3UNYA

Bacillus cereus phosphopentomutase t85e variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3unyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3unyA01
5EGEA 4MIVA 3WAYA 5IJSA 3OT9A 2GSNA 3UNYA 1ED8A 2IUCA 2RH6A 5LRNA 3M8WA 2GLQA 1KH9A 1E3CP 4ZGAA 2W5QA 1FSUA 5DLWA 4UPLA 1AUKA 3BDGB 3Q3QA 4LREA 1SHQA 3BDHA 1KHNA 3IGZB 2D1GA 1AJDA 4UOOA 4LRAA 3IDDA 4KM4A 5HRTA 4LRBA 2ANHA 3ED4A 4NWJA 1ALIA 2XR9A 3DYCA 5TJ3A 5DLVA 2GA3A 2W5XA 1N2KA 3BDFA 3MK1A 2W5SA 1ZEBA 1Y6VA 1ELZA 1N2LA 2W5TA 2XRGA 1HJKA 5LRMA 3UO0A 3NKQA 5GOVA 5LIAA 1EQJA 2GSOA 3NKNA 3UN5A 1ED9A 1E33P 4CXSA 5IJQA 3UN2A 1O98A 4LRFA 4LR7A 1EW2A 1KHKA 4KAVA 3CMRA 1KHJA 2IFYA 4LRDA 1ELYA 1KH5A 1O99A 5AJ9A 5L0BA 4TN0A 3B5QA 4LQYA 3WBHA 3NVLA 4KJGA 4CYRA 1EI6A 3TX0A 1KH4A 4ZG9A 1AJBA 3BDGA 3DPCA 1AJAA 1EW8A 5KXAA 4NWXA 2QZUA 5K4PA 5GRRA 1ALHA 1E1ZP 3NKRA 3KD8A 2W8DA 1KH7A 2G9YA 4KJDA 4LRCA 3T00A 1ELXA 4UPKA 1KHLA 1Y7AA 4UOPA 4MHXA 5C66A 3WAVA 5L0KA 1EW9A 3IGYB 3M8YA 4B56A 3TG0A 1EJJA 2W8SA 3SZZA 4GTXA 2X98A 4GTZA 1B8JA 1E2SP 3E2DA 5EGHA 2W5WA 3A52A 2W5VA 4UPHA 3MK0A 3M7VA 5INHA 4ZG7A 4UORA 1ZEFA 4CXUA 4CXKA 1AJCA 3T01A 3TWZA 3NKPA 3WAXA 4UPIA 2ZKTA 4LR9A 2GSUA 3LXQA 4GTWA 2W5RA 3WAWA 3NKMA 4QAXA 2VQRA 1HDHA 5LQQA 1P49A 3SZYA 3NKOA 4N7TA 4YR1A 4FDJA 2IUCB 4LR2A 1HQAA 5DLTA 3M8ZA 4KAYA 4CYSA 4ZG6A 4FDIA 4MY4A 1ZEDA 4LR8A 4GTYA 5L0EA 1ALJA 3T02A 3UN3A 1K7HA 1URAA 3MK2A 1ANJA 1SHNA 1URBA 1ALKA 1ANIA
chains in the Genus database with same CATH superfamily
5B0BA 3U02A 1PSDA 4FF1A 1N0UA 3DLGA 3EZUA 2CUYA 3TUJC 3PW2A 5F3TA 3KTQA 1U1PA 4PRFA 1VRTA 1KOOA 1HYSA 2YXLA 5BYQA 3RBDA 2ZH3A 3FEYB 1R27B 4I6AA 4WU2A 2DB1A 5KT3A 3T5LA 3C14B 1AYEA 2K3IA 3NGUA 4OIXA 4ICLA 4ECSA 1RT5B 4OI4A 3OFGA 4DHVA 2YX4A 1AJBA 2K2PA 5KXAA 3C16A 1IKWB 3CVKA 1MW7A 2B6AB 3FCVA 1ZAVA 2GGPB 2KT5A 4M5LA 3PJ9A 4G1IA 1F6TA 3OSNA 1XMBA 2MQQA 1JLEB 2FZKB 4DR1J 1IQTA 1AXQA 3DDIA 4LFBF 2HHXA 2HNYA 4LSLA 1I6JA 4IG3B 2PA3A 1ALJA 2DNKA 1F5CA 3CJKA 3PJWA 2PO4A 4I7FB 3IP0A 4CTAB 3CCSS 2CDRB 1VK8A 3BDHA 3KNGA 2IM3A 4NCBA 1NSPA 3HHNB 3DGVA 1Q79A 2FD2A 2KZMA 5HQLA 2HIYA 2E5HA 1SL2A 5D8HB 3TP2A 4HHJA 4N47A 4YS2A 4CLTA 1IKXA 4RNFA 1FKAF 5DM7Q 4CZCA 2VF3A 3LP0A 4WIQA 3NGDA 1KP6A 4WF9Q 4PCQA 1JNRB 2ZM6F 2OD6A 3JSBA 2VASA 4KJDA 1EHWA 1T05A 1G2EA 1RAHB 4WYWA 1R8HA 1O8BA 4IUFA 4GTZA 4NLUA 3TJ9A 3NAIA 3BDEA 1SQGA 4FF4A 2A2CA 4K4XA 1NK4A 3QYYA 2IJNA 2QV6A 2MKSA 1YJTA 1BUXA 5DGAA 3R6GB 2JEJA 2DO0A 2L9DA 1LK5A 4NLWA 3QAEA 4RW7A 5KFVA 2R7WA 1S7IA 2YKPA 3MPVA 1UJ5A 1U2RA 4JI0F 5GVQA 3VV2B 4O3SA 3JQKA 1H2VZ 2HIQA 3NNHA 1EQJA 2CJQA 3DRYA 3B54A 3FKBA 2BW7A 3PFOA 1IWGA 2ZDOA 3MFIA 2VG6B 1AUSL 1SI9A 3F41A 2HHQA 3NKYA 2AV5A 1X4AA 1NJIT 1RTZA 1VGYA 3TQ1A 1OY9A 2DJWA 3HD1A 4FXVA 2F9JA 4NCAA 1KHLA 2B0GA 5ETNA 2MMYA 3AOCA 5L1KA 4I2PB 1NUEA 4A8QA 2UUTA 2EEYA 4DU8A 1D0EA 2APOA 4JYAJ 2ZH9A 1QY7A 2RKIA 4RLEA 4IQMA 4AE5A 5LSLA 4ZG6A 1NXIA 1R43A 3EGVA 3HZGA 2Y1JA 1YSJA 2XMWA 5CYMB 3QFHA 4DR4J 3CD5A 3JXOA 4F02A 4QIEA 3LANA 1UVLA 2Y3YA 2G0CA 3MTJA 4F3QA 2WSEC 3M8SA 4DV5J 2KN4A 1FI4A 3FZBA 1SIWB 5E3CA 2AYEA 3CCUS 4J9KA 4DR1F 2R3VA 4IDKB 5KFJA 2RRBA 5HQ8A 5AE2A 4UT4A 1GX6A 1N48A 3B5QA 3DRPA 2HNDA 1SJ3P 3SCLE 3TAPA 3M6VA 1NSAA 3CUNA 4UY85 2VOPA 2EBEA 1RLCL 4F3OA 2JSXA 4LRCA 2XYGB 5C66A 4BHQA 4JUZA 1XR7A 2Z56B 3WC2A 3EJMA 2G0IA 3UW1A 4DN0A 3LP2B 4WIIA 5B0CA 3WAXA 3GJRB 2LQ8A 2CPDA 1S57A 3KNAA 4J9OA 5KFNA 1UETA 3HF5A 3QLHB 2HK2A 4CLKA 2D9OA 3LAMA 4KO0B 1VK3A 3TQEA 3LGHA 2W4PA 4Y00A 2OUGA 4PR6A 4DR3J 4DI6A 1UZHA 1QTMA 4ZP9A 2ROEA 1I5OB 2NSBA 2D1GA 5KFGA 4RW4B 2WBRA 1N5YA 1OIAA 1GAOA 1RT6A 5K20B 1VRUA 3K58A 1K44A 4U67Q 1HJKA 3LF0A 2R8GA 4DV7J 4GKJF 3FRZA 3CEDA 3LH2S 3SSSA 3NGTA 2BZ2A 3MD1A 3EPGA 3M9OB 5A76A 5E3RA 1YJ9S 2XWXA 2KXNB 4DQRA 2QMWA 1S9GB 1GK8A 4MHXA 1RA6A 4OZ2A 3NL0A 3MK0A 4CT9A 2DITA 2YNIB 2R2SA 3HSZA 3GIJA 4MK7A 3SYZA 4QW8A 1K1QA 2CNOB 3I0RB 3MM9B 4RW9B 2DR7A 1QVGR 2E5JA 4Q43A 3UDCA 2QO3A 3DLHA 1NPRA 3X3UA 1LV5A 3A3NB 5CXTA 4L73A 2JC0A 3OL9A 1GQEA 3GJTB 1WOPA 2PMZD 2FJDB 2EFPA 4JYAF 2BMBA 5HVFA 4UW2A 1SJFA 2U1AA 2EC0A 3VAMA 2YNGA 5DQGA 1OYDA 2H3EB 3NEKA 5KG7A 4DL5A 3AD8C 2RDIA 5K8MA 2CPIA 2CPZA 2MPUA 1AZSA 2VODA 1YBUA 4LQYA 2HHTA 3ZZRA 3W60A 1EJ7L 1KBRA 3T1HJ 4YMEA 1NZAA 1O6XA 4DV5F 2G9YA 3GWCA 2PDAA 1OQ6A 3KDNA 3NNAA 3BH7B 4IR1A 4LVNP 2X98A 4WK3A 2RQKA 2ATCB 4L3NA 3Q89A 3UPFA 1DZ5A 3PKYA 3H4BA 3NNCA 3LGMA 3ULHA 3LP1B 3WAWA 1U26A 2VQRA 1NK7A 3LA0A 2ZBCA 3EGZA 5A8RA 2LU1A 5KOXA 4YB6A 4P2XA 3TEGA 2Z2YB 3C2PA 5F8LA 2YKAA 2CQHA 1RWXB 4A46A 1OYEA 4DL6A 5T7LB 4WCEQ 3OFFA 1T03A 2OKQA 5IT9Y 1S7HA 2DGXA 3IBCB 4FPIA 3IGNA 4DUTA 1S76D 1NKBA 3TA0A 2EW9A 3SQGA 4MT1A 4URGA 3EMTA 2Y1LB 3U1NA 1FFWB 4QQBA 1Q82T 2YH1A 3KLFB 4FZVA 3VAJA 2E5LF 4KAVA 2DNQA 1TKXA 3MEKA 2ZOFA 2EVZA 2DNGA 3S1TA 2FJAB 4DR3F 1UA1A 3R97A 2A2DA 3PM9A 1NJWA 3ZTRA 3ET6B 3SCJE 1TK8A 3DLEB 1N33J 4L72B 4ZKAA 3V6DB 2BXJA 4DSKA 2RQ4A 3TG0A 3J81Y 2AU0A 4QW9A 3V81B 3SEOA 3T19A 2QLFB 4DV7F 2AX1A 2YKMA 3N5FA 3F0NA 3W8PA 2UXBJ 3I32A 2MQLA 5HN0A 2I38A 3BF4A 1JK9B 4P2FA 2ZNZA 2V4QA 1TL7A 2XBPA 3J80Y 4P10A 5F0UA 2LLZA 4BC7A 1UVJA 4Y0FA 3LGNA 1B0TA 1SKRA 4ZPCA 4UTGA 1WC0A 4KIAA 5ETQA 1V3ZA 1ZYQA 3HT3A 2UVUA 5LXYA 2AQ4A 4R5PB 3VVUA 1C2PA 3GYGA 2XR9A 2Z30B 1Q16B 2FLPA 1KTVA 3ZO7A 2BJ7A 2C3UA 4P71A 2N7YA 4LBHA 4NCGB 2U2FA 4TQRA 3TARA 2L9NA 4CQ1A 1BQMA 4C0OC 3DOMA 1CS4B 2PA8D 5KG0A 2X7IA 1R0AB 5KFMA 5KFHA 4F2SA 2ASLA 4RW8A 3THVA 4OZ3A 3FEXB 3BZQA 1IBKJ 4FS1A 2O3DA 1H2TZ 1Q5YA 4DCOB 4MFBA 4L3KA 4C0BA 2XS5A 4I2QA 4MIAA 1VQSA 1TVRA 3EM1A 1WJ9A 1ZM9A 3QGHA 4ZVRB 2V34A 3TO8A 3SFGA 1B7YB 4GTYA 2AEJA 3T1HF 5HRTA 1FDNA 1N6QB 4QU7A 2DCUB 5E33A 2MSTA 2FJVA 5HQMA 4LRAA 2ROPA 4ZVGA 4LT6A 1NK6A 1KC8T 2A6OA 3CTRA 4RBVA 4K2XA 1HBUB 1M5KC 3BPSP 1UVKA 3K59A 2C3YA 2E5GA 2JDJA 3NS5A 2FUG9 4O0NA 3CMRA 5L0BA 4B08A 2M70A 1OMSA 3DLKB 1VQLS 2AKWB 1ZA2B 1HPZA 2ABYA 5KT2A 3SMZA 1KLNA 3GJSB 4FS2A 4PAAA 2HMIB 5EX0A 3FSIA 4OHWA 4X64J 2HHHJ 4MIWA 2ZHBA 1X0PA 3PYDA 1BGXT 3R27A 3LXQA 4TY8B 1HDHA 1WC4A 2DPIA 4U9RA 2VHGA 1IKYB 3LWLA 3P45B 2F40A 5A0YA 5SUHA 2RH6A 1N33F 3MM6B 6FDRA 3EYZA 4Y2CA 2BABA 2DR8A 3DGPA 4RPFA 1DQAA 2AD9A 1Z2LA 3V5RA 3CO0P 3MM7B 2UXBF 3GE9A 1R89A 1ACMB 1PO6A 1RWNB 4RL1A 4UOFA 1KLMB 3KKFA 4NYPA 5IV4A 4X4NA 1DAXA 4A48A 2JLFA 2AGQA 1X8DA 1FRMA 1NNDA 2CNLB 3VGTA 1IBLJ 1YTYA 4C3LA 3FVYA 2WRMA 4K4YA 2XHWA 4DFJA 1KH4A 4GKKJ 3MDFA 2W8DA 2NXJA 4KR0B 4Z2XA 1DTTA 4KHRA 3DOLB 1EJJA 3JSMB 4ECZA 1RLDA 1QJHA 2JVOA 1N36J 3SI8A 1YJUA 3PG9A 3MUVP 1QE1B 1FXRA 1FKOA 2B4UA 3OVSA 1T9XA 4FDJA 5E0OA 4JBCA 1HBNB 1UCNA 2BVZA 1MWYA 2GO8A 3CCWA 2KYZA 3K5LA 1SC4B 2IUCA 5I3PA 4IKAA 3MFHA 2R8JA 1H38A 3GCWP 4PYDA 2LEPA 3A3PB 1X5PA 3BM7A 2ZH1A 1AB8A 2OTLS 2XWYA 2HVIA 4USWA 2DGQA 4LF9J 1XN9A 4W4MA 3MECB 3BH6B 4B3MJ 2KHCA 5D15A 1N0VC 3CJTA 3DKDA 2ILYA 3PIPQ 2IFYA 1JLCB 1C0UA 2JRSA 2R8KA 1S6QB 3TW0A 2BKNA 4PUOB 1ZH5A 1SXLA 2CRLA 3MM8B 3MPYA 2N3LA 1X9SA 5A8KA 3IGYB 3QO9B 3GV8B 1PILA 4ERDA 1WOSA 3IBFB 1WF2A 1RWPB 2H5IB 3BO4A 5GADI 2ZKTA 2ZD1A 3I5CA 2W9BB 3KG4A 2XZDB 1BD6A 3NKOA 5EHHA 2OFHX 3O3LA 2O67A 2UVVA 4CYSA 1KOHA 4ED4A 2D41A 1PJ5A 2MXYA 2CQIA 3W8GA 1X0FA 2EKYA 3CJ3A 4X64F 1GXUA 2EFNA 4IG3A 2HHHF 1ZZNA 3RG6A 3GYNA 3KUEA 4RO0A 4CTAA 2Z58B 3O44A 4QWCA 2HBRB 3VAKA 1T0TV 1ZEBA 4GVBA 2CJKA 2V9KA 5AE3A 4NRTA 2L9WA 3GILA 3J7Z5 3EICA 3N6NA 4LRDA 2DRBA 2C2OB 2ZJRQ 2ZC3A 2XTJP 1S59A 2P8IA 3I6PA 1RKIA 1U8WA 3FDSA 3I56S 1FNOA 4X2BA 2NUHA 1P8GA 1NCLA 3GFXA 4B9TA 4JI2J 4X84A 5DO2A 3M2UA 2OLWA 4ZCLA 4NLGA 3JS9A 3EVOA 1HKAA 4HDHA 1RTHB 1IBLF 1WHXA 5HVHA 2I6WA 4ER8A 2IDEA 3IAM9 4K2JA 5D78A 3T3FA 3QIPB 3PW0A 1WKKA 1YHQS 2PI5A 3T5JA 4XDCA 2C2EA 3KHHA 3AA8A 1RHKB 2CQ2A 1WUUA 3D3CJ 1SQFA 2RDDA 3HVTA 1N36F 5CYJA 2J8AA 5HROA 4NWJA 3H2VE 2GA3A 5G4DA 4QIGA 2V68A 3DXSX 4FBTA 3B4MA 1YVFA 5BYSA 1VQPS 3ENWA 5HLFB 3E8OA 4HTIA 4EZ9A 4LFAJ 4A8FA 4V1Ak 2YWWA 4F4KA 4GC6A 1M5SA 4F50A 1LW0A 5CYQB 2DHGA 2PEHA 1FDBA 2WCXA 2BRKA 5FIIA 4KBIA 5IT0A 1LOUA 3SQOP 2UUCJ 3PRDA 4UF4A 4DV6J 3KD8A 3IR5B 4OYPA 3R7NB 4OYOA 1MU2B 3CDWA 2JC1A 5C7PA 4LF9F 5KFUA 2KVIA 2DH9A 4NRUA 4DJBA 4O3NA 4B3MF 2MLZA 4C8OA 1SH2A 1HW9A 4OI1A 4P2SA 1GH8A 3MMAA 2R2TA 2XS7A 2MTLA 3CO9A 4U95A 1JLBB 3MXHP 2JFKA 3G71S 2G13A 4C8LA 3DI6A 4CO1A 3NMRA 4DG1B 1KH9A 4O4RA 2G4BA 2GCFA 4HTJA 5CYMA 1HBOB 4K50A 3I4HX 3B8HA 4JP8A 5B09A 2BX6A 2P6TA 1VBYA 5J2QB 4GVLA 1UVIA 1MN7A 1MNEA 1BC6A 5D77A 2DNNA 3MEGA 1Q53A 1G7CB 1E6VA 1JLAA 2VC0A 3KJNB 2CDQA 1IQZA 5BR8J 3KHRA 1FFSB 2MKHA 2GA7A 4J37A 4M5IA 2WBMA 1NB2A 3Q8YA 3JAMY 2PEBA 3US5A 5ITHA 1KONA 2HHWA 3OTOJ 1U1RA 2VQEJ 4LR9A 3SCKE 4EK2A 3VGUA 4LBIA 3M1VB 4WP9A 2V6AA 1KS2A 3C15B 2R7OA 4MYUA 1U49A 3C6TA 2LKZA 1XC9A 5K14B 1RP5A 2HS3A 3M2RA 4JI2F 5K8OA 3ITHB 4S0MA 1UWBB 3AJ2A 2DISA 2RRAA 1S0OA 3EX7B 1B0VA 2CA9A 4Q0BA 1MMDA 1UAWA 4L75A 1SJ4P 2HSEB 4LR7A 4Q44A 4G1QA 3RR7A 2YPYA 4WKRA 1EQ0A 3CCMS 2PSZA 3QJJA 4ID8A 3H7HB 2LP4A 2IY5B 3KOAA 4ZOSA 4U8VA 2Q79A 2AZ3A 2DRDA 3W7BA 1LXNA 1WNEA 1BQXA 2AJ2A 3TNVA 1HI1A 4LSNA 4W98A 1I51B 4UORA 2IC3A 4NLPA 2GSUA 4LFAF 3TYTA 4NE9C 1SKWA 2WW4A 2Q1LA 3GSIA 5J2PB 1GMVA 3DOKA 1U24A 4TN2A 4BWJA 2UUCF 4DV6F 1CEZA 2BEFA 2NUUG 2OEJA 3RBXA 3HLUA 5DG9A 3M8PB 3VF0B 3HJVA 1GX5A 1E3CP 3MM9A 4KV8B 2DH8A 4M95A 1ELOA 3W9JA 4RNOA 2QG9B 4O3QA 2DNLA 1BMQB 7AT1B 2X51A 1XBWA 3QMQA 2ZOMA 2ZZNA 5L38A 4KH0B 2AJ1A 2JVRA 2IA6A 1V6HA 3UCGA 2HW3A 3CJQA 4CNZA 3IFEA 1J2VA 1TAQA 2BQUA 2LDIA 3AXKA 1TMMA 3GP9A 4IO9Q 2PN6A 3I96A 4CIOA 5KFYA 1TKDA 2J0SD 2IJRA 5JXSA 1HWIA 4IH7A 3BGUA 3IWLA 1N5VA 4ZG7A 2QL5B 3KG0A 2Z0GA 1QVFR 3B78A 1JJHA 3DC2A 1JQGA 1LWXA 2MQNA 3Q2SC 2CQGA 3RW7A 2IM2A 1SH0A 3QSIA 5BR8F 2F5GA 4MKVA 1T7PA 3GFHA 1FD8A 4JV5J 1FJCA 1JLQA 3J7A1 2AP6A 5EUHA 4FKYA 5BJRA 2ZHOA 3T6BA 1RUSA 4ZJLA 3OTOF 2Z8QA 2VQEF 3FEZA 3A3OB 3BDFA 1YRTA 3H5XA 4P7TA 1FK9B 4PG4A 1N2LA 2IBKA 1XNQJ 4DL2A 3HJFA 2V8PA 1VQOS 3HVWA 5KG2A 1CULB 4PABA 5D4OA 3K89A 5CQGA 4KJGA 3ZTPA 3TX0A 3BDGA 2VH7A 4A47A 1CSJA 3KLFA 4PQUB 2CJ9A 1K0TA 3KLEA 2ADBA 2ZBRA 4MIBA 2KHDA 2ZH4A 3DLGB 4AQYJ 4OV1A 4C9DA 3TWZA 3DLEA 1FVSA 3LWMA 1CJKA 2LDYA 1Q0NA 5J1NA 1HYSB 2WHOA 4NMLA 2CQCA 1Q4RA 1V3RA 4AFFA 2D74B 2QYGA 4ICLB 4OZNA 4CYUA 2BQRA 1QAYA 1OWXA 2Y1IA 2VZ9A 3C16B 3IS9A 5U47A 2HZCA 5IXUA 1FWPA 1KQGB 5D4LA 2R2UA 3CMES 2ZKUA 3ILOA 3P3DA 1S1XA 1HHQA 4KGZB 3MK1A 4M1KA 4CLUA 5IM0B 3WC0A 5GOVA 1NBEB 4R5PA 3QT7A 3R6LB 4USVA 1KKHA 2KXHA 2MSSA 3HFKA 4PG7A 4EO6A 3QBCA 4ZDNA 3HHLC 4C8KA 2BANB 2QL9B 4XAKA 4LSLB 1Y9OA 1KVJA 5B0DA 3M4XA 2FPHX 1IM6A 2CQ1A 4ZPDA 1CS4A 2AJFE 1ZM2A 3CJRA 4HH1A 3HVRA 2LU2A 3HHEA 3K5OA 4GTXA 4UPHA 1FRIA 1ZEFA 4DZDA 3PYFA 2E9TA 1PYOB 3OR1A 4MH8A 2BOPA 2OSRA 3LPEA 4L76A 3BQ2A 1RZMA 1IKXB 3ENAA 4R8UA 5AJ3F 1CPZA 1URAA 2CPEA 4MIVA 4PG5A 2EKNA 3DRRA 3LP0B 2Z2LA 2CFXA 4RZRA 3MI7X 3NLCA 3EXYA 4OZ5A 5KT5A 4DUYJ 4XDDA 2Q6BA 2QLXA 4U8YA 1ULRA 3GR0A 4FYXB 3SV3A 4DQSA 1T05B 1X5SA 2YPZA 3BO3A 4OJ3A 2NXUA 2NREA 2GJFA 2IVFB 3QWPA 2DO4A 1SH3A 2ZZTA 1HBUA 2XNQA 2G2ZA 4LMZA 4JV5F 1AFJA 1KH5A 1Q86T 2G2YA 1LKZA 2AEMA 2RF2B 2BKOA 3MAHA 2KRBA 1FXLA 5L1JA 1WELA 3WAVA 4EU0A 2JWNA 1EP4A 2QN6B 5L9XA 1XNQF 3TANA 4CRJA 3AH6A 4NLTA 1U4BA 2XB2D 4A8KA 1S9EA 4NLQA 1MSWD 1PAUB 2RS2A 2VPWB 3EZ5A 4FNHA 2B4PA 4JOUA 1M1KT 2W2OP 1ALKA 4LFCJ 2IHR1 3QZ8A 2F9DA 1Q8KA 2C22A 2WVFA 1VOMA 3NMAA 4ID5A 4AQYF 5K8NA 4X4SA 1HFEL 2HNZA 2IM1A 4FDFA 2D3O1 3AA9A 1DLOA 2H65B 2KO1A 3S7RA 4ZIWA 1TAUA 3EGWB 1RABB 2JLEA 3ZXWA 4QWEA 2MQMA 5C25A 4DFKA 3C19A 4ZCMA 1YZ6A 2HFUA 5JJBA 3SZ2A 1KLMA 2BE2B 1RWMB 1RSCA 4CDIA 1N88A 3HHLA 1KQFB 2VV5A 2KU7A 5ETVA 3MEEB 1R7IA 3DOLA 5F8GA 4OHZA 1REGX 2UVRA 5DQHA 2YNFA 3OW2R 1C1CA 4IOBA 2RT3A 1PJ7A 1QE1A 1V9OA 1C1BA 4JI7J 4F3MA 1OSCA 4RUCA 2DCLA 5LRNA 1HBNA 2VA2A 3DRPB 3ISNC 4FNIA 2I9SA 1S6PA 4EWTA 3CNQP 3D66A 5KG1A 2WVDA 2O5DA 1TKZA 5D0RA 2PD1A 4P72A 3F56A 4PZVA 4OI0A 1S1WA 2R9LA 4UUXA 2WSFC 5MLCV 4DV1J 3NKNA 2R2RA 1FX2A 1O98A 4UZCA 3SBMA 1SL0A 4F0MA 3QATA 3NGSA 3MECA 1U2CA 4IOCQ 1S0NA 4HI1A 1FTRA 5L8RC 1EW8A 3QGGA 3TVZA 1VIXA 4NLRA 5J1PA 1JLCA 2MKYA 1PBAA 4I64A 1WF0A 3OL7A 4DPOA 3HSDA 1SUQA 4FF3A 3IGVA 1BE4A 4GMKA 5B0AA 3SZYA 4HVZA 1VRUB 2GMJA 4WFAQ 2PE8A 5ETLA 2W9BA 2XZWA 3MUMP 4CLLA 1S10A 3HSGA 4WKYA 3OXLA 3KLGA 4IYQA 4PXBA 4LF1A 3PZPA 2D9PA 4ZVSB 3CDUA 4B9LA 2ALZA 3PJXA 2AJ0A 1L3TA 1ZOTA 1Q5VA 1ALIA 5THWA 4OL8A 3LW5C 3EWGA 3T9ZA 3W2WB 4IH5A 4MMOA 4USIA 2GS8A 4ECRA 4FBUA 4LFCF 5CHCB 5DZ7A 2XCPA 5J2NB 2LQJA 3I82A 4NEZA 2AYGA 4XO0A 1K9MT 3WQPA 4USJC 5J1EA 5KAKA 5HSPA 3ZNUA 3M7VA 5GAHI 4M5HA 3FUYA 3HZEA 4NYZA 2HGNA 1PAEX 3Q8UA 1AROP 2YBVA 4K4VA 4QPXA 3HXMA 3UQSA 2Q3PA 3ZZZA 1RTHA 1AZSB 2GSNA 1RT3A 1ZTWA 2BACA 2D3ZA 3HHKA 2DXDA 5LSOA 1ZM4A 1LK7A 3CCES 5L46A 5J2MA 3H59A 2POKA 3Q22A 4NLDA 3CC7S 1X5TA 3GTYX 5C24A 3PCOB 3I5AA 1SC6A 3S01A 4JI7F 2VJUA 2JNJA 2Z4PA 3BBFA 3OLBA 2XMMA 2XLJA 2XMTA 1TELA 5A8RB 3NBPA 1P9YA 2VG5A 4AUKA 2ZOGA 3BBBA 2YWKA 4OZ0A 1T03B 1C4AA 3PX6A 4KPCA 4TYAA 1FF2A 4DV1F 1B3TA 2VC1A 1VC5A 3SQGB 5IC4B 4DL7A 3V4IA 5LMUJ 2BW2A 1H2UX 3CSKA 4Q2MA 3VWSA 3VAHA 5ETMA 5T14A 4I6WA 4J9PA 2F7VA 2E1CA 1TKXB 3MHYA 3WDOA 1V5IB 4U6PA 2YX1A 2Y9HA 5DLWA 2HBQB 1SHQA 3DU6A 1B64A 4KM4A 3PKMA 5DJBA 4C6AA 1BXNA 1MMLA 1PC5A 4O0IA 4JB8B 3ELHA 3GFZA 1OJ4A 4QWAA 2FGCA 3ZZPA 5LL6d 4K4WA 2YKMB 1RK8A 2QFIA 3A13A 4QYZJ 3D68A 3JB9k 3DPCA 1VISA 3MEDB 1PYTA 2FY1A 2IFXA 4ZVEA 3BDPA 1QUPA 1PGZA 3R1HA 1YZ7A 3UVJB 4CXSA 1T9TA 3D1QA 3ONQA 3CT9A 5LQQA 2CQBA 3LAKA 1NHUA 4N7TA 2AWZA 2GMHA 3NOGA 4RX6A 5B0GA 4MK8A 3PVXA 2QRRA 1WEYA 1BQMB 4K4TA 3BKFA 3DOMB 1FJGJ 3M1VA 3HSJA 3L7PA 4RNHA 3T1YF 1B4SA 4J9MA 5LXRA 4WFXA 3BREA 3ED4A 2ZH5A 4Y65A 2W5SA 2NZCA 2W9CA 5SZTA 4MFBB 3OVAA 3QFWA 4C8YA 4DSLA 5LIAA 1NHKL 4MTPA 2ZE2B 2FVCA 1LXJA 3K0JA 1CJUA 1JKHA 2F3JA 2KTQA 3M9MB 2W25A 3D6FB 1B70B 1UFKA 2FJWA 2HS0A 1LW2B 3DDKA 1L3SA 3MR6A 1H7WA 4P2MA 2QZUA 3HI9A 5EDWA 3AXMA 3H5SA 4ILMA 1VS3A 3EVWA 3WHIA 3R5CA 4OI2A 1RT2A 1X4EA 4WU3A 2JZ5A 2QYCA 1RACB 2YWHA 3GIRA 2V4RA 6AT1B 3QQCD 2EBGA 2FLLA 3EZOA 1JMTA 4YR2A 3UWTA 1RAOA 2JJ4D 2GIQA 1FNXH 1CJVA 1NKCA 1VRQC 4WYLA 5IOLA 4H4OB 1WI6A 1VQYA 4EGLA 1K7HA 4ZVUB 3M32A 3JSRA 3KHGA 1H98A 4KSEB 2F1FA 2CNNB 3IGZB 2H5JB 3HO1A 2RHSB 4WFZA 4KV8A 2UUAF 2ZDPA 2YKNA 4Y28C 2CPJA 2QZ8A 5LMUF 3IA0A 1T95A 3UO0A 1QDUB 1P27B 4A8MP 2XULA 2XY7A 3B6BA 2HZVA 5D4PA 1IXKA 3S6EA 1KHJA 1O99A 2LXFA 3G87A 1HQEA 3KMSA 3I9V9 4TKTA 1D9FA 3KUGA 5EWFA 4CO4A 4DX5A 1NDPA 3DCAA 2PI4A 4C0HA 3S8SA 2CJXB 1XTZA 3DYAB 2ZWPA 3HD2A 3DGPB 2XZTB 3DFEA 1WHYA 4ECUA 2QX0A 3D67A 5H1SV 1J5OB 4QPTA 1UZDA 1FVQA 3PX4A 2VFUA 2J9CA 1X4BA 3NCQA 4DF8A 2EFGA 1DURA 1G1XA 2HAIA 5KFLA 3BQ1A 3EDQB 2JHEA 3WAYA 3K5MA 4LF7J 1VQ4S 2CQ4A 3C66A 1Y3KA 1RAJA 4LF4F 2YQ3A 3RB0A 4KB7A 2XM3A 3OQ2A 4DPXA 2W5XA 2HZAA 5F8MA 1CQNA 1I94J 1S4EA 1PC4A 4YHHJ 2HVHA 2VONA 2A0FB 5HBMA 3N28A 4IG0A 1FKOB 1FK9A 4B9MA 3VAFA 3CJ5A 1FJGF 3TUZC 2DNYA 4OQJA 3TVKA 3W2VB 1IM4A 2HRYA 3CD6S 4U96A 3TA1A 3E01A 2DR5A 1CULA 4ATNA 2ZBIA 2BE9B 1D9DA 1C0TA 2C2DA 2V2KA 1MMNA 3T00A 3SIPB 4ZITA 3M8YA 5ADZA 2FDNA 2L41A 2WSCC 3L09A 2W5WA 2H54B 5CZXA 2WVCA 1ZM3A 5AXNA 1BHNA 2Y1RI 4KKOA 1REVA 1ZPWX 4LQ9A 2YH0A 4V19X 4RUHA 3PFEA 4RBUA 1QAXA 3IM8A 3ZTQA 3BSNA 2J7UA 1C0UB 3C8YA 3FK4A 3HPOA 3Q8SB 2DGSA 5E5NA 1I1GA 4NLOA 2XI2A 3PRVA 5A8KB 1UEUA 1QUVA 2HFZA 4GO5X 4IFVB 1GMWA 3G9CA 4CM0A 1EAYC 2ZD1B 1SJQA 3FC9A 1F9EB 4JI8J 4ELTA 5IM0A 2E5IA 4ITSA 1EI6A 3UD5A 3UR3C 2HHVA 2WB1D 3D28A 3DDNA 3FCWA 2BANA 2QIFA 3VZHA 2FLNA 4QOTA 3SSQA 4ZS6A 4KAIA 4M94A 2OPQB 3SZZA 3ICLA 1YRXA 3TX8A 4TY9A 2C2RA 2V8GA 3DN9A 4KGKA 1VQNS 1N5SA 4HACA 3MAQA 4GVBB 4TU7A 4ANEA 1TFWA 5GAEU 1RBAA 3VGSA 3DHWC 3G4SS 2MY8A 4ANDA 1LFPA 1M5PC 1Y5LB 2HRUA 3GCXP 4UPLA 4XPCA 4X4RA 4IR9A 1AJDA 4OX6A 1RT4B 3RW6A 4J9UE 1XIQA 3RRKA 2VICA 3GLJA 2XRGA 3ZZOA 4JI3J 2QSWA 3M2UB 1IJFB 4B9NA 2X3GA 2XGPA 4WP3A 3V2UC 4BCAA 4ZN1A 2VA3A 2FVSA 3KLHA 1IR1A 1RTJA 3W61A 4Y34A 2NR0A 1KDNA 2J6TA 1URNA 3SFUA 4USKA 2VBXA 1HBMA 4WTOB 2J0XA 3NKRA 3R3TA 2RF2A 4OJ1A 3CCVS 1I94F 5DETA 1X4DA 3HVTB 4YHHF 4CXUA 5HROB 3A8KA 4Z37A 1TL5A 2OPSA 4MKBA 4DBQA 1XMOJ 2DBBA 1IKVB 3M8RA 2PFDA 2GVZA 3ILIA 1RE1B 2K3KA 1R6YA 4PXDA 3G82B 2RRNA 1LWEA 2ERRA 1S1UA 1LW0B 2LYVA 3KUHA 2GZOA 3UD4P 2KXFA 4DX6A 1FJ7A 1R31A 4YEAA 1IN0A 3FCHA 2IPOB 2HAFA 3E2EA 1J5EJ 1NB7A 1TL1A 2CVEA 3FBCA 3MCNA 3QSYB 2FVRA 4F0HA 1EW2A 2J5AA 3MMAB 2V5HG 5KG4A 3KHLA 2HFNA 4NPOA 2ZJPQ 3DHXA 2GHVC 4B17A 3TAMB 3Q83A 1YIJS 4PWDA 3X1LB 2WB4A 3DI6B 3U1MA 4DX8H 1T9WA 3A8EA 2H9ZA 2BE2A 5F8NA 3OL8A 3MWBA 1TKTB 2W7AA 2WOMB 2GVDB 1QSYA 3BSAA 2XNRA 2C2KB 5E41A 1S1VA 4WE1A 4JI8F 3GV7B 1Q95G 2GAGC 5DZ6A 4QIWD 2W2QP 3MEEA 2PFFB 3QZ7A 2VD3A 3RTVA 1URBA 3NGKA 1JLGA 1HWJA 3MEGB 3CC4S 1E6VB 1JLAB 2HS4A 2ZWOA 3AFGA 1M1GA 4G3IA 2OAUA 2UUBJ 4AXJA 2G2OA 3SV4A 2LCWA 3UCZP 2DIUA 1FJEB 1MWQA 3THTA 4IRDA 2KKHA 1GNKA 1ELZA 2IM0A 2E7XA 4YB5A 3H90A 5M2UA 4NXMJ 5IWAJ 4M8LA 1VJWA 2W7OA 4R0JA 1KEKA 3AODA 1YJ7A 1YJVA 4DV0J 1RTDA 1SQEA 1F9FA 2OEKA 2MZRA 4ZP7A 5AE1A 1ALHA 3C6TB 4EFAC 4UOGA 3P5BP 3H2UB 1YG0A 1ELXA 1FRJA 4ZP6A 2WVEA 2X1GA 5I3QA 5FJ4A 3M2RB 2QA1A 4JI3F 4OLOA 3C6UA 4RUBA 3R8YA 3MOZA 3QJLA 3G2XA 4NI2A 4N5SA 4I68A 2KDOA 3IC1A 5KFXA 3OVBA 1N8RT 1SJRA 3BJYA 3UI3A 2QEXS 3HT0A 2XCAA 2LXIA 4Q0BB 2W24A 3CXCR 2FTRA 2DEJA 4QWBA 1KSPA 1YX2A 4F4AA 3ETMA 3J81j 3OR2A 4G1QB 1S49A 3QT6A 3O2IA 4OYAA 4LQ3A 4NXNJ 5HMWA 2K1RB 1Y7PA 1F60B 1WTBA 4ZLPA 1QLNA 5D3GB 2VPZB 1KTQA 2KT3A 4WXWA 2DGTA 1T9YA 1GMWD 2HVZA 2I8EA 4LSNB 2IC3B 3BGLA 4O4GA 1LNQA 1G3OA 5IJQA 2NSCA 1KHKA 1TL3A 2A6MA 3W2WA 3MMJA 1O5JA 2EC2A 4XPEA 5HMYA 4CLWA 4ED8A 3CD7A 3DOKB 4Q45A 2DXEA 4PPZA 5D6GA 4WZQA 5EGYA 3AQOA 5J2NA 1R8CA 1OY8A 2M8DB 2B8QA 1IJEB 2FHMA 1J5EF 4F25A 4JI1J 1YJNS 3MTKA 1RWVB 3GG0A 4F8RA 2QLWA 4HHUA 2GIFA 1UW4A 2M52A 2ZVIA 4NA1A 1CQMA 2NPFA 3D9BA 3BSOA 1DQ8A 3UE2A 1M5HA 4K8RA 4AD6A 2YNHA 4E98A 4GRSA 3QRPA 1KHNA 2MLXA 4DR4F 3G8QA 1RHMB 3TUPA 5DM6Q 1APSA 1U1LA 1HWUA 1CVJA 1PIEA 4M5DB 3PRBA 2RDJA 2W7PA 1WG4A 3NP5A 3PHTA 2C3OA 4OI6A 4K5RA 3VTIA 1RAIB 4QJVA 2UUBF 3TOQA 4OYBA 5AT1B 5GMKa 5FDLA 2EK1A 1JLQB 2B5JA 1HHTP 1HD0A 1EW9A 5CH7B 2J6UA 4ZPBA 3JTOA 2YWGA 2BKPA 2WVBA 4USUA 5KFTA 4NXMF 2RU9A 5IWAF 3VALA 3Q2TC 4OJGA 4LF8J 4DDFA 2OEMA 2ZFHA 1SKSA 2CPFA 4AYBD 2ASDA 4DV0F 3G6ES 2AJ4A 1OPIA 3LTOA 3A8JA 4RUAA 3VHQA 1U09A 5DDPC 3PHEA 3GMGA 4Y6IA 2OHDA 4FP9A 3KK2B 1FSUA 1RTIA 3IWNC 3BDGB 4DCJB 2ZJQQ 1SL1A 3C3LA 4OYZA 3MAAB 4WP8A 2EFVA 3JSYA 3QWUA 2RIJA 3KLEB 1YGYA 3DLJA 3BEGB 2Z2MA 3DM2A 1VLYA 2ZBPA 4EYHB 1W25A 1NKEA 1Y10A 3UN2A 4LF5J 1CJKB 4ZMMA 2XSJA 1P9QC 1Q7LB 1HNWJ 2XMKA 3WBHA 1BQNA 1F3FA 4X65J 2Z2ZA 4RR5A 4NXNF 3R7SB 2FVQA 2YWFA 3TEHB 1GFWB 1XK8A 3Q8VA 1WKJA 4H4MB 1V5VA 1RT1A 3ZZYA 4UOPA 2JOQA 2B9EA 4CYUB 4B3TJ 1RJJA 4B56A 3MEDA 2EG2A 5M2RA 1A6LA 1HNXJ 3RUBL 1U1OA 1Y11A 1Y3JA 3IS9B 3OJUA 1KVIA 4X4TA 3TA2A 5F9NA 2DXFA 2KG0A 1M5VC 4I56A 1S1XB 4EO8A 4A8YA 1T9VA 3HKZD 2CPXA 3UVJA 5B08A 2HQ3A 3OFEA 3G6XA 3W5ZA 1NO8A 2XYPB 3KXDA 1OS5A 3CDBA 4CO0A 1DRZA 3V6KA 4DFPA 2VU5A 2GFFA 2DNPA 3OPKA 4JI1F 1DFDA 4F0KA 2MKIA 3RAXA 4C7QA 3EDRB 2M7SA 5IS2A 1S99A 3U1LA 3D6TB 1Q78A 1JJ2R 2Q6CA 5HJXA 1UEKA 4IFYA 3OR1B 4FYYB 2OPPA 2XC9A 5IZHA 3AB2B 1MROA 2XGQA 2ZE2A 4DU7A 1RDRA 4R8UB 4K59A 3L7OA 3DRRB 1SPBP 1LW2A 1QAJA 2MJUA 1SIZA 1T02A 4I4BA 4ZVQB 2ALYB 2R7XA 2FB0A 3CJ0A 1NHVA 1RAEB 1RCXB 3AAWB 3NWRA 1CJTB 3GZ7A 4MYTA 1DHMA 4YR1A 3TZYA 3ZZ0A 4I69A 1HNIA 3PYEA 5GAGU 4DQQA 2MHNA 5A2QU 1R8AA 3CJSA 3QGIA 4NLYA 1SHNA 1X4FA 5EGEA 2D3UA 2MB0B 1HIYA 2CWXA 2GLQA 2LVWA 3G8SA 2FY8A 3GG1A 4H4OA 1XMQJ 5L1IA 4WPAA 3N9UC 9RUBA 5B0EA 5JMNA 1TV6A 2AZ1A 2NYHA 4LF8F 2CWKA 1EP4B 4HDGA 2F63A 3CGIA 4HKQA 2RB7A 1I3OB 3MGJA 3OXGA 1S9EB 1D3WA 2XYHB 4K0KJ 2RHQB 5DDOC 3MD3A 4ZG9A 5I4MA 1AJAA 3D0IE 1XEZA 4USHA 5GRRA 4X66J 2ACYA 1S1TA 1YDLA 1RBOB 5F9LA 2D7SA 4DMZA 1A7GE 3PO5A 4YY3J 1FA0A 3WZ0A 4OHXA 4O3PA 4M5NA 2J7KA 1ICEB 2Q66A 4ID5B 4NWBA 4DR6J 2XMAA 4EMDA 3OXFA 1F5AA 2K7JA 4ES1A 3K8WA 2Z57B 2HNZB 1M0SA 4LF5F 4HR2A 3FMBA 1HNWF 3DYAA 1DLOB 2VFVA 2MEWA 4XIUA 3M05A 4X65F 3PDNA 1X4GA 1ZTTA 1J5OA 2WAQD 1OY6A 1YWXA 3PIOQ 4C8ZA 5C25B 4ZLJA 2B7BB 4CLYA 5KT6A 4B3TF 1NJYA 3MPWA 1WF1A 1H7XA 2BYCA 2V67A 1HNXF 3RAMA 4RJVA 4B9VA 3AY0A 5E3AA 2GIRA 1KRPA 4WWSA 1NH7A 5DLVA 2B51A 1LQ9A 3HHLB 1Y00A 3GQCA 4DX7A 5A6WA 1LFWA 3UN5A 5L1LA 3D1HA 1PCAA 3KDOA 1TU0B 2ZVSA 2YNFB 4MKAA 4Y3CA 2I5JA 1C1CB 1NLKL 2MZTA 4DL3A 4YP3A 2FHOB 4O3RA 1C1BB 2DGWA 3J7YU 2QMUB 2LEAA 1HNVA 3RRHA 1IR0A 3W2VA 1KHWA 3MCOA 2JL9A 1VQKS 5FLXU 2IMOA 1S6PB 1IBKF 1EETB 1TKZB 2HQGA 4AT1B 2UZAA 2RAQA 4FYWB 1CG2A 1S1WB 3WX8A 1S77D 2HWIA 3M30A 4DR5J 4EZ6A 4YDXA 1EKSA 2A1BA 3IRXA 3EUNA 3KLVA 1M5OC 4ENOA 1JNZB 3Q8PB 4M5KA 1RXOB 3H25A 3AQPA 2ZBQA 4FVCA 4A4JA 5D0HA 2C2NA 2QA4G 4USTA 2CPHA 2DPJA 2PMWA 4CWBA 1SUQB 3MM5A 4B9SA 2XMUA 4IFVA 2F8HA 2N4CA 5B0FA 3D3BJ 1VHFA 3CWJA 4LJMA 3GJQB 1D9AA 1XMQF 4F67A 3M2VA 5K4PA 1VI7A 4NMXA 5MAOA 4ECXA 3KLGB 4WBFA 3GR1A 2RE1A 2D3OR 2NXNA 3DLLQ 1WDTA 3T01A 1JWWA 1R8BA 1PYSB 2OPQA 3PW7A 3BPDA 4K0KF 3FMWA 2CZ4A 2QE5A 4EUVA 2R7TA 2HKEA 4DLGA 1N56A 2OIHA 5HK4A 3IBWA 2DYAA 2BV3A 3UDEA 3AB4B 4X66F 1JB0C 4CLSA 4HL9A 2AX0A 4MAKA 1FESA 4ZGAA 4YY3F 2BR0A 1W2BR 1SB6A 2MDAA 2HFOA 3AD9C 4DR6F 3IDDA 3D54A 5J1EB 5KFIA 3IMQJ 2X3DA 3CJ2A 2NS1B 4OI3A 1MWZA 4J9VA 1RT4A 2B9WA 2KJWA 1E33P 2AGOA 2HURA 3ZNJ1 4OLPA 1RT7A 4EBDA 2F65A 1RT3B 3PTWA 1FO1A 4FVMA 2DY9A 4K7QA 2G1HA 4GKKF 1B8JA 4F4ZA 5EGHA 2E1AA 3U27A 4C3MA 3IG1B 3AJDA 1UFWA 5IC6B 1Y0HA 1QTNB 3POTA 3VR1A 5J2MB 3G6VA 5HP1A 3F44A 2YY3A 5F3ZA 3BS9A 1VQ6S 2OPRB 5C24B 1E6YA 2R8HA 4DFMA 3M8QA 4I67A 4ED7A 3VVTA 5KFBA 1IKVA 2K8GA 4PG8A 4YOEA 1KR4A 3NBPB 3G82A 2VG5B 1UJ6A 1J27A 4J9QA 2M88A 4GKJJ 2DNRA 3QT5A 1TZ0A 2HGLA 3IAS9 2OFGX 2DGVA 4FPRA 1JIHA 2MGZA 1ZA1B 3GU0A 1JLFB 3ILJA 3HVAA 2DT9A 2OO4A 2A3JA 4DR5F 3VAIA 2VKZG 3QPIA 3V4IB 3K8VA 4O44A 2AGPA 4FYDA 5ETRA 4OZLA 4K4SA 1U0SA 2H4WB 2Y0SD 2HPUA 1P6TA 2DNOA 2OMLA 5KFRA 2WW8A 3OFHA 2XHCA 4KT0C 4YUDA 5H9EK 4CH0S 4Q5VA 4HH0A 3TAMA 1BLUA 2DHXA 3H5UA 2M9KA 3KLIA 1WSRA 1FCAA 2I1RA 2VBYA 3HP6A 1TKTA 2E66A 2WOMA 4JV1A 2GVDA 1NSKL 4OHYA 1HQAA 5C42A 5E2QA 2HEKA 2B3TB 5IJSA 2AW0A 4F2RA 2KH9A 1AW0A 4P7VA 3R1LA 3BSCA 2KM8C 3JYTA 1UL3A 3ZTSA 1U02A 4Z7CA 4EBCA 4G65A 2JFDA 2OH2A 1RYRA 2ZITA 2NPIA 1VC6A 2GHPA 4ETXA 1FKPA 2QT7A 4YR0A 4E0DA 2NXCA 4O3OA 4HI2A 4UQTA 2B43A 5F8HA 4ZLNA 3D5MA 4J5OA 2FC9A 4LIWA 1B7FA 1FX4A 4CH1A 1UKUA 3DMJA 3MMCA 2DRAA 2YKOA 1OPZA 1KH7A 3BGRA 3RB3A 4N8NA 3CW2C 1TUGB 4ZHRA 1RI7A 2EPIA 4ECWA 3FFIA 4B3OA 1HLWA 2CJYB 3W66A 3NG8A 3THPA 2R8IA 1HQUB 4BBYA 2AIRB 2W9CB 2MZJA 2E9ZA 4KTQA 2B9YA 3MF5A 2E44A 4RW6B 5E3PA 5A6PA 1RU2A 1TL4A 2P9GA 1UW9A 1CJUB 4ZLLA 5I42A 1JKHB 1OSDA 1ANJA 2HQCA 3QGPA 4KGVB 3H2LA 3Q23A 2MZQA 5DDQC 5F41A 3O5TB 1FE4A 1YKWA 5H9EJ 4CP5A 4UOOA 1R8PA 3EVMA 1RT2B 2A10A 1N2KA 4C11A 2E5LJ 2CADA 3IO1A 2K1RA 3D6HB 2LQ9A 1WG1A 5D3GA 2BJ3A 4K4ZA 4QWDA 5HJYA 4FXDA 2WTFA 4TN0A 1GMUA 2FJEB 1CJVB 2AYBA 4YQWA 1LWCA 2KT2A 3M32B 1H72C 1S9FA 4DSJA 4DF4A 1NDKA 4OJHA 5L9NA 3BBCA 3TZXA 2W5VA 1S97A 5INHA 1WI8A 2MZ1A 2YQ1A 5KFAA 3D0HE 3O1LA 4BLGA 3M6UA 3TAQA 3K7RA 3JQMA 1X4HA 2B4OA 5T41A 2YKNB 2KG1A 2VPXB 4Y2AA 3IR7B 1EARA 2OD4A 2NXEA 3Q8QB 4KFBA 1HQEB 9ATCB 4LF2A 2ZUGA 5HL7Q 2DIVA 1T8EA 4ELVA 4HLBA 1KFDA 2DY1A 2GMLA 5KFSA 3MMBA 5HVGA 2E7WA 4MJKA 4R0EA 3CCQS 1ZETA 1H3DA 2QSFA 4ED5A 3HKWA 4JI4J 4QBUA 3WX4A 3T9NA 2RMLA 2PMHA 4M5DA 4QIVA 3R2DJ 5LJ5Y 1G6BA 3HX9A 4URSA 2HFSA 2DHHA 1AFIA 3P96A 1O0PA 3RJMB 1YK9A 1TR0A 1FFGB 1U0HB 5KFFA 4ECTA 3E2DA 2ZUAA 2R7VA 1U8SA 2VFRA 1V3SA 4ED1A 2UVWA 4ELUA 1DJ0A 4USMA 2HVDA 3W64A 3TVYA 4ILRA 1RA7A 4J7CA 3PO4A 5HBMB 5L0EA 4IG0B 3LOUA 5CAAA 4DQPA 2FVPA 2W5QA 2ZC4A 1TP7A 3IM9A 1L3UA 2HRTA 3E01B 1YBAA 3KK2A 5DG7A 3FBBA 1C0TB 3DRSB 2OGUA 2RJZA 1FHTA 3MAAA 1S12A 2Y0BB 2BJ8A 3ADAC 2IVMA 4F4XA 2GHWA 2HWHA 2JEFA 4KKOB 1REVB 4ZPTR 4I0WA 3NCRA 2V9WA 2RSQA 4EEYA 2COLA 2VG7B 2MLYA 2FHKA 2IRYA 4U7UD 3CDEA 1S4FA 2FGOA 4H4MA 1EKRA 2O01C 3MUTP 3AHPA 3MZIA 3JQJA 1MLAA 3RR8A 4K5SA 2ATLA 3OHAA 1RQ0A 1X7VA 4GO7X 2N82B 2VBZA 2QJ3A 2KVQE 1LWFA 2LMIA 3QRQA 2B4VA 5C2GA 3V6HA 2ASJA 5EN1A 4ES3A 1U1KA 2DNZA 3NOCA 1ZZFA 4PYAA 1T3OA 1W2IA 4LBPA 2AJQA 3OV7A 1RBLA 3D1OA 2GJ2A 3KWMA 5M2PA 2NLWA 2GW8A 1HW8A 2WONA 5GMDA 4HACB 4E2FB 3VGVA 2VB6A 1DTQA 2CJAA 5AJ9A 4WFYA 5LJ3Y 2AHOB 2J9DE 5HI7A 1SV5A 4PXEA 5D0GA 2W01A 3KK3B 1HARA 4FYVB 2RS8A 3CMQA 1NK8A 4ZPWR 1S0VA 3RRGA 1JXVA 4FN5A 2CAJA 1XQIA 4OX8A 2KI2A 4TNOA 3QRRA 1JJ4A 4QZVB 4JI4F 4LVOP 2BQ3A 4ZN3A 2VKRA 3I31A 1R0BG 3V4MA 1CJTA 3KLHB 3L7UA 1F5BA 1RTJB 4Q8EA 3M8WA 3NRBA 4NL5A 3H0PA 2JX2A 3B82A 1M1HA 4A8WA 1HBMB 4MKYA 2ZZMA 2W2PP 3LPYA 4NA2A 4ZJOA 5DRKA 2HHPA 3HFZB 1VBKA 1NMEB 3BYRA 3NKQA 4FXWA 4IRCA 4D3HA 4PPDA 2R7RA 3UR0A 2OPSB 2XY5A 5I3UA 2AEFA 4I1TA 5G0RB 2E1RA 2GVZB 4RU9A 4P6QA 3P49B 3KK1A 1H73A 2KFYA 4LF6J 1LWEB 2R42A 1Q81T 2QTWA 1S1UB 2BJDA 2FJBB 4Q8FA 3F73A 3VQSA 3W3SA 4Y2IA 5KG5A 1WTFA 4L74A 3ENQA 2P9CA 3OTEA 3CJ4A 4WZMA 4CLZA 4X4UA 4CT8A 1F0XA 2FJXA 3CB4A 1TL1B 5HAOA 5KFPA 4DSFA 3PX0A 1NAQA 1UJ4A 2QLBB 2EG1A 3MK2A 2NYIA 4BS2A 1Q8IA 4CO3A 2G1DA 3UNYA 4JV2A 1U48A 3OSPA 2B9XA 1GT8A 1RISA 3PNIA 4PWDB 1IBCB 1Q8BA 2NCKL 2E9RX 4F4WA 4I6YA 5K9FA 2XQCA 3RAQA 4QCLA 4UY8T 2R7QA 2GSOA 3NAHA 1VCTA 2H4YB 2HQDA 3W5YA 8RUCA 2OSQA 2BRLA 2Q43A 1S1VB 4WE1B 5GMEA 1QAIA 1NPPA 4NZ0A 2FIUA 2LFVA 3UDLA 3FNNA 1JLGB 8ATCB 2V2VA 5KG6A 5KFEA 3PEHA 5KFZA 4LSZB 5CCMA 2GQ2A 4TYBA 3GPAA 2C28A 4UZBA 1XWLA 1WWHA 3PR5B 3U7JA 2HG4A 4QAXA 2RU3A 3LUYA 2HVEA 4WXOA 3RGIA 4NX9A 2K7KA 1EETA 1YITS 2PC6A 2DGUA 1T9UA 2HGMA 2FZCB 5KFCA 5CD4H 1MG7A 4XTTA 2DEIA 3FZ2A 1G4CA 3CDAA 1RTDB 2UU9J 1SC3B 4X62J 3OBIA 4P9SA 1FRXA 2C3PA 4DV2J 3GIIA 4X4VA 3BR8A 1ZS6A 5TJ3A 3CD0A 2W4DA 1ZAWA 1FRLA 4DUYF 3ETOA 1NK9A 1B0PA 1X9MA 3C6UB 1YBTA 2GC8A 3MURP 3T5HA 5K5MA 4PQAA 3K5PA 4NI2B 2UXCJ 5KFQA 2UP1A 1RKJA 1U7LA 4LRFA 1D8YA 1RU1A 2XMVA 5LMNJ 3AJ1A 4KGMA 2F8MA 4CH7A 5AXKA 2DTJA 1CC8A 7FDRA 1RWWB 4ETZA 4KY3A 1R0CB 3OR2B 5KFWA 4DR2J 2KRRA 4G6VB 4RWXA 1AT1B 1NEEA 1SBRA 2CQDA 2V4JB 4DSIA 4DV3J 4XK8C 1D1UA 1VBZA 4UPIA 3HDSA 2QGFB 2ADCA 3CCTA 3OUYB 4X4PA 3NKMA 3C14A 3KFWX 4AL6A 3BYPA 4RNNA 2ZH2A 1F9HA 5DLGA 4KGXB 1RHQB 1RT5A 1S48A 2ZH8A 5RUBA 2BA9A 4ZVHA 1TFYA 3UNGC 4LIRA 4O4GB 5ETTA 2YKQA 1IKWA 3OTDA 1TK0A 4LF6F 3VQTA 1TL3B 2W8KA 1A0OB 2B6AA 2GGPA 3CIMA 3CCJS 2BUNA 5BYRA 1RAGB 3EGNA 1JLEA 4A8XA 4P73A 8AT1B 2VOOA 4CI0B 3KG1A 5CD4A 1VDHA 2DNHA 4Z7YA 4KHMA 4OZ1A 2W1BA 5KFDA 2HHSA 4Q2LA 1RB0A 1T3NA 4I7FA 3MR3A 2DD8S 4X4QA 1WSVA 1U47A 2E1PA 4TQSA 1DBDA 4EI2A 1TUWA 3N79A 2MKJA 4OZJA 5E7OB 3BB5A 2H5EA 2YNHB 3K2YA 4C2MA 5C5JA 2OMOA 4Y2MA 1FDAA 4QYZK 1NM2A 1YJRA 1AJCA 5ETKA 1HQ2A 1NSQA 2QMXA 2WK4A 3PR4A 2JH3A 3EE3A 4C4WA 3KJVB 4ED3A 3IG1A 4Y2KA 3OLAA 4X4OA 5LT5A 2EFOA 3FBFA 1X9WA 4RKUC 1JX4A 4OX9J 4NLXA 2OPRA 3IN5A 4QR2A 2P6SA 2DR9A 3R5JB 1Q7YT 5DLFA 3A4TA 4HEA9 4LRBA 5FDLB 4J9RA 1HNZJ 3DYCA 1FEHA 3W9IA 2B5JB 2VIHA 3FQLA 3HHDA 2D1CA 3SDEB 1H6KX 1VQMS 4C97A 1K0VA 1WDDA 1HI0P 3WIVA 1XR5A 1CBKA 1Z2ZA 2OTJS 1ELYA 1JLFA 3DU5A 2CJBA 3PACA 1X5OA 1WEXA 5GADU 4E8UA 3GYXB 2UU9F 5DG8A 4X62F 2HQIA 2MQPA 2JEIA 4DV2F 2VJVA 1FERA 3QAUA 5LSRA 2QLJB 1SKUB 2G9OA 1RTIB 4PEOA 2QC3A 4Q7AA 3UDVA 2UXCF 2JLGA 1NPKA 3MPDA 3L95X 4PXCA 2VG6A 1HMVB 2XLIA 5LMNF 3DM2B 3SCIE 2BBEA 2RH3A 4KRWA 2XG8A 3CC2S 2CQ0A 3DXBA 4CM2A 3PV8A 3D2WA 3RB4A 2XSJB 1SVDA 4OMFG 4DR2F 1BQNB 5BXIA 3KMQA 1AUKA 4I2PA 1D8ZA 1XNRJ 5IQQA 2HLUA 3FJ2A 4DV3F 1RGVA 4URQU 1RT1B 4BC9A 1HL6A 3TJAA 2IRUA 1NDLA 1Q8LA 2V69A 2CG4A 3ISZA 1HWLA 1QD1A 3KYLA 5ETOA 4HT5A 3PY8A 1RAFB 1D09B 3PXGa 1L3KA 3QT8A 4GC7A 1KD1T 3P6YC 3NS6A 3EXCX 4N56A 1Y4ZB 3I0SB 3H5YA 1FEEA 4IDKA 4YR3A 2VBWA 2W2MP 4ES2A 3NKPA 3B4DA 3VCDA 2BM1A 4A8SA 4GTWA 1PJ6A 1UTAA 1NK5A 1U2FA 1JJCB 4U7CA 4CLFA 2Y8YA 3NCPA 3A8IA 4IFYB 1L5UA 3I4PA 3H98A 1KN6A 1HQUA 2ZNYA 2OPPB 4M5GA 4O23A 1KQKA 1MROB 5CA5A 4RW6A 4AXIA 4IOAQ 1URRA 3BKTA 4LREA 3LP2A 4M63A 3C46A 2LEBA 2XO7A 2ZHAA 1FE0A 2HWTA 2BE7D 2FQQB 3Q8RB 1R6VA 4KE5A 1K73T 2LQ5A 2C2MB 2IVYA 2W5TA 3I5BA 4N77A 1WC6A 5IQ6A 1TUVA 3QLHA 4WK1A 1VLOA 4KO0A 2JEGA 4OX9F 1HNIB 4TVAB 2HBYB 4CLPA 4RW4A 2D69A 1HNZF 1XERA 1U6BA 2X1BA 2J7WA 2EXUA 4W92B 2I2YA 1SC1B 1TV6B 4JV0A 2FC8A 4C8NA 2W5RA 3AOBA 4ECQA 4IH6A 2FZGB 4P52A 1ITPA 1Z1ZA 1BWEA 3AT1B 1W26A 3ILLA 5CCLA 1RCOB 2IAJB 2M8HA 1IUJA 1S9GA 1IR2A 1FTCA 2VDHA 1NU4A 3Q3QA 1PG5B 5C2CA 2M0GB 4DZ6A 4RWWA 1VMBA 1S1TB 2KB2A 1YQHA 2YNIA 3N01A 1HR0J 5DDRC 5A2QY 4J91A 2MHEA 4RBTA 2DH7A 5A8WB 1FDDA 5HO4A 3I0RA 4RW9A 4W90B 3BGFA 3CPWR 4TU9A 3W1YC 1VIOA 1UA0A 2N7CA 3ZC4A 1XNRF 1WC5A 2CXEA 2M4MA 1ZAXA 1QSLA 3CIZA 3CULA 1MN9A 1WHVA 5KT7A 4OYWA 1H74A 3IXQA 1U1MA 4CO5A 5IT9U 1U0HA 2GO9A 2M3DA 5AJ3J 1N5QA 1VBXA 2CG8A 1FD2A 3A12A 2IBOA 3N5BA 1RWUA 3ZZUA 5EX3A 3OTBA 1VJQA 1HD1A 1FRHA 2I5JB 1PKUA 3K5NA 5JVHQ 1HI8A 4B3RJ 1SJ1A 4NLVA 4DL4A 1P1TA 5ETSA 3N0VA 4B9UA 3D7SB 1HNVB 3LP1A 5GAEI 3BKUA 4PWUA 3SXLA 4DS4A 4J9LA 3TI0A 4ANCA 3TUIC 3J81U 2F4VJ 1NDCA 3DRSA 4V19J 4DS5A 3H8YA 4C8MA 2CIMA 1L3VA 4DXLA 5T7LA 1Y5IB 4DL0C 3Q24A 3DLBA 2OP5A 3H4DA 3R5DA 3M30B 2SXLA 2CYYA 3FBEA 2YVSA 3T1AA 3W62A 2UV8A 3FGVA 3I87A 3IRXB 4TU8A 3D0GE 2LXUA 3J80U 1UPPA 1WACA 1P1LA 2G0JA 1RADB 3W5XA 1X31C 2VG7A 3PW5A 2J0WA 1P49A 4J90A 2VPYB 5DLTA 2VL1A 4OV6A 3N4WA 2O1PA 4DN9A 4NLSA 3MM5B 2W2NP 3ET6A 5LM7E 5FLXY 1SCJB 3V6DA 2XS2A 3MCMA 1S72S 4ZPAA 1VRTB 2N3OA 3V81A 2HK3A 2LA6A 2L08A 3M2VB 3J7ZT 2DHSA 2ACMA 3J7AN 2CNKB 2HYIB 1O51A 3AD7C 4P74A 4WTYA 1S79A 1RHRB 4OYMA 4ZP8A 5H9FK 3DRXA 2V2QA 2CVIA 4OX7A 4NZ6A 2DNMA 4YDDB 2HFVA 5IT4A 4R25A 4KJIA 4ZA1A 1NRKA 2PGCA 3RBZA 2FLOA 1HR0F 2BJ9A 2DK2A 2KL8A 3HK2A 3I55S 3KK3A 2HNYB 2V8DA 4NCGA 4UOCA 3ENVA 1WOOA 1F1BB 1UVMA 3NGRA 3CJKB 1FWKA 2H1YA 2GQCA 3DNCA 1R0AA 4ZVOB 4DEZA 4QU6A 3R2CJ 3NWGA 4AL5A 1N4LA 1RT7B 2W4CA 3H20A 2YWEA 3PEJA 2KJVA 2IRXA 4ALZA 2Y8WA 3W9HA 4LF7F 3MOJB 1VQ8S 3UD3P 4F4YA 2GQQA 2L48A 1WC1A 1N54B 2HBZB 2M2BA 2QA4S 2E29A 3GSDA 1M90T 2FYXA 1N6QA 2NZ4A 5ETPA 3POTB 5HP1B 3NXZA 3NY0A 1KVKA 3QNWB 3GONA 4B3RF 3D4JA 3A1YG 1E6YB 2OJ3A 3M8QB 4UOHA 3G86A 5G0RA 5AXLA 1GTEA 4H4KC 4M5MA 1LEOA 3WIUA 4WJBA 3ZFVA 2O66A 2F4VF 2XY6A 5H9FJ 2V2ZA 1VYAA 1WORA 1UWAA 3CJ8A 4RW7B 2MGZB 1ROFA 3I9ZA 1FXDA 3HFVA 3DLKA 3EPIA 4MY4A 3MR5A 3QIDA 4F36A 1ANIA 2IDLA 2HMIA 1IVZA 2BJ1A 4O44B 4NYOA 2AF6A 1U25A 2BJEA 1JXLA 2J9EA 3BV8A 2HHUA 4TY8A 2R7UA 1S6UA 2MQOA 1IKYA 1EIYB 4C48A 1EB0A 5DS7A 3G8TA 1RWOB 1KFSA 3KLIB 1TK5A 1FRKA 2RUGA 3K57A 3PW4A 5IFMA 1HHSA 3MM6A 5L39A 3T41A 2VQFJ 5C42B 5DGBA 2RUSA 2RNEA 2KFNA 1FWLA 1E1ZP 4U7UK 4LUBA 4RNMA 3M6XA 3MM7A 5F0WA 1RYSA 2RKIB 1GXTA 2AT1B 2DGOA 3JYTB 2EFQA 4KHPJ 1HWKA 3ZTOA 1EX8A 2NQPA 2X1FA 3R5GA 4N41A 1FKPB 4DQIA 4NA3A 3HMJG 2F4FA 1VQ7S 4YB1P 4ZK7M 3UN3A 4ED6A 4WFBQ 4PKDB 3RBEA 2X1AA 5KTQA 2BOAA 3JSMA 1VQ9S 3DMJB 1F3VA 3MMCB 2YTCA 4HT7A 4IO1A 5K8PA 4CNYA 1Z4UA 3GIMA 2IYIA 3BGRB 2MJNA 1N32J 4ZHRB 4ED2A 3MPUB 4FKXA 1FT8A 4F04B 1U6FA 3VAGA 4UQGA 5LRMA 3LQVA 3FFIB 4B3OB 4ZJQA 2HNDB 2HQFA 1EQMA 2W8LA 3FQKA 3T6JA 4KC5A 2C42A 1UEVA 4YFUA 4NWXA 5I42B 1XJWB 3BQ0A 2RD5C 5JUMA 2QFJA 3CCZA 3V6JA 2IA0A 1DY3A 1WKLA 2LA4A 1WG5A 3L4BC 1F2HA 5CABA 4DPTA 1F2GA 3Q0AA 2H51B 1UP1A 3OD2A 4DV4J 1N52B 2J0QD 4F7VA 1S6OA 1X60A 4ILLA 2OI2A 4DR7J 2V50A 2V4JA 4C11B 2AYMA 3D6MB 3BGOP 1S6QA 2RQMA 4H4KA 3IR6B 5IV3A 4PUOA 2GAHC 3OUYA 4ZPVR 1KHVA 3MM8A 4CXKA 3TR5A 2UXDJ 1XMOF 3M9NB 3P4UB 1N5YB 3TRGA 3QO9A 1EZZB 2FHJA 1RT6B 1LWCB 2GV1A 2VDIA 6FD1A 3OL6A 4J9NA 1GXLA 2EWHA 5F8JA 2GNKA 4ECYA 4DWIA 2K06A 1DQ9A 2W9AA 4B3SJ 2AMCB 2E1MC 1T94A 1ED9A 4G1PA 2R4FA 5EWEA 1TTHB 1HA1A 4PG6A 2WZ1A 4OHVA 4WFNQ 1S0MA 5E3QA 4K4UA 4ZVPB 3G96A 1NZ8A 3O6QA 5JVGQ 4FF2A 4KFBB 4UPKA 3W63A 2CQ3A 1E2SP 3OJSA 4KH1B 3CCLS 4A8OA 1UMJA 1YLXA 2R7SA 4QR0A 3MMBB 4BDPA 5KT4A 1AA1B 2VQFF 3RB6A 3T1YJ 4KPYA 2LQBA 1OQ3A 3GB0A 3OT9A 2KM8B 5B7WA 3KJVA 3N6LA 3OHBA 1N34J 5HANA 1UVNA 2YNGB 2BDPA 1X4CA 4ECVA 1GTHA 4HHHA 3E3XA 3LALA 1VR6A 4KHPF 4DPUA 3RZAA 4IQXA 7FD1A 1KWMA 3KJFB 2CZ9A 1WEZA 2DHAA 4QYRA 3QIPA 4NOHA 2MQ8A 3SDEA 1R3NA 2QA2A 2XI3A 2KZZA 5AXMA 5KOWA 1BY9A 1AUDA 3GFYA 2B56A 3L3CA 2H48B 2PT0A 1N32F 4KQZA 1PBUA 2HLTA 3CE8A 2UUWA 4DUZJ 1Q1KA 5HLFA 5KFOA 3CMAS 2P2CB 1U6ZA 3QJPA 5KFKA 1A9NB 4ZVFA 1Y5NB 4YN3B 5EWGA 2LECA 5CYQA 3M6WA 2F8EX 1QM9A 4LR8A 1YI2S 3T02A 4L6V3 4F26A 2IYGA 3VZIA 2MY7A 1HMVA 1CLFA 2PIIA 3PYGA 1MU2A 2V0NA 2C2ZB 4JI6J 2UUAJ 4ZCKA 5KG3A 4NZ7A 3LO3A 4DV4F 2ANHA 5GAGI 3FRYA 4ZCIA 2E7VA 4DR7F 5DQIA 2P9EA 1T11A 2P5VA 1YRUA 1JLBA 3JAMU 3JTPA 1DARA 3NS7B 2RILA 2UXDF 3H40A 3BN4A 3NVLA 4DG1A 1U1QA 5GAHU 3L9ZA 1XR6A 3BO2A 4DPWA 4P75A 4TLRA 1HBOA 2CKWA 2QL7B 2J6SA 1LWFB 3R5BA 2MKKA 1RWKB 5J2QA 4B3SF 1VC0A 3WBZA 4C3KA 3R5AA 3I0SA 1TL7B 1WHWA 3FSYA 5LOQA 3RYLA 4LR2A 3HHLD 2MYFA 4H54A 4OYIA 2WONB 5HATA 4LF4J 2GJIA 2ZH7A 1ED8A 1DTQB 2B8PA 2MKCA 3IWXA 2EK6A 3N6MA 2XLKA 4AL7A 4CCHA 1SV5B 4NASA 2MZSA 2M5YA 1ZBTA 2V8VA 4JI5J 4ZIVA 3K17A 4QR1A 1QSSA 1KNZA 4B02A 1IBMJ 2I0XA 1RHJB 2VUGA 3C15A 1VHIA 4RW8B 4YB7A 2ROGA 4EBEA 3ZZTA 4DPYA 3Q86A 2VFTA 2C3MA 4CYRA 2RQCA 5K14A 1B99A 2N4DA 1N34F 2J9DA 3ITHA 2YQ0A 1S5ZA 1UWBA 4I2QB 2IIHA 1GEHA 5L0KA 4DLEA 2W8SA 1TVRB 3IRWP 3A52A 2V63A 1VQ5S 1YJWS 2XMJA 3FSXA 5CZVA 4CO2A 3J7YI 1UPMB 4UUWA 2IJFA 3H42A 4KAYA 2L3MA 2ZEJA 4FDIA 3HCXA 2V8HA 3W65A 3BN7A 3TZWA 1KQSR 5I3UB 2FHJD 3GV5B 3CF5Q 1WC3A 2IAJA 3KK1B 4DUZF 4ED0A 5D4NA 4DCPB 4DSEA 3UCUP 4TXSA 1Y6VA 3TJ8A 5D0EA 1NJXA 2V94A 5J2PA 5HMXA 3T5KA 4QIFA 3G6YA 2CZVC 1H0HB 1HPZB 1NK0A 4LFBJ 4OYXA 3M8PA 2EI5A 4JI6F 5A8WA 4C98A 4IRKA 2DKOB 3UFCX 1BWVA 3R7BB 1W7WA 2DR6A 3P5TL 3MCSA 4ZVTB 2ASYA 1NJZA 2YX7A 2DVIA 3JTNA 1IWAA 4HYKA 3BR9A 4BWMA 1TQLA 3P8BB 5HMZA 4D3GA 5A0YB 2IMWP 1TMJA 1N5TA 4MK9A 4M5JA 2KFZA 4DOZA 1UFLA 2CPYA 1ZEDA 4NEYA 3AOAA 2RVJA 3GIKA 1U1NA 1C4CA 2B7CB 5FD1A 2ZM6J 3O8WA 3TZZA 1CC7A 2CQPA 2KYXA 2OELA 1RAAB 2XSFA 4RU2A 2XO6A 2VFSA 1FNMA 1U45A 4N76A 1JXEA 3MR7A 1WD6A 2J76E 3SSRA 1ZPVA 1K1SA 3R9LA 3HULA 4EYIB 2A18A 4N8OA 1DTTB 2XEXA 3HM9A 3RU0A 2BM0A 3KJQB 1K47A 4KYZA 3MR2A 3ISND 4JI5F 1Y7AA 2J8SA 2ILZA 1IBMF 1K8AT 4OFZA 4J9SA 4JI0J 4TLQA 2ZH6A 1RHUB 1NH8A 4PWWA 3CCRS 1OO0B 2UV8G 2C1EB 3E51A 3OTCA 2IUCB 3M8ZA 1VFJA 2GX8A 4PQUA 5F8IA
chains in the Genus database with same CATH topology
5EGEA 4MIVA 3WAYA 5IJSA 3OT9A 2GSNA 3UNYA 1ED8A 2IUCA 2RH6A 5LRNA 3M8WA 2GLQA 1KH9A 1E3CP 4ZGAA 2W5QA 1FSUA 5DLWA 4UPLA 1AUKA 3BDGB 3Q3QA 4LREA 1SHQA 3BDHA 1KHNA 3IGZB 2D1GA 1AJDA 4UOOA 4LRAA 3IDDA 4KM4A 5HRTA 4LRBA 2ANHA 3ED4A 4NWJA 1ALIA 2XR9A 3DYCA 5TJ3A 5DLVA 2GA3A 2W5XA 1N2KA 3BDFA 3MK1A 2W5SA 1ZEBA 1Y6VA 1ELZA 1N2LA 2W5TA 2XRGA 1HJKA 5LRMA 3UO0A 3NKQA 5GOVA 5LIAA 1EQJA 2GSOA 3NKNA 3UN5A 1ED9A 1E33P 4CXSA 5IJQA 3UN2A 1O98A 4LRFA 4LR7A 1EW2A 1KHKA 4KAVA 3CMRA 1KHJA 2IFYA 4LRDA 1ELYA 1KH5A 1O99A 5AJ9A 5L0BA 4TN0A 3B5QA 4LQYA 3WBHA 3NVLA 4KJGA 4CYRA 1EI6A 3TX0A 1KH4A 4ZG9A 1AJBA 3BDGA 3DPCA 1AJAA 1EW8A 5KXAA 4NWXA 2QZUA 5K4PA 5GRRA 1ALHA 1E1ZP 3NKRA 3KD8A 2W8DA 1KH7A 2G9YA 4KJDA 4LRCA 3T00A 1ELXA 4UPKA 1KHLA 1Y7AA 4UOPA 4MHXA 5C66A 3WAVA 5L0KA 1EW9A 3IGYB 3M8YA 4B56A 3TG0A 1EJJA 2W8SA 3SZZA 4GTXA 2X98A 4GTZA 1B8JA 1E2SP 3E2DA 5EGHA 2W5WA 3A52A 2W5VA 4UPHA 3MK0A 3M7VA 5INHA 4ZG7A 4UORA 1ZEFA 4CXUA 4CXKA 1AJCA 3T01A 3TWZA 3NKPA 3WAXA 4UPIA 2ZKTA 4LR9A 2GSUA 3LXQA 4GTWA 2W5RA 3WAWA 3NKMA 4QAXA 2VQRA 1HDHA 5LQQA 1P49A 3SZYA 3NKOA 4N7TA 4YR1A 4FDJA 2IUCB 4LR2A 1HQAA 5DLTA 3M8ZA 4KAYA 4CYSA 4ZG6A 4FDIA 4MY4A 1ZEDA 4LR8A 4GTYA 5L0EA 1ALJA 3T02A 3UN3A 1K7HA 1URAA 3MK2A 1ANJA 1SHNA 1URBA 1ALKA 1ANIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EGE A;  4MIV A;  3WAY A;  5IJS A;  3OT9 A;  2GSN A;  3UNY A;  1ED8 A;  2IUC A;  2RH6 A;  5LRN A;  3M8W A;  2GLQ A;  1KH9 A;  1E3C P;  4ZGA A;  2W5Q A;  1FSU A;  5DLW A;  4UPL A;  1AUK A;  3BDG B;  3Q3Q A;  4LRE A;  1SHQ A;  3BDH A;  1KHN A;  3IGZ B;  2D1G A;  1AJD A;  4UOO A;  4LRA A;  3IDD A;  4KM4 A;  5HRT A;  4LRB A;  2ANH A;  3ED4 A;  4NWJ A;  1ALI A;  2XR9 A;  3DYC A;  5TJ3 A;  5DLV A;  2GA3 A;  2W5X A;  1N2K A;  3BDF A;  3MK1 A;  2W5S A;  1ZEB A;  1Y6V A;  1ELZ A;  1N2L A;  2W5T A;  2XRG A;  1HJK A;  5LRM A;  3UO0 A;  3NKQ A;  5GOV A;  5LIA A;  1EQJ A;  2GSO A;  3NKN A;  3UN5 A;  1ED9 A;  1E33 P;  4CXS A;  5IJQ A;  3UN2 A;  1O98 A;  4LRF A;  4LR7 A;  1EW2 A;  1KHK A;  4KAV A;  3CMR A;  1KHJ A;  2IFY A;  4LRD A;  1ELY A;  1KH5 A;  1O99 A;  5AJ9 A;  5L0B A;  4TN0 A;  3B5Q A;  4LQY A;  3WBH A;  3NVL A;  4KJG A;  4CYR A;  1EI6 A;  3TX0 A;  1KH4 A;  4ZG9 A;  1AJB A;  3BDG A;  3DPC A;  1AJA A;  1EW8 A;  5KXA A;  4NWX A;  2QZU A;  5K4P A;  5GRR A;  1ALH A;  1E1Z P;  3NKR A;  3KD8 A;  2W8D A;  1KH7 A;  2G9Y A;  4KJD A;  4LRC A;  3T00 A;  1ELX A;  4UPK A;  1KHL A;  1Y7A A;  4UOP A;  4MHX A;  5C66 A;  3WAV A;  5L0K A;  1EW9 A;  3IGY B;  3M8Y A;  4B56 A;  3TG0 A;  1EJJ A;  2W8S A;  3SZZ A;  4GTX A;  2X98 A;  4GTZ A;  1B8J A;  1E2S P;  3E2D A;  5EGH A;  2W5W A;  3A52 A;  2W5V A;  4UPH A;  3MK0 A;  3M7V A;  5INH A;  4ZG7 A;  4UOR A;  1ZEF A;  4CXU A;  4CXK A;  1AJC A;  3T01 A;  3TWZ A;  3NKP A;  3WAX A;  4UPI A;  2ZKT A;  4LR9 A;  2GSU A;  3LXQ A;  4GTW A;  2W5R A;  3WAW A;  3NKM A;  4QAX A;  2VQR A;  1HDH A;  5LQQ A;  1P49 A;  3SZY A;  3NKO A;  4N7T A;  4YR1 A;  4FDJ A;  2IUC B;  4LR2 A;  1HQA A;  5DLT A;  3M8Z A;  4KAY A;  4CYS A;  4ZG6 A;  4FDI A;  4MY4 A;  1ZED A;  4LR8 A;  4GTY A;  5L0E A;  1ALJ A;  3T02 A;  3UN3 A;  1K7H A;  1URA A;  3MK2 A;  1ANJ A;  1SHN A;  1URB A;  1ALK A;  1ANI A; 
#chains in the Genus database with same CATH topology
 5B0B A;  3U02 A;  1PSD A;  4FF1 A;  1N0U A;  3DLG A;  3EZU A;  2CUY A;  3TUJ C;  3PW2 A;  5F3T A;  3KTQ A;  1U1P A;  4PRF A;  1VRT A;  1KOO A;  1HYS A;  2YXL A;  5BYQ A;  3RBD A;  2ZH3 A;  3FEY B;  1R27 B;  4I6A A;  4WU2 A;  2DB1 A;  5KT3 A;  3T5L A;  3C14 B;  1AYE A;  2K3I A;  3NGU A;  4OIX A;  4ICL A;  4ECS A;  1RT5 B;  4OI4 A;  3OFG A;  4DHV A;  2YX4 A;  1AJB A;  2K2P A;  5KXA A;  3C16 A;  1IKW B;  3CVK A;  1MW7 A;  2B6A B;  3FCV A;  1ZAV A;  2GGP B;  2KT5 A;  4M5L A;  3PJ9 A;  4G1I A;  1F6T A;  3OSN A;  1XMB A;  2MQQ A;  1JLE B;  2FZK B;  4DR1 J;  1IQT A;  1AXQ A;  3DDI A;  4LFB F;  2HHX A;  2HNY A;  4LSL A;  1I6J A;  4IG3 B;  2PA3 A;  1ALJ A;  2DNK A;  1F5C A;  3CJK A;  3PJW A;  2PO4 A;  4I7F B;  3IP0 A;  4CTA B;  3CCS S;  2CDR B;  1VK8 A;  3BDH A;  3KNG A;  2IM3 A;  4NCB A;  1NSP A;  3HHN B;  3DGV A;  1Q79 A;  2FD2 A;  2KZM A;  5HQL A;  2HIY A;  2E5H A;  1SL2 A;  5D8H B;  3TP2 A;  4HHJ A;  4N47 A;  4YS2 A;  4CLT A;  1IKX A;  4RNF A;  1FKA F;  5DM7 Q;  4CZC A;  2VF3 A;  3LP0 A;  4WIQ A;  3NGD A;  1KP6 A;  4WF9 Q;  4PCQ A;  1JNR B;  2ZM6 F;  2OD6 A;  3JSB A;  2VAS A;  4KJD A;  1EHW A;  1T05 A;  1G2E A;  1RAH B;  4WYW A;  1R8H A;  1O8B A;  4IUF A;  4GTZ A;  4NLU A;  3TJ9 A;  3NAI A;  3BDE A;  1SQG A;  4FF4 A;  2A2C A;  4K4X A;  1NK4 A;  3QYY A;  2IJN A;  2QV6 A;  2MKS A;  1YJT A;  1BUX A;  5DGA A;  3R6G B;  2JEJ A;  2DO0 A;  2L9D A;  1LK5 A;  4NLW A;  3QAE A;  4RW7 A;  5KFV A;  2R7W A;  1S7I A;  2YKP A;  3MPV A;  1UJ5 A;  1U2R A;  4JI0 F;  5GVQ A;  3VV2 B;  4O3S A;  3JQK A;  1H2V Z;  2HIQ A;  3NNH A;  1EQJ A;  2CJQ A;  3DRY A;  3B54 A;  3FKB A;  2BW7 A;  3PFO A;  1IWG A;  2ZDO A;  3MFI A;  2VG6 B;  1AUS L;  1SI9 A;  3F41 A;  2HHQ A;  3NKY A;  2AV5 A;  1X4A A;  1NJI T;  1RTZ A;  1VGY A;  3TQ1 A;  1OY9 A;  2DJW A;  3HD1 A;  4FXV A;  2F9J A;  4NCA A;  1KHL A;  2B0G A;  5ETN A;  2MMY A;  3AOC A;  5L1K A;  4I2P B;  1NUE A;  4A8Q A;  2UUT A;  2EEY A;  4DU8 A;  1D0E A;  2APO A;  4JYA J;  2ZH9 A;  1QY7 A;  2RKI A;  4RLE A;  4IQM A;  4AE5 A;  5LSL A;  4ZG6 A;  1NXI A;  1R43 A;  3EGV A;  3HZG A;  2Y1J A;  1YSJ A;  2XMW A;  5CYM B;  3QFH A;  4DR4 J;  3CD5 A;  3JXO A;  4F02 A;  4QIE A;  3LAN A;  1UVL A;  2Y3Y A;  2G0C A;  3MTJ A;  4F3Q A;  2WSE C;  3M8S A;  4DV5 J;  2KN4 A;  1FI4 A;  3FZB A;  1SIW B;  5E3C A;  2AYE A;  3CCU S;  4J9K A;  4DR1 F;  2R3V A;  4IDK B;  5KFJ A;  2RRB A;  5HQ8 A;  5AE2 A;  4UT4 A;  1GX6 A;  1N48 A;  3B5Q A;  3DRP A;  2HND A;  1SJ3 P;  3SCL E;  3TAP A;  3M6V A;  1NSA A;  3CUN A;  4UY8 5;  2VOP A;  2EBE A;  1RLC L;  4F3O A;  2JSX A;  4LRC A;  2XYG B;  5C66 A;  4BHQ A;  4JUZ A;  1XR7 A;  2Z56 B;  3WC2 A;  3EJM A;  2G0I A;  3UW1 A;  4DN0 A;  3LP2 B;  4WII A;  5B0C A;  3WAX A;  3GJR B;  2LQ8 A;  2CPD A;  1S57 A;  3KNA A;  4J9O A;  5KFN A;  1UET A;  3HF5 A;  3QLH B;  2HK2 A;  4CLK A;  2D9O A;  3LAM A;  4KO0 B;  1VK3 A;  3TQE A;  3LGH A;  2W4P A;  4Y00 A;  2OUG A;  4PR6 A;  4DR3 J;  4DI6 A;  1UZH A;  1QTM A;  4ZP9 A;  2ROE A;  1I5O B;  2NSB A;  2D1G A;  5KFG A;  4RW4 B;  2WBR A;  1N5Y A;  1OIA A;  1GAO A;  1RT6 A;  5K20 B;  1VRU A;  3K58 A;  1K44 A;  4U67 Q;  1HJK A;  3LF0 A;  2R8G A;  4DV7 J;  4GKJ F;  3FRZ A;  3CED A;  3LH2 S;  3SSS A;  3NGT A;  2BZ2 A;  3MD1 A;  3EPG A;  3M9O B;  5A76 A;  5E3R A;  1YJ9 S;  2XWX A;  2KXN B;  4DQR A;  2QMW A;  1S9G B;  1GK8 A;  4MHX A;  1RA6 A;  4OZ2 A;  3NL0 A;  3MK0 A;  4CT9 A;  2DIT A;  2YNI B;  2R2S A;  3HSZ A;  3GIJ A;  4MK7 A;  3SYZ A;  4QW8 A;  1K1Q A;  2CNO B;  3I0R B;  3MM9 B;  4RW9 B;  2DR7 A;  1QVG R;  2E5J A;  4Q43 A;  3UDC A;  2QO3 A;  3DLH A;  1NPR A;  3X3U A;  1LV5 A;  3A3N B;  5CXT A;  4L73 A;  2JC0 A;  3OL9 A;  1GQE A;  3GJT B;  1WOP A;  2PMZ D;  2FJD B;  2EFP A;  4JYA F;  2BMB A;  5HVF A;  4UW2 A;  1SJF A;  2U1A A;  2EC0 A;  3VAM A;  2YNG A;  5DQG A;  1OYD A;  2H3E B;  3NEK A;  5KG7 A;  4DL5 A;  3AD8 C;  2RDI A;  5K8M A;  2CPI A;  2CPZ A;  2MPU A;  1AZS A;  2VOD A;  1YBU A;  4LQY A;  2HHT A;  3ZZR A;  3W60 A;  1EJ7 L;  1KBR A;  3T1H J;  4YME A;  1NZA A;  1O6X A;  4DV5 F;  2G9Y A;  3GWC A;  2PDA A;  1OQ6 A;  3KDN A;  3NNA A;  3BH7 B;  4IR1 A;  4LVN P;  2X98 A;  4WK3 A;  2RQK A;  2ATC B;  4L3N A;  3Q89 A;  3UPF A;  1DZ5 A;  3PKY A;  3H4B A;  3NNC A;  3LGM A;  3ULH A;  3LP1 B;  3WAW A;  1U26 A;  2VQR A;  1NK7 A;  3LA0 A;  2ZBC A;  3EGZ A;  5A8R A;  2LU1 A;  5KOX A;  4YB6 A;  4P2X A;  3TEG A;  2Z2Y B;  3C2P A;  5F8L A;  2YKA A;  2CQH A;  1RWX B;  4A46 A;  1OYE A;  4DL6 A;  5T7L B;  4WCE Q;  3OFF A;  1T03 A;  2OKQ A;  5IT9 Y;  1S7H A;  2DGX A;  3IBC B;  4FPI A;  3IGN A;  4DUT A;  1S76 D;  1NKB A;  3TA0 A;  2EW9 A;  3SQG A;  4MT1 A;  4URG A;  3EMT A;  2Y1L B;  3U1N A;  1FFW B;  4QQB A;  1Q82 T;  2YH1 A;  3KLF B;  4FZV A;  3VAJ A;  2E5L F;  4KAV A;  2DNQ A;  1TKX A;  3MEK A;  2ZOF A;  2EVZ A;  2DNG A;  3S1T A;  2FJA B;  4DR3 F;  1UA1 A;  3R97 A;  2A2D A;  3PM9 A;  1NJW A;  3ZTR A;  3ET6 B;  3SCJ E;  1TK8 A;  3DLE B;  1N33 J;  4L72 B;  4ZKA A;  3V6D B;  2BXJ A;  4DSK A;  2RQ4 A;  3TG0 A;  3J81 Y;  2AU0 A;  4QW9 A;  3V81 B;  3SEO A;  3T19 A;  2QLF B;  4DV7 F;  2AX1 A;  2YKM A;  3N5F A;  3F0N A;  3W8P A;  2UXB J;  3I32 A;  2MQL A;  5HN0 A;  2I38 A;  3BF4 A;  1JK9 B;  4P2F A;  2ZNZ A;  2V4Q A;  1TL7 A;  2XBP A;  3J80 Y;  4P10 A;  5F0U A;  2LLZ A;  4BC7 A;  1UVJ A;  4Y0F A;  3LGN A;  1B0T A;  1SKR A;  4ZPC A;  4UTG A;  1WC0 A;  4KIA A;  5ETQ A;  1V3Z A;  1ZYQ A;  3HT3 A;  2UVU A;  5LXY A;  2AQ4 A;  4R5P B;  3VVU A;  1C2P A;  3GYG A;  2XR9 A;  2Z30 B;  1Q16 B;  2FLP A;  1KTV A;  3ZO7 A;  2BJ7 A;  2C3U A;  4P71 A;  2N7Y A;  4LBH A;  4NCG B;  2U2F A;  4TQR A;  3TAR A;  2L9N A;  4CQ1 A;  1BQM A;  4C0O C;  3DOM A;  1CS4 B;  2PA8 D;  5KG0 A;  2X7I A;  1R0A B;  5KFM A;  5KFH A;  4F2S A;  2ASL A;  4RW8 A;  3THV A;  4OZ3 A;  3FEX B;  3BZQ A;  1IBK J;  4FS1 A;  2O3D A;  1H2T Z;  1Q5Y A;  4DCO B;  4MFB A;  4L3K A;  4C0B A;  2XS5 A;  4I2Q A;  4MIA A;  1VQS A;  1TVR A;  3EM1 A;  1WJ9 A;  1ZM9 A;  3QGH A;  4ZVR B;  2V34 A;  3TO8 A;  3SFG A;  1B7Y B;  4GTY A;  2AEJ A;  3T1H F;  5HRT A;  1FDN A;  1N6Q B;  4QU7 A;  2DCU B;  5E33 A;  2MST A;  2FJV A;  5HQM A;  4LRA A;  2ROP A;  4ZVG A;  4LT6 A;  1NK6 A;  1KC8 T;  2A6O A;  3CTR A;  4RBV A;  4K2X A;  1HBU B;  1M5K C;  3BPS P;  1UVK A;  3K59 A;  2C3Y A;  2E5G A;  2JDJ A;  3NS5 A;  2FUG 9;  4O0N A;  3CMR A;  5L0B A;  4B08 A;  2M70 A;  1OMS A;  3DLK B;  1VQL S;  2AKW B;  1ZA2 B;  1HPZ A;  2ABY A;  5KT2 A;  3SMZ A;  1KLN A;  3GJS B;  4FS2 A;  4PAA A;  2HMI B;  5EX0 A;  3FSI A;  4OHW A;  4X64 J;  2HHH J;  4MIW A;  2ZHB A;  1X0P A;  3PYD A;  1BGX T;  3R27 A;  3LXQ A;  4TY8 B;  1HDH A;  1WC4 A;  2DPI A;  4U9R A;  2VHG A;  1IKY B;  3LWL A;  3P45 B;  2F40 A;  5A0Y A;  5SUH A;  2RH6 A;  1N33 F;  3MM6 B;  6FDR A;  3EYZ A;  4Y2C A;  2BAB A;  2DR8 A;  3DGP A;  4RPF A;  1DQA A;  2AD9 A;  1Z2L A;  3V5R A;  3CO0 P;  3MM7 B;  2UXB F;  3GE9 A;  1R89 A;  1ACM B;  1PO6 A;  1RWN B;  4RL1 A;  4UOF A;  1KLM B;  3KKF A;  4NYP A;  5IV4 A;  4X4N A;  1DAX A;  4A48 A;  2JLF A;  2AGQ A;  1X8D A;  1FRM A;  1NND A;  2CNL B;  3VGT A;  1IBL J;  1YTY A;  4C3L A;  3FVY A;  2WRM A;  4K4Y A;  2XHW A;  4DFJ A;  1KH4 A;  4GKK J;  3MDF A;  2W8D A;  2NXJ A;  4KR0 B;  4Z2X A;  1DTT A;  4KHR A;  3DOL B;  1EJJ A;  3JSM B;  4ECZ A;  1RLD A;  1QJH A;  2JVO A;  1N36 J;  3SI8 A;  1YJU A;  3PG9 A;  3MUV P;  1QE1 B;  1FXR A;  1FKO A;  2B4U A;  3OVS A;  1T9X A;  4FDJ A;  5E0O A;  4JBC A;  1HBN B;  1UCN A;  2BVZ A;  1MWY A;  2GO8 A;  3CCW A;  2KYZ A;  3K5L A;  1SC4 B;  2IUC A;  5I3P A;  4IKA A;  3MFH A;  2R8J A;  1H38 A;  3GCW P;  4PYD A;  2LEP A;  3A3P B;  1X5P A;  3BM7 A;  2ZH1 A;  1AB8 A;  2OTL S;  2XWY A;  2HVI A;  4USW A;  2DGQ A;  4LF9 J;  1XN9 A;  4W4M A;  3MEC B;  3BH6 B;  4B3M J;  2KHC A;  5D15 A;  1N0V C;  3CJT A;  3DKD A;  2ILY A;  3PIP Q;  2IFY A;  1JLC B;  1C0U A;  2JRS A;  2R8K A;  1S6Q B;  3TW0 A;  2BKN A;  4PUO B;  1ZH5 A;  1SXL A;  2CRL A;  3MM8 B;  3MPY A;  2N3L A;  1X9S A;  5A8K A;  3IGY B;  3QO9 B;  3GV8 B;  1PIL A;  4ERD A;  1WOS A;  3IBF B;  1WF2 A;  1RWP B;  2H5I B;  3BO4 A;  5GAD I;  2ZKT A;  2ZD1 A;  3I5C A;  2W9B B;  3KG4 A;  2XZD B;  1BD6 A;  3NKO A;  5EHH A;  2OFH X;  3O3L A;  2O67 A;  2UVV A;  4CYS A;  1KOH A;  4ED4 A;  2D41 A;  1PJ5 A;  2MXY A;  2CQI A;  3W8G A;  1X0F A;  2EKY A;  3CJ3 A;  4X64 F;  1GXU A;  2EFN A;  4IG3 A;  2HHH F;  1ZZN A;  3RG6 A;  3GYN A;  3KUE A;  4RO0 A;  4CTA A;  2Z58 B;  3O44 A;  4QWC A;  2HBR B;  3VAK A;  1T0T V;  1ZEB A;  4GVB A;  2CJK A;  2V9K A;  5AE3 A;  4NRT A;  2L9W A;  3GIL A;  3J7Z 5;  3EIC A;  3N6N A;  4LRD A;  2DRB A;  2C2O B;  2ZJR Q;  2ZC3 A;  2XTJ P;  1S59 A;  2P8I A;  3I6P A;  1RKI A;  1U8W A;  3FDS A;  3I56 S;  1FNO A;  4X2B A;  2NUH A;  1P8G A;  1NCL A;  3GFX A;  4B9T A;  4JI2 J;  4X84 A;  5DO2 A;  3M2U A;  2OLW A;  4ZCL A;  4NLG A;  3JS9 A;  3EVO A;  1HKA A;  4HDH A;  1RTH B;  1IBL F;  1WHX A;  5HVH A;  2I6W A;  4ER8 A;  2IDE A;  3IAM 9;  4K2J A;  5D78 A;  3T3F A;  3QIP B;  3PW0 A;  1WKK A;  1YHQ S;  2PI5 A;  3T5J A;  4XDC A;  2C2E A;  3KHH A;  3AA8 A;  1RHK B;  2CQ2 A;  1WUU A;  3D3C J;  1SQF A;  2RDD A;  3HVT A;  1N36 F;  5CYJ A;  2J8A A;  5HRO A;  4NWJ A;  3H2V E;  2GA3 A;  5G4D A;  4QIG A;  2V68 A;  3DXS X;  4FBT A;  3B4M A;  1YVF A;  5BYS A;  1VQP S;  3ENW A;  5HLF B;  3E8O A;  4HTI A;  4EZ9 A;  4LFA J;  4A8F A;  4V1A k;  2YWW A;  4F4K A;  4GC6 A;  1M5S A;  4F50 A;  1LW0 A;  5CYQ B;  2DHG A;  2PEH A;  1FDB A;  2WCX A;  2BRK A;  5FII A;  4KBI A;  5IT0 A;  1LOU A;  3SQO P;  2UUC J;  3PRD A;  4UF4 A;  4DV6 J;  3KD8 A;  3IR5 B;  4OYP A;  3R7N B;  4OYO A;  1MU2 B;  3CDW A;  2JC1 A;  5C7P A;  4LF9 F;  5KFU A;  2KVI A;  2DH9 A;  4NRU A;  4DJB A;  4O3N A;  4B3M F;  2MLZ A;  4C8O A;  1SH2 A;  1HW9 A;  4OI1 A;  4P2S A;  1GH8 A;  3MMA A;  2R2T A;  2XS7 A;  2MTL A;  3CO9 A;  4U95 A;  1JLB B;  3MXH P;  2JFK A;  3G71 S;  2G13 A;  4C8L A;  3DI6 A;  4CO1 A;  3NMR A;  4DG1 B;  1KH9 A;  4O4R A;  2G4B A;  2GCF A;  4HTJ A;  5CYM A;  1HBO B;  4K50 A;  3I4H X;  3B8H A;  4JP8 A;  5B09 A;  2BX6 A;  2P6T A;  1VBY A;  5J2Q B;  4GVL A;  1UVI A;  1MN7 A;  1MNE A;  1BC6 A;  5D77 A;  2DNN A;  3MEG A;  1Q53 A;  1G7C B;  1E6V A;  1JLA A;  2VC0 A;  3KJN B;  2CDQ A;  1IQZ A;  5BR8 J;  3KHR A;  1FFS B;  2MKH A;  2GA7 A;  4J37 A;  4M5I A;  2WBM A;  1NB2 A;  3Q8Y A;  3JAM Y;  2PEB A;  3US5 A;  5ITH A;  1KON A;  2HHW A;  3OTO J;  1U1R A;  2VQE J;  4LR9 A;  3SCK E;  4EK2 A;  3VGU A;  4LBI A;  3M1V B;  4WP9 A;  2V6A A;  1KS2 A;  3C15 B;  2R7O A;  4MYU A;  1U49 A;  3C6T A;  2LKZ A;  1XC9 A;  5K14 B;  1RP5 A;  2HS3 A;  3M2R A;  4JI2 F;  5K8O A;  3ITH B;  4S0M A;  1UWB B;  3AJ2 A;  2DIS A;  2RRA A;  1S0O A;  3EX7 B;  1B0V A;  2CA9 A;  4Q0B A;  1MMD A;  1UAW A;  4L75 A;  1SJ4 P;  2HSE B;  4LR7 A;  4Q44 A;  4G1Q A;  3RR7 A;  2YPY A;  4WKR A;  1EQ0 A;  3CCM S;  2PSZ A;  3QJJ A;  4ID8 A;  3H7H B;  2LP4 A;  2IY5 B;  3KOA A;  4ZOS A;  4U8V A;  2Q79 A;  2AZ3 A;  2DRD A;  3W7B A;  1LXN A;  1WNE A;  1BQX A;  2AJ2 A;  3TNV A;  1HI1 A;  4LSN A;  4W98 A;  1I51 B;  4UOR A;  2IC3 A;  4NLP A;  2GSU A;  4LFA F;  3TYT A;  4NE9 C;  1SKW A;  2WW4 A;  2Q1L A;  3GSI A;  5J2P B;  1GMV A;  3DOK A;  1U24 A;  4TN2 A;  4BWJ A;  2UUC F;  4DV6 F;  1CEZ A;  2BEF A;  2NUU G;  2OEJ A;  3RBX A;  3HLU A;  5DG9 A;  3M8P B;  3VF0 B;  3HJV A;  1GX5 A;  1E3C P;  3MM9 A;  4KV8 B;  2DH8 A;  4M95 A;  1ELO A;  3W9J A;  4RNO A;  2QG9 B;  4O3Q A;  2DNL A;  1BMQ B;  7AT1 B;  2X51 A;  1XBW A;  3QMQ A;  2ZOM A;  2ZZN A;  5L38 A;  4KH0 B;  2AJ1 A;  2JVR A;  2IA6 A;  1V6H A;  3UCG A;  2HW3 A;  3CJQ A;  4CNZ A;  3IFE A;  1J2V A;  1TAQ A;  2BQU A;  2LDI A;  3AXK A;  1TMM A;  3GP9 A;  4IO9 Q;  2PN6 A;  3I96 A;  4CIO A;  5KFY A;  1TKD A;  2J0S D;  2IJR A;  5JXS A;  1HWI A;  4IH7 A;  3BGU A;  3IWL A;  1N5V A;  4ZG7 A;  2QL5 B;  3KG0 A;  2Z0G A;  1QVF R;  3B78 A;  1JJH A;  3DC2 A;  1JQG A;  1LWX A;  2MQN A;  3Q2S C;  2CQG A;  3RW7 A;  2IM2 A;  1SH0 A;  3QSI A;  5BR8 F;  2F5G A;  4MKV A;  1T7P A;  3GFH A;  1FD8 A;  4JV5 J;  1FJC A;  1JLQ A;  3J7A 1;  2AP6 A;  5EUH A;  4FKY A;  5BJR A;  2ZHO A;  3T6B A;  1RUS A;  4ZJL A;  3OTO F;  2Z8Q A;  2VQE F;  3FEZ A;  3A3O B;  3BDF A;  1YRT A;  3H5X A;  4P7T A;  1FK9 B;  4PG4 A;  1N2L A;  2IBK A;  1XNQ J;  4DL2 A;  3HJF A;  2V8P A;  1VQO S;  3HVW A;  5KG2 A;  1CUL B;  4PAB A;  5D4O A;  3K89 A;  5CQG A;  4KJG A;  3ZTP A;  3TX0 A;  3BDG A;  2VH7 A;  4A47 A;  1CSJ A;  3KLF A;  4PQU B;  2CJ9 A;  1K0T A;  3KLE A;  2ADB A;  2ZBR A;  4MIB A;  2KHD A;  2ZH4 A;  3DLG B;  4AQY J;  4OV1 A;  4C9D A;  3TWZ A;  3DLE A;  1FVS A;  3LWM A;  1CJK A;  2LDY A;  1Q0N A;  5J1N A;  1HYS B;  2WHO A;  4NML A;  2CQC A;  1Q4R A;  1V3R A;  4AFF A;  2D74 B;  2QYG A;  4ICL B;  4OZN A;  4CYU A;  2BQR A;  1QAY A;  1OWX A;  2Y1I A;  2VZ9 A;  3C16 B;  3IS9 A;  5U47 A;  2HZC A;  5IXU A;  1FWP A;  1KQG B;  5D4L A;  2R2U A;  3CME S;  2ZKU A;  3ILO A;  3P3D A;  1S1X A;  1HHQ A;  4KGZ B;  3MK1 A;  4M1K A;  4CLU A;  5IM0 B;  3WC0 A;  5GOV A;  1NBE B;  4R5P A;  3QT7 A;  3R6L B;  4USV A;  1KKH A;  2KXH A;  2MSS A;  3HFK A;  4PG7 A;  4EO6 A;  3QBC A;  4ZDN A;  3HHL C;  4C8K A;  2BAN B;  2QL9 B;  4XAK A;  4LSL B;  1Y9O A;  1KVJ A;  5B0D A;  3M4X A;  2FPH X;  1IM6 A;  2CQ1 A;  4ZPD A;  1CS4 A;  2AJF E;  1ZM2 A;  3CJR A;  4HH1 A;  3HVR A;  2LU2 A;  3HHE A;  3K5O A;  4GTX A;  4UPH A;  1FRI A;  1ZEF A;  4DZD A;  3PYF A;  2E9T A;  1PYO B;  3OR1 A;  4MH8 A;  2BOP A;  2OSR A;  3LPE A;  4L76 A;  3BQ2 A;  1RZM A;  1IKX B;  3ENA A;  4R8U A;  5AJ3 F;  1CPZ A;  1URA A;  2CPE A;  4MIV A;  4PG5 A;  2EKN A;  3DRR A;  3LP0 B;  2Z2L A;  2CFX A;  4RZR A;  3MI7 X;  3NLC A;  3EXY A;  4OZ5 A;  5KT5 A;  4DUY J;  4XDD A;  2Q6B A;  2QLX A;  4U8Y A;  1ULR A;  3GR0 A;  4FYX B;  3SV3 A;  4DQS A;  1T05 B;  1X5S A;  2YPZ A;  3BO3 A;  4OJ3 A;  2NXU A;  2NRE A;  2GJF A;  2IVF B;  3QWP A;  2DO4 A;  1SH3 A;  2ZZT A;  1HBU A;  2XNQ A;  2G2Z A;  4LMZ A;  4JV5 F;  1AFJ A;  1KH5 A;  1Q86 T;  2G2Y A;  1LKZ A;  2AEM A;  2RF2 B;  2BKO A;  3MAH A;  2KRB A;  1FXL A;  5L1J A;  1WEL A;  3WAV A;  4EU0 A;  2JWN A;  1EP4 A;  2QN6 B;  5L9X A;  1XNQ F;  3TAN A;  4CRJ A;  3AH6 A;  4NLT A;  1U4B A;  2XB2 D;  4A8K A;  1S9E A;  4NLQ A;  1MSW D;  1PAU B;  2RS2 A;  2VPW B;  3EZ5 A;  4FNH A;  2B4P A;  4JOU A;  1M1K T;  2W2O P;  1ALK A;  4LFC J;  2IHR 1;  3QZ8 A;  2F9D A;  1Q8K A;  2C22 A;  2WVF A;  1VOM A;  3NMA A;  4ID5 A;  4AQY F;  5K8N A;  4X4S A;  1HFE L;  2HNZ A;  2IM1 A;  4FDF A;  2D3O 1;  3AA9 A;  1DLO A;  2H65 B;  2KO1 A;  3S7R A;  4ZIW A;  1TAU A;  3EGW B;  1RAB B;  2JLE A;  3ZXW A;  4QWE A;  2MQM A;  5C25 A;  4DFK A;  3C19 A;  4ZCM A;  1YZ6 A;  2HFU A;  5JJB A;  3SZ2 A;  1KLM A;  2BE2 B;  1RWM B;  1RSC A;  4CDI A;  1N88 A;  3HHL A;  1KQF B;  2VV5 A;  2KU7 A;  5ETV A;  3MEE B;  1R7I A;  3DOL A;  5F8G A;  4OHZ A;  1REG X;  2UVR A;  5DQH A;  2YNF A;  3OW2 R;  1C1C A;  4IOB A;  2RT3 A;  1PJ7 A;  1QE1 A;  1V9O A;  1C1B A;  4JI7 J;  4F3M A;  1OSC A;  4RUC A;  2DCL A;  5LRN A;  1HBN A;  2VA2 A;  3DRP B;  3ISN C;  4FNI A;  2I9S A;  1S6P A;  4EWT A;  3CNQ P;  3D66 A;  5KG1 A;  2WVD A;  2O5D A;  1TKZ A;  5D0R A;  2PD1 A;  4P72 A;  3F56 A;  4PZV A;  4OI0 A;  1S1W A;  2R9L A;  4UUX A;  2WSF C;  5MLC V;  4DV1 J;  3NKN A;  2R2R A;  1FX2 A;  1O98 A;  4UZC A;  3SBM A;  1SL0 A;  4F0M A;  3QAT A;  3NGS A;  3MEC A;  1U2C A;  4IOC Q;  1S0N A;  4HI1 A;  1FTR A;  5L8R C;  1EW8 A;  3QGG A;  3TVZ A;  1VIX A;  4NLR A;  5J1P A;  1JLC A;  2MKY A;  1PBA A;  4I64 A;  1WF0 A;  3OL7 A;  4DPO A;  3HSD A;  1SUQ A;  4FF3 A;  3IGV A;  1BE4 A;  4GMK A;  5B0A A;  3SZY A;  4HVZ A;  1VRU B;  2GMJ A;  4WFA Q;  2PE8 A;  5ETL A;  2W9B A;  2XZW A;  3MUM P;  4CLL A;  1S10 A;  3HSG A;  4WKY A;  3OXL A;  3KLG A;  4IYQ A;  4PXB A;  4LF1 A;  3PZP A;  2D9P A;  4ZVS B;  3CDU A;  4B9L A;  2ALZ A;  3PJX A;  2AJ0 A;  1L3T A;  1ZOT A;  1Q5V A;  1ALI A;  5THW A;  4OL8 A;  3LW5 C;  3EWG A;  3T9Z A;  3W2W B;  4IH5 A;  4MMO A;  4USI A;  2GS8 A;  4ECR A;  4FBU A;  4LFC F;  5CHC B;  5DZ7 A;  2XCP A;  5J2N B;  2LQJ A;  3I82 A;  4NEZ A;  2AYG A;  4XO0 A;  1K9M T;  3WQP A;  4USJ C;  5J1E A;  5KAK A;  5HSP A;  3ZNU A;  3M7V A;  5GAH I;  4M5H A;  3FUY A;  3HZE A;  4NYZ A;  2HGN A;  1PAE X;  3Q8U A;  1ARO P;  2YBV A;  4K4V A;  4QPX A;  3HXM A;  3UQS A;  2Q3P A;  3ZZZ A;  1RTH A;  1AZS B;  2GSN A;  1RT3 A;  1ZTW A;  2BAC A;  2D3Z A;  3HHK A;  2DXD A;  5LSO A;  1ZM4 A;  1LK7 A;  3CCE S;  5L46 A;  5J2M A;  3H59 A;  2POK A;  3Q22 A;  4NLD A;  3CC7 S;  1X5T A;  3GTY X;  5C24 A;  3PCO B;  3I5A A;  1SC6 A;  3S01 A;  4JI7 F;  2VJU A;  2JNJ A;  2Z4P A;  3BBF A;  3OLB A;  2XMM A;  2XLJ A;  2XMT A;  1TEL A;  5A8R B;  3NBP A;  1P9Y A;  2VG5 A;  4AUK A;  2ZOG A;  3BBB A;  2YWK A;  4OZ0 A;  1T03 B;  1C4A A;  3PX6 A;  4KPC A;  4TYA A;  1FF2 A;  4DV1 F;  1B3T A;  2VC1 A;  1VC5 A;  3SQG B;  5IC4 B;  4DL7 A;  3V4I A;  5LMU J;  2BW2 A;  1H2U X;  3CSK A;  4Q2M A;  3VWS A;  3VAH A;  5ETM A;  5T14 A;  4I6W A;  4J9P A;  2F7V A;  2E1C A;  1TKX B;  3MHY A;  3WDO A;  1V5I B;  4U6P A;  2YX1 A;  2Y9H A;  5DLW A;  2HBQ B;  1SHQ A;  3DU6 A;  1B64 A;  4KM4 A;  3PKM A;  5DJB A;  4C6A A;  1BXN A;  1MML A;  1PC5 A;  4O0I A;  4JB8 B;  3ELH A;  3GFZ A;  1OJ4 A;  4QWA A;  2FGC A;  3ZZP A;  5LL6 d;  4K4W A;  2YKM B;  1RK8 A;  2QFI A;  3A13 A;  4QYZ J;  3D68 A;  3JB9 k;  3DPC A;  1VIS A;  3MED B;  1PYT A;  2FY1 A;  2IFX A;  4ZVE A;  3BDP A;  1QUP A;  1PGZ A;  3R1H A;  1YZ7 A;  3UVJ B;  4CXS A;  1T9T A;  3D1Q A;  3ONQ A;  3CT9 A;  5LQQ A;  2CQB A;  3LAK A;  1NHU A;  4N7T A;  2AWZ A;  2GMH A;  3NOG A;  4RX6 A;  5B0G A;  4MK8 A;  3PVX A;  2QRR A;  1WEY A;  1BQM B;  4K4T A;  3BKF A;  3DOM B;  1FJG J;  3M1V A;  3HSJ A;  3L7P A;  4RNH A;  3T1Y F;  1B4S A;  4J9M A;  5LXR A;  4WFX A;  3BRE A;  3ED4 A;  2ZH5 A;  4Y65 A;  2W5S A;  2NZC A;  2W9C A;  5SZT A;  4MFB B;  3OVA A;  3QFW A;  4C8Y A;  4DSL A;  5LIA A;  1NHK L;  4MTP A;  2ZE2 B;  2FVC A;  1LXJ A;  3K0J A;  1CJU A;  1JKH A;  2F3J A;  2KTQ A;  3M9M B;  2W25 A;  3D6F B;  1B70 B;  1UFK A;  2FJW A;  2HS0 A;  1LW2 B;  3DDK A;  1L3S A;  3MR6 A;  1H7W A;  4P2M A;  2QZU A;  3HI9 A;  5EDW A;  3AXM A;  3H5S A;  4ILM A;  1VS3 A;  3EVW A;  3WHI A;  3R5C A;  4OI2 A;  1RT2 A;  1X4E A;  4WU3 A;  2JZ5 A;  2QYC A;  1RAC B;  2YWH A;  3GIR A;  2V4R A;  6AT1 B;  3QQC D;  2EBG A;  2FLL A;  3EZO A;  1JMT A;  4YR2 A;  3UWT A;  1RAO A;  2JJ4 D;  2GIQ A;  1FNX H;  1CJV A;  1NKC A;  1VRQ C;  4WYL A;  5IOL A;  4H4O B;  1WI6 A;  1VQY A;  4EGL A;  1K7H A;  4ZVU B;  3M32 A;  3JSR A;  3KHG A;  1H98 A;  4KSE B;  2F1F A;  2CNN B;  3IGZ B;  2H5J B;  3HO1 A;  2RHS B;  4WFZ A;  4KV8 A;  2UUA F;  2ZDP A;  2YKN A;  4Y28 C;  2CPJ A;  2QZ8 A;  5LMU F;  3IA0 A;  1T95 A;  3UO0 A;  1QDU B;  1P27 B;  4A8M P;  2XUL A;  2XY7 A;  3B6B A;  2HZV A;  5D4P A;  1IXK A;  3S6E A;  1KHJ A;  1O99 A;  2LXF A;  3G87 A;  1HQE A;  3KMS A;  3I9V 9;  4TKT A;  1D9F A;  3KUG A;  5EWF A;  4CO4 A;  4DX5 A;  1NDP A;  3DCA A;  2PI4 A;  4C0H A;  3S8S A;  2CJX B;  1XTZ A;  3DYA B;  2ZWP A;  3HD2 A;  3DGP B;  2XZT B;  3DFE A;  1WHY A;  4ECU A;  2QX0 A;  3D67 A;  5H1S V;  1J5O B;  4QPT A;  1UZD A;  1FVQ A;  3PX4 A;  2VFU A;  2J9C A;  1X4B A;  3NCQ A;  4DF8 A;  2EFG A;  1DUR A;  1G1X A;  2HAI A;  5KFL A;  3BQ1 A;  3EDQ B;  2JHE A;  3WAY A;  3K5M A;  4LF7 J;  1VQ4 S;  2CQ4 A;  3C66 A;  1Y3K A;  1RAJ A;  4LF4 F;  2YQ3 A;  3RB0 A;  4KB7 A;  2XM3 A;  3OQ2 A;  4DPX A;  2W5X A;  2HZA A;  5F8M A;  1CQN A;  1I94 J;  1S4E A;  1PC4 A;  4YHH J;  2HVH A;  2VON A;  2A0F B;  5HBM A;  3N28 A;  4IG0 A;  1FKO B;  1FK9 A;  4B9M A;  3VAF A;  3CJ5 A;  1FJG F;  3TUZ C;  2DNY A;  4OQJ A;  3TVK A;  3W2V B;  1IM4 A;  2HRY A;  3CD6 S;  4U96 A;  3TA1 A;  3E01 A;  2DR5 A;  1CUL A;  4ATN A;  2ZBI A;  2BE9 B;  1D9D A;  1C0T A;  2C2D A;  2V2K A;  1MMN A;  3T00 A;  3SIP B;  4ZIT A;  3M8Y A;  5ADZ A;  2FDN A;  2L41 A;  2WSC C;  3L09 A;  2W5W A;  2H54 B;  5CZX A;  2WVC A;  1ZM3 A;  5AXN A;  1BHN A;  2Y1R I;  4KKO A;  1REV A;  1ZPW X;  4LQ9 A;  2YH0 A;  4V19 X;  4RUH A;  3PFE A;  4RBU A;  1QAX A;  3IM8 A;  3ZTQ A;  3BSN A;  2J7U A;  1C0U B;  3C8Y A;  3FK4 A;  3HPO A;  3Q8S B;  2DGS A;  5E5N A;  1I1G A;  4NLO A;  2XI2 A;  3PRV A;  5A8K B;  1UEU A;  1QUV A;  2HFZ A;  4GO5 X;  4IFV B;  1GMW A;  3G9C A;  4CM0 A;  1EAY C;  2ZD1 B;  1SJQ A;  3FC9 A;  1F9E B;  4JI8 J;  4ELT A;  5IM0 A;  2E5I A;  4ITS A;  1EI6 A;  3UD5 A;  3UR3 C;  2HHV A;  2WB1 D;  3D28 A;  3DDN A;  3FCW A;  2BAN A;  2QIF A;  3VZH A;  2FLN A;  4QOT A;  3SSQ A;  4ZS6 A;  4KAI A;  4M94 A;  2OPQ B;  3SZZ A;  3ICL A;  1YRX A;  3TX8 A;  4TY9 A;  2C2R A;  2V8G A;  3DN9 A;  4KGK A;  1VQN S;  1N5S A;  4HAC A;  3MAQ A;  4GVB B;  4TU7 A;  4ANE A;  1TFW A;  5GAE U;  1RBA A;  3VGS A;  3DHW C;  3G4S S;  2MY8 A;  4AND A;  1LFP A;  1M5P C;  1Y5L B;  2HRU A;  3GCX P;  4UPL A;  4XPC A;  4X4R A;  4IR9 A;  1AJD A;  4OX6 A;  1RT4 B;  3RW6 A;  4J9U E;  1XIQ A;  3RRK A;  2VIC A;  3GLJ A;  2XRG A;  3ZZO A;  4JI3 J;  2QSW A;  3M2U B;  1IJF B;  4B9N A;  2X3G A;  2XGP A;  4WP3 A;  3V2U C;  4BCA A;  4ZN1 A;  2VA3 A;  2FVS A;  3KLH A;  1IR1 A;  1RTJ A;  3W61 A;  4Y34 A;  2NR0 A;  1KDN A;  2J6T A;  1URN A;  3SFU A;  4USK A;  2VBX A;  1HBM A;  4WTO B;  2J0X A;  3NKR A;  3R3T A;  2RF2 A;  4OJ1 A;  3CCV S;  1I94 F;  5DET A;  1X4D A;  3HVT B;  4YHH F;  4CXU A;  5HRO B;  3A8K A;  4Z37 A;  1TL5 A;  2OPS A;  4MKB A;  4DBQ A;  1XMO J;  2DBB A;  1IKV B;  3M8R A;  2PFD A;  2GVZ A;  3ILI A;  1RE1 B;  2K3K A;  1R6Y A;  4PXD A;  3G82 B;  2RRN A;  1LWE A;  2ERR A;  1S1U A;  1LW0 B;  2LYV A;  3KUH A;  2GZO A;  3UD4 P;  2KXF A;  4DX6 A;  1FJ7 A;  1R31 A;  4YEA A;  1IN0 A;  3FCH A;  2IPO B;  2HAF A;  3E2E A;  1J5E J;  1NB7 A;  1TL1 A;  2CVE A;  3FBC A;  3MCN A;  3QSY B;  2FVR A;  4F0H A;  1EW2 A;  2J5A A;  3MMA B;  2V5H G;  5KG4 A;  3KHL A;  2HFN A;  4NPO A;  2ZJP Q;  3DHX A;  2GHV C;  4B17 A;  3TAM B;  3Q83 A;  1YIJ S;  4PWD A;  3X1L B;  2WB4 A;  3DI6 B;  3U1M A;  4DX8 H;  1T9W A;  3A8E A;  2H9Z A;  2BE2 A;  5F8N A;  3OL8 A;  3MWB A;  1TKT B;  2W7A A;  2WOM B;  2GVD B;  1QSY A;  3BSA A;  2XNR A;  2C2K B;  5E41 A;  1S1V A;  4WE1 A;  4JI8 F;  3GV7 B;  1Q95 G;  2GAG C;  5DZ6 A;  4QIW D;  2W2Q P;  3MEE A;  2PFF B;  3QZ7 A;  2VD3 A;  3RTV A;  1URB A;  3NGK A;  1JLG A;  1HWJ A;  3MEG B;  3CC4 S;  1E6V B;  1JLA B;  2HS4 A;  2ZWO A;  3AFG A;  1M1G A;  4G3I A;  2OAU A;  2UUB J;  4AXJ A;  2G2O A;  3SV4 A;  2LCW A;  3UCZ P;  2DIU A;  1FJE B;  1MWQ A;  3THT A;  4IRD A;  2KKH A;  1GNK A;  1ELZ A;  2IM0 A;  2E7X A;  4YB5 A;  3H90 A;  5M2U A;  4NXM J;  5IWA J;  4M8L A;  1VJW A;  2W7O A;  4R0J A;  1KEK A;  3AOD A;  1YJ7 A;  1YJV A;  4DV0 J;  1RTD A;  1SQE A;  1F9F A;  2OEK A;  2MZR A;  4ZP7 A;  5AE1 A;  1ALH A;  3C6T B;  4EFA C;  4UOG A;  3P5B P;  3H2U B;  1YG0 A;  1ELX A;  1FRJ A;  4ZP6 A;  2WVE A;  2X1G A;  5I3Q A;  5FJ4 A;  3M2R B;  2QA1 A;  4JI3 F;  4OLO A;  3C6U A;  4RUB A;  3R8Y A;  3MOZ A;  3QJL A;  3G2X A;  4NI2 A;  4N5S A;  4I68 A;  2KDO A;  3IC1 A;  5KFX A;  3OVB A;  1N8R T;  1SJR A;  3BJY A;  3UI3 A;  2QEX S;  3HT0 A;  2XCA A;  2LXI A;  4Q0B B;  2W24 A;  3CXC R;  2FTR A;  2DEJ A;  4QWB A;  1KSP A;  1YX2 A;  4F4A A;  3ETM A;  3J81 j;  3OR2 A;  4G1Q B;  1S49 A;  3QT6 A;  3O2I A;  4OYA A;  4LQ3 A;  4NXN J;  5HMW A;  2K1R B;  1Y7P A;  1F60 B;  1WTB A;  4ZLP A;  1QLN A;  5D3G B;  2VPZ B;  1KTQ A;  2KT3 A;  4WXW A;  2DGT A;  1T9Y A;  1GMW D;  2HVZ A;  2I8E A;  4LSN B;  2IC3 B;  3BGL A;  4O4G A;  1LNQ A;  1G3O A;  5IJQ A;  2NSC A;  1KHK A;  1TL3 A;  2A6M A;  3W2W A;  3MMJ A;  1O5J A;  2EC2 A;  4XPE A;  5HMY A;  4CLW A;  4ED8 A;  3CD7 A;  3DOK B;  4Q45 A;  2DXE A;  4PPZ A;  5D6G A;  4WZQ A;  5EGY A;  3AQO A;  5J2N A;  1R8C A;  1OY8 A;  2M8D B;  2B8Q A;  1IJE B;  2FHM A;  1J5E F;  4F25 A;  4JI1 J;  1YJN S;  3MTK A;  1RWV B;  3GG0 A;  4F8R A;  2QLW A;  4HHU A;  2GIF A;  1UW4 A;  2M52 A;  2ZVI A;  4NA1 A;  1CQM A;  2NPF A;  3D9B A;  3BSO A;  1DQ8 A;  3UE2 A;  1M5H A;  4K8R A;  4AD6 A;  2YNH A;  4E98 A;  4GRS A;  3QRP A;  1KHN A;  2MLX A;  4DR4 F;  3G8Q A;  1RHM B;  3TUP A;  5DM6 Q;  1APS A;  1U1L A;  1HWU A;  1CVJ A;  1PIE A;  4M5D B;  3PRB A;  2RDJ A;  2W7P A;  1WG4 A;  3NP5 A;  3PHT A;  2C3O A;  4OI6 A;  4K5R A;  3VTI A;  1RAI B;  4QJV A;  2UUB F;  3TOQ A;  4OYB A;  5AT1 B;  5GMK a;  5FDL A;  2EK1 A;  1JLQ B;  2B5J A;  1HHT P;  1HD0 A;  1EW9 A;  5CH7 B;  2J6U A;  4ZPB A;  3JTO A;  2YWG A;  2BKP A;  2WVB A;  4USU A;  5KFT A;  4NXM F;  2RU9 A;  5IWA F;  3VAL A;  3Q2T C;  4OJG A;  4LF8 J;  4DDF A;  2OEM A;  2ZFH A;  1SKS A;  2CPF A;  4AYB D;  2ASD A;  4DV0 F;  3G6E S;  2AJ4 A;  1OPI A;  3LTO A;  3A8J A;  4RUA A;  3VHQ A;  1U09 A;  5DDP C;  3PHE A;  3GMG A;  4Y6I A;  2OHD A;  4FP9 A;  3KK2 B;  1FSU A;  1RTI A;  3IWN C;  3BDG B;  4DCJ B;  2ZJQ Q;  1SL1 A;  3C3L A;  4OYZ A;  3MAA B;  4WP8 A;  2EFV A;  3JSY A;  3QWU A;  2RIJ A;  3KLE B;  1YGY A;  3DLJ A;  3BEG B;  2Z2M A;  3DM2 A;  1VLY A;  2ZBP A;  4EYH B;  1W25 A;  1NKE A;  1Y10 A;  3UN2 A;  4LF5 J;  1CJK B;  4ZMM A;  2XSJ A;  1P9Q C;  1Q7L B;  1HNW J;  2XMK A;  3WBH A;  1BQN A;  1F3F A;  4X65 J;  2Z2Z A;  4RR5 A;  4NXN F;  3R7S B;  2FVQ A;  2YWF A;  3TEH B;  1GFW B;  1XK8 A;  3Q8V A;  1WKJ A;  4H4M B;  1V5V A;  1RT1 A;  3ZZY A;  4UOP A;  2JOQ A;  2B9E A;  4CYU B;  4B3T J;  1RJJ A;  4B56 A;  3MED A;  2EG2 A;  5M2R A;  1A6L A;  1HNX J;  3RUB L;  1U1O A;  1Y11 A;  1Y3J A;  3IS9 B;  3OJU A;  1KVI A;  4X4T A;  3TA2 A;  5F9N A;  2DXF A;  2KG0 A;  1M5V C;  4I56 A;  1S1X B;  4EO8 A;  4A8Y A;  1T9V A;  3HKZ D;  2CPX A;  3UVJ A;  5B08 A;  2HQ3 A;  3OFE A;  3G6X A;  3W5Z A;  1NO8 A;  2XYP B;  3KXD A;  1OS5 A;  3CDB A;  4CO0 A;  1DRZ A;  3V6K A;  4DFP A;  2VU5 A;  2GFF A;  2DNP A;  3OPK A;  4JI1 F;  1DFD A;  4F0K A;  2MKI A;  3RAX A;  4C7Q A;  3EDR B;  2M7S A;  5IS2 A;  1S99 A;  3U1L A;  3D6T B;  1Q78 A;  1JJ2 R;  2Q6C A;  5HJX A;  1UEK A;  4IFY A;  3OR1 B;  4FYY B;  2OPP A;  2XC9 A;  5IZH A;  3AB2 B;  1MRO A;  2XGQ A;  2ZE2 A;  4DU7 A;  1RDR A;  4R8U B;  4K59 A;  3L7O A;  3DRR B;  1SPB P;  1LW2 A;  1QAJ A;  2MJU A;  1SIZ A;  1T02 A;  4I4B A;  4ZVQ B;  2ALY B;  2R7X A;  2FB0 A;  3CJ0 A;  1NHV A;  1RAE B;  1RCX B;  3AAW B;  3NWR A;  1CJT B;  3GZ7 A;  4MYT A;  1DHM A;  4YR1 A;  3TZY A;  3ZZ0 A;  4I69 A;  1HNI A;  3PYE A;  5GAG U;  4DQQ A;  2MHN A;  5A2Q U;  1R8A A;  3CJS A;  3QGI A;  4NLY A;  1SHN A;  1X4F A;  5EGE A;  2D3U A;  2MB0 B;  1HIY A;  2CWX A;  2GLQ A;  2LVW A;  3G8S A;  2FY8 A;  3GG1 A;  4H4O A;  1XMQ J;  5L1I A;  4WPA A;  3N9U C;  9RUB A;  5B0E A;  5JMN A;  1TV6 A;  2AZ1 A;  2NYH A;  4LF8 F;  2CWK A;  1EP4 B;  4HDG A;  2F63 A;  3CGI A;  4HKQ A;  2RB7 A;  1I3O B;  3MGJ A;  3OXG A;  1S9E B;  1D3W A;  2XYH B;  4K0K J;  2RHQ B;  5DDO C;  3MD3 A;  4ZG9 A;  5I4M A;  1AJA A;  3D0I E;  1XEZ A;  4USH A;  5GRR A;  4X66 J;  2ACY A;  1S1T A;  1YDL A;  1RBO B;  5F9L A;  2D7S A;  4DMZ A;  1A7G E;  3PO5 A;  4YY3 J;  1FA0 A;  3WZ0 A;  4OHX A;  4O3P A;  4M5N A;  2J7K A;  1ICE B;  2Q66 A;  4ID5 B;  4NWB A;  4DR6 J;  2XMA A;  4EMD A;  3OXF A;  1F5A A;  2K7J A;  4ES1 A;  3K8W A;  2Z57 B;  2HNZ B;  1M0S A;  4LF5 F;  4HR2 A;  3FMB A;  1HNW F;  3DYA A;  1DLO B;  2VFV A;  2MEW A;  4XIU A;  3M05 A;  4X65 F;  3PDN A;  1X4G A;  1ZTT A;  1J5O A;  2WAQ D;  1OY6 A;  1YWX A;  3PIO Q;  4C8Z A;  5C25 B;  4ZLJ A;  2B7B B;  4CLY A;  5KT6 A;  4B3T F;  1NJY A;  3MPW A;  1WF1 A;  1H7X A;  2BYC A;  2V67 A;  1HNX F;  3RAM A;  4RJV A;  4B9V A;  3AY0 A;  5E3A A;  2GIR A;  1KRP A;  4WWS A;  1NH7 A;  5DLV A;  2B51 A;  1LQ9 A;  3HHL B;  1Y00 A;  3GQC A;  4DX7 A;  5A6W A;  1LFW A;  3UN5 A;  5L1L A;  3D1H A;  1PCA A;  3KDO A;  1TU0 B;  2ZVS A;  2YNF B;  4MKA A;  4Y3C A;  2I5J A;  1C1C B;  1NLK L;  2MZT A;  4DL3 A;  4YP3 A;  2FHO B;  4O3R A;  1C1B B;  2DGW A;  3J7Y U;  2QMU B;  2LEA A;  1HNV A;  3RRH A;  1IR0 A;  3W2V A;  1KHW A;  3MCO A;  2JL9 A;  1VQK S;  5FLX U;  2IMO A;  1S6P B;  1IBK F;  1EET B;  1TKZ B;  2HQG A;  4AT1 B;  2UZA A;  2RAQ A;  4FYW B;  1CG2 A;  1S1W B;  3WX8 A;  1S77 D;  2HWI A;  3M30 A;  4DR5 J;  4EZ6 A;  4YDX A;  1EKS A;  2A1B A;  3IRX A;  3EUN A;  3KLV A;  1M5O C;  4ENO A;  1JNZ B;  3Q8P B;  4M5K A;  1RXO B;  3H25 A;  3AQP A;  2ZBQ A;  4FVC A;  4A4J A;  5D0H A;  2C2N A;  2QA4 G;  4UST A;  2CPH A;  2DPJ A;  2PMW A;  4CWB A;  1SUQ B;  3MM5 A;  4B9S A;  2XMU A;  4IFV A;  2F8H A;  2N4C A;  5B0F A;  3D3B J;  1VHF A;  3CWJ A;  4LJM A;  3GJQ B;  1D9A A;  1XMQ F;  4F67 A;  3M2V A;  5K4P A;  1VI7 A;  4NMX A;  5MAO A;  4ECX A;  3KLG B;  4WBF A;  3GR1 A;  2RE1 A;  2D3O R;  2NXN A;  3DLL Q;  1WDT A;  3T01 A;  1JWW A;  1R8B A;  1PYS B;  2OPQ A;  3PW7 A;  3BPD A;  4K0K F;  3FMW A;  2CZ4 A;  2QE5 A;  4EUV A;  2R7T A;  2HKE A;  4DLG A;  1N56 A;  2OIH A;  5HK4 A;  3IBW A;  2DYA A;  2BV3 A;  3UDE A;  3AB4 B;  4X66 F;  1JB0 C;  4CLS A;  4HL9 A;  2AX0 A;  4MAK A;  1FES A;  4ZGA A;  4YY3 F;  2BR0 A;  1W2B R;  1SB6 A;  2MDA A;  2HFO A;  3AD9 C;  4DR6 F;  3IDD A;  3D54 A;  5J1E B;  5KFI A;  3IMQ J;  2X3D A;  3CJ2 A;  2NS1 B;  4OI3 A;  1MWZ A;  4J9V A;  1RT4 A;  2B9W A;  2KJW A;  1E33 P;  2AGO A;  2HUR A;  3ZNJ 1;  4OLP A;  1RT7 A;  4EBD A;  2F65 A;  1RT3 B;  3PTW A;  1FO1 A;  4FVM A;  2DY9 A;  4K7Q A;  2G1H A;  4GKK F;  1B8J A;  4F4Z A;  5EGH A;  2E1A A;  3U27 A;  4C3M A;  3IG1 B;  3AJD A;  1UFW A;  5IC6 B;  1Y0H A;  1QTN B;  3POT A;  3VR1 A;  5J2M B;  3G6V A;  5HP1 A;  3F44 A;  2YY3 A;  5F3Z A;  3BS9 A;  1VQ6 S;  2OPR B;  5C24 B;  1E6Y A;  2R8H A;  4DFM A;  3M8Q A;  4I67 A;  4ED7 A;  3VVT A;  5KFB A;  1IKV A;  2K8G A;  4PG8 A;  4YOE A;  1KR4 A;  3NBP B;  3G82 A;  2VG5 B;  1UJ6 A;  1J27 A;  4J9Q A;  2M88 A;  4GKJ J;  2DNR A;  3QT5 A;  1TZ0 A;  2HGL A;  3IAS 9;  2OFG X;  2DGV A;  4FPR A;  1JIH A;  2MGZ A;  1ZA1 B;  3GU0 A;  1JLF B;  3ILJ A;  3HVA A;  2DT9 A;  2OO4 A;  2A3J A;  4DR5 F;  3VAI A;  2VKZ G;  3QPI A;  3V4I B;  3K8V A;  4O44 A;  2AGP A;  4FYD A;  5ETR A;  4OZL A;  4K4S A;  1U0S A;  2H4W B;  2Y0S D;  2HPU A;  1P6T A;  2DNO A;  2OML A;  5KFR A;  2WW8 A;  3OFH A;  2XHC A;  4KT0 C;  4YUD A;  5H9E K;  4CH0 S;  4Q5V A;  4HH0 A;  3TAM A;  1BLU A;  2DHX A;  3H5U A;  2M9K A;  3KLI A;  1WSR A;  1FCA A;  2I1R A;  2VBY A;  3HP6 A;  1TKT A;  2E66 A;  2WOM A;  4JV1 A;  2GVD A;  1NSK L;  4OHY A;  1HQA A;  5C42 A;  5E2Q A;  2HEK A;  2B3T B;  5IJS A;  2AW0 A;  4F2R A;  2KH9 A;  1AW0 A;  4P7V A;  3R1L A;  3BSC A;  2KM8 C;  3JYT A;  1UL3 A;  3ZTS A;  1U02 A;  4Z7C A;  4EBC A;  4G65 A;  2JFD A;  2OH2 A;  1RYR A;  2ZIT A;  2NPI A;  1VC6 A;  2GHP A;  4ETX A;  1FKP A;  2QT7 A;  4YR0 A;  4E0D A;  2NXC A;  4O3O A;  4HI2 A;  4UQT A;  2B43 A;  5F8H A;  4ZLN A;  3D5M A;  4J5O A;  2FC9 A;  4LIW A;  1B7F A;  1FX4 A;  4CH1 A;  1UKU A;  3DMJ A;  3MMC A;  2DRA A;  2YKO A;  1OPZ A;  1KH7 A;  3BGR A;  3RB3 A;  4N8N A;  3CW2 C;  1TUG B;  4ZHR A;  1RI7 A;  2EPI A;  4ECW A;  3FFI A;  4B3O A;  1HLW A;  2CJY B;  3W66 A;  3NG8 A;  3THP A;  2R8I A;  1HQU B;  4BBY A;  2AIR B;  2W9C B;  2MZJ A;  2E9Z A;  4KTQ A;  2B9Y A;  3MF5 A;  2E44 A;  4RW6 B;  5E3P A;  5A6P A;  1RU2 A;  1TL4 A;  2P9G A;  1UW9 A;  1CJU B;  4ZLL A;  5I42 A;  1JKH B;  1OSD A;  1ANJ A;  2HQC A;  3QGP A;  4KGV B;  3H2L A;  3Q23 A;  2MZQ A;  5DDQ C;  5F41 A;  3O5T B;  1FE4 A;  1YKW A;  5H9E J;  4CP5 A;  4UOO A;  1R8P A;  3EVM A;  1RT2 B;  2A10 A;  1N2K A;  4C11 A;  2E5L J;  2CAD A;  3IO1 A;  2K1R A;  3D6H B;  2LQ9 A;  1WG1 A;  5D3G A;  2BJ3 A;  4K4Z A;  4QWD A;  5HJY A;  4FXD A;  2WTF A;  4TN0 A;  1GMU A;  2FJE B;  1CJV B;  2AYB A;  4YQW A;  1LWC A;  2KT2 A;  3M32 B;  1H72 C;  1S9F A;  4DSJ A;  4DF4 A;  1NDK A;  4OJH A;  5L9N A;  3BBC A;  3TZX A;  2W5V A;  1S97 A;  5INH A;  1WI8 A;  2MZ1 A;  2YQ1 A;  5KFA A;  3D0H E;  3O1L A;  4BLG A;  3M6U A;  3TAQ A;  3K7R A;  3JQM A;  1X4H A;  2B4O A;  5T41 A;  2YKN B;  2KG1 A;  2VPX B;  4Y2A A;  3IR7 B;  1EAR A;  2OD4 A;  2NXE A;  3Q8Q B;  4KFB A;  1HQE B;  9ATC B;  4LF2 A;  2ZUG A;  5HL7 Q;  2DIV A;  1T8E A;  4ELV A;  4HLB A;  1KFD A;  2DY1 A;  2GML A;  5KFS A;  3MMB A;  5HVG A;  2E7W A;  4MJK A;  4R0E A;  3CCQ S;  1ZET A;  1H3D A;  2QSF A;  4ED5 A;  3HKW A;  4JI4 J;  4QBU A;  3WX4 A;  3T9N A;  2RML A;  2PMH A;  4M5D A;  4QIV A;  3R2D J;  5LJ5 Y;  1G6B A;  3HX9 A;  4URS A;  2HFS A;  2DHH A;  1AFI A;  3P96 A;  1O0P A;  3RJM B;  1YK9 A;  1TR0 A;  1FFG B;  1U0H B;  5KFF A;  4ECT A;  3E2D A;  2ZUA A;  2R7V A;  1U8S A;  2VFR A;  1V3S A;  4ED1 A;  2UVW A;  4ELU A;  1DJ0 A;  4USM A;  2HVD A;  3W64 A;  3TVY A;  4ILR A;  1RA7 A;  4J7C A;  3PO4 A;  5HBM B;  5L0E A;  4IG0 B;  3LOU A;  5CAA A;  4DQP A;  2FVP A;  2W5Q A;  2ZC4 A;  1TP7 A;  3IM9 A;  1L3U A;  2HRT A;  3E01 B;  1YBA A;  3KK2 A;  5DG7 A;  3FBB A;  1C0T B;  3DRS B;  2OGU A;  2RJZ A;  1FHT A;  3MAA A;  1S12 A;  2Y0B B;  2BJ8 A;  3ADA C;  2IVM A;  4F4X A;  2GHW A;  2HWH A;  2JEF A;  4KKO B;  1REV B;  4ZPT R;  4I0W A;  3NCR A;  2V9W A;  2RSQ A;  4EEY A;  2COL A;  2VG7 B;  2MLY A;  2FHK A;  2IRY A;  4U7U D;  3CDE A;  1S4F A;  2FGO A;  4H4M A;  1EKR A;  2O01 C;  3MUT P;  3AHP A;  3MZI A;  3JQJ A;  1MLA A;  3RR8 A;  4K5S A;  2ATL A;  3OHA A;  1RQ0 A;  1X7V A;  4GO7 X;  2N82 B;  2VBZ A;  2QJ3 A;  2KVQ E;  1LWF A;  2LMI A;  3QRQ A;  2B4V A;  5C2G A;  3V6H A;  2ASJ A;  5EN1 A;  4ES3 A;  1U1K A;  2DNZ A;  3NOC A;  1ZZF A;  4PYA A;  1T3O A;  1W2I A;  4LBP A;  2AJQ A;  3OV7 A;  1RBL A;  3D1O A;  2GJ2 A;  3KWM A;  5M2P A;  2NLW A;  2GW8 A;  1HW8 A;  2WON A;  5GMD A;  4HAC B;  4E2F B;  3VGV A;  2VB6 A;  1DTQ A;  2CJA A;  5AJ9 A;  4WFY A;  5LJ3 Y;  2AHO B;  2J9D E;  5HI7 A;  1SV5 A;  4PXE A;  5D0G A;  2W01 A;  3KK3 B;  1HAR A;  4FYV B;  2RS8 A;  3CMQ A;  1NK8 A;  4ZPW R;  1S0V A;  3RRG A;  1JXV A;  4FN5 A;  2CAJ A;  1XQI A;  4OX8 A;  2KI2 A;  4TNO A;  3QRR A;  1JJ4 A;  4QZV B;  4JI4 F;  4LVO P;  2BQ3 A;  4ZN3 A;  2VKR A;  3I31 A;  1R0B G;  3V4M A;  1CJT A;  3KLH B;  3L7U A;  1F5B A;  1RTJ B;  4Q8E A;  3M8W A;  3NRB A;  4NL5 A;  3H0P A;  2JX2 A;  3B82 A;  1M1H A;  4A8W A;  1HBM B;  4MKY A;  2ZZM A;  2W2P P;  3LPY A;  4NA2 A;  4ZJO A;  5DRK A;  2HHP A;  3HFZ B;  1VBK A;  1NME B;  3BYR A;  3NKQ A;  4FXW A;  4IRC A;  4D3H A;  4PPD A;  2R7R A;  3UR0 A;  2OPS B;  2XY5 A;  5I3U A;  2AEF A;  4I1T A;  5G0R B;  2E1R A;  2GVZ B;  4RU9 A;  4P6Q A;  3P49 B;  3KK1 A;  1H73 A;  2KFY A;  4LF6 J;  1LWE B;  2R42 A;  1Q81 T;  2QTW A;  1S1U B;  2BJD A;  2FJB B;  4Q8F A;  3F73 A;  3VQS A;  3W3S A;  4Y2I A;  5KG5 A;  1WTF A;  4L74 A;  3ENQ A;  2P9C A;  3OTE A;  3CJ4 A;  4WZM A;  4CLZ A;  4X4U A;  4CT8 A;  1F0X A;  2FJX A;  3CB4 A;  1TL1 B;  5HAO A;  5KFP A;  4DSF A;  3PX0 A;  1NAQ A;  1UJ4 A;  2QLB B;  2EG1 A;  3MK2 A;  2NYI A;  4BS2 A;  1Q8I A;  4CO3 A;  2G1D A;  3UNY A;  4JV2 A;  1U48 A;  3OSP A;  2B9X A;  1GT8 A;  1RIS A;  3PNI A;  4PWD B;  1IBC B;  1Q8B A;  2NCK L;  2E9R X;  4F4W A;  4I6Y A;  5K9F A;  2XQC A;  3RAQ A;  4QCL A;  4UY8 T;  2R7Q A;  2GSO A;  3NAH A;  1VCT A;  2H4Y B;  2HQD A;  3W5Y A;  8RUC A;  2OSQ A;  2BRL A;  2Q43 A;  1S1V B;  4WE1 B;  5GME A;  1QAI A;  1NPP A;  4NZ0 A;  2FIU A;  2LFV A;  3UDL A;  3FNN A;  1JLG B;  8ATC B;  2V2V A;  5KG6 A;  5KFE A;  3PEH A;  5KFZ A;  4LSZ B;  5CCM A;  2GQ2 A;  4TYB A;  3GPA A;  2C28 A;  4UZB A;  1XWL A;  1WWH A;  3PR5 B;  3U7J A;  2HG4 A;  4QAX A;  2RU3 A;  3LUY A;  2HVE A;  4WXO A;  3RGI A;  4NX9 A;  2K7K A;  1EET A;  1YIT S;  2PC6 A;  2DGU A;  1T9U A;  2HGM A;  2FZC B;  5KFC A;  5CD4 H;  1MG7 A;  4XTT A;  2DEI A;  3FZ2 A;  1G4C A;  3CDA A;  1RTD B;  2UU9 J;  1SC3 B;  4X62 J;  3OBI A;  4P9S A;  1FRX A;  2C3P A;  4DV2 J;  3GII A;  4X4V A;  3BR8 A;  1ZS6 A;  5TJ3 A;  3CD0 A;  2W4D A;  1ZAW A;  1FRL A;  4DUY F;  3ETO A;  1NK9 A;  1B0P A;  1X9M A;  3C6U B;  1YBT A;  2GC8 A;  3MUR P;  3T5H A;  5K5M A;  4PQA A;  3K5P A;  4NI2 B;  2UXC J;  5KFQ A;  2UP1 A;  1RKJ A;  1U7L A;  4LRF A;  1D8Y A;  1RU1 A;  2XMV A;  5LMN J;  3AJ1 A;  4KGM A;  2F8M A;  4CH7 A;  5AXK A;  2DTJ A;  1CC8 A;  7FDR A;  1RWW B;  4ETZ A;  4KY3 A;  1R0C B;  3OR2 B;  5KFW A;  4DR2 J;  2KRR A;  4G6V B;  4RWX A;  1AT1 B;  1NEE A;  1SBR A;  2CQD A;  2V4J B;  4DSI A;  4DV3 J;  4XK8 C;  1D1U A;  1VBZ A;  4UPI A;  3HDS A;  2QGF B;  2ADC A;  3CCT A;  3OUY B;  4X4P A;  3NKM A;  3C14 A;  3KFW X;  4AL6 A;  3BYP A;  4RNN A;  2ZH2 A;  1F9H A;  5DLG A;  4KGX B;  1RHQ B;  1RT5 A;  1S48 A;  2ZH8 A;  5RUB A;  2BA9 A;  4ZVH A;  1TFY A;  3UNG C;  4LIR A;  4O4G B;  5ETT A;  2YKQ A;  1IKW A;  3OTD A;  1TK0 A;  4LF6 F;  3VQT A;  1TL3 B;  2W8K A;  1A0O B;  2B6A A;  2GGP A;  3CIM A;  3CCJ S;  2BUN A;  5BYR A;  1RAG B;  3EGN A;  1JLE A;  4A8X A;  4P73 A;  8AT1 B;  2VOO A;  4CI0 B;  3KG1 A;  5CD4 A;  1VDH A;  2DNH A;  4Z7Y A;  4KHM A;  4OZ1 A;  2W1B A;  5KFD A;  2HHS A;  4Q2L A;  1RB0 A;  1T3N A;  4I7F A;  3MR3 A;  2DD8 S;  4X4Q A;  1WSV A;  1U47 A;  2E1P A;  4TQS A;  1DBD A;  4EI2 A;  1TUW A;  3N79 A;  2MKJ A;  4OZJ A;  5E7O B;  3BB5 A;  2H5E A;  2YNH B;  3K2Y A;  4C2M A;  5C5J A;  2OMO A;  4Y2M A;  1FDA A;  4QYZ K;  1NM2 A;  1YJR A;  1AJC A;  5ETK A;  1HQ2 A;  1NSQ A;  2QMX A;  2WK4 A;  3PR4 A;  2JH3 A;  3EE3 A;  4C4W A;  3KJV B;  4ED3 A;  3IG1 A;  4Y2K A;  3OLA A;  4X4O A;  5LT5 A;  2EFO A;  3FBF A;  1X9W A;  4RKU C;  1JX4 A;  4OX9 J;  4NLX A;  2OPR A;  3IN5 A;  4QR2 A;  2P6S A;  2DR9 A;  3R5J B;  1Q7Y T;  5DLF A;  3A4T A;  4HEA 9;  4LRB A;  5FDL B;  4J9R A;  1HNZ J;  3DYC A;  1FEH A;  3W9I A;  2B5J B;  2VIH A;  3FQL A;  3HHD A;  2D1C A;  3SDE B;  1H6K X;  1VQM S;  4C97 A;  1K0V A;  1WDD A;  1HI0 P;  3WIV A;  1XR5 A;  1CBK A;  1Z2Z A;  2OTJ S;  1ELY A;  1JLF A;  3DU5 A;  2CJB A;  3PAC A;  1X5O A;  1WEX A;  5GAD U;  4E8U A;  3GYX B;  2UU9 F;  5DG8 A;  4X62 F;  2HQI A;  2MQP A;  2JEI A;  4DV2 F;  2VJV A;  1FER A;  3QAU A;  5LSR A;  2QLJ B;  1SKU B;  2G9O A;  1RTI B;  4PEO A;  2QC3 A;  4Q7A A;  3UDV A;  2UXC F;  2JLG A;  1NPK A;  3MPD A;  3L95 X;  4PXC A;  2VG6 A;  1HMV B;  2XLI A;  5LMN F;  3DM2 B;  3SCI E;  2BBE A;  2RH3 A;  4KRW A;  2XG8 A;  3CC2 S;  2CQ0 A;  3DXB A;  4CM2 A;  3PV8 A;  3D2W A;  3RB4 A;  2XSJ B;  1SVD A;  4OMF G;  4DR2 F;  1BQN B;  5BXI A;  3KMQ A;  1AUK A;  4I2P A;  1D8Z A;  1XNR J;  5IQQ A;  2HLU A;  3FJ2 A;  4DV3 F;  1RGV A;  4URQ U;  1RT1 B;  4BC9 A;  1HL6 A;  3TJA A;  2IRU A;  1NDL A;  1Q8L A;  2V69 A;  2CG4 A;  3ISZ A;  1HWL A;  1QD1 A;  3KYL A;  5ETO A;  4HT5 A;  3PY8 A;  1RAF B;  1D09 B;  3PXG a;  1L3K A;  3QT8 A;  4GC7 A;  1KD1 T;  3P6Y C;  3NS6 A;  3EXC X;  4N56 A;  1Y4Z B;  3I0S B;  3H5Y A;  1FEE A;  4IDK A;  4YR3 A;  2VBW A;  2W2M P;  4ES2 A;  3NKP A;  3B4D A;  3VCD A;  2BM1 A;  4A8S A;  4GTW A;  1PJ6 A;  1UTA A;  1NK5 A;  1U2F A;  1JJC B;  4U7C A;  4CLF A;  2Y8Y A;  3NCP A;  3A8I A;  4IFY B;  1L5U A;  3I4P A;  3H98 A;  1KN6 A;  1HQU A;  2ZNY A;  2OPP B;  4M5G A;  4O23 A;  1KQK A;  1MRO B;  5CA5 A;  4RW6 A;  4AXI A;  4IOA Q;  1URR A;  3BKT A;  4LRE A;  3LP2 A;  4M63 A;  3C46 A;  2LEB A;  2XO7 A;  2ZHA A;  1FE0 A;  2HWT A;  2BE7 D;  2FQQ B;  3Q8R B;  1R6V A;  4KE5 A;  1K73 T;  2LQ5 A;  2C2M B;  2IVY A;  2W5T A;  3I5B A;  4N77 A;  1WC6 A;  5IQ6 A;  1TUV A;  3QLH A;  4WK1 A;  1VLO A;  4KO0 A;  2JEG A;  4OX9 F;  1HNI B;  4TVA B;  2HBY B;  4CLP A;  4RW4 A;  2D69 A;  1HNZ F;  1XER A;  1U6B A;  2X1B A;  2J7W A;  2EXU A;  4W92 B;  2I2Y A;  1SC1 B;  1TV6 B;  4JV0 A;  2FC8 A;  4C8N A;  2W5R A;  3AOB A;  4ECQ A;  4IH6 A;  2FZG B;  4P52 A;  1ITP A;  1Z1Z A;  1BWE A;  3AT1 B;  1W26 A;  3ILL A;  5CCL A;  1RCO B;  2IAJ B;  2M8H A;  1IUJ A;  1S9G A;  1IR2 A;  1FTC A;  2VDH A;  1NU4 A;  3Q3Q A;  1PG5 B;  5C2C A;  2M0G B;  4DZ6 A;  4RWW A;  1VMB A;  1S1T B;  2KB2 A;  1YQH A;  2YNI A;  3N01 A;  1HR0 J;  5DDR C;  5A2Q Y;  4J91 A;  2MHE A;  4RBT A;  2DH7 A;  5A8W B;  1FDD A;  5HO4 A;  3I0R A;  4RW9 A;  4W90 B;  3BGF A;  3CPW R;  4TU9 A;  3W1Y C;  1VIO A;  1UA0 A;  2N7C A;  3ZC4 A;  1XNR F;  1WC5 A;  2CXE A;  2M4M A;  1ZAX A;  1QSL A;  3CIZ A;  3CUL A;  1MN9 A;  1WHV A;  5KT7 A;  4OYW A;  1H74 A;  3IXQ A;  1U1M A;  4CO5 A;  5IT9 U;  1U0H A;  2GO9 A;  2M3D A;  5AJ3 J;  1N5Q A;  1VBX A;  2CG8 A;  1FD2 A;  3A12 A;  2IBO A;  3N5B A;  1RWU A;  3ZZU A;  5EX3 A;  3OTB A;  1VJQ A;  1HD1 A;  1FRH A;  2I5J B;  1PKU A;  3K5N A;  5JVH Q;  1HI8 A;  4B3R J;  1SJ1 A;  4NLV A;  4DL4 A;  1P1T A;  5ETS A;  3N0V A;  4B9U A;  3D7S B;  1HNV B;  3LP1 A;  5GAE I;  3BKU A;  4PWU A;  3SXL A;  4DS4 A;  4J9L A;  3TI0 A;  4ANC A;  3TUI C;  3J81 U;  2F4V J;  1NDC A;  3DRS A;  4V19 J;  4DS5 A;  3H8Y A;  4C8M A;  2CIM A;  1L3V A;  4DXL A;  5T7L A;  1Y5I B;  4DL0 C;  3Q24 A;  3DLB A;  2OP5 A;  3H4D A;  3R5D A;  3M30 B;  2SXL A;  2CYY A;  3FBE A;  2YVS A;  3T1A A;  3W62 A;  2UV8 A;  3FGV A;  3I87 A;  3IRX B;  4TU8 A;  3D0G E;  2LXU A;  3J80 U;  1UPP A;  1WAC A;  1P1L A;  2G0J A;  1RAD B;  3W5X A;  1X31 C;  2VG7 A;  3PW5 A;  2J0W A;  1P49 A;  4J90 A;  2VPY B;  5DLT A;  2VL1 A;  4OV6 A;  3N4W A;  2O1P A;  4DN9 A;  4NLS A;  3MM5 B;  2W2N P;  3ET6 A;  5LM7 E;  5FLX Y;  1SCJ B;  3V6D A;  2XS2 A;  3MCM A;  1S72 S;  4ZPA A;  1VRT B;  2N3O A;  3V81 A;  2HK3 A;  2LA6 A;  2L08 A;  3M2V B;  3J7Z T;  2DHS A;  2ACM A;  3J7A N;  2CNK B;  2HYI B;  1O51 A;  3AD7 C;  4P74 A;  4WTY A;  1S79 A;  1RHR B;  4OYM A;  4ZP8 A;  5H9F K;  3DRX A;  2V2Q A;  2CVI A;  4OX7 A;  4NZ6 A;  2DNM A;  4YDD B;  2HFV A;  5IT4 A;  4R25 A;  4KJI A;  4ZA1 A;  1NRK A;  2PGC A;  3RBZ A;  2FLO A;  1HR0 F;  2BJ9 A;  2DK2 A;  2KL8 A;  3HK2 A;  3I55 S;  3KK3 A;  2HNY B;  2V8D A;  4NCG A;  4UOC A;  3ENV A;  1WOO A;  1F1B B;  1UVM A;  3NGR A;  3CJK B;  1FWK A;  2H1Y A;  2GQC A;  3DNC A;  1R0A A;  4ZVO B;  4DEZ A;  4QU6 A;  3R2C J;  3NWG A;  4AL5 A;  1N4L A;  1RT7 B;  2W4C A;  3H20 A;  2YWE A;  3PEJ A;  2KJV A;  2IRX A;  4ALZ A;  2Y8W A;  3W9H A;  4LF7 F;  3MOJ B;  1VQ8 S;  3UD3 P;  4F4Y A;  2GQQ A;  2L48 A;  1WC1 A;  1N54 B;  2HBZ B;  2M2B A;  2QA4 S;  2E29 A;  3GSD A;  1M90 T;  2FYX A;  1N6Q A;  2NZ4 A;  5ETP A;  3POT B;  5HP1 B;  3NXZ A;  3NY0 A;  1KVK A;  3QNW B;  3GON A;  4B3R F;  3D4J A;  3A1Y G;  1E6Y B;  2OJ3 A;  3M8Q B;  4UOH A;  3G86 A;  5G0R A;  5AXL A;  1GTE A;  4H4K C;  4M5M A;  1LEO A;  3WIU A;  4WJB A;  3ZFV A;  2O66 A;  2F4V F;  2XY6 A;  5H9F J;  2V2Z A;  1VYA A;  1WOR A;  1UWA A;  3CJ8 A;  4RW7 B;  2MGZ B;  1ROF A;  3I9Z A;  1FXD A;  3HFV A;  3DLK A;  3EPI A;  4MY4 A;  3MR5 A;  3QID A;  4F36 A;  1ANI A;  2IDL A;  2HMI A;  1IVZ A;  2BJ1 A;  4O44 B;  4NYO A;  2AF6 A;  1U25 A;  2BJE A;  1JXL A;  2J9E A;  3BV8 A;  2HHU A;  4TY8 A;  2R7U A;  1S6U A;  2MQO A;  1IKY A;  1EIY B;  4C48 A;  1EB0 A;  5DS7 A;  3G8T A;  1RWO B;  1KFS A;  3KLI B;  1TK5 A;  1FRK A;  2RUG A;  3K57 A;  3PW4 A;  5IFM A;  1HHS A;  3MM6 A;  5L39 A;  3T41 A;  2VQF J;  5C42 B;  5DGB A;  2RUS A;  2RNE A;  2KFN A;  1FWL A;  1E1Z P;  4U7U K;  4LUB A;  4RNM A;  3M6X A;  3MM7 A;  5F0W A;  1RYS A;  2RKI B;  1GXT A;  2AT1 B;  2DGO A;  3JYT B;  2EFQ A;  4KHP J;  1HWK A;  3ZTO A;  1EX8 A;  2NQP A;  2X1F A;  3R5G A;  4N41 A;  1FKP B;  4DQI A;  4NA3 A;  3HMJ G;  2F4F A;  1VQ7 S;  4YB1 P;  4ZK7 M;  3UN3 A;  4ED6 A;  4WFB Q;  4PKD B;  3RBE A;  2X1A A;  5KTQ A;  2BOA A;  3JSM A;  1VQ9 S;  3DMJ B;  1F3V A;  3MMC B;  2YTC A;  4HT7 A;  4IO1 A;  5K8P A;  4CNY A;  1Z4U A;  3GIM A;  2IYI A;  3BGR B;  2MJN A;  1N32 J;  4ZHR B;  4ED2 A;  3MPU B;  4FKX A;  1FT8 A;  4F04 B;  1U6F A;  3VAG A;  4UQG A;  5LRM A;  3LQV A;  3FFI B;  4B3O B;  4ZJQ A;  2HND B;  2HQF A;  1EQM A;  2W8L A;  3FQK A;  3T6J A;  4KC5 A;  2C42 A;  1UEV A;  4YFU A;  4NWX A;  5I42 B;  1XJW B;  3BQ0 A;  2RD5 C;  5JUM A;  2QFJ A;  3CCZ A;  3V6J A;  2IA0 A;  1DY3 A;  1WKL A;  2LA4 A;  1WG5 A;  3L4B C;  1F2H A;  5CAB A;  4DPT A;  1F2G A;  3Q0A A;  2H51 B;  1UP1 A;  3OD2 A;  4DV4 J;  1N52 B;  2J0Q D;  4F7V A;  1S6O A;  1X60 A;  4ILL A;  2OI2 A;  4DR7 J;  2V50 A;  2V4J A;  4C11 B;  2AYM A;  3D6M B;  3BGO P;  1S6Q A;  2RQM A;  4H4K A;  3IR6 B;  5IV3 A;  4PUO A;  2GAH C;  3OUY A;  4ZPV R;  1KHV A;  3MM8 A;  4CXK A;  3TR5 A;  2UXD J;  1XMO F;  3M9N B;  3P4U B;  1N5Y B;  3TRG A;  3QO9 A;  1EZZ B;  2FHJ A;  1RT6 B;  1LWC B;  2GV1 A;  2VDI A;  6FD1 A;  3OL6 A;  4J9N A;  1GXL A;  2EWH A;  5F8J A;  2GNK A;  4ECY A;  4DWI A;  2K06 A;  1DQ9 A;  2W9A A;  4B3S J;  2AMC B;  2E1M C;  1T94 A;  1ED9 A;  4G1P A;  2R4F A;  5EWE A;  1TTH B;  1HA1 A;  4PG6 A;  2WZ1 A;  4OHV A;  4WFN Q;  1S0M A;  5E3Q A;  4K4U A;  4ZVP B;  3G96 A;  1NZ8 A;  3O6Q A;  5JVG Q;  4FF2 A;  4KFB B;  4UPK A;  3W63 A;  2CQ3 A;  1E2S P;  3OJS A;  4KH1 B;  3CCL S;  4A8O A;  1UMJ A;  1YLX A;  2R7S A;  4QR0 A;  3MMB B;  4BDP A;  5KT4 A;  1AA1 B;  2VQF F;  3RB6 A;  3T1Y J;  4KPY A;  2LQB A;  1OQ3 A;  3GB0 A;  3OT9 A;  2KM8 B;  5B7W A;  3KJV A;  3N6L A;  3OHB A;  1N34 J;  5HAN A;  1UVN A;  2YNG B;  2BDP A;  1X4C A;  4ECV A;  1GTH A;  4HHH A;  3E3X A;  3LAL A;  1VR6 A;  4KHP F;  4DPU A;  3RZA A;  4IQX A;  7FD1 A;  1KWM A;  3KJF B;  2CZ9 A;  1WEZ A;  2DHA A;  4QYR A;  3QIP A;  4NOH A;  2MQ8 A;  3SDE A;  1R3N A;  2QA2 A;  2XI3 A;  2KZZ A;  5AXM A;  5KOW A;  1BY9 A;  1AUD A;  3GFY A;  2B56 A;  3L3C A;  2H48 B;  2PT0 A;  1N32 F;  4KQZ A;  1PBU A;  2HLT A;  3CE8 A;  2UUW A;  4DUZ J;  1Q1K A;  5HLF A;  5KFO A;  3CMA S;  2P2C B;  1U6Z A;  3QJP A;  5KFK A;  1A9N B;  4ZVF A;  1Y5N B;  4YN3 B;  5EWG A;  2LEC A;  5CYQ A;  3M6W A;  2F8E X;  1QM9 A;  4LR8 A;  1YI2 S;  3T02 A;  4L6V 3;  4F26 A;  2IYG A;  3VZI A;  2MY7 A;  1HMV A;  1CLF A;  2PII A;  3PYG A;  1MU2 A;  2V0N A;  2C2Z B;  4JI6 J;  2UUA J;  4ZCK A;  5KG3 A;  4NZ7 A;  3LO3 A;  4DV4 F;  2ANH A;  5GAG I;  3FRY A;  4ZCI A;  2E7V A;  4DR7 F;  5DQI A;  2P9E A;  1T11 A;  2P5V A;  1YRU A;  1JLB A;  3JAM U;  3JTP A;  1DAR A;  3NS7 B;  2RIL A;  2UXD F;  3H40 A;  3BN4 A;  3NVL A;  4DG1 A;  1U1Q A;  5GAH U;  3L9Z A;  1XR6 A;  3BO2 A;  4DPW A;  4P75 A;  4TLR A;  1HBO A;  2CKW A;  2QL7 B;  2J6S A;  1LWF B;  3R5B A;  2MKK A;  1RWK B;  5J2Q A;  4B3S F;  1VC0 A;  3WBZ A;  4C3K A;  3R5A A;  3I0S A;  1TL7 B;  1WHW A;  3FSY A;  5LOQ A;  3RYL A;  4LR2 A;  3HHL D;  2MYF A;  4H54 A;  4OYI A;  2WON B;  5HAT A;  4LF4 J;  2GJI A;  2ZH7 A;  1ED8 A;  1DTQ B;  2B8P A;  2MKC A;  3IWX A;  2EK6 A;  3N6M A;  2XLK A;  4AL7 A;  4CCH A;  1SV5 B;  4NAS A;  2MZS A;  2M5Y A;  1ZBT A;  2V8V A;  4JI5 J;  4ZIV A;  3K17 A;  4QR1 A;  1QSS A;  1KNZ A;  4B02 A;  1IBM J;  2I0X A;  1RHJ B;  2VUG A;  3C15 A;  1VHI A;  4RW8 B;  4YB7 A;  2ROG A;  4EBE A;  3ZZT A;  4DPY A;  3Q86 A;  2VFT A;  2C3M A;  4CYR A;  2RQC A;  5K14 A;  1B99 A;  2N4D A;  1N34 F;  2J9D A;  3ITH A;  2YQ0 A;  1S5Z A;  1UWB A;  4I2Q B;  2IIH A;  1GEH A;  5L0K A;  4DLE A;  2W8S A;  1TVR B;  3IRW P;  3A52 A;  2V63 A;  1VQ5 S;  1YJW S;  2XMJ A;  3FSX A;  5CZV A;  4CO2 A;  3J7Y I;  1UPM B;  4UUW A;  2IJF A;  3H42 A;  4KAY A;  2L3M A;  2ZEJ A;  4FDI A;  3HCX A;  2V8H A;  3W65 A;  3BN7 A;  3TZW A;  1KQS R;  5I3U B;  2FHJ D;  3GV5 B;  3CF5 Q;  1WC3 A;  2IAJ A;  3KK1 B;  4DUZ F;  4ED0 A;  5D4N A;  4DCP B;  4DSE A;  3UCU P;  4TXS A;  1Y6V A;  3TJ8 A;  5D0E A;  1NJX A;  2V94 A;  5J2P A;  5HMX A;  3T5K A;  4QIF A;  3G6Y A;  2CZV C;  1H0H B;  1HPZ B;  1NK0 A;  4LFB J;  4OYX A;  3M8P A;  2EI5 A;  4JI6 F;  5A8W A;  4C98 A;  4IRK A;  2DKO B;  3UFC X;  1BWV A;  3R7B B;  1W7W A;  2DR6 A;  3P5T L;  3MCS A;  4ZVT B;  2ASY A;  1NJZ A;  2YX7 A;  2DVI A;  3JTN A;  1IWA A;  4HYK A;  3BR9 A;  4BWM A;  1TQL A;  3P8B B;  5HMZ A;  4D3G A;  5A0Y B;  2IMW P;  1TMJ A;  1N5T A;  4MK9 A;  4M5J A;  2KFZ A;  4DOZ A;  1UFL A;  2CPY A;  1ZED A;  4NEY A;  3AOA A;  2RVJ A;  3GIK A;  1U1N A;  1C4C A;  2B7C B;  5FD1 A;  2ZM6 J;  3O8W A;  3TZZ A;  1CC7 A;  2CQP A;  2KYX A;  2OEL A;  1RAA B;  2XSF A;  4RU2 A;  2XO6 A;  2VFS A;  1FNM A;  1U45 A;  4N76 A;  1JXE A;  3MR7 A;  1WD6 A;  2J76 E;  3SSR A;  1ZPV A;  1K1S A;  3R9L A;  3HUL A;  4EYI B;  2A18 A;  4N8O A;  1DTT B;  2XEX A;  3HM9 A;  3RU0 A;  2BM0 A;  3KJQ B;  1K47 A;  4KYZ A;  3MR2 A;  3ISN D;  4JI5 F;  1Y7A A;  2J8S A;  2ILZ A;  1IBM F;  1K8A T;  4OFZ A;  4J9S A;  4JI0 J;  4TLQ A;  2ZH6 A;  1RHU B;  1NH8 A;  4PWW A;  3CCR S;  1OO0 B;  2UV8 G;  2C1E B;  3E51 A;  3OTC A;  2IUC B;  3M8Z A;  1VFJ A;  2GX8 A;  4PQU A;  5F8I A; 
#chains in the Genus database with same CATH homology
 5EGE A;  4MIV A;  3WAY A;  5IJS A;  3OT9 A;  2GSN A;  3UNY A;  1ED8 A;  2IUC A;  2RH6 A;  5LRN A;  3M8W A;  2GLQ A;  1KH9 A;  1E3C P;  4ZGA A;  2W5Q A;  1FSU A;  5DLW A;  4UPL A;  1AUK A;  3BDG B;  3Q3Q A;  4LRE A;  1SHQ A;  3BDH A;  1KHN A;  3IGZ B;  2D1G A;  1AJD A;  4UOO A;  4LRA A;  3IDD A;  4KM4 A;  5HRT A;  4LRB A;  2ANH A;  3ED4 A;  4NWJ A;  1ALI A;  2XR9 A;  3DYC A;  5TJ3 A;  5DLV A;  2GA3 A;  2W5X A;  1N2K A;  3BDF A;  3MK1 A;  2W5S A;  1ZEB A;  1Y6V A;  1ELZ A;  1N2L A;  2W5T A;  2XRG A;  1HJK A;  5LRM A;  3UO0 A;  3NKQ A;  5GOV A;  5LIA A;  1EQJ A;  2GSO A;  3NKN A;  3UN5 A;  1ED9 A;  1E33 P;  4CXS A;  5IJQ A;  3UN2 A;  1O98 A;  4LRF A;  4LR7 A;  1EW2 A;  1KHK A;  4KAV A;  3CMR A;  1KHJ A;  2IFY A;  4LRD A;  1ELY A;  1KH5 A;  1O99 A;  5AJ9 A;  5L0B A;  4TN0 A;  3B5Q A;  4LQY A;  3WBH A;  3NVL A;  4KJG A;  4CYR A;  1EI6 A;  3TX0 A;  1KH4 A;  4ZG9 A;  1AJB A;  3BDG A;  3DPC A;  1AJA A;  1EW8 A;  5KXA A;  4NWX A;  2QZU A;  5K4P A;  5GRR A;  1ALH A;  1E1Z P;  3NKR A;  3KD8 A;  2W8D A;  1KH7 A;  2G9Y A;  4KJD A;  4LRC A;  3T00 A;  1ELX A;  4UPK A;  1KHL A;  1Y7A A;  4UOP A;  4MHX A;  5C66 A;  3WAV A;  5L0K A;  1EW9 A;  3IGY B;  3M8Y A;  4B56 A;  3TG0 A;  1EJJ A;  2W8S A;  3SZZ A;  4GTX A;  2X98 A;  4GTZ A;  1B8J A;  1E2S P;  3E2D A;  5EGH A;  2W5W A;  3A52 A;  2W5V A;  4UPH A;  3MK0 A;  3M7V A;  5INH A;  4ZG7 A;  4UOR A;  1ZEF A;  4CXU A;  4CXK A;  1AJC A;  3T01 A;  3TWZ A;  3NKP A;  3WAX A;  4UPI A;  2ZKT A;  4LR9 A;  2GSU A;  3LXQ A;  4GTW A;  2W5R A;  3WAW A;  3NKM A;  4QAX A;  2VQR A;  1HDH A;  5LQQ A;  1P49 A;  3SZY A;  3NKO A;  4N7T A;  4YR1 A;  4FDJ A;  2IUC B;  4LR2 A;  1HQA A;  5DLT A;  3M8Z A;  4KAY A;  4CYS A;  4ZG6 A;  4FDI A;  4MY4 A;  1ZED A;  4LR8 A;  4GTY A;  5L0E A;  1ALJ A;  3T02 A;  3UN3 A;  1K7H A;  1URA A;  3MK2 A;  1ANJ A;  1SHN A;  1URB A;  1ALK A;  1ANI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...