3UNYA

Bacillus cereus phosphopentomutase t85e variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3unyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3unyA01
3IGYB 1ELYA 1EW2A 1O99A 3M8WA 2GA3A 5L0KA 1E2SP 5KXAA 2W8DA 3NKNA 3WAVA 4N7TA 4CXUA 1ED8A 3CMRA 5IJQA 5L0BA 4FDIA 2W5WA 1SHQA 1EQJA 3IGZB 1ELZA 3M8YA 1KH9A 1KHJA 1P49A 4UOOA 4GTXA 4ZG7A 4LRDA 3Q3QA 3TX0A 1KH7A 1EJJA 5DLTA 5TJ3A 3T00A 1Y6VA 4LR7A 3UN2A 2W5VA 4B56A 4TN0A 3OT9A 3WAXA 5IJSA 4LRCA 1N2LA 2D1GA 4UOPA 5LQQA 1EW8A 4MHXA 3T02A 4LR9A 2IUCA 2W8SA 1EW9A 1URBA 1ANJA 4GTYA 4UPLA 5DLVA 1FSUA 1ALJA 3M8ZA 1AJBA 1KHNA 2ZKTA 2ANHA 3KD8A 2W5SA 1AJAA 4LRFA 1HJKA 3NKOA 3T01A 3NVLA 4ZG9A 1ZEBA 4CXKA 5GRRA 4MIVA 1O98A 1AUKA 4QAXA 4NWJA 5LRNA 4UORA 5LRMA 1AJCA 2W5XA 3MK2A 2RH6A 1B8JA 1KH5A 2W5QA 5DLWA 2GSNA 5HRTA 3E2DA 1HQAA 2XR9A 1KH4A 3DPCA 1ALIA 5EGHA 2VQRA 3IDDA 3BDGA 4GTWA 4KAVA 5K4PA 5LIAA 3TG0A 1E1ZP 4GTZA 3UN3A 2IUCB 4YR1A 4LR2A 1Y7AA 1KHLA 2GSUA 5AJ9A 2QZUA 3WBHA 4LR8A 3SZYA 1E3CP 1ZEFA 4LRAA 2GLQA 4UPKA 4KJGA 3MK0A 3MK1A 4LREA 5EGEA 1ELXA 1URAA 1ALKA 2G9YA 5GOVA 2XRGA 4CXSA 3ED4A 1E33P 3WAWA 4CYRA 1ED9A 1EI6A 2IFYA 4FDJA 3M7VA 4UPIA 3B5QA 3BDHA 3NKRA 2GSOA 4ZG6A 3BDGB 3NKQA 2X98A 3BDFA 1ALHA 3UN5A 4KJDA 1ANIA 1HDHA 1SHNA 1N2KA 4KAYA 2W5RA 5C66A 4MY4A 4CYSA 3NKMA 1ZEDA 3DYCA 3LXQA 4UPHA 3WAYA 5INHA 4LRBA 1AJDA 4LQYA 3UNYA 1K7HA 4NWXA 3SZZA 3UO0A 1KHKA 4ZGAA 5L0EA 2W5TA 3NKPA 3TWZA 4KM4A 3A52A
chains in the Genus database with same CATH superfamily
4DS4A 3L7UA 2YQ3A 2GW8A 3W8GA 3EPGA 2IAJB 1TVRA 4IFYA 3PR4A 4F2RA 4V19X 2FLOA 1OIAA 4LVOP 4DFPA 2P6TA 1W2BR 3G82B 2DH8A 4IDKA 5KFXA 5HSPA 1C1CB 4LF2A 5F8GA 3FJ2A 4JI7F 3QO9B 4C8ZA 8AT1B 4B9SA 5D3GA 3GG1A 5E33A 1RWNB 1G6BA 3AD7C 2H65B 4I2QA 2VBYA 5KT6A 3I96A 5D0EA 1JWWA 1HQUB 2DNQA 3KJVA 4IH6A 3KOAA 3UCZP 4MKBA 3NGUA 2DGUA 1U24A 3CJ3A 2R7UA 1HHSA 3T1AA 5IM0A 2RKIA 2CQGA 2AGQA 4NCGA 4IO9Q 3T3FA 4NA2A 3NKPA 1FRLA 5F8JA 2J76E 3DOLA 2UVVA 1KRPA 4YB5A 5JVGQ 4IQXA 4O3SA 2J5AA 1YJ9S 1DJ0A 4URGA 1HQUA 3CCZA 3O8WA 4GTXA 1FRIA 1OPZA 2C22A 3TNVA 1R8PA 2V63A 3C14B 3I5AA 2A6MA 1Y7PA 1KN6A 4ECQA 2XS2A 1X4HA 1PSDA 3Q83A 4MYUA 2YX1A 2AX1A 3TUPA 1RT2B 2V2KA 1AJCA 3J7AN 3OL8A 4PXEA 2HNDB 4NMXA 7FDRA 3ELHA 1XMQJ 2V2ZA 3LANA 2BUNA 5JVHQ 2HVHA 3KLHB 5LOQA 1UEVA 3CDUA 3MCMA 3PW2A 4C11A 4OI3A 3DRSB 3MM9B 4J9MA 1H2UX 1FERA 1RT2A 3OJUA 5IC6B 2QA1A 2ZBIA 2A18A 3GCWP 1O99A 3MEEB 3M8WA 4OZ1A 4K5SA 2KFZA 3AA9A 3N0VA 1RTHB 2A6OA 1PGZA 1NPRA 1RA6A 4UY8T 2QE5A 1SHQA 1VOMA 2RSQA 1S1WB 4EO6A 4YHHJ 5CAAA 4JI6J 2QL5B 5AXMA 4DUYF 1DLOA 3S01A 1RU2A 2IBOA 3VR1A 3GIKA 3GONA 1IKXA 4DSJA 1F2GA 1GEHA 3A4TA 2WRMA 1FD2A 2MQNA 5T41A 2V4RA 1HW8A 1IWGA 3AJ2A 2CPDA 3MEEA 3RUBL 1VK3A 1DY3A 1SIZA 3B6BA 4URQU 3V5RA 3T6BA 3PNIA 2IYGA 2OJ3A 1LWEB 4RW7A 4X4QA 4A8XA 1TL3A 4DPXA 2G0CA 2DCLA 4QCLA 2FVSA 2UVRA 1YWXA 2DIUA 4A48A 3TEHB 2XYGB 5LMUJ 4JI1J 2RRAA 1LKZA 4CQ1A 3JB9k 4B3SF 3IR5B 2M2BA 1S9FA 3JYTB 2DR7A 1ALHA 3MD3A 1RYRA 4GO7X 3OUYB 5K20B 1T0TV 2AIRB 3IGYB 2QFJA 2EFVA 4ZLNA 3NWRA 4BLGA 2DT9A 1IVZA 1MWZA 3WHIA 1AUSL 3MM6B 5D15A 3GFHA 2BJ8A 1BWEA 5F41A 4TN0A 5KFLA 4DR1F 3BSAA 1UA1A 1F3FA 1JJ4A 2NZ4A 4G1QB 3AHPA 3GLJA 3VAKA 1FE0A 4UY85 3OUYA 4TKTA 4BC7A 3M9NB 4UQGA 1J5EF 3K5MA 4LT6A 1F5BA 3TAMB 1KH5A 5D4LA 2W9CB 4HDHA 1VQ6S 5A0YA 4LR2A 3ZC4A 2XG8A 4CM2A 1NDCA 4ZPBA 4DR5F 1IKVB 4LMZA 3BSOA 2K06A 3R2CJ 4OHVA 3BJYA 4MTPA 3CT9A 3AXKA 1FVSA 3MZIA 2KYXA 3NBPB 3KDOA 4O3PA 1H72C 3H25A 4RX6A 4NWBA 1RAGB 4EUVA 2OPSA 4M1KA 4IFVB 2V8DA 2YX4A 4KM4A 2W9CA 3BQ1A 4LF8J 1EW2A 4DQRA 3ENVA 3J81j 3K57A 5E3CA 2OMLA 4ZIVA 5CHCB 3HVRA 1ELZA 2JNJA 5HATA 2VF3A 4F25A 2FJVA 3D1QA 1VFJA 2AJ1A 3C6TB 3TVKA 4XPEA 4B56A 2GV1A 4WXWA 1KFSA 2HFNA 1RLDA 4ZPAA 5CCLA 5A8WB 2MKYA 2DXEA 2DNZA 5B08A 3SV4A 4NLGA 4NEYA 3TVZA 4AUKA 1T8EA 5HMWA 1N5YB 1RTJA 4D3HA 5LRMA 2DGXA 2YQ1A 1QVFR 2WONB 4FF1A 4URSA 1RXOB 4Y65A 1YLXA 2EBGA 4I69A 3ETMA 4TY9A 2WBRA 3TZXA 2OLWA 1H98A 1IBMF 2CQ2A 2VPXB 2JEFA 2C3UA 5F9NA 1MN9A 4FDJA 3BB5A 5KFAA 4E8UA 2FZCB 2B5JB 3BF4A 3SQOP 4CTAA 2W4PA 1HMVB 1Q8KA 2FY8A 4PEOA 2WONA 4QW9A 5KFMA 1RTZA 3OTEA 4U8VA 2QLXA 4LSLA 2C1EB 1TMJA 1HIYA 4DQIA 3NGRA 3GYGA 1X0PA 2FJXA 2B6AA 5C42A 1U1KA 1YQHA 3QLHB 1VQNS 3N9UC 1GXLA 3ZZRA 3RRHA 2ZDPA 1S99A 1FT8A 1F3VA 4IRDA 2P9GA 4FNIA 4MMOA 1U0HA 2BJ3A 2KO1A 4UZCA 4YR3A 3FCWA 2YWKA 2HMIB 1XMOJ 1WSRA 4KR0B 2YNHB 3UE2A 3L95X 2M4MA 4MFBB 3ZTOA 1HA1A 2DR8A 1WKKA 2ABYA 3G96A 3HI9A 1NHVA 1GMWA 1Q86T 4B02A 3QLHA 5DDQC 5HK4A 4YR0A 2JL9A 3NCPA 4TVAB 3WC0A 3ILOA 2CQBA 4EFAC 3LW5C 3QRQA 4UT4A 3PVXA 3M7VA 3G8TA 2R2SA 1SCJB 3VVUA 1UAWA 4NA3A 4PPDA 3LGHA 1RAEB 1B0PA 1PG5B 2YWEA 1Y3JA 5DQGA 2NXNA 3IGZB 1X4CA 5DG8A 4ECXA 2CNOB 4OFZA 4B9VA 1FKOA 1GFWB 4HI2A 4ZPCA 4H4OB 1W2IA 2HWTA 1VQSA 1TK8A 3AFGA 3MUVP 4LUBA 3AY0A 1P9YA 2VZ9A 4LR9A 1KBRA 3W5ZA 2PT0A 1FXDA 1KTVA 2CZ9A 3AJDA 2BDPA 4FDFA 5THWA 1U1LA 4FVCA 1CQMA 3T01A 3SZ2A 3WX4A 3QT6A 1RT6B 4I68A 4W4MA 3E2DA 2VBZA 3JAMY 5AT1B 3UN3A 2UXBF 2ZH7A 1QAJA 2LKZA 3ZZZA 4KIAA 3FDSA 3EMTA 3KJFB 4FS1A 3FFIA 1VQKS 5K8PA 2FHKA 4J9OA 1K1QA 2XRGA 3EXYA 5K14A 3D6MB 2Q3PA 4R5PB 2CG8A 2D41A 2IM2A 2QA2A 1ZA2B 3W3SA 2OTJS 1HNWF 1LNQA 3HSZA 2YQ0A 3H2LA 3PHEA 2F63A 4CIOA 2VJUA 4DJBA 2BRKA 2CJKA 4DX5A 2EPIA 2DNKA 3AB2B 4F36A 4ZPDA 2XS5A 1T7PA 4JI5F 2YNGA 2VL1A 1BQXA 1R43A 3QJPA 1MLAA 1PBUA 2AW0A 4Q2MA 1HARA 3DLEB 2XMWA 1CC7A 2IC3A 4KT0C 4XPCA 4UUWA 2DXFA 4O44A 4L73A 3CDWA 3CCRS 3QIPA 3K0JA 4QQBA 2J9DA 2NPIA 3OL6A 2H5JB 2YX7A 4C7QA 1U45A 1U7LA 4QWEA 1TU0B 3S6EA 4PG7A 2XSJA 3CCSS 4ECRA 3FEZA 1S9GB 2G0IA 2MLYA 1TV6A 3PO5A 2HQ3A 4ZMMA 2OPRB 4G65A 3UCUP 4NXMJ 2YXLA 5EUHA 3DLEA 4LBIA 1NKBA 2Z8QA 5JMNA 1H74A 2ZBRA 2DR9A 4MH8A 4S0MA 3NKMA 3ZZUA 1IWAA 4B08A 5F0WA 3CXCR 1OYDA 5T14A 3ZZPA 1U49A 1O6XA 4X84A 7FD1A 2W8KA 1EIYB 1MWYA 3BR9A 4DPOA 2GS8A 3HSJA 3WC2A 1FNXH 2D3OR 4ZG7A 1U1RA 5DLTA 1H73A 3LP2A 4WJBA 1R31A 3MUTP 4JI3J 5H9EJ 2ZEJA 1PKUA 4I2PB 5KG3A 4KY3A 1UW9A 4FNHA 2L3MA 5EWFA 2MZJA 2IBKA 4KAIA 1E6YA 3J7ZT 5HMYA 4LFBF 1R27B 1FFSB 3HDSA 4XIUA 2W2NP 2XY5A 4QZVB 2BACA 3PM9A 2IMOA 1QDUB 4EMDA 2HFSA 2M3DA 4FYXB 4HTIA 1U1NA 1XTZA 5T7LA 1DURA 4C98A 4MK9A 4MYTA 4NEZA 1HQ2A 4X66F 3ED4A 1CJUB 2VG7A 4AQYJ 4RW6A 1LV5A 5I4MA 5LMNJ 5B09A 4FXDA 4I7FA 3QRRA 2YNIB 3FUYA 4ZVRB 3CD0A 3GILA 3TWZA 4Y28C 4XDCA 2V8PA 2W8DA 3WIUA 4RO0A 4EZ9A 3CVKA 1UWBB 5KG7A 4LIRA 2G1HA 2YKNA 1C0TB 2DK2A 2ZZNA 4TYBA 3KD8A 1AJAA 4F4KA 4J91A 4OV6A 1PO6A 1QAIA 1S1TA 4UORA 1O0PA 2PE8A 3T5KA 2M52A 2DHGA 1N88A 4FF2A 3QIDA 1NPKA 3SV3A 2CPIA 3UR3C 2GQ2A 2KT5A 3A8EA 1N4LA 4KHMA 1LOUA 3U27A 4OLPA 1P6TA 2AJFE 1FJGF 3HT0A 2H5IB 3J7Z5 4K4VA 4NYZA 2HSEB 2XYPB 1MU2B 1ELXA 4PYDA 5G4DA 4PQUB 4CH0S 2MZ1A 1R8AA 3MXHP 3B5QA 1AFJA 1XR5A 4WBFA 1VQ5S 1U1PA 1JLAB 3SFUA 1CVJA 3KMQA 3VCDA 4MIWA 4ECWA 3TUJC 2NLWA 2W01A 4JP8A 4DSEA 2ZNZA 1AJDA 3RRGA 3UNYA 2IM3A 4M5KA 3BBCA 4J5OA 1S1VA 4OZ0A 3MEDB 1XNRF 4TXSA 1NHUA 4PWUA 3VV2B 4JYAF 4D3GA 4ES1A 4FYWB 1RABB 4E0DA 3MOZA 2HWHA 2B4OA 4F4XA 5LJ3Y 4PQUA 1HNZJ 5BYSA 5B0FA 5AE3A 1EW8A 5DDRC 1JLAA 1NZ8A 3MM7B 1N8RT 3OLAA 1NZAA 3O1LA 4YDXA 4BS2A 4RR5A 3I55S 3M2RA 1N54B 5LM7E 2N4CA 3S7RA 3P4UB 4X4UA 3MOJB 3MK2A 4TY8B 2DHSA 3MEDA 1YRTA 3W65A 1TL7A 2AT1B 2VQRA 5KFFA 4P6QA 2D9PA 2ZBQA 1ZM4A 3M2UA 3OXFA 2JVOA 3DLKA 3R2DJ 1HKAA 4OZNA 2VFVA 5KG4A 1RHMB 4NI2B 5ETRA 3MM7A 2QIFA 5JJBA 3US5A 3PW7A 2XHWA 3A13A 4ETZA 3VQSA 4QYRA 5A8KB 4OMFG 2GZOA 1SJ1A 3TX8A 4DI6A 2MQLA 5A6WA 4K59A 3HXMA 3TYTA 1FA0A 4JI2J 1P9QC 1U1QA 4NXNJ 3PRVA 5GMKa 1I5OB 4TLRA 3RBDA 1Y5IB 3M1VB 3L9ZA 3TO8A 2VDHA 4DMZA 1U6BA 4E2FB 1DQ9A 1MW7A 2CPYA 3V6HA 5A8KA 3HMJG 1NK4A 4HT5A 4DR4F 4M5NA 2DD8S 5ETVA 3SDEB 3CIMA 3G6YA 2NUHA 2FB0A 2KFYA 3K17A 4GTWA 3EZOA 1FDDA 1I94J 4OYZA 4ZIWA 3N6MA 1FVQA 2BW2A 1VRQC 3GFZA 4B9MA 3ZFVA 2V50A 4V19J 4EEYA 2GMLA 5FJ4A 1VIXA 2YBVA 4WFZA 4W98A 2EXUA 4ZN3A 3DXSX 3JTNA 1SKRA 3HLUA 3JTPA 2GO9A 2F9JA 4X4OA 3NMAA 2VC1A 4DUZJ 1X9SA 4LF5J 1WC6A 4LFAF 4DQSA 1J2VA 5FDLA 3JTOA 2VOPA 5FD1A 3UR0A 3FGVA 4FF3A 1DTQA 1U8SA 4RLEA 2QA4S 3SBMA 2Y9HA 2BJ9A 5J2PB 5J2QA 4I67A 2IUCA 1DARA 3Q8UA 3OVBA 3K7RA 1PAEX 1WG4A 2I38A 5GAHI 3HKWA 1F9EB 2OD6A 1RU1A 5E0OA 4CLWA 4K4TA 1RAJA 4UOGA 4NLVA 4DL0C 1AZSA 2L9DA 3OTCA 3W60A 2MJUA 4HKQA 2MQ8A 1UA0A 3CNQP 3FBEA 4J9NA 2CDQA 1H2VZ 4LFCF 4QU6A 2DNHA 3H0PA 2LYVA 3BO3A 2JWNA 1D8YA 4PQAA 1QM9A 1FDNA 1KHKA 1WHVA 2W24A 3EJMA 2IVFB 3WAVA 1X4EA 3PYGA 4N47A 1EB0A 2FLNA 2H5EA 2E29A 3Q3QA 3NWGA 1VR6A 2PEHA 4I0WA 3GPAA 1BGXT 2ZD1B 1N36J 1YJVA 3OR2B 1KLMB 2XULA 2Z4PA 2ZUGA 1DHMA 3DDNA 1Q82T 2XMUA 4WFYA 2VG5B 1H3DA 3C46A 3BBFA 1HBUA 1M1KT 5KFZA 3IRWP 1X9WA 2QC3A 4CCHA 2RJZA 1UVKA 2YPZA 4O3QA 2GIQA 5M2UA 1T9TA 3LQVA 1RTIA 2HWIA 4ZITA 1VJQA 1WEYA 4ZG6A 2HK2A 4DCPB 1ZTTA 4E98A 2OPPA 3KK2A 2QG9B 3DCAA 2D74B 1WJ9A 4WYWA 4P2SA 2N3OA 2XZTB 3QRPA 4DR2F 3ULHA 5B0DA 1QJHA 1IUJA 1QAXA 4M5GA 4ILMA 3U1LA 1RWUA 2PSZA 4JB8B 3RW6A 1LWCA 4USJC 1S1XB 1TK5A 3ITHA 2HQGA 3HD1A 2POKA 1QLNA 2HLTA 1VRUB 2BE2B 3GIRA 3TX0A 3UW1A 4C8KA 4ZJQA 4X4SA 4DR3J 2PDAA 3IWXA 4O3OA 5J2NA 2XBPA 3AXMA 3MECA 3Q24A 1REVB 2ZOMA 5L38A 5GRRA 3SCJE 4DPYA 1GTHA 2CNLB 5L1KA 1KKHA 2XR9A 3BKFA 4PXBA 3GG0A 3IDDA 2BQUA 4CYUA 3BQ2A 1TMMA 4TLQA 3OQ2A 4ICLA 4NCAA 3DM2A 4ZVFA 4RUCA 4Y34A 1S9EA 1JLGA 3MK1A 1TKZB 5I3UB 1K0VA 3OHBA 3WAYA 1WF0A 1UETA 2QYCA 1S12A 5HLFB 5F3TA 3A52A 2HURA 3K59A 1RAAB 2K1RA 5B0EA 2HVEA 3MAAB 5J1EB 3BKTA 3MHYA 1GH8A 1Q79A 3JSMA 3BGOP 2XTJP 1PIEA 4DF4A 2W4CA 1YJNS 3IG1B 4GC6A 2UXCJ 1HPZB 1Y00A 4RNHA 3K8WA 1N2LA 4CO4A 2HHUA 5AE2A 2FC9A 1DQ8A 1IN0A 3QT5A 3ZTQA 3BQ0A 4K4YA 1IBLF 4B3TJ 3DHXA 5HLFA 2PMZD 1U26A 3V6DA 2MLXA 1N5TA 2NR0A 3GIIA 4K4UA 1KS2A 4HR2A 2BE7D 2QLFB 4HTJA 5KFCA 4F0KA 1CULB 4KHPJ 2PIIA 2C2KB 3GZ7A 5F8IA 4NRUA 1JLBB 3M05A 2J9EA 4H4KC 2UP1A 4ATNA 3JXOA 1J27A 3GU0A 3N5BA 2HFOA 3B54A 4PWDA 3E8OA 2ZNYA 2NYIA 2R7QA 4EU0A 4X4PA 5IOLA 5IT4A 2V2VA 3R1LA 1SQEA 3T9NA 5MLCV 4MY4A 5J2MB 3DYCA 3R5JB 4WE1A 1RAHB 1CS4A 3LWLA 2B9WA 1HQEB 4P2FA 1PYTA 4A8WA 4ILLA 4WP3A 1WF2A 2EKNA 3MPVA 2WOMA 2ZBCA 3OTBA 3V6KA 2RS8A 1VQLS 3KLIB 5U47A 2DNLA 4U7UD 2CDRB 1YRUA 1PYSB 3N28A 1VQMS 2RAQA 4FN5A 2MSTA 2ZH9A 5J2MA 5CQGA 5DJBA 1RACB 1CJTA 2YKAA 4B3RF 3P5BP 1XMOF 2MZTA 2EEYA 1ULRA 2DKOB 3ET6B 2OPQB 3N6NA 2AGPA 4AXJA 3DDKA 4QR2A 2OUGA 5ETKA 4WWSA 2RF2B 4LF4F 3CD7A 1HWUA 2XMVA 4P9SA 3SQGA 4A8FA 3SXLA 3I4PA 4AT1B 2DR6A 3RJMB 1EI6A 1S6PB 1RT4B 1XR7A 2OHDA 4RW9A 3D66A 4Q2LA 3TJ9A 1Q95G 2XNRA 3P96A 1F9FA 4KQZA 2FTRA 4DV3J 1B64A 1AFIA 3OV7A 4M95A 1X4FA 2BEFA 3MMBA 1T9YA 2QT7A 2GVZA 5L0KA 3PW5A 2GAGC 4YFUA 4QIVA 1VBKA 2XHCA 4FS2A 5KFUA 4ITSA 2PI5A 1VMBA 2LU1A 5EDWA 3O5TB 2B0GA 2JJ4D 4F7VA 3D0HE 2DNPA 1MMLA 4A46A 1S6PA 1UVMA 1HNVA 1FESA 1EQ0A 4I1TA 2MYFA 3Q8RB 2JC1A 1KFDA 1M5HA 3RZAA 4QIFA 2JC0A 3HHEA 4KO0A 2JH3A 3DLLQ 1R3NA 4DX8H 2XM3A 4KB7A 4IUFA 2DO0A 1T3NA 1VIOA 5EN1A 2VFUA 1N32F 3W1YC 4QWCA 2OO4A 2RQ4A 4P71A 2A2DA 1OMSA 3AQOA 2HBZB 1Y4ZB 4OHYA 2IJFA 3ENAA 2NREA 2LDYA 1PJ7A 2DISA 2ASDA 1TKXB 1UTAA 1IM6A 4ZVTB 2GMHA 3BDHA 4DBQA 3OR1B 4UOCA 1FTRA 5EX3A 2AYBA 2H4YB 2W5RA 1S0NA 3U1NA 2D69A 2X1BA 2JX2A 2J7UA 1S0OA 4B9TA 3VAHA 5KG1A 2ALZA 4USUA 1HW9A 2JVRA 4CXUA 3KHLA 1LWFB 2FVCA 4V1Ak 2DGVA 2BOPA 1TKXA 2BYCA 2IRYA 1L3KA 2J0XA 1WHXA 1SC6A 1AJBA 1Q16B 3MMJA 2HVDA 3R27A 9RUBA 2AF6A 2HNZB 4P72A 5KFTA 4WFNQ 2C3PA 3W9HA 2W8LA 4Y0FA 3R1HA 3W2WB 1HNXJ 1E1ZP 2H48B 3NAIA 4HACB 2R7VA 2ZHAA 2ZOGA 3GFYA 2ZH6A 1S49A 4JI8J 4LF6F 3DRPB 4CLPA 2G9YA 3RB6A 2IJNA 3KHHA 2GIRA 1TUWA 2JEGA 1N0UA 2BJ7A 2HNZA 1HDHA 1KTQA 2L9WA 4CYSA 4DV0J 3RG6A 1W25A 3FZ2A 3H4BA 3PRDA 2BVZA 2UUAJ 4M8LA 5HP1B 4L3NA 2YKMA 4ECSA 4NYOA 2MMYA 3Q22A 1X5OA 4X4TA 1CLFA 3NXZA 3T5LA 2CFXA 1LXJA 2ZM6F 3TW0A 2RU3A 1NH8A 2VHGA 4DF8A 2JHEA 2VQEF 1U1OA 3PY8A 3NRBA 1Y5LB 4LIWA 3PIOQ 2XWYA 1K1SA 4YMEA 1YBUA 1FE4A 5KT2A 4WK3A 4GKKJ 1V3SA 2BANA 5ETQA 2ZC4A 3DHWC 4OHXA 4HL9A 5KFGA 3H59A 3QNWB 2FHOB 3UI3A 2E5JA 3C8YA 1IR0A 5HAOA 3QMQA 3H5UA 3W2VB 4RL1A 3W66A 3OSPA 1NDPA 2ZHOA 4UPIA 4OX9J 3R5CA 3WBZA 4F67A 2E1PA 4NLRA 1R6YA 5LJ5Y 1YJWS 3CUNA 4YEAA 1B0VA 1RAIB 4RW4A 2LP4A 2B7CB 2LFVA 1RTDA 3IS9B 1FHTA 4TU8A 1HBNA 3PTWA 3V4IA 3BKUA 3ZNUA 5G0RB 2UVWA 1IJEB 1EAYC 3G9CA 4NLDA 3UDLA 3QFHA 4B3MJ 1IKWB 1KH7A 3O3LA 2D1CA 1BXNA 1NRKA 2I5JA 2BMBA 5CZVA 5LXYA 3PEJA 1MSWD 3HVTA 3HHNB 1VHIA 1ZAVA 2K3IA 2A10A 4QAXA 2C2MB 3QSYB 4KHRA 4R8UB 3VGSA 2NSBA 1EP4B 2XGQA 2XSFA 3M9OB 2KT3A 3BO2A 4RNFA 4L76A 2X1FA 3TJ8A 1N6QB 4WFXA 5CYJA 2DNRA 1C1BB 4GKJJ 1AA1B 4ID5A 4A8KA 1JJCB 2CPEA 3M30A 2BKPA 2A1BA 5B0CA 4HYKA 1JLCA 1AW0A 8ATCB 3CC2S 1RWMB 4MJKA 4M5LA 5CYQA 2KZMA 2OGUA 1RCOB 2JLEA 3NEKA 1TQLA 2J7KA 1F0XA 4F0HA 3NKNA 3V81A 3I31A 4ANDA 1R0AA 3A1YG 5I42B 1BE4A 2CJQA 1C1BA 3HHKA 4NA1A 1L5UA 1HNZF 3AOCA 1FJCA 3HP6A 2B9XA 3E01A 3BGUA 2NSCA 4CP5A 1LW0A 3GCXP 5LRNA 4P73A 2AQ4A 2W5XA 3F56A 1Q5YA 1F5CA 5A76A 4KPCA 3NNCA 1NK0A 5ETMA 1HI0P 2M9KA 4X65J 3TZZA 3C6UB 2VUGA 2O1PA 4ZLLA 2RU9A 3MM5A 3IC1A 2C3OA 2CZ4A 2IFYA 1W7WA 3T6JA 3NP5A 2R7SA 4HVZA 4F2SA 1D0EA 4EK2A 3DLBA 2EK1A 2GGPB 4CNZA 3MCSA 3GQCA 3SCKE 1I6JA 2D9OA 2K7JA 1T11A 3R6GB 1WTBA 1GNKA 2OTLS 3L09A 2VG6B 2W9BB 5KT7A 4J9QA 2PEBA 3F73A 3LO3A 3SSSA 4Y6IA 1Y11A 3RB4A 2AJ2A 3MR6A 3LA0A 3QWUA 3LPYA 2G2ZA 2KVIA 3DMJB 2GGPA 2U2FA 4FYYB 4YB7A 4H4MA 3M8QB 3K58A 3QAEA 5ETSA 2ASYA 4YB6A 2C2OB 4EBEA 1TFYA 4PPZA 2MLZA 5ETLA 1RWPB 5KT5A 1FRJA 4CO0A 3R7NB 3QT7A 3HSDA 1SIWB 1N34J 2I2YA 1ANIA 3A8IA 1YITS 3VZHA 4DSLA 4IOAQ 2D7SA 2VPWB 1RHKB 2X1GA 1BLUA 2CPXA 4P10A 1M5OC 2HFVA 1LW2B 3FSIA 1LWXA 1NCLA 4WPAA 4UOOA 4C8MA 5BR8F 5IV4A 3IFEA 2AKWB 1FTCA 1XK8A 2ANHA 2W5SA 4LRFA 4DDFA 5IT0A 4KGZB 4YOEA 1XMBA 5H1SV 4TYAA 1RT7B 3MDFA 5LT5A 3T1HJ 2LMIA 3IBCB 2BJEA 4KAVA 3TUIC 2AEJA 4QR1A 2DHAA 3NOGA 3HHLA 1JXLA 3KLEA 2DB1A 1UL3A 1OSCA 2F8HA 3CJSA 2ZH8A 5HBMB 3V6JA 2XLKA 3I87A 1WSVA 1VLOA 5FIIA 4CYRA 3JQJA 5H9FJ 2VV5A 2XMJA 5GMDA 3QGIA 3H98A 4KJDA 1LQ9A 1Z2ZA 5D4OA 3NS6A 1Y10A 1WELA 1RT7A 3T1YF 2GAHC 2HS4A 2DVIA 3SZZA 4J9SA 4KTQA 3OTOJ 2F4VJ 3FBFA 3MCNA 2R7XA 4CLTA 2PO4A 2M8DB 2E9TA 4ZLJA 4ZP6A 4DSFA 5HBMA 1OY9A 1TL1A 4WFBQ 1N52B 1KHJA 4DV2J 1P1LA 1JNZB 3D3CJ 3IM9A 4ZCLA 2B8QA 5IJSA 2LCWA 1M5VC 4ECUA 2RQMA 2QL9B 1JXEA 2XEXA 3J7YU 3LP1B 2G4BA 1UVJA 1AB8A 1KSPA 3MUMP 4A8MP 4KJIA 2FIUA 3QFWA 2VDIA 1OY8A 1T03A 1A0OB 5K8MA 2QYGA 3KUHA 3S1TA 1UMJA 4UOFA 3ENWA 3PYDA 2HS0A 1GQEA 1KOOA 5L9NA 2M0GB 3KG4A 2ZH4A 3FZBA 2NXCA 2Y0SD 2XLJA 1MMDA 1ED9A 4Y2AA 4AD6A 1VJWA 3IRXB 3EVOA 4ZHRB 2KHDA 2P5VA 4IR1A 3I82A 4L75A 1ZPWX 2HKEA 1U48A 5HROA 4XTTA 4Q44A 5INHA 1FNMA 4R0JA 1H6KX 1X5SA 4DV4J 4UQTA 4P75A 1VRTB 4ILRA 5IQQA 1M5SA 3GV7B 2J6TA 1U0SA 1KLNA 1RBOB 3VQTA 2WVFA 4CRJA 2MZQA 3KDNA 1IBCB 4UF4A 3KHGA 2W2QP 3K5PA 2QLBB 3NMRA 2CVEA 1S77D 4NLYA 2RMLA 3MM8B 4LF7J 4DR3F 3RR7A 3H5XA 4Y2CA 1MROB 3KG0A 2HZCA 2GVDB 2E44A 2EFQA 5KFOA 3PX6A 3I0RA 1K8AT 1JLQA 1RYSA 3ZTSA 3RTVA 1J5OA 3MMAB 5DLWA 1NK5A 2C28A 2N3LA 1IQZA 2KM8C 5LIAA 2E5LJ 4IYQA 2KKHA 3G71S 2C2DA 5M2RA 3PFEA 2MKJA 4XK8C 4O4GA 1TAUA 3W5YA 3VGVA 2MPUA 1HYSB 2W25A 1RAFB 3PFOA 3CMAS 1NSPA 5L1JA 4KFBA 2HHHF 4ELVA 4BWJA 3CJ5A 5C24A 1S7HA 1X4BA 3TAPA 1UJ5A 4ZVGA 3EWGA 4LSNB 3EVMA 4RWXA 1YRXA 2ZHBA 4QJVA 2HHQA 3MMCB 1RGVA 5HVGA 2HK3A 3H90A 3IO1A 4NYPA 3R9LA 1UZHA 2VQFJ 1FXLA 1TVRB 4IFYB 2BJDA 2X51A 1FDBA 1EARA 1NNDA 4CXKA 4IKAA 4PABA 1RT3A 2V34A 5CCMA 2X1AA 1HQAA 4WFAQ 2W9AA 3I56S 2N7CA 2G2OA 4EWTA 4IDKB 3MMCA 1XNQF 3CJKA 4JI7J 2FGOA 2HGMA 1FEEA 4CNYA 4UPKA 3Q2SC 3KJQB 3KLFA 5EGEA 4OX7A 1TELA 2Z57B 3PV8A 1YX2A 5D3GB 1T05A 3J7A1 4I2QB 4NCBA 3KJVB 3UCGA 1PYOB 4HHUA 1CJVA 1VQYA 1WEZA 3GSDA 1S48A 2ZJPQ 4ED5A 2B9YA 4DSKA 1NK7A 2ZH5A 2HFZA 1X7VA 3WDOA 5IM0B 1S59A 2NXEA 3RGIA 2RKIB 3DNCA 3PW0A 3T00A 2QGFB 4NCGB 1VS3A 1SXLA 1AT1B 2BBEA 3DOLB 2F8EX 2XGPA 4RKUC 5ETNA 3FBBA 4ZCKA 2MKSA 1HL6A 3OPKA 4MKVA 2LXUA 2MKKA 1OQ3A 1M1GA 3M6UA 1EZZB 4TU7A 3KHRA 1ZTWA 3NCRA 2KJWA 5MAOA 4EI2A 1FO1A 3I0SA 1RA7A 4UTGA 2DNNA 1R8HA 1RHJB 1SH2A 4DL4A 2YKPA 3NG8A 3OXGA 5HVFA 1VDHA 2VIHA 2DY1A 2Y3YA 3CJ4A 3I9ZA 2LQ5A 3DC2A 2R9LA 1HWKA 2WSEC 3MWBA 3HK2A 5F0UA 3HSGA 2VKRA 1UVNA 3D68A 2PI4A 1U02A 1L3SA 3CCVS 4IRKA 1Q81T 2DJWA 2QJ3A 1SC3B 1D09B 2QMWA 4C11B 2R8JA 2UV8G 2C3YA 4ZK7M 3EYZA 1B3TA 1EETA 2VODA 2LU2A 3LAMA 4C8NA 4OJ1A 1VGYA 1V3RA 2WVCA 2E1RA 3Q89A 1EW9A 4PCQA 4DV5F 1B7FA 5IT9U 3SI8A 3KTQA 2M88A 5SZTA 1HJKA 2KVQE 1XC9A 1UPPA 5KOWA 2B4VA 4DUYJ 2XQCA 4HEA9 1HBMA 1QSLA 1DLOB 3BDGA 1TKTA 1IKXB 5DETA 4A8OA 3M6XA 4JV0A 2GSUA 4O4RA 4Y2MA 2B9EA 3C15A 4RUAA 2B4UA 1QVGR 2H3EB 2HBQB 3G6VA 2BX6A 2NXUA 3DOMA 3DLJA 4I6AA 3IBWA 3FC9A 2FJWA 2UU9F 2HYIB 4RW7B 2AYEA 1TL3B 1WKLA 4KV8A 3HD2A 2VJVA 1ZBTA 2HG4A 3N01A 4I6WA 4B3SJ 2QX0A 5HANA 4OYIA 5KXAA 4KKOA 3CMRA 2QV6A 1GK8A 1NJIT 5IFMA 4FYVB 1S6QA 3H5YA 4Y2KA 5C25B 4M5HA 3M6VA 3KNAA 3OT9A 2MEWA 2ZH2A 2IDLA 2XMMA 4L72B 2ZE2B 3X3UA 4CH7A 3M32A 1F6TA 4IG0A 4CLFA 1RBLA 3AT1B 4CO3A 4DFKA 2RH6A 3VF0B 1WDTA 2W5QA 4BHQA 4DR1J 5ETPA 2CQ4A 4C8LA 3CJ0A 5GVQA 4N41A 4X4VA 1J5EJ 5C25A 3CC4S 4W90B 3K5OA 4Y2IA 2HHPA 3D67A 5DDPC 2BQ3A 3THVA 3H42A 2ZE2A 3W8PA 3POTA 1X4AA 2Y1LB 4KBIA 4EYIB 2WW8A 5HVHA 2O01C 1RBAA 5A0YB 3UN5A 2QSWA 4DR5J 3MPDA 1SBRA 4C3MA 2VICA 3LXQA 4Q45A 4RZRA 4DV0F 4OYXA 2LXIA 5HJYA 2VBXA 3KUGA 3D3BJ 3JSRA 4OJHA 4ELTA 2DIVA 2EC2A 1BWVA 3D7SB 2PN6A 3BGLA 1V3ZA 3HULA 3W9IA 1EQJA 2F40A 1GMVA 4W92B 2OPSB 3KG1A 3IAS9 2HVIA 2XCPA 3BYPA 2PFDA 3HVWA 3GIJA 1MWQA 4HT7A 1EJJA 1VQOS 1IKYA 2UXDJ 3F41A 3GV5B 1UFLA 5E7OB 5KFNA 4HI1A 2KYZA 1OY6A 2HHWA 4BDPA 1GTEA 2MQMA 1GT8A 3MGJA 4C48A 1NSQA 1WEXA 3U7JA 3LUYA 1WDDA 4NLTA 2RVJA 3DRRA 4OYAA 1EJ7L 3C16A 3SCLE 5EGHA 3A8JA 1V9OA 1WC4A 1H38A 4J9VA 3MFIA 1PAUB 4ANCA 2AEMA 2GLQA 3OL7A 1RTJB 5L46A 4QYZK 1FX2A 1NJWA 4QWBA 4CI0B 4YN3B 2RS2A 2ADBA 1C2PA 4IR9A 3ZZTA 1SKUB 1Q7YT 2XB2D 1BQNA 4BC9A 4NWXA 3BBBA 1IBMJ 2KG0A 3X1LB 2CQHA 2GA3A 1XJWB 2KM8B 2KRRA 3CJ8A 1NSAA 5B7WA 1X8DA 2LQJA 4CTAB 2W2MP 3EE3A 3JQKA 4B3MF 2CPJA 1XWLA 4A47A 2W8SA 4UPLA 4A4JA 2YPYA 3F44A 4B3OA 1KHNA 2OELA 4LSLB 1A6LA 4NZ6A 3MCOA 1HI1A 4WXOA 3H8YA 3BGRA 2Y1JA 1HR0F 2B6AB 5C42B 4DG1A 2QLWA 2MGZA 1KNZA 2R7TA 3LP0B 2KXFA 3M9MB 5A2QU 2B7BB 3OFFA 4AL5A 1U0HB 1SUQB 1WUUA 1URRA 1HHQA 3U02A 3FMWA 4NLPA 4L74A 4GKJF 4TQRA 3TANA 3GYNA 2CVIA 4UW2A 2FY1A 2AV5A 2O67A 2Z2LA 1ITPA 3CDBA 5DG9A 5F8MA 2KT2A 4J9RA 1ZM2A 1I51B 2HRYA 2IM1A 2JEIA 2R8HA 3UDCA 3LP0A 1N5VA 4DPTA 1SUQA 4U8YA 1N33F 1UZDA 2R8KA 4X64J 2BV3A 4EGLA 4MKYA 4JV1A 1RP5A 2KL8A 4P52A 2FD2A 5LSOA 2V94A 1NUEA 2GA7A 1U8WA 3AD8C 1ZPVA 1FKOB 1YBTA 3G87A 4OJ3A 5BYRA 2E5HA 2CNKB 3ISZA 1K47A 2VU5A 4HH1A 3SSRA 3GJTB 4C8OA 3MF5A 2IRXA 1HHTP 2PA8D 2V6AA 4ZVSB 2M70A 2IYIA 2W7AA 4X65F 2CJBA 5C7PA 3CCJS 2BZ2A 4QYZJ 3QJLA 4DV1F 3VGUA 2LEAA 2MB0B 2GSOA 3BDFA 2Q1LA 1SHNA 4QU7A 2E66A 2DCUB 2IHR1 1RDRA 3FFIB 3DFEA 4O23A 2UUCF 2MZSA 2ATLA 5K14B 4OZ3A 4L6V3 2KXNB 2DEIA 1K44A 4UOPA 4WF9Q 1NU4A 1VQPS 4OYMA 2MJNA 3BPSP 4JI5J 3GR1A 2Y8YA 1URNA 2HHVA 2YNGB 3CCUS 4DV6J 2R8IA 2EFOA 3ISNC 2W7PA 2X3DA 5F8HA 3CJQA 2MQPA 4CLKA 1RT1B 4USVA 4M5DA 2IC3B 1LEOA 4C8YA 4O44B 3HCXA 2IM0A 3QIPB 5KFJA 4ELUA 1N5SA 3SCIE 3R6LB 3DU5A 3HFZB 2CQ0A 1SVDA 2XSJB 2B56A 4ZJOA 5E41A 1NHKL 1N34F 1TV6B 2V4JA 1TUGB 1RWWB 2FVQA 4F04B 4CO2A 3CCQS 5K9FA 4QOTA 4YQWA 2JSXA 1VC6A 1RT1A 4KGKA 2HAIA 3DLHA 4F4WA 1JMTA 1VYAA 4U67Q 1S1UA 5D4NA 3TAQA 3FEXB 3WIVA 1F1BB 3DI6A 4PAAA 3KKFA 3F0NA 4LVNP 2AJ0A 1F60B 1GMWD 2BM1A 2DTJA 4IH5A 3PRBA 4MAKA 2XI3A 1ICEB 2BXJA 4EBDA 1SJFA 4CDIA 4IO1A 5K8NA 4GC7A 3TQ1A 1UEKA 3DOKA 4USIA 2CADA 3LP2B 3MPYA 1JKHA 3D5MA 3PX0A 4DR7F 3Q8YA 4F3QA 1RB0A 2WCXA 4KSEB 4TN2A 4BBYA 1E6YB 4LFBJ 1T9VA 2LQ8A 1KEKA 1GX6A 1ZZFA 2IRUA 3HHDA 3CMQA 4X62F 3BPDA 1QE1A 4DL3A 2G0JA 3FCVA 3K8VA 4LQYA 5T7LB 3NGDA 4C0BA 2BM0A 1Y9OA 2WB1D 3OTOF 1X5TA 2VG7B 2RQCA 4RW6B 4RNOA 4H54A 3I9V9 2HFUA 2ZC3A 4I7FB 3I5CA 4C4WA 1G2EA 2X7IA 3KLGA 1VLYA 1WOSA 3D1HA 2RD5C 4PG4A 2MDAA 4ZOSA 3IGNA 4ZG9A 4C0HA 1O51A 3RYLA 1RQ0A 2I8EA 1EHWA 1P1TA 1HWJA 3FSXA 2LEPA 1SC1B 3PDNA 1YSJA 4KYZA 1S5ZA 1ALIA 2YKNB 3VHQA 2ZKUA 2ZBPA 1KVIA 2H4WB 1GXUA 4DN9A 4Q8FA 2FPHX 4OI0A 4MIBA 2KXHA 1LXNA 4F4ZA 3KK3A 2EK6A 4RUHA 2HIQA 1S1TB 2MZRA 4CXSA 2M5YA 3PKMA 1E33P 1F2HA 4DS5A 3OVSA 2WAQD 3JQMA 1FJGJ 2K3KA 4GVBA 2JRSA 1I1GA 3Q8SB 2AGOA 2P6SA 4DX6A 2JFKA 1IBKJ 1RT5A 2IY5B 3DYAA 4DV4F 3EGZA 2CQCA 3DLGB 5F8NA 1Q8LA 1S4FA 5EX0A 4F4AA 1SL0A 4NASA 4K0KF 5DQIA 2HQDA 2P9CA 3UFCX 2XY7A 4LR7A 2W5VA 1YVFA 1XNRJ 4DR6F 1S1VB 4LF7F 3RBXA 3P45B 3PJ9A 2ZKTA 1APSA 2VFRA 4KE5A 1HNIA 1U2CA 2ZITA 3R97A 3DLGA 2WSFC 2R7WA 2KJVA 5I3PA 4F3MA 2HHTA 3GB0A 3QJJA 6FDRA 3C2PA 1JLEA 1YZ7A 3C19A 4Y3CA 3IR7B 4LF9F 2V8GA 1VQ4S 3M2RB 1C0UA 4LREA 5AJ3J 2A0FB 1EKRA 1SJRA 3K5LA 3BYRA 9ATCB 3TRGA 1TL7B 4FKYA 1WC3A 1P8GA 3RR8A 1N2KA 3M2UB 1RUSA 2ROPA 3EGWB 1QSSA 3OW2R 1FCAA 3DLKB 5LL6d 2NZCA 3A3NB 2HAFA 3NNHA 1Q8IA 1JJHA 2LVWA 4WP9A 1KQSR 3JSBA 5KFWA 4N8NA 2QMUB 5IWAF 4ZCMA 1KH9A 5CH7B 3H5SA 1DTTA 2HNYA 3I32A 2D1GA 2AD9A 3I4HX 1L3TA 4CH1A 2VQFF 4DCOB 5FLXU 3TEGA 3KK1A 4N8OA 3KNGA 4HLBA 4RBVA 4J37A 2N4DA 5KOXA 5FLXY 1S7IA 2UZAA 3TJAA 5DZ7A 4ANEA 2GJFA 4P7VA 4JV5F 4ZVEA 5AXKA 4DR4J 4NMLA 3KUEA 1T94A 2KFNA 1Q53A 2NS1B 3B8HA 5L8RC 2IAJA 2HQFA 1RWXB 3HFKA 2RH3A 4IH7A 5IC4B 1B4SA 2JEJA 2GNKA 3G82A 4DLEA 3H20A 3CJRA 3BO4A 3UQSA 1C1CA 3SEOA 3IGVA 2CQPA 2F8MA 3QO9A 2DGSA 3MEGB 5E2QA 1Y6VA 2ERRA 1VC5A 2CRLA 2C2NA 4WU3A 2FDNA 4LFAJ 4FF4A 3OXLA 3KJNB 4Q43A 3D4JA 1RLCL 5FDLB 1T02A 2J6SA 4YB1P 3WQPA 3GYXB 5DZ6A 2DHHA 1S0VA 2J8AA 3KXDA 4ZA1A 1DTQB 4QPTA 2WVBA 2NYHA 5D4PA 4USKA 5J2QB 2IUCB 1Y7AA 2Q6BA 2DNYA 3MEGA 2QZUA 3N4WA 3GSIA 4U7CA 2YNFB 2NXJA 1X5PA 2V4QA 4DV7J 1BD6A 2GX8A 1WI8A 4C2MA 1V5IB 5J1NA 1AZSB 1ROFA 2RUSA 2ZFHA 1R7IA 2CWXA 4J90A 1K7HA 2CQDA 5D0GA 1U25A 3C14A 3EM1A 4LFCJ 1NDLA 1T95A 2YNFA 2YVSA 5ITHA 5BJRA 4OYBA 1H2TZ 2RUGA 2GQCA 2HNDA 1NJZA 5CD4A 7AT1B 1XMQF 1O8BA 3RB0A 1UVLA 4KC5A 2CJAA 1KHWA 3KLHA 5D6GA 4PKDB 1XBWA 1KH4A 3DRSA 5K4PA 1VQ7S 3DGVA 3MM9A 4OZ2A 2NPFA 1G3OA 2CQ3A 3E3XA 1FI4A 1RKJA 2AP6A 3AODA 4KRWA 1SJ4P 1RTHA 1PC4A 1VHFA 5IV3A 1HBUB 2DEJA 1MNEA 2BKOA 1KHVA 1S1WA 1KQKA 1NKEA 1UCNA 4YHHF 2GJ2A 4JI6F 4ZGAA 4ZPVR 2XWXA 4LQ3A 1CPZA 1G4CA 4UOHA 4JUZA 1RTIB 5DDOC 2W7OA 1ZM3A 4FDIA 2KI2A 3MTJA 5DRKA 2I0XA 1F9HA 2OPPB 2JDJA 3KK2B 4DR2J 1RZMA 1T3OA 3FRYA 3GJRB 3MPWA 3UN2A 5GAEI 3QQCD 4PR6A 1OS5A 5DGBA 1LWEA 1A7GE 2V2QA 2QMXA 2DHXA 1NLKL 5GAHU 3SMZA 1LWCB 3SYZA 4CT9A 3ITHB 1FEHA 2ZVSA 1D9DA 5J1PA 3G2XA 4DFJA 5LMUF 2D3ZA 4JI1F 5HRTA 3JYTA 1S4EA 3D1OA 2MQOA 3V2UC 3R7BB 5J2NB 2I6WA 1FD8A 1WG5A 3MECB 1IM4A 3HM9A 1WI6A 2RRBA 3TARA 2B51A 3CCWA 5HMXA 2F4FA 2A2CA 4NLWA 3G86A 3WZ0A 2DNMA 3J81U 1HLWA 1YDLA 2CNNB 2BR0A 2XI2A 3IBFB 1IJFB 4CYUB 5EGYA 1NBEB 1RHQB 3MM6A 4QWAA 4UPHA 2VPYB 3HFVA 4ED7A 1B0TA 4OYWA 3J81Y 3HKZD 2LQBA 4ICLB 1U6FA 3DM2B 3R5AA 1S9EB 2FZGB 1JLGB 1FWPA 3CC7S 2ZJRQ 1I3OB 5KFDA 4G1QA 2MHNA 2B3TB 4F02A 5HJXA 4N7TA 4LBPA 2XC9A 2MKCA 2CPZA 3TAMA 2XCAA 1BMQB 4DSIA 3AJ1A 5KG0A 2UXDF 1GAOA 1HFEL 2K1RB 3ISND 2HIYA 1IKVA 3JSMB 4ZVUB 4ECVA 2DNOA 3NBPA 4USTA 5GAEU 1YKWA 4P2MA 2DGQA 2ZH3A 3PXGa 4IFVA 1IBLJ 3CPWR 4J9KA 1ZAXA 3V6DB 2UUBJ 4LF8F 3N5FA 5KFKA 3MI7X 3DXBA 4Y00A 1R89A 4U6PA 1LK5A 1Q1KA 1UJ6A 2W2PP 3Q8QB 2YWGA 2LA6A 4Q7AA 5F9LA 3C6TA 1TK0A 3RAQA 2DGTA 3BREA 2DH9A 4Q5VA 1P27B 5A8WA 1S6UA 1KC8T 2Z30B 1YK9A 2WVDA 4YS2A 3Q8PB 4PWDB 2A3JA 1RHRB 2E9RX 5IXUA 1DRZA 1N5YA 2PC6A 4IRCA 2EFNA 2F7VA 2O5DA 2HPUA 4WE1B 2QO3A 3WAXA 3CDAA 3RRKA 1CS4B 1Q0NA 2E5GA 1QSYA 1FWLA 3DKDA 4DL7A 5D0RA 3RBEA 2WOMB 3MURP 5E3RA 1DAXA 3JSYA 4Z7YA 4NLXA 2CAJA 3RU0A 3BZQA 3DPCA 5E3QA 1RISA 5K8OA 2B5JA 3IMQJ 2BOAA 5GADI 1HMVA 2D3O1 1T9WA 4LRAA 5L9XA 3CD6S 4B3RJ 3OD2A 2VFSA 4ZVPB 1CJTB 3IP0A 4Q0BB 3TI0A 4ZS6A 1ZOTA 1GX5A 3WAWA 4ES3A 3D54A 4MIAA 1NK6A 3IWNC 1YI2S 2XO6A 4LF4J 2N7YA 3CCLS 3FQLA 3IM8A 1M1HA 4EZ6A 1SV5B 2ZWPA 3SQGB 2I9SA 1S97A 3PYFA 4OV1A 2Y8WA 2HGNA 4OHZA 4C0OC 1U09A 4RW9B 1YJTA 2HMIA 3M8YA 4DWIA 1PJ6A 4Q0BA 2YNHA 2M8HA 4MFBA 3CWJA 5BXIA 3CF5Q 3R5DA 4X64F 3MMBB 4OI6A 5RUBA 4O3RA 2GVZB 3L4BC 3M8RA 3HVAA 1RI7A 1ZEBA 1SV5A 3P8BB 4DL6A 2JFDA 4U9RA 2Q66A 3T5JA 5H9EK 1NAQA 3QYYA 2EFGA 1HNVB 4GTZA 2GHWA 1YG0A 2H54B 4USHA 1VQ8S 3JAMU 2HHXA 4KO0B 3SSQA 1N32J 1URAA 5GOVA 2XZWA 3NGTA 1Y3KA 3O6QA 2R8GA 3H2VE 3AH6A 4DEZA 2LXFA 3ICLA 3RBZA 5GADU 1FRXA 1K73T 1YHQS 6FD1A 4H4OA 3ZTRA 2KG1A 2HEKA 2KH9A 3PKYA 4OI2A 2ZUAA 2VOOA 4QIEA 4MK7A 1E2SP 4WYLA 1D8ZA 1UFWA 2OSQA 4FXWA 5GMEA 3CO0P 4UZBA 2OEMA 2Y1IA 1RT6A 3TUZC 2VD3A 4FPIA 2QEXS 4DPWA 3QAUA 1FRHA 2ADCA 2OP5A 2FUG9 3SFGA 3HHLC 3PEHA 1NJYA 2MKIA 5HQLA 4ETXA 4NPOA 2E7XA 2W4DA 4DV6F 2D3UA 4R5PA 4AXIA 2VPZB 2KDOA 2OFHX 3FSYA 4FXVA 4ES2A 2VBWA 3AOBA 1REGX 3BSCA 1QY7A 1JK9B 1TZ0A 1TUVA 1BHNA 1YBAA 4RNNA 5JUMA 2ZJQQ 2OMOA 1SKSA 2E1CA 2UV8A 4LF6J 3CEDA 2EWHA 5LSLA 4U95A 2E9ZA 3OLBA 2O66A 3LAKA 5KFRA 1U1MA 2FZKB 3PO4A 1Y0HA 3CB4A 2LA4A 2RDJA 3VAJA 3UNGC 1RK8A 1KD1T 4JBCA 2E7VA 5KT4A 2QN6B 3HX9A 3ETOA 4B17A 2R2UA 3D0IE 2BKNA 1S9GA 3OFGA 2YKMB 1N48A 4NZ7A 3NNAA 4U7UK 4DN0A 2OPRA 2ZM6J 5D0HA 2VQEJ 2LEBA 3R5BA 3G6XA 4NXMF 1V6HA 4IG3B 1G7CB 4P7TA 2RDDA 3D9BA 3VWSA 2R3VA 3FKBA 4JI4J 3AD9C 3GV8B 2ZVIA 2CJXB 2DGOA 1S79A 4ED8A 1M5PC 1AUDA 3EUNA 4R0EA 2BANB 2YWWA 1WG1A 2G13A 1TAQA 4K4XA 4OYOA 3DN9A 3IAM9 4K4ZA 2CWKA 4RJVA 4IG3A 2QSFA 4I2PA 4JI3F 4PG8A 2MXYA 1TR0A 5DLFA 3BDEA 2DPJA 3KLVA 1TL5A 3PACA 2QA4G 3BEGB 3BN7A 2GQQA 3ZZYA 4NLSA 3CTRA 2AZ1A 2RILA 4RW4B 3ONQA 1D9AA 1RTDB 3LOUA 1HBNB 3V4IB 2DR5A 3R8YA 3EXCX 5B0BA 5D77A 3B82A 1CJUA 4AL6A 2I5JB 2EKYA 3FVYA 4X4RA 4LJMA 4AQYF 3CD5A 5LMNF 4AFFA 2YNIA 3HVTB 1XR6A 4ER8A 1UPMB 4YR2A 1UW4A 2EVZA 4ZP9A 5DS7A 1S6OA 1PC5A 4K4SA 1RKIA 2C2EA 1RAOA 2APOA 3B4MA 5HI7A 3GR0A 2ZH1A 1SQGA 1UWBA 3HO1A 2KU7A 2Y1RI 1NO8A 2XMKA 3MD1A 1IBKF 1C0TA 1Q5VA 3OFHA 2EC0A 3PW4A 2EI5A 5C2GA 2N82B 4FBTA 1M90T 4ID5B 2RDIA 1QTNB 1VK8A 4FBUA 3M30B 3NS7B 3LWMA 3I5BA 2JLGA 1JLCB 1PILA 2DXDA 2B43A 3PYEA 4WCEQ 1FRKA 5CYQB 1NMEB 3FRZA 5CXTA 1TP7A 4B9NA 3V81B 3VAGA 3CO9A 1R0AB 4NOHA 1MU2A 2ZWOA 2GSNA 2IDEA 1NXIA 3TQEA 4RNMA 3TA0A 3FBCA 5D8HB 1RWKB 1WC5A 4FYDA 3E01B 2HS3A 4KJGA 1LW0B 3ZZ0A 3H4DA 4MK8A 2AYGA 1ALKA 1JX4A 1CG2A 5AJ3F 3UWTA 3T9ZA 5LXRA 1XQIA 4ECTA 1YZ6A 2AMCB 2RRNA 2RE1A 2CZVC 4MIVA 2W1BA 5EWEA 2QRRA 2JLFA 3MM5B 4QIWD 2PD1A 4DLGA 3BGFA 1CEZA 2YH1A 1P49A 2V0NA 5CABA 4TY8A 2FQQB 3NGSA 4JI0J 2HHSA 2RIJA 4R25A 2RNEA 1QD1A 2ACYA 3MPUB 2AU0A 2IVMA 4ZP8A 1NPPA 4NI2A 3U1MA 3MTKA 2CPHA 4M63A 4ECZA 4LQ9A 3QT8A 3EGNA 3ZNJ1 2LLZA 1EQMA 5KFEA 1E3CP 4AYBD 4RWWA 1T9UA 3W9JA 2ACMA 1M0SA 3EZ5A 4H4MB 3W5XA 1SQFA 1U2RA 2NUUG 4BCAA 2FC8A 1JLFB 4U96A 4JI2F 3BR8A 4NXNF 4A8QA 2XZDB 1VBXA 3M1VA 2Y0BB 4XO0A 3M8SA 2HBRB 3BM7A 3L7OA 4DZDA 2DRAA 2VKZG 5B0GA 1ZS6A 3D6HB 3LGMA 5DM7Q 4TNOA 2WB4A 3QGPA 1BQMB 4M5JA 3Q2TC 3SDEA 1X4GA 2Z0GA 1X9MA 4NRTA 3S8SA 3MR3A 4MHXA 5IQ6A 1JLFA 3TA2A 5DLVA 4RU9A 3BSNA 1I94F 2ATCB 1QUVA 3CDEA 3GMGA 4NWJA 2LECA 2YKQA 2VASA 5BR8J 3W63A 2CJ9A 3THTA 1YIJS 1UFKA 1BQMA 4CO1A 1DFDA 1GXTA 1ZEFA 5KFVA 2J0WA 5L1IA 3EPIA 3CCTA 4DV7F 4DUZF 4OX6A 3D6FB 5CZXA 5KFQA 4LF5F 2U1AA 2Q43A 2J0SD 3EDQB 3HHLB 3KLEB 4ZKAA 5DM6Q 5J2PA 3UDVA 3OHAA 4ZPWR 4WTYA 3RAXA 2IFXA 1AXQA 2P8IA 2RHSB 4OLOA 4P74A 3PZPA 2C2RA 2HW3A 3T1YJ 4ED0A 4DU8A 2OFGX 4DL2A 5I3QA 4WKYA 4J9LA 2CIMA 4KGXB 4QWDA 1QTMA 3CJTA 2BRLA 3QWPA 4XDDA 1FJ7A 1UJ4A 3LGNA 1KR4A 4FZVA 1U2FA 1VISA 1TL1B 4OZ5A 4CLZA 4J7CA 1FNOA 2DBBA 3TG0A 5L39A 4XAKA 4L3KA 3OTDA 4ZVQB 2ROEA 3LH2S 1FF2A 1FX4A 2GCFA 2H9ZA 3K2YA 1T03B 2Z2YB 2O3DA 1KQGB 4C3KA 3CE8A 1FXRA 1NDKA 1Z2LA 1R8BA 4LRBA 2FLPA 2BQRA 1SKWA 5L0EA 2X3GA 1TFWA 2ZD1A 4I56A 1PCAA 2MSSA 1Z4UA 3OR2A 1S72S 4RW8B 1N36F 2HRUA 1KLMA 4A8YA 3PX4A 2GC8A 5HROB 3DGPB 2XS7A 3GE9A 2VG5A 4ZPTR 3QBCA 3WX8A 3OJSA 4CZCA 5EWGA 1NJXA 2AWZA 1SL2A 1OJ4A 4FKXA 4KH1B 4WZQA 1KVJA 2G2YA 3VZIA 4NZ0A 4RW8A 4CWBA 1FDAA 1Q4RA 4FP9A 4HHHA 3T19A 4PYAA 3DGPA 4ERDA 2FVPA 1ACMB 2BABA 3O2IA 1Q78A 3I0RB 5IZHA 4ECYA 1JLQB 1RWOB 3Q86A 1J5OB 3BH6B 3NKRA 1S1XA 4CLLA 1FFGB 3NKQA 3N79A 1DZ5A 1VRUA 1SPBP 2BE2A 4O4GB 1KONA 3A8KA 4K5RA 4IOCQ 1H7WA 2JOQA 1ZETA 2V5HG 2VONA 1REVA 4X2BA 4PWWA 5AXNA 5AXLA 2HHHJ 5ETOA 3UDEA 4KFBB 5B0AA 3W7BA 4GMKA 3DU6A 1JQGA 3N6LA 5C24B 3HHLD 4DXLA 3CCES 1NK8A 3OFEA 4YY3J 2AZ3A 3MAQA 4ZLPA 1ELOA 2YWHA 1FSUA 3LPEA 3NL0A 4OYPA 1WORA 2OH2A 3M2VB 4RBUA 2J9DE 1B8JA 5SUHA 4F26A 1TKZA 1VC0A 1VQ9S 5I3UA 3AQPA 3FCHA 1RE1B 4G1PA 2GJIA 2FVRA 1N56A 2CQIA 4CM0A 3PHTA 2FHMA 4M5IA 4I6YA 1RT3B 2XMAA 2F65A 3G8SA 4WTOB 2UUBF 4JOUA 3MAAA 5J1EA 1KVKA 1R0BG 2B8PA 4PZVA 2SXLA 1XNQJ 3UD4P 3M2VA 5D78A 3IR6B 2KTQA 5DQHA 2R2RA 5KTQA 3CJKB 3IG1A 4F3OA 1HPZA 3AOAA 1RWVB 2UXCF 4TQSA 4M94A 3KLFB 1OPIA 1WC0A 2ASLA 1NB7A 2E1MC 1T05B 2Z2MA 1FFWB 4B3TF 2EBEA 1CJKB 1JJ2R 2L41A 1KP6A 1CULA 1CJVB 3ILJA 1DBDA 1JLBA 2F9DA 4KHPF 2KN4A 4EBCA 4O0IA 1DQAA 3NKOA 2H1YA 3BH7B 2IA6A 3ILIA 2Z2ZA 4BWMA 2V9KA 2GMJA 2GO8A 2PA3A 2CG4A 1CBKA 4LR8A 1B7YB 1O5JA 1CJKA 4QPXA 4QR0A 1HQEA 5JXSA 2WBMA 2DNGA 4ED2A 2HZVA 1NK9A 3GJSB 4NX9A 2X98A 3KLIA 4PUOB 3DDIA 4ED6A 3CIZA 2M7SA 1OSDA 3VALA 3W64A 3C3LA 3I0SB 2W5TA 2C42A 2UUWA 1VBYA 4WIQA 1HWIA 3FK4A 2W5WA 1WNEA 2Z58B 5TJ3A 1WF1A 3ET6A 5KFIA 2OPQA 5DO2A 2LDIA 1LFPA 4OZJA 4GRSA 4PUOA 4YDDB 3CGIA 2RF2A 2PFFB 4ED1A 2XY6A 1YJRA 3VVTA 1AUKA 1XEZA 2DRBA 2DGWA 1EETB 2QLJB 1ZYQA 3KWMA 4N76A 4WZMA 1RT4A 4B9UA 1S10A 4DV5J 3PJXA 3OSNA 3ZXWA 4YR1A 3FEYB 4FPRA 3WBHA 2WTFA 3QGGA 1TTHB 5A8RB 5ETTA 1Q8BA 1MMNA 4DV3F 4ZP7A 1VI7A 2FJDB 1YTYA 1HI8A 1HBMB 3V4MA 3BDGB 1TKTB 2VFTA 4PG5A 1WHWA 1RCXB 2IMWP 2PMWA 3VAMA 4LF1A 3TZYA 3C15B 1ELYA 4AL7A 3DOMB 3CJ2A 2UU9J 1FWKA 1MG7A 5A8RA 2J8SA 1WACA 2MTLA 4C9DA 2V68A 2ASJA 4KV8B 5IT9Y 2XLIA 3ADAC 3G8QA 4LRCA 2FLLA 3HJVA 5L1LA 3FMBA 3C66A 4KKOB 2KHCA 2WHOA 4KGMA 1TKDA 4DL5A 3D2WA 1S6QB 5CD4H 1GMUA 1BUXA 3NCQA 1KWMA 3OR1A 4OZLA 5E3PA 4WK1A 3W61A 3M32B 1WC1A 3CULA 4ZVOB 1TL4A 5CA5A 4IG0B 4ALZA 4CLSA 4G6VB 3IN5A 2AJ4A 1ZZNA 2AJQA 4OX8A 1K0TA 4WKRA 1V5VA 2RHQB 2XMTA 4DQQA 2BJ1A 1LWFA 4OQJA 2HQCA 3CSKA 1B70B 3T5HA 4DCJB 4B9LA 2AYMA 4HH0A 3POTB 3LF0A 1NSKL 4IQMA 3NY0A 3GFXA 5KFHA 5L0BA 4UUXA 2FGCA 3ENQA 1YJUA 4NLQA 3RB3A 3E51A 1KOHA 5EHHA 3W2WA 4KH0B 3GWCA 4HACA 1ANJA 1HNXF 5E3AA 3EDRB 5CYMB 4F4YA 1E6VB 2OI2A 3DRPA 4JI8F 3TA1A 2WW4A 2YY3A 1IKYB 1VCTA 2E5IA 4AE5A 2ZZMA 2R42A 3KMSA 2F1FA 3TOQA 4PXDA 2NCKL 4JI4F 5HP1A 4K7QA 2UUAF 4C97A 1X60A 3DRRB 2VA2A 3E2EA 3PJWA 5CYMA 3C16B 3QPIA 5KAKA 2DITA 1E6VA 2KRBA 5C66A 1SI9A 1FJEB 3O44A 3PCOB 3RW7A 2VA3A 3UD3P 3Q8VA 2EG1A 1XN9A 1HD1A 1XIQA 1A9NB 1IR2A 3ZO7A 2CXEA 2E1AA 4OI4A 1CSJA 3H40A 3D0GE 3TP2A 1JB0C 1BQNB 2MY7A 2B4PA 4GKKF 4YUDA 2R7OA 4RBTA 1R8CA 4ID8A 2CPFA 1ALJA 3M8ZA 3MAHA 2OKQA 4N56A 2HZAA 5BYQA 3W2VA 4G3IA 1IR1A 2Z56B 3HZGA 4WP8A 2XNQA 3FQKA 4NL5A 2FYXA 2CUYA 3MR2A 5LSRA 5KG5A 2P2CB 4OX9F 4QIGA 4LSZB 4B3OB 4P2XA 3P49B 1HR0J 3BGRB 3IS9A 5HN0A 1WOOA 3EX7B 4Q8EA 2CJYB 2ZZTA 4DG1B 4DQPA 1UVIA 5G0RA 3NAHA 2MGZB 4MKAA 3LTOA 4KAYA 4I64A 2G9OA 1IKWA 4ED3A 1VBZA 1G1XA 3I6PA 3UPFA 1ED8A 5E5NA 3IXQA 3BN4A 3MEKA 1L3VA 4NE9C 1SH0A 1OO0B 5HMZA 1RHUB 4R8UA 3DRYA 2XYHB 1KDNA 2DYAA 3EVWA 1EP4A 1N0VC 3AA8A 1X4DA 3M6WA 2R7RA 2RT3A 1FRMA 3IA0A 2MKHA 2YKOA 3L7PA 1N33J 5KT3A 1N6QA 2FJBB 2HVZA 3NLCA 5F3ZA 3TVYA 1FK9B 5A2QY 2OD4A 3RAMA 3P5TL 1WTFA 4KPYA 2BW7A 1SJ3P 1WHYA 2QZ8A 2BA9A 3CCMS 1JNRB 1KHLA 2K2PA 3SZYA 1U6ZA 4DFMA 4X4NA 2H51B 4N77A 4GO5X 2PMHA 3A12A 4RPFA 3QZ7A 1Q7LB 4C3LA 5I42A 1EX8A 2BE9B 2NQPA 4H4KA 1ZEDA 2GHVC 4DHVA 1YJ7A 1M5KC 1FK9A 2QTWA 3HT3A 4DV1J 3P6YC 4F0MA 2Q6CA 1IXKA 4C6AA 5F8LA 4G1IA 4OJGA 5DG7A 2V69A 5H9FK 5IJQA 4WIIA 1NH7A 3QATA 1WOPA 3IWLA 2C2ZB 1BY9A 2UUCJ 3G6ES 1MN7A 2J7WA 4QBUA 2YH0A 2VH7A 4JI0F 3D28A 1RSCA 3R7SB 2WK4A 3C6UA 3NVLA 4CO5A 2V8HA 4USWA 2WZ1A 4K2XA 3LALA 1N5QA 2UXBJ 5K5MA 2MHEA 4M5MA 5AJ9A 4DU7A 2WVEA 5C2CA 1R6VA 2RB7A 4LBHA 2J6UA 3KFWX 2PGCA 2CQ1A 4NLOA 2F5GA 4CT8A 4N5SA 2L9NA 4M5DB 3OVAA 1R0CB 4OHWA 1HNWJ 2OAUA 1OWXA 2R2TA 2CKWA 1SJQA 1SC4B 4ZDNA 4PG6A 2VG6A 2W9BA 4HDGA 4J9PA 4QW8A 2QL7B 4RU2A 1WKJA 2AX0A 1W26A 3DMJA 4IOBA 3Q23A 3NGKA 2J9CA 2V4JB 3OL9A 4ZN1A 1S76D 3HF5A 3M8QA 1D3WA 1NEEA 1ZH5A 1SH3A 5LQQA 4I4BA 3EZUA 3R5GA 2KZZA 4K8RA 2OSRA 4DPUA 4YP3A 2IVYA 3J7YI 2VB6A 3HJFA 2FJAB 1S1UB 1SL1A 3DI6B 2AHOB 3GP9A 2DY9A 2DH7A 2I1RA 4OIXA 3MR7A 4HHJA 3M4XA 3B78A 2W2OP 4K4WA 1HWLA 2CYYA 1S57A 4J9UE 2RQKA 3DOKB 1OYEA 3DRXA 4DR7J 1K9MT 1JKHB 1LW2A 1LK7A 5M2PA 3H7HB 4USMA 4DUTA 1RADB 2FJEB 3BV8A 3UO0A 3K5NA 1EKSA 3VAIA 3NOCA 3TR5A 4X62J 3VGTA 2UVUA 1NKCA 5C5JA 5HO4A 1L3UA 3OBIA 4DX7A 1QE1B 4TU9A 3AB4B 1ZAWA 2HBYB 1B99A 5HQ8A 2V8VA 1BC6A 5A6PA 5KFBA 2ZOFA 3T1HF 3PIPQ 2IIHA 5KFYA 1URBA 3P3DA 1IQTA 1D1UA 4ED4A 4DOZA 2V67A 3QGHA 1H0HB 2FHJA 1WWHA 3GTYX 3KLGB 3Q0AA 4ZVHA 2VC0A 2E7WA 4O3NA 2F3JA 3W62A 5KFPA 1ZA1B 1LFWA 3UVJB 3UD5A 3AAWB 4X66J 4WU2A 1FKPB 3QZ8A 1NM2A 2IA0A 2F4VF 2L08A 1PJ5A 4Z2XA 4EO8A 2MY8A 3BDPA 3VAFA 3MR5A 1U4BA 2CA9A 3GJQB 4DV2F 2K8GA 3SIPB 4DZ6A 2HGLA 3CW2C 3KK3B 3NS5A 3GIMA 5IS2A 2MQQA 1KQFB 1UP1A 3EGVA 3ZZOA 2G1DA 5GAGI 3HZEA 1H7XA 1X0FA 3L3CA 3ZTPA 3LP1A 1D9FA 1RJJA 4NLUA 3UVJA 2DRDA 4GVBB 4KGVB 4PXCA 4LRDA 1FKPA 2GIFA 1RT5B 3R3TA 2GFFA 3DYAB 2LQ9A 4Z37A 3T02A 4O0NA 1XERA 1F5AA 1C4AA 2AEFA 2ROGA 4Z7CA 4K0KJ 1YGYA 1O98A 2EG2A 4GVLA 4OL8A 2IJRA 1PBAA 5AE1A 1U47A 4DR6J 1Y5NB 1JIHA 3IRXA 1WD6A 4ZHRA 5DGAA 3EICA 2K7KA 1ZM9A 3ILLA 3M8PB 5DLGA 2J0QD 2HRTA 3MK0A 4JV2A 1VRTA 1HNIB 4EYHB 3H2UB 4K2JA 3D6TB 1HBOB 1OQ6A 2COLA 3THPA 3MFHA 1CC8A 4LF9J 8RUCA 1JLEB 4ZJLA 2OEKA 5KFSA 2DO4A 3A3PB 1C0UB 3MM8A 5HL7Q 2DPIA 1NB2A 1C4CA 1QUPA 4JYAJ 4FVMA 3CMES 2HQIA 1HD0A 1MROA 3M8PA 2JZ5A 2GVDA 1X31C 2HLUA 1QAYA 2GHPA 4CLYA 3PG9A 2L48A 3QSIA 3MMAA 3G4SS 2Q79A 2V9WA 4A8SA 1HBOA 4CLUA 4RUBA 5HQMA 4YY3F 5GAGU 3PR5B 4GTYA 2E5LF 1S0MA 3HPOA 4ENOA 2KB2A 3J80U 3T41A 1AROP 5IWAJ 2FHJD 3A3OB 4K50A 1SB6A 4F50A 2ILYA 2IPOB 6AT1B 1HYSA 2EFPA 2WSCC 1JXVA 4MT1A 1DTTB 2XO7A 3J80Y 2HNYB 2OIHA 3FNNA 1UWAA 1UEUA 3TZWA 2ILZA 3NKYA 5KG2A 3VTIA 2C3MA 1FKAF 3KK1B 1T9XA 1CQNA 1Z1ZA 2ALYB 4F8RA 4PRFA 2P9EA 4OI1A 2R4FA 4LSNA 3K89A 5ADZA 1AYEA 2EW9A 2OEJA 2YTCA 5KG6A 2UUTA 1UKUA 2ZDOA 4JV5J 2QFIA 3BS9A 3B4DA 3JS9A 4ZCIA 2YWFA 3KYLA
chains in the Genus database with same CATH topology
3IGYB 1ELYA 1EW2A 1O99A 3M8WA 2GA3A 5L0KA 1E2SP 5KXAA 2W8DA 3NKNA 3WAVA 4N7TA 4CXUA 1ED8A 3CMRA 5IJQA 5L0BA 4FDIA 2W5WA 1SHQA 1EQJA 3IGZB 1ELZA 3M8YA 1KH9A 1KHJA 1P49A 4UOOA 4GTXA 4ZG7A 4LRDA 3Q3QA 3TX0A 1KH7A 1EJJA 5DLTA 5TJ3A 3T00A 1Y6VA 4LR7A 3UN2A 2W5VA 4B56A 4TN0A 3OT9A 3WAXA 5IJSA 4LRCA 1N2LA 2D1GA 4UOPA 5LQQA 1EW8A 4MHXA 3T02A 4LR9A 2IUCA 2W8SA 1EW9A 1URBA 1ANJA 4GTYA 4UPLA 5DLVA 1FSUA 1ALJA 3M8ZA 1AJBA 1KHNA 2ZKTA 2ANHA 3KD8A 2W5SA 1AJAA 4LRFA 1HJKA 3NKOA 3T01A 3NVLA 4ZG9A 1ZEBA 4CXKA 5GRRA 4MIVA 1O98A 1AUKA 4QAXA 4NWJA 5LRNA 4UORA 5LRMA 1AJCA 2W5XA 3MK2A 2RH6A 1B8JA 1KH5A 2W5QA 5DLWA 2GSNA 5HRTA 3E2DA 1HQAA 2XR9A 1KH4A 3DPCA 1ALIA 5EGHA 2VQRA 3IDDA 3BDGA 4GTWA 4KAVA 5K4PA 5LIAA 3TG0A 1E1ZP 4GTZA 3UN3A 2IUCB 4YR1A 4LR2A 1Y7AA 1KHLA 2GSUA 5AJ9A 2QZUA 3WBHA 4LR8A 3SZYA 1E3CP 1ZEFA 4LRAA 2GLQA 4UPKA 4KJGA 3MK0A 3MK1A 4LREA 5EGEA 1ELXA 1URAA 1ALKA 2G9YA 5GOVA 2XRGA 4CXSA 3ED4A 1E33P 3WAWA 4CYRA 1ED9A 1EI6A 2IFYA 4FDJA 3M7VA 4UPIA 3B5QA 3BDHA 3NKRA 2GSOA 4ZG6A 3BDGB 3NKQA 2X98A 3BDFA 1ALHA 3UN5A 4KJDA 1ANIA 1HDHA 1SHNA 1N2KA 4KAYA 2W5RA 5C66A 4MY4A 4CYSA 3NKMA 1ZEDA 3DYCA 3LXQA 4UPHA 3WAYA 5INHA 4LRBA 1AJDA 4LQYA 3UNYA 1K7HA 4NWXA 3SZZA 3UO0A 1KHKA 4ZGAA 5L0EA 2W5TA 3NKPA 3TWZA 4KM4A 3A52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGY B;  1ELY A;  1EW2 A;  1O99 A;  3M8W A;  2GA3 A;  5L0K A;  1E2S P;  5KXA A;  2W8D A;  3NKN A;  3WAV A;  4N7T A;  4CXU A;  1ED8 A;  3CMR A;  5IJQ A;  5L0B A;  4FDI A;  2W5W A;  1SHQ A;  1EQJ A;  3IGZ B;  1ELZ A;  3M8Y A;  1KH9 A;  1KHJ A;  1P49 A;  4UOO A;  4GTX A;  4ZG7 A;  4LRD A;  3Q3Q A;  3TX0 A;  1KH7 A;  1EJJ A;  5DLT A;  5TJ3 A;  3T00 A;  1Y6V A;  4LR7 A;  3UN2 A;  2W5V A;  4B56 A;  4TN0 A;  3OT9 A;  3WAX A;  5IJS A;  4LRC A;  1N2L A;  2D1G A;  4UOP A;  5LQQ A;  1EW8 A;  4MHX A;  3T02 A;  4LR9 A;  2IUC A;  2W8S A;  1EW9 A;  1URB A;  1ANJ A;  4GTY A;  4UPL A;  5DLV A;  1FSU A;  1ALJ A;  3M8Z A;  1AJB A;  1KHN A;  2ZKT A;  2ANH A;  3KD8 A;  2W5S A;  1AJA A;  4LRF A;  1HJK A;  3NKO A;  3T01 A;  3NVL A;  4ZG9 A;  1ZEB A;  4CXK A;  5GRR A;  4MIV A;  1O98 A;  1AUK A;  4QAX A;  4NWJ A;  5LRN A;  4UOR A;  5LRM A;  1AJC A;  2W5X A;  3MK2 A;  2RH6 A;  1B8J A;  1KH5 A;  2W5Q A;  5DLW A;  2GSN A;  5HRT A;  3E2D A;  1HQA A;  2XR9 A;  1KH4 A;  3DPC A;  1ALI A;  5EGH A;  2VQR A;  3IDD A;  3BDG A;  4GTW A;  4KAV A;  5K4P A;  5LIA A;  3TG0 A;  1E1Z P;  4GTZ A;  3UN3 A;  2IUC B;  4YR1 A;  4LR2 A;  1Y7A A;  1KHL A;  2GSU A;  5AJ9 A;  2QZU A;  3WBH A;  4LR8 A;  3SZY A;  1E3C P;  1ZEF A;  4LRA A;  2GLQ A;  4UPK A;  4KJG A;  3MK0 A;  3MK1 A;  4LRE A;  5EGE A;  1ELX A;  1URA A;  1ALK A;  2G9Y A;  5GOV A;  2XRG A;  4CXS A;  3ED4 A;  1E33 P;  3WAW A;  4CYR A;  1ED9 A;  1EI6 A;  2IFY A;  4FDJ A;  3M7V A;  4UPI A;  3B5Q A;  3BDH A;  3NKR A;  2GSO A;  4ZG6 A;  3BDG B;  3NKQ A;  2X98 A;  3BDF A;  1ALH A;  3UN5 A;  4KJD A;  1ANI A;  1HDH A;  1SHN A;  1N2K A;  4KAY A;  2W5R A;  5C66 A;  4MY4 A;  4CYS A;  3NKM A;  1ZED A;  3DYC A;  3LXQ A;  4UPH A;  3WAY A;  5INH A;  4LRB A;  1AJD A;  4LQY A;  3UNY A;  1K7H A;  4NWX A;  3SZZ A;  3UO0 A;  1KHK A;  4ZGA A;  5L0E A;  2W5T A;  3NKP A;  3TWZ A;  4KM4 A;  3A52 A; 
#chains in the Genus database with same CATH topology
 4DS4 A;  3L7U A;  2YQ3 A;  2GW8 A;  3W8G A;  3EPG A;  2IAJ B;  1TVR A;  4IFY A;  3PR4 A;  4F2R A;  4V19 X;  2FLO A;  1OIA A;  4LVO P;  4DFP A;  2P6T A;  1W2B R;  3G82 B;  2DH8 A;  4IDK A;  5KFX A;  5HSP A;  1C1C B;  4LF2 A;  5F8G A;  3FJ2 A;  4JI7 F;  3QO9 B;  4C8Z A;  8AT1 B;  4B9S A;  5D3G A;  3GG1 A;  5E33 A;  1RWN B;  1G6B A;  3AD7 C;  2H65 B;  4I2Q A;  2VBY A;  5KT6 A;  3I96 A;  5D0E A;  1JWW A;  1HQU B;  2DNQ A;  3KJV A;  4IH6 A;  3KOA A;  3UCZ P;  4MKB A;  3NGU A;  2DGU A;  1U24 A;  3CJ3 A;  2R7U A;  1HHS A;  3T1A A;  5IM0 A;  2RKI A;  2CQG A;  2AGQ A;  4NCG A;  4IO9 Q;  3T3F A;  4NA2 A;  3NKP A;  1FRL A;  5F8J A;  2J76 E;  3DOL A;  2UVV A;  1KRP A;  4YB5 A;  5JVG Q;  4IQX A;  4O3S A;  2J5A A;  1YJ9 S;  1DJ0 A;  4URG A;  1HQU A;  3CCZ A;  3O8W A;  4GTX A;  1FRI A;  1OPZ A;  2C22 A;  3TNV A;  1R8P A;  2V63 A;  3C14 B;  3I5A A;  2A6M A;  1Y7P A;  1KN6 A;  4ECQ A;  2XS2 A;  1X4H A;  1PSD A;  3Q83 A;  4MYU A;  2YX1 A;  2AX1 A;  3TUP A;  1RT2 B;  2V2K A;  1AJC A;  3J7A N;  3OL8 A;  4PXE A;  2HND B;  4NMX A;  7FDR A;  3ELH A;  1XMQ J;  2V2Z A;  3LAN A;  2BUN A;  5JVH Q;  2HVH A;  3KLH B;  5LOQ A;  1UEV A;  3CDU A;  3MCM A;  3PW2 A;  4C11 A;  4OI3 A;  3DRS B;  3MM9 B;  4J9M A;  1H2U X;  1FER A;  1RT2 A;  3OJU A;  5IC6 B;  2QA1 A;  2ZBI A;  2A18 A;  3GCW P;  1O99 A;  3MEE B;  3M8W A;  4OZ1 A;  4K5S A;  2KFZ A;  3AA9 A;  3N0V A;  1RTH B;  2A6O A;  1PGZ A;  1NPR A;  1RA6 A;  4UY8 T;  2QE5 A;  1SHQ A;  1VOM A;  2RSQ A;  1S1W B;  4EO6 A;  4YHH J;  5CAA A;  4JI6 J;  2QL5 B;  5AXM A;  4DUY F;  1DLO A;  3S01 A;  1RU2 A;  2IBO A;  3VR1 A;  3GIK A;  3GON A;  1IKX A;  4DSJ A;  1F2G A;  1GEH A;  3A4T A;  2WRM A;  1FD2 A;  2MQN A;  5T41 A;  2V4R A;  1HW8 A;  1IWG A;  3AJ2 A;  2CPD A;  3MEE A;  3RUB L;  1VK3 A;  1DY3 A;  1SIZ A;  3B6B A;  4URQ U;  3V5R A;  3T6B A;  3PNI A;  2IYG A;  2OJ3 A;  1LWE B;  4RW7 A;  4X4Q A;  4A8X A;  1TL3 A;  4DPX A;  2G0C A;  2DCL A;  4QCL A;  2FVS A;  2UVR A;  1YWX A;  2DIU A;  4A48 A;  3TEH B;  2XYG B;  5LMU J;  4JI1 J;  2RRA A;  1LKZ A;  4CQ1 A;  3JB9 k;  4B3S F;  3IR5 B;  2M2B A;  1S9F A;  3JYT B;  2DR7 A;  1ALH A;  3MD3 A;  1RYR A;  4GO7 X;  3OUY B;  5K20 B;  1T0T V;  2AIR B;  3IGY B;  2QFJ A;  2EFV A;  4ZLN A;  3NWR A;  4BLG A;  2DT9 A;  1IVZ A;  1MWZ A;  3WHI A;  1AUS L;  3MM6 B;  5D15 A;  3GFH A;  2BJ8 A;  1BWE A;  5F41 A;  4TN0 A;  5KFL A;  4DR1 F;  3BSA A;  1UA1 A;  1F3F A;  1JJ4 A;  2NZ4 A;  4G1Q B;  3AHP A;  3GLJ A;  3VAK A;  1FE0 A;  4UY8 5;  3OUY A;  4TKT A;  4BC7 A;  3M9N B;  4UQG A;  1J5E F;  3K5M A;  4LT6 A;  1F5B A;  3TAM B;  1KH5 A;  5D4L A;  2W9C B;  4HDH A;  1VQ6 S;  5A0Y A;  4LR2 A;  3ZC4 A;  2XG8 A;  4CM2 A;  1NDC A;  4ZPB A;  4DR5 F;  1IKV B;  4LMZ A;  3BSO A;  2K06 A;  3R2C J;  4OHV A;  3BJY A;  4MTP A;  3CT9 A;  3AXK A;  1FVS A;  3MZI A;  2KYX A;  3NBP B;  3KDO A;  4O3P A;  1H72 C;  3H25 A;  4RX6 A;  4NWB A;  1RAG B;  4EUV A;  2OPS A;  4M1K A;  4IFV B;  2V8D A;  2YX4 A;  4KM4 A;  2W9C A;  3BQ1 A;  4LF8 J;  1EW2 A;  4DQR A;  3ENV A;  3J81 j;  3K57 A;  5E3C A;  2OML A;  4ZIV A;  5CHC B;  3HVR A;  1ELZ A;  2JNJ A;  5HAT A;  2VF3 A;  4F25 A;  2FJV A;  3D1Q A;  1VFJ A;  2AJ1 A;  3C6T B;  3TVK A;  4XPE A;  4B56 A;  2GV1 A;  4WXW A;  1KFS A;  2HFN A;  1RLD A;  4ZPA A;  5CCL A;  5A8W B;  2MKY A;  2DXE A;  2DNZ A;  5B08 A;  3SV4 A;  4NLG A;  4NEY A;  3TVZ A;  4AUK A;  1T8E A;  5HMW A;  1N5Y B;  1RTJ A;  4D3H A;  5LRM A;  2DGX A;  2YQ1 A;  1QVF R;  2WON B;  4FF1 A;  4URS A;  1RXO B;  4Y65 A;  1YLX A;  2EBG A;  4I69 A;  3ETM A;  4TY9 A;  2WBR A;  3TZX A;  2OLW A;  1H98 A;  1IBM F;  2CQ2 A;  2VPX B;  2JEF A;  2C3U A;  5F9N A;  1MN9 A;  4FDJ A;  3BB5 A;  5KFA A;  4E8U A;  2FZC B;  2B5J B;  3BF4 A;  3SQO P;  4CTA A;  2W4P A;  1HMV B;  1Q8K A;  2FY8 A;  4PEO A;  2WON A;  4QW9 A;  5KFM A;  1RTZ A;  3OTE A;  4U8V A;  2QLX A;  4LSL A;  2C1E B;  1TMJ A;  1HIY A;  4DQI A;  3NGR A;  3GYG A;  1X0P A;  2FJX A;  2B6A A;  5C42 A;  1U1K A;  1YQH A;  3QLH B;  1VQN S;  3N9U C;  1GXL A;  3ZZR A;  3RRH A;  2ZDP A;  1S99 A;  1FT8 A;  1F3V A;  4IRD A;  2P9G A;  4FNI A;  4MMO A;  1U0H A;  2BJ3 A;  2KO1 A;  4UZC A;  4YR3 A;  3FCW A;  2YWK A;  2HMI B;  1XMO J;  1WSR A;  4KR0 B;  2YNH B;  3UE2 A;  3L95 X;  2M4M A;  4MFB B;  3ZTO A;  1HA1 A;  2DR8 A;  1WKK A;  2ABY A;  3G96 A;  3HI9 A;  1NHV A;  1GMW A;  1Q86 T;  4B02 A;  3QLH A;  5DDQ C;  5HK4 A;  4YR0 A;  2JL9 A;  3NCP A;  4TVA B;  3WC0 A;  3ILO A;  2CQB A;  4EFA C;  3LW5 C;  3QRQ A;  4UT4 A;  3PVX A;  3M7V A;  3G8T A;  2R2S A;  1SCJ B;  3VVU A;  1UAW A;  4NA3 A;  4PPD A;  3LGH A;  1RAE B;  1B0P A;  1PG5 B;  2YWE A;  1Y3J A;  5DQG A;  2NXN A;  3IGZ B;  1X4C A;  5DG8 A;  4ECX A;  2CNO B;  4OFZ A;  4B9V A;  1FKO A;  1GFW B;  4HI2 A;  4ZPC A;  4H4O B;  1W2I A;  2HWT A;  1VQS A;  1TK8 A;  3AFG A;  3MUV P;  4LUB A;  3AY0 A;  1P9Y A;  2VZ9 A;  4LR9 A;  1KBR A;  3W5Z A;  2PT0 A;  1FXD A;  1KTV A;  2CZ9 A;  3AJD A;  2BDP A;  4FDF A;  5THW A;  1U1L A;  4FVC A;  1CQM A;  3T01 A;  3SZ2 A;  3WX4 A;  3QT6 A;  1RT6 B;  4I68 A;  4W4M A;  3E2D A;  2VBZ A;  3JAM Y;  5AT1 B;  3UN3 A;  2UXB F;  2ZH7 A;  1QAJ A;  2LKZ A;  3ZZZ A;  4KIA A;  3FDS A;  3EMT A;  3KJF B;  4FS1 A;  3FFI A;  1VQK S;  5K8P A;  2FHK A;  4J9O A;  1K1Q A;  2XRG A;  3EXY A;  5K14 A;  3D6M B;  2Q3P A;  4R5P B;  2CG8 A;  2D41 A;  2IM2 A;  2QA2 A;  1ZA2 B;  3W3S A;  2OTJ S;  1HNW F;  1LNQ A;  3HSZ A;  2YQ0 A;  3H2L A;  3PHE A;  2F63 A;  4CIO A;  2VJU A;  4DJB A;  2BRK A;  2CJK A;  4DX5 A;  2EPI A;  2DNK A;  3AB2 B;  4F36 A;  4ZPD A;  2XS5 A;  1T7P A;  4JI5 F;  2YNG A;  2VL1 A;  1BQX A;  1R43 A;  3QJP A;  1MLA A;  1PBU A;  2AW0 A;  4Q2M A;  1HAR A;  3DLE B;  2XMW A;  1CC7 A;  2IC3 A;  4KT0 C;  4XPC A;  4UUW A;  2DXF A;  4O44 A;  4L73 A;  3CDW A;  3CCR S;  3QIP A;  3K0J A;  4QQB A;  2J9D A;  2NPI A;  3OL6 A;  2H5J B;  2YX7 A;  4C7Q A;  1U45 A;  1U7L A;  4QWE A;  1TU0 B;  3S6E A;  4PG7 A;  2XSJ A;  3CCS S;  4ECR A;  3FEZ A;  1S9G B;  2G0I A;  2MLY A;  1TV6 A;  3PO5 A;  2HQ3 A;  4ZMM A;  2OPR B;  4G65 A;  3UCU P;  4NXM J;  2YXL A;  5EUH A;  3DLE A;  4LBI A;  1NKB A;  2Z8Q A;  5JMN A;  1H74 A;  2ZBR A;  2DR9 A;  4MH8 A;  4S0M A;  3NKM A;  3ZZU A;  1IWA A;  4B08 A;  5F0W A;  3CXC R;  1OYD A;  5T14 A;  3ZZP A;  1U49 A;  1O6X A;  4X84 A;  7FD1 A;  2W8K A;  1EIY B;  1MWY A;  3BR9 A;  4DPO A;  2GS8 A;  3HSJ A;  3WC2 A;  1FNX H;  2D3O R;  4ZG7 A;  1U1R A;  5DLT A;  1H73 A;  3LP2 A;  4WJB A;  1R31 A;  3MUT P;  4JI3 J;  5H9E J;  2ZEJ A;  1PKU A;  4I2P B;  5KG3 A;  4KY3 A;  1UW9 A;  4FNH A;  2L3M A;  5EWF A;  2MZJ A;  2IBK A;  4KAI A;  1E6Y A;  3J7Z T;  5HMY A;  4LFB F;  1R27 B;  1FFS B;  3HDS A;  4XIU A;  2W2N P;  2XY5 A;  4QZV B;  2BAC A;  3PM9 A;  2IMO A;  1QDU B;  4EMD A;  2HFS A;  2M3D A;  4FYX B;  4HTI A;  1U1N A;  1XTZ A;  5T7L A;  1DUR A;  4C98 A;  4MK9 A;  4MYT A;  4NEZ A;  1HQ2 A;  4X66 F;  3ED4 A;  1CJU B;  2VG7 A;  4AQY J;  4RW6 A;  1LV5 A;  5I4M A;  5LMN J;  5B09 A;  4FXD A;  4I7F A;  3QRR A;  2YNI B;  3FUY A;  4ZVR B;  3CD0 A;  3GIL A;  3TWZ A;  4Y28 C;  4XDC A;  2V8P A;  2W8D A;  3WIU A;  4RO0 A;  4EZ9 A;  3CVK A;  1UWB B;  5KG7 A;  4LIR A;  2G1H A;  2YKN A;  1C0T B;  2DK2 A;  2ZZN A;  4TYB A;  3KD8 A;  1AJA A;  4F4K A;  4J91 A;  4OV6 A;  1PO6 A;  1QAI A;  1S1T A;  4UOR A;  1O0P A;  2PE8 A;  3T5K A;  2M52 A;  2DHG A;  1N88 A;  4FF2 A;  3QID A;  1NPK A;  3SV3 A;  2CPI A;  3UR3 C;  2GQ2 A;  2KT5 A;  3A8E A;  1N4L A;  4KHM A;  1LOU A;  3U27 A;  4OLP A;  1P6T A;  2AJF E;  1FJG F;  3HT0 A;  2H5I B;  3J7Z 5;  4K4V A;  4NYZ A;  2HSE B;  2XYP B;  1MU2 B;  1ELX A;  4PYD A;  5G4D A;  4PQU B;  4CH0 S;  2MZ1 A;  1R8A A;  3MXH P;  3B5Q A;  1AFJ A;  1XR5 A;  4WBF A;  1VQ5 S;  1U1P A;  1JLA B;  3SFU A;  1CVJ A;  3KMQ A;  3VCD A;  4MIW A;  4ECW A;  3TUJ C;  2NLW A;  2W01 A;  4JP8 A;  4DSE A;  2ZNZ A;  1AJD A;  3RRG A;  3UNY A;  2IM3 A;  4M5K A;  3BBC A;  4J5O A;  1S1V A;  4OZ0 A;  3MED B;  1XNR F;  4TXS A;  1NHU A;  4PWU A;  3VV2 B;  4JYA F;  4D3G A;  4ES1 A;  4FYW B;  1RAB B;  4E0D A;  3MOZ A;  2HWH A;  2B4O A;  4F4X A;  5LJ3 Y;  4PQU A;  1HNZ J;  5BYS A;  5B0F A;  5AE3 A;  1EW8 A;  5DDR C;  1JLA A;  1NZ8 A;  3MM7 B;  1N8R T;  3OLA A;  1NZA A;  3O1L A;  4YDX A;  4BS2 A;  4RR5 A;  3I55 S;  3M2R A;  1N54 B;  5LM7 E;  2N4C A;  3S7R A;  3P4U B;  4X4U A;  3MOJ B;  3MK2 A;  4TY8 B;  2DHS A;  3MED A;  1YRT A;  3W65 A;  1TL7 A;  2AT1 B;  2VQR A;  5KFF A;  4P6Q A;  2D9P A;  2ZBQ A;  1ZM4 A;  3M2U A;  3OXF A;  2JVO A;  3DLK A;  3R2D J;  1HKA A;  4OZN A;  2VFV A;  5KG4 A;  1RHM B;  4NI2 B;  5ETR A;  3MM7 A;  2QIF A;  5JJB A;  3US5 A;  3PW7 A;  2XHW A;  3A13 A;  4ETZ A;  3VQS A;  4QYR A;  5A8K B;  4OMF G;  2GZO A;  1SJ1 A;  3TX8 A;  4DI6 A;  2MQL A;  5A6W A;  4K59 A;  3HXM A;  3TYT A;  1FA0 A;  4JI2 J;  1P9Q C;  1U1Q A;  4NXN J;  3PRV A;  5GMK a;  1I5O B;  4TLR A;  3RBD A;  1Y5I B;  3M1V B;  3L9Z A;  3TO8 A;  2VDH A;  4DMZ A;  1U6B A;  4E2F B;  1DQ9 A;  1MW7 A;  2CPY A;  3V6H A;  5A8K A;  3HMJ G;  1NK4 A;  4HT5 A;  4DR4 F;  4M5N A;  2DD8 S;  5ETV A;  3SDE B;  3CIM A;  3G6Y A;  2NUH A;  2FB0 A;  2KFY A;  3K17 A;  4GTW A;  3EZO A;  1FDD A;  1I94 J;  4OYZ A;  4ZIW A;  3N6M A;  1FVQ A;  2BW2 A;  1VRQ C;  3GFZ A;  4B9M A;  3ZFV A;  2V50 A;  4V19 J;  4EEY A;  2GML A;  5FJ4 A;  1VIX A;  2YBV A;  4WFZ A;  4W98 A;  2EXU A;  4ZN3 A;  3DXS X;  3JTN A;  1SKR A;  3HLU A;  3JTP A;  2GO9 A;  2F9J A;  4X4O A;  3NMA A;  2VC1 A;  4DUZ J;  1X9S A;  4LF5 J;  1WC6 A;  4LFA F;  4DQS A;  1J2V A;  5FDL A;  3JTO A;  2VOP A;  5FD1 A;  3UR0 A;  3FGV A;  4FF3 A;  1DTQ A;  1U8S A;  4RLE A;  2QA4 S;  3SBM A;  2Y9H A;  2BJ9 A;  5J2P B;  5J2Q A;  4I67 A;  2IUC A;  1DAR A;  3Q8U A;  3OVB A;  3K7R A;  1PAE X;  1WG4 A;  2I38 A;  5GAH I;  3HKW A;  1F9E B;  2OD6 A;  1RU1 A;  5E0O A;  4CLW A;  4K4T A;  1RAJ A;  4UOG A;  4NLV A;  4DL0 C;  1AZS A;  2L9D A;  3OTC A;  3W60 A;  2MJU A;  4HKQ A;  2MQ8 A;  1UA0 A;  3CNQ P;  3FBE A;  4J9N A;  2CDQ A;  1H2V Z;  4LFC F;  4QU6 A;  2DNH A;  3H0P A;  2LYV A;  3BO3 A;  2JWN A;  1D8Y A;  4PQA A;  1QM9 A;  1FDN A;  1KHK A;  1WHV A;  2W24 A;  3EJM A;  2IVF B;  3WAV A;  1X4E A;  3PYG A;  4N47 A;  1EB0 A;  2FLN A;  2H5E A;  2E29 A;  3Q3Q A;  3NWG A;  1VR6 A;  2PEH A;  4I0W A;  3GPA A;  1BGX T;  2ZD1 B;  1N36 J;  1YJV A;  3OR2 B;  1KLM B;  2XUL A;  2Z4P A;  2ZUG A;  1DHM A;  3DDN A;  1Q82 T;  2XMU A;  4WFY A;  2VG5 B;  1H3D A;  3C46 A;  3BBF A;  1HBU A;  1M1K T;  5KFZ A;  3IRW P;  1X9W A;  2QC3 A;  4CCH A;  2RJZ A;  1UVK A;  2YPZ A;  4O3Q A;  2GIQ A;  5M2U A;  1T9T A;  3LQV A;  1RTI A;  2HWI A;  4ZIT A;  1VJQ A;  1WEY A;  4ZG6 A;  2HK2 A;  4DCP B;  1ZTT A;  4E98 A;  2OPP A;  3KK2 A;  2QG9 B;  3DCA A;  2D74 B;  1WJ9 A;  4WYW A;  4P2S A;  2N3O A;  2XZT B;  3QRP A;  4DR2 F;  3ULH A;  5B0D A;  1QJH A;  1IUJ A;  1QAX A;  4M5G A;  4ILM A;  3U1L A;  1RWU A;  2PSZ A;  4JB8 B;  3RW6 A;  1LWC A;  4USJ C;  1S1X B;  1TK5 A;  3ITH A;  2HQG A;  3HD1 A;  2POK A;  1QLN A;  2HLT A;  1VRU B;  2BE2 B;  3GIR A;  3TX0 A;  3UW1 A;  4C8K A;  4ZJQ A;  4X4S A;  4DR3 J;  2PDA A;  3IWX A;  4O3O A;  5J2N A;  2XBP A;  3AXM A;  3MEC A;  3Q24 A;  1REV B;  2ZOM A;  5L38 A;  5GRR A;  3SCJ E;  4DPY A;  1GTH A;  2CNL B;  5L1K A;  1KKH A;  2XR9 A;  3BKF A;  4PXB A;  3GG0 A;  3IDD A;  2BQU A;  4CYU A;  3BQ2 A;  1TMM A;  4TLQ A;  3OQ2 A;  4ICL A;  4NCA A;  3DM2 A;  4ZVF A;  4RUC A;  4Y34 A;  1S9E A;  1JLG A;  3MK1 A;  1TKZ B;  5I3U B;  1K0V A;  3OHB A;  3WAY A;  1WF0 A;  1UET A;  2QYC A;  1S12 A;  5HLF B;  5F3T A;  3A52 A;  2HUR A;  3K59 A;  1RAA B;  2K1R A;  5B0E A;  2HVE A;  3MAA B;  5J1E B;  3BKT A;  3MHY A;  1GH8 A;  1Q79 A;  3JSM A;  3BGO P;  2XTJ P;  1PIE A;  4DF4 A;  2W4C A;  1YJN S;  3IG1 B;  4GC6 A;  2UXC J;  1HPZ B;  1Y00 A;  4RNH A;  3K8W A;  1N2L A;  4CO4 A;  2HHU A;  5AE2 A;  2FC9 A;  1DQ8 A;  1IN0 A;  3QT5 A;  3ZTQ A;  3BQ0 A;  4K4Y A;  1IBL F;  4B3T J;  3DHX A;  5HLF A;  2PMZ D;  1U26 A;  3V6D A;  2MLX A;  1N5T A;  2NR0 A;  3GII A;  4K4U A;  1KS2 A;  4HR2 A;  2BE7 D;  2QLF B;  4HTJ A;  5KFC A;  4F0K A;  1CUL B;  4KHP J;  2PII A;  2C2K B;  3GZ7 A;  5F8I A;  4NRU A;  1JLB B;  3M05 A;  2J9E A;  4H4K C;  2UP1 A;  4ATN A;  3JXO A;  1J27 A;  3GU0 A;  3N5B A;  2HFO A;  3B54 A;  4PWD A;  3E8O A;  2ZNY A;  2NYI A;  2R7Q A;  4EU0 A;  4X4P A;  5IOL A;  5IT4 A;  2V2V A;  3R1L A;  1SQE A;  3T9N A;  5MLC V;  4MY4 A;  5J2M B;  3DYC A;  3R5J B;  4WE1 A;  1RAH B;  1CS4 A;  3LWL A;  2B9W A;  1HQE B;  4P2F A;  1PYT A;  4A8W A;  4ILL A;  4WP3 A;  1WF2 A;  2EKN A;  3MPV A;  2WOM A;  2ZBC A;  3OTB A;  3V6K A;  2RS8 A;  1VQL S;  3KLI B;  5U47 A;  2DNL A;  4U7U D;  2CDR B;  1YRU A;  1PYS B;  3N28 A;  1VQM S;  2RAQ A;  4FN5 A;  2MST A;  2ZH9 A;  5J2M A;  5CQG A;  5DJB A;  1RAC B;  1CJT A;  2YKA A;  4B3R F;  3P5B P;  1XMO F;  2MZT A;  2EEY A;  1ULR A;  2DKO B;  3ET6 B;  2OPQ B;  3N6N A;  2AGP A;  4AXJ A;  3DDK A;  4QR2 A;  2OUG A;  5ETK A;  4WWS A;  2RF2 B;  4LF4 F;  3CD7 A;  1HWU A;  2XMV A;  4P9S A;  3SQG A;  4A8F A;  3SXL A;  3I4P A;  4AT1 B;  2DR6 A;  3RJM B;  1EI6 A;  1S6P B;  1RT4 B;  1XR7 A;  2OHD A;  4RW9 A;  3D66 A;  4Q2L A;  3TJ9 A;  1Q95 G;  2XNR A;  3P96 A;  1F9F A;  4KQZ A;  2FTR A;  4DV3 J;  1B64 A;  1AFI A;  3OV7 A;  4M95 A;  1X4F A;  2BEF A;  3MMB A;  1T9Y A;  2QT7 A;  2GVZ A;  5L0K A;  3PW5 A;  2GAG C;  4YFU A;  4QIV A;  1VBK A;  2XHC A;  4FS2 A;  5KFU A;  4ITS A;  2PI5 A;  1VMB A;  2LU1 A;  5EDW A;  3O5T B;  2B0G A;  2JJ4 D;  4F7V A;  3D0H E;  2DNP A;  1MML A;  4A46 A;  1S6P A;  1UVM A;  1HNV A;  1FES A;  1EQ0 A;  4I1T A;  2MYF A;  3Q8R B;  2JC1 A;  1KFD A;  1M5H A;  3RZA A;  4QIF A;  2JC0 A;  3HHE A;  4KO0 A;  2JH3 A;  3DLL Q;  1R3N A;  4DX8 H;  2XM3 A;  4KB7 A;  4IUF A;  2DO0 A;  1T3N A;  1VIO A;  5EN1 A;  2VFU A;  1N32 F;  3W1Y C;  4QWC A;  2OO4 A;  2RQ4 A;  4P71 A;  2A2D A;  1OMS A;  3AQO A;  2HBZ B;  1Y4Z B;  4OHY A;  2IJF A;  3ENA A;  2NRE A;  2LDY A;  1PJ7 A;  2DIS A;  2ASD A;  1TKX B;  1UTA A;  1IM6 A;  4ZVT B;  2GMH A;  3BDH A;  4DBQ A;  3OR1 B;  4UOC A;  1FTR A;  5EX3 A;  2AYB A;  2H4Y B;  2W5R A;  1S0N A;  3U1N A;  2D69 A;  2X1B A;  2JX2 A;  2J7U A;  1S0O A;  4B9T A;  3VAH A;  5KG1 A;  2ALZ A;  4USU A;  1HW9 A;  2JVR A;  4CXU A;  3KHL A;  1LWF B;  2FVC A;  4V1A k;  2DGV A;  2BOP A;  1TKX A;  2BYC A;  2IRY A;  1L3K A;  2J0X A;  1WHX A;  1SC6 A;  1AJB A;  1Q16 B;  3MMJ A;  2HVD A;  3R27 A;  9RUB A;  2AF6 A;  2HNZ B;  4P72 A;  5KFT A;  4WFN Q;  2C3P A;  3W9H A;  2W8L A;  4Y0F A;  3R1H A;  3W2W B;  1HNX J;  1E1Z P;  2H48 B;  3NAI A;  4HAC B;  2R7V A;  2ZHA A;  2ZOG A;  3GFY A;  2ZH6 A;  1S49 A;  4JI8 J;  4LF6 F;  3DRP B;  4CLP A;  2G9Y A;  3RB6 A;  2IJN A;  3KHH A;  2GIR A;  1TUW A;  2JEG A;  1N0U A;  2BJ7 A;  2HNZ A;  1HDH A;  1KTQ A;  2L9W A;  4CYS A;  4DV0 J;  3RG6 A;  1W25 A;  3FZ2 A;  3H4B A;  3PRD A;  2BVZ A;  2UUA J;  4M8L A;  5HP1 B;  4L3N A;  2YKM A;  4ECS A;  4NYO A;  2MMY A;  3Q22 A;  1X5O A;  4X4T A;  1CLF A;  3NXZ A;  3T5L A;  2CFX A;  1LXJ A;  2ZM6 F;  3TW0 A;  2RU3 A;  1NH8 A;  2VHG A;  4DF8 A;  2JHE A;  2VQE F;  1U1O A;  3PY8 A;  3NRB A;  1Y5L B;  4LIW A;  3PIO Q;  2XWY A;  1K1S A;  4YME A;  1YBU A;  1FE4 A;  5KT2 A;  4WK3 A;  4GKK J;  1V3S A;  2BAN A;  5ETQ A;  2ZC4 A;  3DHW C;  4OHX A;  4HL9 A;  5KFG A;  3H59 A;  3QNW B;  2FHO B;  3UI3 A;  2E5J A;  3C8Y A;  1IR0 A;  5HAO A;  3QMQ A;  3H5U A;  3W2V B;  4RL1 A;  3W66 A;  3OSP A;  1NDP A;  2ZHO A;  4UPI A;  4OX9 J;  3R5C A;  3WBZ A;  4F67 A;  2E1P A;  4NLR A;  1R6Y A;  5LJ5 Y;  1YJW S;  3CUN A;  4YEA A;  1B0V A;  1RAI B;  4RW4 A;  2LP4 A;  2B7C B;  2LFV A;  1RTD A;  3IS9 B;  1FHT A;  4TU8 A;  1HBN A;  3PTW A;  3V4I A;  3BKU A;  3ZNU A;  5G0R B;  2UVW A;  1IJE B;  1EAY C;  3G9C A;  4NLD A;  3UDL A;  3QFH A;  4B3M J;  1IKW B;  1KH7 A;  3O3L A;  2D1C A;  1BXN A;  1NRK A;  2I5J A;  2BMB A;  5CZV A;  5LXY A;  3PEJ A;  1MSW D;  3HVT A;  3HHN B;  1VHI A;  1ZAV A;  2K3I A;  2A10 A;  4QAX A;  2C2M B;  3QSY B;  4KHR A;  4R8U B;  3VGS A;  2NSB A;  1EP4 B;  2XGQ A;  2XSF A;  3M9O B;  2KT3 A;  3BO2 A;  4RNF A;  4L76 A;  2X1F A;  3TJ8 A;  1N6Q B;  4WFX A;  5CYJ A;  2DNR A;  1C1B B;  4GKJ J;  1AA1 B;  4ID5 A;  4A8K A;  1JJC B;  2CPE A;  3M30 A;  2BKP A;  2A1B A;  5B0C A;  4HYK A;  1JLC A;  1AW0 A;  8ATC B;  3CC2 S;  1RWM B;  4MJK A;  4M5L A;  5CYQ A;  2KZM A;  2OGU A;  1RCO B;  2JLE A;  3NEK A;  1TQL A;  2J7K A;  1F0X A;  4F0H A;  3NKN A;  3V81 A;  3I31 A;  4AND A;  1R0A A;  3A1Y G;  5I42 B;  1BE4 A;  2CJQ A;  1C1B A;  3HHK A;  4NA1 A;  1L5U A;  1HNZ F;  3AOC A;  1FJC A;  3HP6 A;  2B9X A;  3E01 A;  3BGU A;  2NSC A;  4CP5 A;  1LW0 A;  3GCX P;  5LRN A;  4P73 A;  2AQ4 A;  2W5X A;  3F56 A;  1Q5Y A;  1F5C A;  5A76 A;  4KPC A;  3NNC A;  1NK0 A;  5ETM A;  1HI0 P;  2M9K A;  4X65 J;  3TZZ A;  3C6U B;  2VUG A;  2O1P A;  4ZLL A;  2RU9 A;  3MM5 A;  3IC1 A;  2C3O A;  2CZ4 A;  2IFY A;  1W7W A;  3T6J A;  3NP5 A;  2R7S A;  4HVZ A;  4F2S A;  1D0E A;  4EK2 A;  3DLB A;  2EK1 A;  2GGP B;  4CNZ A;  3MCS A;  3GQC A;  3SCK E;  1I6J A;  2D9O A;  2K7J A;  1T11 A;  3R6G B;  1WTB A;  1GNK A;  2OTL S;  3L09 A;  2VG6 B;  2W9B B;  5KT7 A;  4J9Q A;  2PEB A;  3F73 A;  3LO3 A;  3SSS A;  4Y6I A;  1Y11 A;  3RB4 A;  2AJ2 A;  3MR6 A;  3LA0 A;  3QWU A;  3LPY A;  2G2Z A;  2KVI A;  3DMJ B;  2GGP A;  2U2F A;  4FYY B;  4YB7 A;  4H4M A;  3M8Q B;  3K58 A;  3QAE A;  5ETS A;  2ASY A;  4YB6 A;  2C2O B;  4EBE A;  1TFY A;  4PPZ A;  2MLZ A;  5ETL A;  1RWP B;  5KT5 A;  1FRJ A;  4CO0 A;  3R7N B;  3QT7 A;  3HSD A;  1SIW B;  1N34 J;  2I2Y A;  1ANI A;  3A8I A;  1YIT S;  3VZH A;  4DSL A;  4IOA Q;  2D7S A;  2VPW B;  1RHK B;  2X1G A;  1BLU A;  2CPX A;  4P10 A;  1M5O C;  2HFV A;  1LW2 B;  3FSI A;  1LWX A;  1NCL A;  4WPA A;  4UOO A;  4C8M A;  5BR8 F;  5IV4 A;  3IFE A;  2AKW B;  1FTC A;  1XK8 A;  2ANH A;  2W5S A;  4LRF A;  4DDF A;  5IT0 A;  4KGZ B;  4YOE A;  1XMB A;  5H1S V;  4TYA A;  1RT7 B;  3MDF A;  5LT5 A;  3T1H J;  2LMI A;  3IBC B;  2BJE A;  4KAV A;  3TUI C;  2AEJ A;  4QR1 A;  2DHA A;  3NOG A;  3HHL A;  1JXL A;  3KLE A;  2DB1 A;  1UL3 A;  1OSC A;  2F8H A;  3CJS A;  2ZH8 A;  5HBM B;  3V6J A;  2XLK A;  3I87 A;  1WSV A;  1VLO A;  5FII A;  4CYR A;  3JQJ A;  5H9F J;  2VV5 A;  2XMJ A;  5GMD A;  3QGI A;  3H98 A;  4KJD A;  1LQ9 A;  1Z2Z A;  5D4O A;  3NS6 A;  1Y10 A;  1WEL A;  1RT7 A;  3T1Y F;  2GAH C;  2HS4 A;  2DVI A;  3SZZ A;  4J9S A;  4KTQ A;  3OTO J;  2F4V J;  3FBF A;  3MCN A;  2R7X A;  4CLT A;  2PO4 A;  2M8D B;  2E9T A;  4ZLJ A;  4ZP6 A;  4DSF A;  5HBM A;  1OY9 A;  1TL1 A;  4WFB Q;  1N52 B;  1KHJ A;  4DV2 J;  1P1L A;  1JNZ B;  3D3C J;  3IM9 A;  4ZCL A;  2B8Q A;  5IJS A;  2LCW A;  1M5V C;  4ECU A;  2RQM A;  2QL9 B;  1JXE A;  2XEX A;  3J7Y U;  3LP1 B;  2G4B A;  1UVJ A;  1AB8 A;  1KSP A;  3MUM P;  4A8M P;  4KJI A;  2FIU A;  3QFW A;  2VDI A;  1OY8 A;  1T03 A;  1A0O B;  5K8M A;  2QYG A;  3KUH A;  3S1T A;  1UMJ A;  4UOF A;  3ENW A;  3PYD A;  2HS0 A;  1GQE A;  1KOO A;  5L9N A;  2M0G B;  3KG4 A;  2ZH4 A;  3FZB A;  2NXC A;  2Y0S D;  2XLJ A;  1MMD A;  1ED9 A;  4Y2A A;  4AD6 A;  1VJW A;  3IRX B;  3EVO A;  4ZHR B;  2KHD A;  2P5V A;  4IR1 A;  3I82 A;  4L75 A;  1ZPW X;  2HKE A;  1U48 A;  5HRO A;  4XTT A;  4Q44 A;  5INH A;  1FNM A;  4R0J A;  1H6K X;  1X5S A;  4DV4 J;  4UQT A;  4P75 A;  1VRT B;  4ILR A;  5IQQ A;  1M5S A;  3GV7 B;  2J6T A;  1U0S A;  1KLN A;  1RBO B;  3VQT A;  2WVF A;  4CRJ A;  2MZQ A;  3KDN A;  1IBC B;  4UF4 A;  3KHG A;  2W2Q P;  3K5P A;  2QLB B;  3NMR A;  2CVE A;  1S77 D;  4NLY A;  2RML A;  3MM8 B;  4LF7 J;  4DR3 F;  3RR7 A;  3H5X A;  4Y2C A;  1MRO B;  3KG0 A;  2HZC A;  2GVD B;  2E44 A;  2EFQ A;  5KFO A;  3PX6 A;  3I0R A;  1K8A T;  1JLQ A;  1RYS A;  3ZTS A;  3RTV A;  1J5O A;  3MMA B;  5DLW A;  1NK5 A;  2C28 A;  2N3L A;  1IQZ A;  2KM8 C;  5LIA A;  2E5L J;  4IYQ A;  2KKH A;  3G71 S;  2C2D A;  5M2R A;  3PFE A;  2MKJ A;  4XK8 C;  4O4G A;  1TAU A;  3W5Y A;  3VGV A;  2MPU A;  1HYS B;  2W25 A;  1RAF B;  3PFO A;  3CMA S;  1NSP A;  5L1J A;  4KFB A;  2HHH F;  4ELV A;  4BWJ A;  3CJ5 A;  5C24 A;  1S7H A;  1X4B A;  3TAP A;  1UJ5 A;  4ZVG A;  3EWG A;  4LSN B;  3EVM A;  4RWX A;  1YRX A;  2ZHB A;  4QJV A;  2HHQ A;  3MMC B;  1RGV A;  5HVG A;  2HK3 A;  3H90 A;  3IO1 A;  4NYP A;  3R9L A;  1UZH A;  2VQF J;  1FXL A;  1TVR B;  4IFY B;  2BJD A;  2X51 A;  1FDB A;  1EAR A;  1NND A;  4CXK A;  4IKA A;  4PAB A;  1RT3 A;  2V34 A;  5CCM A;  2X1A A;  1HQA A;  4WFA Q;  2W9A A;  3I56 S;  2N7C A;  2G2O A;  4EWT A;  4IDK B;  3MMC A;  1XNQ F;  3CJK A;  4JI7 J;  2FGO A;  2HGM A;  1FEE A;  4CNY A;  4UPK A;  3Q2S C;  3KJQ B;  3KLF A;  5EGE A;  4OX7 A;  1TEL A;  2Z57 B;  3PV8 A;  1YX2 A;  5D3G B;  1T05 A;  3J7A 1;  4I2Q B;  4NCB A;  3KJV B;  3UCG A;  1PYO B;  4HHU A;  1CJV A;  1VQY A;  1WEZ A;  3GSD A;  1S48 A;  2ZJP Q;  4ED5 A;  2B9Y A;  4DSK A;  1NK7 A;  2ZH5 A;  2HFZ A;  1X7V A;  3WDO A;  5IM0 B;  1S59 A;  2NXE A;  3RGI A;  2RKI B;  3DNC A;  3PW0 A;  3T00 A;  2QGF B;  4NCG B;  1VS3 A;  1SXL A;  1AT1 B;  2BBE A;  3DOL B;  2F8E X;  2XGP A;  4RKU C;  5ETN A;  3FBB A;  4ZCK A;  2MKS A;  1HL6 A;  3OPK A;  4MKV A;  2LXU A;  2MKK A;  1OQ3 A;  1M1G A;  3M6U A;  1EZZ B;  4TU7 A;  3KHR A;  1ZTW A;  3NCR A;  2KJW A;  5MAO A;  4EI2 A;  1FO1 A;  3I0S A;  1RA7 A;  4UTG A;  2DNN A;  1R8H A;  1RHJ B;  1SH2 A;  4DL4 A;  2YKP A;  3NG8 A;  3OXG A;  5HVF A;  1VDH A;  2VIH A;  2DY1 A;  2Y3Y A;  3CJ4 A;  3I9Z A;  2LQ5 A;  3DC2 A;  2R9L A;  1HWK A;  2WSE C;  3MWB A;  3HK2 A;  5F0U A;  3HSG A;  2VKR A;  1UVN A;  3D68 A;  2PI4 A;  1U02 A;  1L3S A;  3CCV S;  4IRK A;  1Q81 T;  2DJW A;  2QJ3 A;  1SC3 B;  1D09 B;  2QMW A;  4C11 B;  2R8J A;  2UV8 G;  2C3Y A;  4ZK7 M;  3EYZ A;  1B3T A;  1EET A;  2VOD A;  2LU2 A;  3LAM A;  4C8N A;  4OJ1 A;  1VGY A;  1V3R A;  2WVC A;  2E1R A;  3Q89 A;  1EW9 A;  4PCQ A;  4DV5 F;  1B7F A;  5IT9 U;  3SI8 A;  3KTQ A;  2M88 A;  5SZT A;  1HJK A;  2KVQ E;  1XC9 A;  1UPP A;  5KOW A;  2B4V A;  4DUY J;  2XQC A;  4HEA 9;  1HBM A;  1QSL A;  1DLO B;  3BDG A;  1TKT A;  1IKX B;  5DET A;  4A8O A;  3M6X A;  4JV0 A;  2GSU A;  4O4R A;  4Y2M A;  2B9E A;  3C15 A;  4RUA A;  2B4U A;  1QVG R;  2H3E B;  2HBQ B;  3G6V A;  2BX6 A;  2NXU A;  3DOM A;  3DLJ A;  4I6A A;  3IBW A;  3FC9 A;  2FJW A;  2UU9 F;  2HYI B;  4RW7 B;  2AYE A;  1TL3 B;  1WKL A;  4KV8 A;  3HD2 A;  2VJV A;  1ZBT A;  2HG4 A;  3N01 A;  4I6W A;  4B3S J;  2QX0 A;  5HAN A;  4OYI A;  5KXA A;  4KKO A;  3CMR A;  2QV6 A;  1GK8 A;  1NJI T;  5IFM A;  4FYV B;  1S6Q A;  3H5Y A;  4Y2K A;  5C25 B;  4M5H A;  3M6V A;  3KNA A;  3OT9 A;  2MEW A;  2ZH2 A;  2IDL A;  2XMM A;  4L72 B;  2ZE2 B;  3X3U A;  4CH7 A;  3M32 A;  1F6T A;  4IG0 A;  4CLF A;  1RBL A;  3AT1 B;  4CO3 A;  4DFK A;  2RH6 A;  3VF0 B;  1WDT A;  2W5Q A;  4BHQ A;  4DR1 J;  5ETP A;  2CQ4 A;  4C8L A;  3CJ0 A;  5GVQ A;  4N41 A;  4X4V A;  1J5E J;  5C25 A;  3CC4 S;  4W90 B;  3K5O A;  4Y2I A;  2HHP A;  3D67 A;  5DDP C;  2BQ3 A;  3THV A;  3H42 A;  2ZE2 A;  3W8P A;  3POT A;  1X4A A;  2Y1L B;  4KBI A;  4EYI B;  2WW8 A;  5HVH A;  2O01 C;  1RBA A;  5A0Y B;  3UN5 A;  2QSW A;  4DR5 J;  3MPD A;  1SBR A;  4C3M A;  2VIC A;  3LXQ A;  4Q45 A;  4RZR A;  4DV0 F;  4OYX A;  2LXI A;  5HJY A;  2VBX A;  3KUG A;  3D3B J;  3JSR A;  4OJH A;  4ELT A;  2DIV A;  2EC2 A;  1BWV A;  3D7S B;  2PN6 A;  3BGL A;  1V3Z A;  3HUL A;  3W9I A;  1EQJ A;  2F40 A;  1GMV A;  4W92 B;  2OPS B;  3KG1 A;  3IAS 9;  2HVI A;  2XCP A;  3BYP A;  2PFD A;  3HVW A;  3GIJ A;  1MWQ A;  4HT7 A;  1EJJ A;  1VQO S;  1IKY A;  2UXD J;  3F41 A;  3GV5 B;  1UFL A;  5E7O B;  5KFN A;  4HI1 A;  2KYZ A;  1OY6 A;  2HHW A;  4BDP A;  1GTE A;  2MQM A;  1GT8 A;  3MGJ A;  4C48 A;  1NSQ A;  1WEX A;  3U7J A;  3LUY A;  1WDD A;  4NLT A;  2RVJ A;  3DRR A;  4OYA A;  1EJ7 L;  3C16 A;  3SCL E;  5EGH A;  3A8J A;  1V9O A;  1WC4 A;  1H38 A;  4J9V A;  3MFI A;  1PAU B;  4ANC A;  2AEM A;  2GLQ A;  3OL7 A;  1RTJ B;  5L46 A;  4QYZ K;  1FX2 A;  1NJW A;  4QWB A;  4CI0 B;  4YN3 B;  2RS2 A;  2ADB A;  1C2P A;  4IR9 A;  3ZZT A;  1SKU B;  1Q7Y T;  2XB2 D;  1BQN A;  4BC9 A;  4NWX A;  3BBB A;  1IBM J;  2KG0 A;  3X1L B;  2CQH A;  2GA3 A;  1XJW B;  2KM8 B;  2KRR A;  3CJ8 A;  1NSA A;  5B7W A;  1X8D A;  2LQJ A;  4CTA B;  2W2M P;  3EE3 A;  3JQK A;  4B3M F;  2CPJ A;  1XWL A;  4A47 A;  2W8S A;  4UPL A;  4A4J A;  2YPY A;  3F44 A;  4B3O A;  1KHN A;  2OEL A;  4LSL B;  1A6L A;  4NZ6 A;  3MCO A;  1HI1 A;  4WXO A;  3H8Y A;  3BGR A;  2Y1J A;  1HR0 F;  2B6A B;  5C42 B;  4DG1 A;  2QLW A;  2MGZ A;  1KNZ A;  2R7T A;  3LP0 B;  2KXF A;  3M9M B;  5A2Q U;  2B7B B;  3OFF A;  4AL5 A;  1U0H B;  1SUQ B;  1WUU A;  1URR A;  1HHQ A;  3U02 A;  3FMW A;  4NLP A;  4L74 A;  4GKJ F;  4TQR A;  3TAN A;  3GYN A;  2CVI A;  4UW2 A;  2FY1 A;  2AV5 A;  2O67 A;  2Z2L A;  1ITP A;  3CDB A;  5DG9 A;  5F8M A;  2KT2 A;  4J9R A;  1ZM2 A;  1I51 B;  2HRY A;  2IM1 A;  2JEI A;  2R8H A;  3UDC A;  3LP0 A;  1N5V A;  4DPT A;  1SUQ A;  4U8Y A;  1N33 F;  1UZD A;  2R8K A;  4X64 J;  2BV3 A;  4EGL A;  4MKY A;  4JV1 A;  1RP5 A;  2KL8 A;  4P52 A;  2FD2 A;  5LSO A;  2V94 A;  1NUE A;  2GA7 A;  1U8W A;  3AD8 C;  1ZPV A;  1FKO B;  1YBT A;  3G87 A;  4OJ3 A;  5BYR A;  2E5H A;  2CNK B;  3ISZ A;  1K47 A;  2VU5 A;  4HH1 A;  3SSR A;  3GJT B;  4C8O A;  3MF5 A;  2IRX A;  1HHT P;  2PA8 D;  2V6A A;  4ZVS B;  2M70 A;  2IYI A;  2W7A A;  4X65 F;  2CJB A;  5C7P A;  3CCJ S;  2BZ2 A;  4QYZ J;  3QJL A;  4DV1 F;  3VGU A;  2LEA A;  2MB0 B;  2GSO A;  3BDF A;  2Q1L A;  1SHN A;  4QU7 A;  2E66 A;  2DCU B;  2IHR 1;  1RDR A;  3FFI B;  3DFE A;  4O23 A;  2UUC F;  2MZS A;  2ATL A;  5K14 B;  4OZ3 A;  4L6V 3;  2KXN B;  2DEI A;  1K44 A;  4UOP A;  4WF9 Q;  1NU4 A;  1VQP S;  4OYM A;  2MJN A;  3BPS P;  4JI5 J;  3GR1 A;  2Y8Y A;  1URN A;  2HHV A;  2YNG B;  3CCU S;  4DV6 J;  2R8I A;  2EFO A;  3ISN C;  2W7P A;  2X3D A;  5F8H A;  3CJQ A;  2MQP A;  4CLK A;  1RT1 B;  4USV A;  4M5D A;  2IC3 B;  1LEO A;  4C8Y A;  4O44 B;  3HCX A;  2IM0 A;  3QIP B;  5KFJ A;  4ELU A;  1N5S A;  3SCI E;  3R6L B;  3DU5 A;  3HFZ B;  2CQ0 A;  1SVD A;  2XSJ B;  2B56 A;  4ZJO A;  5E41 A;  1NHK L;  1N34 F;  1TV6 B;  2V4J A;  1TUG B;  1RWW B;  2FVQ A;  4F04 B;  4CO2 A;  3CCQ S;  5K9F A;  4QOT A;  4YQW A;  2JSX A;  1VC6 A;  1RT1 A;  4KGK A;  2HAI A;  3DLH A;  4F4W A;  1JMT A;  1VYA A;  4U67 Q;  1S1U A;  5D4N A;  3TAQ A;  3FEX B;  3WIV A;  1F1B B;  3DI6 A;  4PAA A;  3KKF A;  3F0N A;  4LVN P;  2AJ0 A;  1F60 B;  1GMW D;  2BM1 A;  2DTJ A;  4IH5 A;  3PRB A;  4MAK A;  2XI3 A;  1ICE B;  2BXJ A;  4EBD A;  1SJF A;  4CDI A;  4IO1 A;  5K8N A;  4GC7 A;  3TQ1 A;  1UEK A;  3DOK A;  4USI A;  2CAD A;  3LP2 B;  3MPY A;  1JKH A;  3D5M A;  3PX0 A;  4DR7 F;  3Q8Y A;  4F3Q A;  1RB0 A;  2WCX A;  4KSE B;  4TN2 A;  4BBY A;  1E6Y B;  4LFB J;  1T9V A;  2LQ8 A;  1KEK A;  1GX6 A;  1ZZF A;  2IRU A;  3HHD A;  3CMQ A;  4X62 F;  3BPD A;  1QE1 A;  4DL3 A;  2G0J A;  3FCV A;  3K8V A;  4LQY A;  5T7L B;  3NGD A;  4C0B A;  2BM0 A;  1Y9O A;  2WB1 D;  3OTO F;  1X5T A;  2VG7 B;  2RQC A;  4RW6 B;  4RNO A;  4H54 A;  3I9V 9;  2HFU A;  2ZC3 A;  4I7F B;  3I5C A;  4C4W A;  1G2E A;  2X7I A;  3KLG A;  1VLY A;  1WOS A;  3D1H A;  2RD5 C;  4PG4 A;  2MDA A;  4ZOS A;  3IGN A;  4ZG9 A;  4C0H A;  1O51 A;  3RYL A;  1RQ0 A;  2I8E A;  1EHW A;  1P1T A;  1HWJ A;  3FSX A;  2LEP A;  1SC1 B;  3PDN A;  1YSJ A;  4KYZ A;  1S5Z A;  1ALI A;  2YKN B;  3VHQ A;  2ZKU A;  2ZBP A;  1KVI A;  2H4W B;  1GXU A;  4DN9 A;  4Q8F A;  2FPH X;  4OI0 A;  4MIB A;  2KXH A;  1LXN A;  4F4Z A;  3KK3 A;  2EK6 A;  4RUH A;  2HIQ A;  1S1T B;  2MZR A;  4CXS A;  2M5Y A;  3PKM A;  1E33 P;  1F2H A;  4DS5 A;  3OVS A;  2WAQ D;  3JQM A;  1FJG J;  2K3K A;  4GVB A;  2JRS A;  1I1G A;  3Q8S B;  2AGO A;  2P6S A;  4DX6 A;  2JFK A;  1IBK J;  1RT5 A;  2IY5 B;  3DYA A;  4DV4 F;  3EGZ A;  2CQC A;  3DLG B;  5F8N A;  1Q8L A;  1S4F A;  5EX0 A;  4F4A A;  1SL0 A;  4NAS A;  4K0K F;  5DQI A;  2HQD A;  2P9C A;  3UFC X;  2XY7 A;  4LR7 A;  2W5V A;  1YVF A;  1XNR J;  4DR6 F;  1S1V B;  4LF7 F;  3RBX A;  3P45 B;  3PJ9 A;  2ZKT A;  1APS A;  2VFR A;  4KE5 A;  1HNI A;  1U2C A;  2ZIT A;  3R97 A;  3DLG A;  2WSF C;  2R7W A;  2KJV A;  5I3P A;  4F3M A;  2HHT A;  3GB0 A;  3QJJ A;  6FDR A;  3C2P A;  1JLE A;  1YZ7 A;  3C19 A;  4Y3C A;  3IR7 B;  4LF9 F;  2V8G A;  1VQ4 S;  3M2R B;  1C0U A;  4LRE A;  5AJ3 J;  2A0F B;  1EKR A;  1SJR A;  3K5L A;  3BYR A;  9ATC B;  3TRG A;  1TL7 B;  4FKY A;  1WC3 A;  1P8G A;  3RR8 A;  1N2K A;  3M2U B;  1RUS A;  2ROP A;  3EGW B;  1QSS A;  3OW2 R;  1FCA A;  3DLK B;  5LL6 d;  2NZC A;  3A3N B;  2HAF A;  3NNH A;  1Q8I A;  1JJH A;  2LVW A;  4WP9 A;  1KQS R;  3JSB A;  5KFW A;  4N8N A;  2QMU B;  5IWA F;  4ZCM A;  1KH9 A;  5CH7 B;  3H5S A;  1DTT A;  2HNY A;  3I32 A;  2D1G A;  2AD9 A;  3I4H X;  1L3T A;  4CH1 A;  2VQF F;  4DCO B;  5FLX U;  3TEG A;  3KK1 A;  4N8O A;  3KNG A;  4HLB A;  4RBV A;  4J37 A;  2N4D A;  5KOX A;  5FLX Y;  1S7I A;  2UZA A;  3TJA A;  5DZ7 A;  4ANE A;  2GJF A;  4P7V A;  4JV5 F;  4ZVE A;  5AXK A;  4DR4 J;  4NML A;  3KUE A;  1T94 A;  2KFN A;  1Q53 A;  2NS1 B;  3B8H A;  5L8R C;  2IAJ A;  2HQF A;  1RWX B;  3HFK A;  2RH3 A;  4IH7 A;  5IC4 B;  1B4S A;  2JEJ A;  2GNK A;  3G82 A;  4DLE A;  3H20 A;  3CJR A;  3BO4 A;  3UQS A;  1C1C A;  3SEO A;  3IGV A;  2CQP A;  2F8M A;  3QO9 A;  2DGS A;  3MEG B;  5E2Q A;  1Y6V A;  2ERR A;  1VC5 A;  2CRL A;  2C2N A;  4WU3 A;  2FDN A;  4LFA J;  4FF4 A;  3OXL A;  3KJN B;  4Q43 A;  3D4J A;  1RLC L;  5FDL B;  1T02 A;  2J6S A;  4YB1 P;  3WQP A;  3GYX B;  5DZ6 A;  2DHH A;  1S0V A;  2J8A A;  3KXD A;  4ZA1 A;  1DTQ B;  4QPT A;  2WVB A;  2NYH A;  5D4P A;  4USK A;  5J2Q B;  2IUC B;  1Y7A A;  2Q6B A;  2DNY A;  3MEG A;  2QZU A;  3N4W A;  3GSI A;  4U7C A;  2YNF B;  2NXJ A;  1X5P A;  2V4Q A;  4DV7 J;  1BD6 A;  2GX8 A;  1WI8 A;  4C2M A;  1V5I B;  5J1N A;  1AZS B;  1ROF A;  2RUS A;  2ZFH A;  1R7I A;  2CWX A;  4J90 A;  1K7H A;  2CQD A;  5D0G A;  1U25 A;  3C14 A;  3EM1 A;  4LFC J;  1NDL A;  1T95 A;  2YNF A;  2YVS A;  5ITH A;  5BJR A;  4OYB A;  1H2T Z;  2RUG A;  2GQC A;  2HND A;  1NJZ A;  5CD4 A;  7AT1 B;  1XMQ F;  1O8B A;  3RB0 A;  1UVL A;  4KC5 A;  2CJA A;  1KHW A;  3KLH A;  5D6G A;  4PKD B;  1XBW A;  1KH4 A;  3DRS A;  5K4P A;  1VQ7 S;  3DGV A;  3MM9 A;  4OZ2 A;  2NPF A;  1G3O A;  2CQ3 A;  3E3X A;  1FI4 A;  1RKJ A;  2AP6 A;  3AOD A;  4KRW A;  1SJ4 P;  1RTH A;  1PC4 A;  1VHF A;  5IV3 A;  1HBU B;  2DEJ A;  1MNE A;  2BKO A;  1KHV A;  1S1W A;  1KQK A;  1NKE A;  1UCN A;  4YHH F;  2GJ2 A;  4JI6 F;  4ZGA A;  4ZPV R;  2XWX A;  4LQ3 A;  1CPZ A;  1G4C A;  4UOH A;  4JUZ A;  1RTI B;  5DDO C;  2W7O A;  1ZM3 A;  4FDI A;  2KI2 A;  3MTJ A;  5DRK A;  2I0X A;  1F9H A;  2OPP B;  2JDJ A;  3KK2 B;  4DR2 J;  1RZM A;  1T3O A;  3FRY A;  3GJR B;  3MPW A;  3UN2 A;  5GAE I;  3QQC D;  4PR6 A;  1OS5 A;  5DGB A;  1LWE A;  1A7G E;  2V2Q A;  2QMX A;  2DHX A;  1NLK L;  5GAH U;  3SMZ A;  1LWC B;  3SYZ A;  4CT9 A;  3ITH B;  1FEH A;  2ZVS A;  1D9D A;  5J1P A;  3G2X A;  4DFJ A;  5LMU F;  2D3Z A;  4JI1 F;  5HRT A;  3JYT A;  1S4E A;  3D1O A;  2MQO A;  3V2U C;  3R7B B;  5J2N B;  2I6W A;  1FD8 A;  1WG5 A;  3MEC B;  1IM4 A;  3HM9 A;  1WI6 A;  2RRB A;  3TAR A;  2B51 A;  3CCW A;  5HMX A;  2F4F A;  2A2C A;  4NLW A;  3G86 A;  3WZ0 A;  2DNM A;  3J81 U;  1HLW A;  1YDL A;  2CNN B;  2BR0 A;  2XI2 A;  3IBF B;  1IJF B;  4CYU B;  5EGY A;  1NBE B;  1RHQ B;  3MM6 A;  4QWA A;  4UPH A;  2VPY B;  3HFV A;  4ED7 A;  1B0T A;  4OYW A;  3J81 Y;  3HKZ D;  2LQB A;  4ICL B;  1U6F A;  3DM2 B;  3R5A A;  1S9E B;  2FZG B;  1JLG B;  1FWP A;  3CC7 S;  2ZJR Q;  1I3O B;  5KFD A;  4G1Q A;  2MHN A;  2B3T B;  4F02 A;  5HJX A;  4N7T A;  4LBP A;  2XC9 A;  2MKC A;  2CPZ A;  3TAM A;  2XCA A;  1BMQ B;  4DSI A;  3AJ1 A;  5KG0 A;  2UXD F;  1GAO A;  1HFE L;  2K1R B;  3ISN D;  2HIY A;  1IKV A;  3JSM B;  4ZVU B;  4ECV A;  2DNO A;  3NBP A;  4UST A;  5GAE U;  1YKW A;  4P2M A;  2DGQ A;  2ZH3 A;  3PXG a;  4IFV A;  1IBL J;  3CPW R;  4J9K A;  1ZAX A;  3V6D B;  2UUB J;  4LF8 F;  3N5F A;  5KFK A;  3MI7 X;  3DXB A;  4Y00 A;  1R89 A;  4U6P A;  1LK5 A;  1Q1K A;  1UJ6 A;  2W2P P;  3Q8Q B;  2YWG A;  2LA6 A;  4Q7A A;  5F9L A;  3C6T A;  1TK0 A;  3RAQ A;  2DGT A;  3BRE A;  2DH9 A;  4Q5V A;  1P27 B;  5A8W A;  1S6U A;  1KC8 T;  2Z30 B;  1YK9 A;  2WVD A;  4YS2 A;  3Q8P B;  4PWD B;  2A3J A;  1RHR B;  2E9R X;  5IXU A;  1DRZ A;  1N5Y A;  2PC6 A;  4IRC A;  2EFN A;  2F7V A;  2O5D A;  2HPU A;  4WE1 B;  2QO3 A;  3WAX A;  3CDA A;  3RRK A;  1CS4 B;  1Q0N A;  2E5G A;  1QSY A;  1FWL A;  3DKD A;  4DL7 A;  5D0R A;  3RBE A;  2WOM B;  3MUR P;  5E3R A;  1DAX A;  3JSY A;  4Z7Y A;  4NLX A;  2CAJ A;  3RU0 A;  3BZQ A;  3DPC A;  5E3Q A;  1RIS A;  5K8O A;  2B5J A;  3IMQ J;  2BOA A;  5GAD I;  1HMV A;  2D3O 1;  1T9W A;  4LRA A;  5L9X A;  3CD6 S;  4B3R J;  3OD2 A;  2VFS A;  4ZVP B;  1CJT B;  3IP0 A;  4Q0B B;  3TI0 A;  4ZS6 A;  1ZOT A;  1GX5 A;  3WAW A;  4ES3 A;  3D54 A;  4MIA A;  1NK6 A;  3IWN C;  1YI2 S;  2XO6 A;  4LF4 J;  2N7Y A;  3CCL S;  3FQL A;  3IM8 A;  1M1H A;  4EZ6 A;  1SV5 B;  2ZWP A;  3SQG B;  2I9S A;  1S97 A;  3PYF A;  4OV1 A;  2Y8W A;  2HGN A;  4OHZ A;  4C0O C;  1U09 A;  4RW9 B;  1YJT A;  2HMI A;  3M8Y A;  4DWI A;  1PJ6 A;  4Q0B A;  2YNH A;  2M8H A;  4MFB A;  3CWJ A;  5BXI A;  3CF5 Q;  3R5D A;  4X64 F;  3MMB B;  4OI6 A;  5RUB A;  4O3R A;  2GVZ B;  3L4B C;  3M8R A;  3HVA A;  1RI7 A;  1ZEB A;  1SV5 A;  3P8B B;  4DL6 A;  2JFD A;  4U9R A;  2Q66 A;  3T5J A;  5H9E K;  1NAQ A;  3QYY A;  2EFG A;  1HNV B;  4GTZ A;  2GHW A;  1YG0 A;  2H54 B;  4USH A;  1VQ8 S;  3JAM U;  2HHX A;  4KO0 B;  3SSQ A;  1N32 J;  1URA A;  5GOV A;  2XZW A;  3NGT A;  1Y3K A;  3O6Q A;  2R8G A;  3H2V E;  3AH6 A;  4DEZ A;  2LXF A;  3ICL A;  3RBZ A;  5GAD U;  1FRX A;  1K73 T;  1YHQ S;  6FD1 A;  4H4O A;  3ZTR A;  2KG1 A;  2HEK A;  2KH9 A;  3PKY A;  4OI2 A;  2ZUA A;  2VOO A;  4QIE A;  4MK7 A;  1E2S P;  4WYL A;  1D8Z A;  1UFW A;  2OSQ A;  4FXW A;  5GME A;  3CO0 P;  4UZB A;  2OEM A;  2Y1I A;  1RT6 A;  3TUZ C;  2VD3 A;  4FPI A;  2QEX S;  4DPW A;  3QAU A;  1FRH A;  2ADC A;  2OP5 A;  2FUG 9;  3SFG A;  3HHL C;  3PEH A;  1NJY A;  2MKI A;  5HQL A;  4ETX A;  4NPO A;  2E7X A;  2W4D A;  4DV6 F;  2D3U A;  4R5P A;  4AXI A;  2VPZ B;  2KDO A;  2OFH X;  3FSY A;  4FXV A;  4ES2 A;  2VBW A;  3AOB A;  1REG X;  3BSC A;  1QY7 A;  1JK9 B;  1TZ0 A;  1TUV A;  1BHN A;  1YBA A;  4RNN A;  5JUM A;  2ZJQ Q;  2OMO A;  1SKS A;  2E1C A;  2UV8 A;  4LF6 J;  3CED A;  2EWH A;  5LSL A;  4U95 A;  2E9Z A;  3OLB A;  2O66 A;  3LAK A;  5KFR A;  1U1M A;  2FZK B;  3PO4 A;  1Y0H A;  3CB4 A;  2LA4 A;  2RDJ A;  3VAJ A;  3UNG C;  1RK8 A;  1KD1 T;  4JBC A;  2E7V A;  5KT4 A;  2QN6 B;  3HX9 A;  3ETO A;  4B17 A;  2R2U A;  3D0I E;  2BKN A;  1S9G A;  3OFG A;  2YKM B;  1N48 A;  4NZ7 A;  3NNA A;  4U7U K;  4DN0 A;  2OPR A;  2ZM6 J;  5D0H A;  2VQE J;  2LEB A;  3R5B A;  3G6X A;  4NXM F;  1V6H A;  4IG3 B;  1G7C B;  4P7T A;  2RDD A;  3D9B A;  3VWS A;  2R3V A;  3FKB A;  4JI4 J;  3AD9 C;  3GV8 B;  2ZVI A;  2CJX B;  2DGO A;  1S79 A;  4ED8 A;  1M5P C;  1AUD A;  3EUN A;  4R0E A;  2BAN B;  2YWW A;  1WG1 A;  2G13 A;  1TAQ A;  4K4X A;  4OYO A;  3DN9 A;  3IAM 9;  4K4Z A;  2CWK A;  4RJV A;  4IG3 A;  2QSF A;  4I2P A;  4JI3 F;  4PG8 A;  2MXY A;  1TR0 A;  5DLF A;  3BDE A;  2DPJ A;  3KLV A;  1TL5 A;  3PAC A;  2QA4 G;  3BEG B;  3BN7 A;  2GQQ A;  3ZZY A;  4NLS A;  3CTR A;  2AZ1 A;  2RIL A;  4RW4 B;  3ONQ A;  1D9A A;  1RTD B;  3LOU A;  1HBN B;  3V4I B;  2DR5 A;  3R8Y A;  3EXC X;  5B0B A;  5D77 A;  3B82 A;  1CJU A;  4AL6 A;  2I5J B;  2EKY A;  3FVY A;  4X4R A;  4LJM A;  4AQY F;  3CD5 A;  5LMN F;  4AFF A;  2YNI A;  3HVT B;  1XR6 A;  4ER8 A;  1UPM B;  4YR2 A;  1UW4 A;  2EVZ A;  4ZP9 A;  5DS7 A;  1S6O A;  1PC5 A;  4K4S A;  1RKI A;  2C2E A;  1RAO A;  2APO A;  3B4M A;  5HI7 A;  3GR0 A;  2ZH1 A;  1SQG A;  1UWB A;  3HO1 A;  2KU7 A;  2Y1R I;  1NO8 A;  2XMK A;  3MD1 A;  1IBK F;  1C0T A;  1Q5V A;  3OFH A;  2EC0 A;  3PW4 A;  2EI5 A;  5C2G A;  2N82 B;  4FBT A;  1M90 T;  4ID5 B;  2RDI A;  1QTN B;  1VK8 A;  4FBU A;  3M30 B;  3NS7 B;  3LWM A;  3I5B A;  2JLG A;  1JLC B;  1PIL A;  2DXD A;  2B43 A;  3PYE A;  4WCE Q;  1FRK A;  5CYQ B;  1NME B;  3FRZ A;  5CXT A;  1TP7 A;  4B9N A;  3V81 B;  3VAG A;  3CO9 A;  1R0A B;  4NOH A;  1MU2 A;  2ZWO A;  2GSN A;  2IDE A;  1NXI A;  3TQE A;  4RNM A;  3TA0 A;  3FBC A;  5D8H B;  1RWK B;  1WC5 A;  4FYD A;  3E01 B;  2HS3 A;  4KJG A;  1LW0 B;  3ZZ0 A;  3H4D A;  4MK8 A;  2AYG A;  1ALK A;  1JX4 A;  1CG2 A;  5AJ3 F;  3UWT A;  3T9Z A;  5LXR A;  1XQI A;  4ECT A;  1YZ6 A;  2AMC B;  2RRN A;  2RE1 A;  2CZV C;  4MIV A;  2W1B A;  5EWE A;  2QRR A;  2JLF A;  3MM5 B;  4QIW D;  2PD1 A;  4DLG A;  3BGF A;  1CEZ A;  2YH1 A;  1P49 A;  2V0N A;  5CAB A;  4TY8 A;  2FQQ B;  3NGS A;  4JI0 J;  2HHS A;  2RIJ A;  4R25 A;  2RNE A;  1QD1 A;  2ACY A;  3MPU B;  2AU0 A;  2IVM A;  4ZP8 A;  1NPP A;  4NI2 A;  3U1M A;  3MTK A;  2CPH A;  4M63 A;  4ECZ A;  4LQ9 A;  3QT8 A;  3EGN A;  3ZNJ 1;  2LLZ A;  1EQM A;  5KFE A;  1E3C P;  4AYB D;  4RWW A;  1T9U A;  3W9J A;  2ACM A;  1M0S A;  3EZ5 A;  4H4M B;  3W5X A;  1SQF A;  1U2R A;  2NUU G;  4BCA A;  2FC8 A;  1JLF B;  4U96 A;  4JI2 F;  3BR8 A;  4NXN F;  4A8Q A;  2XZD B;  1VBX A;  3M1V A;  2Y0B B;  4XO0 A;  3M8S A;  2HBR B;  3BM7 A;  3L7O A;  4DZD A;  2DRA A;  2VKZ G;  5B0G A;  1ZS6 A;  3D6H B;  3LGM A;  5DM7 Q;  4TNO A;  2WB4 A;  3QGP A;  1BQM B;  4M5J A;  3Q2T C;  3SDE A;  1X4G A;  2Z0G A;  1X9M A;  4NRT A;  3S8S A;  3MR3 A;  4MHX A;  5IQ6 A;  1JLF A;  3TA2 A;  5DLV A;  4RU9 A;  3BSN A;  1I94 F;  2ATC B;  1QUV A;  3CDE A;  3GMG A;  4NWJ A;  2LEC A;  2YKQ A;  2VAS A;  5BR8 J;  3W63 A;  2CJ9 A;  3THT A;  1YIJ S;  1UFK A;  1BQM A;  4CO1 A;  1DFD A;  1GXT A;  1ZEF A;  5KFV A;  2J0W A;  5L1I A;  3EPI A;  3CCT A;  4DV7 F;  4DUZ F;  4OX6 A;  3D6F B;  5CZX A;  5KFQ A;  4LF5 F;  2U1A A;  2Q43 A;  2J0S D;  3EDQ B;  3HHL B;  3KLE B;  4ZKA A;  5DM6 Q;  5J2P A;  3UDV A;  3OHA A;  4ZPW R;  4WTY A;  3RAX A;  2IFX A;  1AXQ A;  2P8I A;  2RHS B;  4OLO A;  4P74 A;  3PZP A;  2C2R A;  2HW3 A;  3T1Y J;  4ED0 A;  4DU8 A;  2OFG X;  4DL2 A;  5I3Q A;  4WKY A;  4J9L A;  2CIM A;  4KGX B;  4QWD A;  1QTM A;  3CJT A;  2BRL A;  3QWP A;  4XDD A;  1FJ7 A;  1UJ4 A;  3LGN A;  1KR4 A;  4FZV A;  1U2F A;  1VIS A;  1TL1 B;  4OZ5 A;  4CLZ A;  4J7C A;  1FNO A;  2DBB A;  3TG0 A;  5L39 A;  4XAK A;  4L3K A;  3OTD A;  4ZVQ B;  2ROE A;  3LH2 S;  1FF2 A;  1FX4 A;  2GCF A;  2H9Z A;  3K2Y A;  1T03 B;  2Z2Y B;  2O3D A;  1KQG B;  4C3K A;  3CE8 A;  1FXR A;  1NDK A;  1Z2L A;  1R8B A;  4LRB A;  2FLP A;  2BQR A;  1SKW A;  5L0E A;  2X3G A;  1TFW A;  2ZD1 A;  4I56 A;  1PCA A;  2MSS A;  1Z4U A;  3OR2 A;  1S72 S;  4RW8 B;  1N36 F;  2HRU A;  1KLM A;  4A8Y A;  3PX4 A;  2GC8 A;  5HRO B;  3DGP B;  2XS7 A;  3GE9 A;  2VG5 A;  4ZPT R;  3QBC A;  3WX8 A;  3OJS A;  4CZC A;  5EWG A;  1NJX A;  2AWZ A;  1SL2 A;  1OJ4 A;  4FKX A;  4KH1 B;  4WZQ A;  1KVJ A;  2G2Y A;  3VZI A;  4NZ0 A;  4RW8 A;  4CWB A;  1FDA A;  1Q4R A;  4FP9 A;  4HHH A;  3T19 A;  4PYA A;  3DGP A;  4ERD A;  2FVP A;  1ACM B;  2BAB A;  3O2I A;  1Q78 A;  3I0R B;  5IZH A;  4ECY A;  1JLQ B;  1RWO B;  3Q86 A;  1J5O B;  3BH6 B;  3NKR A;  1S1X A;  4CLL A;  1FFG B;  3NKQ A;  3N79 A;  1DZ5 A;  1VRU A;  1SPB P;  2BE2 A;  4O4G B;  1KON A;  3A8K A;  4K5R A;  4IOC Q;  1H7W A;  2JOQ A;  1ZET A;  2V5H G;  2VON A;  1REV A;  4X2B A;  4PWW A;  5AXN A;  5AXL A;  2HHH J;  5ETO A;  3UDE A;  4KFB B;  5B0A A;  3W7B A;  4GMK A;  3DU6 A;  1JQG A;  3N6L A;  5C24 B;  3HHL D;  4DXL A;  3CCE S;  1NK8 A;  3OFE A;  4YY3 J;  2AZ3 A;  3MAQ A;  4ZLP A;  1ELO A;  2YWH A;  1FSU A;  3LPE A;  3NL0 A;  4OYP A;  1WOR A;  2OH2 A;  3M2V B;  4RBU A;  2J9D E;  1B8J A;  5SUH A;  4F26 A;  1TKZ A;  1VC0 A;  1VQ9 S;  5I3U A;  3AQP A;  3FCH A;  1RE1 B;  4G1P A;  2GJI A;  2FVR A;  1N56 A;  2CQI A;  4CM0 A;  3PHT A;  2FHM A;  4M5I A;  4I6Y A;  1RT3 B;  2XMA A;  2F65 A;  3G8S A;  4WTO B;  2UUB F;  4JOU A;  3MAA A;  5J1E A;  1KVK A;  1R0B G;  2B8P A;  4PZV A;  2SXL A;  1XNQ J;  3UD4 P;  3M2V A;  5D78 A;  3IR6 B;  2KTQ A;  5DQH A;  2R2R A;  5KTQ A;  3CJK B;  3IG1 A;  4F3O A;  1HPZ A;  3AOA A;  1RWV B;  2UXC F;  4TQS A;  4M94 A;  3KLF B;  1OPI A;  1WC0 A;  2ASL A;  1NB7 A;  2E1M C;  1T05 B;  2Z2M A;  1FFW B;  4B3T F;  2EBE A;  1CJK B;  1JJ2 R;  2L41 A;  1KP6 A;  1CUL A;  1CJV B;  3ILJ A;  1DBD A;  1JLB A;  2F9D A;  4KHP F;  2KN4 A;  4EBC A;  4O0I A;  1DQA A;  3NKO A;  2H1Y A;  3BH7 B;  2IA6 A;  3ILI A;  2Z2Z A;  4BWM A;  2V9K A;  2GMJ A;  2GO8 A;  2PA3 A;  2CG4 A;  1CBK A;  4LR8 A;  1B7Y B;  1O5J A;  1CJK A;  4QPX A;  4QR0 A;  1HQE A;  5JXS A;  2WBM A;  2DNG A;  4ED2 A;  2HZV A;  1NK9 A;  3GJS B;  4NX9 A;  2X98 A;  3KLI A;  4PUO B;  3DDI A;  4ED6 A;  3CIZ A;  2M7S A;  1OSD A;  3VAL A;  3W64 A;  3C3L A;  3I0S B;  2W5T A;  2C42 A;  2UUW A;  1VBY A;  4WIQ A;  1HWI A;  3FK4 A;  2W5W A;  1WNE A;  2Z58 B;  5TJ3 A;  1WF1 A;  3ET6 A;  5KFI A;  2OPQ A;  5DO2 A;  2LDI A;  1LFP A;  4OZJ A;  4GRS A;  4PUO A;  4YDD B;  3CGI A;  2RF2 A;  2PFF B;  4ED1 A;  2XY6 A;  1YJR A;  3VVT A;  1AUK A;  1XEZ A;  2DRB A;  2DGW A;  1EET B;  2QLJ B;  1ZYQ A;  3KWM A;  4N76 A;  4WZM A;  1RT4 A;  4B9U A;  1S10 A;  4DV5 J;  3PJX A;  3OSN A;  3ZXW A;  4YR1 A;  3FEY B;  4FPR A;  3WBH A;  2WTF A;  3QGG A;  1TTH B;  5A8R B;  5ETT A;  1Q8B A;  1MMN A;  4DV3 F;  4ZP7 A;  1VI7 A;  2FJD B;  1YTY A;  1HI8 A;  1HBM B;  3V4M A;  3BDG B;  1TKT B;  2VFT A;  4PG5 A;  1WHW A;  1RCX B;  2IMW P;  2PMW A;  3VAM A;  4LF1 A;  3TZY A;  3C15 B;  1ELY A;  4AL7 A;  3DOM B;  3CJ2 A;  2UU9 J;  1FWK A;  1MG7 A;  5A8R A;  2J8S A;  1WAC A;  2MTL A;  4C9D A;  2V68 A;  2ASJ A;  4KV8 B;  5IT9 Y;  2XLI A;  3ADA C;  3G8Q A;  4LRC A;  2FLL A;  3HJV A;  5L1L A;  3FMB A;  3C66 A;  4KKO B;  2KHC A;  2WHO A;  4KGM A;  1TKD A;  4DL5 A;  3D2W A;  1S6Q B;  5CD4 H;  1GMU A;  1BUX A;  3NCQ A;  1KWM A;  3OR1 A;  4OZL A;  5E3P A;  4WK1 A;  3W61 A;  3M32 B;  1WC1 A;  3CUL A;  4ZVO B;  1TL4 A;  5CA5 A;  4IG0 B;  4ALZ A;  4CLS A;  4G6V B;  3IN5 A;  2AJ4 A;  1ZZN A;  2AJQ A;  4OX8 A;  1K0T A;  4WKR A;  1V5V A;  2RHQ B;  2XMT A;  4DQQ A;  2BJ1 A;  1LWF A;  4OQJ A;  2HQC A;  3CSK A;  1B70 B;  3T5H A;  4DCJ B;  4B9L A;  2AYM A;  4HH0 A;  3POT B;  3LF0 A;  1NSK L;  4IQM A;  3NY0 A;  3GFX A;  5KFH A;  5L0B A;  4UUX A;  2FGC A;  3ENQ A;  1YJU A;  4NLQ A;  3RB3 A;  3E51 A;  1KOH A;  5EHH A;  3W2W A;  4KH0 B;  3GWC A;  4HAC A;  1ANJ A;  1HNX F;  5E3A A;  3EDR B;  5CYM B;  4F4Y A;  1E6V B;  2OI2 A;  3DRP A;  4JI8 F;  3TA1 A;  2WW4 A;  2YY3 A;  1IKY B;  1VCT A;  2E5I A;  4AE5 A;  2ZZM A;  2R42 A;  3KMS A;  2F1F A;  3TOQ A;  4PXD A;  2NCK L;  4JI4 F;  5HP1 A;  4K7Q A;  2UUA F;  4C97 A;  1X60 A;  3DRR B;  2VA2 A;  3E2E A;  3PJW A;  5CYM A;  3C16 B;  3QPI A;  5KAK A;  2DIT A;  1E6V A;  2KRB A;  5C66 A;  1SI9 A;  1FJE B;  3O44 A;  3PCO B;  3RW7 A;  2VA3 A;  3UD3 P;  3Q8V A;  2EG1 A;  1XN9 A;  1HD1 A;  1XIQ A;  1A9N B;  1IR2 A;  3ZO7 A;  2CXE A;  2E1A A;  4OI4 A;  1CSJ A;  3H40 A;  3D0G E;  3TP2 A;  1JB0 C;  1BQN B;  2MY7 A;  2B4P A;  4GKK F;  4YUD A;  2R7O A;  4RBT A;  1R8C A;  4ID8 A;  2CPF A;  1ALJ A;  3M8Z A;  3MAH A;  2OKQ A;  4N56 A;  2HZA A;  5BYQ A;  3W2V A;  4G3I A;  1IR1 A;  2Z56 B;  3HZG A;  4WP8 A;  2XNQ A;  3FQK A;  4NL5 A;  2FYX A;  2CUY A;  3MR2 A;  5LSR A;  5KG5 A;  2P2C B;  4OX9 F;  4QIG A;  4LSZ B;  4B3O B;  4P2X A;  3P49 B;  1HR0 J;  3BGR B;  3IS9 A;  5HN0 A;  1WOO A;  3EX7 B;  4Q8E A;  2CJY B;  2ZZT A;  4DG1 B;  4DQP A;  1UVI A;  5G0R A;  3NAH A;  2MGZ B;  4MKA A;  3LTO A;  4KAY A;  4I64 A;  2G9O A;  1IKW A;  4ED3 A;  1VBZ A;  1G1X A;  3I6P A;  3UPF A;  1ED8 A;  5E5N A;  3IXQ A;  3BN4 A;  3MEK A;  1L3V A;  4NE9 C;  1SH0 A;  1OO0 B;  5HMZ A;  1RHU B;  4R8U A;  3DRY A;  2XYH B;  1KDN A;  2DYA A;  3EVW A;  1EP4 A;  1N0V C;  3AA8 A;  1X4D A;  3M6W A;  2R7R A;  2RT3 A;  1FRM A;  3IA0 A;  2MKH A;  2YKO A;  3L7P A;  1N33 J;  5KT3 A;  1N6Q A;  2FJB B;  2HVZ A;  3NLC A;  5F3Z A;  3TVY A;  1FK9 B;  5A2Q Y;  2OD4 A;  3RAM A;  3P5T L;  1WTF A;  4KPY A;  2BW7 A;  1SJ3 P;  1WHY A;  2QZ8 A;  2BA9 A;  3CCM S;  1JNR B;  1KHL A;  2K2P A;  3SZY A;  1U6Z A;  4DFM A;  4X4N A;  2H51 B;  4N77 A;  4GO5 X;  2PMH A;  3A12 A;  4RPF A;  3QZ7 A;  1Q7L B;  4C3L A;  5I42 A;  1EX8 A;  2BE9 B;  2NQP A;  4H4K A;  1ZED A;  2GHV C;  4DHV A;  1YJ7 A;  1M5K C;  1FK9 A;  2QTW A;  3HT3 A;  4DV1 J;  3P6Y C;  4F0M A;  2Q6C A;  1IXK A;  4C6A A;  5F8L A;  4G1I A;  4OJG A;  5DG7 A;  2V69 A;  5H9F K;  5IJQ A;  4WII A;  1NH7 A;  3QAT A;  1WOP A;  3IWL A;  2C2Z B;  1BY9 A;  2UUC J;  3G6E S;  1MN7 A;  2J7W A;  4QBU A;  2YH0 A;  2VH7 A;  4JI0 F;  3D28 A;  1RSC A;  3R7S B;  2WK4 A;  3C6U A;  3NVL A;  4CO5 A;  2V8H A;  4USW A;  2WZ1 A;  4K2X A;  3LAL A;  1N5Q A;  2UXB J;  5K5M A;  2MHE A;  4M5M A;  5AJ9 A;  4DU7 A;  2WVE A;  5C2C A;  1R6V A;  2RB7 A;  4LBH A;  2J6U A;  3KFW X;  2PGC A;  2CQ1 A;  4NLO A;  2F5G A;  4CT8 A;  4N5S A;  2L9N A;  4M5D B;  3OVA A;  1R0C B;  4OHW A;  1HNW J;  2OAU A;  1OWX A;  2R2T A;  2CKW A;  1SJQ A;  1SC4 B;  4ZDN A;  4PG6 A;  2VG6 A;  2W9B A;  4HDG A;  4J9P A;  4QW8 A;  2QL7 B;  4RU2 A;  1WKJ A;  2AX0 A;  1W26 A;  3DMJ A;  4IOB A;  3Q23 A;  3NGK A;  2J9C A;  2V4J B;  3OL9 A;  4ZN1 A;  1S76 D;  3HF5 A;  3M8Q A;  1D3W A;  1NEE A;  1ZH5 A;  1SH3 A;  5LQQ A;  4I4B A;  3EZU A;  3R5G A;  2KZZ A;  4K8R A;  2OSR A;  4DPU A;  4YP3 A;  2IVY A;  3J7Y I;  2VB6 A;  3HJF A;  2FJA B;  1S1U B;  1SL1 A;  3DI6 B;  2AHO B;  3GP9 A;  2DY9 A;  2DH7 A;  2I1R A;  4OIX A;  3MR7 A;  4HHJ A;  3M4X A;  3B78 A;  2W2O P;  4K4W A;  1HWL A;  2CYY A;  1S57 A;  4J9U E;  2RQK A;  3DOK B;  1OYE A;  3DRX A;  4DR7 J;  1K9M T;  1JKH B;  1LW2 A;  1LK7 A;  5M2P A;  3H7H B;  4USM A;  4DUT A;  1RAD B;  2FJE B;  3BV8 A;  3UO0 A;  3K5N A;  1EKS A;  3VAI A;  3NOC A;  3TR5 A;  4X62 J;  3VGT A;  2UVU A;  1NKC A;  5C5J A;  5HO4 A;  1L3U A;  3OBI A;  4DX7 A;  1QE1 B;  4TU9 A;  3AB4 B;  1ZAW A;  2HBY B;  1B99 A;  5HQ8 A;  2V8V A;  1BC6 A;  5A6P A;  5KFB A;  2ZOF A;  3T1H F;  3PIP Q;  2IIH A;  5KFY A;  1URB A;  3P3D A;  1IQT A;  1D1U A;  4ED4 A;  4DOZ A;  2V67 A;  3QGH A;  1H0H B;  2FHJ A;  1WWH A;  3GTY X;  3KLG B;  3Q0A A;  4ZVH A;  2VC0 A;  2E7W A;  4O3N A;  2F3J A;  3W62 A;  5KFP A;  1ZA1 B;  1LFW A;  3UVJ B;  3UD5 A;  3AAW B;  4X66 J;  4WU2 A;  1FKP B;  3QZ8 A;  1NM2 A;  2IA0 A;  2F4V F;  2L08 A;  1PJ5 A;  4Z2X A;  4EO8 A;  2MY8 A;  3BDP A;  3VAF A;  3MR5 A;  1U4B A;  2CA9 A;  3GJQ B;  4DV2 F;  2K8G A;  3SIP B;  4DZ6 A;  2HGL A;  3CW2 C;  3KK3 B;  3NS5 A;  3GIM A;  5IS2 A;  2MQQ A;  1KQF B;  1UP1 A;  3EGV A;  3ZZO A;  2G1D A;  5GAG I;  3HZE A;  1H7X A;  1X0F A;  3L3C A;  3ZTP A;  3LP1 A;  1D9F A;  1RJJ A;  4NLU A;  3UVJ A;  2DRD A;  4GVB B;  4KGV B;  4PXC A;  4LRD A;  1FKP A;  2GIF A;  1RT5 B;  3R3T A;  2GFF A;  3DYA B;  2LQ9 A;  4Z37 A;  3T02 A;  4O0N A;  1XER A;  1F5A A;  1C4A A;  2AEF A;  2ROG A;  4Z7C A;  4K0K J;  1YGY A;  1O98 A;  2EG2 A;  4GVL A;  4OL8 A;  2IJR A;  1PBA A;  5AE1 A;  1U47 A;  4DR6 J;  1Y5N B;  1JIH A;  3IRX A;  1WD6 A;  4ZHR A;  5DGA A;  3EIC A;  2K7K A;  1ZM9 A;  3ILL A;  3M8P B;  5DLG A;  2J0Q D;  2HRT A;  3MK0 A;  4JV2 A;  1VRT A;  1HNI B;  4EYH B;  3H2U B;  4K2J A;  3D6T B;  1HBO B;  1OQ6 A;  2COL A;  3THP A;  3MFH A;  1CC8 A;  4LF9 J;  8RUC A;  1JLE B;  4ZJL A;  2OEK A;  5KFS A;  2DO4 A;  3A3P B;  1C0U B;  3MM8 A;  5HL7 Q;  2DPI A;  1NB2 A;  1C4C A;  1QUP A;  4JYA J;  4FVM A;  3CME S;  2HQI A;  1HD0 A;  1MRO A;  3M8P A;  2JZ5 A;  2GVD A;  1X31 C;  2HLU A;  1QAY A;  2GHP A;  4CLY A;  3PG9 A;  2L48 A;  3QSI A;  3MMA A;  3G4S S;  2Q79 A;  2V9W A;  4A8S A;  1HBO A;  4CLU A;  4RUB A;  5HQM A;  4YY3 F;  5GAG U;  3PR5 B;  4GTY A;  2E5L F;  1S0M A;  3HPO A;  4ENO A;  2KB2 A;  3J80 U;  3T41 A;  1ARO P;  5IWA J;  2FHJ D;  3A3O B;  4K50 A;  1SB6 A;  4F50 A;  2ILY A;  2IPO B;  6AT1 B;  1HYS A;  2EFP A;  2WSC C;  1JXV A;  4MT1 A;  1DTT B;  2XO7 A;  3J80 Y;  2HNY B;  2OIH A;  3FNN A;  1UWA A;  1UEU A;  3TZW A;  2ILZ A;  3NKY A;  5KG2 A;  3VTI A;  2C3M A;  1FKA F;  3KK1 B;  1T9X A;  1CQN A;  1Z1Z A;  2ALY B;  4F8R A;  4PRF A;  2P9E A;  4OI1 A;  2R4F A;  4LSN A;  3K89 A;  5ADZ A;  1AYE A;  2EW9 A;  2OEJ A;  2YTC A;  5KG6 A;  2UUT A;  1UKU A;  2ZDO A;  4JV5 J;  2QFI A;  3BS9 A;  3B4D A;  3JS9 A;  4ZCI A;  2YWF A;  3KYL A; 
#chains in the Genus database with same CATH homology
 3IGY B;  1ELY A;  1EW2 A;  1O99 A;  3M8W A;  2GA3 A;  5L0K A;  1E2S P;  5KXA A;  2W8D A;  3NKN A;  3WAV A;  4N7T A;  4CXU A;  1ED8 A;  3CMR A;  5IJQ A;  5L0B A;  4FDI A;  2W5W A;  1SHQ A;  1EQJ A;  3IGZ B;  1ELZ A;  3M8Y A;  1KH9 A;  1KHJ A;  1P49 A;  4UOO A;  4GTX A;  4ZG7 A;  4LRD A;  3Q3Q A;  3TX0 A;  1KH7 A;  1EJJ A;  5DLT A;  5TJ3 A;  3T00 A;  1Y6V A;  4LR7 A;  3UN2 A;  2W5V A;  4B56 A;  4TN0 A;  3OT9 A;  3WAX A;  5IJS A;  4LRC A;  1N2L A;  2D1G A;  4UOP A;  5LQQ A;  1EW8 A;  4MHX A;  3T02 A;  4LR9 A;  2IUC A;  2W8S A;  1EW9 A;  1URB A;  1ANJ A;  4GTY A;  4UPL A;  5DLV A;  1FSU A;  1ALJ A;  3M8Z A;  1AJB A;  1KHN A;  2ZKT A;  2ANH A;  3KD8 A;  2W5S A;  1AJA A;  4LRF A;  1HJK A;  3NKO A;  3T01 A;  3NVL A;  4ZG9 A;  1ZEB A;  4CXK A;  5GRR A;  4MIV A;  1O98 A;  1AUK A;  4QAX A;  4NWJ A;  5LRN A;  4UOR A;  5LRM A;  1AJC A;  2W5X A;  3MK2 A;  2RH6 A;  1B8J A;  1KH5 A;  2W5Q A;  5DLW A;  2GSN A;  5HRT A;  3E2D A;  1HQA A;  2XR9 A;  1KH4 A;  3DPC A;  1ALI A;  5EGH A;  2VQR A;  3IDD A;  3BDG A;  4GTW A;  4KAV A;  5K4P A;  5LIA A;  3TG0 A;  1E1Z P;  4GTZ A;  3UN3 A;  2IUC B;  4YR1 A;  4LR2 A;  1Y7A A;  1KHL A;  2GSU A;  5AJ9 A;  2QZU A;  3WBH A;  4LR8 A;  3SZY A;  1E3C P;  1ZEF A;  4LRA A;  2GLQ A;  4UPK A;  4KJG A;  3MK0 A;  3MK1 A;  4LRE A;  5EGE A;  1ELX A;  1URA A;  1ALK A;  2G9Y A;  5GOV A;  2XRG A;  4CXS A;  3ED4 A;  1E33 P;  3WAW A;  4CYR A;  1ED9 A;  1EI6 A;  2IFY A;  4FDJ A;  3M7V A;  4UPI A;  3B5Q A;  3BDH A;  3NKR A;  2GSO A;  4ZG6 A;  3BDG B;  3NKQ A;  2X98 A;  3BDF A;  1ALH A;  3UN5 A;  4KJD A;  1ANI A;  1HDH A;  1SHN A;  1N2K A;  4KAY A;  2W5R A;  5C66 A;  4MY4 A;  4CYS A;  3NKM A;  1ZED A;  3DYC A;  3LXQ A;  4UPH A;  3WAY A;  5INH A;  4LRB A;  1AJD A;  4LQY A;  3UNY A;  1K7H A;  4NWX A;  3SZZ A;  3UO0 A;  1KHK A;  4ZGA A;  5L0E A;  2W5T A;  3NKP A;  3TWZ A;  4KM4 A;  3A52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...