3UNYA

Bacillus cereus phosphopentomutase t85e variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3unyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3unyA01
5GOVA 4LR7A 2GLQA 1EW9A 1KH5A 4FDIA 3OT9A 1N2KA 1ALHA 4MIVA 1ANJA 3B5QA 4LR8A 2X98A 4CYRA 4FDJA 4MHXA 2IUCA 3UN5A 3MK1A 5LRMA 2RH6A 3WAYA 3UO0A 3UN2A 5DLVA 1P49A 1ZEFA 4B56A 4UPIA 5EGHA 4KM4A 5LRNA 3T01A 4GTWA 3T02A 1B8JA 1ALJA 1AJAA 4CXSA 3M8WA 1EI6A 4LRCA 5DLTA 4GTZA 1AJDA 2W5WA 1E33P 3WAVA 2ANHA 1N2LA 2W5QA 5L0KA 1ANIA 2QZUA 3A52A 3ED4A 2GSOA 1O99A 3BDFA 4ZG9A 1KH4A 4NWXA 1E2SP 1ELYA 3M8YA 3TG0A 1ALIA 2XR9A 5IJSA 1ZEBA 5GRRA 3BDGA 3CMRA 1EQJA 4KAYA 2IUCB 4UOPA 5L0EA 1Y7AA 2IFYA 3IGZB 4UORA 4N7TA 1ELXA 2VQRA 3E2DA 3NVLA 3NKPA 4QAXA 1URAA 3T00A 5C66A 1AJCA 4NWJA 4GTXA 5HRTA 1KH7A 1AUKA 4GTYA 2W5XA 3KD8A 4UPHA 1FSUA 3WAWA 1ELZA 2W5SA 4LRAA 2W8DA 3DPCA 3LXQA 5INHA 3UNYA 4KJDA 3NKMA 1Y6VA 4LR9A 5TJ3A 4ZG7A 1KHNA 1EW2A 3NKQA 3NKNA 2G9YA 3UN3A 1AJBA 2GA3A 4LRDA 4TN0A 3SZYA 5KXAA 1KHJA 3Q3QA 2GSNA 3M7VA 3BDGB 1KH9A 5K4PA 3MK0A 4LRFA 1ZEDA 1KHLA 1K7HA 2W5RA 1HJKA 3MK2A 4UOOA 4CYSA 2GSUA 3TX0A 3TWZA 5LIAA 1ALKA 4CXUA 4ZG6A 3IDDA 4LREA 5DLWA 4LQYA 4MY4A 3DYCA 4YR1A 5IJQA 4ZGAA 4LR2A 1O98A 1HQAA 4CXKA 3NKOA 1EW8A 1E3CP 2D1GA 5AJ9A 4UPLA 3IGYB 1ED8A 1HDHA 1URBA 2XRGA 3BDHA 3SZZA 4LRBA 1SHQA 4KAVA 5EGEA 5L0BA 3WAXA 1ED9A 2W8SA 4UPKA 3M8ZA 2ZKTA 3NKRA 5LQQA 3WBHA 1KHKA 1SHNA 1E1ZP 2W5TA 4KJGA 1EJJA 2W5VA
chains in the Genus database with same CATH superfamily
2R7WA 2LQ5A 1B0VA 3QZ8A 1I6JA 1C0UB 2G1HA 3B8HA 2V69A 2PE8A 2F4VF 1HQUA 4X64F 4C11A 4RBTA 5I3UB 4Q0BA 2GO8A 1NCLA 3GR1A 1HWJA 2B6AA 3K2YA 3I87A 4OHYA 2X3GA 4PWDB 4M5NA 3TO8A 8ATCB 1NJXA 1A9NB 4WFBQ 2DY1A 5DLGA 4QBUA 4OZ2A 2QA2A 1KVJA 5A8WB 2HWHA 3N0VA 1YJVA 5KFJA 2OFHX 1YBUA 5K8NA 2B9YA 3GJRB 4ER8A 2YBVA 5HN0A 2E5HA 3CJKB 5DETA 1HHQA 5K8MA 2MGZA 1LWFA 3ZZOA 2WVCA 3POTB 1WHVA 3MTJA 4K0KJ 2B4VA 3VZHA 5GMKa 2DPIA 2COLA 2V4RA 4LFAF 2MTLA 3R9LA 1T9TA 3MM9B 4YQWA 4KAVA 1Q4RA 4M5DA 4ZCIA 4CYUA 2RAQA 4RUHA 3B82A 5GOVA 1P27B 3R5JB 1NAQA 1N33J 2JWNA 5LMNJ 3CJ3A 3FSIA 4ZKAA 2BKPA 2RUGA 1C4CA 3OJUA 1J5EJ 1F5AA 2OPPB 3T1YJ 3W9IA 5J1EA 5KFQA 1SUQB 2W9BB 4DU8A 3FEYB 2CDRB 1RQ0A 4NZ7A 4CM2A 3M1VB 1UFWA 2NXNA 2AU0A 4M5KA 4IO9Q 4ES1A 2HFUA 4ZLJA 2CPFA 1S1XA 1KTQA 2OPRB 4ILMA 2GVZB 5L1LA 3FQKA 3N01A 1SC3B 5BR8F 3R1HA 1S1UA 2HS4A 4LRBA 1IR1A 1F9FA 4EWTA 4KE5A 1B0TA 6AT1B 3HHLB 4CTAA 1TZ0A 2IM3A 3J7YU 2YKQA 4K4ZA 4MH8A 1SL0A 1FFSB 1FJGF 3EXCX 3UCZP 4GRSA 1HNXF 4DSEA 5HL7Q 4CLLA 1BQXA 3GV8B 4JOUA 2GQQA 3IR6B 1RBOB 4ATNA 1AUSL 2ASYA 5GADU 4PG6A 4ZVPB 1MN7A 4GVBB 4X66J 3KKFA 3M6WA 4CT8A 5EX3A 4N56A 4FPRA 1UVJA 3FBEA 1OJ4A 4B9NA 4YB1P 3K5LA 4GC7A 3D2WA 4UOFA 1RT6B 4OHZA 2XO6A 1U25A 4WFNQ 1LWXA 3UFCX 1Q0NA 1JMTA 1OY9A 2ZBIA 3ITHA 1VQMS 4NXMJ 3LP2A 5KFIA 4FN5A 5KG4A 4H4OA 1GMWD 1VFJA 1Y5NB 4USKA 1Z2LA 1FJCA 1VQ9S 2R7QA 3DLEB 3C6UB 3R8YA 1JLFB 4FNHA 3CCWA 4ZJLA 3V6HA 4DSIA 1Q7LB 2W5QA 4MIAA 1FTRA 3F0NA 3KJFB 1MMLA 2FJVA 2HLUA 4B9TA 2KJVA 1NKCA 5IT0A 3FBCA 1H98A 4HL9A 2A2DA 2PA3A 1XTZA 2Y9HA 1YDLA 1V5IB 4UPHA 3IS9A 2F4FA 4G1QA 2JZ5A 1FNMA 1BY9A 2GA3A 3EMTA 5HVGA 3GFZA 5LOQA 4ZN3A 3AOBA 4U67Q 1RK8A 4K4VA 1GQEA 4Z2XA 3SV4A 3WAXA 1OYDA 4NLQA 2UUBJ 4IR9A 4C8NA 2LQ8A 3V6KA 4KB7A 2BA9A 3CD0A 3HVWA 1X5PA 2GMLA 2OELA 1YKWA 4NA3A 3RRGA 4DWIA 4D3HA 3SMZA 2XZDB 1J5OB 3FCWA 3H90A 5DS7A 2OHDA 2VC1A 3MR6A 4Q7AA 5AXNA 3UD4P 3VQTA 4PYDA 3X1LB 5CHCB 3OL9A 1S9EB 2ZVSA 3QGIA 4L73A 3KD8A 5INHA 4TY8B 2AJFE 4HR2A 3RAMA 1BE4A 3B6BA 1V5VA 4WF9Q 2O67A 1TK8A 3KHRA 4X62J 5BXIA 4RKUC 4K8RA 1FDDA 3H98A 1ALKA 3NG8A 5KFVA 1ED8A 2L9NA 3FRYA 3G96A 4NL5A 1S57A 2M8HA 1WNEA 1YRTA 1U6FA 5IZHA 2JFDA 5HLFB 4M5JA 4IG0B 2OPQB 5F8LA 2EPIA 2HZCA 4LR8A 3MK1A 5LRMA 1RAFB 2LU1A 3BGUA 3QMQA 4WIQA 1SQGA 2ZWOA 2CPEA 4ZDNA 2WVFA 2MZJA 1Q82T 5HSPA 3ED4A 2D3UA 4HYKA 2QSFA 2CYYA 4J5OA 1Q81T 5ETSA 3AJ1A 1VI7A 1G4CA 5EUHA 3LPYA 1SJ4P 4DL2A 3M30B 1BXNA 1M1GA 1RB0A 2W8DA 3C6TA 5HVHA 2I5JA 3KDOA 2ZOMA 4USTA 3NKYA 3Q3QA 2HRTA 3HSZA 2VJUA 2C2ZB 5AE1A 2AV5A 3TX0A 4JV5F 2DH7A 4FDFA 2R2SA 1ZH5A 2C42A 4WCEQ 3CJQA 4KH0B 2XCPA 2OMLA 4AQYJ 4X65F 4Y0FA 1HNVB 4MJKA 1LV5A 1V3RA 1MROB 3NY0A 4OJ3A 2ZJRQ 2QLJB 4FDJA 3W5YA 4HH1A 1KRPA 2MQQA 1C1BA 2FHJD 2CPYA 4RNHA 2UXCF 1S1WB 2DNPA 5CAAA 2ZITA 1NPRA 3P5TL 2DIUA 1XC9A 4RZRA 4HDHA 4DPTA 1LWCB 4V19X 4B3OA 4P2FA 4ECZA 2XMAA 2R7OA 1RA7A 1MU2A 1PG5B 2OSQA 4E0DA 5B0DA 4L3KA 2DNKA 4Q44A 4AXJA 1NJYA 2WOMB 2VA3A 3ET6A 5F0UA 2GVDB 3TAMB 1U1NA 1M0SA 2C2RA 1W7WA 1VDHA 4ECUA 2DR8A 1NDCA 4K2XA 1NH8A 5IV3A 1T9WA 2ZBRA 2O5DA 2ASJA 2LU2A 2R3VA 1ZTWA 3UCUP 2BBEA 1KTVA 2GV1A 2OAUA 4UPKA 4OYWA 1WTFA 4P2MA 4LF7F 3PJXA 1RLDA 2K1RA 4IRKA 2UUWA 3SBMA 1NHVA 5C25A 5FLXY 4UZCA 2SXLA 4FPIA 1UA0A 4FVCA 1UETA 2OEKA 1S1TB 1RHRB 1NLKL 1UL3A 2KYZA 4CO2A 4QW9A 1KS2A 3QAEA 2DK2A 4O3PA 3M8YA 4W90B 2CPIA 4DG1A 2G2OA 2WONB 5KFGA 3ZTRA 3NLCA 2XZTB 5GAEI 5DG7A 4CP5A 1CJVA 2EFGA 3FNNA 1N54B 5KFNA 4JI7F 1VJQA 4QIEA 3NKQA 4J91A 4FVMA 3OTOF 1CEZA 1ZAWA 1FXLA 2MZRA 5B0AA 1XMQJ 3J81Y 1Q86T 1P1LA 3OLAA 2IA0A 4NLUA 3RAQA 1RT5B 1JLAB 2GGPA 2DNHA 4ZN1A 2DCLA 1CJKA 3EUNA 1IR2A 4NI2B 2ZKTA 2WVDA 1WC1A 3EYZA 2DNRA 1NJIT 2E7WA 4AL6A 5ITHA 4N47A 3MR7A 1WC4A 2EXUA 4LF1A 2KB2A 3GJQB 2LA4A 3G8TA 1RTHA 2CXEA 4RLEA 1WKLA 3I0SB 1U09A 3EWGA 3QAUA 4DR7F 2MKCA 1FNXH 4NRUA 3AODA 4LSNB 2NUUG 3CCSS 1XMOF 2EI5A 4DX5A 5DQHA 1PAUB 4W92B 1VIOA 2BX6A 2OUGA 3CD5A 1CULA 1ZBTA 4DU7A 2NLWA 1H6KX 4IQMA 4KAIA 2AYBA 3UNYA 4ANEA 3W63A 1HNIA 3G4SS 3KK3B 3IP0A 4NPOA 8AT1B 2OEJA 4O3SA 1HI1A 1UJ6A 4L6V3 3PW0A 4WK1A 2FQQB 4ZGAA 3EDQB 4DX6A 4NYZA 3QRRA 1E6VA 2EFPA 2HIQA 5CYJA 1DHMA 3AH6A 1YSJA 1IKWA 3IBFB 3ZZYA 1KSPA 4UOCA 3EGNA 1AYEA 2DGOA 2BANA 5KG1A 3QZ7A 3OTCA 4DR6J 3LAMA 3CDUA 2E7VA 3CGIA 5KT5A 3HF5A 2F9JA 5KFMA 1N5QA 2BE2B 3ISZA 4OZNA 4PXDA 3R6LB 3GB0A 1T05A 2KVQE 2P2CB 4ZJQA 4B9UA 3PO4A 1FERA 1ELXA 3GP9A 3RBEA 1ITPA 1H2TZ 2ROEA 2IHR1 4QWBA 2W5XA 2MQNA 2HGLA 2OSRA 5T14A 4LFCJ 4ZIVA 2L9WA 1N5YB 3H2UB 2YNGA 3CCJS 5HROA 4QR2A 2U1AA 4CYSA 2YWHA 2DVIA 4DCPB 2XMVA 2YWWA 3V4MA 3MD1A 1EETB 2FIUA 3J7A1 1JKHA 1IM6A 1MMDA 1APSA 1HWKA 1IBCB 2KG1A 4LF9F 3T5LA 3Q89A 1D8ZA 2W8LA 4J7CA 4NYOA 2DNYA 3MPDA 4WKRA 5KG2A 3CSKA 2DNLA 3TA2A 2ZH1A 4ZPDA 4LQ9A 2DGVA 1EB0A 3RBZA 4DR1J 2RRNA 4PG8A 4OYAA 4U7CA 4WXWA 1CQMA 2H48B 1FRMA 1O0PA 1M5KC 3M2RA 7FDRA 5LSOA 2HW3A 2QYGA 3BKTA 3BQ1A 2EW9A 3DRSA 3EXYA 3OW2R 4IRCA 4HHUA 4ZIWA 3V81B 2DGTA 3HHLC 4HTIA 3AXMA 2Y1IA 1RWXB 4DEZA 4BBYA 2CADA 3I9ZA 2KO1A 4DQSA 4KO0B 1HMVB 4DUTA 3KK2A 2NS1B 4V19J 2G13A 2XG8A 1FSUA 1M5HA 2DXDA 3GJSB 2IDLA 4K4SA 1IUJA 2F4VJ 4DLGA 2ZH7A 3CJ5A 4X64J 1NXIA 2GMJA 4FBTA 4Y6IA 4JI3F 5CD4H 1KH9A 4NA2A 3HD2A 3QIPB 2ACYA 5IC6B 1X4EA 2V8DA 5K5MA 2MPUA 5DQGA 3CCVS 4F2RA 4ED1A 4RX6A 4R25A 1KOOA 2DO4A 2D3OR 4K4YA 2HKEA 3HVRA 1VQPS 3RR8A 3VTIA 1HBMB 4R0EA 2KXHA 1GK8A 4JB8B 1CLFA 4UOHA 3QWPA 2XS7A 4L75A 3R2CJ 4TU8A 1RP5A 4LFAJ 3EX7B 3A1YG 3T6JA 1FK9A 5D4OA 5L0KA 1OO0B 1TUVA 4ED7A 1VBXA 4C8ZA 2WCXA 1NUEA 2BJEA 4JI0F 2F63A 4KFBB 4ETXA 4ZPCA 3OPKA 3T00A 2DITA 5KFRA 4I6WA 4DR3F 3AQPA 1VGYA 5DQIA 5ETOA 3TZXA 1FFWB 1R31A 4V1Ak 3O8WA 5HQMA 1RU2A 4ZP6A 1FJEB 4ED2A 2HHQA 4CWBA 2K7KA 3OFHA 1NM2A 4IOBA 4LREA 1JIHA 1Q95G 2OP5A 4CLPA 1TKDA 1JQGA 2VDIA 2LYVA 4HLBA 5DO2A 2D1GA 4W4MA 2JDJA 2QEXS 3JSYA 4ZVUB 1OY6A 3NBPB 3MEDB 4HI2A 1DQ9A 3CCMS 1FFGB 2UVUA 3Q8RB 3HZEA 1H0HB 1PAEX 2H51B 2M9KA 4DV7F 1L3VA 1WDTA 3OT9A 4QWDA 1VYAA 4QW8A 3IGNA 3E2EA 4CO0A 2MKJA 2VG6B 1BWVA 2A18A 2FLNA 5BR8J 1BQMA 2F65A 4Q43A 4MKYA 3WAVA 4DL7A 1FEEA 5E3AA 3C14A 3QFHA 3A52A 4FF1A 4IRDA 1KH4A 3HFVA 4MKBA 1E2SP 2UV8A 3M6XA 2FJXA 3KLFA 1X0FA 4DFPA 4BC9A 3MAHA 4WP8A 2JVOA 1GX5A 6FDRA 2HNDB 1EP4A 5HJYA 3D1OA 2O01C 4LBHA 3UD5A 3HCXA 1FJGJ 3QLHA 1DBDA 1DLOA 2ALZA 2MDAA 1S10A 4WIIA 4IUFA 3FZBA 4Q2LA 1HNXJ 2RNEA 2XWXA 5KT2A 4C3LA 3AOAA 1R43A 3SQGB 2CWXA 1MMNA 2KRRA 3I56S 3KHGA 4G65A 2CFXA 2VZ9A 2XY7A 3IC1A 3SZZA 2K2PA 3N6NA 2GZOA 3Q8UA 1TUGB 2W8SA 4QZVB 3S01A 1H3DA 4ZPWR 5AT1B 3UR0A 1RAGB 3C15B 4WPAA 1VMBA 3C16A 1U2FA 3PHEA 3R97A 4CO4A 2C3YA 1HKAA 5IT9U 4KGVB 4DBQA 4RJVA 1RKJA 1G1XA 5HMZA 5J2NB 2CA9A 2YKAA 3M9OB 3R7BB 2KL8A 5KTQA 3NP5A 1TKXA 4LSLA 1TL1B 1CS4A 4C0HA 1S7IA 2RHSB 3DKDA 2FVPA 4WFZA 2WVBA 4KJDA 2PGCA 3SXLA 2VC0A 3GG1A 5FDLA 3BDGB 1MG7A 5CZVA 2AX0A 5G0RA 5B0EA 4RW8A 2E1MC 3W2WB 1RXOB 2ZD1A 5IXUA 4ZVSB 1KQKA 4DV6F 1IM4A 1TAQA 3K59A 1JJ4A 4NYPA 1OQ3A 1RWNB 2B4OA 4NMXA 3R3TA 5ETMA 3ADAC 4J9SA 2BKNA 2EC2A 1S1VB 1Z4UA 1U45A 4DQRA 1RBLA 2IA6A 4UT4A 4Y2CA 2EWHA 3GFHA 3WHIA 1VJWA 4OFZA 2J7UA 1AW0A 5I3PA 3MFIA 3JQJA 3MM5B 3I0RA 1UKUA 1GTEA 2M2BA 3BN7A 4DFKA 4ZJOA 1U49A 3K8WA 4C3KA 1U8SA 2DEIA 3J7AN 4DL0C 1VBKA 3CVKA 1RDRA 3JSMB 5SUHA 2UXDF 4OLOA 5A8RA 4DXLA 1EJ7L 5KFAA 4PQUA 5AXMA 4DSJA 1RAAB 5KG7A 2YNHB 1WWHA 4QR0A 2XGPA 4HEA9 4O3NA 2VFTA 2VICA 4P9SA 1N5TA 2XMUA 4R5PA 4CQ1A 3NGUA 1HQEA 4LQYA 2B4UA 4OI6A 4J9RA 2Y8YA 3IBCB 5J2PB 1Q8LA 2F8HA 3OFEA 3QJLA 4TQRA 2D3O1 3CC2S 2CQ2A 3B78A 2VONA 3M8ZA 4OV6A 4O4RA 2V9WA 2LCWA 1HNWF 1SH0A 3EZUA 2KVIA 1YITS 1HARA 2Q79A 2CNOB 4PWWA 2IBOA 4C2MA 3V6DA 1IQZA 2P8IA 2VV5A 2W7OA 2QFJA 4EFAC 2KTQA 5E2QA 2FYXA 5L46A 1UVNA 3FBFA 4FYVB 4CH1A 4Y34A 3IRWP 1SL1A 4CLSA 2IM0A 3IXQA 4KAYA 3BGRA 2CQPA 4ZCLA 2DNMA 3K57A 4OJGA 2CDQA 1ZM9A 5HRTA 1M1HA 3FFIA 2ZH2A 3NMRA 2KT3A 4LF8F 2CNNB 5F3TA 4I2PA 1QTMA 3G6YA 3NGDA 3OD2A 4DS5A 1VHFA 1NBEB 4MYUA 3TWZA 3TAPA 2YWFA 4PRFA 4OHWA 1OSCA 2QIFA 5GAHI 4WE1B 1HNZF 3NS7B 1VRQC 3N5FA 1O98A 2ZNYA 4IH5A 2F5GA 1F2HA 4ECXA 2FJAB 5EGEA 3DLGA 3M32A 1T03B 1QAYA 2WTFA 3GIMA 2VPZB 1FWPA 2A10A 3MM7A 1EKSA 1AUDA 3NOGA 1H7XA 3UN5A 1NSPA 4JV5J 3R5GA 1JLCA 3G86A 1ALJA 1VRTB 3RBXA 3RW7A 5D3GA 3ZC4A 4NOHA 1F2GA 5KFUA 3I4HX 4RW6B 1F3FA 2JEFA 2GAHC 4IFYB 4X65J 2F40A 3W3SA 1I3OB 2NYHA 3VQSA 4NWBA 2WBRA 1R6YA 5C24A 3JTNA 2IC3B 1VR6A 1LW2A 1V6HA 1KH7A 3KOAA 4OX8A 2Z2YB 1LOUA 4J9LA 3U1MA 4OI3A 1JLEB 1UFLA 4P73A 1X4BA 4GKKF 5AJ3F 3NL0A 3HKWA 4F3MA 2UXCJ 1LFWA 2OD4A 1WI8A 1XR6A 1LFPA 2IFXA 4BC7A 5M2UA 3MXHP 3I5CA 3IGYB 1YZ7A 5C42A 4PCQA 2CPDA 1RWPB 1SHQA 4AL7A 3HLUA 5LJ5Y 2AX1A 1X5TA 2Z4PA 1JX4A 2GQCA 3FQLA 3DOMA 3PR4A 3SQOP 3MPYA 3HK2A 3KLGB 3MM6A 3H0PA 4RW9B 5I42B 2YQ3A 3WDOA 1CJUA 3EPIA 1NK8A 4IYQA 3IGVA 1P8GA 1UWAA 1CBKA 2UUAF 4MFBB 2HYIB 4QOTA 3QSIA 3UWTA 3BR9A 1A6LA 1SCJB 1NMEB 4LF7J 2GW8A 2XHCA 2QYCA 5J2QA 4YOEA 1NK9A 2XNRA 3NEKA 4RW7B 3KYLA 1Q78A 2R7VA 2A0FB 3IG1B 4H4KC 4DV0F 1RT4B 5KT7A 1TL4A 2YKMB 2HAFA 1VQYA 2VFRA 4B08A 5DJBA 4DHVA 3ZFVA 3RB4A 4O44A 2JLGA 1YJUA 3U02A 3QO9A 3B54A 4JI7J 1I5OB 3FSXA 1ZM2A 3CMQA 1Y5LB 3GIIA 4K5RA 3OTOJ 3I5AA 2EFVA 2JEIA 2O3DA 4MIVA 1HW9A 3H59A 1HPZB 1X5OA 2AJ2A 2BRKA 2PC6A 1P6TA 4NLXA 2W2OP 1RT3A 1WEXA 3M2VB 4KBIA 3CJ4A 2AGPA 3FVYA 1SQEA 3I82A 1VK3A 1EX8A 2PFFB 3PTWA 3PEJA 3TW0A 2IY5B 2C3OA 2J8AA 4C11B 3DRYA 4Q0BB 1T7PA 4P74A 4URQU 3EDRB 2B6AB 1QE1A 1FRLA 2GS8A 3KG4A 4ZHRA 4DR7J 5KFEA 1REVA 3JYTA 3LTOA 2YKNA 3W9JA 3CDBA 4CXUA 2DNGA 3GG0A 3BSAA 2RF2A 1XMOJ 3HVAA 3QJPA 2W4DA 4RNMA 4ELUA 3D5MA 1T9UA 3ZZPA 3A4TA 3BR8A 1LXJA 1NHUA 3RG6A 2MGZB 1LWFB 4J90A 3MTKA 4CH0S 1ZM4A 4U7UK 1MWQA 1QVFR 1XJWB 2KN4A 3CT9A 4NMLA 2G4BA 3JXOA 2CPJA 5KT6A 3DDNA 4GC6A 3HSDA 2LEPA 1KLMA 4ZVHA 5JUMA 3PW5A 2P9GA 4RWWA 1LWEA 4HHJA 4X2BA 5JJBA 4M5DB 2KJWA 2RE1A 3EVOA 4HI1A 4CYUB 4L72B 3ICLA 4NXMF 1ZPWX 1RJJA 3K17A 4PWDA 1YI2S 2GIRA 1ALIA 1AXQA 1URNA 1X60A 2QFIA 3SSSA 3NXZA 4URSA 2VQRA 1RE1B 2H3EB 2IVFB 1YVFA 3E3XA 4ZK7M 2QL5B 1JNRB 3DGVA 4WZQA 1NDKA 2R7SA 1FD2A 3DCAA 3RGIA 4RU9A 4LQ3A 4OYMA 2W2NP 3MMBA 3K7RA 3POTA 4A8WA 3D9BA 4ZP9A 5J1EB 3MK0A 1QDUB 3VAHA 2IAJA 4ED5A 2GFFA 3MUMP 3GIRA 4RPFA 1FKOA 1R8BA 3IBWA 2AQ4A 3PNIA 4O0NA 4PUOA 1RWVB 2K06A 1RWMB 4IFVA 1K73T 2XMTA 3CMAS 4FYXB 1R0BG 4NCGA 3NNAA 3BKFA 4AUKA 3AXKA 3F41A 1NK5A 1G2EA 2BRLA 4LR7A 2GHWA 1S1XB 5LMUF 3CUNA 1L3UA 1SC6A 1RHQB 2L3MA 2MZ1A 1Y9OA 4XIUA 2GQ2A 4P75A 2AD9A 1S1UB 4IDKA 4QR1A 1FTCA 2B5JB 2MHEA 3JTPA 3RR7A 3OV7A 2W5WA 2VASA 3DN9A 2QZUA 2P5VA 2QC3A 4CTAB 4LF9J 1DARA 1OSDA 2QLWA 2O66A 1U26A 3P4UB 3OBIA 3D6HB 5J1NA 3QATA 3OLBA 3SCJE 1Z2ZA 1VC6A 4DDFA 4WFAQ 2Z2ZA 3M1VA 1NZAA 3P5BP 5F0WA 1XQIA 5IT9Y 3Q2SC 1JJCB 3RW6A 3N79A 2VPXB 3MEEA 3L4BC 2IM2A 4PQAA 2RQCA 1H72C 2KI2A 3DDKA 4LIRA 4TN0A 1M5VC 1S72S 1GMWA 4F3OA 3IDDA 5DLWA 1KKHA 2CG4A 5FIIA 1S12A 2V2KA 1KFDA 2B8PA 5CQGA 3UW1A 2YWKA 1AFJA 5AXKA 5LT5A 1VOMA 3DRPA 3H20A 2RQMA 2ZBCA 3MMAA 3W62A 4UW2A 1S5ZA 3RRKA 2D41A 4JI3J 4M5IA 4N5SA 1S6UA 3MFHA 3UO0A 3LAKA 2QL9B 4C0OC 1CPZA 5KFDA 1FRKA 3ITHB 2B3TB 1WEZA 4TQSA 2CVEA 3M6VA 2HHSA 2HEKA 3DDIA 3LP2B 2R8GA 4KH1B 4DPOA 5D0EA 4H4OB 2YQ0A 3DU5A 3WZ0A 4IOCQ 2WHOA 2XEXA 2R8IA 1YX2A 1FRHA 5KFSA 1YJNS 1UVKA 4K4UA 1RUSA 3FK4A 3BH7B 2CPZA 1AJBA 1TMJA 4LRDA 2VFVA 5K14A 2V6AA 2XTJP 5KFHA 4OV1A 2AYEA 4MY4A 4JI0J 3TP2A 3R7NB 1Q8BA 1K47A 3IS9B 4TU9A 3T5KA 4G1QB 2V0NA 1JXLA 2PD1A 2M0GB 4Y2KA 2X1AA 4OYXA 1N8RT 4NXNF 4DR3J 4MK8A 3QPIA 2M52A 4ECRA 3WBHA 1TL5A 3L95X 2XQCA 1ZZNA 2PI4A 5L1IA 1NRKA 4ECWA 4DJBA 5D6GA 1HD1A 5IFMA 4NE9C 2E9ZA 4WK3A 3D0IE 4AT1B 3BO3A 3CNQP 4OYOA 2IJFA 2Z8QA 1SC4B 4CO1A 4KRWA 1U0HA 4C8MA 2DIVA 1EQJA 3NCRA 4DV7J 2LQBA 1M90T 2OKQA 2E5IA 1RGVA 3MAAA 2DB1A 2VFUA 2X7IA 1X4DA 3GSIA 2CIMA 1TP7A 1N6QA 4OI2A 1Q5VA 1G3OA 2KKHA 2APOA 2BEFA 1ZM3A 1L5UA 2DRBA 2HFNA 3N6MA 2BQRA 4HH0A 3PFOA 1RHMB 1SQFA 3GFYA 3PY8A 3QRPA 4XDCA 1H73A 2R2UA 4PKDB 2FY1A 3UPFA 4J9KA 2PIIA 3OR2A 2DY9A 1HWLA 2HQFA 2ADCA 4YEAA 3QNWB 3K58A 1OYEA 3AA9A 5IT4A 4J9NA 2F9DA 5BJRA 1YRXA 1VLYA 2UU9F 2GHVC 2FZGB 1AJCA 2P9CA 4PYAA 3R5CA 2L41A 2B9XA 3H2LA 1RTJA 2ZM6F 1S0VA 1JNZB 4PG4A 2KG0A 4HKQA 2J9DA 2W01A 2RDIA 5A8KA 4CCHA 1AB8A 2HZVA 2G2ZA 4C6AA 2CZ9A 2GAGC 3BSNA 3G2XA 2GNKA 2FHJA 4J9MA 2BR0A 1UEVA 1NKEA 3C6TB 5DM7Q 2I5JB 3EM1A 3HT0A 1X0PA 2LDYA 3UR3C 3WX8A 1N32F 5L0BA 2MLXA 4LUBA 4DOZA 2KFYA 4ZVTB 2QV6A 3TEGA 3MUTP 1NK0A 2W5VA 4FDIA 3N28A 1QAJA 3HO1A 4J37A 3VF0B 4DV6J 4DQQA 3J80Y 2PMWA 2WRMA 5DZ7A 2C22A 2GSOA 3A3NB 2J0XA 4UOPA 3N5BA 5M2RA 3VVTA 5C66A 1TTHB 1C1BB 3X3UA 2FTRA 4JYAF 3DLHA 2B0GA 3BREA 1IJFB 2KXNB 1PC4A 4B3OB 4USWA 2ATCB 4DUZF 2C2DA 1MU2B 2XSJA 1W26A 1U7LA 1JXEA 3P49B 1UVLA 4O4GA 3UD3P 3N9UC 5EGYA 1AROP 2KT2A 1WOPA 3Q22A 5HO4A 4I6AA 3ET6B 4DV2F 3MEGA 1SV5A 3PACA 3LO3A 4P6QA 2Z0GA 2UXDJ 3E01A 1PJ5A 3FKBA 1D1UA 3W8GA 1NDPA 3H4DA 4Y65A 4ZPBA 2C2NA 2MJNA 1FRIA 2X98A 2Z2LA 2ZFHA 4KSEB 1N48A 1Y5IB 4FYDA 3PJ9A 3W8PA 5EGHA 1YWXA 1AJAA 2GO9A 1OIAA 1X4HA 4ZLLA 1ULRA 2ZC4A 3OTBA 1TKZA 1O99A 2K1RB 5D77A 2IJRA 3CJ8A 4RO0A 3DRRA 5C25B 2CNLB 1HFEL 3DM2A 1HWUA 1HNWJ 4TLRA 3DLKA 2PEHA 3HDSA 3M9NB 2AGQA 4C8LA 3PKMA 3KDNA 5GAEU 1O6XA 4NZ6A 1VQLS 4DG1B 3TUZC 4ZS6A 4AD6A 4OZLA 3PX6A 1Y4ZB 4USMA 1CJVB 3T9NA 3W60A 1YBTA 4KPCA 1SI9A 2PMHA 2E29A 4WKYA 4USIA 4EMDA 4LF8J 2AJ4A 4DN0A 1RT1A 3AOCA 5L9XA 3SCLE 3QT8A 4IH7A 2YH1A 2BOPA 2AF6A 1U8WA 2V8GA 5CYQA 4P10A 2E9TA 2VF3A 4OZ1A 4F36A 4DV5F 2GX8A 2W7AA 2RH6A 2GGPB 5KFKA 2R2TA 2LEAA 1HNZJ 1AZSB 3TARA 1CJKB 2ZDPA 5AE3A 3AA8A 3KJVA 2PO4A 1YGYA 2CJ9A 3BDEA 3TJAA 3C66A 4U95A 1TK5A 3H5UA 2ZUGA 1FF2A 2IBKA 3EGZA 4KGKA 4R0JA 4BWMA 2V4JA 1RTHB 3GFXA 2XBPA 4ZCMA 2KZMA 4RWXA 2R7UA 3HHNB 3AFGA 2WSEC 3UDCA 2WK4A 4B02A 4KV8A 1JB0C 3ZTQA 3QBCA 2BXJA 2DGUA 1IQTA 4QWCA 5B0GA 1WD6A 1CULB 3DRXA 4HVZA 2MZSA 4UUXA 4UPLA 1UVMA 3OVBA 1RTIA 3QT6A 5A2QU 3OR1B 1SC1B 1HNIB 4YR3A 1SH2A 1SH3A 2LLZA 1B99A 3VAMA 3G82A 4B3RF 2JHEA 2I38A 3PYGA 4GKKJ 4K7QA 2J9DE 5AJ3J 4B9VA 4ZPTR 2QA4G 3TOQA 3TJ9A 1FE0A 1MSWD 1FRXA 3W65A 1NJWA 1E6VB 3BZQA 4EK2A 5KFWA 2V8HA 4YY3F 1IKWB 2DTJA 4GTZA 3NOCA 1U47A 2QA4S 1D09B 1CSJA 2NCKL 4KTQA 2OIHA 5EHHA 2VQEF 1S6OA 3MR5A 2C1EB 3J81U 4AL5A 3TZWA 4WP3A 4PXBA 1VRUA 2HNZA 3PHTA 2MLZA 1KQFB 3ENAA 4X4TA 1TL3A 1ELZA 2WAQD 3TVZA 2DBBA 2MZTA 4ZG7A 1WC3A 5H9EJ 1T05B 2ZNZA 4WTYA 4FKYA 2K3KA 3I32A 1S97A 4IKAA 5DDOC 1EARA 2UUAJ 3VZIA 2EC0A 3H4BA 3UDVA 2KYXA 3RU0A 3TZZA 1UW9A 3LA0A 2I6WA 3ZNJ1 1RACB 3SEOA 3DHXA 2J7WA 1UA1A 3JQMA 3NKRA 2YNGB 2CQIA 1Y11A 5HROB 3EZ5A 1ZA2B 2NYIA 2ZE2A 1PJ7A 3H8YA 1L3KA 4DV0J 3B5QA 4ZVRB 3AB4B 1JKHB 1VBYA 4DZDA 2CJQA 4DQPA 1RT7A 2VG7A 2NZ4A 5DLTA 4N77A 5H9EK 2OI2A 2OO4A 5KFTA 2C3MA 3MPVA 1WG1A 1WI6A 4KIAA 1UPPA 4NASA 5CCMA 3E2DA 3M2RB 4TXSA 5E3CA 2V9KA 1V3ZA 3GTYX 2GC8A 3FEXB 4KQZA 3DRSB 2R7TA 1B7YB 3LP1A 4JBCA 2FHMA 2QN6B 4ED8A 2HAIA 4DL4A 3DHWC 3BBCA 3OVAA 4C97A 3OUYA 4N76A 3ENQA 4X4PA 2VB6A 2H4YB 3KK2B 4X4QA 5GAGI 1UCNA 2QTWA 3EICA 3K0JA 2OEMA 3PFEA 2WB1D 2W4PA 5LXRA 1F3VA 2EBEA 1F5CA 2FLPA 2D7SA 3LOUA 4A8OA 4B9SA 1DAXA 1IKYA 2ACMA 3GZ7A 1B4SA 5EWEA 1C2PA 3F44A 3VWSA 3LQVA 2E5LF 4KGZB 4JI8F 5ETKA 2EVZA 2V5HG 2RVJA 3PDNA 2G9OA 3VAJA 3N4WA 2CG8A 2QMWA 2MSSA 3NGSA 2AT1B 4CLWA 3QWUA 3ZZZA 5BYQA 1SL2A 2EEYA 3UDEA 3SI8A 2D9PA 5D0GA 5ETLA 3KK1A 3OFGA 1XK8A 5DDQC 4PR6A 3OTDA 1FK9B 3CCZA 1HBUA 5B7WA 3MOJB 4ENOA 3V2UC 1Q16B 2JEGA 5K4PA 2YY3A 1ZEDA 2W2MP 1LXNA 2RKIA 3D1QA 4E8UA 4N41A 4YB5A 1HYSA 3K5OA 5J2MA 4I6YA 2FJBB 2B4PA 3ONQA 2N4DA 4KPYA 2E44A 1S4FA 1WJ9A 2BM0A 1C1CA 4QQBA 2GLQA 1JLBA 2HVEA 2IPOB 3HHLD 1RABB 4ANDA 3TQ1A 1QVGR 1WHWA 2DNZA 3UNGC 2QSWA 5IQ6A 2BVZA 2NREA 1BGXT 4RU2A 1D3WA 3GCXP 4KFBA 3CCLS 1UVIA 2CZVC 3GLJA 5ETNA 5LMUJ 4ED3A 2JFKA 3KLEA 1WELA 1BQMB 2QLFB 2OTLS 2YNFA 2P9EA 3NKMA 2AP6A 3C14B 1PBUA 3PW2A 2RDDA 3FBBA 3KLFB 1UP1A 2HHPA 2XNQA 4O3RA 2MSTA 1NPPA 3CCQS 3KLIA 3C8YA 3BGFA 4FXWA 1NK4A 1EP4B 2ILZA 3F56A 5DRKA 1RKIA 2LEBA 1VLOA 4OJHA 6FD1A 2XB2D 2XRGA 3QLHB 2DR5A 1DLOB 3PRDA 2ZBQA 1KOHA 2DEJA 2C3PA 2HS3A 4NLYA 3CD6S 2ALYB 4K5SA 5HK4A 1J27A 3OL7A 4IR1A 4XTTA 3DFEA 4U8YA 3A8IA 1HI0P 1QLNA 3SDEA 1EIYB 5C2CA 1PCAA 1KC8T 2VIHA 3TG0A 2VU5A 5HBMB 3QJJA 5KT3A 3GIKA 2VBYA 1B3TA 2WSFC 1QJHA 3GQCA 3MGJA 5BYSA 3A8KA 3C16B 3IM8A 3S1TA 4USJC 1NNDA 3Q86A 2Q3PA 4KR0B 3A3OB 5F8IA 9ATCB 2G2YA 1KHLA 2ZOGA 1WF2A 5KG0A 4EGLA 3SQGA 2HHUA 5LIAA 1X4GA 3U1LA 1TVRA 1GH8A 1TKXB 2JVRA 1CS4B 2LXIA 1WF0A 3KJQB 2ZH9A 1I94F 1HA1A 3P96A 3D28A 5KFCA 2HFZA 2BJ1A 2AIRB 1HBNA 5G0RB 3PJWA 5D4NA 4RW8B 1RT2B 2ZD1B 4QIVA 4CIOA 1LK5A 3CMES 1PSDA 2L48A 5CH7B 3C15A 3MUVP 3ISND 1TL7A 3UI3A 1T95A 2ANHA 5D8HB 2ZKUA 4DR2J 4PPZA 4NXNJ 2W7PA 5B09A 4QPTA 2DHAA 5KOXA 2XR9A 3EVWA 4LF4F 3EGWB 4DV1F 2ZDOA 4TY9A 3H5SA 2Q66A 4JI1F 4DX8H 2RU3A 1TU0B 3C46A 3I0RB 2W5SA 4PWUA 2H5EA 3WQPA 4LR9A 4DZ6A 4MK9A 1IBKF 3IAM9 2FJWA 4HT7A 5KG5A 4B9LA 3R2DJ 3M8PA 5A8RB 4I56A 4PQUB 5DG8A 1FKAF 1VBZA 3JS9A 4C98A 3CIMA 3M6UA 2HMIA 3D67A 1U6BA 3BQ2A 3Q8SB 5E3QA 1HQEB 3MCMA 4CM0A 2PDAA 4N8NA 4CLTA 1R8AA 3BGOP 1AFIA 7FD1A 4U6PA 1B8JA 1WG4A 2WZ1A 4ICLA 4TU7A 2YKOA 3V6DB 1O5JA 2N7CA 3MOZA 2HWIA 2B9WA 1HWIA 2VPYB 2JC1A 2IRYA 1UWBA 5B0BA 4DUYF 2Z57B 2OJ3A 3VALA 1DTTA 2Y8WA 3BGRB 2KHCA 4QU7A 3VGTA 2HWTA 2X1BA 2RD5C 4M5HA 2UU9J 3FFIB 4EUVA 2XYGB 3IWXA 4TVAB 3GSDA 3AAWB 4I2PB 4JI4F 1F1BB 1VIXA 1M1KT 1ZAXA 1GXLA 2D1CA 5GAHU 5L9NA 2ZM6J 5L1JA 5A2QY 1XR5A 2J0QD 3J7ZT 4BLGA 4AYBD 1U1OA 1WC5A 2IUCA 3D6TB 3UN2A 4UY85 2QT7A 1UEKA 5KG3A 4A8KA 3DLGB 4DMZA 3M32B 2NUHA 3ILLA 2ZJPQ 3CC7S 2IMOA 2CKWA 1N32J 3MM7B 1FXDA 3T1HF 3OL8A 1HQ2A 3D6FB 3R27A 3IGZB 3CEDA 3NVLA 1N88A 3DYAA 1DTQA 1JLCB 3OQ2A 2ZHOA 2VQFF 5D3GB 1H7WA 2C2EA 3H5XA 4ILLA 1EHWA 5L8RC 1YK9A 2ZVIA 3GWCA 4TYAA 1X4AA 5KFBA 3S7RA 4LF2A 5LXYA 5C24B 5L39A 5L38A 1QAXA 4ID8A 1Y00A 3C19A 4OQJA 4A8XA 1NJZA 1YLXA 2G0CA 3H40A 2E9RX 4JYAJ 2K7JA 3AD9C 3VGVA 3ZZRA 2C3UA 3BDPA 4URGA 1GMUA 5E3PA 2ZH4A 3LPEA 3BSOA 2DNOA 4DUZJ 2VPWB 2Q6BA 5GVQA 4ZLNA 3TRGA 5C42B 1FA0A 1YIJS 1TMMA 4DS4A 1SKRA 1S76D 3IR5B 1DURA 5D4PA 1FDNA 5HVFA 4Y3CA 1T02A 3FEZA 5BYRA 4DV2J 2ZEJA 3DOMB 5B0CA 4ETZA 4I0WA 3V4IA 2BJDA 3CW2C 2MZQA 1VS3A 4NCAA 4ZITA 4RR5A 4KC5A 4NCBA 4YP3A 1CJUB 2QX0A 4RNNA 3CCRS 3MMCA 1QD1A 4ZPVR 4EO8A 4FF4A 1U6ZA 3PW4A 2ASDA 3ILJA 2FB0A 2YX1A 4HACB 2BMBA 3O1LA 2GSUA 5ETRA 1IBMF 1SVDA 2E1AA 1WEYA 4EO6A 2XI3A 1NSKL 2AJQA 3M9MB 1WKKA 3ZTOA 1X8DA 4DI6A 3BS9A 4LF5F 3LANA 1E1ZP 1F60B 2D3ZA 4FXDA 4WXOA 4WTOB 4A8FA 2ZC3A 4I7FA 2U2FA 4ZVGA 2OPSA 1IBLJ 4O44B 3IA0A 1ICEB 2BQ3A 3HHDA 3KFWX 2B56A 2QGFB 4X4OA 2RIJA 3QO9B 2DXEA 3AD8C 4M95A 3G8SA 3Q8VA 5SZTA 3VGSA 2FJDB 1GT8A 2ZH3A 3CJ0A 4A8QA 3CMRA 5LJ3Y 3H42A 3T5JA 2HHTA 2V8PA 2QG9B 4DV5J 3N6LA 3LXQA 1VQKS 1RT3B 1JLGA 5TJ3A 1YJTA 1KHJA 4IQXA 1ELOA 2HK3A 3T3FA 5E33A 2YKMA 1UMJA 3CJTA 2XWYA 1S9GB 3LGNA 3KMSA 5HJXA 1AT1B 2N7YA 3IAS9 3TAQA 1RYRA 1WHYA 2EK1A 1QE1B 1Q8IA 4DV3F 3QFWA 4ZHRB 2LP4A 3HM9A 4WJBA 3PRVA 1REVB 3JYTB 2YKNB 2WW4A 1R89A 2IVMA 1S6QA 2RF2B 3IRXA 1X9MA 2HLTA 2FGOA 4C0BA 1KNZA 1V9OA 3QYYA 2NPFA 2RHQB 2N4CA 4LT6A 4JV0A 3IR7B 4I2QA 2EBGA 5IM0A 2N3OA 4DR5F 2FZCB 1K8AT 3O3LA 4ZG9A 3KUEA 4DQIA 2DD8S 1ZEBA 3W61A 4YR0A 4B3RJ 3RZAA 4FXVA 2F1FA 3CO0P 1E6YA 1KLMB 2XI2A 5DZ6A 3VAIA 1Y3JA 3U1NA 2AJ1A 1LWEB 1NPKA 5ETVA 3WAWA 1VC0A 2HNYA 3GYXB 3FDSA 1N52B 3SZYA 4EI2A 5G4DA 4YY3J 2FLLA 1T3OA 2VODA 5IQQA 3I55S 1HBOA 3NCQA 1XNRF 2VQEJ 3FCVA 1RI7A 2HBQB 2F7VA 2H5IB 1F9HA 3TVKA 3MMBB 1F6TA 2L08A 4UOGA 4QYZK 2ERRA 1ZYQA 4P2SA 2IAJB 3F73A 1ALHA 1FKOB 1X4FA 2W2QP 4ITSA 4PUOB 4X4RA 1O8BA 1C0TA 3D4JA 3VHQA 4IFVB 2QE5A 4UPIA 3M8WA 3TQEA 1Q7YT 4NCGB 1N2LA 3CWJA 5B0FA 2BOAA 4ECQA 5LM7E 2ABYA 1JLQA 4OX7A 2V68A 4PG5A 1TFYA 4UORA 4IDKB 4DR4F 3RAXA 3B4MA 2KFNA 2W8KA 3DMJB 3QT5A 1IKVB 4P52A 4F4KA 5HMXA 5ADZA 4XO0A 2P6TA 4BWJA 1RZMA 2J0SD 3KLHA 5F9LA 3O5TB 2GJFA 4RBVA 2UP1A 3MEEB 4L74A 3D3BJ 3U7JA 4LSZB 2NZCA 3SCKE 1PYSB 3IMQJ 3HHEA 3VCDA 2XLIA 2CQBA 5LQQA 1SHNA 2D74B 3GR0A 1GMVA 4JI5F 3NWGA 5HATA 3P3DA 2E66A 1SB6A 3M2UA 1ZEFA 2B5JA 2R8JA 1RSCA 3DRPB 4NLGA 4DFJA 3MMAB 2NXEA 1SJRA 1N5VA 3KG1A 3GMGA 3TVYA 1NEEA 1DY3A 3CDEA 3D3CJ 4CT9A 3OTEA 2RU9A 1B7FA 2IJNA 2YWEA 2BKOA 1CG2A 2BQUA 4EEYA 1REGX 4UQTA 2E5LJ 4JI8J 3ZO7A 2XM3A 3O2IA 1VCTA 2CJBA 1BLUA 1WSVA 5F8HA 2HVHA 1X9SA 2ASLA 3JAMY 4Y2AA 3WX4A 3DC2A 2LXUA 4LF6F 3AT1B 2BV3A 2AYMA 1RCOB 1Y7PA 4AE5A 2FVSA 5KOWA 2NXJA 2DO0A 1VQ8S 2LQ9A 3BDHA 2W2PP 2Q43A 2IYGA 4ZVEA 3L9ZA 5K14B 2AZ3A 1ZTTA 1LKZA 3BKUA 4E2FB 2YXLA 5E3RA 1FWKA 4MHXA 5E7OB 4F4AA 2VG5A 4DX7A 1ANIA 1R7IA 2FDNA 3H2VE 5L0EA 3JB9k 2Q1LA 2ZZNA 4DCJB 4Y2IA 4F7VA 2CAJA 4LVOP 4DFMA 1FWLA 2XYHB 5ETTA 4F25A 3GYGA 2AHOB 2CQ4A 1NB7A 1U0HB 3HVTA 4PXEA 2ZZTA 3GCWP 1FI4A 1Q79A 1T9VA 5IC4B 2XCAA 2FJEB 5I4MA 4EBEA 2KM8B 2YNIA 3NS5A 2FZKB 5DG9A 5EWGA 3MAAB 4Q2MA 5F9NA 3TX8A 2VOOA 2QJ3A 3GV5B 1YG0A 4FYYB 1ED9A 3PYEA 1U1RA 1N6QB 5HP1A 4KY3A 1U1KA 4P7TA 2O1PA 2KFZA 2VKRA 5DDRC 1EQMA 5E41A 3BJYA 3TUJC 2G0IA 3UVJA 1S6PA 3DOLA 4Q8EA 2N3LA 1HHSA 1OMSA 2AEFA 2W9CA 2XO7A 4GTWA 2M7SA 2ZOFA 1AJDA 2A3JA 4Q8FA 3GPAA 3HHKA 3BYPA 3OR2B 1VQ7S 1VHIA 2CVIA 4QIWD 1Y7AA 1XN9A 3VR1A 1VISA 2H5JB 5ETQA 4CZCA 2KU7A 1TV6A 2HQIA 1AUKA 1I1GA 3FSYA 4TLQA 3G6ES 1RWOB 3Q2TC 2EK6A 1Q53A 3AJDA 2GJ2A 4IO1A 3HJFA 4LRFA 2X3DA 2MMYA 4NEZA 2DNNA 1NO8A 1RTJB 4I1TA 2HFSA 4F0MA 5KFXA 1JK9B 5A8KB 2IM1A 1U0SA 3HZGA 2DGWA 2Y3YA 2HG4A 3ILOA 2HHWA 2V2ZA 1T11A 3HD1A 2MXYA 2NQPA 4WBFA 4NLRA 5D4LA 1BUXA 3U27A 4FZVA 3KMQA 1S0MA 4NRTA 4WU3A 1P49A 4B56A 5CYMA 5DDPC 1HL6A 5KG6A 1NH7A 2VUGA 2JLFA 1I94J 3BBFA 2MQOA 3QSYB 3BB5A 2C2MB 2IFYA 2MKYA 4I67A 4W98A 2HRYA 5JVGQ 4B3SF 5AE2A 4ILRA 5L1KA 4LRAA 2ILYA 4WZMA 2HQDA 4PEOA 1K7HA 2QZ8A 5T7LA 4YDDB 4LF4J 4DV1J 3D6MB 4JI1J 1N5SA 4Q45A 3IWNC 4WFYA 1XWLA 2VOPA 3O44A 2HHHF 2B8QA 5M2PA 3BO4A 2AJ0A 2WB4A 2XSJB 1IBKJ 1GXTA 2DH8A 2EG2A 4O4GB 1FVQA 2V34A 2UXBF 4O0IA 4EU0A 3ZZUA 3BH6B 3PCOB 2DGXA 3MEGB 1NK7A 1RHKB 1ZPVA 1SV5B 4MKVA 1MN9A 3E01B 3CCUS 1KFSA 3MM8A 4DF8A 4MK7A 4YB7A 1RWKB 1VQ4S 3ZTPA 2QLBB 1ACMB 1ZZFA 2JX2A 4CLFA 2Q6CA 4ANCA 3WIVA 1QAIA 3W2VA 1TKZB 2F8EX 2HQCA 3TUPA 5JMNA 2HFOA 3DRRB 1BQNA 3DM2B 1RAHB 2PN6A 1UJ5A 3P6YC 5D0RA 2CUYA 3IM9A 4HHHA 3DLKB 3IO1A 1PILA 1R27B 1CJTA 2MKHA 1VQSA 3GONA 3J80U 4C7QA 2DPJA 3PIOQ 4DUYJ 3DI6A 2HZAA 1BC6A 1DZ5A 3PIPQ 2OGUA 3NRBA 3GIJA 3V6JA 4IG3B 1VQ6S 1CC7A 3UQSA 4RL1A 5D0HA 2LDIA 1ZAVA 1NSQA 1T94A 4KKOA 3CCTA 4JI4J 1RT1B 2YX4A 3G6XA 4EBDA 3VAKA 5CYQB 1V3SA 1UJ4A 4NLSA 4GO7X 1MWZA 4ZLPA 4CO5A 1RTDA 1FX4A 4NWJA 3LUYA 4KGMA 4GTYA 2FUG9 3KJVB 3HFZB 1SKWA 3KNGA 3M8QB 5CCLA 4JV2A 1R0AB 1S49A 5DGBA 3LWLA 1TKTA 2H9ZA 4U96A 4F3QA 2IRXA 2FY8A 4FYWB 1M5SA 2V4JB 5IJQA 3NCPA 3T1HJ 4C8YA 1H2VZ 4BCAA 4OZ3A 4ID5A 2ZH6A 1FKPA 5H1SV 2VQFJ 4CRJA 4ERDA 4KV8B 4CH7A 3DGPA 3DOKA 1M5OC 5AXLA 4FKXA 5EDWA 4ED0A 1EW9A 1KQGB 2QMUB 2K8GA 4H4MA 4DV4F 3K5NA 3NS6A 4RW4A 3P8BB 1AZSA 1RTIB 2AGOA 2DRDA 4ELTA 1HQUB 3C2PA 1NK6A 2DGSA 3MD3A 3OL6A 3G82B 2RMLA 4NLVA 3GU0A 2MLYA 2WSCC 1LQ9A 1IKXA 2A1BA 3MECA 5IJSA 4ZP7A 3R7SB 1HI8A 3DNCA 1GEHA 3MCSA 5F8GA 2Y1JA 4NLPA 2DXFA 4XK8C 4R8UA 1Y0HA 1EW2A 3LP0A 1X7VA 4KHMA 3ENVA 2RILA 1LW0A 2BDPA 5A0YA 5KFOA 1VRUB 2HNZB 2YVSA 1F0XA 5T41A 3W7BA 4C48A 1TL3B 2BJ9A 5EX0A 1C0UA 3OR1A 3E51A 2FHKA 3A3PB 1VQNS 2W9AA 2AYGA 5I3UA 5D15A 3H25A 2ZUAA 5HAOA 4NLWA 3JSRA 4QWEA 2FVRA 1N2KA 4F0KA 2J0WA 3OXFA 3DLBA 5A8WA 2F8MA 5I3QA 1IBMJ 3OFFA 1FX2A 1X31C 3RYLA 4KHPF 3SCIE 1PGZA 3CJKA 2W25A 2F3JA 4LFBF 2ZE2B 4F26A 2LECA 3VV2B 3HSJA 4H54A 4LF5J 2RQ4A 3I4PA 3FJ2A 1RT7B 2VG7B 4M5MA 3JTOA 4OYIA 4QPXA 4OZ0A 3KWMA 3MM9A 1C4AA 4USUA 1KONA 1FVSA 4I64A 4MIWA 1L3SA 4OI0A 3AQOA 4A8YA 3RBDA 2HHVA 2DISA 4ZG6A 4DL6A 1RYSA 2M4MA 4I69A 3LP1B 2RS2A 1WOSA 5HMWA 4UY8T 5GAGU 1Z1ZA 2H54B 4PZVA 3I9V9 3OUYB 4MIBA 4OMFG 1QSLA 1SJQA 3SSQA 2YPYA 2OPPA 3GE9A 4OHVA 1KH5A 4NEYA 3JQKA 3A8EA 1SUQA 2MKIA 2W9BA 4B3TF 3PVXA 2BJ3A 2MQMA 4OZJA 4FS2A 4UZBA 1OWXA 3US5A 1KBRA 2MQLA 1IKYB 2VHGA 5H9FJ 4DV3J 3SFUA 1N4LA 4MAKA 3E8OA 3MAQA 4QCLA 2OPRA 2J7KA 3ELHA 4X84A 2GVZA 1B64A 4K50A 1HR0F 2DR9A 3IN5A 3S8SA 4O23A 1QM9A 2BE9B 3KHLA 2GHPA 3FZ2A 4DR5J 4CNYA 3AY0A 3HHLA 1W25A 1X4CA 4AXIA 1VQOS 2V8VA 3KK1B 2ATLA 4ZVQB 3AJ2A 3LWMA 5IWAF 4Z7YA 2CQ1A 1HBUB 1URBA 3PW7A 2E1PA 3J7YI 4K59A 2BZ2A 1N34F 8RUCA 1D9DA 2BUNA 5C5JA 3J7Z5 5H9FK 2RKIB 3QT7A 1A7GE 3ZXWA 2UZAA 1P9YA 3HXMA 2FD2A 2UV8G 1HYSB 1PYOB 5J2MB 2HK2A 4Y28C 2YWGA 3WIUA 1XNRJ 1WDDA 4L3NA 4MMOA 4JI6F 1S59A 2UVVA 4GVBA 4XAKA 3ZTSA 1YJWS 1C1CB 2RB7A 3G71S 1NZ8A 1FESA 2H1YA 1JLBB 5GADI 3EJMA 1ZS6A 2CWKA 1LNQA 5K8OA 3KHHA 1Q1KA 2RRAA 3CULA 1RT6A 3NGTA 1N0VC 3T1AA 3K89A 2HGNA 5LSLA 3K8VA 4PABA 1QSYA 4OIXA 2VL1A 2PT0A 2QA1A 3QGHA 5DGAA 4YHHF 3DLLQ 4DR2F 2Y0BB 4DPUA 3OHAA 4QU6A 1FXRA 2DHHA 2QRRA 1K0TA 4D3GA 4TN2A 3KLEB 2I8EA 3Q8QB 2R8HA 1E3CP 4CLKA 2YNFB 4QWAA 2UUCF 3DLEA 3R5DA 4DR4J 3C6UA 1JLFA 2X1GA 4B3MF 1YQHA 4F4XA 4RUAA 3EZOA 2W5TA 2BACA 3KLIB 1B70B 2KM8C 3L3CA 4HDGA 1VK8A 3CTRA 4YDXA 4UF4A 2YPZA 1KN6A 3BF4A 4K4TA 3BM7A 4KM4A 2DYAA 5KFPA 3THTA 1YJ7A 3MDFA 2PEBA 3GYNA 2I0XA 4C8OA 1MLAA 1YTYA 2IRUA 2D69A 2D9OA 3AB2B 3SV3A 2VBWA 1SIZA 1NU4A 4M5LA 4QIFA 3K5MA 1ROFA 1RADB 4JI5J 2JOQA 4DPXA 2Z2MA 1TQLA 2NSBA 3SDEB 1AA1B 2G1DA 4N8OA 4ZPAA 4A48A 2LXFA 2B51A 3ISNC 1BHNA 2HQ3A 3MK2A 2ZWPA 3R5BA 2BE7D 1FHTA 2C28A 4CO3A 1IVZA 2LFVA 1U2RA 4JV1A 4IH6A 1J5OA 4KYZA 3PX4A 1N36F 3PYFA 2MJUA 5A6PA 3FMWA 2VBZA 1TVRB 2JJ4D 3NAHA 2R9LA 4OZ5A 5CXTA 2ZHBA 3TJ8A 3HFKA 4LF6J 1S9EA 4FS1A 1U1MA 1H74A 2MHNA 1TUWA 4TY8A 2C2OB 1N0UA 1HBNB 2KDOA 1UW4A 2VD3A 4I68A 5HBMA 1WF1A 2MQPA 2FPHX 1ZETA 3O6QA 4A8MP 1DQ8A 5KFZA 5LSRA 1N56A 1TL7B 2HHXA 3FUYA 4GKJF 2LKZA 3A8JA 1JWWA 3RJMB 2VBXA 2OD6A 2R4FA 2JRSA 3LW5C 2C2KB 1S99A 4KJIA 5HLFA 1HHTP 4IG0A 2OPQA 4DCOB 4EZ6A 4ZP8A 1W2IA 3T19A 3MF5A 2UVRA 3G9CA 4JI2F 3LALA 4M63A 1GTHA 4C4WA 2X1FA 3QGPA 1JJ2R 2A6OA 1RT2A 3MURP 3MR2A 4ZA1A 1Q8KA 2FLOA 4F67A 2Y0SD 3M8PB 3WC2A 2FC9A 2V94A 5EN1A 2XMMA 3M30A 1J2VA 3CD7A 3TR5A 3M8SA 1WG5A 2KRBA 2HMIB 4USHA 3PG9A 3ZNUA 4MT1A 4B9MA 3MI7X 4YN3B 4ECYA 1HW8A 3BPDA 4OX6A 2DRAA 3HKZD 4F8RA 1S7HA 1DRZA 3TA1A 1SJ3P 2I1RA 3CJSA 1PJ6A 1FE4A 2V2VA 3DPCA 1DQAA 2ZH5A 1BWEA 4ICLB 3D1HA 2PMZD 3NKNA 1HD0A 1YRUA 1KQSR 4XDDA 2CJKA 1QUVA 4UQGA 2DR7A 2DJWA 2KH9A 2CJAA 1HNVA 1Y10A 3CE8A 1TELA 2CNKB 4CLUA 1MROA 3FC9A 4WYWA 4YR1A 1UWBB 2CJYB 4PG7A 2HSEB 2ROPA 2MKSA 1S1WA 1DTTB 3A13A 2M3DA 2R8KA 2DT9A 1LWCA 1U24A 2K3IA 1VQ5S 2G0JA 3LF0A 1XERA 4CI0B 1KHVA 2BJ8A 1EZZB 1OY8A 4O3OA 1RCXB 3Q23A 4DPWA 4A4JA 2WOMA 2GVDA 3TAMA 4OX9F 1CC8A 1H2UX 3GILA 2PFDA 2IUCB 3DXBA 1RAJA 1XMBA 3V5RA 3H5YA 1IBLF 4E98A 2DKOB 1XNQF 4CLYA 1FCAA 4S0MA 4B17A 2Z56B 1Y6VA 3TNVA 3ENWA 4OYPA 4DF4A 1GNKA 3M7VA 5FD1A 2W5RA 1GFWB 2ZHAA 5K8PA 4NLTA 2HS0A 4Y2MA 4DL5A 4GMKA 1FT8A 1UEUA 1DTQB 3DYAB 4M1KA 2MQ8A 3H7HB 3TI0A 1SJFA 1LK7A 4K2JA 1WHXA 2RDJA 1M5PC 2RQKA 1S1TA 4MYTA 4B3SJ 4A47A 1KEKA 4F4YA 2GJIA 2CQGA 1RU1A 5IV4A 4GVLA 4LBPA 5DLFA 4WYLA 1IN0A 2BW2A 2XULA 1XR7A 2WONA 4U8VA 1MW7A 4ES3A 2XSFA 2JEJA 3CF5Q 2HHHJ 3TANA 1QY7A 3W1YC 4ZMMA 3D66A 2FVQA 3C3LA 4RUBA 2HURA 4QAXA 3BGLA 2B7BB 1YBAA 2J8SA 1QSSA 2R42A 1EQ0A 4LBIA 2UXBJ 2R7XA 1RT5A 1JLAA 5KAKA 2E1RA 1UAWA 5B08A 2R2RA 3HT3A 5C7PA 1IWAA 4NI2A 3QGGA 1VC5A 3PV8A 3V4IB 3CJRA 4RBUA 2BJ7A 2MKKA 2HVDA 1LEOA 2FC8A 5GMEA 2CJXB 5E5NA 4HT5A 1PYTA 1KLNA 3EPGA 4RNFA 3MMCB 2AWZA 1U1LA 1MNEA 1BMQB 1GAOA 3I0SA 2E5GA 3PM9A 1RTZA 2AEMA 4USVA 5K20B 4C3MA 3P45B 2FVCA 1KP6A 3MEKA 2BANB 1CVJA 4LSNA 4CDIA 1R8CA 2NXCA 5F8MA 3G8QA 1KR4A 1NDLA 1NB2A 1X5SA 2OFGX 4FNIA 5IOLA 1RWWB 2ZH8A 4K0KF 3KK3A 2JNJA 1FDAA 2MYFA 5THWA 4I7FB 2OPSB 4MTPA 3L7UA 3G6VA 1S0OA 3HJVA 3A12A 2DCUB 1SPBP 2GIQA 3UN3A 1T9XA 4YR2A 3KG0A 1FO1A 2GSNA 1SIWB 4HACA 2XYPB 1N33F 3WC0A 5LMNF 3HI9A 4NA1A 1H38A 4RNOA 3WBZA 2YTCA 4WFXA 1RAIB 1J5EF 1HDHA 3NNCA 4F04B 1JLGB 3FMBA 2J9EA 5MAOA 4OJ1A 2BE2A 3T1YF 3EE3A 1NSAA 4FF3A 4BS2A 1XIQA 3BV8A 4J9PA 4H4KA 3CC4S 5C2GA 1ANJA 2IDEA 4ELVA 1F9EB 4ED6A 3M8RA 2ZBPA 2JL9A 3RB0A 2LMIA 2MEWA 3CIZA 4IOAQ 4P71A 3EVMA 4TNOA 2Z30B 1B0PA 4UTGA 1S6QB 3IRXB 1N5YA 3KNAA 1NHKL 2H65B 2HQGA 2GMHA 5JVHQ 3DXSX 1EETA 5IS2A 5CABA 2CQDA 4DV4J 3D54A 4RUCA 4ZVOB 2I2YA 2M8DB 2KHDA 3RB3A 4HTJA 3SZ2A 4I2QB 5IM0B 2G9YA 3B4DA 2XS2A 2RSQA 2WBMA 2HVIA 2DR6A 5D78A 2CPHA 1E6YB 3UE2A 1S9GA 2MY7A 3PRBA 2R7RA 3NMAA 2IMWP 2AEJA 4FBUA 2V50A 2EG1A 4P2XA 1HQAA 2HIYA 5AJ9A 1DFDA 5A76A 1SKSA 2W4CA 1RBAA 4C9DA 1IWGA 1OQ6A 2HNYB 2WVEA 3ZZ0A 3MPWA 4P7VA 3FGVA 3KJNB 2CQCA 3OSNA 1HBOB 3V81A 1TFWA 3G87A 4PXCA 2XMWA 3WAYA 4WWSA 3D0GE 2GIFA 4J9VA 4KO0A 1HMVA 1MWYA 1OPZA 4G6VB 4X66F 5KFLA 1D0EA 3VAGA 1TAUA 1T8EA 3KLVA 3PXGa 3T6BA 2JH3A 1IXKA 4EYIB 4Z37A 1SBRA 1FDBA 1ELYA 2RH3A 2A2CA 4ED4A 5HI7A 4M5GA 4F4WA 1UTAA 3QIPA 2ROGA 3PR5B 1C0TB 1PC5A 1W2BR 2QL7B 1FJ7A 4JP8A 4NZ0A 5DM6Q 1S79A 3I96A 1K44A 3FCHA 4J9UE 4YS2A 5E0OA 1KHNA 2BW7A 1T3NA 2HVZA 5CD4A 4KHPJ 1JLQB 1HBMA 4G1IA 3W5XA 4LFBJ 2VDHA 2ADBA 1FD8A 1HLWA 2XLJA 2EFQA 2A6MA 4YB6A 3ETMA 2Y1RI 2QMXA 4YUDA 2XS5A 3KLHB 4KJGA 1P1TA 3TEHB 3PX0A 3HP6A 3VGUA 4XPEA 3VVUA 3CB4A 2B9EA 3FRZA 3BEGB 1O51A 3I6PA 2HFVA 4K4XA 4X4VA 3T01A 3MPUB 1IJEB 2W1BA 2M88A 1E33P 1K1SA 2V4QA 3BDFA 3NGRA 3Q8PB 2VJVA 3W9HA 1L3TA 3HULA 3BO2A 3M2UB 5HQ8A 3OXGA 2NR0A 1DJ0A 3DMJA 1K9MT 2IIHA 1PKUA 1IKVA 4B3TJ 1R8HA 2UUBF 2BABA 3SFGA 3NBPA 1GXUA 3MEDA 3RB6A 3M05A 1UZHA 2HRUA 5LL6d 4OYBA 2N82B 5KT4A 1D8YA 4KT0C 3IWLA 4U7UD 1FEHA 4L76A 4LVNP 5J1PA 1YZ6A 2NSCA 3THVA 1U4BA 2IVYA 1WTBA 2AMCB 2VG6A 4C8KA 3CO9A 1FNOA 3M4XA 1HR0J 2YH0A 2M5YA 4ECVA 5KFYA 1WSRA 2EKNA 2KT5A 3LGHA 3QIDA 3R1LA 2VH7A 2J5AA 4J9OA 1S77D 2CQ0A 4NLDA 2FGCA 1S4EA 3OSPA 2HNDA 5LRNA 3T02A 4DSLA 4QIGA 3QRQA 1P9QC 2LVWA 5IWAJ 4G3IA 4LRCA 1K0VA 5A6WA 3HMJG 4X62F 2XZWA 1N34J 4BHQA 3IFEA 2E5JA 2KZZA 1CQNA 4OI4A 1PBAA 4J9QA 3Q83A 1HIYA 4U9RA 2V67A 4F2SA 4LSLB 3CJ2A 2VG5B 4BDPA 5HQLA 2KXFA 4JI6J 2XMKA 5FDLB 1WACA 4QJVA 3KTQA 4DLEA 3D68A 2QO3A 3SSRA 2YX7A 4OHXA 1EW8A 1R3NA 4OL8A 2E7XA 4ZVFA 3PZPA 5RUBA 4YMEA 4OYZA 3MZIA 3HVTB 2AKWB 4OLPA 4Y00A 4KHRA 3THPA 4YHHJ 2YNIB 4UUWA 1RA6A 4CNZA 4Q5VA 5J2NA 4FP9A 2Z58B 3OVSA 1SJ1A 1TR0A 3TA0A 1UPMB 1TL1A 5HP1B 2RUSA 1YHQS 3TUIC 2UUCJ 3L09A 2UUTA 4NWXA 4B3MJ 3JAMU 1RAOA 3UVJB 3BDGA 1S6PB 3DOLB 3BSCA 2W9CB 3W2WA 2NPIA 2MY8A 4GTXA 1KHWA 4AQYF 4ES2A 1X9WA 3GV7B 3PEHA 3MCNA 1GX6A 1KVIA 1S9FA 2I9SA 3PO5A 4X4NA 1S1VA 2HBYB 3R5AA 2DHGA 3AD7C 2OTJS 4NX9A 4R5PB 1TV6B 2W24A 4PPDA 1ZA1B 2DHXA 2QLXA 3ZZTA 2LQJA 1EKRA 1S0NA 2NXUA 3MM5A 3Q8YA 2HBRB 2J76E 3S6EA 3KXDA 4O3QA 5MLCV 2HPUA 1EAYC 3L7PA 3T41A 2RRBA 2XGQA 2XC9A 1JJHA 2OMOA 2J9CA 1RHUB 4CYRA 2CQ3A 2XHWA 4LIWA 3ETOA 5DLVA 4F02A 3NNHA 3OJSA 4DPYA 2H4WB 4CXSA 3HX9A 1EI6A 3JSMA 1R8PA 2CRLA 1XEZA 2XY5A 4A46A 2YNHA 1N36J 5GRRA 3RUBL 4OI1A 3RTVA 1JXVA 4TKTA 5EWFA 4F4ZA 1U02A 4I4BA 5CYMB 1YJ9S 3T5HA 1BD6A 5J2PA 3NWRA 1RISA 3CDWA 3I31A 1UFKA 2B7CB 5KXAA 2V63A 3CCES 1KVKA 2JC0A 4ECTA 4DN9A 5F3ZA 3L7OA 4CXKA 3NKOA 3D7SB 1WUUA 5KFFA 1I51B 3HPOA 4G1PA 4GKJJ 3MMJA 3Q0AA 1PIEA 4F50A 2E1CA 2YQ1A 4YFUA 2DNQA 1U2CA 5T7LB 2ZZMA 2BM1A 3UCGA 5U47A 1K1QA 2L9DA 1RHJB 5FJ4A 1PO6A 4TYBA 3BPSP 4K4WA 3SYZA 3LH2S 5ETPA 1SXLA 3OXLA 1XMQF 2P6SA 4JI2J 2X51A 2M70A 4N7TA 3W5ZA 3NKPA 1UZDA 5CA5A 2LA6A 1URAA 4WE1A 3Q24A 1U48A 2JSXA 3AHPA 1D9AA 1LW2B 3GJTB 3NAIA 4M94A 1KD1T 1R6VA 7AT1B 2Y1LB 2XLKA 3MM8B 5F8JA 3W66A 3UDLA 1A0OB 1T03A 1ZOTA 2XY6A 4WP9A 2UVWA 1HJKA 5F8NA 3ULHA 1RWUA 3DYCA 4LR2A 1XBWA 2OH2A 3W2VB 1VRTA 2HGMA 3DLJA 3CDAA 3EGVA 3BBBA 3TYTA 3JSBA 4ECSA 1BQNB 4RW6A 1EJJA 4ZCKA 2DGQA 4IFYA 1WKJA 4X4UA 2EFNA 3KUHA 4NLOA 1G7CB 2OLWA 2IC3A 3ILIA 2PI5A 1CJTB 2DH9A 3MM6B 2J6UA 3D0HE 3DI6B 4QYRA 4PAAA 3MHYA 5HANA 1JLEA 1WC6A 2DHSA 2J6TA 3VAFA 2XMJA 2AZ1A 1D9FA 1SKUB 4EBCA 1Y3KA 3QQCD 3PKYA 2CQHA 2VFSA 3CPWR 4XPCA 2EFOA 2VKZG 2B43A 4DSFA 1T0TV 2FHOB 5J2QB 1WORA 2RJZA 1RAEB 4KKOB 4MKAA 4DSKA 4A8SA 3BN4A 5GMDA 3CXCR 3HSGA 1F5BA 2BYCA 1U1PA 4DR6F 4UOOA 1OPIA 1YJRA 4OX9J 1RTDB 1TK0A 2ZJQQ 2HBZB 3PYDA 3KUGA 3TZYA 3KLGA 3W64A 1S48A 1XNQJ 4RW9A 5I42A 3SIPB 3K5PA 2J6SA 1TKTB 2RS8A 4EZ9A 2CZ4A 4Z7CA 1WOOA 4M8LA 4P72A 4F0HA 1T9YA 1RLCL 3I5BA 4MFBA 1KWMA 4CLZA 4IG3A 4ZOSA 1R0CB 1URRA 3MCOA 1NKBA 4LFCF 4ID5B 2V2QA 2YKPA 1FKPB 3MWBA 3DU6A 4RW7A 1WC0A 1U1QA 4LMZA 3IG1A 3DGPB 3DOKB 2PA8D 5HMYA 2WW8A 2GCFA 1FRJA 1RT4A 2RT3A 4H4MB 5K9FA 1Q5YA 3T9ZA 4RW4B 2IYIA 1KDNA 4LJMA 2VA2A 4KGXB 4GO5X 2PSZA 3NGKA 1IR0A 4AFFA 3M8QA 3BYRA 4DL3A 1R0AA 4ALZA 5F41A 4WU2A 1IKXB 3MECB 3RRHA 4JUZA 4DR1F 1G6BA 2EKYA 2AW0A 3BQ0A 2POKA 3MR3A 2GA7A 9RUBA 1QUPA 2JLEA 2CPXA 3LGMA 4R8UB 1HPZA 5JXSA 4FF2A 3LP0B 1QTNB 1OS5A 3R6GB 4X4SA 3J81j 4EYHB 5CZXA 3OHBA 1LW0B 1KHKA 5A0YB 5FLXU 4QYZJ 3M2VA 2MB0B
chains in the Genus database with same CATH topology
5GOVA 4LR7A 2GLQA 1EW9A 1KH5A 4FDIA 3OT9A 1N2KA 1ALHA 4MIVA 1ANJA 3B5QA 4LR8A 2X98A 4CYRA 4FDJA 4MHXA 2IUCA 3UN5A 3MK1A 5LRMA 2RH6A 3WAYA 3UO0A 3UN2A 5DLVA 1P49A 1ZEFA 4B56A 4UPIA 5EGHA 4KM4A 5LRNA 3T01A 4GTWA 3T02A 1B8JA 1ALJA 1AJAA 4CXSA 3M8WA 1EI6A 4LRCA 5DLTA 4GTZA 1AJDA 2W5WA 1E33P 3WAVA 2ANHA 1N2LA 2W5QA 5L0KA 1ANIA 2QZUA 3A52A 3ED4A 2GSOA 1O99A 3BDFA 4ZG9A 1KH4A 4NWXA 1E2SP 1ELYA 3M8YA 3TG0A 1ALIA 2XR9A 5IJSA 1ZEBA 5GRRA 3BDGA 3CMRA 1EQJA 4KAYA 2IUCB 4UOPA 5L0EA 1Y7AA 2IFYA 3IGZB 4UORA 4N7TA 1ELXA 2VQRA 3E2DA 3NVLA 3NKPA 4QAXA 1URAA 3T00A 5C66A 1AJCA 4NWJA 4GTXA 5HRTA 1KH7A 1AUKA 4GTYA 2W5XA 3KD8A 4UPHA 1FSUA 3WAWA 1ELZA 2W5SA 4LRAA 2W8DA 3DPCA 3LXQA 5INHA 3UNYA 4KJDA 3NKMA 1Y6VA 4LR9A 5TJ3A 4ZG7A 1KHNA 1EW2A 3NKQA 3NKNA 2G9YA 3UN3A 1AJBA 2GA3A 4LRDA 4TN0A 3SZYA 5KXAA 1KHJA 3Q3QA 2GSNA 3M7VA 3BDGB 1KH9A 5K4PA 3MK0A 4LRFA 1ZEDA 1KHLA 1K7HA 2W5RA 1HJKA 3MK2A 4UOOA 4CYSA 2GSUA 3TX0A 3TWZA 5LIAA 1ALKA 4CXUA 4ZG6A 3IDDA 4LREA 5DLWA 4LQYA 4MY4A 3DYCA 4YR1A 5IJQA 4ZGAA 4LR2A 1O98A 1HQAA 4CXKA 3NKOA 1EW8A 1E3CP 2D1GA 5AJ9A 4UPLA 3IGYB 1ED8A 1HDHA 1URBA 2XRGA 3BDHA 3SZZA 4LRBA 1SHQA 4KAVA 5EGEA 5L0BA 3WAXA 1ED9A 2W8SA 4UPKA 3M8ZA 2ZKTA 3NKRA 5LQQA 3WBHA 1KHKA 1SHNA 1E1ZP 2W5TA 4KJGA 1EJJA 2W5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GOV A;  4LR7 A;  2GLQ A;  1EW9 A;  1KH5 A;  4FDI A;  3OT9 A;  1N2K A;  1ALH A;  4MIV A;  1ANJ A;  3B5Q A;  4LR8 A;  2X98 A;  4CYR A;  4FDJ A;  4MHX A;  2IUC A;  3UN5 A;  3MK1 A;  5LRM A;  2RH6 A;  3WAY A;  3UO0 A;  3UN2 A;  5DLV A;  1P49 A;  1ZEF A;  4B56 A;  4UPI A;  5EGH A;  4KM4 A;  5LRN A;  3T01 A;  4GTW A;  3T02 A;  1B8J A;  1ALJ A;  1AJA A;  4CXS A;  3M8W A;  1EI6 A;  4LRC A;  5DLT A;  4GTZ A;  1AJD A;  2W5W A;  1E33 P;  3WAV A;  2ANH A;  1N2L A;  2W5Q A;  5L0K A;  1ANI A;  2QZU A;  3A52 A;  3ED4 A;  2GSO A;  1O99 A;  3BDF A;  4ZG9 A;  1KH4 A;  4NWX A;  1E2S P;  1ELY A;  3M8Y A;  3TG0 A;  1ALI A;  2XR9 A;  5IJS A;  1ZEB A;  5GRR A;  3BDG A;  3CMR A;  1EQJ A;  4KAY A;  2IUC B;  4UOP A;  5L0E A;  1Y7A A;  2IFY A;  3IGZ B;  4UOR A;  4N7T A;  1ELX A;  2VQR A;  3E2D A;  3NVL A;  3NKP A;  4QAX A;  1URA A;  3T00 A;  5C66 A;  1AJC A;  4NWJ A;  4GTX A;  5HRT A;  1KH7 A;  1AUK A;  4GTY A;  2W5X A;  3KD8 A;  4UPH A;  1FSU A;  3WAW A;  1ELZ A;  2W5S A;  4LRA A;  2W8D A;  3DPC A;  3LXQ A;  5INH A;  3UNY A;  4KJD A;  3NKM A;  1Y6V A;  4LR9 A;  5TJ3 A;  4ZG7 A;  1KHN A;  1EW2 A;  3NKQ A;  3NKN A;  2G9Y A;  3UN3 A;  1AJB A;  2GA3 A;  4LRD A;  4TN0 A;  3SZY A;  5KXA A;  1KHJ A;  3Q3Q A;  2GSN A;  3M7V A;  3BDG B;  1KH9 A;  5K4P A;  3MK0 A;  4LRF A;  1ZED A;  1KHL A;  1K7H A;  2W5R A;  1HJK A;  3MK2 A;  4UOO A;  4CYS A;  2GSU A;  3TX0 A;  3TWZ A;  5LIA A;  1ALK A;  4CXU A;  4ZG6 A;  3IDD A;  4LRE A;  5DLW A;  4LQY A;  4MY4 A;  3DYC A;  4YR1 A;  5IJQ A;  4ZGA A;  4LR2 A;  1O98 A;  1HQA A;  4CXK A;  3NKO A;  1EW8 A;  1E3C P;  2D1G A;  5AJ9 A;  4UPL A;  3IGY B;  1ED8 A;  1HDH A;  1URB A;  2XRG A;  3BDH A;  3SZZ A;  4LRB A;  1SHQ A;  4KAV A;  5EGE A;  5L0B A;  3WAX A;  1ED9 A;  2W8S A;  4UPK A;  3M8Z A;  2ZKT A;  3NKR A;  5LQQ A;  3WBH A;  1KHK A;  1SHN A;  1E1Z P;  2W5T A;  4KJG A;  1EJJ A;  2W5V A; 
#chains in the Genus database with same CATH topology
 2R7W A;  2LQ5 A;  1B0V A;  3QZ8 A;  1I6J A;  1C0U B;  2G1H A;  3B8H A;  2V69 A;  2PE8 A;  2F4V F;  1HQU A;  4X64 F;  4C11 A;  4RBT A;  5I3U B;  4Q0B A;  2GO8 A;  1NCL A;  3GR1 A;  1HWJ A;  2B6A A;  3K2Y A;  3I87 A;  4OHY A;  2X3G A;  4PWD B;  4M5N A;  3TO8 A;  8ATC B;  1NJX A;  1A9N B;  4WFB Q;  2DY1 A;  5DLG A;  4QBU A;  4OZ2 A;  2QA2 A;  1KVJ A;  5A8W B;  2HWH A;  3N0V A;  1YJV A;  5KFJ A;  2OFH X;  1YBU A;  5K8N A;  2B9Y A;  3GJR B;  4ER8 A;  2YBV A;  5HN0 A;  2E5H A;  3CJK B;  5DET A;  1HHQ A;  5K8M A;  2MGZ A;  1LWF A;  3ZZO A;  2WVC A;  3POT B;  1WHV A;  3MTJ A;  4K0K J;  2B4V A;  3VZH A;  5GMK a;  2DPI A;  2COL A;  2V4R A;  4LFA F;  2MTL A;  3R9L A;  1T9T A;  3MM9 B;  4YQW A;  4KAV A;  1Q4R A;  4M5D A;  4ZCI A;  4CYU A;  2RAQ A;  4RUH A;  3B82 A;  5GOV A;  1P27 B;  3R5J B;  1NAQ A;  1N33 J;  2JWN A;  5LMN J;  3CJ3 A;  3FSI A;  4ZKA A;  2BKP A;  2RUG A;  1C4C A;  3OJU A;  1J5E J;  1F5A A;  2OPP B;  3T1Y J;  3W9I A;  5J1E A;  5KFQ A;  1SUQ B;  2W9B B;  4DU8 A;  3FEY B;  2CDR B;  1RQ0 A;  4NZ7 A;  4CM2 A;  3M1V B;  1UFW A;  2NXN A;  2AU0 A;  4M5K A;  4IO9 Q;  4ES1 A;  2HFU A;  4ZLJ A;  2CPF A;  1S1X A;  1KTQ A;  2OPR B;  4ILM A;  2GVZ B;  5L1L A;  3FQK A;  3N01 A;  1SC3 B;  5BR8 F;  3R1H A;  1S1U A;  2HS4 A;  4LRB A;  1IR1 A;  1F9F A;  4EWT A;  4KE5 A;  1B0T A;  6AT1 B;  3HHL B;  4CTA A;  1TZ0 A;  2IM3 A;  3J7Y U;  2YKQ A;  4K4Z A;  4MH8 A;  1SL0 A;  1FFS B;  1FJG F;  3EXC X;  3UCZ P;  4GRS A;  1HNX F;  4DSE A;  5HL7 Q;  4CLL A;  1BQX A;  3GV8 B;  4JOU A;  2GQQ A;  3IR6 B;  1RBO B;  4ATN A;  1AUS L;  2ASY A;  5GAD U;  4PG6 A;  4ZVP B;  1MN7 A;  4GVB B;  4X66 J;  3KKF A;  3M6W A;  4CT8 A;  5EX3 A;  4N56 A;  4FPR A;  1UVJ A;  3FBE A;  1OJ4 A;  4B9N A;  4YB1 P;  3K5L A;  4GC7 A;  3D2W A;  4UOF A;  1RT6 B;  4OHZ A;  2XO6 A;  1U25 A;  4WFN Q;  1LWX A;  3UFC X;  1Q0N A;  1JMT A;  1OY9 A;  2ZBI A;  3ITH A;  1VQM S;  4NXM J;  3LP2 A;  5KFI A;  4FN5 A;  5KG4 A;  4H4O A;  1GMW D;  1VFJ A;  1Y5N B;  4USK A;  1Z2L A;  1FJC A;  1VQ9 S;  2R7Q A;  3DLE B;  3C6U B;  3R8Y A;  1JLF B;  4FNH A;  3CCW A;  4ZJL A;  3V6H A;  4DSI A;  1Q7L B;  2W5Q A;  4MIA A;  1FTR A;  3F0N A;  3KJF B;  1MML A;  2FJV A;  2HLU A;  4B9T A;  2KJV A;  1NKC A;  5IT0 A;  3FBC A;  1H98 A;  4HL9 A;  2A2D A;  2PA3 A;  1XTZ A;  2Y9H A;  1YDL A;  1V5I B;  4UPH A;  3IS9 A;  2F4F A;  4G1Q A;  2JZ5 A;  1FNM A;  1BY9 A;  2GA3 A;  3EMT A;  5HVG A;  3GFZ A;  5LOQ A;  4ZN3 A;  3AOB A;  4U67 Q;  1RK8 A;  4K4V A;  1GQE A;  4Z2X A;  3SV4 A;  3WAX A;  1OYD A;  4NLQ A;  2UUB J;  4IR9 A;  4C8N A;  2LQ8 A;  3V6K A;  4KB7 A;  2BA9 A;  3CD0 A;  3HVW A;  1X5P A;  2GML A;  2OEL A;  1YKW A;  4NA3 A;  3RRG A;  4DWI A;  4D3H A;  3SMZ A;  2XZD B;  1J5O B;  3FCW A;  3H90 A;  5DS7 A;  2OHD A;  2VC1 A;  3MR6 A;  4Q7A A;  5AXN A;  3UD4 P;  3VQT A;  4PYD A;  3X1L B;  5CHC B;  3OL9 A;  1S9E B;  2ZVS A;  3QGI A;  4L73 A;  3KD8 A;  5INH A;  4TY8 B;  2AJF E;  4HR2 A;  3RAM A;  1BE4 A;  3B6B A;  1V5V A;  4WF9 Q;  2O67 A;  1TK8 A;  3KHR A;  4X62 J;  5BXI A;  4RKU C;  4K8R A;  1FDD A;  3H98 A;  1ALK A;  3NG8 A;  5KFV A;  1ED8 A;  2L9N A;  3FRY A;  3G96 A;  4NL5 A;  1S57 A;  2M8H A;  1WNE A;  1YRT A;  1U6F A;  5IZH A;  2JFD A;  5HLF B;  4M5J A;  4IG0 B;  2OPQ B;  5F8L A;  2EPI A;  2HZC A;  4LR8 A;  3MK1 A;  5LRM A;  1RAF B;  2LU1 A;  3BGU A;  3QMQ A;  4WIQ A;  1SQG A;  2ZWO A;  2CPE A;  4ZDN A;  2WVF A;  2MZJ A;  1Q82 T;  5HSP A;  3ED4 A;  2D3U A;  4HYK A;  2QSF A;  2CYY A;  4J5O A;  1Q81 T;  5ETS A;  3AJ1 A;  1VI7 A;  1G4C A;  5EUH A;  3LPY A;  1SJ4 P;  4DL2 A;  3M30 B;  1BXN A;  1M1G A;  1RB0 A;  2W8D A;  3C6T A;  5HVH A;  2I5J A;  3KDO A;  2ZOM A;  4UST A;  3NKY A;  3Q3Q A;  2HRT A;  3HSZ A;  2VJU A;  2C2Z B;  5AE1 A;  2AV5 A;  3TX0 A;  4JV5 F;  2DH7 A;  4FDF A;  2R2S A;  1ZH5 A;  2C42 A;  4WCE Q;  3CJQ A;  4KH0 B;  2XCP A;  2OML A;  4AQY J;  4X65 F;  4Y0F A;  1HNV B;  4MJK A;  1LV5 A;  1V3R A;  1MRO B;  3NY0 A;  4OJ3 A;  2ZJR Q;  2QLJ B;  4FDJ A;  3W5Y A;  4HH1 A;  1KRP A;  2MQQ A;  1C1B A;  2FHJ D;  2CPY A;  4RNH A;  2UXC F;  1S1W B;  2DNP A;  5CAA A;  2ZIT A;  1NPR A;  3P5T L;  2DIU A;  1XC9 A;  4RZR A;  4HDH A;  4DPT A;  1LWC B;  4V19 X;  4B3O A;  4P2F A;  4ECZ A;  2XMA A;  2R7O A;  1RA7 A;  1MU2 A;  1PG5 B;  2OSQ A;  4E0D A;  5B0D A;  4L3K A;  2DNK A;  4Q44 A;  4AXJ A;  1NJY A;  2WOM B;  2VA3 A;  3ET6 A;  5F0U A;  2GVD B;  3TAM B;  1U1N A;  1M0S A;  2C2R A;  1W7W A;  1VDH A;  4ECU A;  2DR8 A;  1NDC A;  4K2X A;  1NH8 A;  5IV3 A;  1T9W A;  2ZBR A;  2O5D A;  2ASJ A;  2LU2 A;  2R3V A;  1ZTW A;  3UCU P;  2BBE A;  1KTV A;  2GV1 A;  2OAU A;  4UPK A;  4OYW A;  1WTF A;  4P2M A;  4LF7 F;  3PJX A;  1RLD A;  2K1R A;  4IRK A;  2UUW A;  3SBM A;  1NHV A;  5C25 A;  5FLX Y;  4UZC A;  2SXL A;  4FPI A;  1UA0 A;  4FVC A;  1UET A;  2OEK A;  1S1T B;  1RHR B;  1NLK L;  1UL3 A;  2KYZ A;  4CO2 A;  4QW9 A;  1KS2 A;  3QAE A;  2DK2 A;  4O3P A;  3M8Y A;  4W90 B;  2CPI A;  4DG1 A;  2G2O A;  2WON B;  5KFG A;  3ZTR A;  3NLC A;  2XZT B;  5GAE I;  5DG7 A;  4CP5 A;  1CJV A;  2EFG A;  3FNN A;  1N54 B;  5KFN A;  4JI7 F;  1VJQ A;  4QIE A;  3NKQ A;  4J91 A;  4FVM A;  3OTO F;  1CEZ A;  1ZAW A;  1FXL A;  2MZR A;  5B0A A;  1XMQ J;  3J81 Y;  1Q86 T;  1P1L A;  3OLA A;  2IA0 A;  4NLU A;  3RAQ A;  1RT5 B;  1JLA B;  2GGP A;  2DNH A;  4ZN1 A;  2DCL A;  1CJK A;  3EUN A;  1IR2 A;  4NI2 B;  2ZKT A;  2WVD A;  1WC1 A;  3EYZ A;  2DNR A;  1NJI T;  2E7W A;  4AL6 A;  5ITH A;  4N47 A;  3MR7 A;  1WC4 A;  2EXU A;  4LF1 A;  2KB2 A;  3GJQ B;  2LA4 A;  3G8T A;  1RTH A;  2CXE A;  4RLE A;  1WKL A;  3I0S B;  1U09 A;  3EWG A;  3QAU A;  4DR7 F;  2MKC A;  1FNX H;  4NRU A;  3AOD A;  4LSN B;  2NUU G;  3CCS S;  1XMO F;  2EI5 A;  4DX5 A;  5DQH A;  1PAU B;  4W92 B;  1VIO A;  2BX6 A;  2OUG A;  3CD5 A;  1CUL A;  1ZBT A;  4DU7 A;  2NLW A;  1H6K X;  4IQM A;  4KAI A;  2AYB A;  3UNY A;  4ANE A;  3W63 A;  1HNI A;  3G4S S;  3KK3 B;  3IP0 A;  4NPO A;  8AT1 B;  2OEJ A;  4O3S A;  1HI1 A;  1UJ6 A;  4L6V 3;  3PW0 A;  4WK1 A;  2FQQ B;  4ZGA A;  3EDQ B;  4DX6 A;  4NYZ A;  3QRR A;  1E6V A;  2EFP A;  2HIQ A;  5CYJ A;  1DHM A;  3AH6 A;  1YSJ A;  1IKW A;  3IBF B;  3ZZY A;  1KSP A;  4UOC A;  3EGN A;  1AYE A;  2DGO A;  2BAN A;  5KG1 A;  3QZ7 A;  3OTC A;  4DR6 J;  3LAM A;  3CDU A;  2E7V A;  3CGI A;  5KT5 A;  3HF5 A;  2F9J A;  5KFM A;  1N5Q A;  2BE2 B;  3ISZ A;  4OZN A;  4PXD A;  3R6L B;  3GB0 A;  1T05 A;  2KVQ E;  2P2C B;  4ZJQ A;  4B9U A;  3PO4 A;  1FER A;  1ELX A;  3GP9 A;  3RBE A;  1ITP A;  1H2T Z;  2ROE A;  2IHR 1;  4QWB A;  2W5X A;  2MQN A;  2HGL A;  2OSR A;  5T14 A;  4LFC J;  4ZIV A;  2L9W A;  1N5Y B;  3H2U B;  2YNG A;  3CCJ S;  5HRO A;  4QR2 A;  2U1A A;  4CYS A;  2YWH A;  2DVI A;  4DCP B;  2XMV A;  2YWW A;  3V4M A;  3MD1 A;  1EET B;  2FIU A;  3J7A 1;  1JKH A;  1IM6 A;  1MMD A;  1APS A;  1HWK A;  1IBC B;  2KG1 A;  4LF9 F;  3T5L A;  3Q89 A;  1D8Z A;  2W8L A;  4J7C A;  4NYO A;  2DNY A;  3MPD A;  4WKR A;  5KG2 A;  3CSK A;  2DNL A;  3TA2 A;  2ZH1 A;  4ZPD A;  4LQ9 A;  2DGV A;  1EB0 A;  3RBZ A;  4DR1 J;  2RRN A;  4PG8 A;  4OYA A;  4U7C A;  4WXW A;  1CQM A;  2H48 B;  1FRM A;  1O0P A;  1M5K C;  3M2R A;  7FDR A;  5LSO A;  2HW3 A;  2QYG A;  3BKT A;  3BQ1 A;  2EW9 A;  3DRS A;  3EXY A;  3OW2 R;  4IRC A;  4HHU A;  4ZIW A;  3V81 B;  2DGT A;  3HHL C;  4HTI A;  3AXM A;  2Y1I A;  1RWX B;  4DEZ A;  4BBY A;  2CAD A;  3I9Z A;  2KO1 A;  4DQS A;  4KO0 B;  1HMV B;  4DUT A;  3KK2 A;  2NS1 B;  4V19 J;  2G13 A;  2XG8 A;  1FSU A;  1M5H A;  2DXD A;  3GJS B;  2IDL A;  4K4S A;  1IUJ A;  2F4V J;  4DLG A;  2ZH7 A;  3CJ5 A;  4X64 J;  1NXI A;  2GMJ A;  4FBT A;  4Y6I A;  4JI3 F;  5CD4 H;  1KH9 A;  4NA2 A;  3HD2 A;  3QIP B;  2ACY A;  5IC6 B;  1X4E A;  2V8D A;  5K5M A;  2MPU A;  5DQG A;  3CCV S;  4F2R A;  4ED1 A;  4RX6 A;  4R25 A;  1KOO A;  2DO4 A;  2D3O R;  4K4Y A;  2HKE A;  3HVR A;  1VQP S;  3RR8 A;  3VTI A;  1HBM B;  4R0E A;  2KXH A;  1GK8 A;  4JB8 B;  1CLF A;  4UOH A;  3QWP A;  2XS7 A;  4L75 A;  3R2C J;  4TU8 A;  1RP5 A;  4LFA J;  3EX7 B;  3A1Y G;  3T6J A;  1FK9 A;  5D4O A;  5L0K A;  1OO0 B;  1TUV A;  4ED7 A;  1VBX A;  4C8Z A;  2WCX A;  1NUE A;  2BJE A;  4JI0 F;  2F63 A;  4KFB B;  4ETX A;  4ZPC A;  3OPK A;  3T00 A;  2DIT A;  5KFR A;  4I6W A;  4DR3 F;  3AQP A;  1VGY A;  5DQI A;  5ETO A;  3TZX A;  1FFW B;  1R31 A;  4V1A k;  3O8W A;  5HQM A;  1RU2 A;  4ZP6 A;  1FJE B;  4ED2 A;  2HHQ A;  4CWB A;  2K7K A;  3OFH A;  1NM2 A;  4IOB A;  4LRE A;  1JIH A;  1Q95 G;  2OP5 A;  4CLP A;  1TKD A;  1JQG A;  2VDI A;  2LYV A;  4HLB A;  5DO2 A;  2D1G A;  4W4M A;  2JDJ A;  2QEX S;  3JSY A;  4ZVU B;  1OY6 A;  3NBP B;  3MED B;  4HI2 A;  1DQ9 A;  3CCM S;  1FFG B;  2UVU A;  3Q8R B;  3HZE A;  1H0H B;  1PAE X;  2H51 B;  2M9K A;  4DV7 F;  1L3V A;  1WDT A;  3OT9 A;  4QWD A;  1VYA A;  4QW8 A;  3IGN A;  3E2E A;  4CO0 A;  2MKJ A;  2VG6 B;  1BWV A;  2A18 A;  2FLN A;  5BR8 J;  1BQM A;  2F65 A;  4Q43 A;  4MKY A;  3WAV A;  4DL7 A;  1FEE A;  5E3A A;  3C14 A;  3QFH A;  3A52 A;  4FF1 A;  4IRD A;  1KH4 A;  3HFV A;  4MKB A;  1E2S P;  2UV8 A;  3M6X A;  2FJX A;  3KLF A;  1X0F A;  4DFP A;  4BC9 A;  3MAH A;  4WP8 A;  2JVO A;  1GX5 A;  6FDR A;  2HND B;  1EP4 A;  5HJY A;  3D1O A;  2O01 C;  4LBH A;  3UD5 A;  3HCX A;  1FJG J;  3QLH A;  1DBD A;  1DLO A;  2ALZ A;  2MDA A;  1S10 A;  4WII A;  4IUF A;  3FZB A;  4Q2L A;  1HNX J;  2RNE A;  2XWX A;  5KT2 A;  4C3L A;  3AOA A;  1R43 A;  3SQG B;  2CWX A;  1MMN A;  2KRR A;  3I56 S;  3KHG A;  4G65 A;  2CFX A;  2VZ9 A;  2XY7 A;  3IC1 A;  3SZZ A;  2K2P A;  3N6N A;  2GZO A;  3Q8U A;  1TUG B;  2W8S A;  4QZV B;  3S01 A;  1H3D A;  4ZPW R;  5AT1 B;  3UR0 A;  1RAG B;  3C15 B;  4WPA A;  1VMB A;  3C16 A;  1U2F A;  3PHE A;  3R97 A;  4CO4 A;  2C3Y A;  1HKA A;  5IT9 U;  4KGV B;  4DBQ A;  4RJV A;  1RKJ A;  1G1X A;  5HMZ A;  5J2N B;  2CA9 A;  2YKA A;  3M9O B;  3R7B B;  2KL8 A;  5KTQ A;  3NP5 A;  1TKX A;  4LSL A;  1TL1 B;  1CS4 A;  4C0H A;  1S7I A;  2RHS B;  3DKD A;  2FVP A;  4WFZ A;  2WVB A;  4KJD A;  2PGC A;  3SXL A;  2VC0 A;  3GG1 A;  5FDL A;  3BDG B;  1MG7 A;  5CZV A;  2AX0 A;  5G0R A;  5B0E A;  4RW8 A;  2E1M C;  3W2W B;  1RXO B;  2ZD1 A;  5IXU A;  4ZVS B;  1KQK A;  4DV6 F;  1IM4 A;  1TAQ A;  3K59 A;  1JJ4 A;  4NYP A;  1OQ3 A;  1RWN B;  2B4O A;  4NMX A;  3R3T A;  5ETM A;  3ADA C;  4J9S A;  2BKN A;  2EC2 A;  1S1V B;  1Z4U A;  1U45 A;  4DQR A;  1RBL A;  2IA6 A;  4UT4 A;  4Y2C A;  2EWH A;  3GFH A;  3WHI A;  1VJW A;  4OFZ A;  2J7U A;  1AW0 A;  5I3P A;  3MFI A;  3JQJ A;  3MM5 B;  3I0R A;  1UKU A;  1GTE A;  2M2B A;  3BN7 A;  4DFK A;  4ZJO A;  1U49 A;  3K8W A;  4C3K A;  1U8S A;  2DEI A;  3J7A N;  4DL0 C;  1VBK A;  3CVK A;  1RDR A;  3JSM B;  5SUH A;  2UXD F;  4OLO A;  5A8R A;  4DXL A;  1EJ7 L;  5KFA A;  4PQU A;  5AXM A;  4DSJ A;  1RAA B;  5KG7 A;  2YNH B;  1WWH A;  4QR0 A;  2XGP A;  4HEA 9;  4O3N A;  2VFT A;  2VIC A;  4P9S A;  1N5T A;  2XMU A;  4R5P A;  4CQ1 A;  3NGU A;  1HQE A;  4LQY A;  2B4U A;  4OI6 A;  4J9R A;  2Y8Y A;  3IBC B;  5J2P B;  1Q8L A;  2F8H A;  3OFE A;  3QJL A;  4TQR A;  2D3O 1;  3CC2 S;  2CQ2 A;  3B78 A;  2VON A;  3M8Z A;  4OV6 A;  4O4R A;  2V9W A;  2LCW A;  1HNW F;  1SH0 A;  3EZU A;  2KVI A;  1YIT S;  1HAR A;  2Q79 A;  2CNO B;  4PWW A;  2IBO A;  4C2M A;  3V6D A;  1IQZ A;  2P8I A;  2VV5 A;  2W7O A;  2QFJ A;  4EFA C;  2KTQ A;  5E2Q A;  2FYX A;  5L46 A;  1UVN A;  3FBF A;  4FYV B;  4CH1 A;  4Y34 A;  3IRW P;  1SL1 A;  4CLS A;  2IM0 A;  3IXQ A;  4KAY A;  3BGR A;  2CQP A;  4ZCL A;  2DNM A;  3K57 A;  4OJG A;  2CDQ A;  1ZM9 A;  5HRT A;  1M1H A;  3FFI A;  2ZH2 A;  3NMR A;  2KT3 A;  4LF8 F;  2CNN B;  5F3T A;  4I2P A;  1QTM A;  3G6Y A;  3NGD A;  3OD2 A;  4DS5 A;  1VHF A;  1NBE B;  4MYU A;  3TWZ A;  3TAP A;  2YWF A;  4PRF A;  4OHW A;  1OSC A;  2QIF A;  5GAH I;  4WE1 B;  1HNZ F;  3NS7 B;  1VRQ C;  3N5F A;  1O98 A;  2ZNY A;  4IH5 A;  2F5G A;  1F2H A;  4ECX A;  2FJA B;  5EGE A;  3DLG A;  3M32 A;  1T03 B;  1QAY A;  2WTF A;  3GIM A;  2VPZ B;  1FWP A;  2A10 A;  3MM7 A;  1EKS A;  1AUD A;  3NOG A;  1H7X A;  3UN5 A;  1NSP A;  4JV5 J;  3R5G A;  1JLC A;  3G86 A;  1ALJ A;  1VRT B;  3RBX A;  3RW7 A;  5D3G A;  3ZC4 A;  4NOH A;  1F2G A;  5KFU A;  3I4H X;  4RW6 B;  1F3F A;  2JEF A;  2GAH C;  4IFY B;  4X65 J;  2F40 A;  3W3S A;  1I3O B;  2NYH A;  3VQS A;  4NWB A;  2WBR A;  1R6Y A;  5C24 A;  3JTN A;  2IC3 B;  1VR6 A;  1LW2 A;  1V6H A;  1KH7 A;  3KOA A;  4OX8 A;  2Z2Y B;  1LOU A;  4J9L A;  3U1M A;  4OI3 A;  1JLE B;  1UFL A;  4P73 A;  1X4B A;  4GKK F;  5AJ3 F;  3NL0 A;  3HKW A;  4F3M A;  2UXC J;  1LFW A;  2OD4 A;  1WI8 A;  1XR6 A;  1LFP A;  2IFX A;  4BC7 A;  5M2U A;  3MXH P;  3I5C A;  3IGY B;  1YZ7 A;  5C42 A;  4PCQ A;  2CPD A;  1RWP B;  1SHQ A;  4AL7 A;  3HLU A;  5LJ5 Y;  2AX1 A;  1X5T A;  2Z4P A;  1JX4 A;  2GQC A;  3FQL A;  3DOM A;  3PR4 A;  3SQO P;  3MPY A;  3HK2 A;  3KLG B;  3MM6 A;  3H0P A;  4RW9 B;  5I42 B;  2YQ3 A;  3WDO A;  1CJU A;  3EPI A;  1NK8 A;  4IYQ A;  3IGV A;  1P8G A;  1UWA A;  1CBK A;  2UUA F;  4MFB B;  2HYI B;  4QOT A;  3QSI A;  3UWT A;  3BR9 A;  1A6L A;  1SCJ B;  1NME B;  4LF7 J;  2GW8 A;  2XHC A;  2QYC A;  5J2Q A;  4YOE A;  1NK9 A;  2XNR A;  3NEK A;  4RW7 B;  3KYL A;  1Q78 A;  2R7V A;  2A0F B;  3IG1 B;  4H4K C;  4DV0 F;  1RT4 B;  5KT7 A;  1TL4 A;  2YKM B;  2HAF A;  1VQY A;  2VFR A;  4B08 A;  5DJB A;  4DHV A;  3ZFV A;  3RB4 A;  4O44 A;  2JLG A;  1YJU A;  3U02 A;  3QO9 A;  3B54 A;  4JI7 J;  1I5O B;  3FSX A;  1ZM2 A;  3CMQ A;  1Y5L B;  3GII A;  4K5R A;  3OTO J;  3I5A A;  2EFV A;  2JEI A;  2O3D A;  4MIV A;  1HW9 A;  3H59 A;  1HPZ B;  1X5O A;  2AJ2 A;  2BRK A;  2PC6 A;  1P6T A;  4NLX A;  2W2O P;  1RT3 A;  1WEX A;  3M2V B;  4KBI A;  3CJ4 A;  2AGP A;  3FVY A;  1SQE A;  3I82 A;  1VK3 A;  1EX8 A;  2PFF B;  3PTW A;  3PEJ A;  3TW0 A;  2IY5 B;  2C3O A;  2J8A A;  4C11 B;  3DRY A;  4Q0B B;  1T7P A;  4P74 A;  4URQ U;  3EDR B;  2B6A B;  1QE1 A;  1FRL A;  2GS8 A;  3KG4 A;  4ZHR A;  4DR7 J;  5KFE A;  1REV A;  3JYT A;  3LTO A;  2YKN A;  3W9J A;  3CDB A;  4CXU A;  2DNG A;  3GG0 A;  3BSA A;  2RF2 A;  1XMO J;  3HVA A;  3QJP A;  2W4D A;  4RNM A;  4ELU A;  3D5M A;  1T9U A;  3ZZP A;  3A4T A;  3BR8 A;  1LXJ A;  1NHU A;  3RG6 A;  2MGZ B;  1LWF B;  4J90 A;  3MTK A;  4CH0 S;  1ZM4 A;  4U7U K;  1MWQ A;  1QVF R;  1XJW B;  2KN4 A;  3CT9 A;  4NML A;  2G4B A;  3JXO A;  2CPJ A;  5KT6 A;  3DDN A;  4GC6 A;  3HSD A;  2LEP A;  1KLM A;  4ZVH A;  5JUM A;  3PW5 A;  2P9G A;  4RWW A;  1LWE A;  4HHJ A;  4X2B A;  5JJB A;  4M5D B;  2KJW A;  2RE1 A;  3EVO A;  4HI1 A;  4CYU B;  4L72 B;  3ICL A;  4NXM F;  1ZPW X;  1RJJ A;  3K17 A;  4PWD A;  1YI2 S;  2GIR A;  1ALI A;  1AXQ A;  1URN A;  1X60 A;  2QFI A;  3SSS A;  3NXZ A;  4URS A;  2VQR A;  1RE1 B;  2H3E B;  2IVF B;  1YVF A;  3E3X A;  4ZK7 M;  2QL5 B;  1JNR B;  3DGV A;  4WZQ A;  1NDK A;  2R7S A;  1FD2 A;  3DCA A;  3RGI A;  4RU9 A;  4LQ3 A;  4OYM A;  2W2N P;  3MMB A;  3K7R A;  3POT A;  4A8W A;  3D9B A;  4ZP9 A;  5J1E B;  3MK0 A;  1QDU B;  3VAH A;  2IAJ A;  4ED5 A;  2GFF A;  3MUM P;  3GIR A;  4RPF A;  1FKO A;  1R8B A;  3IBW A;  2AQ4 A;  3PNI A;  4O0N A;  4PUO A;  1RWV B;  2K06 A;  1RWM B;  4IFV A;  1K73 T;  2XMT A;  3CMA S;  4FYX B;  1R0B G;  4NCG A;  3NNA A;  3BKF A;  4AUK A;  3AXK A;  3F41 A;  1NK5 A;  1G2E A;  2BRL A;  4LR7 A;  2GHW A;  1S1X B;  5LMU F;  3CUN A;  1L3U A;  1SC6 A;  1RHQ B;  2L3M A;  2MZ1 A;  1Y9O A;  4XIU A;  2GQ2 A;  4P75 A;  2AD9 A;  1S1U B;  4IDK A;  4QR1 A;  1FTC A;  2B5J B;  2MHE A;  3JTP A;  3RR7 A;  3OV7 A;  2W5W A;  2VAS A;  3DN9 A;  2QZU A;  2P5V A;  2QC3 A;  4CTA B;  4LF9 J;  1DAR A;  1OSD A;  2QLW A;  2O66 A;  1U26 A;  3P4U B;  3OBI A;  3D6H B;  5J1N A;  3QAT A;  3OLB A;  3SCJ E;  1Z2Z A;  1VC6 A;  4DDF A;  4WFA Q;  2Z2Z A;  3M1V A;  1NZA A;  3P5B P;  5F0W A;  1XQI A;  5IT9 Y;  3Q2S C;  1JJC B;  3RW6 A;  3N79 A;  2VPX B;  3MEE A;  3L4B C;  2IM2 A;  4PQA A;  2RQC A;  1H72 C;  2KI2 A;  3DDK A;  4LIR A;  4TN0 A;  1M5V C;  1S72 S;  1GMW A;  4F3O A;  3IDD A;  5DLW A;  1KKH A;  2CG4 A;  5FII A;  1S12 A;  2V2K A;  1KFD A;  2B8P A;  5CQG A;  3UW1 A;  2YWK A;  1AFJ A;  5AXK A;  5LT5 A;  1VOM A;  3DRP A;  3H20 A;  2RQM A;  2ZBC A;  3MMA A;  3W62 A;  4UW2 A;  1S5Z A;  3RRK A;  2D41 A;  4JI3 J;  4M5I A;  4N5S A;  1S6U A;  3MFH A;  3UO0 A;  3LAK A;  2QL9 B;  4C0O C;  1CPZ A;  5KFD A;  1FRK A;  3ITH B;  2B3T B;  1WEZ A;  4TQS A;  2CVE A;  3M6V A;  2HHS A;  2HEK A;  3DDI A;  3LP2 B;  2R8G A;  4KH1 B;  4DPO A;  5D0E A;  4H4O B;  2YQ0 A;  3DU5 A;  3WZ0 A;  4IOC Q;  2WHO A;  2XEX A;  2R8I A;  1YX2 A;  1FRH A;  5KFS A;  1YJN S;  1UVK A;  4K4U A;  1RUS A;  3FK4 A;  3BH7 B;  2CPZ A;  1AJB A;  1TMJ A;  4LRD A;  2VFV A;  5K14 A;  2V6A A;  2XTJ P;  5KFH A;  4OV1 A;  2AYE A;  4MY4 A;  4JI0 J;  3TP2 A;  3R7N B;  1Q8B A;  1K47 A;  3IS9 B;  4TU9 A;  3T5K A;  4G1Q B;  2V0N A;  1JXL A;  2PD1 A;  2M0G B;  4Y2K A;  2X1A A;  4OYX A;  1N8R T;  4NXN F;  4DR3 J;  4MK8 A;  3QPI A;  2M52 A;  4ECR A;  3WBH A;  1TL5 A;  3L95 X;  2XQC A;  1ZZN A;  2PI4 A;  5L1I A;  1NRK A;  4ECW A;  4DJB A;  5D6G A;  1HD1 A;  5IFM A;  4NE9 C;  2E9Z A;  4WK3 A;  3D0I E;  4AT1 B;  3BO3 A;  3CNQ P;  4OYO A;  2IJF A;  2Z8Q A;  1SC4 B;  4CO1 A;  4KRW A;  1U0H A;  4C8M A;  2DIV A;  1EQJ A;  3NCR A;  4DV7 J;  2LQB A;  1M90 T;  2OKQ A;  2E5I A;  1RGV A;  3MAA A;  2DB1 A;  2VFU A;  2X7I A;  1X4D A;  3GSI A;  2CIM A;  1TP7 A;  1N6Q A;  4OI2 A;  1Q5V A;  1G3O A;  2KKH A;  2APO A;  2BEF A;  1ZM3 A;  1L5U A;  2DRB A;  2HFN A;  3N6M A;  2BQR A;  4HH0 A;  3PFO A;  1RHM B;  1SQF A;  3GFY A;  3PY8 A;  3QRP A;  4XDC A;  1H73 A;  2R2U A;  4PKD B;  2FY1 A;  3UPF A;  4J9K A;  2PII A;  3OR2 A;  2DY9 A;  1HWL A;  2HQF A;  2ADC A;  4YEA A;  3QNW B;  3K58 A;  1OYE A;  3AA9 A;  5IT4 A;  4J9N A;  2F9D A;  5BJR A;  1YRX A;  1VLY A;  2UU9 F;  2GHV C;  2FZG B;  1AJC A;  2P9C A;  4PYA A;  3R5C A;  2L41 A;  2B9X A;  3H2L A;  1RTJ A;  2ZM6 F;  1S0V A;  1JNZ B;  4PG4 A;  2KG0 A;  4HKQ A;  2J9D A;  2W01 A;  2RDI A;  5A8K A;  4CCH A;  1AB8 A;  2HZV A;  2G2Z A;  4C6A A;  2CZ9 A;  2GAG C;  3BSN A;  3G2X A;  2GNK A;  2FHJ A;  4J9M A;  2BR0 A;  1UEV A;  1NKE A;  3C6T B;  5DM7 Q;  2I5J B;  3EM1 A;  3HT0 A;  1X0P A;  2LDY A;  3UR3 C;  3WX8 A;  1N32 F;  5L0B A;  2MLX A;  4LUB A;  4DOZ A;  2KFY A;  4ZVT B;  2QV6 A;  3TEG A;  3MUT P;  1NK0 A;  2W5V A;  4FDI A;  3N28 A;  1QAJ A;  3HO1 A;  4J37 A;  3VF0 B;  4DV6 J;  4DQQ A;  3J80 Y;  2PMW A;  2WRM A;  5DZ7 A;  2C22 A;  2GSO A;  3A3N B;  2J0X A;  4UOP A;  3N5B A;  5M2R A;  3VVT A;  5C66 A;  1TTH B;  1C1B B;  3X3U A;  2FTR A;  4JYA F;  3DLH A;  2B0G A;  3BRE A;  1IJF B;  2KXN B;  1PC4 A;  4B3O B;  4USW A;  2ATC B;  4DUZ F;  2C2D A;  1MU2 B;  2XSJ A;  1W26 A;  1U7L A;  1JXE A;  3P49 B;  1UVL A;  4O4G A;  3UD3 P;  3N9U C;  5EGY A;  1ARO P;  2KT2 A;  1WOP A;  3Q22 A;  5HO4 A;  4I6A A;  3ET6 B;  4DV2 F;  3MEG A;  1SV5 A;  3PAC A;  3LO3 A;  4P6Q A;  2Z0G A;  2UXD J;  3E01 A;  1PJ5 A;  3FKB A;  1D1U A;  3W8G A;  1NDP A;  3H4D A;  4Y65 A;  4ZPB A;  2C2N A;  2MJN A;  1FRI A;  2X98 A;  2Z2L A;  2ZFH A;  4KSE B;  1N48 A;  1Y5I B;  4FYD A;  3PJ9 A;  3W8P A;  5EGH A;  1YWX A;  1AJA A;  2GO9 A;  1OIA A;  1X4H A;  4ZLL A;  1ULR A;  2ZC4 A;  3OTB A;  1TKZ A;  1O99 A;  2K1R B;  5D77 A;  2IJR A;  3CJ8 A;  4RO0 A;  3DRR A;  5C25 B;  2CNL B;  1HFE L;  3DM2 A;  1HWU A;  1HNW J;  4TLR A;  3DLK A;  2PEH A;  3HDS A;  3M9N B;  2AGQ A;  4C8L A;  3PKM A;  3KDN A;  5GAE U;  1O6X A;  4NZ6 A;  1VQL S;  4DG1 B;  3TUZ C;  4ZS6 A;  4AD6 A;  4OZL A;  3PX6 A;  1Y4Z B;  4USM A;  1CJV B;  3T9N A;  3W60 A;  1YBT A;  4KPC A;  1SI9 A;  2PMH A;  2E29 A;  4WKY A;  4USI A;  4EMD A;  4LF8 J;  2AJ4 A;  4DN0 A;  1RT1 A;  3AOC A;  5L9X A;  3SCL E;  3QT8 A;  4IH7 A;  2YH1 A;  2BOP A;  2AF6 A;  1U8W A;  2V8G A;  5CYQ A;  4P10 A;  2E9T A;  2VF3 A;  4OZ1 A;  4F36 A;  4DV5 F;  2GX8 A;  2W7A A;  2RH6 A;  2GGP B;  5KFK A;  2R2T A;  2LEA A;  1HNZ J;  1AZS B;  3TAR A;  1CJK B;  2ZDP A;  5AE3 A;  3AA8 A;  3KJV A;  2PO4 A;  1YGY A;  2CJ9 A;  3BDE A;  3TJA A;  3C66 A;  4U95 A;  1TK5 A;  3H5U A;  2ZUG A;  1FF2 A;  2IBK A;  3EGZ A;  4KGK A;  4R0J A;  4BWM A;  2V4J A;  1RTH B;  3GFX A;  2XBP A;  4ZCM A;  2KZM A;  4RWX A;  2R7U A;  3HHN B;  3AFG A;  2WSE C;  3UDC A;  2WK4 A;  4B02 A;  4KV8 A;  1JB0 C;  3ZTQ A;  3QBC A;  2BXJ A;  2DGU A;  1IQT A;  4QWC A;  5B0G A;  1WD6 A;  1CUL B;  3DRX A;  4HVZ A;  2MZS A;  4UUX A;  4UPL A;  1UVM A;  3OVB A;  1RTI A;  3QT6 A;  5A2Q U;  3OR1 B;  1SC1 B;  1HNI B;  4YR3 A;  1SH2 A;  1SH3 A;  2LLZ A;  1B99 A;  3VAM A;  3G82 A;  4B3R F;  2JHE A;  2I38 A;  3PYG A;  4GKK J;  4K7Q A;  2J9D E;  5AJ3 J;  4B9V A;  4ZPT R;  2QA4 G;  3TOQ A;  3TJ9 A;  1FE0 A;  1MSW D;  1FRX A;  3W65 A;  1NJW A;  1E6V B;  3BZQ A;  4EK2 A;  5KFW A;  2V8H A;  4YY3 F;  1IKW B;  2DTJ A;  4GTZ A;  3NOC A;  1U47 A;  2QA4 S;  1D09 B;  1CSJ A;  2NCK L;  4KTQ A;  2OIH A;  5EHH A;  2VQE F;  1S6O A;  3MR5 A;  2C1E B;  3J81 U;  4AL5 A;  3TZW A;  4WP3 A;  4PXB A;  1VRU A;  2HNZ A;  3PHT A;  2MLZ A;  1KQF B;  3ENA A;  4X4T A;  1TL3 A;  1ELZ A;  2WAQ D;  3TVZ A;  2DBB A;  2MZT A;  4ZG7 A;  1WC3 A;  5H9E J;  1T05 B;  2ZNZ A;  4WTY A;  4FKY A;  2K3K A;  3I32 A;  1S97 A;  4IKA A;  5DDO C;  1EAR A;  2UUA J;  3VZI A;  2EC0 A;  3H4B A;  3UDV A;  2KYX A;  3RU0 A;  3TZZ A;  1UW9 A;  3LA0 A;  2I6W A;  3ZNJ 1;  1RAC B;  3SEO A;  3DHX A;  2J7W A;  1UA1 A;  3JQM A;  3NKR A;  2YNG B;  2CQI A;  1Y11 A;  5HRO B;  3EZ5 A;  1ZA2 B;  2NYI A;  2ZE2 A;  1PJ7 A;  3H8Y A;  1L3K A;  4DV0 J;  3B5Q A;  4ZVR B;  3AB4 B;  1JKH B;  1VBY A;  4DZD A;  2CJQ A;  4DQP A;  1RT7 A;  2VG7 A;  2NZ4 A;  5DLT A;  4N77 A;  5H9E K;  2OI2 A;  2OO4 A;  5KFT A;  2C3M A;  3MPV A;  1WG1 A;  1WI6 A;  4KIA A;  1UPP A;  4NAS A;  5CCM A;  3E2D A;  3M2R B;  4TXS A;  5E3C A;  2V9K A;  1V3Z A;  3GTY X;  2GC8 A;  3FEX B;  4KQZ A;  3DRS B;  2R7T A;  1B7Y B;  3LP1 A;  4JBC A;  2FHM A;  2QN6 B;  4ED8 A;  2HAI A;  4DL4 A;  3DHW C;  3BBC A;  3OVA A;  4C97 A;  3OUY A;  4N76 A;  3ENQ A;  4X4P A;  2VB6 A;  2H4Y B;  3KK2 B;  4X4Q A;  5GAG I;  1UCN A;  2QTW A;  3EIC A;  3K0J A;  2OEM A;  3PFE A;  2WB1 D;  2W4P A;  5LXR A;  1F3V A;  2EBE A;  1F5C A;  2FLP A;  2D7S A;  3LOU A;  4A8O A;  4B9S A;  1DAX A;  1IKY A;  2ACM A;  3GZ7 A;  1B4S A;  5EWE A;  1C2P A;  3F44 A;  3VWS A;  3LQV A;  2E5L F;  4KGZ B;  4JI8 F;  5ETK A;  2EVZ A;  2V5H G;  2RVJ A;  3PDN A;  2G9O A;  3VAJ A;  3N4W A;  2CG8 A;  2QMW A;  2MSS A;  3NGS A;  2AT1 B;  4CLW A;  3QWU A;  3ZZZ A;  5BYQ A;  1SL2 A;  2EEY A;  3UDE A;  3SI8 A;  2D9P A;  5D0G A;  5ETL A;  3KK1 A;  3OFG A;  1XK8 A;  5DDQ C;  4PR6 A;  3OTD A;  1FK9 B;  3CCZ A;  1HBU A;  5B7W A;  3MOJ B;  4ENO A;  3V2U C;  1Q16 B;  2JEG A;  5K4P A;  2YY3 A;  1ZED A;  2W2M P;  1LXN A;  2RKI A;  3D1Q A;  4E8U A;  4N41 A;  4YB5 A;  1HYS A;  3K5O A;  5J2M A;  4I6Y A;  2FJB B;  2B4P A;  3ONQ A;  2N4D A;  4KPY A;  2E44 A;  1S4F A;  1WJ9 A;  2BM0 A;  1C1C A;  4QQB A;  2GLQ A;  1JLB A;  2HVE A;  2IPO B;  3HHL D;  1RAB B;  4AND A;  3TQ1 A;  1QVG R;  1WHW A;  2DNZ A;  3UNG C;  2QSW A;  5IQ6 A;  2BVZ A;  2NRE A;  1BGX T;  4RU2 A;  1D3W A;  3GCX P;  4KFB A;  3CCL S;  1UVI A;  2CZV C;  3GLJ A;  5ETN A;  5LMU J;  4ED3 A;  2JFK A;  3KLE A;  1WEL A;  1BQM B;  2QLF B;  2OTL S;  2YNF A;  2P9E A;  3NKM A;  2AP6 A;  3C14 B;  1PBU A;  3PW2 A;  2RDD A;  3FBB A;  3KLF B;  1UP1 A;  2HHP A;  2XNQ A;  4O3R A;  2MST A;  1NPP A;  3CCQ S;  3KLI A;  3C8Y A;  3BGF A;  4FXW A;  1NK4 A;  1EP4 B;  2ILZ A;  3F56 A;  5DRK A;  1RKI A;  2LEB A;  1VLO A;  4OJH A;  6FD1 A;  2XB2 D;  2XRG A;  3QLH B;  2DR5 A;  1DLO B;  3PRD A;  2ZBQ A;  1KOH A;  2DEJ A;  2C3P A;  2HS3 A;  4NLY A;  3CD6 S;  2ALY B;  4K5S A;  5HK4 A;  1J27 A;  3OL7 A;  4IR1 A;  4XTT A;  3DFE A;  4U8Y A;  3A8I A;  1HI0 P;  1QLN A;  3SDE A;  1EIY B;  5C2C A;  1PCA A;  1KC8 T;  2VIH A;  3TG0 A;  2VU5 A;  5HBM B;  3QJJ A;  5KT3 A;  3GIK A;  2VBY A;  1B3T A;  2WSF C;  1QJH A;  3GQC A;  3MGJ A;  5BYS A;  3A8K A;  3C16 B;  3IM8 A;  3S1T A;  4USJ C;  1NND A;  3Q86 A;  2Q3P A;  4KR0 B;  3A3O B;  5F8I A;  9ATC B;  2G2Y A;  1KHL A;  2ZOG A;  1WF2 A;  5KG0 A;  4EGL A;  3SQG A;  2HHU A;  5LIA A;  1X4G A;  3U1L A;  1TVR A;  1GH8 A;  1TKX B;  2JVR A;  1CS4 B;  2LXI A;  1WF0 A;  3KJQ B;  2ZH9 A;  1I94 F;  1HA1 A;  3P96 A;  3D28 A;  5KFC A;  2HFZ A;  2BJ1 A;  2AIR B;  1HBN A;  5G0R B;  3PJW A;  5D4N A;  4RW8 B;  1RT2 B;  2ZD1 B;  4QIV A;  4CIO A;  1LK5 A;  3CME S;  1PSD A;  2L48 A;  5CH7 B;  3C15 A;  3MUV P;  3ISN D;  1TL7 A;  3UI3 A;  1T95 A;  2ANH A;  5D8H B;  2ZKU A;  4DR2 J;  4PPZ A;  4NXN J;  2W7P A;  5B09 A;  4QPT A;  2DHA A;  5KOX A;  2XR9 A;  3EVW A;  4LF4 F;  3EGW B;  4DV1 F;  2ZDO A;  4TY9 A;  3H5S A;  2Q66 A;  4JI1 F;  4DX8 H;  2RU3 A;  1TU0 B;  3C46 A;  3I0R B;  2W5S A;  4PWU A;  2H5E A;  3WQP A;  4LR9 A;  4DZ6 A;  4MK9 A;  1IBK F;  3IAM 9;  2FJW A;  4HT7 A;  5KG5 A;  4B9L A;  3R2D J;  3M8P A;  5A8R B;  4I56 A;  4PQU B;  5DG8 A;  1FKA F;  1VBZ A;  3JS9 A;  4C98 A;  3CIM A;  3M6U A;  2HMI A;  3D67 A;  1U6B A;  3BQ2 A;  3Q8S B;  5E3Q A;  1HQE B;  3MCM A;  4CM0 A;  2PDA A;  4N8N A;  4CLT A;  1R8A A;  3BGO P;  1AFI A;  7FD1 A;  4U6P A;  1B8J A;  1WG4 A;  2WZ1 A;  4ICL A;  4TU7 A;  2YKO A;  3V6D B;  1O5J A;  2N7C A;  3MOZ A;  2HWI A;  2B9W A;  1HWI A;  2VPY B;  2JC1 A;  2IRY A;  1UWB A;  5B0B A;  4DUY F;  2Z57 B;  2OJ3 A;  3VAL A;  1DTT A;  2Y8W A;  3BGR B;  2KHC A;  4QU7 A;  3VGT A;  2HWT A;  2X1B A;  2RD5 C;  4M5H A;  2UU9 J;  3FFI B;  4EUV A;  2XYG B;  3IWX A;  4TVA B;  3GSD A;  3AAW B;  4I2P B;  4JI4 F;  1F1B B;  1VIX A;  1M1K T;  1ZAX A;  1GXL A;  2D1C A;  5GAH U;  5L9N A;  2ZM6 J;  5L1J A;  5A2Q Y;  1XR5 A;  2J0Q D;  3J7Z T;  4BLG A;  4AYB D;  1U1O A;  1WC5 A;  2IUC A;  3D6T B;  3UN2 A;  4UY8 5;  2QT7 A;  1UEK A;  5KG3 A;  4A8K A;  3DLG B;  4DMZ A;  3M32 B;  2NUH A;  3ILL A;  2ZJP Q;  3CC7 S;  2IMO A;  2CKW A;  1N32 J;  3MM7 B;  1FXD A;  3T1H F;  3OL8 A;  1HQ2 A;  3D6F B;  3R27 A;  3IGZ B;  3CED A;  3NVL A;  1N88 A;  3DYA A;  1DTQ A;  1JLC B;  3OQ2 A;  2ZHO A;  2VQF F;  5D3G B;  1H7W A;  2C2E A;  3H5X A;  4ILL A;  1EHW A;  5L8R C;  1YK9 A;  2ZVI A;  3GWC A;  4TYA A;  1X4A A;  5KFB A;  3S7R A;  4LF2 A;  5LXY A;  5C24 B;  5L39 A;  5L38 A;  1QAX A;  4ID8 A;  1Y00 A;  3C19 A;  4OQJ A;  4A8X A;  1NJZ A;  1YLX A;  2G0C A;  3H40 A;  2E9R X;  4JYA J;  2K7J A;  3AD9 C;  3VGV A;  3ZZR A;  2C3U A;  3BDP A;  4URG A;  1GMU A;  5E3P A;  2ZH4 A;  3LPE A;  3BSO A;  2DNO A;  4DUZ J;  2VPW B;  2Q6B A;  5GVQ A;  4ZLN A;  3TRG A;  5C42 B;  1FA0 A;  1YIJ S;  1TMM A;  4DS4 A;  1SKR A;  1S76 D;  3IR5 B;  1DUR A;  5D4P A;  1FDN A;  5HVF A;  4Y3C A;  1T02 A;  3FEZ A;  5BYR A;  4DV2 J;  2ZEJ A;  3DOM B;  5B0C A;  4ETZ A;  4I0W A;  3V4I A;  2BJD A;  3CW2 C;  2MZQ A;  1VS3 A;  4NCA A;  4ZIT A;  4RR5 A;  4KC5 A;  4NCB A;  4YP3 A;  1CJU B;  2QX0 A;  4RNN A;  3CCR S;  3MMC A;  1QD1 A;  4ZPV R;  4EO8 A;  4FF4 A;  1U6Z A;  3PW4 A;  2ASD A;  3ILJ A;  2FB0 A;  2YX1 A;  4HAC B;  2BMB A;  3O1L A;  2GSU A;  5ETR A;  1IBM F;  1SVD A;  2E1A A;  1WEY A;  4EO6 A;  2XI3 A;  1NSK L;  2AJQ A;  3M9M B;  1WKK A;  3ZTO A;  1X8D A;  4DI6 A;  3BS9 A;  4LF5 F;  3LAN A;  1E1Z P;  1F60 B;  2D3Z A;  4FXD A;  4WXO A;  4WTO B;  4A8F A;  2ZC3 A;  4I7F A;  2U2F A;  4ZVG A;  2OPS A;  1IBL J;  4O44 B;  3IA0 A;  1ICE B;  2BQ3 A;  3HHD A;  3KFW X;  2B56 A;  2QGF B;  4X4O A;  2RIJ A;  3QO9 B;  2DXE A;  3AD8 C;  4M95 A;  3G8S A;  3Q8V A;  5SZT A;  3VGS A;  2FJD B;  1GT8 A;  2ZH3 A;  3CJ0 A;  4A8Q A;  3CMR A;  5LJ3 Y;  3H42 A;  3T5J A;  2HHT A;  2V8P A;  2QG9 B;  4DV5 J;  3N6L A;  3LXQ A;  1VQK S;  1RT3 B;  1JLG A;  5TJ3 A;  1YJT A;  1KHJ A;  4IQX A;  1ELO A;  2HK3 A;  3T3F A;  5E33 A;  2YKM A;  1UMJ A;  3CJT A;  2XWY A;  1S9G B;  3LGN A;  3KMS A;  5HJX A;  1AT1 B;  2N7Y A;  3IAS 9;  3TAQ A;  1RYR A;  1WHY A;  2EK1 A;  1QE1 B;  1Q8I A;  4DV3 F;  3QFW A;  4ZHR B;  2LP4 A;  3HM9 A;  4WJB A;  3PRV A;  1REV B;  3JYT B;  2YKN B;  2WW4 A;  1R89 A;  2IVM A;  1S6Q A;  2RF2 B;  3IRX A;  1X9M A;  2HLT A;  2FGO A;  4C0B A;  1KNZ A;  1V9O A;  3QYY A;  2NPF A;  2RHQ B;  2N4C A;  4LT6 A;  4JV0 A;  3IR7 B;  4I2Q A;  2EBG A;  5IM0 A;  2N3O A;  4DR5 F;  2FZC B;  1K8A T;  3O3L A;  4ZG9 A;  3KUE A;  4DQI A;  2DD8 S;  1ZEB A;  3W61 A;  4YR0 A;  4B3R J;  3RZA A;  4FXV A;  2F1F A;  3CO0 P;  1E6Y A;  1KLM B;  2XI2 A;  5DZ6 A;  3VAI A;  1Y3J A;  3U1N A;  2AJ1 A;  1LWE B;  1NPK A;  5ETV A;  3WAW A;  1VC0 A;  2HNY A;  3GYX B;  3FDS A;  1N52 B;  3SZY A;  4EI2 A;  5G4D A;  4YY3 J;  2FLL A;  1T3O A;  2VOD A;  5IQQ A;  3I55 S;  1HBO A;  3NCQ A;  1XNR F;  2VQE J;  3FCV A;  1RI7 A;  2HBQ B;  2F7V A;  2H5I B;  1F9H A;  3TVK A;  3MMB B;  1F6T A;  2L08 A;  4UOG A;  4QYZ K;  2ERR A;  1ZYQ A;  4P2S A;  2IAJ B;  3F73 A;  1ALH A;  1FKO B;  1X4F A;  2W2Q P;  4ITS A;  4PUO B;  4X4R A;  1O8B A;  1C0T A;  3D4J A;  3VHQ A;  4IFV B;  2QE5 A;  4UPI A;  3M8W A;  3TQE A;  1Q7Y T;  4NCG B;  1N2L A;  3CWJ A;  5B0F A;  2BOA A;  4ECQ A;  5LM7 E;  2ABY A;  1JLQ A;  4OX7 A;  2V68 A;  4PG5 A;  1TFY A;  4UOR A;  4IDK B;  4DR4 F;  3RAX A;  3B4M A;  2KFN A;  2W8K A;  3DMJ B;  3QT5 A;  1IKV B;  4P52 A;  4F4K A;  5HMX A;  5ADZ A;  4XO0 A;  2P6T A;  4BWJ A;  1RZM A;  2J0S D;  3KLH A;  5F9L A;  3O5T B;  2GJF A;  4RBV A;  2UP1 A;  3MEE B;  4L74 A;  3D3B J;  3U7J A;  4LSZ B;  2NZC A;  3SCK E;  1PYS B;  3IMQ J;  3HHE A;  3VCD A;  2XLI A;  2CQB A;  5LQQ A;  1SHN A;  2D74 B;  3GR0 A;  1GMV A;  4JI5 F;  3NWG A;  5HAT A;  3P3D A;  2E66 A;  1SB6 A;  3M2U A;  1ZEF A;  2B5J A;  2R8J A;  1RSC A;  3DRP B;  4NLG A;  4DFJ A;  3MMA B;  2NXE A;  1SJR A;  1N5V A;  3KG1 A;  3GMG A;  3TVY A;  1NEE A;  1DY3 A;  3CDE A;  3D3C J;  4CT9 A;  3OTE A;  2RU9 A;  1B7F A;  2IJN A;  2YWE A;  2BKO A;  1CG2 A;  2BQU A;  4EEY A;  1REG X;  4UQT A;  2E5L J;  4JI8 J;  3ZO7 A;  2XM3 A;  3O2I A;  1VCT A;  2CJB A;  1BLU A;  1WSV A;  5F8H A;  2HVH A;  1X9S A;  2ASL A;  3JAM Y;  4Y2A A;  3WX4 A;  3DC2 A;  2LXU A;  4LF6 F;  3AT1 B;  2BV3 A;  2AYM A;  1RCO B;  1Y7P A;  4AE5 A;  2FVS A;  5KOW A;  2NXJ A;  2DO0 A;  1VQ8 S;  2LQ9 A;  3BDH A;  2W2P P;  2Q43 A;  2IYG A;  4ZVE A;  3L9Z A;  5K14 B;  2AZ3 A;  1ZTT A;  1LKZ A;  3BKU A;  4E2F B;  2YXL A;  5E3R A;  1FWK A;  4MHX A;  5E7O B;  4F4A A;  2VG5 A;  4DX7 A;  1ANI A;  1R7I A;  2FDN A;  3H2V E;  5L0E A;  3JB9 k;  2Q1L A;  2ZZN A;  4DCJ B;  4Y2I A;  4F7V A;  2CAJ A;  4LVO P;  4DFM A;  1FWL A;  2XYH B;  5ETT A;  4F25 A;  3GYG A;  2AHO B;  2CQ4 A;  1NB7 A;  1U0H B;  3HVT A;  4PXE A;  2ZZT A;  3GCW P;  1FI4 A;  1Q79 A;  1T9V A;  5IC4 B;  2XCA A;  2FJE B;  5I4M A;  4EBE A;  2KM8 B;  2YNI A;  3NS5 A;  2FZK B;  5DG9 A;  5EWG A;  3MAA B;  4Q2M A;  5F9N A;  3TX8 A;  2VOO A;  2QJ3 A;  3GV5 B;  1YG0 A;  4FYY B;  1ED9 A;  3PYE A;  1U1R A;  1N6Q B;  5HP1 A;  4KY3 A;  1U1K A;  4P7T A;  2O1P A;  2KFZ A;  2VKR A;  5DDR C;  1EQM A;  5E41 A;  3BJY A;  3TUJ C;  2G0I A;  3UVJ A;  1S6P A;  3DOL A;  4Q8E A;  2N3L A;  1HHS A;  1OMS A;  2AEF A;  2W9C A;  2XO7 A;  4GTW A;  2M7S A;  2ZOF A;  1AJD A;  2A3J A;  4Q8F A;  3GPA A;  3HHK A;  3BYP A;  3OR2 B;  1VQ7 S;  1VHI A;  2CVI A;  4QIW D;  1Y7A A;  1XN9 A;  3VR1 A;  1VIS A;  2H5J B;  5ETQ A;  4CZC A;  2KU7 A;  1TV6 A;  2HQI A;  1AUK A;  1I1G A;  3FSY A;  4TLQ A;  3G6E S;  1RWO B;  3Q2T C;  2EK6 A;  1Q53 A;  3AJD A;  2GJ2 A;  4IO1 A;  3HJF A;  4LRF A;  2X3D A;  2MMY A;  4NEZ A;  2DNN A;  1NO8 A;  1RTJ B;  4I1T A;  2HFS A;  4F0M A;  5KFX A;  1JK9 B;  5A8K B;  2IM1 A;  1U0S A;  3HZG A;  2DGW A;  2Y3Y A;  2HG4 A;  3ILO A;  2HHW A;  2V2Z A;  1T11 A;  3HD1 A;  2MXY A;  2NQP A;  4WBF A;  4NLR A;  5D4L A;  1BUX A;  3U27 A;  4FZV A;  3KMQ A;  1S0M A;  4NRT A;  4WU3 A;  1P49 A;  4B56 A;  5CYM A;  5DDP C;  1HL6 A;  5KG6 A;  1NH7 A;  2VUG A;  2JLF A;  1I94 J;  3BBF A;  2MQO A;  3QSY B;  3BB5 A;  2C2M B;  2IFY A;  2MKY A;  4I67 A;  4W98 A;  2HRY A;  5JVG Q;  4B3S F;  5AE2 A;  4ILR A;  5L1K A;  4LRA A;  2ILY A;  4WZM A;  2HQD A;  4PEO A;  1K7H A;  2QZ8 A;  5T7L A;  4YDD B;  4LF4 J;  4DV1 J;  3D6M B;  4JI1 J;  1N5S A;  4Q45 A;  3IWN C;  4WFY A;  1XWL A;  2VOP A;  3O44 A;  2HHH F;  2B8Q A;  5M2P A;  3BO4 A;  2AJ0 A;  2WB4 A;  2XSJ B;  1IBK J;  1GXT A;  2DH8 A;  2EG2 A;  4O4G B;  1FVQ A;  2V34 A;  2UXB F;  4O0I A;  4EU0 A;  3ZZU A;  3BH6 B;  3PCO B;  2DGX A;  3MEG B;  1NK7 A;  1RHK B;  1ZPV A;  1SV5 B;  4MKV A;  1MN9 A;  3E01 B;  3CCU S;  1KFS A;  3MM8 A;  4DF8 A;  4MK7 A;  4YB7 A;  1RWK B;  1VQ4 S;  3ZTP A;  2QLB B;  1ACM B;  1ZZF A;  2JX2 A;  4CLF A;  2Q6C A;  4ANC A;  3WIV A;  1QAI A;  3W2V A;  1TKZ B;  2F8E X;  2HQC A;  3TUP A;  5JMN A;  2HFO A;  3DRR B;  1BQN A;  3DM2 B;  1RAH B;  2PN6 A;  1UJ5 A;  3P6Y C;  5D0R A;  2CUY A;  3IM9 A;  4HHH A;  3DLK B;  3IO1 A;  1PIL A;  1R27 B;  1CJT A;  2MKH A;  1VQS A;  3GON A;  3J80 U;  4C7Q A;  2DPJ A;  3PIO Q;  4DUY J;  3DI6 A;  2HZA A;  1BC6 A;  1DZ5 A;  3PIP Q;  2OGU A;  3NRB A;  3GIJ A;  3V6J A;  4IG3 B;  1VQ6 S;  1CC7 A;  3UQS A;  4RL1 A;  5D0H A;  2LDI A;  1ZAV A;  1NSQ A;  1T94 A;  4KKO A;  3CCT A;  4JI4 J;  1RT1 B;  2YX4 A;  3G6X A;  4EBD A;  3VAK A;  5CYQ B;  1V3S A;  1UJ4 A;  4NLS A;  4GO7 X;  1MWZ A;  4ZLP A;  4CO5 A;  1RTD A;  1FX4 A;  4NWJ A;  3LUY A;  4KGM A;  4GTY A;  2FUG 9;  3KJV B;  3HFZ B;  1SKW A;  3KNG A;  3M8Q B;  5CCL A;  4JV2 A;  1R0A B;  1S49 A;  5DGB A;  3LWL A;  1TKT A;  2H9Z A;  4U96 A;  4F3Q A;  2IRX A;  2FY8 A;  4FYW B;  1M5S A;  2V4J B;  5IJQ A;  3NCP A;  3T1H J;  4C8Y A;  1H2V Z;  4BCA A;  4OZ3 A;  4ID5 A;  2ZH6 A;  1FKP A;  5H1S V;  2VQF J;  4CRJ A;  4ERD A;  4KV8 B;  4CH7 A;  3DGP A;  3DOK A;  1M5O C;  5AXL A;  4FKX A;  5EDW A;  4ED0 A;  1EW9 A;  1KQG B;  2QMU B;  2K8G A;  4H4M A;  4DV4 F;  3K5N A;  3NS6 A;  4RW4 A;  3P8B B;  1AZS A;  1RTI B;  2AGO A;  2DRD A;  4ELT A;  1HQU B;  3C2P A;  1NK6 A;  2DGS A;  3MD3 A;  3OL6 A;  3G82 B;  2RML A;  4NLV A;  3GU0 A;  2MLY A;  2WSC C;  1LQ9 A;  1IKX A;  2A1B A;  3MEC A;  5IJS A;  4ZP7 A;  3R7S B;  1HI8 A;  3DNC A;  1GEH A;  3MCS A;  5F8G A;  2Y1J A;  4NLP A;  2DXF A;  4XK8 C;  4R8U A;  1Y0H A;  1EW2 A;  3LP0 A;  1X7V A;  4KHM A;  3ENV A;  2RIL A;  1LW0 A;  2BDP A;  5A0Y A;  5KFO A;  1VRU B;  2HNZ B;  2YVS A;  1F0X A;  5T41 A;  3W7B A;  4C48 A;  1TL3 B;  2BJ9 A;  5EX0 A;  1C0U A;  3OR1 A;  3E51 A;  2FHK A;  3A3P B;  1VQN S;  2W9A A;  2AYG A;  5I3U A;  5D15 A;  3H25 A;  2ZUA A;  5HAO A;  4NLW A;  3JSR A;  4QWE A;  2FVR A;  1N2K A;  4F0K A;  2J0W A;  3OXF A;  3DLB A;  5A8W A;  2F8M A;  5I3Q A;  1IBM J;  3OFF A;  1FX2 A;  1X31 C;  3RYL A;  4KHP F;  3SCI E;  1PGZ A;  3CJK A;  2W25 A;  2F3J A;  4LFB F;  2ZE2 B;  4F26 A;  2LEC A;  3VV2 B;  3HSJ A;  4H54 A;  4LF5 J;  2RQ4 A;  3I4P A;  3FJ2 A;  1RT7 B;  2VG7 B;  4M5M A;  3JTO A;  4OYI A;  4QPX A;  4OZ0 A;  3KWM A;  3MM9 A;  1C4A A;  4USU A;  1KON A;  1FVS A;  4I64 A;  4MIW A;  1L3S A;  4OI0 A;  3AQO A;  4A8Y A;  3RBD A;  2HHV A;  2DIS A;  4ZG6 A;  4DL6 A;  1RYS A;  2M4M A;  4I69 A;  3LP1 B;  2RS2 A;  1WOS A;  5HMW A;  4UY8 T;  5GAG U;  1Z1Z A;  2H54 B;  4PZV A;  3I9V 9;  3OUY B;  4MIB A;  4OMF G;  1QSL A;  1SJQ A;  3SSQ A;  2YPY A;  2OPP A;  3GE9 A;  4OHV A;  1KH5 A;  4NEY A;  3JQK A;  3A8E A;  1SUQ A;  2MKI A;  2W9B A;  4B3T F;  3PVX A;  2BJ3 A;  2MQM A;  4OZJ A;  4FS2 A;  4UZB A;  1OWX A;  3US5 A;  1KBR A;  2MQL A;  1IKY B;  2VHG A;  5H9F J;  4DV3 J;  3SFU A;  1N4L A;  4MAK A;  3E8O A;  3MAQ A;  4QCL A;  2OPR A;  2J7K A;  3ELH A;  4X84 A;  2GVZ A;  1B64 A;  4K50 A;  1HR0 F;  2DR9 A;  3IN5 A;  3S8S A;  4O23 A;  1QM9 A;  2BE9 B;  3KHL A;  2GHP A;  3FZ2 A;  4DR5 J;  4CNY A;  3AY0 A;  3HHL A;  1W25 A;  1X4C A;  4AXI A;  1VQO S;  2V8V A;  3KK1 B;  2ATL A;  4ZVQ B;  3AJ2 A;  3LWM A;  5IWA F;  4Z7Y A;  2CQ1 A;  1HBU B;  1URB A;  3PW7 A;  2E1P A;  3J7Y I;  4K59 A;  2BZ2 A;  1N34 F;  8RUC A;  1D9D A;  2BUN A;  5C5J A;  3J7Z 5;  5H9F K;  2RKI B;  3QT7 A;  1A7G E;  3ZXW A;  2UZA A;  1P9Y A;  3HXM A;  2FD2 A;  2UV8 G;  1HYS B;  1PYO B;  5J2M B;  2HK2 A;  4Y28 C;  2YWG A;  3WIU A;  1XNR J;  1WDD A;  4L3N A;  4MMO A;  4JI6 F;  1S59 A;  2UVV A;  4GVB A;  4XAK A;  3ZTS A;  1YJW S;  1C1C B;  2RB7 A;  3G71 S;  1NZ8 A;  1FES A;  2H1Y A;  1JLB B;  5GAD I;  3EJM A;  1ZS6 A;  2CWK A;  1LNQ A;  5K8O A;  3KHH A;  1Q1K A;  2RRA A;  3CUL A;  1RT6 A;  3NGT A;  1N0V C;  3T1A A;  3K89 A;  2HGN A;  5LSL A;  3K8V A;  4PAB A;  1QSY A;  4OIX A;  2VL1 A;  2PT0 A;  2QA1 A;  3QGH A;  5DGA A;  4YHH F;  3DLL Q;  4DR2 F;  2Y0B B;  4DPU A;  3OHA A;  4QU6 A;  1FXR A;  2DHH A;  2QRR A;  1K0T A;  4D3G A;  4TN2 A;  3KLE B;  2I8E A;  3Q8Q B;  2R8H A;  1E3C P;  4CLK A;  2YNF B;  4QWA A;  2UUC F;  3DLE A;  3R5D A;  4DR4 J;  3C6U A;  1JLF A;  2X1G A;  4B3M F;  1YQH A;  4F4X A;  4RUA A;  3EZO A;  2W5T A;  2BAC A;  3KLI B;  1B70 B;  2KM8 C;  3L3C A;  4HDG A;  1VK8 A;  3CTR A;  4YDX A;  4UF4 A;  2YPZ A;  1KN6 A;  3BF4 A;  4K4T A;  3BM7 A;  4KM4 A;  2DYA A;  5KFP A;  3THT A;  1YJ7 A;  3MDF A;  2PEB A;  3GYN A;  2I0X A;  4C8O A;  1MLA A;  1YTY A;  2IRU A;  2D69 A;  2D9O A;  3AB2 B;  3SV3 A;  2VBW A;  1SIZ A;  1NU4 A;  4M5L A;  4QIF A;  3K5M A;  1ROF A;  1RAD B;  4JI5 J;  2JOQ A;  4DPX A;  2Z2M A;  1TQL A;  2NSB A;  3SDE B;  1AA1 B;  2G1D A;  4N8O A;  4ZPA A;  4A48 A;  2LXF A;  2B51 A;  3ISN C;  1BHN A;  2HQ3 A;  3MK2 A;  2ZWP A;  3R5B A;  2BE7 D;  1FHT A;  2C28 A;  4CO3 A;  1IVZ A;  2LFV A;  1U2R A;  4JV1 A;  4IH6 A;  1J5O A;  4KYZ A;  3PX4 A;  1N36 F;  3PYF A;  2MJU A;  5A6P A;  3FMW A;  2VBZ A;  1TVR B;  2JJ4 D;  3NAH A;  2R9L A;  4OZ5 A;  5CXT A;  2ZHB A;  3TJ8 A;  3HFK A;  4LF6 J;  1S9E A;  4FS1 A;  1U1M A;  1H74 A;  2MHN A;  1TUW A;  4TY8 A;  2C2O B;  1N0U A;  1HBN B;  2KDO A;  1UW4 A;  2VD3 A;  4I68 A;  5HBM A;  1WF1 A;  2MQP A;  2FPH X;  1ZET A;  3O6Q A;  4A8M P;  1DQ8 A;  5KFZ A;  5LSR A;  1N56 A;  1TL7 B;  2HHX A;  3FUY A;  4GKJ F;  2LKZ A;  3A8J A;  1JWW A;  3RJM B;  2VBX A;  2OD6 A;  2R4F A;  2JRS A;  3LW5 C;  2C2K B;  1S99 A;  4KJI A;  5HLF A;  1HHT P;  4IG0 A;  2OPQ A;  4DCO B;  4EZ6 A;  4ZP8 A;  1W2I A;  3T19 A;  3MF5 A;  2UVR A;  3G9C A;  4JI2 F;  3LAL A;  4M63 A;  1GTH A;  4C4W A;  2X1F A;  3QGP A;  1JJ2 R;  2A6O A;  1RT2 A;  3MUR P;  3MR2 A;  4ZA1 A;  1Q8K A;  2FLO A;  4F67 A;  2Y0S D;  3M8P B;  3WC2 A;  2FC9 A;  2V94 A;  5EN1 A;  2XMM A;  3M30 A;  1J2V A;  3CD7 A;  3TR5 A;  3M8S A;  1WG5 A;  2KRB A;  2HMI B;  4USH A;  3PG9 A;  3ZNU A;  4MT1 A;  4B9M A;  3MI7 X;  4YN3 B;  4ECY A;  1HW8 A;  3BPD A;  4OX6 A;  2DRA A;  3HKZ D;  4F8R A;  1S7H A;  1DRZ A;  3TA1 A;  1SJ3 P;  2I1R A;  3CJS A;  1PJ6 A;  1FE4 A;  2V2V A;  3DPC A;  1DQA A;  2ZH5 A;  1BWE A;  4ICL B;  3D1H A;  2PMZ D;  3NKN A;  1HD0 A;  1YRU A;  1KQS R;  4XDD A;  2CJK A;  1QUV A;  4UQG A;  2DR7 A;  2DJW A;  2KH9 A;  2CJA A;  1HNV A;  1Y10 A;  3CE8 A;  1TEL A;  2CNK B;  4CLU A;  1MRO A;  3FC9 A;  4WYW A;  4YR1 A;  1UWB B;  2CJY B;  4PG7 A;  2HSE B;  2ROP A;  2MKS A;  1S1W A;  1DTT B;  3A13 A;  2M3D A;  2R8K A;  2DT9 A;  1LWC A;  1U24 A;  2K3I A;  1VQ5 S;  2G0J A;  3LF0 A;  1XER A;  4CI0 B;  1KHV A;  2BJ8 A;  1EZZ B;  1OY8 A;  4O3O A;  1RCX B;  3Q23 A;  4DPW A;  4A4J A;  2WOM A;  2GVD A;  3TAM A;  4OX9 F;  1CC8 A;  1H2U X;  3GIL A;  2PFD A;  2IUC B;  3DXB A;  1RAJ A;  1XMB A;  3V5R A;  3H5Y A;  1IBL F;  4E98 A;  2DKO B;  1XNQ F;  4CLY A;  1FCA A;  4S0M A;  4B17 A;  2Z56 B;  1Y6V A;  3TNV A;  3ENW A;  4OYP A;  4DF4 A;  1GNK A;  3M7V A;  5FD1 A;  2W5R A;  1GFW B;  2ZHA A;  5K8P A;  4NLT A;  2HS0 A;  4Y2M A;  4DL5 A;  4GMK A;  1FT8 A;  1UEU A;  1DTQ B;  3DYA B;  4M1K A;  2MQ8 A;  3H7H B;  3TI0 A;  1SJF A;  1LK7 A;  4K2J A;  1WHX A;  2RDJ A;  1M5P C;  2RQK A;  1S1T A;  4MYT A;  4B3S J;  4A47 A;  1KEK A;  4F4Y A;  2GJI A;  2CQG A;  1RU1 A;  5IV4 A;  4GVL A;  4LBP A;  5DLF A;  4WYL A;  1IN0 A;  2BW2 A;  2XUL A;  1XR7 A;  2WON A;  4U8V A;  1MW7 A;  4ES3 A;  2XSF A;  2JEJ A;  3CF5 Q;  2HHH J;  3TAN A;  1QY7 A;  3W1Y C;  4ZMM A;  3D66 A;  2FVQ A;  3C3L A;  4RUB A;  2HUR A;  4QAX A;  3BGL A;  2B7B B;  1YBA A;  2J8S A;  1QSS A;  2R42 A;  1EQ0 A;  4LBI A;  2UXB J;  2R7X A;  1RT5 A;  1JLA A;  5KAK A;  2E1R A;  1UAW A;  5B08 A;  2R2R A;  3HT3 A;  5C7P A;  1IWA A;  4NI2 A;  3QGG A;  1VC5 A;  3PV8 A;  3V4I B;  3CJR A;  4RBU A;  2BJ7 A;  2MKK A;  2HVD A;  1LEO A;  2FC8 A;  5GME A;  2CJX B;  5E5N A;  4HT5 A;  1PYT A;  1KLN A;  3EPG A;  4RNF A;  3MMC B;  2AWZ A;  1U1L A;  1MNE A;  1BMQ B;  1GAO A;  3I0S A;  2E5G A;  3PM9 A;  1RTZ A;  2AEM A;  4USV A;  5K20 B;  4C3M A;  3P45 B;  2FVC A;  1KP6 A;  3MEK A;  2BAN B;  1CVJ A;  4LSN A;  4CDI A;  1R8C A;  2NXC A;  5F8M A;  3G8Q A;  1KR4 A;  1NDL A;  1NB2 A;  1X5S A;  2OFG X;  4FNI A;  5IOL A;  1RWW B;  2ZH8 A;  4K0K F;  3KK3 A;  2JNJ A;  1FDA A;  2MYF A;  5THW A;  4I7F B;  2OPS B;  4MTP A;  3L7U A;  3G6V A;  1S0O A;  3HJV A;  3A12 A;  2DCU B;  1SPB P;  2GIQ A;  3UN3 A;  1T9X A;  4YR2 A;  3KG0 A;  1FO1 A;  2GSN A;  1SIW B;  4HAC A;  2XYP B;  1N33 F;  3WC0 A;  5LMN F;  3HI9 A;  4NA1 A;  1H38 A;  4RNO A;  3WBZ A;  2YTC A;  4WFX A;  1RAI B;  1J5E F;  1HDH A;  3NNC A;  4F04 B;  1JLG B;  3FMB A;  2J9E A;  5MAO A;  4OJ1 A;  2BE2 A;  3T1Y F;  3EE3 A;  1NSA A;  4FF3 A;  4BS2 A;  1XIQ A;  3BV8 A;  4J9P A;  4H4K A;  3CC4 S;  5C2G A;  1ANJ A;  2IDE A;  4ELV A;  1F9E B;  4ED6 A;  3M8R A;  2ZBP A;  2JL9 A;  3RB0 A;  2LMI A;  2MEW A;  3CIZ A;  4IOA Q;  4P71 A;  3EVM A;  4TNO A;  2Z30 B;  1B0P A;  4UTG A;  1S6Q B;  3IRX B;  1N5Y A;  3KNA A;  1NHK L;  2H65 B;  2HQG A;  2GMH A;  5JVH Q;  3DXS X;  1EET A;  5IS2 A;  5CAB A;  2CQD A;  4DV4 J;  3D54 A;  4RUC A;  4ZVO B;  2I2Y A;  2M8D B;  2KHD A;  3RB3 A;  4HTJ A;  3SZ2 A;  4I2Q B;  5IM0 B;  2G9Y A;  3B4D A;  2XS2 A;  2RSQ A;  2WBM A;  2HVI A;  2DR6 A;  5D78 A;  2CPH A;  1E6Y B;  3UE2 A;  1S9G A;  2MY7 A;  3PRB A;  2R7R A;  3NMA A;  2IMW P;  2AEJ A;  4FBU A;  2V50 A;  2EG1 A;  4P2X A;  1HQA A;  2HIY A;  5AJ9 A;  1DFD A;  5A76 A;  1SKS A;  2W4C A;  1RBA A;  4C9D A;  1IWG A;  1OQ6 A;  2HNY B;  2WVE A;  3ZZ0 A;  3MPW A;  4P7V A;  3FGV A;  3KJN B;  2CQC A;  3OSN A;  1HBO B;  3V81 A;  1TFW A;  3G87 A;  4PXC A;  2XMW A;  3WAY A;  4WWS A;  3D0G E;  2GIF A;  4J9V A;  4KO0 A;  1HMV A;  1MWY A;  1OPZ A;  4G6V B;  4X66 F;  5KFL A;  1D0E A;  3VAG A;  1TAU A;  1T8E A;  3KLV A;  3PXG a;  3T6B A;  2JH3 A;  1IXK A;  4EYI B;  4Z37 A;  1SBR A;  1FDB A;  1ELY A;  2RH3 A;  2A2C A;  4ED4 A;  5HI7 A;  4M5G A;  4F4W A;  1UTA A;  3QIP A;  2ROG A;  3PR5 B;  1C0T B;  1PC5 A;  1W2B R;  2QL7 B;  1FJ7 A;  4JP8 A;  4NZ0 A;  5DM6 Q;  1S79 A;  3I96 A;  1K44 A;  3FCH A;  4J9U E;  4YS2 A;  5E0O A;  1KHN A;  2BW7 A;  1T3N A;  2HVZ A;  5CD4 A;  4KHP J;  1JLQ B;  1HBM A;  4G1I A;  3W5X A;  4LFB J;  2VDH A;  2ADB A;  1FD8 A;  1HLW A;  2XLJ A;  2EFQ A;  2A6M A;  4YB6 A;  3ETM A;  2Y1R I;  2QMX A;  4YUD A;  2XS5 A;  3KLH B;  4KJG A;  1P1T A;  3TEH B;  3PX0 A;  3HP6 A;  3VGU A;  4XPE A;  3VVU A;  3CB4 A;  2B9E A;  3FRZ A;  3BEG B;  1O51 A;  3I6P A;  2HFV A;  4K4X A;  4X4V A;  3T01 A;  3MPU B;  1IJE B;  2W1B A;  2M88 A;  1E33 P;  1K1S A;  2V4Q A;  3BDF A;  3NGR A;  3Q8P B;  2VJV A;  3W9H A;  1L3T A;  3HUL A;  3BO2 A;  3M2U B;  5HQ8 A;  3OXG A;  2NR0 A;  1DJ0 A;  3DMJ A;  1K9M T;  2IIH A;  1PKU A;  1IKV A;  4B3T J;  1R8H A;  2UUB F;  2BAB A;  3SFG A;  3NBP A;  1GXU A;  3MED A;  3RB6 A;  3M05 A;  1UZH A;  2HRU A;  5LL6 d;  4OYB A;  2N82 B;  5KT4 A;  1D8Y A;  4KT0 C;  3IWL A;  4U7U D;  1FEH A;  4L76 A;  4LVN P;  5J1P A;  1YZ6 A;  2NSC A;  3THV A;  1U4B A;  2IVY A;  1WTB A;  2AMC B;  2VG6 A;  4C8K A;  3CO9 A;  1FNO A;  3M4X A;  1HR0 J;  2YH0 A;  2M5Y A;  4ECV A;  5KFY A;  1WSR A;  2EKN A;  2KT5 A;  3LGH A;  3QID A;  3R1L A;  2VH7 A;  2J5A A;  4J9O A;  1S77 D;  2CQ0 A;  4NLD A;  2FGC A;  1S4E A;  3OSP A;  2HND A;  5LRN A;  3T02 A;  4DSL A;  4QIG A;  3QRQ A;  1P9Q C;  2LVW A;  5IWA J;  4G3I A;  4LRC A;  1K0V A;  5A6W A;  3HMJ G;  4X62 F;  2XZW A;  1N34 J;  4BHQ A;  3IFE A;  2E5J A;  2KZZ A;  1CQN A;  4OI4 A;  1PBA A;  4J9Q A;  3Q83 A;  1HIY A;  4U9R A;  2V67 A;  4F2S A;  4LSL B;  3CJ2 A;  2VG5 B;  4BDP A;  5HQL A;  2KXF A;  4JI6 J;  2XMK A;  5FDL B;  1WAC A;  4QJV A;  3KTQ A;  4DLE A;  3D68 A;  2QO3 A;  3SSR A;  2YX7 A;  4OHX A;  1EW8 A;  1R3N A;  4OL8 A;  2E7X A;  4ZVF A;  3PZP A;  5RUB A;  4YME A;  4OYZ A;  3MZI A;  3HVT B;  2AKW B;  4OLP A;  4Y00 A;  4KHR A;  3THP A;  4YHH J;  2YNI B;  4UUW A;  1RA6 A;  4CNZ A;  4Q5V A;  5J2N A;  4FP9 A;  2Z58 B;  3OVS A;  1SJ1 A;  1TR0 A;  3TA0 A;  1UPM B;  1TL1 A;  5HP1 B;  2RUS A;  1YHQ S;  3TUI C;  2UUC J;  3L09 A;  2UUT A;  4NWX A;  4B3M J;  3JAM U;  1RAO A;  3UVJ B;  3BDG A;  1S6P B;  3DOL B;  3BSC A;  2W9C B;  3W2W A;  2NPI A;  2MY8 A;  4GTX A;  1KHW A;  4AQY F;  4ES2 A;  1X9W A;  3GV7 B;  3PEH A;  3MCN A;  1GX6 A;  1KVI A;  1S9F A;  2I9S A;  3PO5 A;  4X4N A;  1S1V A;  2HBY B;  3R5A A;  2DHG A;  3AD7 C;  2OTJ S;  4NX9 A;  4R5P B;  1TV6 B;  2W24 A;  4PPD A;  1ZA1 B;  2DHX A;  2QLX A;  3ZZT A;  2LQJ A;  1EKR A;  1S0N A;  2NXU A;  3MM5 A;  3Q8Y A;  2HBR B;  2J76 E;  3S6E A;  3KXD A;  4O3Q A;  5MLC V;  2HPU A;  1EAY C;  3L7P A;  3T41 A;  2RRB A;  2XGQ A;  2XC9 A;  1JJH A;  2OMO A;  2J9C A;  1RHU B;  4CYR A;  2CQ3 A;  2XHW A;  4LIW A;  3ETO A;  5DLV A;  4F02 A;  3NNH A;  3OJS A;  4DPY A;  2H4W B;  4CXS A;  3HX9 A;  1EI6 A;  3JSM A;  1R8P A;  2CRL A;  1XEZ A;  2XY5 A;  4A46 A;  2YNH A;  1N36 J;  5GRR A;  3RUB L;  4OI1 A;  3RTV A;  1JXV A;  4TKT A;  5EWF A;  4F4Z A;  1U02 A;  4I4B A;  5CYM B;  1YJ9 S;  3T5H A;  1BD6 A;  5J2P A;  3NWR A;  1RIS A;  3CDW A;  3I31 A;  1UFK A;  2B7C B;  5KXA A;  2V63 A;  3CCE S;  1KVK A;  2JC0 A;  4ECT A;  4DN9 A;  5F3Z A;  3L7O A;  4CXK A;  3NKO A;  3D7S B;  1WUU A;  5KFF A;  1I51 B;  3HPO A;  4G1P A;  4GKJ J;  3MMJ A;  3Q0A A;  1PIE A;  4F50 A;  2E1C A;  2YQ1 A;  4YFU A;  2DNQ A;  1U2C A;  5T7L B;  2ZZM A;  2BM1 A;  3UCG A;  5U47 A;  1K1Q A;  2L9D A;  1RHJ B;  5FJ4 A;  1PO6 A;  4TYB A;  3BPS P;  4K4W A;  3SYZ A;  3LH2 S;  5ETP A;  1SXL A;  3OXL A;  1XMQ F;  2P6S A;  4JI2 J;  2X51 A;  2M70 A;  4N7T A;  3W5Z A;  3NKP A;  1UZD A;  5CA5 A;  2LA6 A;  1URA A;  4WE1 A;  3Q24 A;  1U48 A;  2JSX A;  3AHP A;  1D9A A;  1LW2 B;  3GJT B;  3NAI A;  4M94 A;  1KD1 T;  1R6V A;  7AT1 B;  2Y1L B;  2XLK A;  3MM8 B;  5F8J A;  3W66 A;  3UDL A;  1A0O B;  1T03 A;  1ZOT A;  2XY6 A;  4WP9 A;  2UVW A;  1HJK A;  5F8N A;  3ULH A;  1RWU A;  3DYC A;  4LR2 A;  1XBW A;  2OH2 A;  3W2V B;  1VRT A;  2HGM A;  3DLJ A;  3CDA A;  3EGV A;  3BBB A;  3TYT A;  3JSB A;  4ECS A;  1BQN B;  4RW6 A;  1EJJ A;  4ZCK A;  2DGQ A;  4IFY A;  1WKJ A;  4X4U A;  2EFN A;  3KUH A;  4NLO A;  1G7C B;  2OLW A;  2IC3 A;  3ILI A;  2PI5 A;  1CJT B;  2DH9 A;  3MM6 B;  2J6U A;  3D0H E;  3DI6 B;  4QYR A;  4PAA A;  3MHY A;  5HAN A;  1JLE A;  1WC6 A;  2DHS A;  2J6T A;  3VAF A;  2XMJ A;  2AZ1 A;  1D9F A;  1SKU B;  4EBC A;  1Y3K A;  3QQC D;  3PKY A;  2CQH A;  2VFS A;  3CPW R;  4XPC A;  2EFO A;  2VKZ G;  2B43 A;  4DSF A;  1T0T V;  2FHO B;  5J2Q B;  1WOR A;  2RJZ A;  1RAE B;  4KKO B;  4MKA A;  4DSK A;  4A8S A;  3BN4 A;  5GMD A;  3CXC R;  3HSG A;  1F5B A;  2BYC A;  1U1P A;  4DR6 F;  4UOO A;  1OPI A;  1YJR A;  4OX9 J;  1RTD B;  1TK0 A;  2ZJQ Q;  2HBZ B;  3PYD A;  3KUG A;  3TZY A;  3KLG A;  3W64 A;  1S48 A;  1XNQ J;  4RW9 A;  5I42 A;  3SIP B;  3K5P A;  2J6S A;  1TKT B;  2RS8 A;  4EZ9 A;  2CZ4 A;  4Z7C A;  1WOO A;  4M8L A;  4P72 A;  4F0H A;  1T9Y A;  1RLC L;  3I5B A;  4MFB A;  1KWM A;  4CLZ A;  4IG3 A;  4ZOS A;  1R0C B;  1URR A;  3MCO A;  1NKB A;  4LFC F;  4ID5 B;  2V2Q A;  2YKP A;  1FKP B;  3MWB A;  3DU6 A;  4RW7 A;  1WC0 A;  1U1Q A;  4LMZ A;  3IG1 A;  3DGP B;  3DOK B;  2PA8 D;  5HMY A;  2WW8 A;  2GCF A;  1FRJ A;  1RT4 A;  2RT3 A;  4H4M B;  5K9F A;  1Q5Y A;  3T9Z A;  4RW4 B;  2IYI A;  1KDN A;  4LJM A;  2VA2 A;  4KGX B;  4GO5 X;  2PSZ A;  3NGK A;  1IR0 A;  4AFF A;  3M8Q A;  3BYR A;  4DL3 A;  1R0A A;  4ALZ A;  5F41 A;  4WU2 A;  1IKX B;  3MEC B;  3RRH A;  4JUZ A;  4DR1 F;  1G6B A;  2EKY A;  2AW0 A;  3BQ0 A;  2POK A;  3MR3 A;  2GA7 A;  9RUB A;  1QUP A;  2JLE A;  2CPX A;  3LGM A;  4R8U B;  1HPZ A;  5JXS A;  4FF2 A;  3LP0 B;  1QTN B;  1OS5 A;  3R6G B;  4X4S A;  3J81 j;  4EYH B;  5CZX A;  3OHB A;  1LW0 B;  1KHK A;  5A0Y B;  5FLX U;  4QYZ J;  3M2V A;  2MB0 B; 
#chains in the Genus database with same CATH homology
 5GOV A;  4LR7 A;  2GLQ A;  1EW9 A;  1KH5 A;  4FDI A;  3OT9 A;  1N2K A;  1ALH A;  4MIV A;  1ANJ A;  3B5Q A;  4LR8 A;  2X98 A;  4CYR A;  4FDJ A;  4MHX A;  2IUC A;  3UN5 A;  3MK1 A;  5LRM A;  2RH6 A;  3WAY A;  3UO0 A;  3UN2 A;  5DLV A;  1P49 A;  1ZEF A;  4B56 A;  4UPI A;  5EGH A;  4KM4 A;  5LRN A;  3T01 A;  4GTW A;  3T02 A;  1B8J A;  1ALJ A;  1AJA A;  4CXS A;  3M8W A;  1EI6 A;  4LRC A;  5DLT A;  4GTZ A;  1AJD A;  2W5W A;  1E33 P;  3WAV A;  2ANH A;  1N2L A;  2W5Q A;  5L0K A;  1ANI A;  2QZU A;  3A52 A;  3ED4 A;  2GSO A;  1O99 A;  3BDF A;  4ZG9 A;  1KH4 A;  4NWX A;  1E2S P;  1ELY A;  3M8Y A;  3TG0 A;  1ALI A;  2XR9 A;  5IJS A;  1ZEB A;  5GRR A;  3BDG A;  3CMR A;  1EQJ A;  4KAY A;  2IUC B;  4UOP A;  5L0E A;  1Y7A A;  2IFY A;  3IGZ B;  4UOR A;  4N7T A;  1ELX A;  2VQR A;  3E2D A;  3NVL A;  3NKP A;  4QAX A;  1URA A;  3T00 A;  5C66 A;  1AJC A;  4NWJ A;  4GTX A;  5HRT A;  1KH7 A;  1AUK A;  4GTY A;  2W5X A;  3KD8 A;  4UPH A;  1FSU A;  3WAW A;  1ELZ A;  2W5S A;  4LRA A;  2W8D A;  3DPC A;  3LXQ A;  5INH A;  3UNY A;  4KJD A;  3NKM A;  1Y6V A;  4LR9 A;  5TJ3 A;  4ZG7 A;  1KHN A;  1EW2 A;  3NKQ A;  3NKN A;  2G9Y A;  3UN3 A;  1AJB A;  2GA3 A;  4LRD A;  4TN0 A;  3SZY A;  5KXA A;  1KHJ A;  3Q3Q A;  2GSN A;  3M7V A;  3BDG B;  1KH9 A;  5K4P A;  3MK0 A;  4LRF A;  1ZED A;  1KHL A;  1K7H A;  2W5R A;  1HJK A;  3MK2 A;  4UOO A;  4CYS A;  2GSU A;  3TX0 A;  3TWZ A;  5LIA A;  1ALK A;  4CXU A;  4ZG6 A;  3IDD A;  4LRE A;  5DLW A;  4LQY A;  4MY4 A;  3DYC A;  4YR1 A;  5IJQ A;  4ZGA A;  4LR2 A;  1O98 A;  1HQA A;  4CXK A;  3NKO A;  1EW8 A;  1E3C P;  2D1G A;  5AJ9 A;  4UPL A;  3IGY B;  1ED8 A;  1HDH A;  1URB A;  2XRG A;  3BDH A;  3SZZ A;  4LRB A;  1SHQ A;  4KAV A;  5EGE A;  5L0B A;  3WAX A;  1ED9 A;  2W8S A;  4UPK A;  3M8Z A;  2ZKT A;  3NKR A;  5LQQ A;  3WBH A;  1KHK A;  1SHN A;  1E1Z P;  2W5T A;  4KJG A;  1EJJ A;  2W5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...