTJA 4ZPVR 2HHHF 1T02A 2B4UA 4ES2A 3CDAA 4ANEA 4ZCKA 1FKOB 4JI6J 4V19J 2OMOA 1QD1A 3D6HB 3UO0A 2B4PA 3QO9A 1VQ5S 3AT1B 2QTWA 3TUZC 5KG2A 4DN9A 3DDIA 4J9SA 2C3UA 2HHVA 2E44A 1S6PB 1VCTA 2IFXA 5E7OB 4CO5A 5J2QB 2L9WA 2RDIA 5CYQB 4QWDA 2E5GA 3C16B 2ZJQQ 3CMES 5LJ5Y 4JI7J 1F9FA 1LWFB 1ALHA 1KLMB 1EX8A 3S8SA 2XGPA 2W1BA 4N76A 2F8HA 2P9CA 1MWZA 2HZAA 3RAQA 1KLNA 2RMLA 1BQMA 3KUHA 1T7PA 4OHYA 2HSEB 4KC5A 5I4MA 1E6YB 3KOAA 4IOAQ 3N6MA 4NWBA 1S1XB 4PZVA 4C48A 4J37A 3BO3A 1TELA 2CPIA 2C2KB 1XR5A 2RJZA 4A47A 1D1UA 3DDKA 4MHXA 5THWA 5KFQA 2AJ1A 3RUBL 3QGGA 5AXKA 3W60A 1RKJA 1RWWB 1TUGB 3J80Y 1QSYA 3BDPA 3ZNUA 1TFYA 1AW0A 3QWUA 2IRUA 1WF1A 3M2UB 3MEDA 4IH7A 4C0BA 5HVGA 2DKOB 2R4FA 1XMBA 2MKCA 2E5LF 4B3TF 2VOPA 1ZH5A 1U48A 1TVRB 2ZFHA 3FSXA 4LF9F 3QAEA 4ZKAA 4F36A 4UTGA 4LR9A 3IN5A 2PIIA 1IQZA 2MZQA 2VBYA 1FKPB 1HYSA 4M5JA 4DFJA 1RAIB 1S1UB 5D4NA 3JYTA 2IBKA 2M5YA 4JI4F 3I9V9 4RO0A 2KVIA 1EP4B 3TANA 1ZAVA 5KFEA 1TL4A 2YPZA 2LU2A 4DEZA 3I0RA 3M7VA 2OPSA 4MK7A 3EPGA 3NKPA 4KB7A 1HJKA 1VS3A 3CDWA 1CQMA 1JJCB 5ETOA 2V9KA 1YWXA 4NZ0A 4F3QA 3KK3A 4J9QA 1CG2A 2AF6A 2OSQA 3QATA 1FVSA 2AX1A 4USUA 2WW4A 5CZVA 4ICLB 3CJ5A 2WBMA 4W90B 2OD6A 1HWIA 4FN5A 2KDOA 2P6SA 4KHRA 5KXAA 2MQ8A 4AXIA 5JJBA 4DV7F 3SV3A 1B7YB 2UXCF 1O99A 3GR1A 5KFXA 4URGA 2MY7A 2ZNYA 3IS9A 4TYBA 4FPRA 1VHIA 4ICLA 3TEGA 2JZ5A 3TX8A 4N47A 5CYMA 4YS2A 1HI0P 4LF8J 2MJNA 1UVIA 2HWIA 2L9DA 2GC8A 3LP0B 2C3MA 4I69A 1OPIA 4HEA9 4U7UK 1T03B 3PZPA 1K9MT 4NCBA 1S1VA 1SIZA 4M5MA 4ZITA 1Q7YT 1R0AB 3QT6A 2AGOA 1DZ5A 4DV2F 4NLWA 2DISA 2LFVA 1WF0A 5KT3A 3CUNA 5C2GA 3GSIA 1K47A 4CTAB 3ZTOA 3H5SA 4HYKA 2BJEA 4ZPBA 1HHQA 5DGAA 1VQLS 2YX4A 2UV8G 3V6DA 2CPJA 2XY5A 4DSJA 2E1AA 3SCKE 3HK2A 1GMWD 3VF0B 2J6TA 1NLKL 2YKAA 5DDPC 3GIJA 2IFYA 4CYUB 5F8IA 2ZWOA 1JX4A 3LOUA 1S79A 1TMMA 3I6PA 5L0BA 1ALIA 4OV1A 4QR1A 1NDPA 5A8KA 1HW9A 2DGQA 4HH0A 3I5CA 5E2QA 5G0RA 1ZM4A 4JI8F 3J7A1 1LXJA 2ASDA 1ZOTA 2W24A 3CEDA 2XS2A 5A0YB 4UOFA 4X64J 4F02A 1NCLA 4PQUB 2J0WA 2XI3A 3EICA 4JV0A 1ZM2A 3MPUB 1KN6A 1U8SA 5E3QA 5AT1B 4CO2A 2B9XA 2LQ5A 1T03A 4M5LA 4CT8A 3VAIA 3C16A 4AUKA 7AT1B 3Q22A 3QGPA 1FI4A 5B0CA 3DOLB 3LXQA 4QU7A 1X5PA 2AEJA 4RNOA 2EW9A 2H5EA 4NCGA 1OMSA 1BLUA 4GVBA 5F3ZA 2BABA 3QMQA 4RW8B 4F4WA 4USKA 4GO7X 3MUMP 3JSMB 4DR2J 3RZAA 2ANHA 1ZAWA 1SVDA 1E6YA 1OSDA 3AH6A 3GJQB 2AJ4A 2V2ZA 1ZZFA 3H5UA 4QWAA 3PW4A 2M8DB 1U25A 1PBUA 1NH7A 4DPOA 1SUQA 3KMQA 5HSPA 2DPIA 1RWUA 2OP5A 1QAYA 3MGJA 5DZ6A 1UTAA 5B0BA 2DR8A 3HULA 1BY9A 2RKIB 4GVLA 2YX7A 1BQNA 1IKWB 3NG8A 4C11A 4D3GA 4P75A 5ETKA 3ILIA 3NVLA 1SC1B 1RLDA 1C1BA 2WK4A 2CPHA 2RNEA 1HNVA 1VJWA 2GFFA 1WKJA 2FIUA 4UQGA 4IR9A 5LOQA 1MN9A 3LAKA 2CNLB 1N33J 3OVSA 1NAQA 5KG4A 3JQKA 3S6EA 2M2BA 2FUG9 1WORA 3QBCA 4J9PA 1SL1A 3BQ0A 4KGZB 2V5HG 1F1BB 1FE0A 4CDIA 4DR4F 4OZ3A 3AB4B 5D4LA 2XMWA 5HVFA 3KG0A 2GHWA 2FVQA 1QDUB 5EDWA 2HFVA 3RTVA 4XPEA 2BR0A 4DN0A 4IOBA 2DCLA 3NS7B 1RAOA 2JNJA 3C15B 3DOKA 3JB9k 2LXUA 2OUGA 3SZ2A 1N54B 3ILJA 2V67A 2YH0A 1OYEA 2ZZTA 4P71A 2EVZA 1SJ4P 2G4BA 3TO8A 1H38A 4B3SF 4PWDA 1KQSR 1S1TB 3HSJA 4JI4J 1RAJA 2YNFA 5DZ7A 3HSDA 2KM8C 2UUTA 4USJC 1C2PA 2QO3A 3M2RB 4CLFA 4OHVA 3PIPQ 3DRPA 3KHLA 5DG8A 4ED8A 1GTHA 2WSCC 3FBBA 2NZCA 4OYXA 3KHRA 3PACA 2LEBA 4G1QB 1S1TA 3BN7A 3Q8QB 2JWNA 4ZS6A 2DJWA 1U1MA 2FYXA 2PC6A 2OGUA 2HVEA 3HMJG 4I64A 1KDNA 1TKTB 1TV6B 1KWMA 3MFIA 2NUUG 1PJ7A 2A10A 2JFDA 2RUGA 3EGVA 3ILOA 5KG6A 4LR2A 4J9KA 3L7OA 2BA9A 3KK2A 3EWGA 2R8KA 2F65A 2J6UA 2H4WB 1YQHA 3M4XA 3U1MA 5F8MA 2MQPA 3KK1B 4L75A 3Q8SB 4B3RF 3AQPA 3NEKA 4TLQA 1YRTA 2MZTA 3M2UA 4ZVTB 5DLGA 1S97A 2M4MA 3QSYB 1DJ0A 2B5JA 4XTTA 5FIIA 2CPZA 5F9NA 2C22A 1PILA 4KFBA 3BF4A 3PV8A 4K4ZA 2BW2A 1R6YA 2ZJPQ 2BE2B 3MEKA 3C46A 3HHLA 4TU7A 2WW8A 2YX1A 1S4EA 2IA0A 3DFEA 3MMJA 3H8YA 1NB2A 3DGPB 3MAHA 3NCQA 4WCEQ 5CD4A 3J7ZT 5IOLA 2R8IA 1YJ9S 2FLLA 2IA6A 3AFGA 4KTQA 1NKBA 2IM1A 3FCWA 4F0MA 5A8KB 2PD1A 4RU9A 4Q44A 4XIUA 1VBYA 3BEGB 3MM7A 3I32A 2M3DA 3JSRA 1Q8IA 1MNEA 3SFUA 4J9UE 1LWEA 4C98A 2VPWB 5IS2A 1PYTA 5JUMA 1ULRA 4N77A 3OTBA 4P2MA 2IM0A 1Y4ZB 2R7UA 1GTEA 3BN4A 1N6QA 2BYCA 1LOUA 2RT3A 5AXNA 2CQGA 2LQ8A 2VKRA 1KTVA 2LLZA 2MMYA 2ZBIA 3MAAB 1LK5A 3PFEA 3QIPB 1SC4B 1R31A 2FLNA 1RCXB 5IC6B 3UCZP 4I6YA 3PVXA 4TNOA 4UUXA 4X4RA 1VRQC 5T41A 3BPSP 2CXEA 4L76A 1GK8A 2FPHX 2JSXA 4O0NA 3D3CJ 3LP0A 5BYQA 3R7SB 3WHIA 3OHBA 3T01A 4H4OB 5CYQA 1S1WA 2NPIA 5H9FJ 3EUNA 2Y3YA 3FFIB 4NMLA 3M1VB 3ZTPA 2YNGA 4YFUA 3G96A 2CAJA 3L9ZA 2VA3A 1MWYA 1N52B 2DGSA 3HHLB 3HLUA 3NWGA 5SZTA 5KAKA 1HNZJ 4NCAA 1U02A 2WZ1A 5KFUA 3TJ8A 1BQMB 4KO0A 4M5KA 2AW0A 4PXEA 5KG1A 1G2EA 4EI2A 2E7XA 2M8HA 2LKZA 1FNXH 4RUHA 1OPZA 2G1HA 1HNVB 4AE5A 4YN3B 3I5AA 1HBUB 3ZTRA 4A8YA 1NK0A 5HN0A 2BE9B 4DR3F 3TP2A 4CT9A 4KKOB 1JLBB 4X65F 4ECUA 4QAXA 2P9GA 2IMWP 3D1OA 1CSJA 2WVCA 4K0KF 1NJIT 4EO6A 2QL9B 2VJVA 1JK9B 1KC8T 3CO0P 4OZLA 1RDRA 5KFFA 2RRNA 1PAEX 2NREA 2W8KA 1BMQB 1FJGJ 1P9QC 2CIMA 2YPYA 3IWXA 4L73A 5MAOA 2RF2B 4Y3CA 4YB6A 2DHSA 2HRUA 3TZZA 2DGTA 1U1LA 5H1SV 2OH2A 4JYAF 2G2YA 4MJKA 1WDDA 4ERDA 4Q2MA 1KKHA 1JNZB 2OEJA 3OW2R 2UUAJ 4CCHA 3I31A 3U7JA 3KG1A 4L6V3 4RKUC 1XNQF 4FXVA 1UETA 1B7FA 3DLJA 2B0GA 3R5JB 2W7OA 4KH0B 1E1ZP 5GAEI 4JI3J 3HVWA 3ZNJ1 1ALJA 1HR0F 1ELXA 5ETMA 2XSJB 4DFMA 2MPUA 2RE1A 2CQ1A 3WBZA 3CD5A 1VQNS 4GC6A 4FDJA 2YNHB 5ETVA 3NGTA 3DN9A 4DZDA 2F8MA 4PWUA 4ECQA 4JV2A 2BBEA 3CJSA 3LGNA 4USVA 1O6XA 2W2QP 3MUVP 5I42B 1N34J 2VFRA 5GMKa 4BCAA 3MUTP 1EETA 2FVSA 3R5DA 3QSIA 3FNNA 1IN0A 3X3UA 4J9NA 3BDFA 3BSOA 3TAQA 1DY3A 4UT4A 4CH0S 6FD1A 4DCPB 1ICEB 1KOHA 2XSFA 3A8IA 1HBUA 5E3CA 5LXRA 4EYHB 4ECTA 1JXLA 3D67A 2VONA 3MEDB 1V9OA 1RABB 2FJAB 3BGRA 4WPAA 5J2PB 4ETXA 3SV4A 3MR6A 4K4VA 1BHNA 1HMVB 1RHQB 3VQTA 1TKXB 4LBIA 3RW6A 3BPDA 1UFWA 5IWAJ 2LQ9A 2ALYB 2GW8A 3VAMA 5F8GA 1HNZF 4DL4A 1M90T 1WC4A 1D9DA 2AZ3A 2QLJB 3C6UA 3PRBA 2MYFA 4PXBA 1M1HA 2XTJP 4UOCA 4DS5A 4G3IA 2LMIA 5TJ3A 4ETZA 3TQ1A 1HDHA 2N82B 1J2VA 3FJ2A 3P49B 2B56A 4UOPA 3BH6B 3TOQA 2KFYA 2EFGA 4YHHF 2LXFA 4I2PB 1ITPA 1IKXA 2QA2A 1X0FA 2Y0SD 1HBMA 3OL6A 4NLQA 1VRTB 5CQGA 3HZEA 4JV5F 3B78A 2BRLA 4KY3A 1X0PA 2RHSB 1Y7AA 4Z7YA 1X4HA 5LSLA 2SXLA 2VG5A 3KJFB 5C25A 3QJPA 4PCQA 4USMA 2ZHBA 1UEUA 1CJKB 1ZEDA 3AQOA 2G0IA 3VZIA 1VK8A 3TA2A 2AWZA 2UXDF 2AJ0A 3KWMA 8ATCB 4Y65A 1UJ5A 4YR1A 3CDEA 2ZD1A 4JI1F 2IVYA 3ISZA 5FLXY 1N88A 3TYTA 3V6HA 4QYRA 2F4FA 5L9NA 2B9YA 2W2OP 3FQKA 4ZN3A 4FKXA 1UEVA 4FYDA 4ES1A 4L74A 2HMIA 3FRYA 1A7GE 4P72A 3C2PA 4L3NA 1VC6A 3SDEA 2CADA 5DETA 2WVFA 2YWGA 3N5BA 3ETMA 3RAXA 5H9EJ 1NPRA 1ZETA 1I94J 1RHUB 3PY8A 1DLOB 4Y2IA 1REGX 4DG1B 4ZLNA 1KH4A 3BDGB 1SJFA 1Z1ZA 2HRYA 2EFNA 2DHHA 1FE4A 3AAWB 2ZHOA 3AOAA 1YTYA 1NJXA 4WYWA 4FYWB 3POTB 2OELA 3VVUA 3JSMA 4B9UA 3X1LB 1B64A 2ZUAA 4EO8A 2GV1A 1WDTA 4OYAA 4K4SA 3K0JA 2QX0A 2XB2D 3CJKA 5LMNJ 4V1Ak 2BJ3A 4KFBB 4MKVA 2J7KA 4DPWA 1VLYA 4HTIA 1L3TA 2BE2A 1HQ2A 5KFNA 4B56A 3DU6A 2OPPB 3HVAA 1TL7A 4HL9A 4K2JA 3SCIE 1RT7B 2FDNA 4O23A 4CXSA 1JLFB 4NEYA 3MK2A 3DXSX 2UUWA 1NSAA 4LRBA 4DF4A 4KPCA 3HVTA 3W2VA 3V6DB 4OX9J 1N5YB 4WTOB 2E1MC 5HLFB 2DB1A 3NAIA 2CPEA 4RWXA 3OV7A 5KFTA 4XDCA 3OXFA 4FF4A 2HFOA 3M8WA 1JXVA 1R6VA 2HLTA 3TNVA 5KFDA 1RU1A 3PIOQ 5IJSA 4Y2MA 2WONB 5F3TA 4YB5A 3G6YA 4WFNQ 1S6QB 3OL7A 2JDJA 1T11A 4J90A 1Q81T 2VOOA 5F0WA 2R2RA 1Q5VA 2N7YA 4DOZA 3CJQA 4RW8A 2JOQA 2XG8A 2VF3A 1WELA 3A1YG 2DTJA 1KHNA 1GAOA 1VQYA 3MPYA 2FB0A 5CA5A 4Q45A 3TJ9A 4CH7A 4U8VA 4ITSA 4NXNJ 4HHUA 4DR5F 4UW2A 1R3NA 2Y1JA 3M6XA 2MSTA 1JWWA 3DPCA 3SZZA 2AGPA 4DPUA 2ZH9A 3MZIA 3P45B 3G9CA 2A6MA 2HIQA 3GFXA 5L39A 1FSUA 4RL1A 1Q82T 2JC1A 2YKMB 3AODA 2QA4G 2YNGB 1UVMA 4I6AA 4EFAC 2X1GA 2W5SA 3M8PB 4K2XA 3GB0A 2HHXA 4NZ6A 1EZZB 3H42A 1B99A 1IKVA 2G0JA 2V8DA 1B8JA 3GWCA 2ZH1A 2UVWA 1FT8A 4RJVA 3OLAA 3A13A 3VWSA 1GX5A 1SKUB 1DBDA 4UOHA 3MEGA 4DCOB 1WD6A 4QIGA 5D0EA 3S01A 3VGVA 1VQ8S 4C8YA 4ZDNA 4A8OA 1U4BA 2QC3A 4ZMMA 3H40A 1YHQS 1P1LA 2RQKA 5K8NA 1FJCA 2HQCA 2LA6A 4I0WA 1TL3B 5IZHA 5F8NA 4CLPA 4DU7A 3RRGA 4TU9A 2MTLA 3OUYA 5HO4A 1NPKA 3DNCA 4DV7J 4KAVA 4ECYA 3HDSA 1B4SA 2F3JA 1RT6B 3F56A 4IG0A 2HVDA 3L3CA 1S0OA 2OPRB 1EQJA 2HFZA 2EI5A 3DRXA 2W7AA 1FRHA 4UOGA 1T3OA 2X7IA 4Y28C 2R9LA 1TL1B 4JI6F 3DGPA 3HHLC 5ETRA 1WC6A 1XQIA 3W9JA 5KFHA 1VQKS 1FRIA 1PBAA 1MW7A 3D3BJ 4RNHA 1B3TA 1FRXA 1S6PA 2IAJA 2MKJA 3MCOA 2Z30B 3UN3A 5J1EA 3ET6A 3EYZA 2KRRA 3IGVA 3CC4S 4A8KA 3BGFA 3DYCA 1SQEA 2W2MP 2DR6A 3FRZA 4X4TA 1YK9A 1M5HA 2R7SA 3MWBA 4PPZA 3WAVA 4JUZA 5KFSA 4C97A 4ZP6A 2CJKA 4EZ6A 2J9CA 2DNQA 2R8HA 3E01A 4OX9F 3VALA 1NEEA 2RB7A 1ANIA 3KK1A 4KJDA 2VG6B 3D54A 3ONQA 1N48A 2CYYA 3OTDA 4M5IA 3R2DJ 3T5HA 4KGXB 2FJWA 4IRDA 3NMRA 2XQCA 1U1PA 1HMVA 3BREA 2DNMA 2OTLS 2WSFC 3PR5B 1DFDA 5ETNA 4JI5F 1K73T 2GJ2A 5ITHA 4WFBQ 2LU1A 3L7UA 4WWSA 1A9NB 1Y3KA 2FHOB 4ED4A 2XMTA 2W01A 3CCES 1BC6A 1RXOB 1EW8A 4JI5J 4WP3A 3Q2TC 2HHTA 5DM6Q 2JRSA 3D6FB 2C2EA 4W92B 5LIAA 3EVMA 4H4KA 2B43A 2EK1A 4OX7A 4RW4A 4ZLJA 4FBUA 1HYSB 4FDIA 2EC0A 4DQSA 1HKAA 1TUWA 1J27A 1RT1A 2JJ4D 1VLOA 4O44A 1NZ8A 2CQ0A 1HL6A 2G2OA 2ZOGA 3NAHA 1H2VZ 4FYVB 1HNXJ 5HP1A 2B7CB 4B9SA 1VQOS 3DLEA 1EP4A 2GMHA 4OZ5A 3EGZA 4IDKB 5U47A 1X5TA 3WC0A 2ASLA 4LVNP 2HYIB 4BS2A 3MM6A 4DPTA 2J0SD 3RB0A 4DL0C 3OR1A 5KFYA 3M32A 3TAPA 3HHEA 2CQPA 2H5IB 2YY3A 4FP9A 4NMXA 4OZ0A 1XN9A 5A2QU 2JLGA 2BE7D 4PEOA 5B0EA 2K7KA 1KOOA 2BOAA 3KLEB 2CNNB 2RF2A 1UL3A 1NDKA 1ROFA 2WOMB 2H1YA 1OIAA 3A8KA 5JVHQ 5HVHA 1T05A 2AYGA 3IR5B 2DEJA 4ZVFA 3V6KA 1RZMA 4N7TA 3W5XA 4GTZA 3CJTA 3LAMA 3QZ7A 3KG4A 4I6WA 4J91A 2PE8A 4PXCA 3IGYB 2HQFA 2VA2A 1IJEB 1QAXA 2E5HA 3ULHA 4AL6A 5DLVA 2IC3B 3H20A 3GCXP 3W1YC 1D8ZA 4OV6A 2YKMA 2F8EX 3ISNC 1SB6A 2HFSA 2QMWA 4M5HA 2BKNA 2PA8D 4M63A 2QEXS 1XNRJ 1NSKL 1RTJA 2V50A 1V5VA 2NSBA 3GR0A 2D3O1 1AFJA 4RBVA 4OYOA 4NLPA 3RAMA 4DFPA 4OHZA 2BRKA 2E7VA 1P9YA 5EX0A 1I3OB 1PIEA 2AJ2A 2HWHA 3CJKB 5GAHI 3T5JA 4NLRA 2HVIA 1JKHA 2ALZA 5T7LB 4GVBB 4NXMJ 3GLJA 4OJGA 1HW8A 4P2SA 7FD1A 3Q24A 5EGEA 2P9EA 3BKUA 3K8VA 1XR7A 3QQCD 2P5VA 5B0GA 4AT1B 3N28A 4EWTA 1KRPA 1U0SA 4G1IA 4MT1A 5D8HB 1MLAA 2R7OA 2J7WA 4J7CA 1G6BA 5CCMA 1KD1T 1V6HA 5GADU 1RAEB 2M70A 4BLGA 1WG4A 4ID5B 3ZC4A 3CWJA 1V3ZA 4LR7A 4JB8B 4Z2XA 4P7TA 4PG7A 3T1YF 1SV5B 2CPDA 4UY8T 5DLTA 3DKDA 3K57A 1XERA 3ZZYA 1FKAF 4B3OB 2NYIA 4DUYF 2Z4PA 4ED5A 4C8KA 4KJGA 4F2RA 3R3TA 1LW0A 3VCDA 1B0VA 2A18A 3A8JA 3RRKA 3KLHB 1JMTA 1XNQJ 2J8AA 1YBUA 4DX6A 3KLVA 2BM0A 2VG5B 1R0CB 3TUJC 2ADBA 2FHMA 2V4RA 3PM9A 3R6LB 1T3NA 1A6LA 2K06A 5DGBA 4H4MA 4C9DA 4O3RA 4DV0F 4YR0A 1FWLA 3QGIA 2JEIA 1KHWA 3FBCA 3Q8PB 1F9EB 3G6ES 2KT2A 4DL3A 2X3DA 1Q79A 3TA1A 3JAMU 2BJDA 3PX6A 3KDOA 2CQCA 4DR7F 1D3WA 2KT3A 2M0GB 1RBLA 1FDAA 4C0OC 3EE3A 3WZ0A 1U24A 4QW9A 2B8PA 1YJWS 3F41A 1WHXA 1NDCA 2E5IA 4QYZJ 3Q3QA 3LWLA 4H4KC 2MKYA 4K50A 1IXKA 2VJUA 5AJ9A 2ZITA 4NA2A 2QFJA 4DV1F 4DX5A 2IM3A 3PW2A 2ZC3A 4HI1A 4CNYA 3SMZA 4DLEA 2R2TA 1U1NA 3J80U 1H2TZ 1HBMB 1MWQA 2VFVA 3AY0A 3DRRA 3FZBA 2GVDA 5F8HA 1BE4A 2QIFA 4G1PA 3OPKA 3HJFA 4J9RA 1LFWA 1NHVA 3H25A 4M5DA 3PDNA 4UQTA 1U8WA 1VJQA 3DMJB 3OL8A 4K4WA 2CG4A 1NM2A 1YJUA 2CQIA 2NUHA 2ROGA 5M2UA 4ECWA 4LF8F 1HWKA 3CJRA 3AOBA 1TFWA 3BZQA 1ZTTA 2AZ1A 1Y5NB 2GQQA 2I1RA 5H9EK 6AT1B 1VQ4S 2DVIA 3KJVA 1EJJA 3DDNA 1JLEB 1RT3A 2AKWB 1RTZA 2YBVA 2WSEC 3FKBA 5K9FA 4F0HA 3ZTSA 3FQLA 2VDIA 3B5QA 3CDUA 2MQQA 3B6BA 3CVKA 3QNWB 4ZVUB 3WDOA 3WIUA 3JYTB 2OJ3A 1N36J 3W5ZA 1ZPWX 1RT3B 5D3GA 4GMKA 3DM2A 2M9KA 3ZFVA 3V4IB 5DQHA 2XLJA 1J5OB 2GGPB 3HF5A 1LFPA 2JVRA 1PG5B 2V2VA 2P6TA 1J5EF 1FFWB 3CCSS 3NKNA 4A8QA 3K5PA 3MEEA 3C19A 4ECSA 1DLOA 5D3GB 1VBZA 5GVQA 2ZD1B 3BDGA 5KT5A 1KHVA 1FFGB 1ELZA 4NLSA 2W9CB 3PXGa 4DSFA 1S76D 1FD8A 3LP1B 3FCVA 1Q1KA 3M6VA 4Q7AA 1TKZB 2FZKB 3UCGA 3D1QA 1RHKB 4MAKA 2KXNB 2HHUA 3D9BA 3MEEB 4OHXA 3R1HA 1RHJB 2HMIB 1Q7LB 4ZP9A 4EUVA 2K2PA 3M8QB 5HQMA 2D1GA 2IUCB 3G8QA 2RQMA 3QT7A 1NK8A 4WZQA 1AB8A 2R8GA 2ZE2A 3P5BP 2VFTA 4N5SA 2KM8B 3LA0A 1RT7A 2Q6CA 4DG1A 4CYSA 2BZ2A 3DLHA 1KVIA 2BVZA 3NGUA 3H98A 4F3MA 5DDOC 1CJUB 4LREA 5B08A 2HQDA 3CTRA 1MU2A 2LECA 2QSWA 2PI5A 3GFYA 5DDRC 1WC0A 2WTFA 3G8SA 1HQUB 2YKOA 1N2LA 1S1WB 1N4LA 1FXLA 2XZDB 3SSQA 3R5BA 3W9IA 1ZPVA 2WCXA 4B02A 2AEMA 4X84A 3LP2B 3Q2SC 3V4MA 1WWHA 3LF0A 3DM2B 3V2UC 4GC7A 4ZVRB 4HLBA 2XNQA 1YI2S 1JJ2R 1DQAA 4KR0B 1HBNA 4R0JA 5KFAA 1N34F 3H2VE 5DRKA 4CYUA 3UVJB 1CQNA 1JLAA 3NNHA 2V34A 1E33P 3OTOJ 3LPEA 2B4OA 3MR3A 1N6QB 3HCXA 4LT6A 3W8GA 1ZTWA 5KFRA 1RUSA 4QIFA 2XNRA 1TTHB 3ZZPA 1P49A 3ZZUA 1KQGB 1JLAB 1F5BA 4TVAB 3J81Y 3VVTA 1HQEB 2IVMA 4NYOA 3T19A 4OIXA 3M9MB 2IMOA 3Q89A 1WSRA 2A0FB 2HHWA 1VDHA 3WIVA 2HFUA 5J1EB 2HHQA 3RG6A 1ED8A 5HROB 2CJAA 2I5JA 3PEHA 3DRPB 1IBLJ 2MKIA 4QWEA 1IBKJ 2YKQA 3Q8RB 2ACYA 3G82B 2ZH5A 1MU2B 1UVKA 2HBYB 3LO3A 4OLPA 4OL8A 1NU4A 2RILA 2DNGA 2XSJA 1U2RA 3DCAA 2HIYA 1GXLA 1S6UA 1SUQB 2DHXA 3H59A 1YVFA 2QFIA 4BWJA 3HVRA 3Q23A 4PUOA 3PCOB 2HFNA 3QLHB 4LF1A 4D3HA 3PX0A 4ECZA 1APSA 1GNKA 3CE8A 2HQGA 2D1CA 2GVZB 3M6WA 4XDDA 2XM3A 1WTBA 1H98A 1UZDA 3O2IA 1SKRA 3PW7A 3AB2B 2VC1A 4DV1J 2L48A 2PEHA 3K17A 2GHVC 4CM2A 2QYCA 3GU0A 3MMCA 1KEKA 2FZCB 3BSNA 2H51B 3QT5A 1FD2A 3ENAA 2F7VA 2QL7B 1W26A 3AJ1A 3E51A 3CCRS 5GOVA 5J2PA 4LF4J 4F04B 2BXJA 2LVWA 1UP1A 2FD2A 4NLDA 4EBDA 2XLKA 2JLFA 3Q0AA 2JVOA 1K8AT 2GZOA 1V3RA 2XZTB 2Z2MA 4KV8A 1IBKF 2BOPA 1RJJA 1WC5A 1XK8A 3ILLA 3VHQA 4C8LA 1K7HA 4GTWA 4O4RA 3NMAA 4J9OA 3HKZD 4RNMA 3C6UB 3FK4A 3PEJA 2XC9A 2V9WA 2B8QA 3KUEA 1PAUB 3N6LA 1T9UA 2B6AA 4BBYA 4M95A 4DL2A 5A8WB 2VFSA 1SHNA 2CJQA 3A3NB 3K7RA 1LV5A 3DOKB 3D0IE 4G65A 2FLOA 3VGTA 2KZZA 4BC9A 1HD1A 2ADCA 3LW5C 5D77A 1VOMA 3Q8VA 1EI6A 1GFWB 3MDFA 5A8WA 1LQ9A 3SFGA 1LEOA 2BJ7A 2QMUB 5C42A 4RZRA 2FC9A 2KJWA 4I56A 5KT6A 3IBWA 1AT1B 4NRTA 4DR6F 3UR3C 1S1XA 2OMLA 2GAHC 2R7QA 2MHNA 3CCVS 1URNA 3HD2A 1DAXA 2QZ8A 3T1YJ 3OL9A 3BJYA 5ETLA 2CQDA 1YJVA 1WOSA 4U7CA 3CMRA 2DY9A 3GMGA 2C3YA 5GAGU 5JVGQ 3GFZA 2CVIA 5B0AA 4KM4A 1FERA 4USHA 2EFQA 3QYYA 1RKIA 4L72B 3MR5A 4IYQA 4QWCA 3MECB 3ISND 2GX8A 1WTFA 2OO4A 3N6NA 3IRWP 3R7NB 1OS5A 8AT1B 3TJAA 4DSKA 2R7VA 3WAWA 3HM9A 3KK2B 2VQFJ 4I1TA 1AXQA 1SHQA 2LXIA 3PFOA 2YXLA 4N8NA 3NNAA 5IQ6A 2YWWA 1HNIA 4ED2A 3MECA 2EXUA 3PRDA 2EFPA 5K4PA 2Z57B 2N3LA 2EFOA 2W2NP 1HWJA 4OYIA 2CWKA 3QIDA 3CCMS 1NJZA 3TR5A 2W4CA 3GE9A 1X8DA 3LP2A 1QTMA 1C4CA 3DGVA 1I94F 2DR5A 5A6WA 3BV8A 1RAFB 1NK5A 4KKOA 4ED3A 1S48A 4NXNF 4BDPA 1F6TA 2HHSA 5KFZA 2K7JA 2XMJA 5HMXA 4BWMA 1Q16B 3MURP 1OY8A 5KFMA 3FCHA 5AXLA 2ZKUA 2V4QA 2BJ8A 1ZS6A 4MIBA 1X4DA 2MB0B 2IJRA 4RLEA 4JOUA 4C3MA 5DQGA 4EZ9A 1N32J 1UAWA 2WBRA 5CH7B 5HATA 5K8MA 4WKRA 2J5AA 3D5MA 2LQBA 5CYMB 2KO1A 3OD2A 4YY3F 1SQFA 5DJBA 2OHDA 4F67A 3G8TA 1LW0B 2Y8WA 3P8BB 3EGNA 1VR6A 3FUYA 3NWRA 3OLBA 5HJYA 1I6JA 4LF6F 4JV5J 2DITA 1TR0A 2YKNB 2GAGC 1BD6A 2V4JB 3GG1A 4Y2AA 4X4OA 3W5YA 3CSKA 3D28A 1R89A 2CFXA 3G82A 4OZ2A 3SQOP 4YHHJ 4LSNB 4DUZJ 1VQ7S 2W8SA 4LRAA 5L9XA 3JSYA 1S72S 3SQGB 1D09B 2ABYA 5KT7A 2E5LJ 4URQU 1F5CA 2JH3A 1S77D 2GSUA 1Q53A 2KH9A 3L95X 2C2RA 2Y0BB 4KAYA 3I82A 2U1AA 4R5PA 4FPIA 4HH1A 3SIPB 4J9MA 5EX3A 1T9WA 2VUGA 3GSDA 4N56A 1ZZNA 2E7WA 1RT5B 2PA3A 3AXKA 5IWAF 1XNRF 5HL7Q 3SSRA 3RB3A 2D41A 2R7XA 1S12A 3LTOA 5K8PA 1JKHB 2XR9A 2HHPA 2KJVA 4XPCA 3D0HE 4K4TA 3T5KA 5DLFA 5HLFA 3DI6A 2FJXA 4NYPA 1JJ4A 1FK9B 3QJJA 1U2CA 2CUYA 1EARA 3CMQA 2IRXA 3AJ2A 5M2PA 1L3SA 2C2OB 4DR7J 1N5QA 4E8UA 3IA0A 3KNGA 1M5PC 5A8RB 1Z2LA 1NKCA 2I8EA 1XMQJ 3MEGB 4MK8A 1FJGF 4A8FA 2DGVA 4USIA 5HBMB 2BJ9A 4LF5F 4Z37A 1RWPB 2K8GA 2KXFA 5EWFA 3ZO7A 2PMWA 2D7SA 2CZ4A 5D15A 1HI1A 3VR1A 5J1PA 1UA0A 4CM0A 4GKKJ 3MI7X 2RHQB 4MYTA 1TL3A 3BDEA 2QA4S 4EEYA 2BKOA 1XC9A 3SSSA 5GADI 3BQ2A 1W2BR 1L3KA 2JHEA 2XEXA 4LSNA 2DR7A 3ENVA 3IR6B 4RW7A 3IRXB 3OVBA 2YWKA 2ZVIA 3KLHA 2NXEA 1N5VA 1RSCA 2DHAA 4WU2A 2XMMA 4DUYJ 2A6OA 3CCZA 1N36F 2EBGA 2PI4A 5CZXA 4JI8J 1CPZA 3H7HB 2WAQD 1RT2B 2HG4A 2C28A 1C0TA 4ELTA 5LRMA 4LBHA 4HHJA 4U6PA 2L9NA 1PC4A 3N9UC 4FKYA 2C2ZB 2NSCA 2RS8A 4KGVB 4UUWA 4C11B 1EETB 5IV4A 1QAJA 4KGMA 5LXYA 2IUCA 3M6UA 3C66A 1WSVA 3QLHA 1X5SA 5LQQA 2U2FA 1CS4A 4F7VA 1YJNS 1N0UA 3MPWA 1EIYB 2E29A 3N0VA 4TQRA 5C5JA 4DV3F 4OI0A 3CCLS 4TY8B 1S9EB 2YNIB 1JLEA 4K5RA 4ED7A 1Y5LB 3VAHA 3FSIA 4IRKA 1T95A 2EWHA 2RVJA 2OLWA 2HRTA 5I3QA 2O01C 1KONA 5K8OA 4ZGAA 1NRKA 4X4QA 1TU0B 4B3TJ 4Q0BA 3AXMA 2ZBCA 2OPRA 1ELOA 1S7IA 4V19X 3RB6A 3VQSA 4MIAA 2UUCJ 1VC5A 3C15A 3QT8A 2DNLA 4FVCA 1FKPA 2HWTA 4C6AA 3NGDA 1WKKA 4FF1A 1I51B 3TVYA 3ZZ0A 4YB1P 1M5OC 3BKTA 3HFKA 2PT0A 1LK7A 4M5GA 2ZH4A 3FGVA 3UPFA 1CVJA 2C2MB 2E1CA 2W5TA 4OHWA 2FGOA 1C0TB 4FZVA 4OYPA 4EBCA 5GRRA 1HBNB 1JLCB 1FX4A 1SJRA 2XMUA 2JFKA 3JS9A 3MHYA 5AE3A 1F2GA 1UMJA 4CZCA 4NRUA 6FDRA 4MMOA 2LP4A 1TUVA 2HQ3A 4JI0J 2GIFA 2EG2A 1YRUA 2VPXB 1NNDA 4I7FB 4CLYA 5INHA 1S9GA 1W7WA 3AHPA 1LW2B 3PX4A 1DTTA 1PGZA 1JLCA 2LDYA 1H2UX 1HD0A 1B0PA 3R5GA 1OSCA 1CC8A 2N4CA 5BXIA 1IWAA 2E1PA 1Q8BA 1S0MA 2FLPA 3DOLA 1KH5A 1WI6A 4GO5X 1RBOB 2CPFA 4PRFA 4CO4A 3L09A 3PJXA 1Y0HA 4KBIA 2EKYA 3JAMY 2C1EB 2VPYB 3OFHA 4OI6A 4R0EA 3UN2A 4F50A 1R43A 2A1BA 2LEPA 4DSLA 1EAYC 2VFUA 2YTCA 4CWBA 3R97A 1DRZA 1BUXA 3H4DA 2BANA 4ZIWA 2D3ZA 2ZE2B 3MM8A 1FXRA 1UWBB 2F9DA 2R42A 2VH7A 2K3IA 4JBCA 4OZ1A 4U95A 5L1KA 3R5AA 4IUFA 3HHNB 4DV2J 2GJIA 5KFVA 1RYSA 3GCWP 1WEYA 2WVBA 4DV6J 2YWFA 1X9SA 1EW2A 4KHPJ 4JI2J 3O3LA 2O67A 2JL9A 4OJHA 1T9XA 2XYGB 4U96A 4DLGA 2WRMA 2AYEA 3CF5Q 2DO4A 4WU3A 4KO0B 3ZZOA 1GT8A 2ZM6F 5K14B 1NXIA 4C3LA 3UDEA 2B4VA 1RWNB 4QIWD 4AL7A 2IBOA 2VG7B 5AXMA 3FEXB 4Y00A 3QFWA 1RQ0A 3JXOA 5T7LA 3HVTB 3CJ4A 4LFBJ 4PXDA 3D6TB 4USTA 4X62F 5G0RB 3LALA 4F4KA 4KGKA 3W7BA 4YDXA 3HJVA 2UZAA 5K14A 2ATLA 3NBPA 3NY0A 2ZJRQ 2ZEJA 1M5SA 2DCUB 2I9SA 2PEBA 4ZIVA 3CC2S 4K4YA 1QUVA 4ILMA 1F60B 4ILRA 4K5SA 1CULA 2X1BA 2FY8A 2HK2A 2HPUA 2IYGA 4RW7B 4CP5A 5KFOA 3EMTA 3LH2S 2MGZA 2RDJA 2MHEA 1N32F 3WAYA 3KKFA 2DXEA 2ZH2A 1QLNA 2B7BB 2W5XA 3F0NA 5EUHA 5JMNA 2DNHA 3W2WA 4EU0A 5KFPA 4Y34A 2XMAA 1PJ6A 2WVDA 3OFEA 2GO9A 3GJRB 2DRDA 3MM9A 1P27B 4PG4A 2QYGA 5AE1A 3K8WA 2OPQA 3RR7A 4F3OA 1FEEA 1RWOB 3HHLD 4YQWA 3CCWA 1EJ7L 2HS3A 3VV2B 1UJ6A 2KL8A 2ZM6J 1S10A 3CIZA 2XZWA 2GQCA 3EZUA 2DH9A 3BBBA 2A2DA 2RKIA 1VI7A 1TMJA 4KHPF 3LWMA 1RI7A 2E9ZA 5EWEA 2DGOA 2V68A 4RNFA 1WEZA 1S99A 3CJ8A 3G2XA 3M2VA 2VQFF 3RBDA 2NXUA 4DV3J 5LSOA 4AXJA 3HKWA 2WB4A 1X4CA 3I96A 4NLYA 1AUSL 1G4CA 1OWXA 5L1IA 1CBKA 1R8PA 1RTIB 2OEMA 2V8VA 1XEZA 1F3FA 4I68A 1UZHA 3R8YA 3NOGA 4LSLA 4OMFG 2V8HA 5B09A 3ZZRA 3GONA 4DQRA 4HDGA 4DR2F 1UW9A 2F9JA 1IQTA 1CULB 1PYOB 1RBAA 2J7UA 1RISA 4WBFA 3W64A 3UN5A 4JI7F 2DGXA 2GVDB 1F9HA 2MLXA 3DLEB 1GMVA 3B8HA 3L4BC 4FYXB 3UD3P 2D9PA 1FO1A 2KN4A 4P6QA 3GZ7A 3DLLQ 3DLKB 3OR2B 4AD6A 3K2YA 3W2WB 1YJRA 1RT4B 4IOCQ 2RU3A 2X98A 3EVOA 2NCKL 4J5OA 1OY6A 2ASYA 3W61A 1FDNA 5DO2A 3OXGA 2DBBA 5I42A 3C6TA 3CNQP 3S1TA 2VBWA 3EDQB 4LBPA 4DHVA 3I0RB 5LJ3Y 1U45A 4PWDB 1S9GB 1UVLA 3DLKA 3OR2A 4ZVSB 1Y6VA 4DUTA 3IGZB 2ILZA 4OQJA
chains in the Genus database with same CATH topology
3UO0A 4KM4A 3UNYA 1AUKA 1ZEFA 1AJDA 3WAVA 3NKOA 1KH5A 3LXQA 4MY4A 3WBHA 1ALHA 1KHKA 3IDDA 4NWJA 4KJDA 1ANIA 2W8SA 4LRAA 3T02A 3UN2A 3T01A 2ANHA 4LR8A 4ZG6A 2GSUA 3Q3QA 3BDGB 4UPHA 5LRNA 4LQYA 4KAYA 3NKQA 5AJ9A 1KH7A 2W5QA 1ELYA 4MHXA 1EW2A 1EW8A 4NWXA 4CXUA 2XR9A 3NVLA 5LIAA 3TWZA 3A52A 4FDIA 3MK1A 4B56A 1E3CP 2GA3A 2VQRA 5GOVA 3E2DA 4CXSA 5IJQA 4LRFA 4MIVA 3MK2A 4QAXA 2W5WA 3TG0A 4LRBA 1EJJA 4GTWA 1K7HA 4ZG9A 3OT9A 4LR9A 4ZG7A 3B5QA 3M8WA 4LRCA 5IJSA 3ED4A 1SHNA 1E2SP 5L0BA 3M7VA 1URBA 3TX0A 3NKPA 1EW9A 1HJKA 1ED9A 2W5VA 3WAYA 4TN0A 2W8DA 1EI6A 1E1ZP 3NKNA 1HQAA 1ED8A 1URAA 1ALJA 1KHNA 4N7TA 1AJCA 1ELXA 4GTZA 5EGHA 2W5XA 5HRTA 3BDGA 4FDJA 3SZYA 1ELZA 1KHJA 3IGZB 3DPCA 3IGYB 3SZZA 5LRMA 3KD8A 2G9YA 5KXAA 5L0KA 1O99A 5DLVA 1FSUA 3CMRA 2W5RA 2D1GA 3BDFA 1ZEBA 5DLWA 2IUCA 2IUCB 2W5SA 4GTYA 5LQQA 3M8YA 4LR2A 1ALKA 2GLQA 4UORA 4CYSA 1B8JA 3WAWA 1AJAA 1SHQA 4LREA 2QZUA 3NKMA 1KH4A 2ZKTA 5EGEA 1N2KA 3BDHA 5K4PA 1N2LA 4YR1A 4CYRA 5TJ3A 4ZGAA 1HDHA 4UOOA 3M8ZA 4UOPA 5L0EA 1O98A 4UPLA 2IFYA 4LR7A 3UN5A 4KAVA 4LRDA 5DLTA 4UPKA 3NKRA 4GTXA 1EQJA 4UPIA 1ALIA 3WAXA 1KH9A 2RH6A 1E33P 1Y7AA 2W5TA 2X98A 2XRGA 5GRRA 4KJGA 4CXKA 1ZEDA 1KHLA 1AJBA 1P49A 5C66A 2GSNA 3UN3A 3MK0A 5INHA 1Y6VA 1ANJA 2GSOA 3T00A 3DYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO0 A;  4KM4 A;  3UNY A;  1AUK A;  1ZEF A;  1AJD A;  3WAV A;  3NKO A;  1KH5 A;  3LXQ A;  4MY4 A;  3WBH A;  1ALH A;  1KHK A;  3IDD A;  4NWJ A;  4KJD A;  1ANI A;  2W8S A;  4LRA A;  3T02 A;  3UN2 A;  3T01 A;  2ANH A;  4LR8 A;  4ZG6 A;  2GSU A;  3Q3Q A;  3BDG B;  4UPH A;  5LRN A;  4LQY A;  4KAY A;  3NKQ A;  5AJ9 A;  1KH7 A;  2W5Q A;  1ELY A;  4MHX A;  1EW2 A;  1EW8 A;  4NWX A;  4CXU A;  2XR9 A;  3NVL A;  5LIA A;  3TWZ A;  3A52 A;  4FDI A;  3MK1 A;  4B56 A;  1E3C P;  2GA3 A;  2VQR A;  5GOV A;  3E2D A;  4CXS A;  5IJQ A;  4LRF A;  4MIV A;  3MK2 A;  4QAX A;  2W5W A;  3TG0 A;  4LRB A;  1EJJ A;  4GTW A;  1K7H A;  4ZG9 A;  3OT9 A;  4LR9 A;  4ZG7 A;  3B5Q A;  3M8W A;  4LRC A;  5IJS A;  3ED4 A;  1SHN A;  1E2S P;  5L0B A;  3M7V A;  1URB A;  3TX0 A;  3NKP A;  1EW9 A;  1HJK A;  1ED9 A;  2W5V A;  3WAY A;  4TN0 A;  2W8D A;  1EI6 A;  1E1Z P;  3NKN A;  1HQA A;  1ED8 A;  1URA A;  1ALJ A;  1KHN A;  4N7T A;  1AJC A;  1ELX A;  4GTZ A;  5EGH A;  2W5X A;  5HRT A;  3BDG A;  4FDJ A;  3SZY A;  1ELZ A;  1KHJ A;  3IGZ B;  3DPC A;  3IGY B;  3SZZ A;  5LRM A;  3KD8 A;  2G9Y A;  5KXA A;  5L0K A;  1O99 A;  5DLV A;  1FSU A;  3CMR A;  2W5R A;  2D1G A;  3BDF A;  1ZEB A;  5DLW A;  2IUC A;  2IUC B;  2W5S A;  4GTY A;  5LQQ A;  3M8Y A;  4LR2 A;  1ALK A;  2GLQ A;  4UOR A;  4CYS A;  1B8J A;  3WAW A;  1AJA A;  1SHQ A;  4LRE A;  2QZU A;  3NKM A;  1KH4 A;  2ZKT A;  5EGE A;  1N2K A;  3BDH A;  5K4P A;  1N2L A;  4YR1 A;  4CYR A;  5TJ3 A;  4ZGA A;  1HDH A;  4UOO A;  3M8Z A;  4UOP A;  5L0E A;  1O98 A;  4UPL A;  2IFY A;  4LR7 A;  3UN5 A;  4KAV A;  4LRD A;  5DLT A;  4UPK A;  3NKR A;  4GTX A;  1EQJ A;  4UPI A;  1ALI A;  3WAX A;  1KH9 A;  2RH6 A;  1E33 P;  1Y7A A;  2W5T A;  2X98 A;  2XRG A;  5GRR A;  4KJG A;  4CXK A;  1ZED A;  1KHL A;  1AJB A;  1P49 A;  5C66 A;  2GSN A;  3UN3 A;  3MK0 A;  5INH A;  1Y6V A;  1ANJ A;  2GSO A;  3T00 A;  3DYC A; 
#chains in the Genus database with same CATH topology
 1WHW A;  1X4E A;  2FHJ A;  4W4M A;  5ETT A;  3NL0 A;  1T05 B;  3T6B A;  1CJK A;  2O3D A;  2DH7 A;  2UXB J;  2UXD J;  3BH7 B;  2DRA A;  2W2P P;  3RBE A;  1YZ7 A;  2CA9 A;  2VD3 A;  4G1Q A;  2EFV A;  1UVJ A;  2R7T A;  1YDL A;  1CLF A;  2Z2L A;  3L7P A;  3PHE A;  3WBH A;  1ZA1 B;  2DXD A;  4NWX A;  5HAN A;  4J9L A;  4B9M A;  1KFD A;  3BR9 A;  3W8P A;  4H4O A;  1TK8 A;  1LKZ A;  4KJI A;  2EKN A;  2K3K A;  2V4J A;  1XJW B;  4N8O A;  3A8E A;  2IJF A;  5LRN A;  2K1R A;  1TAQ A;  4PWW A;  2W9C A;  1IM6 A;  4O4G A;  4EK2 A;  4TU8 A;  2KVQ E;  1FES A;  1Q4R A;  5DS7 A;  5HMY A;  2Y9H A;  1PC5 A;  1NPP A;  4DV4 J;  3SI8 A;  2BX6 A;  2E66 A;  2PFD A;  4IG3 B;  3W65 A;  1P8G A;  5I3U B;  3GP9 A;  1LWC A;  4LQ3 A;  4B3M F;  4LSZ B;  4MKY A;  3MK1 A;  1E3C P;  4U8Y A;  3TAM B;  5M2R A;  2YQ3 A;  3WC2 A;  2KXH A;  1TZ0 A;  3S7R A;  4RUC A;  2XLI A;  4ID8 A;  4K4X A;  3RBX A;  1AUD A;  5KFJ A;  2XUL A;  2RS2 A;  1XMO J;  4FF2 A;  2HGM A;  1O8B A;  2EK6 A;  1VFJ A;  3B54 A;  2JEJ A;  1X4B A;  1C1C B;  3SBM A;  3VAG A;  4DR5 J;  4ECV A;  3IWN C;  5E33 A;  1JNR B;  1SV5 A;  3CPW R;  9ATC B;  5A2Q Y;  1X60 A;  4NAS A;  3W2V B;  3KLI B;  4JI1 J;  2PMZ D;  1SQG A;  3NGK A;  1PKU A;  4DR1 J;  5HBM A;  3ZXW A;  2XYP B;  2UUB J;  4FXW A;  2V2Q A;  2VPZ B;  3NGR A;  4TN0 A;  2R3V A;  2RRB A;  1S49 A;  1ZM3 A;  4Q2L A;  3SDE B;  3QJL A;  3P5T L;  3QIP A;  1P6T A;  4CRJ A;  2UU9 J;  2HS4 A;  4ATN A;  5C24 B;  3M05 A;  3U1L A;  3RRH A;  3H2L A;  3W3S A;  4QU6 A;  1KHJ A;  1HAR A;  4WYL A;  4HTJ A;  3PO4 A;  1XMQ F;  3TUP A;  3MD1 A;  5KFC A;  2Q43 A;  1URR A;  2ZBR A;  3I9Z A;  1MRO B;  5A76 A;  2W5R A;  4WP8 A;  1ZEB A;  1BQX A;  5KFL A;  2PMH A;  4DQI A;  2DGU A;  3DLG B;  3PJ9 A;  3EJM A;  3LAN A;  4NL5 A;  4XAK A;  2Y1L B;  3M30 B;  2CG8 A;  1S4F A;  4OX8 A;  2QRR A;  3C8Y A;  4K4U A;  3TAM A;  1JLG B;  1SC6 A;  3QZ8 A;  1U26 A;  3MAQ A;  4UZC A;  4Z7C A;  3HO1 A;  3SCL E;  1BGX T;  1WC1 A;  4AFF A;  3I56 S;  1F0X A;  4DJB A;  2F4V J;  3QRR A;  1WG5 A;  2BAC A;  1OYD A;  1R27 B;  4M5N A;  5F8L A;  1NDL A;  1YKW A;  2ZKT A;  3IAS 9;  5DDQ C;  2MQO A;  4ZA1 A;  3UWT A;  2ZDO A;  2Q66 A;  4DL6 A;  2ZBP A;  4O3Q A;  5HQL A;  4Y2C A;  2COL A;  1P1T A;  1L5U A;  1XTZ A;  1IJF B;  3IG1 B;  4DF8 A;  4DFK A;  3KLI A;  1F5A A;  4QYZ K;  2EEY A;  3G71 S;  3MF5 A;  4B17 A;  3NOC A;  2HNZ A;  2BMB A;  2IVF B;  2A3J A;  3UDL A;  1W25 A;  5L0E A;  4DL5 A;  2HLU A;  1RWK B;  4LRD A;  1Q8K A;  1SC3 B;  1XR6 A;  2ROE A;  3UR0 A;  2AQ4 A;  4UPK A;  2I0X A;  2DHG A;  4EBE A;  3A3P B;  9RUB A;  3UDC A;  4ZCI A;  2HBZ B;  4F4Y A;  1RT2 A;  4ZJL A;  4YOE A;  4YY3 J;  3W62 A;  1HR0 J;  3OFF A;  3G6X A;  2NQP A;  2DNP A;  2CNK B;  2C3O A;  2KYZ A;  1TL5 A;  4A8W A;  2AJF E;  4ANC A;  5IM0 B;  1T9V A;  4S0M A;  4DMZ A;  4IFY A;  4YR2 A;  4DR1 F;  2GSO A;  4LJM A;  2NXC A;  3KLG A;  3RU0 A;  2PFF B;  2GGP A;  4CNZ A;  3IMQ J;  3M8P A;  4K8R A;  1QM9 A;  3KLF A;  2AT1 B;  3K5L A;  3LUY A;  3ICL A;  3TAR A;  4HI2 A;  3MD3 A;  5KG7 A;  1JQG A;  4F4X A;  3ZTQ A;  3V81 A;  2UVR A;  4I7F A;  4OI2 A;  1BWV A;  5KG0 A;  2HS0 A;  2OPS B;  4WXO A;  2AD9 A;  2YVS A;  1EKR A;  2IRY A;  4DPY A;  1JLQ A;  2F40 A;  3GIR A;  1XMO F;  1X9M A;  1UCN A;  3IR7 B;  5ETS A;  4RNN A;  2H48 B;  2D3O R;  3GYX B;  2UUC F;  2KFZ A;  3WX4 A;  1IM4 A;  4X65 J;  5MLC V;  3VAK A;  2JEF A;  3CJ3 A;  3EDR B;  2AIR B;  3I0S A;  3KJQ B;  2VZ9 A;  2MKK A;  4FS1 A;  3I55 S;  1X31 C;  3NKQ A;  3R7B B;  3HFZ B;  3W9H A;  2BV3 A;  3R5C A;  1VQM S;  3AA9 A;  2CDQ A;  5F41 A;  2BQR A;  1DHM A;  3ELH A;  2F1F A;  3VAJ A;  1CJV B;  1U09 A;  3DRR B;  2H65 B;  4OYM A;  3GV7 B;  3F73 A;  1S0N A;  1TP7 A;  2CQH A;  1C1B B;  2G1D A;  4ZPC A;  2VQR A;  1SKW A;  3THP A;  4MKB A;  2N3O A;  2FJE B;  4K7Q A;  3H4B A;  3VZH A;  2ZOM A;  4RW6 B;  4Q8E A;  2DNY A;  5EGY A;  2FHK A;  3M9N B;  1IBL F;  2AEF A;  5HJX A;  3UE2 A;  2KT5 A;  4DCJ B;  3HFV A;  1REV B;  5AJ3 F;  1GEH A;  3T1A A;  4RX6 A;  2WON A;  1RA6 A;  2QL5 B;  2XY7 A;  5E3P A;  4IH5 A;  3MMA A;  1OJ4 A;  3TX0 A;  4ZPW R;  2NR0 A;  1Y9O A;  1SI9 A;  1QJH A;  4FDF A;  3VGS A;  1J5O A;  3MM6 B;  3HX9 A;  4P2X A;  3TZY A;  3BO4 A;  1X4F A;  1YJT A;  2QMX A;  3DRY A;  2ZBQ A;  2CQ2 A;  3CXC R;  1VIO A;  1XBW A;  3OFG A;  5JXS A;  2XHC A;  4GKK F;  2NXN A;  5L38 A;  2MLZ A;  4CQ1 A;  3OXL A;  2LA4 A;  2H9Z A;  3D7S B;  3P4U B;  1H0H B;  3MAA A;  1FRK A;  1Y5I B;  1U1K A;  4P74 A;  4YEA A;  5L0K A;  1DQ8 A;  1RYR A;  4GKJ F;  2HND B;  3MM5 B;  4PG8 A;  1SIW B;  3UW1 A;  3EXY A;  5SUH A;  4MK9 A;  2FJB B;  2X3G A;  2ZH7 A;  1VQS A;  3H2U B;  3NXZ A;  4WFX A;  1ALK A;  2OSR A;  2OPQ B;  3IAM 9;  3MPV A;  3CCT A;  4P73 A;  1UPM B;  5FDL B;  1R7I A;  2YKN A;  1H7X A;  4B08 A;  2FGC A;  1RHR B;  2AMC B;  4M1K A;  4A46 A;  2I6W A;  4ECR A;  3H0P A;  2FJV A;  2BEF A;  2ZVS A;  2XO6 A;  1VBK A;  1WOP A;  2RD5 C;  3GJT B;  1M5K C;  5FJ4 A;  4IFV A;  2XMK A;  4QW8 A;  3UCU P;  4NLG A;  4OFZ A;  4RPF A;  2W9A A;  1FNM A;  1U49 A;  1HQU A;  2DEI A;  3BGO P;  3M8Z A;  3Q8Y A;  4YR3 A;  1VRU B;  2R2S A;  4F8R A;  2P8I A;  3RJM B;  1U6B A;  1O98 A;  2HK3 A;  2LDI A;  2ZZN A;  4KH1 B;  2WOM A;  3EZO A;  3HSZ A;  1IUJ A;  5BJR A;  4DX8 H;  1MSW D;  1IWG A;  1XWL A;  2DNO A;  5CYJ A;  2OFH X;  5A0Y A;  5KTQ A;  1SL2 A;  1TKD A;  4C8O A;  1AJB A;  5E3R A;  1NHU A;  2OD4 A;  2X1F A;  4DR4 J;  1ARO P;  3DI6 B;  4QPT A;  1WHY A;  3VAF A;  1RAC B;  3ITH A;  4OJ3 A;  4HAC B;  2C42 A;  1HPZ A;  1J5E J;  2LYV A;  2E9T A;  5DG7 A;  2D74 B;  5GMD A;  5IM0 A;  4CXK A;  1N56 A;  1LWE B;  4LFA J;  2GSN A;  1FKO A;  2HQI A;  2Y1R I;  2CRL A;  2UUB F;  1FF2 A;  1HQE A;  2QLX A;  4B3O A;  5D4P A;  1NK7 A;  1Q86 T;  4Q8F A;  1RTJ B;  2EC2 A;  1NSP A;  3U1N A;  3DYA B;  3UNY A;  1EHW A;  5K20 B;  5DM7 Q;  3JTP A;  2ZNZ A;  3D0G E;  3EGW B;  1RWX B;  3V81 B;  1AJD A;  1OQ6 A;  4AYB D;  1R0B G;  3NKO A;  1K1Q A;  4TN2 A;  5HRO A;  4Y2K A;  4ED6 A;  4C8M A;  2XWY A;  3E01 B;  1WAC A;  3ETO A;  3GV5 B;  4LF7 J;  4F4A A;  1L3U A;  4LF9 J;  3IDD A;  4NLX A;  5EWG A;  1KS2 A;  2RH3 A;  3LGM A;  3O1L A;  3M30 A;  3O5T B;  3T9Z A;  2R7W A;  1TAU A;  3R9L A;  1V5I B;  1FCA A;  3KDN A;  3PW5 A;  1WJ9 A;  2XMV A;  4ZJO A;  4FXD A;  3IWL A;  3RYL A;  3B4M A;  1X9W A;  4YUD A;  4LSL B;  4R8U B;  5BYR A;  4LQY A;  5L1J A;  4CLT A;  3C3L A;  2Q79 A;  2XYH B;  1YX2 A;  5G4D A;  1ELY A;  2XS7 A;  4DV6 F;  1RAG B;  1RTD A;  3MR7 A;  2F4V F;  2MLY A;  2IPO B;  4RWW A;  4TKT A;  2KG1 A;  3NCR A;  4CXU A;  1AYE A;  1U1Q A;  3IBC B;  1KFS A;  3IG1 A;  2Z58 B;  4LUB A;  2MSS A;  4O4G B;  1TV6 A;  1K1S A;  2I38 A;  2Q6B A;  1PYS B;  1CS4 B;  5J1N A;  3RB4 A;  3G86 A;  1E6V B;  3QWP A;  5IJQ A;  4WFZ A;  4URS A;  3OUY B;  4A8S A;  5LMU J;  5HP1 B;  2DR9 A;  2UVV A;  3C6T B;  1LWC B;  4GKJ J;  2BW7 A;  2H5J B;  1SH3 A;  3OT9 A;  4ZG7 A;  2YQ1 A;  4B9L A;  4NLO A;  2HUR A;  2OFG X;  3IFE A;  4DR6 J;  1TL1 A;  2DYA A;  4FVM A;  1S57 A;  4HKQ A;  2MJU A;  2NS1 B;  4L3K A;  2KTQ A;  2M7S A;  4P9S A;  4U67 Q;  2VIH A;  3OSN A;  1E2S P;  2Q3P A;  2W4P A;  3D2W A;  4QCL A;  1Q95 G;  3BGL A;  1GXU A;  2ZH8 A;  3CD6 S;  4X4V A;  4J9V A;  4ZLL A;  2NZ4 A;  2GCF A;  1YBT A;  1YBA A;  3Q8U A;  2IM2 A;  4ZHR A;  5D6G A;  1WEX A;  2QE5 A;  3OQ2 A;  1OO0 B;  3KLF B;  2FVR A;  4HDH A;  5HRT A;  1V3S A;  4DS4 A;  5EGH A;  2HKE A;  2HVH A;  1U0H A;  4PQU A;  2GHP A;  3T6J A;  3HP6 A;  1YIJ S;  4Q5V A;  3CMA S;  1HLW A;  1ACM B;  2YWE A;  2F5G A;  1U1R A;  2WVE A;  1AA1 B;  4ZVO B;  3A12 A;  3D4J A;  4K0K J;  2RIJ A;  1G7C B;  1QE1 B;  3CJ2 A;  2QGF B;  3GYG A;  2PO4 A;  2A2C A;  4CLW A;  5F9L A;  4LF4 F;  3PYG A;  4ECX A;  4I4B A;  1SJ1 A;  2NPF A;  1IBM F;  1VQ9 S;  4PYD A;  1LWX A;  3SQG A;  3G4S S;  2PDA A;  4B3M J;  1NBE B;  3UDV A;  5HK4 A;  3T41 A;  4WFA Q;  4Y6I A;  1T8E A;  4NLU A;  2FZG B;  2B9W A;  4ZCM A;  3PYD A;  1Y11 A;  4DV4 F;  3UD4 P;  2G2Z A;  4QJV A;  1FRJ A;  4P7V A;  3UFC X;  1RT5 A;  1HNI B;  2VU5 A;  3KMS A;  4MFB A;  2GO8 A;  1YJ7 A;  1D9A A;  2N7C A;  4PAA A;  5J2N A;  2L08 A;  4W98 A;  2RUS A;  5DG9 A;  3GYN A;  2CDR B;  3TRG A;  2W8L A;  1MN7 A;  4RR5 A;  4WP9 A;  4RW6 A;  1KR4 A;  3DOM A;  2FQQ B;  2J6S A;  2W7P A;  3E3X A;  4NE9 C;  3V4I A;  4DPX A;  4ZHR B;  1M1K T;  2QG9 B;  1SH0 A;  4GTX A;  4DV0 J;  2ACM A;  5E3A A;  2GMJ A;  3OJS A;  2PGC A;  4ZJQ A;  2V2K A;  2XS5 A;  2MZ1 A;  3MPD A;  4RU2 A;  4HAC A;  3IO1 A;  4NA1 A;  1NSQ A;  3ZZT A;  4ENO A;  1JB0 C;  4C8N A;  1SJQ A;  2GML A;  4PR6 A;  5C25 B;  2FTR A;  1O51 A;  5L8R C;  4C3K A;  1EQ0 A;  2RU9 A;  4WF9 Q;  1FJ7 A;  2RAQ A;  1NB7 A;  2XWX A;  2IYI A;  4HT5 A;  5CD4 H;  2I2Y A;  1VGY A;  2DY1 A;  5FLX U;  3N79 A;  5B0F A;  2UP1 A;  4NI2 A;  3DYA A;  2ZHA A;  4DV5 J;  3QFH A;  5D78 A;  1GMU A;  4OI4 A;  1I5O B;  3OTO F;  4LVO P;  1WNE A;  3HXM A;  5IV3 A;  3M8R A;  1QSL A;  4LF5 J;  3H5X A;  2V69 A;  4LQ9 A;  3THV A;  1UEK A;  2MY8 A;  3KUG A;  1ZM9 A;  4NI2 B;  2ATC B;  2KFN A;  1HHS A;  4F0K A;  2FHJ D;  1Z4U A;  4ZVE A;  1R8H A;  3T02 A;  2KHD A;  4LR8 A;  4OJ1 A;  4AQY J;  1TK5 A;  1RA7 A;  3EVW A;  2MKS A;  1U1O A;  5FDL A;  2ERR A;  4UPH A;  4O3O A;  4PG6 A;  3J7Z 5;  1SH2 A;  3EM1 A;  3N4W A;  2W5Q A;  1HWU A;  1VMB A;  3DHX A;  1KQF B;  3GIM A;  1K0V A;  2DXF A;  5GME A;  2C2N A;  3P96 A;  4EGL A;  3JSB A;  3UD5 A;  2IDL A;  1DAR A;  3TVZ A;  2EG1 A;  4NEZ A;  1S9E A;  2YNI A;  3O44 A;  3TWZ A;  4ELV A;  1X5O A;  3TUI C;  5T14 A;  2O5D A;  1FK9 A;  3OJU A;  1H6K X;  3E2D A;  2QLF B;  3DXB A;  3QAU A;  1KTQ A;  4AQY F;  1TL7 B;  3CW2 C;  4EYI B;  2GIR A;  1FEH A;  5KOW A;  3O8W A;  3BBC A;  4KAI A;  5HQ8 A;  3HHK A;  3M2V B;  4WE1 A;  4X4P A;  4DUZ F;  4DDF A;  5F0U A;  3B4D A;  4A8M P;  1FRM A;  2JX2 A;  4B9T A;  4QR0 A;  4IQX A;  3ZZZ A;  2X1A A;  1QVF R;  1FHT A;  4TLR A;  2OAU A;  2D69 A;  1Y10 A;  1D8Y A;  4OX6 A;  2UU9 F;  1Q0N A;  1S9F A;  4LIR A;  1S5Z A;  4DV5 F;  4H54 A;  3N5F A;  3SCJ E;  2WB1 D;  1WOO A;  1JJH A;  1FX2 A;  1EW9 A;  4JI0 F;  3Q86 A;  2HGL A;  3I4P A;  2YNH A;  3KHG A;  2YQ0 A;  2CJB A;  3MM9 B;  5ADZ A;  2W8D A;  4CLU A;  2QT7 A;  4PG5 A;  1WI8 A;  4X4S A;  3FDS A;  3EX7 B;  3RBZ A;  1UA1 A;  1HQA A;  4I2Q B;  3OHA A;  2DK2 A;  3FVY A;  4X66 J;  1GQE A;  2Q1L A;  3HT0 A;  4UZB A;  1Z2Z A;  5CAB A;  2EBE A;  4U9R A;  2J0X A;  1HNW J;  2PN6 A;  3DC2 A;  2DIV A;  3BGU A;  3M2R A;  3MOZ A;  4NCG B;  4X62 J;  3KK3 B;  3K5N A;  5L1L A;  2GVZ A;  4ZPD A;  1IKY B;  1MMD A;  4P10 A;  3M8Q A;  1KP6 A;  1FNO A;  2HBQ B;  1C0U A;  2ILY A;  2L41 A;  4DZ6 A;  5RUB A;  1HNX F;  5IT9 U;  5CXT A;  4OI1 A;  5C7P A;  2E5J A;  4NLV A;  1WHV A;  2Z8Q A;  3AJD A;  2AHO B;  1H73 A;  4OYZ A;  4QIE A;  3V5R A;  4O0I A;  2RRA A;  1U7L A;  1X7V A;  2CKW A;  1HA1 A;  1R8C A;  3HI9 A;  4DBQ A;  5KFK A;  4RUB A;  1WG1 A;  3CC7 S;  2GLQ A;  1RAA B;  4JI2 F;  3TZW A;  1N8R T;  4GRS A;  3IM8 A;  1SCJ B;  3CD7 A;  3TW0 A;  3NKM A;  2UV8 A;  1RB0 A;  2JLE A;  4YDD B;  1FTR A;  3D6M B;  3BDH A;  3DMJ A;  1NZA A;  4FNI A;  4I2P A;  4ES3 A;  4B9N A;  1RGV A;  2R8J A;  4KT0 C;  4DWI A;  3CCQ S;  1VRT A;  2VHG A;  4CLZ A;  1EQM A;  2FVC A;  4DQQ A;  2AYM A;  1M1G A;  4Q0B B;  4X4U A;  4KE5 A;  3IXQ A;  4P52 A;  1SKS A;  1NHK L;  4O3N A;  1Y00 A;  3OBI A;  1IBM J;  4O44 B;  1BWE A;  4IQM A;  2G9O A;  4OI3 A;  3PW0 A;  2DH8 A;  2VG7 A;  3WX8 A;  4A48 A;  1AZS B;  3TQE A;  3MR2 A;  2RQC A;  4X4N A;  5F8J A;  4UPI A;  4OZN A;  3WAX A;  2UXB F;  1FDD A;  4NLT A;  1HBO B;  2CQ4 A;  4YB7 A;  2ROP A;  2VV5 A;  4R8U A;  1IBC B;  2O66 A;  2XY6 A;  2GQ2 A;  5KFI A;  4DX7 A;  5KG5 A;  5HI7 A;  5D0G A;  3GJS B;  1CJT B;  2MKH A;  2KHC A;  3KFW X;  2EPI A;  4M8L A;  4RBT A;  3E2E A;  4NZ7 A;  2VQE F;  1DTQ A;  4B9V A;  2XBP A;  3H5Y A;  4DQP A;  3G6V A;  4IRC A;  2J9D E;  1HBO A;  3HSG A;  3LPY A;  5HAO A;  3KLE A;  2NXJ A;  2RQ4 A;  3ENQ A;  3ET6 B;  3HHD A;  4ZVH A;  3JTO A;  3J7Y I;  3NKY A;  1HPZ B;  1RWM B;  1G1X A;  3PRV A;  2BM1 A;  4WK3 A;  1KSP A;  2IDE A;  4LIW A;  2HBR B;  3C14 B;  4OZJ A;  5KG3 A;  2D9O A;  4USW A;  4CLK A;  3QRQ A;  3GV8 B;  2IY5 B;  2DD8 S;  4MY4 A;  3KJN B;  2MZS A;  4OLO A;  4F25 A;  2X51 A;  1QUP A;  4QPX A;  4B3S J;  1N5S A;  5CHC B;  1KHK A;  4NWJ A;  2HZC A;  5HMZ A;  2XO7 A;  1VIS A;  4C2M A;  4KHM A;  4DR3 J;  4QIV A;  4KSE B;  4E2F B;  4HT7 A;  4OYB A;  4Q43 A;  4X2B A;  1WF2 A;  3MM8 B;  3M1V A;  5I3U A;  1RAD B;  1K44 A;  2VBX A;  4C0H A;  3EXC X;  4CO0 A;  1WC3 A;  4CO1 A;  1UWB A;  4NXM F;  2B3T B;  1IR0 A;  3CO9 A;  4MFB B;  5J2N B;  1JLF A;  2FY1 A;  1U6Z A;  2HNY A;  2MQL A;  3FEY B;  3DLG A;  3O6Q A;  1U6F A;  2OI2 A;  4JP8 A;  4CH1 A;  3DLB A;  3A52 A;  2GNK A;  2GA3 A;  2N4D A;  1JLB A;  3OSP A;  1IKV B;  5IXU A;  4LFC F;  5AE2 A;  3A4T A;  1L3V A;  4FYY B;  5LT5 A;  3NLC A;  2QLB B;  1NK6 A;  1FWK A;  3T5L A;  1UW4 A;  1UFK A;  3PR4 A;  4KIA A;  5BR8 F;  5J2Q A;  3SYZ A;  4ID5 A;  1B0T A;  3M8S A;  1AFI A;  1VBX A;  3NBP B;  3TEH B;  4WK1 A;  4LRC A;  1Q8L A;  4PYA A;  4AL5 A;  2H54 B;  3UI3 A;  2XHW A;  5D0H A;  5D0R A;  5DQI A;  3ED4 A;  2J8S A;  1MMN A;  2POK A;  4KYZ A;  4FS2 A;  4K59 A;  1JIH A;  4C7Q A;  3ITH B;  1ED9 A;  4LFA F;  3PKM A;  1NH8 A;  5H9F K;  3T9N A;  1DQ9 A;  1U2F A;  5C42 B;  3BSA A;  1T9Y A;  4QZV B;  1T9T A;  4UF4 A;  1PCA A;  3KYL A;  4P2F A;  1KBR A;  4IR1 A;  1IVZ A;  2J0Q D;  3TVK A;  3FBE A;  2QA1 A;  3MCS A;  1KLM A;  3GPA A;  3MMB B;  4ZVQ B;  4RW9 B;  3U02 A;  3MXH P;  2RDD A;  5KT4 A;  3IGN A;  4LF2 A;  5IT9 Y;  5GAH U;  2VB6 A;  2YKP A;  4PPD A;  4WKY A;  2HEK A;  2VL1 A;  1U0H B;  3P3D A;  5LMU F;  1O0P A;  2QSF A;  4CI0 B;  4FF3 A;  2AYB A;  2ZUG A;  2DPJ A;  4WII A;  4RW9 A;  1RAH B;  2DT9 A;  1W2I A;  3SEO A;  2MXY A;  3RGI A;  3M9O B;  1NO8 A;  4O3S A;  1GXT A;  1S59 A;  1TKX A;  5IT0 A;  2KG0 A;  2CWX A;  2HGN A;  3CCU S;  2QZU A;  3FBF A;  2IIH A;  5A8R A;  5GAG I;  1NJW A;  2P2C B;  1SJ3 P;  4C4W A;  2V0N A;  2R7R A;  4DSE A;  3ENW A;  2CQ3 A;  2VOD A;  5KFB A;  2OTJ S;  1RLC L;  3D68 A;  3J81 j;  2MEW A;  2IHR 1;  3CCJ S;  1SL0 A;  3QRP A;  1RTI A;  4TY8 A;  4BHQ A;  2FC8 A;  1UVN A;  3TA0 A;  1U47 A;  2UVU A;  4NYZ A;  1NK9 A;  2BKP A;  3NS6 A;  4KRW A;  1RCO B;  1IKX B;  2DNK A;  2NYH A;  3IRX A;  5ETQ A;  2VC0 A;  3IBF B;  5E41 A;  2MZR A;  3KJV B;  3NKR A;  3B82 A;  4HVZ A;  5E5N A;  3EZ5 A;  4IO1 A;  2HZV A;  4G6V B;  3IM9 A;  2KRB A;  3PO5 A;  1YRX A;  3BS9 A;  2VKZ G;  3PYE A;  4NPO A;  3PNI A;  1IR1 A;  5KOX A;  4JI3 F;  3PHT A;  2J76 E;  1YLX A;  3N01 A;  3D1H A;  3OVA A;  2R2U A;  2G0C A;  1RTH B;  3KHH A;  2E9R X;  1ANJ A;  3BBF A;  3G87 A;  2VDH A;  3BKF A;  2UUA F;  3MM7 B;  3T1H J;  1CEZ A;  3T00 A;  1TKT A;  4BC7 A;  1LWF A;  1YZ6 A;  2V8G A;  4QR2 A;  2HHH J;  1AUK A;  1HFE L;  2DNZ A;  5J2M B;  3FMB A;  1T94 A;  2QLW A;  3FZ2 A;  3LQV A;  3BO2 A;  3M32 B;  4PQA A;  1EKS A;  1HI8 A;  5C24 A;  2C2D A;  2IJN A;  3I0S B;  5LM7 E;  4YME A;  5BR8 J;  4A8X A;  2XCA A;  2F63 A;  2RSQ A;  2ZDP A;  1DTT B;  5B0D A;  2QJ3 A;  4EMD A;  3DRS B;  3LGH A;  3QGH A;  2KB2 A;  3HZG A;  1VHF A;  1C4A A;  1FDB A;  4PAB A;  3JQJ A;  4IH6 A;  3FC9 A;  1QE1 A;  1EB0 A;  1XIQ A;  1CJV A;  1YGY A;  2K1R B;  3HPO A;  4ER8 A;  1UPP A;  2CNO B;  4FNH A;  3PG9 A;  1F2H A;  2CJY B;  2V63 A;  4DXL A;  1M0S A;  5B7W A;  3MFH A;  1PO6 A;  1KH7 A;  4F26 A;  3BQ1 A;  3T3F A;  3KTQ A;  3FSY A;  3AA8 A;  2CJ9 A;  3DHW C;  3GQC A;  4DSI A;  3CUL A;  4CTA A;  4IG3 A;  2BAN B;  1TVR A;  3R6G B;  3CJ0 A;  4M5D B;  4IDK A;  4WIQ A;  1KVJ A;  3A3O B;  2GJF A;  1VC0 A;  1HWL A;  2KKH A;  4LRF A;  3R2C J;  2KYX A;  4QOT A;  4MIV A;  2Z2Z A;  4O3P A;  3U27 A;  3GIK A;  3NNC A;  2M52 A;  4C8Z A;  4Y0F A;  1MML A;  1AZS A;  1RTH A;  2GS8 A;  2MZJ A;  1UWA A;  1N5Y A;  2Y1I A;  4PKD B;  4RBU A;  5GAE U;  1FVQ A;  1RWV B;  2AGQ A;  2JEG A;  2KU7 A;  1SBR A;  4NA3 A;  4WJB A;  4TY9 A;  4ZP8 A;  2Z0G A;  4WE1 B;  1URB A;  2D3U A;  3US5 A;  2OEK A;  1RP5 A;  3JTN A;  4RUA A;  2W5V A;  3K89 A;  5ETP A;  3PJW A;  4XO0 A;  2B9E A;  1VQP S;  3OTE A;  1UJ4 A;  5K5M A;  2CVE A;  1URA A;  2IC3 A;  5LL6 d;  1AJC A;  3KXD A;  4CLL A;  1QTN B;  2J9D A;  2Y8Y A;  2MGZ B;  4TQS A;  3HT3 A;  4UY8 5;  3QO9 B;  1K0T A;  5AJ3 J;  1BXN A;  2LQJ A;  3AOC A;  5BYS A;  3CGI A;  2G9Y A;  3KD8 A;  1RHM B;  2VIC A;  1O5J A;  2VBZ A;  4I2Q A;  3F44 A;  2HVZ A;  4IO9 Q;  2CQB A;  4JV1 A;  2HW3 A;  4WTY A;  2AV5 A;  4ZOS A;  2QV6 A;  1JLQ B;  1MRO A;  1SPB P;  1R0A A;  5DLW A;  1OQ3 A;  2KI2 A;  1NK4 A;  2YWH A;  4GTY A;  1LXN A;  2J9E A;  2W9B A;  1VIX A;  1VK3 A;  5HMW A;  4KPY A;  2DGW A;  4H4M B;  3CB4 A;  4U7U D;  1ZBT A;  2BDP A;  2DO0 A;  5LMN F;  4CIO A;  1IKW A;  2MQN A;  3JQM A;  1AJA A;  1FTC A;  2HAF A;  1H3D A;  2CPX A;  2MQM A;  2KZM A;  4E0D A;  5KFG A;  3V6J A;  3R1L A;  1G3O A;  1PJ5 A;  3BGR B;  2ZZM A;  3ADA C;  2V6A A;  3VGU A;  1I1G A;  1NME B;  2DIU A;  4MIW A;  4ILL A;  4CYR A;  1T0T V;  3MMC B;  3BSC A;  3BYP A;  5IT4 A;  3K58 A;  1GX6 A;  4ED1 A;  4WFY A;  2BUN A;  2O1P A;  4ZK7 M;  1H74 A;  4N41 A;  2LCW A;  4WXW A;  3RW7 A;  4WZM A;  1HIY A;  5D4O A;  3GIL A;  4LF7 F;  1FJE B;  4KV8 B;  1D0E A;  4LF6 J;  1HNW F;  1FFS B;  2ZH3 A;  3EPI A;  1KH9 A;  1HHT P;  3CD0 A;  2V94 A;  1S6Q A;  1REV A;  2GA7 A;  1ZYQ A;  1Q78 A;  3I5B A;  5E0O A;  1S1U A;  2OIH A;  3T1H F;  4TXS A;  2B51 A;  3J81 U;  1KHL A;  5C66 A;  5IC4 B;  4OYW A;  5I3P A;  5EHH A;  3UNG C;  3K59 A;  1WUU A;  1C0U B;  2HAI A;  3E8O A;  3MMA B;  2IAJ B;  3UQS A;  3KLG B;  1S0V A;  4IFY B;  1RT4 A;  1NUE A;  1RU2 A;  4ED0 A;  3R27 A;  2ASJ A;  2Z2Y B;  2W9B B;  1ZEF A;  1QY7 A;  3GII A;  1CJT A;  1FXD A;  2CZ9 A;  2GIQ A;  3I4H X;  1DTQ B;  4A4J A;  1H72 C;  2BQ3 A;  3H90 A;  5IFM A;  5LSR A;  4LFB F;  1KNZ A;  1ZAX A;  2CJX B;  4MYU A;  3VTI A;  1IR2 A;  1N33 F;  5FD1 A;  3J7Y U;  1IKY A;  2VG6 A;  1RE1 B;  8RUC A;  2HND A;  4QWB A;  1R8B A;  1RTD B;  4ZG6 A;  4MKA A;  1A0O B;  3PKY A;  3GTY X;  3I87 A;  5IQQ A;  3BB5 A;  3BM7 A;  3WQP A;  1D9F A;  3RR8 A;  2AP6 A;  1RK8 A;  3NRB A;  5C2C A;  2FJD B;  3FMW A;  4PUO B;  1SXL A;  2QN6 B;  1JXE A;  1TKZ A;  2G13 A;  3Q83 A;  1KQK A;  3MTK A;  1CC7 A;  4HHH A;  4QQB A;  4ALZ A;  4B3R J;  1E6V A;  2XGQ A;  3D66 A;  1S6O A;  2ZH6 A;  2PSZ A;  2AX0 A;  2BJ1 A;  1YIT S;  1S7H A;  3POT A;  1RT1 B;  3MCM A;  4IFV B;  3TZX A;  4ZVP B;  3IP0 A;  1TQL A;  2XCP A;  3TI0 A;  2V8P A;  3K5O A;  4LMZ A;  1UKU A;  5CCL A;  1TK0 A;  3KNA A;  1NKE A;  1QVG R;  2W5W A;  3TG0 A;  2E1R A;  3CIM A;  7FDR A;  1RT6 A;  4IG0 B;  4ZG9 A;  4ZPA A;  1VQ6 S;  2AU0 A;  2BQU A;  4ZPT R;  4R25 A;  3QPI A;  4F4Z A;  4NOH A;  4MTP A;  1UFL A;  3GFH A;  3C14 A;  3NGS A;  2DNN A;  4HR2 A;  1FRL A;  1GMW A;  2B6A B;  4ZN1 A;  5L46 A;  3J7A N;  3OR1 B;  2W25 A;  4MH8 A;  4ZVG A;  4YP3 A;  2YNF B;  4X64 F;  4NX9 A;  2DNR A;  2VQE J;  1LW2 A;  2L3M A;  1N0V C;  3LP1 A;  5J2M A;  2DRB A;  2XI2 A;  3AD7 C;  5EN1 A;  3W63 A;  1M5V C;  2YH1 A;  1GH8 A;  4JYA J;  1QAI A;  1MG7 A;  2ZOF A;  3SZY A;  2H4Y B;  1YG0 A;  4QBU A;  1Q5Y A;  1ZA2 B;  2W4D A;  1R8A A;  3AD8 C;  1DUR A;  3DRS A;  2FVP A;  1FWP A;  2APO A;  2JC0 A;  3MM5 A;  3NS5 A;  4I67 A;  1PSD A;  3FFI A;  1KVK A;  3IS9 B;  3K5M A;  4CLS A;  2Z56 B;  3HD1 A;  1Y3J A;  2CZV C;  1CJU A;  4LFC J;  3MMB A;  4DI6 A;  2CPY A;  3MCN A;  2OKQ A;  3M8Y A;  2NLW A;  1H7W A;  2OPP A;  1Y7P A;  4DU8 A;  4FBT A;  4UOR A;  3NP5 A;  2B5J B;  3CDB A;  4F2S A;  2AJQ A;  2H3E B;  1S1V B;  1YSJ A;  3SXL A;  2I5J B;  3CT9 A;  1X4G A;  2C3P A;  1N5T A;  4R5P B;  1NJY A;  3MOJ B;  1FA0 A;  2XRG A;  1X4A A;  2VAS A;  3DOM B;  5CAA A;  1LNQ A;  2LEA A;  4RW4 B;  1N2K A;  1JLG A;  1OY9 A;  3OTC A;  2MDA A;  1BQN B;  1C1C A;  1WKL A;  3AD9 C;  4M94 A;  3BR8 A;  4XK8 C;  4ZP7 A;  5KFW A;  3NCP A;  3P6Y C;  5A6P A;  2M88 A;  3DU5 A;  2HNY B;  3BYR A;  3UVJ A;  4ELU A;  4DL7 A;  4ZLP A;  3FEZ A;  1VYA A;  4AND A;  3PTW A;  4E98 A;  3MK0 A;  1VRU A;  1QSS A;  4UPL A;  4UOO A;  3THT A;  3W66 A;  3IC1 A;  2UXC J;  4IKA A;  5KT2 A;  4CO3 A;  1B70 B;  2RH6 A;  3GG0 A;  2HNZ B;  4ZCL A;  2ZC4 A;  3PYF A;  4KQZ A;  4TYA A;  2WHO A;  1F3V A;  2ZWP A;  4X66 F;  3MTJ A;  4ZPV R;  2HHH F;  1T02 A;  2B4U A;  4ES2 A;  3CDA A;  4ANE A;  4ZCK A;  1FKO B;  4JI6 J;  4V19 J;  2OMO A;  1QD1 A;  3D6H B;  3UO0 A;  2B4P A;  3QO9 A;  1VQ5 S;  3AT1 B;  2QTW A;  3TUZ C;  5KG2 A;  4DN9 A;  3DDI A;  4J9S A;  2C3U A;  2HHV A;  2E44 A;  1S6P B;  1VCT A;  2IFX A;  5E7O B;  4CO5 A;  5J2Q B;  2L9W A;  2RDI A;  5CYQ B;  4QWD A;  2E5G A;  3C16 B;  2ZJQ Q;  3CME S;  5LJ5 Y;  4JI7 J;  1F9F A;  1LWF B;  1ALH A;  1KLM B;  1EX8 A;  3S8S A;  2XGP A;  2W1B A;  4N76 A;  2F8H A;  2P9C A;  1MWZ A;  2HZA A;  3RAQ A;  1KLN A;  2RML A;  1BQM A;  3KUH A;  1T7P A;  4OHY A;  2HSE B;  4KC5 A;  5I4M A;  1E6Y B;  3KOA A;  4IOA Q;  3N6M A;  4NWB A;  1S1X B;  4PZV A;  4C48 A;  4J37 A;  3BO3 A;  1TEL A;  2CPI A;  2C2K B;  1XR5 A;  2RJZ A;  4A47 A;  1D1U A;  3DDK A;  4MHX A;  5THW A;  5KFQ A;  2AJ1 A;  3RUB L;  3QGG A;  5AXK A;  3W60 A;  1RKJ A;  1RWW B;  1TUG B;  3J80 Y;  1QSY A;  3BDP A;  3ZNU A;  1TFY A;  1AW0 A;  3QWU A;  2IRU A;  1WF1 A;  3M2U B;  3MED A;  4IH7 A;  4C0B A;  5HVG A;  2DKO B;  2R4F A;  1XMB A;  2MKC A;  2E5L F;  4B3T F;  2VOP A;  1ZH5 A;  1U48 A;  1TVR B;  2ZFH A;  3FSX A;  4LF9 F;  3QAE A;  4ZKA A;  4F36 A;  4UTG A;  4LR9 A;  3IN5 A;  2PII A;  1IQZ A;  2MZQ A;  2VBY A;  1FKP B;  1HYS A;  4M5J A;  4DFJ A;  1RAI B;  1S1U B;  5D4N A;  3JYT A;  2IBK A;  2M5Y A;  4JI4 F;  3I9V 9;  4RO0 A;  2KVI A;  1EP4 B;  3TAN A;  1ZAV A;  5KFE A;  1TL4 A;  2YPZ A;  2LU2 A;  4DEZ A;  3I0R A;  3M7V A;  2OPS A;  4MK7 A;  3EPG A;  3NKP A;  4KB7 A;  1HJK A;  1VS3 A;  3CDW A;  1CQM A;  1JJC B;  5ETO A;  2V9K A;  1YWX A;  4NZ0 A;  4F3Q A;  3KK3 A;  4J9Q A;  1CG2 A;  2AF6 A;  2OSQ A;  3QAT A;  1FVS A;  2AX1 A;  4USU A;  2WW4 A;  5CZV A;  4ICL B;  3CJ5 A;  2WBM A;  4W90 B;  2OD6 A;  1HWI A;  4FN5 A;  2KDO A;  2P6S A;  4KHR A;  5KXA A;  2MQ8 A;  4AXI A;  5JJB A;  4DV7 F;  3SV3 A;  1B7Y B;  2UXC F;  1O99 A;  3GR1 A;  5KFX A;  4URG A;  2MY7 A;  2ZNY A;  3IS9 A;  4TYB A;  4FPR A;  1VHI A;  4ICL A;  3TEG A;  2JZ5 A;  3TX8 A;  4N47 A;  5CYM A;  4YS2 A;  1HI0 P;  4LF8 J;  2MJN A;  1UVI A;  2HWI A;  2L9D A;  2GC8 A;  3LP0 B;  2C3M A;  4I69 A;  1OPI A;  4HEA 9;  4U7U K;  1T03 B;  3PZP A;  1K9M T;  4NCB A;  1S1V A;  1SIZ A;  4M5M A;  4ZIT A;  1Q7Y T;  1R0A B;  3QT6 A;  2AGO A;  1DZ5 A;  4DV2 F;  4NLW A;  2DIS A;  2LFV A;  1WF0 A;  5KT3 A;  3CUN A;  5C2G A;  3GSI A;  1K47 A;  4CTA B;  3ZTO A;  3H5S A;  4HYK A;  2BJE A;  4ZPB A;  1HHQ A;  5DGA A;  1VQL S;  2YX4 A;  2UV8 G;  3V6D A;  2CPJ A;  2XY5 A;  4DSJ A;  2E1A A;  3SCK E;  3HK2 A;  1GMW D;  3VF0 B;  2J6T A;  1NLK L;  2YKA A;  5DDP C;  3GIJ A;  2IFY A;  4CYU B;  5F8I A;  2ZWO A;  1JX4 A;  3LOU A;  1S79 A;  1TMM A;  3I6P A;  5L0B A;  1ALI A;  4OV1 A;  4QR1 A;  1NDP A;  5A8K A;  1HW9 A;  2DGQ A;  4HH0 A;  3I5C A;  5E2Q A;  5G0R A;  1ZM4 A;  4JI8 F;  3J7A 1;  1LXJ A;  2ASD A;  1ZOT A;  2W24 A;  3CED A;  2XS2 A;  5A0Y B;  4UOF A;  4X64 J;  4F02 A;  1NCL A;  4PQU B;  2J0W A;  2XI3 A;  3EIC A;  4JV0 A;  1ZM2 A;  3MPU B;  1KN6 A;  1U8S A;  5E3Q A;  5AT1 B;  4CO2 A;  2B9X A;  2LQ5 A;  1T03 A;  4M5L A;  4CT8 A;  3VAI A;  3C16 A;  4AUK A;  7AT1 B;  3Q22 A;  3QGP A;  1FI4 A;  5B0C A;  3DOL B;  3LXQ A;  4QU7 A;  1X5P A;  2AEJ A;  4RNO A;  2EW9 A;  2H5E A;  4NCG A;  1OMS A;  1BLU A;  4GVB A;  5F3Z A;  2BAB A;  3QMQ A;  4RW8 B;  4F4W A;  4USK A;  4GO7 X;  3MUM P;  3JSM B;  4DR2 J;  3RZA A;  2ANH A;  1ZAW A;  1SVD A;  1E6Y A;  1OSD A;  3AH6 A;  3GJQ B;  2AJ4 A;  2V2Z A;  1ZZF A;  3H5U A;  4QWA A;  3PW4 A;  2M8D B;  1U25 A;  1PBU A;  1NH7 A;  4DPO A;  1SUQ A;  3KMQ A;  5HSP A;  2DPI A;  1RWU A;  2OP5 A;  1QAY A;  3MGJ A;  5DZ6 A;  1UTA A;  5B0B A;  2DR8 A;  3HUL A;  1BY9 A;  2RKI B;  4GVL A;  2YX7 A;  1BQN A;  1IKW B;  3NG8 A;  4C11 A;  4D3G A;  4P75 A;  5ETK A;  3ILI A;  3NVL A;  1SC1 B;  1RLD A;  1C1B A;  2WK4 A;  2CPH A;  2RNE A;  1HNV A;  1VJW A;  2GFF A;  1WKJ A;  2FIU A;  4UQG A;  4IR9 A;  5LOQ A;  1MN9 A;  3LAK A;  2CNL B;  1N33 J;  3OVS A;  1NAQ A;  5KG4 A;  3JQK A;  3S6E A;  2M2B A;  2FUG 9;  1WOR A;  3QBC A;  4J9P A;  1SL1 A;  3BQ0 A;  4KGZ B;  2V5H G;  1F1B B;  1FE0 A;  4CDI A;  4DR4 F;  4OZ3 A;  3AB4 B;  5D4L A;  2XMW A;  5HVF A;  3KG0 A;  2GHW A;  2FVQ A;  1QDU B;  5EDW A;  2HFV A;  3RTV A;  4XPE A;  2BR0 A;  4DN0 A;  4IOB A;  2DCL A;  3NS7 B;  1RAO A;  2JNJ A;  3C15 B;  3DOK A;  3JB9 k;  2LXU A;  2OUG A;  3SZ2 A;  1N54 B;  3ILJ A;  2V67 A;  2YH0 A;  1OYE A;  2ZZT A;  4P71 A;  2EVZ A;  1SJ4 P;  2G4B A;  3TO8 A;  1H38 A;  4B3S F;  4PWD A;  1KQS R;  1S1T B;  3HSJ A;  4JI4 J;  1RAJ A;  2YNF A;  5DZ7 A;  3HSD A;  2KM8 C;  2UUT A;  4USJ C;  1C2P A;  2QO3 A;  3M2R B;  4CLF A;  4OHV A;  3PIP Q;  3DRP A;  3KHL A;  5DG8 A;  4ED8 A;  1GTH A;  2WSC C;  3FBB A;  2NZC A;  4OYX A;  3KHR A;  3PAC A;  2LEB A;  4G1Q B;  1S1T A;  3BN7 A;  3Q8Q B;  2JWN A;  4ZS6 A;  2DJW A;  1U1M A;  2FYX A;  2PC6 A;  2OGU A;  2HVE A;  3HMJ G;  4I64 A;  1KDN A;  1TKT B;  1TV6 B;  1KWM A;  3MFI A;  2NUU G;  1PJ7 A;  2A10 A;  2JFD A;  2RUG A;  3EGV A;  3ILO A;  5KG6 A;  4LR2 A;  4J9K A;  3L7O A;  2BA9 A;  3KK2 A;  3EWG A;  2R8K A;  2F65 A;  2J6U A;  2H4W B;  1YQH A;  3M4X A;  3U1M A;  5F8M A;  2MQP A;  3KK1 B;  4L75 A;  3Q8S B;  4B3R F;  3AQP A;  3NEK A;  4TLQ A;  1YRT A;  2MZT A;  3M2U A;  4ZVT B;  5DLG A;  1S97 A;  2M4M A;  3QSY B;  1DJ0 A;  2B5J A;  4XTT A;  5FII A;  2CPZ A;  5F9N A;  2C22 A;  1PIL A;  4KFB A;  3BF4 A;  3PV8 A;  4K4Z A;  2BW2 A;  1R6Y A;  2ZJP Q;  2BE2 B;  3MEK A;  3C46 A;  3HHL A;  4TU7 A;  2WW8 A;  2YX1 A;  1S4E A;  2IA0 A;  3DFE A;  3MMJ A;  3H8Y A;  1NB2 A;  3DGP B;  3MAH A;  3NCQ A;  4WCE Q;  5CD4 A;  3J7Z T;  5IOL A;  2R8I A;  1YJ9 S;  2FLL A;  2IA6 A;  3AFG A;  4KTQ A;  1NKB A;  2IM1 A;  3FCW A;  4F0M A;  5A8K B;  2PD1 A;  4RU9 A;  4Q44 A;  4XIU A;  1VBY A;  3BEG B;  3MM7 A;  3I32 A;  2M3D A;  3JSR A;  1Q8I A;  1MNE A;  3SFU A;  4J9U E;  1LWE A;  4C98 A;  2VPW B;  5IS2 A;  1PYT A;  5JUM A;  1ULR A;  4N77 A;  3OTB A;  4P2M A;  2IM0 A;  1Y4Z B;  2R7U A;  1GTE A;  3BN4 A;  1N6Q A;  2BYC A;  1LOU A;  2RT3 A;  5AXN A;  2CQG A;  2LQ8 A;  2VKR A;  1KTV A;  2LLZ A;  2MMY A;  2ZBI A;  3MAA B;  1LK5 A;  3PFE A;  3QIP B;  1SC4 B;  1R31 A;  2FLN A;  1RCX B;  5IC6 B;  3UCZ P;  4I6Y A;  3PVX A;  4TNO A;  4UUX A;  4X4R A;  1VRQ C;  5T41 A;  3BPS P;  2CXE A;  4L76 A;  1GK8 A;  2FPH X;  2JSX A;  4O0N A;  3D3C J;  3LP0 A;  5BYQ A;  3R7S B;  3WHI A;  3OHB A;  3T01 A;  4H4O B;  5CYQ A;  1S1W A;  2NPI A;  5H9F J;  3EUN A;  2Y3Y A;  3FFI B;  4NML A;  3M1V B;  3ZTP A;  2YNG A;  4YFU A;  3G96 A;  2CAJ A;  3L9Z A;  2VA3 A;  1MWY A;  1N52 B;  2DGS A;  3HHL B;  3HLU A;  3NWG A;  5SZT A;  5KAK A;  1HNZ J;  4NCA A;  1U02 A;  2WZ1 A;  5KFU A;  3TJ8 A;  1BQM B;  4KO0 A;  4M5K A;  2AW0 A;  4PXE A;  5KG1 A;  1G2E A;  4EI2 A;  2E7X A;  2M8H A;  2LKZ A;  1FNX H;  4RUH A;  1OPZ A;  2G1H A;  1HNV B;  4AE5 A;  4YN3 B;  3I5A A;  1HBU B;  3ZTR A;  4A8Y A;  1NK0 A;  5HN0 A;  2BE9 B;  4DR3 F;  3TP2 A;  4CT9 A;  4KKO B;  1JLB B;  4X65 F;  4ECU A;  4QAX A;  2P9G A;  2IMW P;  3D1O A;  1CSJ A;  2WVC A;  4K0K F;  1NJI T;  4EO6 A;  2QL9 B;  2VJV A;  1JK9 B;  1KC8 T;  3CO0 P;  4OZL A;  1RDR A;  5KFF A;  2RRN A;  1PAE X;  2NRE A;  2W8K A;  1BMQ B;  1FJG J;  1P9Q C;  2CIM A;  2YPY A;  3IWX A;  4L73 A;  5MAO A;  2RF2 B;  4Y3C A;  4YB6 A;  2DHS A;  2HRU A;  3TZZ A;  2DGT A;  1U1L A;  5H1S V;  2OH2 A;  4JYA F;  2G2Y A;  4MJK A;  1WDD A;  4ERD A;  4Q2M A;  1KKH A;  1JNZ B;  2OEJ A;  3OW2 R;  2UUA J;  4CCH A;  3I31 A;  3U7J A;  3KG1 A;  4L6V 3;  4RKU C;  1XNQ F;  4FXV A;  1UET A;  1B7F A;  3DLJ A;  2B0G A;  3R5J B;  2W7O A;  4KH0 B;  1E1Z P;  5GAE I;  4JI3 J;  3HVW A;  3ZNJ 1;  1ALJ A;  1HR0 F;  1ELX A;  5ETM A;  2XSJ B;  4DFM A;  2MPU A;  2RE1 A;  2CQ1 A;  3WBZ A;  3CD5 A;  1VQN S;  4GC6 A;  4FDJ A;  2YNH B;  5ETV A;  3NGT A;  3DN9 A;  4DZD A;  2F8M A;  4PWU A;  4ECQ A;  4JV2 A;  2BBE A;  3CJS A;  3LGN A;  4USV A;  1O6X A;  2W2Q P;  3MUV P;  5I42 B;  1N34 J;  2VFR A;  5GMK a;  4BCA A;  3MUT P;  1EET A;  2FVS A;  3R5D A;  3QSI A;  3FNN A;  1IN0 A;  3X3U A;  4J9N A;  3BDF A;  3BSO A;  3TAQ A;  1DY3 A;  4UT4 A;  4CH0 S;  6FD1 A;  4DCP B;  1ICE B;  1KOH A;  2XSF A;  3A8I A;  1HBU A;  5E3C A;  5LXR A;  4EYH B;  4ECT A;  1JXL A;  3D67 A;  2VON A;  3MED B;  1V9O A;  1RAB B;  2FJA B;  3BGR A;  4WPA A;  5J2P B;  4ETX A;  3SV4 A;  3MR6 A;  4K4V A;  1BHN A;  1HMV B;  1RHQ B;  3VQT A;  1TKX B;  4LBI A;  3RW6 A;  3BPD A;  1UFW A;  5IWA J;  2LQ9 A;  2ALY B;  2GW8 A;  3VAM A;  5F8G A;  1HNZ F;  4DL4 A;  1M90 T;  1WC4 A;  1D9D A;  2AZ3 A;  2QLJ B;  3C6U A;  3PRB A;  2MYF A;  4PXB A;  1M1H A;  2XTJ P;  4UOC A;  4DS5 A;  4G3I A;  2LMI A;  5TJ3 A;  4ETZ A;  3TQ1 A;  1HDH A;  2N82 B;  1J2V A;  3FJ2 A;  3P49 B;  2B56 A;  4UOP A;  3BH6 B;  3TOQ A;  2KFY A;  2EFG A;  4YHH F;  2LXF A;  4I2P B;  1ITP A;  1IKX A;  2QA2 A;  1X0F A;  2Y0S D;  1HBM A;  3OL6 A;  4NLQ A;  1VRT B;  5CQG A;  3HZE A;  4JV5 F;  3B78 A;  2BRL A;  4KY3 A;  1X0P A;  2RHS B;  1Y7A A;  4Z7Y A;  1X4H A;  5LSL A;  2SXL A;  2VG5 A;  3KJF B;  5C25 A;  3QJP A;  4PCQ A;  4USM A;  2ZHB A;  1UEU A;  1CJK B;  1ZED A;  3AQO A;  2G0I A;  3VZI A;  1VK8 A;  3TA2 A;  2AWZ A;  2UXD F;  2AJ0 A;  3KWM A;  8ATC B;  4Y65 A;  1UJ5 A;  4YR1 A;  3CDE A;  2ZD1 A;  4JI1 F;  2IVY A;  3ISZ A;  5FLX Y;  1N88 A;  3TYT A;  3V6H A;  4QYR A;  2F4F A;  5L9N A;  2B9Y A;  2W2O P;  3FQK A;  4ZN3 A;  4FKX A;  1UEV A;  4FYD A;  4ES1 A;  4L74 A;  2HMI A;  3FRY A;  1A7G E;  4P72 A;  3C2P A;  4L3N A;  1VC6 A;  3SDE A;  2CAD A;  5DET A;  2WVF A;  2YWG A;  3N5B A;  3ETM A;  3RAX A;  5H9E J;  1NPR A;  1ZET A;  1I94 J;  1RHU B;  3PY8 A;  1DLO B;  4Y2I A;  1REG X;  4DG1 B;  4ZLN A;  1KH4 A;  3BDG B;  1SJF A;  1Z1Z A;  2HRY A;  2EFN A;  2DHH A;  1FE4 A;  3AAW B;  2ZHO A;  3AOA A;  1YTY A;  1NJX A;  4WYW A;  4FYW B;  3POT B;  2OEL A;  3VVU A;  3JSM A;  4B9U A;  3X1L B;  1B64 A;  2ZUA A;  4EO8 A;  2GV1 A;  1WDT A;  4OYA A;  4K4S A;  3K0J A;  2QX0 A;  2XB2 D;  3CJK A;  5LMN J;  4V1A k;  2BJ3 A;  4KFB B;  4MKV A;  2J7K A;  4DPW A;  1VLY A;  4HTI A;  1L3T A;  2BE2 A;  1HQ2 A;  5KFN A;  4B56 A;  3DU6 A;  2OPP B;  3HVA A;  1TL7 A;  4HL9 A;  4K2J A;  3SCI E;  1RT7 B;  2FDN A;  4O23 A;  4CXS A;  1JLF B;  4NEY A;  3MK2 A;  3DXS X;  2UUW A;  1NSA A;  4LRB A;  4DF4 A;  4KPC A;  3HVT A;  3W2V A;  3V6D B;  4OX9 J;  1N5Y B;  4WTO B;  2E1M C;  5HLF B;  2DB1 A;  3NAI A;  2CPE A;  4RWX A;  3OV7 A;  5KFT A;  4XDC A;  3OXF A;  4FF4 A;  2HFO A;  3M8W A;  1JXV A;  1R6V A;  2HLT A;  3TNV A;  5KFD A;  1RU1 A;  3PIO Q;  5IJS A;  4Y2M A;  2WON B;  5F3T A;  4YB5 A;  3G6Y A;  4WFN Q;  1S6Q B;  3OL7 A;  2JDJ A;  1T11 A;  4J90 A;  1Q81 T;  2VOO A;  5F0W A;  2R2R A;  1Q5V A;  2N7Y A;  4DOZ A;  3CJQ A;  4RW8 A;  2JOQ A;  2XG8 A;  2VF3 A;  1WEL A;  3A1Y G;  2DTJ A;  1KHN A;  1GAO A;  1VQY A;  3MPY A;  2FB0 A;  5CA5 A;  4Q45 A;  3TJ9 A;  4CH7 A;  4U8V A;  4ITS A;  4NXN J;  4HHU A;  4DR5 F;  4UW2 A;  1R3N A;  2Y1J A;  3M6X A;  2MST A;  1JWW A;  3DPC A;  3SZZ A;  2AGP A;  4DPU A;  2ZH9 A;  3MZI A;  3P45 B;  3G9C A;  2A6M A;  2HIQ A;  3GFX A;  5L39 A;  1FSU A;  4RL1 A;  1Q82 T;  2JC1 A;  2YKM B;  3AOD A;  2QA4 G;  2YNG B;  1UVM A;  4I6A A;  4EFA C;  2X1G A;  2W5S A;  3M8P B;  4K2X A;  3GB0 A;  2HHX A;  4NZ6 A;  1EZZ B;  3H42 A;  1B99 A;  1IKV A;  2G0J A;  2V8D A;  1B8J A;  3GWC A;  2ZH1 A;  2UVW A;  1FT8 A;  4RJV A;  3OLA A;  3A13 A;  3VWS A;  1GX5 A;  1SKU B;  1DBD A;  4UOH A;  3MEG A;  4DCO B;  1WD6 A;  4QIG A;  5D0E A;  3S01 A;  3VGV A;  1VQ8 S;  4C8Y A;  4ZDN A;  4A8O A;  1U4B A;  2QC3 A;  4ZMM A;  3H40 A;  1YHQ S;  1P1L A;  2RQK A;  5K8N A;  1FJC A;  2HQC A;  2LA6 A;  4I0W A;  1TL3 B;  5IZH A;  5F8N A;  4CLP A;  4DU7 A;  3RRG A;  4TU9 A;  2MTL A;  3OUY A;  5HO4 A;  1NPK A;  3DNC A;  4DV7 J;  4KAV A;  4ECY A;  3HDS A;  1B4S A;  2F3J A;  1RT6 B;  3F56 A;  4IG0 A;  2HVD A;  3L3C A;  1S0O A;  2OPR B;  1EQJ A;  2HFZ A;  2EI5 A;  3DRX A;  2W7A A;  1FRH A;  4UOG A;  1T3O A;  2X7I A;  4Y28 C;  2R9L A;  1TL1 B;  4JI6 F;  3DGP A;  3HHL C;  5ETR A;  1WC6 A;  1XQI A;  3W9J A;  5KFH A;  1VQK S;  1FRI A;  1PBA A;  1MW7 A;  3D3B J;  4RNH A;  1B3T A;  1FRX A;  1S6P A;  2IAJ A;  2MKJ A;  3MCO A;  2Z30 B;  3UN3 A;  5J1E A;  3ET6 A;  3EYZ A;  2KRR A;  3IGV A;  3CC4 S;  4A8K A;  3BGF A;  3DYC A;  1SQE A;  2W2M P;  2DR6 A;  3FRZ A;  4X4T A;  1YK9 A;  1M5H A;  2R7S A;  3MWB A;  4PPZ A;  3WAV A;  4JUZ A;  5KFS A;  4C97 A;  4ZP6 A;  2CJK A;  4EZ6 A;  2J9C A;  2DNQ A;  2R8H A;  3E01 A;  4OX9 F;  3VAL A;  1NEE A;  2RB7 A;  1ANI A;  3KK1 A;  4KJD A;  2VG6 B;  3D54 A;  3ONQ A;  1N48 A;  2CYY A;  3OTD A;  4M5I A;  3R2D J;  3T5H A;  4KGX B;  2FJW A;  4IRD A;  3NMR A;  2XQC A;  1U1P A;  1HMV A;  3BRE A;  2DNM A;  2OTL S;  2WSF C;  3PR5 B;  1DFD A;  5ETN A;  4JI5 F;  1K73 T;  2GJ2 A;  5ITH A;  4WFB Q;  2LU1 A;  3L7U A;  4WWS A;  1A9N B;  1Y3K A;  2FHO B;  4ED4 A;  2XMT A;  2W01 A;  3CCE S;  1BC6 A;  1RXO B;  1EW8 A;  4JI5 J;  4WP3 A;  3Q2T C;  2HHT A;  5DM6 Q;  2JRS A;  3D6F B;  2C2E A;  4W92 B;  5LIA A;  3EVM A;  4H4K A;  2B43 A;  2EK1 A;  4OX7 A;  4RW4 A;  4ZLJ A;  4FBU A;  1HYS B;  4FDI A;  2EC0 A;  4DQS A;  1HKA A;  1TUW A;  1J27 A;  1RT1 A;  2JJ4 D;  1VLO A;  4O44 A;  1NZ8 A;  2CQ0 A;  1HL6 A;  2G2O A;  2ZOG A;  3NAH A;  1H2V Z;  4FYV B;  1HNX J;  5HP1 A;  2B7C B;  4B9S A;  1VQO S;  3DLE A;  1EP4 A;  2GMH A;  4OZ5 A;  3EGZ A;  4IDK B;  5U47 A;  1X5T A;  3WC0 A;  2ASL A;  4LVN P;  2HYI B;  4BS2 A;  3MM6 A;  4DPT A;  2J0S D;  3RB0 A;  4DL0 C;  3OR1 A;  5KFY A;  3M32 A;  3TAP A;  3HHE A;  2CQP A;  2H5I B;  2YY3 A;  4FP9 A;  4NMX A;  4OZ0 A;  1XN9 A;  5A2Q U;  2JLG A;  2BE7 D;  4PEO A;  5B0E A;  2K7K A;  1KOO A;  2BOA A;  3KLE B;  2CNN B;  2RF2 A;  1UL3 A;  1NDK A;  1ROF A;  2WOM B;  2H1Y A;  1OIA A;  3A8K A;  5JVH Q;  5HVH A;  1T05 A;  2AYG A;  3IR5 B;  2DEJ A;  4ZVF A;  3V6K A;  1RZM A;  4N7T A;  3W5X A;  4GTZ A;  3CJT A;  3LAM A;  3QZ7 A;  3KG4 A;  4I6W A;  4J91 A;  2PE8 A;  4PXC A;  3IGY B;  2HQF A;  2VA2 A;  1IJE B;  1QAX A;  2E5H A;  3ULH A;  4AL6 A;  5DLV A;  2IC3 B;  3H20 A;  3GCX P;  3W1Y C;  1D8Z A;  4OV6 A;  2YKM A;  2F8E X;  3ISN C;  1SB6 A;  2HFS A;  2QMW A;  4M5H A;  2BKN A;  2PA8 D;  4M63 A;  2QEX S;  1XNR J;  1NSK L;  1RTJ A;  2V50 A;  1V5V A;  2NSB A;  3GR0 A;  2D3O 1;  1AFJ A;  4RBV A;  4OYO A;  4NLP A;  3RAM A;  4DFP A;  4OHZ A;  2BRK A;  2E7V A;  1P9Y A;  5EX0 A;  1I3O B;  1PIE A;  2AJ2 A;  2HWH A;  3CJK B;  5GAH I;  3T5J A;  4NLR A;  2HVI A;  1JKH A;  2ALZ A;  5T7L B;  4GVB B;  4NXM J;  3GLJ A;  4OJG A;  1HW8 A;  4P2S A;  7FD1 A;  3Q24 A;  5EGE A;  2P9E A;  3BKU A;  3K8V A;  1XR7 A;  3QQC D;  2P5V A;  5B0G A;  4AT1 B;  3N28 A;  4EWT A;  1KRP A;  1U0S A;  4G1I A;  4MT1 A;  5D8H B;  1MLA A;  2R7O A;  2J7W A;  4J7C A;  1G6B A;  5CCM A;  1KD1 T;  1V6H A;  5GAD U;  1RAE B;  2M70 A;  4BLG A;  1WG4 A;  4ID5 B;  3ZC4 A;  3CWJ A;  1V3Z A;  4LR7 A;  4JB8 B;  4Z2X A;  4P7T A;  4PG7 A;  3T1Y F;  1SV5 B;  2CPD A;  4UY8 T;  5DLT A;  3DKD A;  3K57 A;  1XER A;  3ZZY A;  1FKA F;  4B3O B;  2NYI A;  4DUY F;  2Z4P A;  4ED5 A;  4C8K A;  4KJG A;  4F2R A;  3R3T A;  1LW0 A;  3VCD A;  1B0V A;  2A18 A;  3A8J A;  3RRK A;  3KLH B;  1JMT A;  1XNQ J;  2J8A A;  1YBU A;  4DX6 A;  3KLV A;  2BM0 A;  2VG5 B;  1R0C B;  3TUJ C;  2ADB A;  2FHM A;  2V4R A;  3PM9 A;  3R6L B;  1T3N A;  1A6L A;  2K06 A;  5DGB A;  4H4M A;  4C9D A;  4O3R A;  4DV0 F;  4YR0 A;  1FWL A;  3QGI A;  2JEI A;  1KHW A;  3FBC A;  3Q8P B;  1F9E B;  3G6E S;  2KT2 A;  4DL3 A;  2X3D A;  1Q79 A;  3TA1 A;  3JAM U;  2BJD A;  3PX6 A;  3KDO A;  2CQC A;  4DR7 F;  1D3W A;  2KT3 A;  2M0G B;  1RBL A;  1FDA A;  4C0O C;  3EE3 A;  3WZ0 A;  1U24 A;  4QW9 A;  2B8P A;  1YJW S;  3F41 A;  1WHX A;  1NDC A;  2E5I A;  4QYZ J;  3Q3Q A;  3LWL A;  4H4K C;  2MKY A;  4K50 A;  1IXK A;  2VJU A;  5AJ9 A;  2ZIT A;  4NA2 A;  2QFJ A;  4DV1 F;  4DX5 A;  2IM3 A;  3PW2 A;  2ZC3 A;  4HI1 A;  4CNY A;  3SMZ A;  4DLE A;  2R2T A;  1U1N A;  3J80 U;  1H2T Z;  1HBM B;  1MWQ A;  2VFV A;  3AY0 A;  3DRR A;  3FZB A;  2GVD A;  5F8H A;  1BE4 A;  2QIF A;  4G1P A;  3OPK A;  3HJF A;  4J9R A;  1LFW A;  1NHV A;  3H25 A;  4M5D A;  3PDN A;  4UQT A;  1U8W A;  1VJQ A;  3DMJ B;  3OL8 A;  4K4W A;  2CG4 A;  1NM2 A;  1YJU A;  2CQI A;  2NUH A;  2ROG A;  5M2U A;  4ECW A;  4LF8 F;  1HWK A;  3CJR A;  3AOB A;  1TFW A;  3BZQ A;  1ZTT A;  2AZ1 A;  1Y5N B;  2GQQ A;  2I1R A;  5H9E K;  6AT1 B;  1VQ4 S;  2DVI A;  3KJV A;  1EJJ A;  3DDN A;  1JLE B;  1RT3 A;  2AKW B;  1RTZ A;  2YBV A;  2WSE C;  3FKB A;  5K9F A;  4F0H A;  3ZTS A;  3FQL A;  2VDI A;  3B5Q A;  3CDU A;  2MQQ A;  3B6B A;  3CVK A;  3QNW B;  4ZVU B;  3WDO A;  3WIU A;  3JYT B;  2OJ3 A;  1N36 J;  3W5Z A;  1ZPW X;  1RT3 B;  5D3G A;  4GMK A;  3DM2 A;  2M9K A;  3ZFV A;  3V4I B;  5DQH A;  2XLJ A;  1J5O B;  2GGP B;  3HF5 A;  1LFP A;  2JVR A;  1PG5 B;  2V2V A;  2P6T A;  1J5E F;  1FFW B;  3CCS S;  3NKN A;  4A8Q A;  3K5P A;  3MEE A;  3C19 A;  4ECS A;  1DLO A;  5D3G B;  1VBZ A;  5GVQ A;  2ZD1 B;  3BDG A;  5KT5 A;  1KHV A;  1FFG B;  1ELZ A;  4NLS A;  2W9C B;  3PXG a;  4DSF A;  1S76 D;  1FD8 A;  3LP1 B;  3FCV A;  1Q1K A;  3M6V A;  4Q7A A;  1TKZ B;  2FZK B;  3UCG A;  3D1Q A;  1RHK B;  4MAK A;  2KXN B;  2HHU A;  3D9B A;  3MEE B;  4OHX A;  3R1H A;  1RHJ B;  2HMI B;  1Q7L B;  4ZP9 A;  4EUV A;  2K2P A;  3M8Q B;  5HQM A;  2D1G A;  2IUC B;  3G8Q A;  2RQM A;  3QT7 A;  1NK8 A;  4WZQ A;  1AB8 A;  2R8G A;  2ZE2 A;  3P5B P;  2VFT A;  4N5S A;  2KM8 B;  3LA0 A;  1RT7 A;  2Q6C A;  4DG1 A;  4CYS A;  2BZ2 A;  3DLH A;  1KVI A;  2BVZ A;  3NGU A;  3H98 A;  4F3M A;  5DDO C;  1CJU B;  4LRE A;  5B08 A;  2HQD A;  3CTR A;  1MU2 A;  2LEC A;  2QSW A;  2PI5 A;  3GFY A;  5DDR C;  1WC0 A;  2WTF A;  3G8S A;  1HQU B;  2YKO A;  1N2L A;  1S1W B;  1N4L A;  1FXL A;  2XZD B;  3SSQ A;  3R5B A;  3W9I A;  1ZPV A;  2WCX A;  4B02 A;  2AEM A;  4X84 A;  3LP2 B;  3Q2S C;  3V4M A;  1WWH A;  3LF0 A;  3DM2 B;  3V2U C;  4GC7 A;  4ZVR B;  4HLB A;  2XNQ A;  1YI2 S;  1JJ2 R;  1DQA A;  4KR0 B;  1HBN A;  4R0J A;  5KFA A;  1N34 F;  3H2V E;  5DRK A;  4CYU A;  3UVJ B;  1CQN A;  1JLA A;  3NNH A;  2V34 A;  1E33 P;  3OTO J;  3LPE A;  2B4O A;  3MR3 A;  1N6Q B;  3HCX A;  4LT6 A;  3W8G A;  1ZTW A;  5KFR A;  1RUS A;  4QIF A;  2XNR A;  1TTH B;  3ZZP A;  1P49 A;  3ZZU A;  1KQG B;  1JLA B;  1F5B A;  4TVA B;  3J81 Y;  3VVT A;  1HQE B;  2IVM A;  4NYO A;  3T19 A;  4OIX A;  3M9M B;  2IMO A;  3Q89 A;  1WSR A;  2A0F B;  2HHW A;  1VDH A;  3WIV A;  2HFU A;  5J1E B;  2HHQ A;  3RG6 A;  1ED8 A;  5HRO B;  2CJA A;  2I5J A;  3PEH A;  3DRP B;  1IBL J;  2MKI A;  4QWE A;  1IBK J;  2YKQ A;  3Q8R B;  2ACY A;  3G82 B;  2ZH5 A;  1MU2 B;  1UVK A;  2HBY B;  3LO3 A;  4OLP A;  4OL8 A;  1NU4 A;  2RIL A;  2DNG A;  2XSJ A;  1U2R A;  3DCA A;  2HIY A;  1GXL A;  1S6U A;  1SUQ B;  2DHX A;  3H59 A;  1YVF A;  2QFI A;  4BWJ A;  3HVR A;  3Q23 A;  4PUO A;  3PCO B;  2HFN A;  3QLH B;  4LF1 A;  4D3H A;  3PX0 A;  4ECZ A;  1APS A;  1GNK A;  3CE8 A;  2HQG A;  2D1C A;  2GVZ B;  3M6W A;  4XDD A;  2XM3 A;  1WTB A;  1H98 A;  1UZD A;  3O2I A;  1SKR A;  3PW7 A;  3AB2 B;  2VC1 A;  4DV1 J;  2L48 A;  2PEH A;  3K17 A;  2GHV C;  4CM2 A;  2QYC A;  3GU0 A;  3MMC A;  1KEK A;  2FZC B;  3BSN A;  2H51 B;  3QT5 A;  1FD2 A;  3ENA A;  2F7V A;  2QL7 B;  1W26 A;  3AJ1 A;  3E51 A;  3CCR S;  5GOV A;  5J2P A;  4LF4 J;  4F04 B;  2BXJ A;  2LVW A;  1UP1 A;  2FD2 A;  4NLD A;  4EBD A;  2XLK A;  2JLF A;  3Q0A A;  2JVO A;  1K8A T;  2GZO A;  1V3R A;  2XZT B;  2Z2M A;  4KV8 A;  1IBK F;  2BOP A;  1RJJ A;  1WC5 A;  1XK8 A;  3ILL A;  3VHQ A;  4C8L A;  1K7H A;  4GTW A;  4O4R A;  3NMA A;  4J9O A;  3HKZ D;  4RNM A;  3C6U B;  3FK4 A;  3PEJ A;  2XC9 A;  2V9W A;  2B8Q A;  3KUE A;  1PAU B;  3N6L A;  1T9U A;  2B6A A;  4BBY A;  4M95 A;  4DL2 A;  5A8W B;  2VFS A;  1SHN A;  2CJQ A;  3A3N B;  3K7R A;  1LV5 A;  3DOK B;  3D0I E;  4G65 A;  2FLO A;  3VGT A;  2KZZ A;  4BC9 A;  1HD1 A;  2ADC A;  3LW5 C;  5D77 A;  1VOM A;  3Q8V A;  1EI6 A;  1GFW B;  3MDF A;  5A8W A;  1LQ9 A;  3SFG A;  1LEO A;  2BJ7 A;  2QMU B;  5C42 A;  4RZR A;  2FC9 A;  2KJW A;  4I56 A;  5KT6 A;  3IBW A;  1AT1 B;  4NRT A;  4DR6 F;  3UR3 C;  1S1X A;  2OML A;  2GAH C;  2R7Q A;  2MHN A;  3CCV S;  1URN A;  3HD2 A;  1DAX A;  2QZ8 A;  3T1Y J;  3OL9 A;  3BJY A;  5ETL A;  2CQD A;  1YJV A;  1WOS A;  4U7C A;  3CMR A;  2DY9 A;  3GMG A;  2C3Y A;  5GAG U;  5JVG Q;  3GFZ A;  2CVI A;  5B0A A;  4KM4 A;  1FER A;  4USH A;  2EFQ A;  3QYY A;  1RKI A;  4L72 B;  3MR5 A;  4IYQ A;  4QWC A;  3MEC B;  3ISN D;  2GX8 A;  1WTF A;  2OO4 A;  3N6N A;  3IRW P;  3R7N B;  1OS5 A;  8AT1 B;  3TJA A;  4DSK A;  2R7V A;  3WAW A;  3HM9 A;  3KK2 B;  2VQF J;  4I1T A;  1AXQ A;  1SHQ A;  2LXI A;  3PFO A;  2YXL A;  4N8N A;  3NNA A;  5IQ6 A;  2YWW A;  1HNI A;  4ED2 A;  3MEC A;  2EXU A;  3PRD A;  2EFP A;  5K4P A;  2Z57 B;  2N3L A;  2EFO A;  2W2N P;  1HWJ A;  4OYI A;  2CWK A;  3QID A;  3CCM S;  1NJZ A;  3TR5 A;  2W4C A;  3GE9 A;  1X8D A;  3LP2 A;  1QTM A;  1C4C A;  3DGV A;  1I94 F;  2DR5 A;  5A6W A;  3BV8 A;  1RAF B;  1NK5 A;  4KKO A;  4ED3 A;  1S48 A;  4NXN F;  4BDP A;  1F6T A;  2HHS A;  5KFZ A;  2K7J A;  2XMJ A;  5HMX A;  4BWM A;  1Q16 B;  3MUR P;  1OY8 A;  5KFM A;  3FCH A;  5AXL A;  2ZKU A;  2V4Q A;  2BJ8 A;  1ZS6 A;  4MIB A;  1X4D A;  2MB0 B;  2IJR A;  4RLE A;  4JOU A;  4C3M A;  5DQG A;  4EZ9 A;  1N32 J;  1UAW A;  2WBR A;  5CH7 B;  5HAT A;  5K8M A;  4WKR A;  2J5A A;  3D5M A;  2LQB A;  5CYM B;  2KO1 A;  3OD2 A;  4YY3 F;  1SQF A;  5DJB A;  2OHD A;  4F67 A;  3G8T A;  1LW0 B;  2Y8W A;  3P8B B;  3EGN A;  1VR6 A;  3FUY A;  3NWR A;  3OLB A;  5HJY A;  1I6J A;  4LF6 F;  4JV5 J;  2DIT A;  1TR0 A;  2YKN B;  2GAG C;  1BD6 A;  2V4J B;  3GG1 A;  4Y2A A;  4X4O A;  3W5Y A;  3CSK A;  3D28 A;  1R89 A;  2CFX A;  3G82 A;  4OZ2 A;  3SQO P;  4YHH J;  4LSN B;  4DUZ J;  1VQ7 S;  2W8S A;  4LRA A;  5L9X A;  3JSY A;  1S72 S;  3SQG B;  1D09 B;  2ABY A;  5KT7 A;  2E5L J;  4URQ U;  1F5C A;  2JH3 A;  1S77 D;  2GSU A;  1Q53 A;  2KH9 A;  3L95 X;  2C2R A;  2Y0B B;  4KAY A;  3I82 A;  2U1A A;  4R5P A;  4FPI A;  4HH1 A;  3SIP B;  4J9M A;  5EX3 A;  1T9W A;  2VUG A;  3GSD A;  4N56 A;  1ZZN A;  2E7W A;  1RT5 B;  2PA3 A;  3AXK A;  5IWA F;  1XNR F;  5HL7 Q;  3SSR A;  3RB3 A;  2D41 A;  2R7X A;  1S12 A;  3LTO A;  5K8P A;  1JKH B;  2XR9 A;  2HHP A;  2KJV A;  4XPC A;  3D0H E;  4K4T A;  3T5K A;  5DLF A;  5HLF A;  3DI6 A;  2FJX A;  4NYP A;  1JJ4 A;  1FK9 B;  3QJJ A;  1U2C A;  2CUY A;  1EAR A;  3CMQ A;  2IRX A;  3AJ2 A;  5M2P A;  1L3S A;  2C2O B;  4DR7 J;  1N5Q A;  4E8U A;  3IA0 A;  3KNG A;  1M5P C;  5A8R B;  1Z2L A;  1NKC A;  2I8E A;  1XMQ J;  3MEG B;  4MK8 A;  1FJG F;  4A8F A;  2DGV A;  4USI A;  5HBM B;  2BJ9 A;  4LF5 F;  4Z37 A;  1RWP B;  2K8G A;  2KXF A;  5EWF A;  3ZO7 A;  2PMW A;  2D7S A;  2CZ4 A;  5D15 A;  1HI1 A;  3VR1 A;  5J1P A;  1UA0 A;  4CM0 A;  4GKK J;  3MI7 X;  2RHQ B;  4MYT A;  1TL3 A;  3BDE A;  2QA4 S;  4EEY A;  2BKO A;  1XC9 A;  3SSS A;  5GAD I;  3BQ2 A;  1W2B R;  1L3K A;  2JHE A;  2XEX A;  4LSN A;  2DR7 A;  3ENV A;  3IR6 B;  4RW7 A;  3IRX B;  3OVB A;  2YWK A;  2ZVI A;  3KLH A;  2NXE A;  1N5V A;  1RSC A;  2DHA A;  4WU2 A;  2XMM A;  4DUY J;  2A6O A;  3CCZ A;  1N36 F;  2EBG A;  2PI4 A;  5CZX A;  4JI8 J;  1CPZ A;  3H7H B;  2WAQ D;  1RT2 B;  2HG4 A;  2C28 A;  1C0T A;  4ELT A;  5LRM A;  4LBH A;  4HHJ A;  4U6P A;  2L9N A;  1PC4 A;  3N9U C;  4FKY A;  2C2Z B;  2NSC A;  2RS8 A;  4KGV B;  4UUW A;  4C11 B;  1EET B;  5IV4 A;  1QAJ A;  4KGM A;  5LXY A;  2IUC A;  3M6U A;  3C66 A;  1WSV A;  3QLH A;  1X5S A;  5LQQ A;  2U2F A;  1CS4 A;  4F7V A;  1YJN S;  1N0U A;  3MPW A;  1EIY B;  2E29 A;  3N0V A;  4TQR A;  5C5J A;  4DV3 F;  4OI0 A;  3CCL S;  4TY8 B;  1S9E B;  2YNI B;  1JLE A;  4K5R A;  4ED7 A;  1Y5L B;  3VAH A;  3FSI A;  4IRK A;  1T95 A;  2EWH A;  2RVJ A;  2OLW A;  2HRT A;  5I3Q A;  2O01 C;  1KON A;  5K8O A;  4ZGA A;  1NRK A;  4X4Q A;  1TU0 B;  4B3T J;  4Q0B A;  3AXM A;  2ZBC A;  2OPR A;  1ELO A;  1S7I A;  4V19 X;  3RB6 A;  3VQS A;  4MIA A;  2UUC J;  1VC5 A;  3C15 A;  3QT8 A;  2DNL A;  4FVC A;  1FKP A;  2HWT A;  4C6A A;  3NGD A;  1WKK A;  4FF1 A;  1I51 B;  3TVY A;  3ZZ0 A;  4YB1 P;  1M5O C;  3BKT A;  3HFK A;  2PT0 A;  1LK7 A;  4M5G A;  2ZH4 A;  3FGV A;  3UPF A;  1CVJ A;  2C2M B;  2E1C A;  2W5T A;  4OHW A;  2FGO A;  1C0T B;  4FZV A;  4OYP A;  4EBC A;  5GRR A;  1HBN B;  1JLC B;  1FX4 A;  1SJR A;  2XMU A;  2JFK A;  3JS9 A;  3MHY A;  5AE3 A;  1F2G A;  1UMJ A;  4CZC A;  4NRU A;  6FDR A;  4MMO A;  2LP4 A;  1TUV A;  2HQ3 A;  4JI0 J;  2GIF A;  2EG2 A;  1YRU A;  2VPX B;  1NND A;  4I7F B;  4CLY A;  5INH A;  1S9G A;  1W7W A;  3AHP A;  1LW2 B;  3PX4 A;  1DTT A;  1PGZ A;  1JLC A;  2LDY A;  1H2U X;  1HD0 A;  1B0P A;  3R5G A;  1OSC A;  1CC8 A;  2N4C A;  5BXI A;  1IWA A;  2E1P A;  1Q8B A;  1S0M A;  2FLP A;  3DOL A;  1KH5 A;  1WI6 A;  4GO5 X;  1RBO B;  2CPF A;  4PRF A;  4CO4 A;  3L09 A;  3PJX A;  1Y0H A;  4KBI A;  2EKY A;  3JAM Y;  2C1E B;  2VPY B;  3OFH A;  4OI6 A;  4R0E A;  3UN2 A;  4F50 A;  1R43 A;  2A1B A;  2LEP A;  4DSL A;  1EAY C;  2VFU A;  2YTC A;  4CWB A;  3R97 A;  1DRZ A;  1BUX A;  3H4D A;  2BAN A;  4ZIW A;  2D3Z A;  2ZE2 B;  3MM8 A;  1FXR A;  1UWB B;  2F9D A;  2R42 A;  2VH7 A;  2K3I A;  4JBC A;  4OZ1 A;  4U95 A;  5L1K A;  3R5A A;  4IUF A;  3HHN B;  4DV2 J;  2GJI A;  5KFV A;  1RYS A;  3GCW P;  1WEY A;  2WVB A;  4DV6 J;  2YWF A;  1X9S A;  1EW2 A;  4KHP J;  4JI2 J;  3O3L A;  2O67 A;  2JL9 A;  4OJH A;  1T9X A;  2XYG B;  4U96 A;  4DLG A;  2WRM A;  2AYE A;  3CF5 Q;  2DO4 A;  4WU3 A;  4KO0 B;  3ZZO A;  1GT8 A;  2ZM6 F;  5K14 B;  1NXI A;  4C3L A;  3UDE A;  2B4V A;  1RWN B;  4QIW D;  4AL7 A;  2IBO A;  2VG7 B;  5AXM A;  3FEX B;  4Y00 A;  3QFW A;  1RQ0 A;  3JXO A;  5T7L A;  3HVT B;  3CJ4 A;  4LFB J;  4PXD A;  3D6T B;  4UST A;  4X62 F;  5G0R B;  3LAL A;  4F4K A;  4KGK A;  3W7B A;  4YDX A;  3HJV A;  2UZA A;  5K14 A;  2ATL A;  3NBP A;  3NY0 A;  2ZJR Q;  2ZEJ A;  1M5S A;  2DCU B;  2I9S A;  2PEB A;  4ZIV A;  3CC2 S;  4K4Y A;  1QUV A;  4ILM A;  1F60 B;  4ILR A;  4K5S A;  1CUL A;  2X1B A;  2FY8 A;  2HK2 A;  2HPU A;  2IYG A;  4RW7 B;  4CP5 A;  5KFO A;  3EMT A;  3LH2 S;  2MGZ A;  2RDJ A;  2MHE A;  1N32 F;  3WAY A;  3KKF A;  2DXE A;  2ZH2 A;  1QLN A;  2B7B B;  2W5X A;  3F0N A;  5EUH A;  5JMN A;  2DNH A;  3W2W A;  4EU0 A;  5KFP A;  4Y34 A;  2XMA A;  1PJ6 A;  2WVD A;  3OFE A;  2GO9 A;  3GJR B;  2DRD A;  3MM9 A;  1P27 B;  4PG4 A;  2QYG A;  5AE1 A;  3K8W A;  2OPQ A;  3RR7 A;  4F3O A;  1FEE A;  1RWO B;  3HHL D;  4YQW A;  3CCW A;  1EJ7 L;  2HS3 A;  3VV2 B;  1UJ6 A;  2KL8 A;  2ZM6 J;  1S10 A;  3CIZ A;  2XZW A;  2GQC A;  3EZU A;  2DH9 A;  3BBB A;  2A2D A;  2RKI A;  1VI7 A;  1TMJ A;  4KHP F;  3LWM A;  1RI7 A;  2E9Z A;  5EWE A;  2DGO A;  2V68 A;  4RNF A;  1WEZ A;  1S99 A;  3CJ8 A;  3G2X A;  3M2V A;  2VQF F;  3RBD A;  2NXU A;  4DV3 J;  5LSO A;  4AXJ A;  3HKW A;  2WB4 A;  1X4C A;  3I96 A;  4NLY A;  1AUS L;  1G4C A;  1OWX A;  5L1I A;  1CBK A;  1R8P A;  1RTI B;  2OEM A;  2V8V A;  1XEZ A;  1F3F A;  4I68 A;  1UZH A;  3R8Y A;  3NOG A;  4LSL A;  4OMF G;  2V8H A;  5B09 A;  3ZZR A;  3GON A;  4DQR A;  4HDG A;  4DR2 F;  1UW9 A;  2F9J A;  1IQT A;  1CUL B;  1PYO B;  1RBA A;  2J7U A;  1RIS A;  4WBF A;  3W64 A;  3UN5 A;  4JI7 F;  2DGX A;  2GVD B;  1F9H A;  2MLX A;  3DLE B;  1GMV A;  3B8H A;  3L4B C;  4FYX B;  3UD3 P;  2D9P A;  1FO1 A;  2KN4 A;  4P6Q A;  3GZ7 A;  3DLL Q;  3DLK B;  3OR2 B;  4AD6 A;  3K2Y A;  3W2W B;  1YJR A;  1RT4 B;  4IOC Q;  2RU3 A;  2X98 A;  3EVO A;  2NCK L;  4J5O A;  1OY6 A;  2ASY A;  3W61 A;  1FDN A;  5DO2 A;  3OXG A;  2DBB A;  5I42 A;  3C6T A;  3CNQ P;  3S1T A;  2VBW A;  3EDQ B;  4LBP A;  4DHV A;  3I0R B;  5LJ3 Y;  1U45 A;  4PWD B;  1S9G B;  1UVL A;  3DLK A;  3OR2 A;  4ZVS B;  1Y6V A;  4DUT A;  3IGZ B;  2ILZ A;  4OQJ A; 
#chains in the Genus database with same CATH homology
 3UO0 A;  4KM4 A;  3UNY A;  1AUK A;  1ZEF A;  1AJD A;  3WAV A;  3NKO A;  1KH5 A;  3LXQ A;  4MY4 A;  3WBH A;  1ALH A;  1KHK A;  3IDD A;  4NWJ A;  4KJD A;  1ANI A;  2W8S A;  4LRA A;  3T02 A;  3UN2 A;  3T01 A;  2ANH A;  4LR8 A;  4ZG6 A;  2GSU A;  3Q3Q A;  3BDG B;  4UPH A;  5LRN A;  4LQY A;  4KAY A;  3NKQ A;  5AJ9 A;  1KH7 A;  2W5Q A;  1ELY A;  4MHX A;  1EW2 A;  1EW8 A;  4NWX A;  4CXU A;  2XR9 A;  3NVL A;  5LIA A;  3TWZ A;  3A52 A;  4FDI A;  3MK1 A;  4B56 A;  1E3C P;  2GA3 A;  2VQR A;  5GOV A;  3E2D A;  4CXS A;  5IJQ A;  4LRF A;  4MIV A;  3MK2 A;  4QAX A;  2W5W A;  3TG0 A;  4LRB A;  1EJJ A;  4GTW A;  1K7H A;  4ZG9 A;  3OT9 A;  4LR9 A;  4ZG7 A;  3B5Q A;  3M8W A;  4LRC A;  5IJS A;  3ED4 A;  1SHN A;  1E2S P;  5L0B A;  3M7V A;  1URB A;  3TX0 A;  3NKP A;  1EW9 A;  1HJK A;  1ED9 A;  2W5V A;  3WAY A;  4TN0 A;  2W8D A;  1EI6 A;  1E1Z P;  3NKN A;  1HQA A;  1ED8 A;  1URA A;  1ALJ A;  1KHN A;  4N7T A;  1AJC A;  1ELX A;  4GTZ A;  5EGH A;  2W5X A;  5HRT A;  3BDG A;  4FDJ A;  3SZY A;  1ELZ A;  1KHJ A;  3IGZ B;  3DPC A;  3IGY B;  3SZZ A;  5LRM A;  3KD8 A;  2G9Y A;  5KXA A;  5L0K A;  1O99 A;  5DLV A;  1FSU A;  3CMR A;  2W5R A;  2D1G A;  3BDF A;  1ZEB A;  5DLW A;  2IUC A;  2IUC B;  2W5S A;  4GTY A;  5LQQ A;  3M8Y A;  4LR2 A;  1ALK A;  2GLQ A;  4UOR A;  4CYS A;  1B8J A;  3WAW A;  1AJA A;  1SHQ A;  4LRE A;  2QZU A;  3NKM A;  1KH4 A;  2ZKT A;  5EGE A;  1N2K A;  3BDH A;  5K4P A;  1N2L A;  4YR1 A;  4CYR A;  5TJ3 A;  4ZGA A;  1HDH A;  4UOO A;  3M8Z A;  4UOP A;  5L0E A;  1O98 A;  4UPL A;  2IFY A;  4LR7 A;  3UN5 A;  4KAV A;  4LRD A;  5DLT A;  4UPK A;  3NKR A;  4GTX A;  1EQJ A;  4UPI A;  1ALI A;  3WAX A;  1KH9 A;  2RH6 A;  1E33 P;  1Y7A A;  2W5T A;  2X98 A;  2XRG A;  5GRR A;  4KJG A;  4CXK A;  1ZED A;  1KHL A;  1AJB A;  1P49 A;  5C66 A;  2GSN A;  3UN3 A;  3MK0 A;  5INH A;  1Y6V A;  1ANJ A;  2GSO A;  3T00 A;  3DYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...