3UNYA

Bacillus cereus phosphopentomutase t85e variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3unyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3unyA01
1KHNA 3DPCA 5IJQA 3NKRA 3TX0A 1KH9A 2GLQA 3NKNA 4LQYA 1ALKA 3NKQA 1E3CP 3UN2A 1E2SP 4CXUA 1URBA 4ZGAA 3T01A 1FSUA 5K4PA 1EW9A 2D1GA 4KAYA 1URAA 5IJSA 3M8ZA 4UOPA 4KM4A 1ANJA 3NKPA 2IUCB 3CMRA 4MY4A 1EW8A 4LREA 4LRDA 3UN5A 4KAVA 3WAYA 5GOVA 3WBHA 4QAXA 4N7TA 4UPIA 4NWJA 4UPKA 2GSNA 4YR1A 1AJCA 5DLTA 1ZEFA 5L0EA 4FDIA 4ZG6A 4LR2A 1ALHA 4UOOA 3M8YA 3UNYA 2W5QA 3MK2A 4MHXA 4KJDA 1ELXA 4LR7A 1KH5A 3IDDA 5L0BA 3B5QA 4CYSA 2QZUA 2W5SA 2XRGA 4GTXA 5LIAA 1N2LA 1Y6VA 4MIVA 3BDGB 3M8WA 3OT9A 1SHNA 4B56A 1EI6A 2W5RA 1ED9A 1P49A 1SHQA 1ZEBA 4UPHA 5EGHA 5DLWA 5LRMA 2W8DA 1E33P 3BDGA 3Q3QA 4CYRA 4UPLA 4NWXA 1Y7AA 4ZG7A 4KJGA 3UO0A 3WAVA 5DLVA 4TN0A 2IUCA 2X98A 4GTWA 2G9YA 1KHLA 1HDHA 1ALIA 3IGYB 3BDFA 4LR8A 1B8JA 2W5XA 2W8SA 3T00A 5KXAA 3DYCA 1N2KA 3TWZA 1AJAA 2VQRA 2ZKTA 1EJJA 1O99A 5EGEA 2ANHA 1HQAA 3IGZB 1E1ZP 3SZZA 4LR9A 1HJKA 2GSOA 1KH4A 2XR9A 4LRBA 3NVLA 3UN3A 4UORA 3ED4A 2GSUA 1ED8A 1KHJA 3MK1A 1EQJA 1K7HA 3SZYA 1KHKA 1O98A 3T02A 1EW2A 4GTZA 5GRRA 3BDHA 4ZG9A 1KH7A 2GA3A 4CXSA 2IFYA 5AJ9A 1AJDA 1AUKA 1AJBA 1ELYA 1ZEDA 3A52A 5TJ3A 3TG0A 5LQQA 5HRTA 1ELZA 3MK0A 3E2DA 5LRNA 1ANIA 3NKMA 4GTYA 5INHA 2RH6A 2W5VA 3KD8A 3WAWA 5L0KA 1ALJA 3M7VA 4CXKA 2W5WA 3LXQA 2W5TA 3NKOA 3WAXA 4LRCA 4LRAA 4FDJA 4LRFA 5C66A
chains in the Genus database with same CATH superfamily
1JLCB 1IBLJ 5KFCA 2ZOFA 1WELA 4FNHA 5HJXA 3F41A 1VQKS 3KXDA 2ASYA 1TL1B 2V4JB 2FLOA 2AKWB 5J2MA 4DF4A 1RQ0A 3NCQA 4KJDA 4TLQA 4PG7A 3R5GA 2X1AA 1TELA 3TP2A 3MMJA 2EFPA 3T19A 5BR8J 5A8KB 3AFGA 2VQFF 4O4RA 4DI6A 1CPZA 2P8IA 4NLDA 2CJKA 2VUGA 1FK9A 4KFBA 4U96A 5JXSA 2XMUA 4U95A 3DLGB 2DH9A 1ZPVA 1UETA 2IC3B 4DQSA 3W66A 2AJQA 1ZM3A 4DR1J 4ZVEA 5KG4A 2KT2A 2ZEJA 5DS7A 1G2EA 2DNRA 3BO2A 1S0NA 1R0AB 4OX9F 1JNZB 2DRDA 1RT5B 5EGYA 1ZM4A 2BE2B 4QW8A 3O3LA 3OVBA 3DI6A 3VVUA 2ZBRA 1NBEB 1QE1B 3IM8A 3VCDA 1T9YA 1U25A 1FCAA 1X5TA 2RRNA 1Q82T 3KK2B 4ZJOA 2W5SA 3NGRA 1K47A 4DL4A 1BY9A 4MKVA 5FDLA 2W8DA 3HULA 1F9HA 1F1BB 2GJFA 1VMBA 5ETMA 2LA4A 1F6TA 1M1GA 2FVRA 3R1LA 1B0PA 1T05A 4DUZF 2OPRB 3BBFA 1YKWA 4DHVA 2MGZA 3EJMA 4I4BA 3CUNA 3R5BA 1DHMA 3PJWA 1XNQJ 5B0FA 1X4BA 3T1YJ 1FJEB 3TJAA 2BMBA 4DPTA 2RS2A 2HQGA 3NXZA 1NHVA 2SXLA 2DPIA 2AV5A 3JQMA 2VG5A 4H4OA 5BYRA 2DJWA 2PI4A 5ETLA 5GMEA 3I9ZA 4RW8B 3SIPB 3HHLB 1S1WB 3H0PA 4JP8A 2Z4PA 1PILA 3V6DB 2EFOA 2U1AA 4ZVOB 5ETOA 5EUHA 2RUGA 1G4CA 4TU9A 2GVZA 3HVWA 3KK3A 4RL1A 5F0WA 1NPPA 2X1FA 1FK9B 3QGHA 4KFBB 2HW3A 3W60A 2EFNA 4RZRA 4LJMA 1IQZA 3BSCA 1URNA 1AYEA 4V19J 5GAGI 1FF2A 2HHQA 2CRLA 1ZA2B 3G86A 3GFYA 3OL9A 4ICLB 5F41A 4ID5B 3I5AA 2DNNA 1O5JA 2XSJA 1FDBA 3DI6B 3ZZPA 1WJ9A 4F04B 2HGMA 2B9XA 4NA3A 1WF0A 1CBKA 3MWBA 1HW8A 3OW2R 1ROFA 4FYVB 4JV5F 3WC2A 4OJGA 1IBCB 4CH7A 4UOPA 1T94A 1OWXA 3DLKA 4LF5F 3TJ9A 2A3JA 4EYIB 3BGFA 2Y1IA 4NLGA 5BYQA 3K8WA 2WW4A 1TUWA 1XTZA 3MAAB 1T05B 2QZ8A 2G1HA 4UY85 2WVCA 2MGZB 2H48B 2I1RA 4CYRA 4B02A 1JLGB 5DGAA 2GQQA 5CXTA 2V9WA 1D9FA 5C25B 5KFWA 3CD7A 2ZKTA 1RT3A 4EZ6A 1O99A 2IA6A 2DKOB 2DH8A 1UWBA 1S6UA 1NJYA 5CYMA 1QVGR 4WCEQ 3B54A 1M5OC 3ITHA 2DITA 2IFXA 2E5GA 3OTCA 2XC9A 1U47A 3MZIA 1ZOTA 3BN7A 1DRZA 2HFZA 1OYEA 3P3DA 2YH1A 1LW2A 1XR6A 1WORA 2RD5C 2OMLA 3PX6A 3BQ2A 2HMIA 1VFJA 4Q7AA 2R2SA 3MFIA 2QLXA 2BDPA 2WVEA 5E3RA 5LXRA 4DSEA 3KK3B 3M9MB 1KH9A 2HVZA 3NKQA 4C8OA 2GO9A 4MK7A 2V4RA 1N36J 4WFNQ 5DDPC 3AH6A 2YNHA 3I5BA 4J9OA 1VQNS 2Q6CA 1F0XA 3I96A 4CZCA 1S76D 2DR7A 4B3TJ 2QZUA 4P75A 3NG8A 2XM3A 1X5SA 2Z30B 2B56A 4LSLB 3GJTB 2EBEA 2OEJA 4MT1A 3E8OA 3MPWA 2W8SA 2ALYB 2HQFA 3U02A 4N8OA 3Q24A 3OJSA 4OI4A 3IGNA 1KHJA 3R2DJ 2HWTA 3AB2B 1D0EA 2KM8B 3GR0A 4DG1A 1G1XA 4EEYA 2OLWA 3D6HB 4Y0FA 2E5LF 1VQ7S 3GJSB 1XEZA 2ZBQA 4M63A 2KG0A 4F4ZA 3CXCR 3Q86A 4DX5A 5FD1A 4R8UA 3CT9A 1U1OA 3QJPA 4NLWA 4LF1A 3EMTA 1WOPA 3EZOA 4MMOA 1RT3B 3U1NA 4KTQA 1WSVA 3DU5A 5CYMB 3ENAA 2ZH6A 1L3KA 3JTPA 5KFMA 4JV0A 3A8JA 1FNOA 9RUBA 2CQIA 2FC9A 4JI2F 1R6VA 3UNGC 2ZE2B 1S1UA 1WTBA 4ZDNA 3EE3A 3I0RA 2BE9B 1LW2B 3Q2TC 2FD2A 2MB0B 2K2PA 4FVCA 3MPDA 3DOKA 3HHEA 2J7UA 3K89A 2OHDA 4DR5J 1RWVB 3H5XA 3DC2A 4ZS6A 5I42B 5B09A 3J81U 1SH3A 1YTYA 2KYXA 1ELYA 1KTVA 1KOHA 4IQXA 3CJ4A 2YNHB 4ECZA 1FE4A 2FYXA 3T6JA 1NDCA 3ILLA 5GAGU 3KFWX 2JZ5A 3MCMA 4WFYA 2DO4A 5D0RA 3UW1A 5ITHA 2J9CA 1ALKA 1H7WA 2AYEA 1X0PA 1QSYA 1YGYA 5F0UA 1SKUB 3CJ8A 4CRJA 2QLBB 1EJ7L 1BGXT 1N5YA 3OFHA 3FKBA 4RBUA 2AHOB 4RW6A 1PYSB 4ED7A 5LJ5Y 1VOMA 1I6JA 4FPIA 1IR1A 2G0CA 2MKJA 4QWAA 2QIFA 1TV6B 5KFQA 4WYWA 5I3PA 4G1QA 1YIJS 1CJTA 2FZKB 1R27B 1KLNA 2PFFB 1RAEB 1OQ6A 4IH7A 1YJ7A 4ID8A 1EX8A 3HVTA 4RW7A 4RU2A 5KFIA 2IFYA 4J90A 2R8IA 1NU4A 1XMOF 1AJBA 3K17A 2FVPA 4R8UB 3VGTA 3TQ1A 2GC8A 1SC4B 2VD3A 2KDOA 1FE0A 1UEKA 2DGSA 1TUVA 1ZBTA 3BB5A 3GONA 1V9OA 1ZTWA 3SSRA 3NGDA 3Q22A 1VQLS 2X51A 2GHPA 2YWKA 5HLFB 1NB7A 2J6SA 1KFSA 3OLBA 1S1UB 4NASA 1OMSA 4ZVUB 1YQHA 2DIUA 3I0RB 5HN0A 2RE1A 1OIAA 3D4JA 3B4MA 5L0EA 1KEKA 1VJQA 3JAMY 4FS2A 1Q53A 3JTOA 3KG0A 3HCXA 2C2RA 4M5HA 1VC6A 1FTCA 3HZGA 3NBPB 2ZD1B 4ZPWR 4PRFA 1RHUB 2XI3A 5ETVA 1KDNA 2VG7A 2GSOA 2XR9A 2G9OA 4YY3J 4O4GA 4AFFA 4TQRA 1Y9OA 4E8UA 2GNKA 1K44A 3KDOA 4M8LA 2OEMA 2VPXB 3LP2B 4ECSA 2DNLA 1F3VA 1VDHA 1NMEB 3G6YA 2AEFA 4C48A 4DPXA 2W1BA 5ETTA 3DMJA 3MMAA 1JMTA 2QX0A 2HS0A 1VS3A 3NEKA 3R3TA 3LP1B 1TP7A 2DB1A 1TVRB 3NWRA 1EKRA 2W8KA 5K4PA 5CCMA 1EAYC 5K8MA 3MPUB 3OVAA 3R9LA 3OUYB 1TL3A 3HSZA 1CJTB 4JI3J 4R0EA 4KYZA 3HXMA 4A46A 1XN9A 4GTXA 1J5EF 3QRQA 3MGJA 3BDGB 2R8KA 1Y10A 1U1LA 1YHQS 3ISZA 4RW7B 4WTYA 4C0HA 2EXUA 1RBAA 2RF2B 2OMOA 3W3SA 1NHUA 1RT4B 2R2RA 4XPEA 1AT1B 3FRZA 5A8RA 3CSKA 3IRXB 5A76A 2W7AA 4QWDA 1U0HB 4CLLA 2HRYA 2ILYA 2Z8QA 4EK2A 4YDDB 4QPXA 2HVDA 2E29A 2BJ7A 4HHUA 1YBUA 3KUHA 4C8LA 4BDPA 3UD4P 4PG4A 1W2BR 3ULHA 1RZMA 3W1YC 1S57A 4DQRA 1WDTA 4IOBA 1FVQA 4DL5A 3ZTPA 1O0PA 3CTRA 2AZ3A 3E51A 1CJKB 5IQ6A 4X64J 1VK3A 3BSAA 5HBMB 4ZCKA 2LKZA 3ZZTA 1EW9A 3W8PA 2ROPA 3BQ1A 2QN6B 3JSBA 4PABA 4KT0C 5LJ3Y 2F3JA 2DTJA 4B3SF 3N9UC 4IH5A 4YN3B 4OZ5A 3K5OA 3NS7B 2YX4A 5LIAA 4KHMA 4FF1A 8RUCA 2IVMA 4C2MA 3PRDA 1XMQJ 4P74A 2UXDJ 4IUFA 3TEGA 1EJJA 3MMAB 2Y0SD 4PWDB 4LR9A 5L1IA 2Y1JA 2VA2A 4QIFA 1L3VA 2AIRB 4I68A 5LSOA 3I0SA 1TKTA 4KRWA 3HP6A 3PIPQ 4LF2A 1QVFR 4NE9C 3ZNUA 1UVIA 4QWEA 5FLXY 4WU2A 2NYIA 3H2VE 5B0DA 3DDKA 1HYSA 2J0SD 3NL0A 4YS2A 3VV2B 4B3MJ 4UT4A 2MJUA 1VJWA 3BR8A 3TA2A 1PIEA 1X0FA 3C6TA 3RB3A 3QGIA 1Z2ZA 3P5TL 1NAQA 3MUVP 3HMJG 1Y5LB 1S99A 3J7ZT 5A8RB 2M4MA 1ZTTA 1H73A 3TZYA 3IWLA 2IBOA 4JI7J 2AJ0A 1EI6A 3T5HA 3GIJA 3IC1A 1RTJB 3BPSP 1V3SA 2RAQA 2VPWB 1SL2A 4DCJB 3BGOP 3T9ZA 3W8GA 3SZ2A 2OD6A 1RWUA 1QLNA 3KTQA 1GMWA 2M88A 1K0TA 4I67A 1AUDA 2FJDB 3MPYA 2YBVA 4OZ0A 5KTQA 2V2ZA 1HMVB 4O3SA 1X4DA 3ADAC 2JC0A 3FVYA 1VQOS 1RI7A 2KXHA 5HMYA 2R3VA 2W5VA 2UU9F 3HSGA 1S9EA 2LQ9A 1VISA 2DRBA 3WAXA 2R8GA 4CO1A 3BGRB 1QM9A 2CNOB 4QYZJ 1T3OA 4EFAC 1NPRA 1R8HA 1RP5A 1IM4A 2X3DA 2ILZA 2E9TA 3QFWA 4RW9A 2MHNA 3QAUA 3B78A 5IV3A 3LQVA 3D6TB 2D3OR 3I0SB 3LALA 1VQ6S 4B56A 3SQOP 4NLUA 4F8RA 4P52A 2V0NA 2AGPA 4CLUA 3R8YA 1RHJB 4ZJLA 2V8DA 4B3SJ 3UN3A 1WC0A 3CCRS 3WQPA 4LBHA 3MM7A 2A2DA 5CH7B 3W5ZA 1SJRA 2ZHAA 5D77A 3OXLA 3IN5A 3F56A 4EO6A 3PRVA 1JQGA 1S49A 5HRTA 4X62J 2YPZA 4ES2A 1IXKA 1EETB 5DJBA 2RKIA 1KFDA 5B0BA 1SPBP 1RK8A 4LIRA 4UOCA 1NNDA 1DTTA 3FCVA 4FF4A 4ZPAA 2YNGA 2E1AA 4OLPA 1FJGF 3CCES 2HK2A 4KY3A 3O1LA 4RJVA 4QU7A 1YSJA 1ICEB 3BKTA 4MHXA 4M5DA 2BW2A 1S7IA 3OR1B 2D3ZA 4CO3A 2CZ9A 4LFAF 4UOHA 2XG8A 4N77A 4AL7A 4USTA 3R7SB 4CM2A 2HHPA 3F0NA 3KNAA 2BJEA 4A8OA 3O6QA 4B17A 5T41A 1A7GE 3AOCA 2IDLA 3KG1A 2AYGA 2MDAA 3BYPA 2AT1B 2DIVA 2XULA 1C1BA 3MEEA 4N8NA 1HNWF 2WSFC 4RW4B 2ZBCA 1YVFA 2CWXA 3PW0A 4ES1A 3E2DA 1NZAA 4PXDA 1NSAA 3Q8VA 2VDIA 4ECWA 3MTJA 4M5KA 2C2NA 4ECRA 2V8GA 3SI8A 1X4CA 4JI1F 1HR0F 3TW0A 5K20B 4ZJQA 3CC7S 3IG1A 5D4NA 4CXUA 5EN1A 1FSUA 1FXDA 3NWGA 4X4QA 2ZC4A 2DHGA 3RB6A 3WBHA 3HM9A 1NK5A 2HHHF 3A13A 4B9UA 2HNZB 4JI5F 3CCUS 2UU9J 2Z2YB 3T1HF 1KQFB 3VAIA 3E2EA 1SHNA 2CQ0A 2WBRA 4NPOA 5DM6Q 1TAQA 3G8SA 1AW0A 2XYHB 2IUCA 3BGUA 3B6BA 4DV4F 5C5JA 2CQ1A 4NMXA 1N0UA 4LF9F 2FZCB 2LA6A 2RKIB 1L3TA 1JLFA 2DCLA 4QIEA 4RBTA 3OTOJ 4IFYB 4I0WA 4UUWA 3BDHA 1CS4B 1DTTB 1NH7A 1HBOA 5A6WA 4NLYA 3PW5A 1RDRA 2NXEA 3VGVA 2DNKA 2EW9A 1T3NA 1S1XB 4WK3A 2XHCA 4OZ3A 4JI4F 2WSCC 2YKAA 1HNVA 2XLJA 2W5TA 1YJNS 4DQIA 2DY9A 3MHYA 5DZ7A 3ONQA 3C6UB 2BABA 5BXIA 1Y5IB 5L1JA 2LXIA 4FF3A 2Y8YA 1E2SP 4ZGAA 2CJBA 1ACMB 3ZTSA 2JX2A 2YKNA 2H4WB 3V6HA 5DLTA 2VFTA 5HP1A 4PAAA 3UFCX 3OPKA 4W92B 2DK2A 3G8QA 3BN4A 2Q79A 1R0BG 2FJXA 1R31A 2IHR1 1U6ZA 2FB0A 3OV7A 1UEUA 3TA0A 4UPLA 1EQ0A 4PEOA 3GILA 4C3MA 5KFTA 5E7OB 3IBWA 3U1MA 4ATNA 1WDDA 3FDSA 2QA2A 1I1GA 4AYBD 2KRBA 4KHPF 1X9WA 3DRSB 4ZHRB 2QV6A 3IG1B 5H1SV 4PXBA 4DV0F 1PGZA 4DEZA 4NXMF 1DBDA 2R8HA 2PDAA 3TR5A 3M2UB 4DR2J 4K4VA 1TL7A 1FT8A 1ZM9A 4FDJA 2KFZA 3NMRA 1TK5A 3Q23A 4KB7A 2O1PA 3HFVA 3FQKA 2IUCB 4I7FA 2FC8A 3CJSA 2IYIA 4UZCA 3MR7A 3KNGA 2L3MA 3E3XA 5J1NA 4FKYA 1URRA 2Q1LA 1IBMF 3GFHA 1DTQB 5DDQC 2HGNA 1A9NB 1SHQA 4Y34A 3HHKA 4B9TA 2XTJP 1K1QA 1HBOB 4P6QA 2EI5A 1RWOB 4UQGA 4RNNA 4E0DA 2ZVIA 1DARA 1N32J 4LFBF 4ED6A 1TAUA 3UCZP 3RGIA 3N28A 4DS5A 1N5SA 4PXCA 4LUBA 3GV5B 3M05A 4M1KA 3DXBA 2R7WA 2ZDPA 1YJRA 2XMJA 4BHQA 1N4LA 2BVZA 1HNIB 3OBIA 4O3RA 3N6NA 1LXNA 3IGVA 3SCJE 3TUZC 4DV7J 4EBCA 4M95A 3G9CA 3CCLS 1OS5A 2W4DA 5LT5A 2PN6A 5GMKa 1NSPA 3GR1A 4F4XA 2ZZNA 1X9SA 5KFEA 2YKNB 5LMUF 2OP5A 1T03A 5DETA 1TKXA 4WE1B 4TY9A 2D9PA 4ZP8A 3L09A 4OZNA 4K8RA 5ETNA 1SKWA 3W7BA 3QMQA 3G4SS 2GMJA 2E7WA 2D9OA 3IP0A 4MIWA 5HVHA 1TL5A 2NS1B 2PI5A 2JEJA 3PKYA 1ZZNA 1A6LA 4PZVA 4EBDA 3CJQA 4GRSA 4UPHA 3ILOA 2AF6A 2P6SA 4RO0A 1KONA 2YWWA 2XYPB 4X84A 3G71S 2OSRA 2UXBJ 3C46A 1H2TZ 2R7UA 1TL7B 3IS9A 4DSKA 2Z2ZA 3J81j 2COLA 5L9NA 3J80U 2B4OA 4NYOA 2M70A 3RBDA 5L1KA 2HK3A 1WTFA 3GLJA 1HNZF 3JQJA 4OYPA 3K58A 1B4SA 1FKOA 3SSQA 5INHA 1YRTA 1KVIA 2E66A 4XIUA 3CC4S 2VF3A 2VB6A 4ZPDA 2OFHX 5SZTA 3N01A 2KFNA 2QMUB 4KHPJ 3UR0A 2B5JB 2V4QA 1VIOA 3T1AA 2ATLA 4J9UE 1S48A 3SDEB 4DV0J 3P6YC 5CD4H 4NXMJ 5KFYA 3NGSA 2ZZMA 1LEOA 4URGA 1YX2A 1U1MA 2JEIA 4DCPB 3DGPB 3NRBA 1JKHA 1FRMA 3W62A 3RBZA 3R7BB 3MMCA 2DGOA 4QYRA 3D1OA 1T03B 2K7KA 4M5IA 3M32B 3ZZOA 1TKXB 1D9AA 3CMQA 2LQ8A 2JEGA 2GAGC 3AODA 1WACA 1REGX 3Q89A 2B6AA 4JYAF 3X3UA 3V5RA 3IR6B 4Z2XA 4DV5J 2C3OA 5BJRA 1H7XA 3RW7A 5AJ3F 3NKMA 2CQGA 5JVHQ 1FNMA 2AJ4A 4YOEA 1NK6A 4JI0F 3T5KA 4YR3A 3MM9A 4OYAA 1OY6A 2ZH3A 1GMWD 4S0MA 4K5RA 1T8EA 3M8QA 4DSLA 5KFZA 4YFUA 4KAYA 1HWUA 4RNHA 3K59A 4H4MA 3HT0A 2EK6A 2Z2MA 3K0JA 7AT1B 3DM2B 2IJNA 1NH8A 3SBMA 5HI7A 2VICA 1IQTA 2CA9A 4DX8H 3CWJA 2KG1A 3IS9B 4FXDA 2Q43A 3PW4A 2XRGA 3K7RA 3C16A 1RWWB 3W5XA 2CPHA 5K8NA 3HD2A 3SFGA 1HI0P 4C4WA 1OSDA 2EFVA 2HSEB 4GO7X 1FKOB 2CKWA 4IO9Q 3SXLA 4X65J 3QLHB 3RR8A 1RKIA 2IY5B 4EGLA 1Y3JA 3QRPA 2V8VA 4OFZA 5F8LA 4Q2LA 1OY9A 1WG4A 1KR4A 1WEZA 3QIPA 1EW2A 1BQMA 4QOTA 1U2FA 2JVOA 4PPDA 1D3WA 3V2UC 1N34F 2HNDA 3QT8A 3NOCA 1FVSA 4KH0B 3VZHA 5L0KA 1GFWB 1TKZA 1WF1A 3CCZA 3CMAS 4WZQA 4XK8C 4C11A 2R7VA 1JKHB 1TUGB 2IA0A 3CJKB 2ZH2A 2W9BB 1Q4RA 1F60B 1HNZJ 2E5HA 1QTNB 3KLGA 2BM1A 4P71A 1TL4A 4EI2A 1ZM2A 1Q86T 2FGOA 5GMDA 2DNHA 1V5IB 4IRCA 3QJJA 3N0VA 3M6WA 1U45A 1GXLA 2YY3A 3TARA 3HSDA 2KO1A 5KT3A 2VQRA 3QATA 3T9NA 4J9MA 4HT5A 5LXYA 3G6ES 3SZZA 4F4YA 2BRLA 3MPVA 3N79A 3IA0A 4ZOSA 2R7OA 1FNXH 5ADZA 2QFJA 2OAUA 4WXWA 3M8QB 2W9AA 4FKXA 3QT6A 4O3QA 2YVSA 3D0HE 2L08A 3OJUA 4CNZA 3ETOA 2F8HA 4H4MB 4LF6F 2HBQB 1U26A 3CJ5A 1IBKJ 1CJUB 3TO8A 2F4VF 5D0HA 5BYSA 1QTMA 2C3YA 5DQHA 1XK8A 3C16B 3PO5A 1UJ5A 2MZRA 4DV3J 5IOLA 2L9DA 3GG1A 1DQ9A 4CM0A 2VBWA 4IFVB 1SJFA 4X4NA 1VRTA 1HBNA 1NB2A 4N56A 1HBMA 4ZIVA 1HKAA 1SH0A 3MECA 4X66F 2HKEA 2JDJA 1U48A 1SV5A 3PNIA 1BD6A 1IKWB 2VQEJ 2Z2LA 3HHDA 2HG4A 2KRRA 1RAAB 3RYLA 2IYGA 2ZHOA 1BC6A 2JOQA 2MZTA 1RLCL 5J2QB 4ECQA 4BC9A 2VL1A 4USMA 3PZPA 5C2GA 3UCUP 2NSBA 2WVFA 3TA1A 2Y8WA 4LSNA 5KFBA 4NLQA 1F5BA 3V6JA 1NK4A 3OXGA 3LH2S 1AJDA 3Q8PB 2BJDA 3FEZA 1W25A 4KQZA 3QT5A 1TMMA 4KAIA 3KLGB 4PQUA 1HQUB 2WRMA 1SH2A 1YWXA 2RNEA 3Q83A 3OLAA 3DLBA 4OYBA 1UPPA 3WX8A 2OUGA 2ZC3A 2XY6A 1FWKA 5EWEA 4A47A 3NKPA 3PX0A 2AYBA 2LXFA 2VBXA 2HAIA 4DUYJ 3PW7A 4UQTA 4ES3A 3DOLA 3LP0A 1QUVA 4KPCA 2QFIA 1SL0A 2AQ4A 4F4AA 4YB6A 3EXYA 5CD4A 2LVWA 1OY8A 2H54B 4NZ6A 2FLPA 2LDIA 3G2XA 1QY7A 2WTFA 4DWIA 5KG3A 3CCJS 3R97A 5C24B 1D09B 5DG7A 4TVAB 3US5A 2WCXA 1FWPA 1BE4A 2Y0BB 2YKMB 5HK4A 2VV5A 4IKAA 3I5CA 4ECUA 4ED8A 4DUTA 2AZ1A 4WZMA 2IRXA 2HWHA 1IJFB 2HZVA 5HO4A 2M7SA 1HBNB 2UUAJ 1HBMB 4BBYA 2ASDA 1FJCA 5KT5A 1CULA 3VAHA 3CJ2A 2LU2A 1R0CB 4YR0A 4DZ6A 1LOUA 1U1QA 2CJXB 4ED3A 1RKJA 1EW8A 4CLWA 1HQ2A 5D0GA 5A2QU 1M90T 2D74B 4QU6A 2ZITA 3TJ8A 4ERDA 3POTA 1T9XA 4C8NA 4LSNB 1N2LA 2F65A 1P49A 3FBFA 3H42A 4JI8J 4OJ3A 2MTLA 5I3UA 5HVFA 3BGLA 4DLGA 3EWGA 2YNFA 4PQUB 3BEGB 5LMNF 1Y5NB 3CE8A 1NJZA 1HW9A 1S77D 4KV8A 4TY8A 5KFXA 2Y9HA 3H7HB 3MEDA 2KT5A 2MPUA 2CPJA 2FVQA 1HWJA 4WJBA 2QLWA 4ZLLA 5CZXA 4MIBA 4ED0A 3DOLB 4USWA 3LP0B 4DSFA 1ZS6A 1IKXA 2PMWA 2OH2A 1BQNA 1GMVA 2FJVA 3LF0A 2FDNA 1Y11A 1S6QA 3LWMA 1WHWA 3V81A 4LREA 3KG4A 3BSNA 3ENQA 3AOAA 2ZZTA 4Z37A 4DV6F 3G82B 1MLAA 5E3CA 2JSXA 4DFKA 4PXEA 2XS2A 1P8GA 2GA7A 5KG2A 2BKNA 3KLFB 4O0NA 2GVDB 2HGLA 4IG3A 3CD0A 3KK1B 4QW9A 5DDRC 3CCWA 2MHEA 5T14A 2W2NP 2ZH8A 4NLRA 1VBZA 3THTA 2M8HA 3QZ7A 1O51A 1RCXB 2CZ4A 2ZDOA 3WC0A 4MTPA 2HAFA 4DFJA 2KYZA 1IKVA 1U24A 1XNRJ 1S9GA 1NDKA 5DO2A 3CCVS 5ETRA 1CULB 5DQGA 4JI6F 2LU1A 4AE5A 4K4XA 4CT8A 5HROA 1C0UA 1IKYB 4OMFG 1ZA1B 2YQ0A 2RH6A 3CDAA 3KLIA 2LDYA 2KHDA 5KT2A 1CG2A 5F8NA 2V69A 4TNOA 4FBTA 3RU0A 1BLUA 3NKRA 2L9WA 3MD3A 3CB4A 1QDUB 1U8WA 4F02A 1HHTP 2VKRA 2UUBJ 2R7SA 1FKPB 2K1RA 2O67A 4I2PA 1XR7A 1FERA 1WI6A 3W2VA 4ED4A 3M4XA 1PJ5A 2YNFB 3AJ1A 1EKSA 2VHGA 3LA0A 3RG6A 2WVBA 4K4SA 1K1SA 2CNLB 5CA5A 1QD1A 4QIWD 3ZZYA 2N3OA 2GMLA 1R8BA 5IWAJ 4Y3CA 2CQ3A 5IFMA 3MEDB 4BLGA 3IGYB 4U7UD 2BANB 1LWFA 3D6MB 1NM2A 2LEBA 4LF4F 2XWYA 3FRYA 1RT6A 4DR4J 3C15B 2LYVA 1NDLA 4YQWA 1T11A 2MQLA 1UA0A 5GRRA 3KJFB 3UVJB 2B4VA 1S6QB 3TG0A 4Z7CA 3G6XA 2N4DA 3A3NB 2XMMA 3VWSA 1KBRA 2VU5A 2HHXA 1U7LA 1VQYA 3M8PA 2H65B 1JLCA 1WOSA 2CNNB 4IG3B 2IRUA 3SV4A 1XERA 4F26A 3CJ0A 3QNWB 4B3RJ 1B99A 4I1TA 3CF5Q 4ZP6A 4IO1A 4K2XA 1Q0NA 3HVAA 4YB5A 2V4JA 4W90B 1VQPS 2QYGA 2FVCA 3BO4A 1D9DA 5KFUA 3NKYA 1S9GB 2XCAA 1FA0A 1W2IA 1NLKL 2F8EX 3AXMA 4QWCA 3GIMA 1VRUB 5DRKA 2JLGA 4ETXA 5HROB 1FDNA 1C0UB 3HX9A 2E5JA 2Q3PA 3QJLA 5J1PA 1RUSA 1HJKA 5AE1A 2BEFA 2E44A 5A8KA 4DR3J 1GX6A 3TYTA 2BR0A 3MD1A 3HJVA 3IM9A 1K7HA 1S59A 1KHKA 1FHTA 3CULA 3QBCA 1UWAA 3TZXA 4YB1P 3DLGA 1IUJA 3M6XA 4UUXA 2FLNA 2XGQA 3W2VB 1YJWS 3WAWA 2IC3A 3LXQA 3FMWA 4R5PB 5H9EJ 3OXFA 4RBVA 3EVWA 4QWBA 4JI6J 1R0AA 1E3CP 1VYAA 2QG9B 1X60A 3KJNB 1HA1A 2IM2A 3DYAA 2BE2A 3PJ9A 4ZVPB 1QE1A 1GX5A 1X9MA 3TRGA 3RAXA 4F0MA 4LR7A 4J9VA 2RUSA 5HJYA 1UVMA 2AGQA 2UXCF 3M9OB 2H51B 1MWQA 1KOOA 3JSRA 4O44A 1AJAA 2C22A 1SI9A 3MUTP 1HQEB 3C14B 1YG0A 4ZPVR 5IXUA 2W8LA 2YWEA 2OPRA 4URSA 2OPPA 2AMCB 2N7YA 3DDNA 2AX0A 4EYHB 2UP1A 4GO5X 1VK8A 5HQMA 3D3CJ 2JFDA 1YJUA 2DHXA 2DPJA 4LF4J 2M0GB 1HHQA 3A8IA 4CIOA 1L3SA 2CG4A 3IFEA 2DNYA 1RWNB 4QIGA 1Q79A 4F2SA 4KPYA 4P73A 1C0TB 1PKUA 2HYIB 2YKOA 4OX7A 1ZPWX 4RW8A 4GKKF 4NWJA 4WKRA 3HHLA 1S1WA 4GVLA 3V6DA 4AQYF 1QAXA 2HFOA 3MK2A 1PYOB 1HI8A 2CQCA 4OHZA 3WIVA 3AQOA 1ZEBA 2MKCA 2YXLA 1PC5A 3KLHB 3S8SA 2NXNA 2XS7A 4ANDA 4EUVA 1F3FA 2OIHA 2ZFHA 1N2KA 2OD4A 4K0KF 3CDWA 3P96A 3OVSA 4NL5A 4K4WA 3PYDA 4ZVQB 2J9DA 4ED1A 1S0MA 3EX7B 4MAKA 3IO1A 6FDRA 4LFCJ 3W64A 4C8YA 3LW5C 1H38A 3PTWA 4ZK7M 1XBWA 3R2CJ 1RT1A 4ICLA 1WHVA 1KQGB 4ZVRB 4ID5A 2VOOA 3DYAB 4OYOA 4KIAA 1NXIA 1UFWA 1K8AT 3QZ8A 2KVQE 1DQ8A 5L1LA 3LPEA 3Q8QB 3GIIA 3BM7A 4NLPA 1CQMA 2DH7A 3CVKA 3EVOA 3DKDA 2MQQA 1KVKA 2VG6B 2W2PP 1X4AA 1UVKA 1VQ9S 1K73T 2J76E 2YX7A 4O44B 2LFVA 3SCIE 2NPIA 3H25A 1U0SA 1VBXA 4NZ0A 4CYSA 2DD8S 3UCGA 3MAAA 4TXSA 2VJVA 2OPPB 2UV8A 2AEJA 1H72C 4LF7F 3IAM9 2X7IA 4A8FA 4TN0A 1FDDA 1Q8BA 4IDKB 4DX7A 2N82B 3GFXA 1JLGA 3I4PA 5IM0B 2DNPA 3U1LA 5C25A 4BWJA 1E1ZP 1OPIA 9ATCB 1RU2A 4W4MA 3N5FA 1RWXB 3D0IE 4DF8A 1RWPB 1U02A 4MH8A 2GZOA 2NUUG 3EZUA 1BWEA 2JC1A 4P7TA 3FBEA 2MZJA 5KG7A 4DJBA 3CC2S 4TKTA 4C3LA 4O23A 4ZVTB 3J7AN 1Q1KA 1FD2A 3TI0A 3H20A 3WDOA 3Q8RB 3TZZA 4OX6A 4J9RA 2A10A 1URBA 2RVJA 3AY0A 3I9V9 2EC0A 3WIUA 5IC6B 4CLSA 2J9EA 4ZLPA 2ZUAA 3P49B 1HPZB 5DDOC 2AU0A 1NJXA 3KYLA 2CQHA 3DRPB 4L6V3 3GZ7A 1OSCA 4KJIA 2E1MC 3L9ZA 4CDIA 4NWXA 1CJVB 3AXKA 5F8MA 1FEHA 3KKFA 3TZWA 3CNQP 4LSLA 4NRUA 1RT1B 4LR8A 3FQLA 2OSQA 1TQLA 1G7CB 2JLEA 2QRRA 2MKSA 3IR5B 3MOZA 3PEHA 4R0JA 1JNRB 1F9FA 2YX1A 2F1FA 4EBEA 2VQFJ 3I82A 4XO0A 2DHHA 3NGUA 5GVQA 1SKSA 4USUA 1RT7B 3QO9B 3RAMA 5B7WA 3AT1B 2GW8A 3PW2A 2IMOA 4Z7YA 2E1RA 3HLUA 2D69A 2BQ3A 3ET6A 3FSIA 4A8YA 3JAMU 3D28A 3HKZD 1QAYA 4F4WA 2UUCF 1HWLA 3GQCA 1UJ4A 3AA9A 5ETPA 4FF2A 3C2PA 3N5BA 1MMLA 1E6YB 1JLBB 4EU0A 4KSEB 4ZPBA 4PG8A 1ANJA 4OX9J 3CMRA 1WNEA 4U8VA 2B4PA 2IM0A 2V94A 2BW7A 2FGCA 2B9WA 1JK9B 4M5LA 4MIVA 1N88A 5MAOA 2BX6A 3B8HA 3NCRA 1N5TA 4WP8A 2MKHA 2W7OA 2A1BA 2FY8A 3FFIA 5L38A 2LQJA 2ZE2A 4K4ZA 5K9FA 4CLTA 4ZMMA 3BKFA 3CEDA 4E2FB 2CPIA 3NVLA 4I2QB 2YPYA 2F8MA 4CO0A 1LNQA 4DU8A 3LPYA 1S7HA 3A1YG 2DNGA 2H5EA 1HIYA 4DUZJ 2BKPA 1VLYA 2B0GA 1O8BA 4HI1A 4CH1A 4LF7J 1AXQA 5I42A 3TAPA 5CYQA 3PV8A 2CFXA 4LBIA 2ASLA 4NEZA 1WHYA 3GV7B 3W65A 4B9VA 3C8YA 4YHHF 2MSTA 4NI2B 4OLOA 4OJHA 2XLIA 4JOUA 5KT4A 4FXWA 3NAHA 1UL3A 2CVIA 1XMBA 5IJSA 3BR9A 2RRBA 3MM8A 3GIKA 4IRDA 4UPKA 1FI4A 5IS2A 4CLYA 4OZJA 1ELXA 1OYDA 1LKZA 2I9SA 2XQCA 2ALZA 1AROP 3I56S 5G0RA 2VFVA 1LQ9A 3THPA 2PEBA 4C7QA 2BA9A 3S6EA 2V8HA 3AJ2A 1YK9A 3H5UA 4Q45A 5F8HA 1OQ3A 1TV6A 3GTYX 2ZBPA 2H5IB 3ET6B 1W7WA 1HFEL 5CCLA 3MEGA 3RTVA 4G6VB 4ZCIA 4ZKAA 4C8ZA 4DR7F 2KL8A 2ZH5A 4K50A 4QR1A 3HHLC 2MZQA 4KBIA 4K4UA 3TQEA 3ISNC 5E33A 2FJEB 4C6AA 5KFJA 3PFEA 2RILA 2FQQB 3PY8A 1GTHA 1Y7PA 1AA1B 5KFAA 2ZWOA 2KJVA 3BBCA 3KJVA 4X4TA 5HLFA 4JV5J 4OYWA 4HHJA 2HVEA 3FFIB 4OYIA 4CI0B 3OL8A 1H3DA 1BXNA 2A6OA 1NK7A 1C4CA 1LWEB 3W9JA 4LF5J 4GKJF 4DSIA 4DL6A 2XZDB 1U6BA 2LQ5A 3IDDA 3BPDA 3HT3A 4WK1A 3E01B 2CDRB 3S01A 1CVJA 1Y6VA 3OT9A 4ZP9A 4IOAQ 3MR2A 2RQCA 2N4CA 3WBZA 3PR5B 2VC1A 3CCMS 3LO3A 5FLXU 1HDHA 1RCOB 5EX3A 3NBPA 2ZD1A 5CYQB 2RJZA 2XMVA 3EVMA 4U9RA 2YQ3A 5KFPA 1UJ6A 2V2KA 2DCUB 4D3HA 4FVMA 4PYDA 3R5DA 3D6FB 2OO4A 2P9CA 5F9NA 5KG1A 3BSOA 3LP2A 3MM8B 3I32A 3TVYA 4YUDA 1YITS 1GMUA 3NOGA 3KMQA 1DFDA 4HACB 3BDEA 4HI2A 2HBZB 3GSDA 4WFBQ 4G1IA 3NKNA 5G0RB 1P1TA 2XSFA 3LP1A 2RQMA 4ENOA 2C2EA 2CADA 1S0OA 1TVRA 2J0WA 2F9DA 2Q66A 2HHWA 2DGWA 4XPCA 5AE3A 1FXRA 1KRPA 1ZZFA 2GQ2A 3OUYA 2RDJA 4OZ2A 2RRAA 2WONB 3GFZA 3MEGB 2PA8D 2ZWPA 2HNYB 1V3ZA 2XZTB 3K57A 3BDGA 4PKDB 2GX8A 5LM7E 1VIXA 4TQSA 4FS1A 4IH6A 2MKIA 2RF2A 4A8XA 1RTDB 1M5HA 4HEA9 2FHJA 1RT4A 1CEZA 1FD8A 3UE2A 2PMHA 1WG1A 4ZVGA 3FSYA 3IRXA 5C42B 1U0HA 1EQJA 4Y2CA 2DO0A 2JNJA 3X1LB 3AD8C 3QT7A 3KJVB 2GHWA 1FFSB 3FJ2A 1R8AA 3HVRA 4PWUA 2CQ2A 1IVZA 1H6KX 3BJYA 4CLZA 3R7NB 2JRSA 3GU0A 5DGBA 4WKYA 2C42A 1CJKA 3LGHA 4X4RA 1TK0A 1UP1A 3UDEA 1T95A 5HBMA 2E5LJ 2CVEA 1ZAXA 2C3PA 3M8ZA 5D78A 4C98A 1LXJA 4LR2A 1U49A 3AOBA 3EDQB 4FPRA 1KH5A 2GGPB 2ROGA 2QEXS 2PIIA 5KT7A 2KM8C 3OHAA 3G6VA 2ZJQQ 2VZ9A 4A8SA 1HNXF 1SC1B 1FX2A 3HO1A 1YZ7A 4JI2J 3H40A 1RAHB 2IRYA 4MKBA 3DRRA 3N6LA 1PCAA 3L7OA 4PWDA 4MYUA 3ED4A 3HHLD 2FJBB 3OSPA 1JB0C 2IBKA 4H54A 3K5MA 3QYYA 3ISND 2XNRA 2OTJS 1O98A 2EFQA 3ZXWA 4JBCA 4HT7A 2ZM6F 4PPZA 2F40A 1IBLF 4MJKA 1GAOA 3Q8SB 3SQGB 3CIZA 3CJRA 3G8TA 2GCFA 4AXIA 2W2MP 1SJ4P 5IT0A 5HMZA 2J0QD 5DG8A 3SEOA 1G6BA 4Y2MA 3ENWA 4XAKA 2KU7A 3HJFA 2GJ2A 2BM0A 3DN9A 3ZZZA 3EGZA 1VQ8S 3MM5B 3GG0A 1FWLA 3KHGA 5BR8F 4ZG7A 4KJGA 3UO0A 2RT3A 1RTJA 5E0OA 4V19X 2NYHA 2VDHA 1RYRA 1WUUA 1O6XA 4OHYA 4MFBB 4RNMA 3HI9A 2C2ZB 3DGVA 2GIQA 3M2VA 1GH8A 3D54A 2DXFA 2IAJA 2QJ3A 4DBQA 4DR1F 1RB0A 1HHSA 1HMVA 4CYUB 3TUPA 1FO1A 3WHIA 3JB9k 2AD9A 1XMOJ 1E6VB 2W7PA 2XB2D 2YTCA 1Y0HA 1C4AA 1HWKA 4DL3A 5KFDA 3BGRA 2AWZA 2W01A 1U2RA 4J9NA 1U09A 1URAA 1I94F 2DR5A 2HEKA 2JVRA 1N6QA 4ANEA 2DT9A 1VGYA 1TTHB 3DRRB 2CG8A 1ZEFA 1YI2S 3FGVA 4NMLA 2MKYA 4JV2A 1RHMB 2K7JA 5ETKA 2LECA 2F63A 2G13A 2O01C 4KGKA 2FTRA 4YEAA 5KFOA 1REVA 1FX4A 4U6PA 3D66A 4AUKA 2CPEA 1MU2B 1NJIT 3T00A 1NSQA 5B0AA 5KT6A 1VQ5S 1MWYA 2J7KA 4M5GA 3ELHA 2W9CA 3K8VA 4QQBA 3KHHA 4LVOP 1XNQF 4OZ1A 4CXSA 3PRBA 5JVGQ 3Q2SC 5LL6d 3FSXA 5A8WA 5D3GB 3T1YF 5EWGA 2CPYA 5KOWA 3QGPA 4OI2A 1SB6A 3OQ2A 1TFWA 3TANA 1Q95G 2CNKB 4HDHA 1RJJA 2QE5A 1EETA 2DXEA 3TNVA 2KJWA 2OELA 2FVSA 2YWGA 3LUYA 1NSKL 2WK4A 4P9SA 2M8DB 1FEEA 2I8EA 3CO0P 4P2FA 3EDRB 1X5OA 1LK5A 3D1QA 2J9DE 3KLEB 5F8IA 3TOQA 3M2VB 4U7CA 2XGPA 3OR1A 1FXLA 3ZFVA 1RADB 2IAJB 5KAKA 1J5EJ 3L7UA 4ECVA 5KXAA 4UY8T 2RIJA 2KZMA 2FHOB 4DN9A 3H4DA 1VC5A 3RUBL 4Y2AA 4PWWA 3LWLA 2N3LA 1KH7A 1JLAA 4IG0A 2XY5A 2JL9A 5K5MA 1JLEA 4RW4A 1N6QB 2EG1A 3H98A 4J5OA 1UMJA 3CCQS 2FHKA 1UCNA 3J7YI 5E41A 4HDGA 2Y3YA 1SJQA 4NLSA 2EK1A 2JHEA 3VF0B 1J5OA 1C2PA 1H2UX 1RBOB 1REVB 2ZH7A 4CNYA 3H2LA 4I6WA 1CLFA 4OV1A 2DR9A 3GIRA 1YDLA 2Z57B 4CWBA 4P10A 2R7TA 3CO9A 2HNZA 3M8YA 4KE5A 2AGOA 1B0TA 1BHNA 3AAWB 2W9CB 1UVLA 2GV1A 3NS5A 1ED9A 4QYZK 3DDIA 2JH3A 3JSMB 2MSSA 5A8WB 1X8DA 1I94J 3AD7C 4L3KA 2BJ9A 1MMDA 4L74A 1Y00A 2NXJA 1QJHA 3H5YA 4K4YA 2JWNA 1UAWA 4CQ1A 3S7RA 1PSDA 4IR1A 2JLFA 4IFYA 2C1EB 4G3IA 1CS4A 1Q16B 2VKZG 4ZIWA 3SFUA 1JXVA 5IC4B 3MMBA 2H9ZA 3UWTA 1S1XA 2BV3A 3QWPA 1YJVA 2XNQA 3C6UA 1N36F 3OL7A 4OQJA 2YKPA 1GXUA 4QCLA 2POKA 3A12A 4KGVB 2CQDA 4AT1B 2ROEA 3VAJA 4OYZA 3BO3A 4TU8A 3BZQA 4B3TF 5J2MB 3I4HX 2HIYA 2UUWA 2X1GA 1ALHA 2DISA 4X4VA 2UVRA 1TMJA 1FRJA 5EX0A 5D6GA 1YBAA 1JLAB 4IG0B 3KDNA 3H8YA 3D3BJ 2BJ8A 1JLEB 5KFHA 2LP4A 1GXTA 4Q44A 2XYGB 1N54B 2ASJA 5DLFA 1JJ4A 1K9MT 2AEMA 2XO7A 1RSCA 4A8WA 1JJCB 3FBBA 4B3OA 1HARA 1J5OB 3HFZB 3DRSA 4DQQA 4ZHRA 3I31A 1UA1A 4IRKA 2FHMA 3OTDA 5AXNA 1HL6A 1QAJA 2YH0A 3M2UA 2HHTA 5E2QA 2ZHBA 3IXQA 1NRKA 1EZZB 3DPCA 1NZ8A 3J7Z5 4ETZA 1D1UA 1X4HA 4YP3A 3HK2A 1PBAA 3TAMA 1VR6A 1ZAWA 2DHAA 5E3QA 1JX4A 5KG6A 4X4OA 4ILRA 4KGMA 2XHWA 4LIWA 2DVIA 5FDLB 2KT3A 1N5QA 5JJBA 2Y1LB 1XC9A 1DTQA 2NXCA 1E33P 4D3GA 3KHLA 1PBUA 3QWUA 2PD1A 2KVIA 1ALIA 1X7VA 2QA1A 3RRGA 2ZOMA 3O8WA 1M1HA 3SYZA 5THWA 4K7QA 3FCHA 3MMBB 4DR5F 1B64A 5F9LA 1R3NA 1RWMB 3RJMB 4I6YA 1HNIA 1SUQA 1M5SA 1RLDA 2GAHC 3MAHA 3C3LA 4M94A 1NKCA 4URQU 1KNZA 1N0VC 2NZCA 4KC5A 4OHVA 4WE1A 2FHJD 5F8JA 2VG5B 4H4OB 2K3KA 4Q5VA 4L73A 3D9BA 2HHSA 4I56A 4Q8FA 3PACA 4UPIA 2BBEA 3BV8A 2I6WA 3ILIA 6AT1B 1TK8A 2UVWA 1FJGJ 3GCWP 2GVZB 3FNNA 3J7YU 1RAIB 1L5UA 4B3OB 3VAFA 1RWKB 5EGHA 2CUYA 2BQRA 2VODA 2ZH1A 3A4TA 2BXJA 2DEJA 4LFAJ 1FRXA 1X5PA 4WP3A 3GSIA 2J6TA 3TAQA 4UORA 5CHCB 1TR0A 3SSSA 3MFHA 5ETQA 4XDDA 1RABB 3DHWC 1RTIA 4OI3A 1BMQB 2RU9A 2XSJB 2DGVA 5TJ3A 5E3PA 3UR3C 1G3OA 1HNWJ 4DSJA 4HTJA 2V9KA 3TAMB 3NNHA 3HPOA 2APOA 2C2DA 4P2XA 4CLFA 4OZLA 3B82A 1KHNA 5E5NA 2R7RA 3PYFA 5JUMA 4F3MA 4JI1J 3RBXA 2ACMA 1HR0J 3DLKB 3K5PA 2QT7A 1YZ6A 2UVVA 3EXCX 3D1HA 4NRTA 2B5JA 1U1PA 5L39A 4LF8F 2DY1A 4YR1A 3SDEA 4F67A 1GK8A 2B9YA 3OTBA 4I6AA 2HHHJ 1P1LA 4QPTA 2EG2A 2ABYA 1NDPA 4JI5J 2J0XA 1MMNA 4LQ9A 3M2RA 3T1HJ 2HBYB 4RWWA 2CPDA 1SUQB 3DGPA 2PEHA 2HQCA 5G4DA 4YY3F 2EFGA 1UWBB 4ZN3A 2HRTA 4DV4J 1WKJA 3MF5A 3IWXA 3ITHB 3M32A 4LF9J 5D15A 4B08A 4UW2A 3RRHA 2BZ2A 2LMIA 5FJ4A 1SC3B 3K2YA 2WB4A 2HMIB 3DXSX 3ZZUA 3PHTA 2V50A 2KB2A 2NCKL 2MMYA 2UZAA 3M30A 2ADBA 4JI4J 3TX0A 2J7WA 2BJ1A 1NK8A 1QSSA 1DLOA 5M2PA 3Q0AA 3BQ0A 2FY1A 4JI3F 1RE1B 1NO8A 5AT1B 1RA7A 4P72A 4QBUA 2O3DA 3DM2A 3R5JB 2NREA 4LT6A 3VQSA 3B5QA 1NKEA 1T0TV 2CJAA 1ZYQA 1WD6A 4DL7A 2W5RA 4DOZA 3GMGA 2NPFA 1B3TA 1RTIB 4FYWB 1NK0A 2HQIA 3MEKA 1SC6A 2I2YA 3V4MA 2W5XA 5J2NA 3Q8UA 2G2ZA 4IQMA 1VLOA 2ANHA 2LEPA 4OHWA 2VC0A 4PCQA 3ZTQA 1KQKA 2Z0GA 1N5VA 5D8HB 1S0VA 3ICLA 2WAQD 4J9KA 2M9KA 3QLHA 4NLOA 4X2BA 4OYXA 5U47A 2DHSA 3KJQB 4N76A 3Q8YA 1N48A 4DG1B 4NX9A 2W2QP 2IM3A 5M2RA 3OSNA 2DGUA 2F7VA 3VAGA 2RH3A 4OV6A 4X64F 2ZVSA 3ZTRA 1AFJA 4FDFA 3KHRA 5C66A 2VH7A 3PFOA 2RDIA 2YNIA 4OHXA 1MN9A 3M2RB 5KFFA 3PHEA 3RB0A 2DNZA 3CJKA 4USJC 2W9BA 5GOVA 3UD5A 2B4UA 2DGQA 4EZ9A 2CQ4A 3KUGA 5HAOA 1KKHA 2MEWA 1DZ5A 1PC4A 1UPMB 4G1PA 3IBCB 1XMQF 1KC8T 2HFVA 1IBMJ 2UXDF 1Q5VA 4MKAA 3PM9A 2CJ9A 3MUMP 3I6PA 2CJYB 4GC7A 1P27B 1F9EB 1FRIA 4Q2MA 4LF8J 4MK8A 2XZWA 3DOKB 2MY7A 1EP4A 1JJHA 4LFBJ 3M30B 3VHQA 5DZ6A 2MQOA 4WXOA 3NAIA 1DLOB 2MYFA 2ZNZA 4B3MF 2DR6A 2AJ1A 1MROA 5D0EA 1CJUA 5LMUJ 4L72B 1FRLA 4CCHA 4L75A 4NLXA 4TYAA 2R8JA 4YMEA 3T6BA 2D1GA 4FN5A 4Y65A 4C97A 4B9MA 4IFVA 1N5YB 4NLVA 5J2NB 4RW6B 4ITSA 2IJFA 4JI7F 4UOOA 5HMWA 1S10A 3P8BB 2GS8A 2G4BA 3KOAA 4WPAA 1RT2A 2CDQA 4CTAA 4YR2A 1ULRA 2YWHA 3OL6A 2HZCA 3RRKA 1IKWA 4G1QB 3D67A 5B0EA 3M6UA 1KHLA 5HL7Q 1U4BA 1VBKA 1RHKB 4WP9A 2YWFA 2V67A 3A8KA 4IOCQ 5J2QA 1H74A 3LAMA 5A0YA 3HVTB 1B70B 2NQPA 2YNIB 1F2GA 3MR3A 3EGNA 4ZG9A 4ECXA 5D4OA 1FFGB 2KN4A 2QLJB 3A52A 2FJWA 1S72S 1OO0B 4DV1F 2C3UA 1WC5A 4HH1A 2XY7A 3N6MA 2VASA 2R7QA 2B7CB 4V1Ak 2HVIA 3F73A 2L9NA 2E1CA 1HQUA 1TZ0A 4WF9Q 1ITPA 2MZSA 2Y1RI 1APSA 2CQBA 4LQYA 1Y4ZB 3QIDA 4OI6A 3TUJC 2HFUA 2DNOA 2KI2A 2V63A 3DHXA 1S5ZA 4L3NA 4C8MA 2ZOGA 1WEYA 3ENVA 4NYPA 1RAOA 3RW6A 1VBYA 1WEXA 1T9WA 1EP4B 2MQPA 2I0XA 2JJ4D 2WW8A 1SQFA 4UF4A 2EC2A 4HVZA 1RACB 3FCWA 3V6KA 2C3MA 1Y7AA 4Q0BA 3FZ2A 4FNIA 4MYTA 1S4FA 2A18A 2VG7B 4KKOA 3R5AA 3VZIA 1FTRA 4O4GB 3ETMA 2R7XA 1EARA 1MROB 5C24A 2VJUA 3M1VA 2BYCA 3W2WA 4HH0A 4X62F 3T02A 2YKMA 2EWHA 4DPUA 3DMJB 3SCKE 3LOUA 4JYAJ 2K8GA 2XMKA 4RKUC 1D8ZA 1SL1A 3NKOA 1SKRA 2HRUA 3FUYA 2B3TB 3VQTA 5AJ3J 3HKWA 3RZAA 2HQDA 2R4FA 1RT2B 4CTAB 3LTOA 4JI0J 3J81Y 3T01A 1S1TA 5I3QA 5HATA 1TL3B 4OI0A 3NLCA 5KFKA 2C2KB 2QTWA 5HQLA 4U67Q 3A8EA 5A0YB 5HSPA 5FIIA 4DMZA 1RTHA 2U2FA 5F8GA 4ZVSB 2W24A 1LWXA 2Q6BA 2V68A 2X98A 3O44A 3BDFA 1B8JA 4RUCA 1JXEA 1VQ4S 3OHBA 3B4DA 1RYSA 3PR4A 1AFIA 1Q7YT 1UW4A 1WC4A 3AJDA 1L3UA 3S1TA 1VCTA 3RBEA 1FESA 2KFYA 2ZBIA 2GO8A 4F3OA 4PUOA 4P2MA 2F4FA 1FRKA 2GHVC 2KXNB 2W5WA 1S6PA 4U8YA 2FPHX 1MW7A 1N34J 4DPWA 1YJ9S 3AHPA 2EBGA 1UEVA 1PAUB 4CO4A 1U6FA 2XBPA 2P2CB 3PCOB 2MQNA 4Q0BB 1FDAA 2AJFE 3WAYA 3R27A 4DV1J 1AJCA 4KKOB 3PIOQ 4ER8A 4KH1B 2AJ2A 4DL0C 2B8PA 3G82A 3UQSA 4WWSA 3M1VB 1VHIA 3W2WB 3M8WA 5AXLA 2I5JA 4LMZA 3KLFA 3DLEA 3Q3QA 1H0HB 1W26A 2GVDA 2MZ1A 3KK1A 1Q78A 2B43A 3BREA 1KTQA 1WF2A 1LWCA 3UD3P 1F5AA 3OTOF 2VONA 3MOJB 1U1RA 3FEXB 1TFYA 1TKTB 1I51B 5DM7Q 2NR0A 1C1CA 4ANCA 3R6GB 1V3RA 1QSLA 4GTZA 4C0BA 5E3AA 1IKYA 1S1TB 5IT9U 1HYSB 3ZNJ1 2FIUA 4LF6J 1Z1ZA 2DRAA 2F4VJ 4F3QA 4WFXA 2QA4G 1KSPA 4FBUA 3VALA 1RTHB 3C6TB 1CSJA 3AQPA 1P9YA 5ETSA 2ZJRQ 4PG6A 4NCGA 1LW0A 2X3GA 4RU9A 1KLMA 1FKPA 1SJ1A 4A8MP 3VR1A 3DLLQ 1VQSA 4ZVHA 5KG5A 3H2UB 2MLYA 2FJAB 5L0BA 3IR7B 1UZHA 1WKLA 3GYXB 3VAKA 4EO8A 5EHHA 4X66J 5F3ZA 1X4EA 1Y3KA 3IRWP 3T41A 4PUOB 1U1KA 2IVFB 5M2UA 2H1YA 2BANA 3IGZB 4DS4A 1S6PB 1BUXA 2KH9A 2V8PA 4CO5A 1XWLA 5GAEI 4WIIA 3C15A 2OJ3A 1KD1T 1T9UA 2V2QA 4M5NA 2EPIA 3F44A 4DR2F 4FXVA 3UVJA 4J9QA 3MCSA 1WHXA 1TKDA 4GTYA 1NPKA 1S9EB 2CZVC 4X4UA 3FBCA 1R8PA 3LANA 2WB1D 5CYJA 3THVA 3ZZRA 3H5SA 4B9LA 1J2VA 2Z58B 5C7PA 2I5JB 1Q7LB 3DLEB 1NCLA 1HWIA 1MNEA 1RISA 1K0VA 4RW9B 3G96A 3OR2A 1LWCB 1HBUA 3QAEA 3ZZ0A 3BF4A 3G87A 2LXUA 4MIAA 4LBPA 1C1CB 4DLEA 1SVDA 4Y00A 4DXLA 1N32F 2HURA 3VVTA 1VRUA 8AT1B 5J1EA 3CD5A 4MK9A 4ILMA 2H3EB 2VOPA 2PSZA 5K8OA 3MURP 1N52B 2HZAA 4DV7F 1P6TA 1U2CA 5L9XA 4TU7A 3CJTA 3UI3A 3W9HA 3MM7B 4LQ3A 3BS9A 3U27A 1AUKA 3WX4A 2YKQA 3HDSA 2LLZA 1FFWB 4NCGB 1LW0B 1M1KT 4CLKA 4DV2F 1ZETA 4CLPA 1KLMB 2MLXA 1P9QC 2HHVA 2PMZD 1EB0A 3MM6A 2AW0A 3OD2A 4ZPCA 3QFHA 4O3PA 2PO4A 2V2VA 4R5PA 1S1VA 1PAEX 3JYTA 2YNGB 4X4SA 3U7JA 2RHSB 1RAFB 4E98A 2CPXA 3UN5A 2OEKA 4HR2A 2OFGX 2N7CA 5EDWA 3DFEA 4M5DB 2DBBA 3QSYB 5H9FJ 2C2MB 2W5QA 1R43A 4A4JA 3CMES 4JB8B 4C0OC 5CABA 2G1DA 4TN2A 5IQQA 3H90A 1T9VA 5HMXA 1S4EA 3GYGA 2UXBF 2IJRA 7FDRA 2KHCA 4RNFA 4WU3A 3CPWR 4J9SA 2CYYA 4C3KA 4ELVA 4W98A 1CC8A 5T7LA 1HQEA 1C1BB 3C14A 3MEEB 2WVDA 3L3CA 3SZYA 5LMNJ 3M9NB 4AL5A 5KFLA 3BYRA 4FYYB 1UVJA 5KFVA 2B8QA 1PJ6A 2EKYA 1RHQB 2HLTA 1N33F 5H9FK 4O3OA 1TU0B 3OR2B 3QSIA 1HBUB 3M7VA 2MXYA 3CDEA 4LRCA 1DAXA 1X31C 3CGIA 3UN2A 4KGXB 4OIXA 5J1EB 4LRDA 3FC9A 1C0TA 2V5HG 4NA2A 5HANA 2RHQB 2RU3A 4NYZA 2HFSA 2DGTA 1WOOA 3OTEA 3SV3A 4RUBA 4DV6J 1F2HA 2K3IA 3WAVA 5DLVA 4UZBA 1RAJA 2GJIA 1UW9A 3KLHA 4CO2A 2OPQA 2MQ8A 3TX8A 1JLFB 2KXFA 5GAHI 3IAS9 3MM6B 4WBFA 5CQGA 3MK1A 4M5MA 2QLFB 5KFSA 4CT9A 4DV5F 1S1VB 3JYTB 2CIMA 2D41A 4CH0S 2LQBA 2O5DA 3AB4B 3N4WA 1KHVA 1WC3A 1RHRB 4J9PA 5K14A 1HNVB 3DRXA 5IT4A 3R5CA 1J27A 5GAEU 1Q8IA 2OGUA 4F2RA 1VI7A 3QPIA 3I55S 1VQMS 1SQEA 3D5MA 1H2VZ 3D0GE 1SBRA 4FZVA 4BS2A 4WIQA 3TEHB 3EGWB 4H4KA 1PO6A 5HP1B 2VG6A 4DV2J 4ALZA 1IJEB 4ZG6A 4BWMA 5H9EK 5T7LB 3NCPA 2MJNA 4USIA 4BCAA 3H4BA 3VTIA 4F4KA 3HHNB 2DR8A 2B9EA 2H5JB 4X65F 2P6TA 2HLUA 2D3O1 4P2SA 4IDKA 4J91A 3DYCA 5EGEA 5LSLA 5IM0A 1WSRA 3P4UB 1KH4A 2FUG9 5HVGA 1ED8A 1EHWA 4ECTA 2D7SA 5AJ9A 1JJ2R 4ZN1A 3A3PB 2ERRA 3UDVA 1ELZA 5B0CA 5D4LA 2C28A 2O66A 3W61A 3H59A 4LRAA 1JLQA 3CCTA 2G2OA 3PDNA 3PO4A 1JWWA 4ED5A 4NZ7A 4I7FB 4GMKA 3JXOA 4HHHA 4OX8A 1ELOA 4ECYA 4A8KA 2JFKA 4I64A 4QZVB 3ZO7A 1N33J 2OPQB 5L8RC 3SCLE 4ZITA 1HPZA 4FYDA 3W9IA 1UFLA 3JSYA 2HS3A 3DRPA 2OKQA 1FJ7A 4AD6A 3L7PA 3T5LA 3EM1A 1QAIA 2D3UA 5KFGA 1CJVA 4OJ1A 5K14B 2W2OP 3NP5A 2NXUA 5AE2A 2W4PA 5IV4A 3LGMA 1VC0A 1MSWD 1QUPA 4WFAQ 2GFFA 4USKA 4AL6A 1IBKF 2RB7A 4N47A 4DR6F 1RT7A 3QO9A 1XJWB 4ZCLA 2E7XA 1M5KC 1RTZA 3TVKA 2XMWA 4DV3F 1HI1A 4HKQA 4ELTA 4K2JA 4GVBA 4HLBA 3C19A 1X4GA 3EZ5A 2V6AA 3QQCD 4KM4A 3AA8A 1E6YA 1JLBA 4N7TA 3HD1A 3NGTA 1YRUA 3T5JA 1B7FA 2VQEF 1KWMA 1I3OB 1KQSR 5LRMA 1R7IA 4WYLA 4NXNF 2EEYA 1AUSL 1Z2LA 2VFRA 1SQGA 3SMZA 2UXCJ 2Z56B 4B9NA 3NY0A 1YRXA 2NZ4A 1HQAA 3L95X 3D2WA 1D8YA 1JLQB 1U1NA 2BACA 4I2QA 1EIYB 4Y6IA 4YDXA 3NGKA 2OI2A 2PE8A 5LRNA 1SIZA 3JS9A 2M52A 2HHUA 2HIQA 3GV8B 5GAHU 2NLWA 1M5PC 1NJWA 3MCOA 4FP9A 4NI2A 4RLEA 4DUYF 1U8SA 1A0OB 4KO0A 4QAXA 2LEAA 2GMHA 3CCSS 2GSNA 1IR2A 3M6VA 4ILLA 2IVYA 5JMNA 1S97A 1ZAVA 4GKKJ 2HFNA 4KR0B 4MKYA 3DLHA 5F3TA 4ED2A 4AQYJ 1BQXA 2RQ4A 2ATCB 2GQCA 3CJ3A 3MMCB 4J9LA 2QC3A 3BBBA 3UPFA 4HTIA 4I69A 4B9SA 1KS2A 3W63A 4O0IA 2MLZA 4Y2IA 5K8PA 3HFKA 1RU1A 2XLKA 1UKUA 4UOFA 4K0KJ 2QSWA 4FYXB 4Y28C 2B6AB 4GVBB 2IIHA 3GCXP 2P5VA 1PG5B 4HYKA 1FKAF 1F5CA 5IZHA 2UUAF 3ILJA 3FMBA 4QJVA 4TLRA 3WZ0A 2XCPA 5SUHA 4BC7A 1RXOB 2ADCA 3FEYB 4ELUA 2E7VA 3QRRA 5LSRA 1NK9A 2WSEC 3GP9A 2HPUA 3MM9B 1S9FA 4PG5A 3MXHP 2QL9B 4Q43A 4L76A 4C8KA 3GJRB 2A0FB 4OI1A 3CW2C 2I38A 2J8AA 1SIWB 3VAMA 2V34A 4DR6J 3C66A 3PVXA 5EWFA 2DNQA 4N5SA 2X1BA 1HD1A 3FZBA 1LWEA 4JI8F 2J5AA 4RR5A 2G2YA 3LGNA 1UTAA 3D68A 1B7YB 3E01A 2HVHA 2ZH4A 2AP6A 2R42A 5KG0A 4U7UK 2WHOA 4F50A 4K4TA 1M0SA 3KUEA 1ZH5A 2XS5A 4DDFA 1CQNA 3PXGa 4ZP7A 2M2BA 3NNCA 4RPFA 4DPOA 1LFWA 4M5JA 3QIPB 4C9DA 1MG7A 1BQMB 4ZLJA 2KKHA 3MR5A 1UVNA 2LCWA 2VBZA 4H4KC 2GA3A 2RS8A 1RAGB 2HNDB 1N8RT 4NXNJ 1OPZA 2BJ3A 2MQMA 1JIHA 2DYAA 4KO0B 1TKZB 3GE9A 2L41A 2R2UA 3PX4A 1WC6A 4WTOB 2A6MA 5DQIA 3J80Y 4C11B 4HACA 2DNMA 2UUTA 4CP5A 2CJQA 2MKKA 2IDEA 4DCOB 4JV1A 2PC6A 4P7VA 3BDPA 3OFFA 1S79A 1DY3A 2WONA 2VPYB 2HNYA 3ZTOA 3CDUA 2BE7D 3KWMA 4PYAA 1FRHA 2CPZA 3O2IA 4J37A 5CZVA 1XNRF 5B08A 3PJXA 3IMQJ 1X4FA 4KGZB 1GNKA 1RTDA 2UVUA 4Q8EA 2OTLS 3EICA 4DU7A 5C42A 2XWXA 4AXJA 3IWNC 4NEYA 2CAJA 1T9TA 1WG5A 3PEJA 2QMWA 2QL5B 2M3DA 2WZ1A 2JEFA 2W4CA 3EPGA 4NLTA 1B0VA 4USHA 2UUBF 2M5YA 5B0GA 1BWVA 2FLLA 4A48A 3RR7A 2UUCJ 3P45B 1SXLA 1HLWA 2WOMA 4ZVFA 1VRTB 3PKMA 2AX1A 4RWXA 3IBFB 3MECB 2RSQA 4GC6A 1AB8A 5KFRA 1SV5B 5A6PA 5IWAF 2P9EA 3OFGA 3NS6A 4X4PA 2GGPA 5DLWA 3MCNA 2CWKA 4G65A 1IM6A 1NKBA 1GQEA 1NUEA 3HSJA 4DR4F 2BOAA 2PFDA 4DZDA 2IM1A 2G0IA 4XTTA 1N56A 1Q8KA 3D7SB 3T3FA 2QSFA 4JUZA 4DPYA 2PT0A 2J8SA 2GIRA 3PYGA 3MDFA 4F36A 2A2CA 4QR0A 2XMTA 2J6UA 3R1HA 3BKUA 1S12A 2IPOB 4DL2A 4RUHA 4F0KA 3SQGA 4RUAA 4NCAA 4B3RF 5I4MA 2QGFB 2G0JA 2PA3A 4YHHJ 1T02A 3RB4A 1WC1A 4DX6A 1SJ3P 5DLGA 4MY4A 2P9GA 2WBMA 5KOXA 2VBYA 2HS4A 2D1CA 2QA4S 2ZJPQ 2F5GA 2CQPA 2OPSA 2VFSA 3UNYA 1WI8A 1IWGA 3P5BP 3EUNA 2FZGB 1I5OB 1YLXA 3MM5A 3GWCA 1LV5A 4IR9A 5HQ8A 3DU6A 2E9RX 4DR3F 1Q5YA 1KP6A 4ZA1A 4ZPTR 3EYZA 1NHKL 5GADI 2VPZB 2QL7B 2R2TA 3GJQB 4MFBA 1RGVA 4PR6A 3KLVA 2BKOA 2BRKA 2KTQA 4LVNP 4QIVA 1R6YA 3UDLA 3TUIC 2E1PA 6FD1A 2ZH9A 1ZEDA 1RA6A 5LQQA 3MK0A 3NNAA 4IYQA 4DR7J 4F0HA 3MAQA 2WOMB 1MN7A 3EPIA 4CYUA 2UV8G 3GYNA 4CXKA 1LFPA 1AZSA 1MWZA 2B51A 1E6VA 2MY8A 1DJ0A 2VIHA 5IJQA 5DG9A 2IMWP 2GLQA 4OYMA 3OFEA 3EGVA 1EQMA 4DQPA 1GEHA 3JTNA 8ATCB 4PQAA 4KAVA 3GB0A 3PYEA 5C2CA 4RX6A 3POTB 3V4IA 2RMLA 4FDIA 4NCBA 3QGGA 1Q8LA 1YJTA 4KHRA 1Z4UA 2XO6A 1KN6A 3PG9A 3GPAA 1PJ7A 4GKJJ 4N41A 3DRYA 1M5VC 3HF5A 5I3UB 2H4YB 4R25A 5MLCV 2C2OB 1MU2A 3TWZA 2KZZA 5J2PA 2VFUA 3HZEA 3DNCA 5CAAA 3DOMA 1KVJA 4LRBA 4DN0A 2QMXA 5LOQA 2DXDA 4KV8B 4Y2KA 4TY8B 2W25A 3CD6S 4J7CA 7FD1A 1GT8A 5D3GA 1ANIA 4EWTA 2ZUGA 2HBRB 4USVA 1IKXB 2OPSB 1BQNB 1XQIA 1VHFA 1RBLA 1DURA 2RQKA 3V81B 2QYCA 4RNOA 1T7PA 3AD9C 2R9LA 1IWAA 4HL9A 3J7A1 3LAKA 1WWHA 4UTGA 3K5NA 3R6LB 3MTKA 4K59A 2E9ZA 1DQAA 2AYMA 3KLEA 1GTEA 3DCAA 3UDCA 2XMAA 1XR5A 2CXEA 3MR6A 2XI2A 4GTWA 1TL1A 2G9YA 3O5TB 2NUHA 2E5IA 1V6HA 3CIMA 3VGSA 2DGXA 2HQ3A 2PGCA 1IKVB 4NOHA 3M8SA 5L46A 1AZSB 4LFCF 2GSUA 3BH6B 4QR2A 3MI7X 4ZLNA 3CDBA 1V5VA 4ZCMA 2EKNA 3K5LA 3ZC4A 2BUNA 3BH7B 4OL8A 1H98A 1R89A 2YQ1A 3KLIB 4TYBA 2L48A 1ALJA 3V4IB 1YBTA 1PYTA 1UZDA 1Q81T 2BOPA 4K5SA 2VA3A 2HWIA 1IR0A 3DLJA 3W5YA 4EMDA 2NSCA 4A8QA 3FK4A 2B7BB 2K1RB 4I2PB 5AXMA 2DEIA 1WKKA 1VRQC 3I87A 1HD0A 4YB7A 5J2PB 1JXLA 3DOMB 3A3OB 4NWBA 2ZNYA 1S6OA 2XEXA 1RT5A 1UFKA 5RUBA 4WFZA 2ZKUA 5IT9Y 3JSMA 2K06A 2BQUA 1CC7A 1LWFB 3VGUA 2QO3A 1KHWA 3JQKA 5A2QY 1HNXJ 1RT6B 4F25A 5KFNA 4O3NA 4NA1A 2ACYA 3KK2A 3L4BC 1OJ4A 2GIFA 3KMSA 3M8RA 4DFMA 3NMAA 1IN0A 4XDCA 1XIQA 2RDDA 3RAQA 4F7VA 1NEEA 2CPFA 4LSZB 3KD8A 3TVZA 1SCJB 1LK7A 1R8CA 5D4PA 5GADU 2ZM6J 2F9JA 5AXKA 4UOGA 2EVZA 3M8PB 4LRFA 4DFPA
chains in the Genus database with same CATH topology
1KHNA 3DPCA 5IJQA 3NKRA 3TX0A 1KH9A 2GLQA 3NKNA 4LQYA 1ALKA 3NKQA 1E3CP 3UN2A 1E2SP 4CXUA 1URBA 4ZGAA 3T01A 1FSUA 5K4PA 1EW9A 2D1GA 4KAYA 1URAA 5IJSA 3M8ZA 4UOPA 4KM4A 1ANJA 3NKPA 2IUCB 3CMRA 4MY4A 1EW8A 4LREA 4LRDA 3UN5A 4KAVA 3WAYA 5GOVA 3WBHA 4QAXA 4N7TA 4UPIA 4NWJA 4UPKA 2GSNA 4YR1A 1AJCA 5DLTA 1ZEFA 5L0EA 4FDIA 4ZG6A 4LR2A 1ALHA 4UOOA 3M8YA 3UNYA 2W5QA 3MK2A 4MHXA 4KJDA 1ELXA 4LR7A 1KH5A 3IDDA 5L0BA 3B5QA 4CYSA 2QZUA 2W5SA 2XRGA 4GTXA 5LIAA 1N2LA 1Y6VA 4MIVA 3BDGB 3M8WA 3OT9A 1SHNA 4B56A 1EI6A 2W5RA 1ED9A 1P49A 1SHQA 1ZEBA 4UPHA 5EGHA 5DLWA 5LRMA 2W8DA 1E33P 3BDGA 3Q3QA 4CYRA 4UPLA 4NWXA 1Y7AA 4ZG7A 4KJGA 3UO0A 3WAVA 5DLVA 4TN0A 2IUCA 2X98A 4GTWA 2G9YA 1KHLA 1HDHA 1ALIA 3IGYB 3BDFA 4LR8A 1B8JA 2W5XA 2W8SA 3T00A 5KXAA 3DYCA 1N2KA 3TWZA 1AJAA 2VQRA 2ZKTA 1EJJA 1O99A 5EGEA 2ANHA 1HQAA 3IGZB 1E1ZP 3SZZA 4LR9A 1HJKA 2GSOA 1KH4A 2XR9A 4LRBA 3NVLA 3UN3A 4UORA 3ED4A 2GSUA 1ED8A 1KHJA 3MK1A 1EQJA 1K7HA 3SZYA 1KHKA 1O98A 3T02A 1EW2A 4GTZA 5GRRA 3BDHA 4ZG9A 1KH7A 2GA3A 4CXSA 2IFYA 5AJ9A 1AJDA 1AUKA 1AJBA 1ELYA 1ZEDA 3A52A 5TJ3A 3TG0A 5LQQA 5HRTA 1ELZA 3MK0A 3E2DA 5LRNA 1ANIA 3NKMA 4GTYA 5INHA 2RH6A 2W5VA 3KD8A 3WAWA 5L0KA 1ALJA 3M7VA 4CXKA 2W5WA 3LXQA 2W5TA 3NKOA 3WAXA 4LRCA 4LRAA 4FDJA 4LRFA 5C66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHN A;  3DPC A;  5IJQ A;  3NKR A;  3TX0 A;  1KH9 A;  2GLQ A;  3NKN A;  4LQY A;  1ALK A;  3NKQ A;  1E3C P;  3UN2 A;  1E2S P;  4CXU A;  1URB A;  4ZGA A;  3T01 A;  1FSU A;  5K4P A;  1EW9 A;  2D1G A;  4KAY A;  1URA A;  5IJS A;  3M8Z A;  4UOP A;  4KM4 A;  1ANJ A;  3NKP A;  2IUC B;  3CMR A;  4MY4 A;  1EW8 A;  4LRE A;  4LRD A;  3UN5 A;  4KAV A;  3WAY A;  5GOV A;  3WBH A;  4QAX A;  4N7T A;  4UPI A;  4NWJ A;  4UPK A;  2GSN A;  4YR1 A;  1AJC A;  5DLT A;  1ZEF A;  5L0E A;  4FDI A;  4ZG6 A;  4LR2 A;  1ALH A;  4UOO A;  3M8Y A;  3UNY A;  2W5Q A;  3MK2 A;  4MHX A;  4KJD A;  1ELX A;  4LR7 A;  1KH5 A;  3IDD A;  5L0B A;  3B5Q A;  4CYS A;  2QZU A;  2W5S A;  2XRG A;  4GTX A;  5LIA A;  1N2L A;  1Y6V A;  4MIV A;  3BDG B;  3M8W A;  3OT9 A;  1SHN A;  4B56 A;  1EI6 A;  2W5R A;  1ED9 A;  1P49 A;  1SHQ A;  1ZEB A;  4UPH A;  5EGH A;  5DLW A;  5LRM A;  2W8D A;  1E33 P;  3BDG A;  3Q3Q A;  4CYR A;  4UPL A;  4NWX A;  1Y7A A;  4ZG7 A;  4KJG A;  3UO0 A;  3WAV A;  5DLV A;  4TN0 A;  2IUC A;  2X98 A;  4GTW A;  2G9Y A;  1KHL A;  1HDH A;  1ALI A;  3IGY B;  3BDF A;  4LR8 A;  1B8J A;  2W5X A;  2W8S A;  3T00 A;  5KXA A;  3DYC A;  1N2K A;  3TWZ A;  1AJA A;  2VQR A;  2ZKT A;  1EJJ A;  1O99 A;  5EGE A;  2ANH A;  1HQA A;  3IGZ B;  1E1Z P;  3SZZ A;  4LR9 A;  1HJK A;  2GSO A;  1KH4 A;  2XR9 A;  4LRB A;  3NVL A;  3UN3 A;  4UOR A;  3ED4 A;  2GSU A;  1ED8 A;  1KHJ A;  3MK1 A;  1EQJ A;  1K7H A;  3SZY A;  1KHK A;  1O98 A;  3T02 A;  1EW2 A;  4GTZ A;  5GRR A;  3BDH A;  4ZG9 A;  1KH7 A;  2GA3 A;  4CXS A;  2IFY A;  5AJ9 A;  1AJD A;  1AUK A;  1AJB A;  1ELY A;  1ZED A;  3A52 A;  5TJ3 A;  3TG0 A;  5LQQ A;  5HRT A;  1ELZ A;  3MK0 A;  3E2D A;  5LRN A;  1ANI A;  3NKM A;  4GTY A;  5INH A;  2RH6 A;  2W5V A;  3KD8 A;  3WAW A;  5L0K A;  1ALJ A;  3M7V A;  4CXK A;  2W5W A;  3LXQ A;  2W5T A;  3NKO A;  3WAX A;  4LRC A;  4LRA A;  4FDJ A;  4LRF A;  5C66 A; 
#chains in the Genus database with same CATH topology
 1JLC B;  1IBL J;  5KFC A;  2ZOF A;  1WEL A;  4FNH A;  5HJX A;  3F41 A;  1VQK S;  3KXD A;  2ASY A;  1TL1 B;  2V4J B;  2FLO A;  2AKW B;  5J2M A;  4DF4 A;  1RQ0 A;  3NCQ A;  4KJD A;  4TLQ A;  4PG7 A;  3R5G A;  2X1A A;  1TEL A;  3TP2 A;  3MMJ A;  2EFP A;  3T19 A;  5BR8 J;  5A8K B;  3AFG A;  2VQF F;  4O4R A;  4DI6 A;  1CPZ A;  2P8I A;  4NLD A;  2CJK A;  2VUG A;  1FK9 A;  4KFB A;  4U96 A;  5JXS A;  2XMU A;  4U95 A;  3DLG B;  2DH9 A;  1ZPV A;  1UET A;  2IC3 B;  4DQS A;  3W66 A;  2AJQ A;  1ZM3 A;  4DR1 J;  4ZVE A;  5KG4 A;  2KT2 A;  2ZEJ A;  5DS7 A;  1G2E A;  2DNR A;  3BO2 A;  1S0N A;  1R0A B;  4OX9 F;  1JNZ B;  2DRD A;  1RT5 B;  5EGY A;  1ZM4 A;  2BE2 B;  4QW8 A;  3O3L A;  3OVB A;  3DI6 A;  3VVU A;  2ZBR A;  1NBE B;  1QE1 B;  3IM8 A;  3VCD A;  1T9Y A;  1U25 A;  1FCA A;  1X5T A;  2RRN A;  1Q82 T;  3KK2 B;  4ZJO A;  2W5S A;  3NGR A;  1K47 A;  4DL4 A;  1BY9 A;  4MKV A;  5FDL A;  2W8D A;  3HUL A;  1F9H A;  1F1B B;  2GJF A;  1VMB A;  5ETM A;  2LA4 A;  1F6T A;  1M1G A;  2FVR A;  3R1L A;  1B0P A;  1T05 A;  4DUZ F;  2OPR B;  3BBF A;  1YKW A;  4DHV A;  2MGZ A;  3EJM A;  4I4B A;  3CUN A;  3R5B A;  1DHM A;  3PJW A;  1XNQ J;  5B0F A;  1X4B A;  3T1Y J;  1FJE B;  3TJA A;  2BMB A;  4DPT A;  2RS2 A;  2HQG A;  3NXZ A;  1NHV A;  2SXL A;  2DPI A;  2AV5 A;  3JQM A;  2VG5 A;  4H4O A;  5BYR A;  2DJW A;  2PI4 A;  5ETL A;  5GME A;  3I9Z A;  4RW8 B;  3SIP B;  3HHL B;  1S1W B;  3H0P A;  4JP8 A;  2Z4P A;  1PIL A;  3V6D B;  2EFO A;  2U1A A;  4ZVO B;  5ETO A;  5EUH A;  2RUG A;  1G4C A;  4TU9 A;  2GVZ A;  3HVW A;  3KK3 A;  4RL1 A;  5F0W A;  1NPP A;  2X1F A;  1FK9 B;  3QGH A;  4KFB B;  2HW3 A;  3W60 A;  2EFN A;  4RZR A;  4LJM A;  1IQZ A;  3BSC A;  1URN A;  1AYE A;  4V19 J;  5GAG I;  1FF2 A;  2HHQ A;  2CRL A;  1ZA2 B;  3G86 A;  3GFY A;  3OL9 A;  4ICL B;  5F41 A;  4ID5 B;  3I5A A;  2DNN A;  1O5J A;  2XSJ A;  1FDB A;  3DI6 B;  3ZZP A;  1WJ9 A;  4F04 B;  2HGM A;  2B9X A;  4NA3 A;  1WF0 A;  1CBK A;  3MWB A;  1HW8 A;  3OW2 R;  1ROF A;  4FYV B;  4JV5 F;  3WC2 A;  4OJG A;  1IBC B;  4CH7 A;  4UOP A;  1T94 A;  1OWX A;  3DLK A;  4LF5 F;  3TJ9 A;  2A3J A;  4EYI B;  3BGF A;  2Y1I A;  4NLG A;  5BYQ A;  3K8W A;  2WW4 A;  1TUW A;  1XTZ A;  3MAA B;  1T05 B;  2QZ8 A;  2G1H A;  4UY8 5;  2WVC A;  2MGZ B;  2H48 B;  2I1R A;  4CYR A;  4B02 A;  1JLG B;  5DGA A;  2GQQ A;  5CXT A;  2V9W A;  1D9F A;  5C25 B;  5KFW A;  3CD7 A;  2ZKT A;  1RT3 A;  4EZ6 A;  1O99 A;  2IA6 A;  2DKO B;  2DH8 A;  1UWB A;  1S6U A;  1NJY A;  5CYM A;  1QVG R;  4WCE Q;  3B54 A;  1M5O C;  3ITH A;  2DIT A;  2IFX A;  2E5G A;  3OTC A;  2XC9 A;  1U47 A;  3MZI A;  1ZOT A;  3BN7 A;  1DRZ A;  2HFZ A;  1OYE A;  3P3D A;  2YH1 A;  1LW2 A;  1XR6 A;  1WOR A;  2RD5 C;  2OML A;  3PX6 A;  3BQ2 A;  2HMI A;  1VFJ A;  4Q7A A;  2R2S A;  3MFI A;  2QLX A;  2BDP A;  2WVE A;  5E3R A;  5LXR A;  4DSE A;  3KK3 B;  3M9M B;  1KH9 A;  2HVZ A;  3NKQ A;  4C8O A;  2GO9 A;  4MK7 A;  2V4R A;  1N36 J;  4WFN Q;  5DDP C;  3AH6 A;  2YNH A;  3I5B A;  4J9O A;  1VQN S;  2Q6C A;  1F0X A;  3I96 A;  4CZC A;  1S76 D;  2DR7 A;  4B3T J;  2QZU A;  4P75 A;  3NG8 A;  2XM3 A;  1X5S A;  2Z30 B;  2B56 A;  4LSL B;  3GJT B;  2EBE A;  2OEJ A;  4MT1 A;  3E8O A;  3MPW A;  2W8S A;  2ALY B;  2HQF A;  3U02 A;  4N8O A;  3Q24 A;  3OJS A;  4OI4 A;  3IGN A;  1KHJ A;  3R2D J;  2HWT A;  3AB2 B;  1D0E A;  2KM8 B;  3GR0 A;  4DG1 A;  1G1X A;  4EEY A;  2OLW A;  3D6H B;  4Y0F A;  2E5L F;  1VQ7 S;  3GJS B;  1XEZ A;  2ZBQ A;  4M63 A;  2KG0 A;  4F4Z A;  3CXC R;  3Q86 A;  4DX5 A;  5FD1 A;  4R8U A;  3CT9 A;  1U1O A;  3QJP A;  4NLW A;  4LF1 A;  3EMT A;  1WOP A;  3EZO A;  4MMO A;  1RT3 B;  3U1N A;  4KTQ A;  1WSV A;  3DU5 A;  5CYM B;  3ENA A;  2ZH6 A;  1L3K A;  3JTP A;  5KFM A;  4JV0 A;  3A8J A;  1FNO A;  9RUB A;  2CQI A;  2FC9 A;  4JI2 F;  1R6V A;  3UNG C;  2ZE2 B;  1S1U A;  1WTB A;  4ZDN A;  3EE3 A;  3I0R A;  2BE9 B;  1LW2 B;  3Q2T C;  2FD2 A;  2MB0 B;  2K2P A;  4FVC A;  3MPD A;  3DOK A;  3HHE A;  2J7U A;  3K89 A;  2OHD A;  4DR5 J;  1RWV B;  3H5X A;  3DC2 A;  4ZS6 A;  5I42 B;  5B09 A;  3J81 U;  1SH3 A;  1YTY A;  2KYX A;  1ELY A;  1KTV A;  1KOH A;  4IQX A;  3CJ4 A;  2YNH B;  4ECZ A;  1FE4 A;  2FYX A;  3T6J A;  1NDC A;  3ILL A;  5GAG U;  3KFW X;  2JZ5 A;  3MCM A;  4WFY A;  2DO4 A;  5D0R A;  3UW1 A;  5ITH A;  2J9C A;  1ALK A;  1H7W A;  2AYE A;  1X0P A;  1QSY A;  1YGY A;  5F0U A;  1SKU B;  3CJ8 A;  4CRJ A;  2QLB B;  1EJ7 L;  1BGX T;  1N5Y A;  3OFH A;  3FKB A;  4RBU A;  2AHO B;  4RW6 A;  1PYS B;  4ED7 A;  5LJ5 Y;  1VOM A;  1I6J A;  4FPI A;  1IR1 A;  2G0C A;  2MKJ A;  4QWA A;  2QIF A;  1TV6 B;  5KFQ A;  4WYW A;  5I3P A;  4G1Q A;  1YIJ S;  1CJT A;  2FZK B;  1R27 B;  1KLN A;  2PFF B;  1RAE B;  1OQ6 A;  4IH7 A;  1YJ7 A;  4ID8 A;  1EX8 A;  3HVT A;  4RW7 A;  4RU2 A;  5KFI A;  2IFY A;  4J90 A;  2R8I A;  1NU4 A;  1XMO F;  1AJB A;  3K17 A;  2FVP A;  4R8U B;  3VGT A;  3TQ1 A;  2GC8 A;  1SC4 B;  2VD3 A;  2KDO A;  1FE0 A;  1UEK A;  2DGS A;  1TUV A;  1ZBT A;  3BB5 A;  3GON A;  1V9O A;  1ZTW A;  3SSR A;  3NGD A;  3Q22 A;  1VQL S;  2X51 A;  2GHP A;  2YWK A;  5HLF B;  1NB7 A;  2J6S A;  1KFS A;  3OLB A;  1S1U B;  4NAS A;  1OMS A;  4ZVU B;  1YQH A;  2DIU A;  3I0R B;  5HN0 A;  2RE1 A;  1OIA A;  3D4J A;  3B4M A;  5L0E A;  1KEK A;  1VJQ A;  3JAM Y;  4FS2 A;  1Q53 A;  3JTO A;  3KG0 A;  3HCX A;  2C2R A;  4M5H A;  1VC6 A;  1FTC A;  3HZG A;  3NBP B;  2ZD1 B;  4ZPW R;  4PRF A;  1RHU B;  2XI3 A;  5ETV A;  1KDN A;  2VG7 A;  2GSO A;  2XR9 A;  2G9O A;  4YY3 J;  4O4G A;  4AFF A;  4TQR A;  1Y9O A;  4E8U A;  2GNK A;  1K44 A;  3KDO A;  4M8L A;  2OEM A;  2VPX B;  3LP2 B;  4ECS A;  2DNL A;  1F3V A;  1VDH A;  1NME B;  3G6Y A;  2AEF A;  4C48 A;  4DPX A;  2W1B A;  5ETT A;  3DMJ A;  3MMA A;  1JMT A;  2QX0 A;  2HS0 A;  1VS3 A;  3NEK A;  3R3T A;  3LP1 B;  1TP7 A;  2DB1 A;  1TVR B;  3NWR A;  1EKR A;  2W8K A;  5K4P A;  5CCM A;  1EAY C;  5K8M A;  3MPU B;  3OVA A;  3R9L A;  3OUY B;  1TL3 A;  3HSZ A;  1CJT B;  4JI3 J;  4R0E A;  4KYZ A;  3HXM A;  4A46 A;  1XN9 A;  4GTX A;  1J5E F;  3QRQ A;  3MGJ A;  3BDG B;  2R8K A;  1Y10 A;  1U1L A;  1YHQ S;  3ISZ A;  4RW7 B;  4WTY A;  4C0H A;  2EXU A;  1RBA A;  2RF2 B;  2OMO A;  3W3S A;  1NHU A;  1RT4 B;  2R2R A;  4XPE A;  1AT1 B;  3FRZ A;  5A8R A;  3CSK A;  3IRX B;  5A76 A;  2W7A A;  4QWD A;  1U0H B;  4CLL A;  2HRY A;  2ILY A;  2Z8Q A;  4EK2 A;  4YDD B;  4QPX A;  2HVD A;  2E29 A;  2BJ7 A;  4HHU A;  1YBU A;  3KUH A;  4C8L A;  4BDP A;  3UD4 P;  4PG4 A;  1W2B R;  3ULH A;  1RZM A;  3W1Y C;  1S57 A;  4DQR A;  1WDT A;  4IOB A;  1FVQ A;  4DL5 A;  3ZTP A;  1O0P A;  3CTR A;  2AZ3 A;  3E51 A;  1CJK B;  5IQ6 A;  4X64 J;  1VK3 A;  3BSA A;  5HBM B;  4ZCK A;  2LKZ A;  3ZZT A;  1EW9 A;  3W8P A;  2ROP A;  3BQ1 A;  2QN6 B;  3JSB A;  4PAB A;  4KT0 C;  5LJ3 Y;  2F3J A;  2DTJ A;  4B3S F;  3N9U C;  4IH5 A;  4YN3 B;  4OZ5 A;  3K5O A;  3NS7 B;  2YX4 A;  5LIA A;  4KHM A;  4FF1 A;  8RUC A;  2IVM A;  4C2M A;  3PRD A;  1XMQ J;  4P74 A;  2UXD J;  4IUF A;  3TEG A;  1EJJ A;  3MMA B;  2Y0S D;  4PWD B;  4LR9 A;  5L1I A;  2Y1J A;  2VA2 A;  4QIF A;  1L3V A;  2AIR B;  4I68 A;  5LSO A;  3I0S A;  1TKT A;  4KRW A;  3HP6 A;  3PIP Q;  4LF2 A;  1QVF R;  4NE9 C;  3ZNU A;  1UVI A;  4QWE A;  5FLX Y;  4WU2 A;  2NYI A;  3H2V E;  5B0D A;  3DDK A;  1HYS A;  2J0S D;  3NL0 A;  4YS2 A;  3VV2 B;  4B3M J;  4UT4 A;  2MJU A;  1VJW A;  3BR8 A;  3TA2 A;  1PIE A;  1X0F A;  3C6T A;  3RB3 A;  3QGI A;  1Z2Z A;  3P5T L;  1NAQ A;  3MUV P;  3HMJ G;  1Y5L B;  1S99 A;  3J7Z T;  5A8R B;  2M4M A;  1ZTT A;  1H73 A;  3TZY A;  3IWL A;  2IBO A;  4JI7 J;  2AJ0 A;  1EI6 A;  3T5H A;  3GIJ A;  3IC1 A;  1RTJ B;  3BPS P;  1V3S A;  2RAQ A;  2VPW B;  1SL2 A;  4DCJ B;  3BGO P;  3T9Z A;  3W8G A;  3SZ2 A;  2OD6 A;  1RWU A;  1QLN A;  3KTQ A;  1GMW A;  2M88 A;  1K0T A;  4I67 A;  1AUD A;  2FJD B;  3MPY A;  2YBV A;  4OZ0 A;  5KTQ A;  2V2Z A;  1HMV B;  4O3S A;  1X4D A;  3ADA C;  2JC0 A;  3FVY A;  1VQO S;  1RI7 A;  2KXH A;  5HMY A;  2R3V A;  2W5V A;  2UU9 F;  3HSG A;  1S9E A;  2LQ9 A;  1VIS A;  2DRB A;  3WAX A;  2R8G A;  4CO1 A;  3BGR B;  1QM9 A;  2CNO B;  4QYZ J;  1T3O A;  4EFA C;  1NPR A;  1R8H A;  1RP5 A;  1IM4 A;  2X3D A;  2ILZ A;  2E9T A;  3QFW A;  4RW9 A;  2MHN A;  3QAU A;  3B78 A;  5IV3 A;  3LQV A;  3D6T B;  2D3O R;  3I0S B;  3LAL A;  1VQ6 S;  4B56 A;  3SQO P;  4NLU A;  4F8R A;  4P52 A;  2V0N A;  2AGP A;  4CLU A;  3R8Y A;  1RHJ B;  4ZJL A;  2V8D A;  4B3S J;  3UN3 A;  1WC0 A;  3CCR S;  3WQP A;  4LBH A;  3MM7 A;  2A2D A;  5CH7 B;  3W5Z A;  1SJR A;  2ZHA A;  5D77 A;  3OXL A;  3IN5 A;  3F56 A;  4EO6 A;  3PRV A;  1JQG A;  1S49 A;  5HRT A;  4X62 J;  2YPZ A;  4ES2 A;  1IXK A;  1EET B;  5DJB A;  2RKI A;  1KFD A;  5B0B A;  1SPB P;  1RK8 A;  4LIR A;  4UOC A;  1NND A;  1DTT A;  3FCV A;  4FF4 A;  4ZPA A;  2YNG A;  2E1A A;  4OLP A;  1FJG F;  3CCE S;  2HK2 A;  4KY3 A;  3O1L A;  4RJV A;  4QU7 A;  1YSJ A;  1ICE B;  3BKT A;  4MHX A;  4M5D A;  2BW2 A;  1S7I A;  3OR1 B;  2D3Z A;  4CO3 A;  2CZ9 A;  4LFA F;  4UOH A;  2XG8 A;  4N77 A;  4AL7 A;  4UST A;  3R7S B;  4CM2 A;  2HHP A;  3F0N A;  3KNA A;  2BJE A;  4A8O A;  3O6Q A;  4B17 A;  5T41 A;  1A7G E;  3AOC A;  2IDL A;  3KG1 A;  2AYG A;  2MDA A;  3BYP A;  2AT1 B;  2DIV A;  2XUL A;  1C1B A;  3MEE A;  4N8N A;  1HNW F;  2WSF C;  4RW4 B;  2ZBC A;  1YVF A;  2CWX A;  3PW0 A;  4ES1 A;  3E2D A;  1NZA A;  4PXD A;  1NSA A;  3Q8V A;  2VDI A;  4ECW A;  3MTJ A;  4M5K A;  2C2N A;  4ECR A;  2V8G A;  3SI8 A;  1X4C A;  4JI1 F;  1HR0 F;  3TW0 A;  5K20 B;  4ZJQ A;  3CC7 S;  3IG1 A;  5D4N A;  4CXU A;  5EN1 A;  1FSU A;  1FXD A;  3NWG A;  4X4Q A;  2ZC4 A;  2DHG A;  3RB6 A;  3WBH A;  3HM9 A;  1NK5 A;  2HHH F;  3A13 A;  4B9U A;  2HNZ B;  4JI5 F;  3CCU S;  2UU9 J;  2Z2Y B;  3T1H F;  1KQF B;  3VAI A;  3E2E A;  1SHN A;  2CQ0 A;  2WBR A;  4NPO A;  5DM6 Q;  1TAQ A;  3G8S A;  1AW0 A;  2XYH B;  2IUC A;  3BGU A;  3B6B A;  4DV4 F;  5C5J A;  2CQ1 A;  4NMX A;  1N0U A;  4LF9 F;  2FZC B;  2LA6 A;  2RKI B;  1L3T A;  1JLF A;  2DCL A;  4QIE A;  4RBT A;  3OTO J;  4IFY B;  4I0W A;  4UUW A;  3BDH A;  1CS4 B;  1DTT B;  1NH7 A;  1HBO A;  5A6W A;  4NLY A;  3PW5 A;  1RDR A;  2NXE A;  3VGV A;  2DNK A;  2EW9 A;  1T3N A;  1S1X B;  4WK3 A;  2XHC A;  4OZ3 A;  4JI4 F;  2WSC C;  2YKA A;  1HNV A;  2XLJ A;  2W5T A;  1YJN S;  4DQI A;  2DY9 A;  3MHY A;  5DZ7 A;  3ONQ A;  3C6U B;  2BAB A;  5BXI A;  1Y5I B;  5L1J A;  2LXI A;  4FF3 A;  2Y8Y A;  1E2S P;  4ZGA A;  2CJB A;  1ACM B;  3ZTS A;  2JX2 A;  2YKN A;  2H4W B;  3V6H A;  5DLT A;  2VFT A;  5HP1 A;  4PAA A;  3UFC X;  3OPK A;  4W92 B;  2DK2 A;  3G8Q A;  3BN4 A;  2Q79 A;  1R0B G;  2FJX A;  1R31 A;  2IHR 1;  1U6Z A;  2FB0 A;  3OV7 A;  1UEU A;  3TA0 A;  4UPL A;  1EQ0 A;  4PEO A;  3GIL A;  4C3M A;  5KFT A;  5E7O B;  3IBW A;  3U1M A;  4ATN A;  1WDD A;  3FDS A;  2QA2 A;  1I1G A;  4AYB D;  2KRB A;  4KHP F;  1X9W A;  3DRS B;  4ZHR B;  2QV6 A;  3IG1 B;  5H1S V;  4PXB A;  4DV0 F;  1PGZ A;  4DEZ A;  4NXM F;  1DBD A;  2R8H A;  2PDA A;  3TR5 A;  3M2U B;  4DR2 J;  4K4V A;  1TL7 A;  1FT8 A;  1ZM9 A;  4FDJ A;  2KFZ A;  3NMR A;  1TK5 A;  3Q23 A;  4KB7 A;  2O1P A;  3HFV A;  3FQK A;  2IUC B;  4I7F A;  2FC8 A;  3CJS A;  2IYI A;  4UZC A;  3MR7 A;  3KNG A;  2L3M A;  3E3X A;  5J1N A;  4FKY A;  1URR A;  2Q1L A;  1IBM F;  3GFH A;  1DTQ B;  5DDQ C;  2HGN A;  1A9N B;  1SHQ A;  4Y34 A;  3HHK A;  4B9T A;  2XTJ P;  1K1Q A;  1HBO B;  4P6Q A;  2EI5 A;  1RWO B;  4UQG A;  4RNN A;  4E0D A;  2ZVI A;  1DAR A;  1N32 J;  4LFB F;  4ED6 A;  1TAU A;  3UCZ P;  3RGI A;  3N28 A;  4DS5 A;  1N5S A;  4PXC A;  4LUB A;  3GV5 B;  3M05 A;  4M1K A;  3DXB A;  2R7W A;  2ZDP A;  1YJR A;  2XMJ A;  4BHQ A;  1N4L A;  2BVZ A;  1HNI B;  3OBI A;  4O3R A;  3N6N A;  1LXN A;  3IGV A;  3SCJ E;  3TUZ C;  4DV7 J;  4EBC A;  4M95 A;  3G9C A;  3CCL S;  1OS5 A;  2W4D A;  5LT5 A;  2PN6 A;  5GMK a;  1NSP A;  3GR1 A;  4F4X A;  2ZZN A;  1X9S A;  5KFE A;  2YKN B;  5LMU F;  2OP5 A;  1T03 A;  5DET A;  1TKX A;  4WE1 B;  4TY9 A;  2D9P A;  4ZP8 A;  3L09 A;  4OZN A;  4K8R A;  5ETN A;  1SKW A;  3W7B A;  3QMQ A;  3G4S S;  2GMJ A;  2E7W A;  2D9O A;  3IP0 A;  4MIW A;  5HVH A;  1TL5 A;  2NS1 B;  2PI5 A;  2JEJ A;  3PKY A;  1ZZN A;  1A6L A;  4PZV A;  4EBD A;  3CJQ A;  4GRS A;  4UPH A;  3ILO A;  2AF6 A;  2P6S A;  4RO0 A;  1KON A;  2YWW A;  2XYP B;  4X84 A;  3G71 S;  2OSR A;  2UXB J;  3C46 A;  1H2T Z;  2R7U A;  1TL7 B;  3IS9 A;  4DSK A;  2Z2Z A;  3J81 j;  2COL A;  5L9N A;  3J80 U;  2B4O A;  4NYO A;  2M70 A;  3RBD A;  5L1K A;  2HK3 A;  1WTF A;  3GLJ A;  1HNZ F;  3JQJ A;  4OYP A;  3K58 A;  1B4S A;  1FKO A;  3SSQ A;  5INH A;  1YRT A;  1KVI A;  2E66 A;  4XIU A;  3CC4 S;  2VF3 A;  2VB6 A;  4ZPD A;  2OFH X;  5SZT A;  3N01 A;  2KFN A;  2QMU B;  4KHP J;  3UR0 A;  2B5J B;  2V4Q A;  1VIO A;  3T1A A;  2ATL A;  4J9U E;  1S48 A;  3SDE B;  4DV0 J;  3P6Y C;  5CD4 H;  4NXM J;  5KFY A;  3NGS A;  2ZZM A;  1LEO A;  4URG A;  1YX2 A;  1U1M A;  2JEI A;  4DCP B;  3DGP B;  3NRB A;  1JKH A;  1FRM A;  3W62 A;  3RBZ A;  3R7B B;  3MMC A;  2DGO A;  4QYR A;  3D1O A;  1T03 B;  2K7K A;  4M5I A;  3M32 B;  3ZZO A;  1TKX B;  1D9A A;  3CMQ A;  2LQ8 A;  2JEG A;  2GAG C;  3AOD A;  1WAC A;  1REG X;  3Q89 A;  2B6A A;  4JYA F;  3X3U A;  3V5R A;  3IR6 B;  4Z2X A;  4DV5 J;  2C3O A;  5BJR A;  1H7X A;  3RW7 A;  5AJ3 F;  3NKM A;  2CQG A;  5JVH Q;  1FNM A;  2AJ4 A;  4YOE A;  1NK6 A;  4JI0 F;  3T5K A;  4YR3 A;  3MM9 A;  4OYA A;  1OY6 A;  2ZH3 A;  1GMW D;  4S0M A;  4K5R A;  1T8E A;  3M8Q A;  4DSL A;  5KFZ A;  4YFU A;  4KAY A;  1HWU A;  4RNH A;  3K59 A;  4H4M A;  3HT0 A;  2EK6 A;  2Z2M A;  3K0J A;  7AT1 B;  3DM2 B;  2IJN A;  1NH8 A;  3SBM A;  5HI7 A;  2VIC A;  1IQT A;  2CA9 A;  4DX8 H;  3CWJ A;  2KG1 A;  3IS9 B;  4FXD A;  2Q43 A;  3PW4 A;  2XRG A;  3K7R A;  3C16 A;  1RWW B;  3W5X A;  2CPH A;  5K8N A;  3HD2 A;  3SFG A;  1HI0 P;  4C4W A;  1OSD A;  2EFV A;  2HSE B;  4GO7 X;  1FKO B;  2CKW A;  4IO9 Q;  3SXL A;  4X65 J;  3QLH B;  3RR8 A;  1RKI A;  2IY5 B;  4EGL A;  1Y3J A;  3QRP A;  2V8V A;  4OFZ A;  5F8L A;  4Q2L A;  1OY9 A;  1WG4 A;  1KR4 A;  1WEZ A;  3QIP A;  1EW2 A;  1BQM A;  4QOT A;  1U2F A;  2JVO A;  4PPD A;  1D3W A;  3V2U C;  1N34 F;  2HND A;  3QT8 A;  3NOC A;  1FVS A;  4KH0 B;  3VZH A;  5L0K A;  1GFW B;  1TKZ A;  1WF1 A;  3CCZ A;  3CMA S;  4WZQ A;  4XK8 C;  4C11 A;  2R7V A;  1JKH B;  1TUG B;  2IA0 A;  3CJK B;  2ZH2 A;  2W9B B;  1Q4R A;  1F60 B;  1HNZ J;  2E5H A;  1QTN B;  3KLG A;  2BM1 A;  4P71 A;  1TL4 A;  4EI2 A;  1ZM2 A;  1Q86 T;  2FGO A;  5GMD A;  2DNH A;  1V5I B;  4IRC A;  3QJJ A;  3N0V A;  3M6W A;  1U45 A;  1GXL A;  2YY3 A;  3TAR A;  3HSD A;  2KO1 A;  5KT3 A;  2VQR A;  3QAT A;  3T9N A;  4J9M A;  4HT5 A;  5LXY A;  3G6E S;  3SZZ A;  4F4Y A;  2BRL A;  3MPV A;  3N79 A;  3IA0 A;  4ZOS A;  2R7O A;  1FNX H;  5ADZ A;  2QFJ A;  2OAU A;  4WXW A;  3M8Q B;  2W9A A;  4FKX A;  3QT6 A;  4O3Q A;  2YVS A;  3D0H E;  2L08 A;  3OJU A;  4CNZ A;  3ETO A;  2F8H A;  4H4M B;  4LF6 F;  2HBQ B;  1U26 A;  3CJ5 A;  1IBK J;  1CJU B;  3TO8 A;  2F4V F;  5D0H A;  5BYS A;  1QTM A;  2C3Y A;  5DQH A;  1XK8 A;  3C16 B;  3PO5 A;  1UJ5 A;  2MZR A;  4DV3 J;  5IOL A;  2L9D A;  3GG1 A;  1DQ9 A;  4CM0 A;  2VBW A;  4IFV B;  1SJF A;  4X4N A;  1VRT A;  1HBN A;  1NB2 A;  4N56 A;  1HBM A;  4ZIV A;  1HKA A;  1SH0 A;  3MEC A;  4X66 F;  2HKE A;  2JDJ A;  1U48 A;  1SV5 A;  3PNI A;  1BD6 A;  1IKW B;  2VQE J;  2Z2L A;  3HHD A;  2HG4 A;  2KRR A;  1RAA B;  3RYL A;  2IYG A;  2ZHO A;  1BC6 A;  2JOQ A;  2MZT A;  1RLC L;  5J2Q B;  4ECQ A;  4BC9 A;  2VL1 A;  4USM A;  3PZP A;  5C2G A;  3UCU P;  2NSB A;  2WVF A;  3TA1 A;  2Y8W A;  4LSN A;  5KFB A;  4NLQ A;  1F5B A;  3V6J A;  1NK4 A;  3OXG A;  3LH2 S;  1AJD A;  3Q8P B;  2BJD A;  3FEZ A;  1W25 A;  4KQZ A;  3QT5 A;  1TMM A;  4KAI A;  3KLG B;  4PQU A;  1HQU B;  2WRM A;  1SH2 A;  1YWX A;  2RNE A;  3Q83 A;  3OLA A;  3DLB A;  4OYB A;  1UPP A;  3WX8 A;  2OUG A;  2ZC3 A;  2XY6 A;  1FWK A;  5EWE A;  4A47 A;  3NKP A;  3PX0 A;  2AYB A;  2LXF A;  2VBX A;  2HAI A;  4DUY J;  3PW7 A;  4UQT A;  4ES3 A;  3DOL A;  3LP0 A;  1QUV A;  4KPC A;  2QFI A;  1SL0 A;  2AQ4 A;  4F4A A;  4YB6 A;  3EXY A;  5CD4 A;  2LVW A;  1OY8 A;  2H54 B;  4NZ6 A;  2FLP A;  2LDI A;  3G2X A;  1QY7 A;  2WTF A;  4DWI A;  5KG3 A;  3CCJ S;  3R97 A;  5C24 B;  1D09 B;  5DG7 A;  4TVA B;  3US5 A;  2WCX A;  1FWP A;  1BE4 A;  2Y0B B;  2YKM B;  5HK4 A;  2VV5 A;  4IKA A;  3I5C A;  4ECU A;  4ED8 A;  4DUT A;  2AZ1 A;  4WZM A;  2IRX A;  2HWH A;  1IJF B;  2HZV A;  5HO4 A;  2M7S A;  1HBN B;  2UUA J;  1HBM B;  4BBY A;  2ASD A;  1FJC A;  5KT5 A;  1CUL A;  3VAH A;  3CJ2 A;  2LU2 A;  1R0C B;  4YR0 A;  4DZ6 A;  1LOU A;  1U1Q A;  2CJX B;  4ED3 A;  1RKJ A;  1EW8 A;  4CLW A;  1HQ2 A;  5D0G A;  5A2Q U;  1M90 T;  2D74 B;  4QU6 A;  2ZIT A;  3TJ8 A;  4ERD A;  3POT A;  1T9X A;  4C8N A;  4LSN B;  1N2L A;  2F65 A;  1P49 A;  3FBF A;  3H42 A;  4JI8 J;  4OJ3 A;  2MTL A;  5I3U A;  5HVF A;  3BGL A;  4DLG A;  3EWG A;  2YNF A;  4PQU B;  3BEG B;  5LMN F;  1Y5N B;  3CE8 A;  1NJZ A;  1HW9 A;  1S77 D;  4KV8 A;  4TY8 A;  5KFX A;  2Y9H A;  3H7H B;  3MED A;  2KT5 A;  2MPU A;  2CPJ A;  2FVQ A;  1HWJ A;  4WJB A;  2QLW A;  4ZLL A;  5CZX A;  4MIB A;  4ED0 A;  3DOL B;  4USW A;  3LP0 B;  4DSF A;  1ZS6 A;  1IKX A;  2PMW A;  2OH2 A;  1BQN A;  1GMV A;  2FJV A;  3LF0 A;  2FDN A;  1Y11 A;  1S6Q A;  3LWM A;  1WHW A;  3V81 A;  4LRE A;  3KG4 A;  3BSN A;  3ENQ A;  3AOA A;  2ZZT A;  4Z37 A;  4DV6 F;  3G82 B;  1MLA A;  5E3C A;  2JSX A;  4DFK A;  4PXE A;  2XS2 A;  1P8G A;  2GA7 A;  5KG2 A;  2BKN A;  3KLF B;  4O0N A;  2GVD B;  2HGL A;  4IG3 A;  3CD0 A;  3KK1 B;  4QW9 A;  5DDR C;  3CCW A;  2MHE A;  5T14 A;  2W2N P;  2ZH8 A;  4NLR A;  1VBZ A;  3THT A;  2M8H A;  3QZ7 A;  1O51 A;  1RCX B;  2CZ4 A;  2ZDO A;  3WC0 A;  4MTP A;  2HAF A;  4DFJ A;  2KYZ A;  1IKV A;  1U24 A;  1XNR J;  1S9G A;  1NDK A;  5DO2 A;  3CCV S;  5ETR A;  1CUL B;  5DQG A;  4JI6 F;  2LU1 A;  4AE5 A;  4K4X A;  4CT8 A;  5HRO A;  1C0U A;  1IKY B;  4OMF G;  1ZA1 B;  2YQ0 A;  2RH6 A;  3CDA A;  3KLI A;  2LDY A;  2KHD A;  5KT2 A;  1CG2 A;  5F8N A;  2V69 A;  4TNO A;  4FBT A;  3RU0 A;  1BLU A;  3NKR A;  2L9W A;  3MD3 A;  3CB4 A;  1QDU B;  1U8W A;  4F02 A;  1HHT P;  2VKR A;  2UUB J;  2R7S A;  1FKP B;  2K1R A;  2O67 A;  4I2P A;  1XR7 A;  1FER A;  1WI6 A;  3W2V A;  4ED4 A;  3M4X A;  1PJ5 A;  2YNF B;  3AJ1 A;  1EKS A;  2VHG A;  3LA0 A;  3RG6 A;  2WVB A;  4K4S A;  1K1S A;  2CNL B;  5CA5 A;  1QD1 A;  4QIW D;  3ZZY A;  2N3O A;  2GML A;  1R8B A;  5IWA J;  4Y3C A;  2CQ3 A;  5IFM A;  3MED B;  4BLG A;  3IGY B;  4U7U D;  2BAN B;  1LWF A;  3D6M B;  1NM2 A;  2LEB A;  4LF4 F;  2XWY A;  3FRY A;  1RT6 A;  4DR4 J;  3C15 B;  2LYV A;  1NDL A;  4YQW A;  1T11 A;  2MQL A;  1UA0 A;  5GRR A;  3KJF B;  3UVJ B;  2B4V A;  1S6Q B;  3TG0 A;  4Z7C A;  3G6X A;  2N4D A;  3A3N B;  2XMM A;  3VWS A;  1KBR A;  2VU5 A;  2HHX A;  1U7L A;  1VQY A;  3M8P A;  2H65 B;  1JLC A;  1WOS A;  2CNN B;  4IG3 B;  2IRU A;  3SV4 A;  1XER A;  4F26 A;  3CJ0 A;  3QNW B;  4B3R J;  1B99 A;  4I1T A;  3CF5 Q;  4ZP6 A;  4IO1 A;  4K2X A;  1Q0N A;  3HVA A;  4YB5 A;  2V4J A;  4W90 B;  1VQP S;  2QYG A;  2FVC A;  3BO4 A;  1D9D A;  5KFU A;  3NKY A;  1S9G B;  2XCA A;  1FA0 A;  1W2I A;  1NLK L;  2F8E X;  3AXM A;  4QWC A;  3GIM A;  1VRU B;  5DRK A;  2JLG A;  4ETX A;  5HRO B;  1FDN A;  1C0U B;  3HX9 A;  2E5J A;  2Q3P A;  3QJL A;  5J1P A;  1RUS A;  1HJK A;  5AE1 A;  2BEF A;  2E44 A;  5A8K A;  4DR3 J;  1GX6 A;  3TYT A;  2BR0 A;  3MD1 A;  3HJV A;  3IM9 A;  1K7H A;  1S59 A;  1KHK A;  1FHT A;  3CUL A;  3QBC A;  1UWA A;  3TZX A;  4YB1 P;  3DLG A;  1IUJ A;  3M6X A;  4UUX A;  2FLN A;  2XGQ A;  3W2V B;  1YJW S;  3WAW A;  2IC3 A;  3LXQ A;  3FMW A;  4R5P B;  5H9E J;  3OXF A;  4RBV A;  3EVW A;  4QWB A;  4JI6 J;  1R0A A;  1E3C P;  1VYA A;  2QG9 B;  1X60 A;  3KJN B;  1HA1 A;  2IM2 A;  3DYA A;  2BE2 A;  3PJ9 A;  4ZVP B;  1QE1 A;  1GX5 A;  1X9M A;  3TRG A;  3RAX A;  4F0M A;  4LR7 A;  4J9V A;  2RUS A;  5HJY A;  1UVM A;  2AGQ A;  2UXC F;  3M9O B;  2H51 B;  1MWQ A;  1KOO A;  3JSR A;  4O44 A;  1AJA A;  2C22 A;  1SI9 A;  3MUT P;  1HQE B;  3C14 B;  1YG0 A;  4ZPV R;  5IXU A;  2W8L A;  2YWE A;  2OPR A;  4URS A;  2OPP A;  2AMC B;  2N7Y A;  3DDN A;  2AX0 A;  4EYH B;  2UP1 A;  4GO5 X;  1VK8 A;  5HQM A;  3D3C J;  2JFD A;  1YJU A;  2DHX A;  2DPJ A;  4LF4 J;  2M0G B;  1HHQ A;  3A8I A;  4CIO A;  1L3S A;  2CG4 A;  3IFE A;  2DNY A;  1RWN B;  4QIG A;  1Q79 A;  4F2S A;  4KPY A;  4P73 A;  1C0T B;  1PKU A;  2HYI B;  2YKO A;  4OX7 A;  1ZPW X;  4RW8 A;  4GKK F;  4NWJ A;  4WKR A;  3HHL A;  1S1W A;  4GVL A;  3V6D A;  4AQY F;  1QAX A;  2HFO A;  3MK2 A;  1PYO B;  1HI8 A;  2CQC A;  4OHZ A;  3WIV A;  3AQO A;  1ZEB A;  2MKC A;  2YXL A;  1PC5 A;  3KLH B;  3S8S A;  2NXN A;  2XS7 A;  4AND A;  4EUV A;  1F3F A;  2OIH A;  2ZFH A;  1N2K A;  2OD4 A;  4K0K F;  3CDW A;  3P96 A;  3OVS A;  4NL5 A;  4K4W A;  3PYD A;  4ZVQ B;  2J9D A;  4ED1 A;  1S0M A;  3EX7 B;  4MAK A;  3IO1 A;  6FDR A;  4LFC J;  3W64 A;  4C8Y A;  3LW5 C;  1H38 A;  3PTW A;  4ZK7 M;  1XBW A;  3R2C J;  1RT1 A;  4ICL A;  1WHV A;  1KQG B;  4ZVR B;  4ID5 A;  2VOO A;  3DYA B;  4OYO A;  4KIA A;  1NXI A;  1UFW A;  1K8A T;  3QZ8 A;  2KVQ E;  1DQ8 A;  5L1L A;  3LPE A;  3Q8Q B;  3GII A;  3BM7 A;  4NLP A;  1CQM A;  2DH7 A;  3CVK A;  3EVO A;  3DKD A;  2MQQ A;  1KVK A;  2VG6 B;  2W2P P;  1X4A A;  1UVK A;  1VQ9 S;  1K73 T;  2J76 E;  2YX7 A;  4O44 B;  2LFV A;  3SCI E;  2NPI A;  3H25 A;  1U0S A;  1VBX A;  4NZ0 A;  4CYS A;  2DD8 S;  3UCG A;  3MAA A;  4TXS A;  2VJV A;  2OPP B;  2UV8 A;  2AEJ A;  1H72 C;  4LF7 F;  3IAM 9;  2X7I A;  4A8F A;  4TN0 A;  1FDD A;  1Q8B A;  4IDK B;  4DX7 A;  2N82 B;  3GFX A;  1JLG A;  3I4P A;  5IM0 B;  2DNP A;  3U1L A;  5C25 A;  4BWJ A;  1E1Z P;  1OPI A;  9ATC B;  1RU2 A;  4W4M A;  3N5F A;  1RWX B;  3D0I E;  4DF8 A;  1RWP B;  1U02 A;  4MH8 A;  2GZO A;  2NUU G;  3EZU A;  1BWE A;  2JC1 A;  4P7T A;  3FBE A;  2MZJ A;  5KG7 A;  4DJB A;  3CC2 S;  4TKT A;  4C3L A;  4O23 A;  4ZVT B;  3J7A N;  1Q1K A;  1FD2 A;  3TI0 A;  3H20 A;  3WDO A;  3Q8R B;  3TZZ A;  4OX6 A;  4J9R A;  2A10 A;  1URB A;  2RVJ A;  3AY0 A;  3I9V 9;  2EC0 A;  3WIU A;  5IC6 B;  4CLS A;  2J9E A;  4ZLP A;  2ZUA A;  3P49 B;  1HPZ B;  5DDO C;  2AU0 A;  1NJX A;  3KYL A;  2CQH A;  3DRP B;  4L6V 3;  3GZ7 A;  1OSC A;  4KJI A;  2E1M C;  3L9Z A;  4CDI A;  4NWX A;  1CJV B;  3AXK A;  5F8M A;  1FEH A;  3KKF A;  3TZW A;  3CNQ P;  4LSL A;  4NRU A;  1RT1 B;  4LR8 A;  3FQL A;  2OSQ A;  1TQL A;  1G7C B;  2JLE A;  2QRR A;  2MKS A;  3IR5 B;  3MOZ A;  3PEH A;  4R0J A;  1JNR B;  1F9F A;  2YX1 A;  2F1F A;  4EBE A;  2VQF J;  3I82 A;  4XO0 A;  2DHH A;  3NGU A;  5GVQ A;  1SKS A;  4USU A;  1RT7 B;  3QO9 B;  3RAM A;  5B7W A;  3AT1 B;  2GW8 A;  3PW2 A;  2IMO A;  4Z7Y A;  2E1R A;  3HLU A;  2D69 A;  2BQ3 A;  3ET6 A;  3FSI A;  4A8Y A;  3JAM U;  3D28 A;  3HKZ D;  1QAY A;  4F4W A;  2UUC F;  1HWL A;  3GQC A;  1UJ4 A;  3AA9 A;  5ETP A;  4FF2 A;  3C2P A;  3N5B A;  1MML A;  1E6Y B;  1JLB B;  4EU0 A;  4KSE B;  4ZPB A;  4PG8 A;  1ANJ A;  4OX9 J;  3CMR A;  1WNE A;  4U8V A;  2B4P A;  2IM0 A;  2V94 A;  2BW7 A;  2FGC A;  2B9W A;  1JK9 B;  4M5L A;  4MIV A;  1N88 A;  5MAO A;  2BX6 A;  3B8H A;  3NCR A;  1N5T A;  4WP8 A;  2MKH A;  2W7O A;  2A1B A;  2FY8 A;  3FFI A;  5L38 A;  2LQJ A;  2ZE2 A;  4K4Z A;  5K9F A;  4CLT A;  4ZMM A;  3BKF A;  3CED A;  4E2F B;  2CPI A;  3NVL A;  4I2Q B;  2YPY A;  2F8M A;  4CO0 A;  1LNQ A;  4DU8 A;  3LPY A;  1S7H A;  3A1Y G;  2DNG A;  2H5E A;  1HIY A;  4DUZ J;  2BKP A;  1VLY A;  2B0G A;  1O8B A;  4HI1 A;  4CH1 A;  4LF7 J;  1AXQ A;  5I42 A;  3TAP A;  5CYQ A;  3PV8 A;  2CFX A;  4LBI A;  2ASL A;  4NEZ A;  1WHY A;  3GV7 B;  3W65 A;  4B9V A;  3C8Y A;  4YHH F;  2MST A;  4NI2 B;  4OLO A;  4OJH A;  2XLI A;  4JOU A;  5KT4 A;  4FXW A;  3NAH A;  1UL3 A;  2CVI A;  1XMB A;  5IJS A;  3BR9 A;  2RRB A;  3MM8 A;  3GIK A;  4IRD A;  4UPK A;  1FI4 A;  5IS2 A;  4CLY A;  4OZJ A;  1ELX A;  1OYD A;  1LKZ A;  2I9S A;  2XQC A;  2ALZ A;  1ARO P;  3I56 S;  5G0R A;  2VFV A;  1LQ9 A;  3THP A;  2PEB A;  4C7Q A;  2BA9 A;  3S6E A;  2V8H A;  3AJ2 A;  1YK9 A;  3H5U A;  4Q45 A;  5F8H A;  1OQ3 A;  1TV6 A;  3GTY X;  2ZBP A;  2H5I B;  3ET6 B;  1W7W A;  1HFE L;  5CCL A;  3MEG A;  3RTV A;  4G6V B;  4ZCI A;  4ZKA A;  4C8Z A;  4DR7 F;  2KL8 A;  2ZH5 A;  4K50 A;  4QR1 A;  3HHL C;  2MZQ A;  4KBI A;  4K4U A;  3TQE A;  3ISN C;  5E33 A;  2FJE B;  4C6A A;  5KFJ A;  3PFE A;  2RIL A;  2FQQ B;  3PY8 A;  1GTH A;  1Y7P A;  1AA1 B;  5KFA A;  2ZWO A;  2KJV A;  3BBC A;  3KJV A;  4X4T A;  5HLF A;  4JV5 J;  4OYW A;  4HHJ A;  2HVE A;  3FFI B;  4OYI A;  4CI0 B;  3OL8 A;  1H3D A;  1BXN A;  2A6O A;  1NK7 A;  1C4C A;  1LWE B;  3W9J A;  4LF5 J;  4GKJ F;  4DSI A;  4DL6 A;  2XZD B;  1U6B A;  2LQ5 A;  3IDD A;  3BPD A;  3HT3 A;  4WK1 A;  3E01 B;  2CDR B;  3S01 A;  1CVJ A;  1Y6V A;  3OT9 A;  4ZP9 A;  4IOA Q;  3MR2 A;  2RQC A;  2N4C A;  3WBZ A;  3PR5 B;  2VC1 A;  3CCM S;  3LO3 A;  5FLX U;  1HDH A;  1RCO B;  5EX3 A;  3NBP A;  2ZD1 A;  5CYQ B;  2RJZ A;  2XMV A;  3EVM A;  4U9R A;  2YQ3 A;  5KFP A;  1UJ6 A;  2V2K A;  2DCU B;  4D3H A;  4FVM A;  4PYD A;  3R5D A;  3D6F B;  2OO4 A;  2P9C A;  5F9N A;  5KG1 A;  3BSO A;  3LP2 A;  3MM8 B;  3I32 A;  3TVY A;  4YUD A;  1YIT S;  1GMU A;  3NOG A;  3KMQ A;  1DFD A;  4HAC B;  3BDE A;  4HI2 A;  2HBZ B;  3GSD A;  4WFB Q;  4G1I A;  3NKN A;  5G0R B;  1P1T A;  2XSF A;  3LP1 A;  2RQM A;  4ENO A;  2C2E A;  2CAD A;  1S0O A;  1TVR A;  2J0W A;  2F9D A;  2Q66 A;  2HHW A;  2DGW A;  4XPC A;  5AE3 A;  1FXR A;  1KRP A;  1ZZF A;  2GQ2 A;  3OUY A;  2RDJ A;  4OZ2 A;  2RRA A;  2WON B;  3GFZ A;  3MEG B;  2PA8 D;  2ZWP A;  2HNY B;  1V3Z A;  2XZT B;  3K57 A;  3BDG A;  4PKD B;  2GX8 A;  5LM7 E;  1VIX A;  4TQS A;  4FS1 A;  4IH6 A;  2MKI A;  2RF2 A;  4A8X A;  1RTD B;  1M5H A;  4HEA 9;  2FHJ A;  1RT4 A;  1CEZ A;  1FD8 A;  3UE2 A;  2PMH A;  1WG1 A;  4ZVG A;  3FSY A;  3IRX A;  5C42 B;  1U0H A;  1EQJ A;  4Y2C A;  2DO0 A;  2JNJ A;  3X1L B;  3AD8 C;  3QT7 A;  3KJV B;  2GHW A;  1FFS B;  3FJ2 A;  1R8A A;  3HVR A;  4PWU A;  2CQ2 A;  1IVZ A;  1H6K X;  3BJY A;  4CLZ A;  3R7N B;  2JRS A;  3GU0 A;  5DGB A;  4WKY A;  2C42 A;  1CJK A;  3LGH A;  4X4R A;  1TK0 A;  1UP1 A;  3UDE A;  1T95 A;  5HBM A;  2E5L J;  2CVE A;  1ZAX A;  2C3P A;  3M8Z A;  5D78 A;  4C98 A;  1LXJ A;  4LR2 A;  1U49 A;  3AOB A;  3EDQ B;  4FPR A;  1KH5 A;  2GGP B;  2ROG A;  2QEX S;  2PII A;  5KT7 A;  2KM8 C;  3OHA A;  3G6V A;  2ZJQ Q;  2VZ9 A;  4A8S A;  1HNX F;  1SC1 B;  1FX2 A;  3HO1 A;  1YZ7 A;  4JI2 J;  3H40 A;  1RAH B;  2IRY A;  4MKB A;  3DRR A;  3N6L A;  1PCA A;  3L7O A;  4PWD A;  4MYU A;  3ED4 A;  3HHL D;  2FJB B;  3OSP A;  1JB0 C;  2IBK A;  4H54 A;  3K5M A;  3QYY A;  3ISN D;  2XNR A;  2OTJ S;  1O98 A;  2EFQ A;  3ZXW A;  4JBC A;  4HT7 A;  2ZM6 F;  4PPZ A;  2F40 A;  1IBL F;  4MJK A;  1GAO A;  3Q8S B;  3SQG B;  3CIZ A;  3CJR A;  3G8T A;  2GCF A;  4AXI A;  2W2M P;  1SJ4 P;  5IT0 A;  5HMZ A;  2J0Q D;  5DG8 A;  3SEO A;  1G6B A;  4Y2M A;  3ENW A;  4XAK A;  2KU7 A;  3HJF A;  2GJ2 A;  2BM0 A;  3DN9 A;  3ZZZ A;  3EGZ A;  1VQ8 S;  3MM5 B;  3GG0 A;  1FWL A;  3KHG A;  5BR8 F;  4ZG7 A;  4KJG A;  3UO0 A;  2RT3 A;  1RTJ A;  5E0O A;  4V19 X;  2NYH A;  2VDH A;  1RYR A;  1WUU A;  1O6X A;  4OHY A;  4MFB B;  4RNM A;  3HI9 A;  2C2Z B;  3DGV A;  2GIQ A;  3M2V A;  1GH8 A;  3D54 A;  2DXF A;  2IAJ A;  2QJ3 A;  4DBQ A;  4DR1 F;  1RB0 A;  1HHS A;  1HMV A;  4CYU B;  3TUP A;  1FO1 A;  3WHI A;  3JB9 k;  2AD9 A;  1XMO J;  1E6V B;  2W7P A;  2XB2 D;  2YTC A;  1Y0H A;  1C4A A;  1HWK A;  4DL3 A;  5KFD A;  3BGR A;  2AWZ A;  2W01 A;  1U2R A;  4J9N A;  1U09 A;  1URA A;  1I94 F;  2DR5 A;  2HEK A;  2JVR A;  1N6Q A;  4ANE A;  2DT9 A;  1VGY A;  1TTH B;  3DRR B;  2CG8 A;  1ZEF A;  1YI2 S;  3FGV A;  4NML A;  2MKY A;  4JV2 A;  1RHM B;  2K7J A;  5ETK A;  2LEC A;  2F63 A;  2G13 A;  2O01 C;  4KGK A;  2FTR A;  4YEA A;  5KFO A;  1REV A;  1FX4 A;  4U6P A;  3D66 A;  4AUK A;  2CPE A;  1MU2 B;  1NJI T;  3T00 A;  1NSQ A;  5B0A A;  5KT6 A;  1VQ5 S;  1MWY A;  2J7K A;  4M5G A;  3ELH A;  2W9C A;  3K8V A;  4QQB A;  3KHH A;  4LVO P;  1XNQ F;  4OZ1 A;  4CXS A;  3PRB A;  5JVG Q;  3Q2S C;  5LL6 d;  3FSX A;  5A8W A;  5D3G B;  3T1Y F;  5EWG A;  2CPY A;  5KOW A;  3QGP A;  4OI2 A;  1SB6 A;  3OQ2 A;  1TFW A;  3TAN A;  1Q95 G;  2CNK B;  4HDH A;  1RJJ A;  2QE5 A;  1EET A;  2DXE A;  3TNV A;  2KJW A;  2OEL A;  2FVS A;  2YWG A;  3LUY A;  1NSK L;  2WK4 A;  4P9S A;  2M8D B;  1FEE A;  2I8E A;  3CO0 P;  4P2F A;  3EDR B;  1X5O A;  1LK5 A;  3D1Q A;  2J9D E;  3KLE B;  5F8I A;  3TOQ A;  3M2V B;  4U7C A;  2XGP A;  3OR1 A;  1FXL A;  3ZFV A;  1RAD B;  2IAJ B;  5KAK A;  1J5E J;  3L7U A;  4ECV A;  5KXA A;  4UY8 T;  2RIJ A;  2KZM A;  2FHO B;  4DN9 A;  3H4D A;  1VC5 A;  3RUB L;  4Y2A A;  4PWW A;  3LWL A;  2N3L A;  1KH7 A;  1JLA A;  4IG0 A;  2XY5 A;  2JL9 A;  5K5M A;  1JLE A;  4RW4 A;  1N6Q B;  2EG1 A;  3H98 A;  4J5O A;  1UMJ A;  3CCQ S;  2FHK A;  1UCN A;  3J7Y I;  5E41 A;  4HDG A;  2Y3Y A;  1SJQ A;  4NLS A;  2EK1 A;  2JHE A;  3VF0 B;  1J5O A;  1C2P A;  1H2U X;  1RBO B;  1REV B;  2ZH7 A;  4CNY A;  3H2L A;  4I6W A;  1CLF A;  4OV1 A;  2DR9 A;  3GIR A;  1YDL A;  2Z57 B;  4CWB A;  4P10 A;  2R7T A;  3CO9 A;  2HNZ A;  3M8Y A;  4KE5 A;  2AGO A;  1B0T A;  1BHN A;  3AAW B;  2W9C B;  1UVL A;  2GV1 A;  3NS5 A;  1ED9 A;  4QYZ K;  3DDI A;  2JH3 A;  3JSM B;  2MSS A;  5A8W B;  1X8D A;  1I94 J;  3AD7 C;  4L3K A;  2BJ9 A;  1MMD A;  4L74 A;  1Y00 A;  2NXJ A;  1QJH A;  3H5Y A;  4K4Y A;  2JWN A;  1UAW A;  4CQ1 A;  3S7R A;  1PSD A;  4IR1 A;  2JLF A;  4IFY A;  2C1E B;  4G3I A;  1CS4 A;  1Q16 B;  2VKZ G;  4ZIW A;  3SFU A;  1JXV A;  5IC4 B;  3MMB A;  2H9Z A;  3UWT A;  1S1X A;  2BV3 A;  3QWP A;  1YJV A;  2XNQ A;  3C6U A;  1N36 F;  3OL7 A;  4OQJ A;  2YKP A;  1GXU A;  4QCL A;  2POK A;  3A12 A;  4KGV B;  2CQD A;  4AT1 B;  2ROE A;  3VAJ A;  4OYZ A;  3BO3 A;  4TU8 A;  3BZQ A;  4B3T F;  5J2M B;  3I4H X;  2HIY A;  2UUW A;  2X1G A;  1ALH A;  2DIS A;  4X4V A;  2UVR A;  1TMJ A;  1FRJ A;  5EX0 A;  5D6G A;  1YBA A;  1JLA B;  4IG0 B;  3KDN A;  3H8Y A;  3D3B J;  2BJ8 A;  1JLE B;  5KFH A;  2LP4 A;  1GXT A;  4Q44 A;  2XYG B;  1N54 B;  2ASJ A;  5DLF A;  1JJ4 A;  1K9M T;  2AEM A;  2XO7 A;  1RSC A;  4A8W A;  1JJC B;  3FBB A;  4B3O A;  1HAR A;  1J5O B;  3HFZ B;  3DRS A;  4DQQ A;  4ZHR A;  3I31 A;  1UA1 A;  4IRK A;  2FHM A;  3OTD A;  5AXN A;  1HL6 A;  1QAJ A;  2YH0 A;  3M2U A;  2HHT A;  5E2Q A;  2ZHB A;  3IXQ A;  1NRK A;  1EZZ B;  3DPC A;  1NZ8 A;  3J7Z 5;  4ETZ A;  1D1U A;  1X4H A;  4YP3 A;  3HK2 A;  1PBA A;  3TAM A;  1VR6 A;  1ZAW A;  2DHA A;  5E3Q A;  1JX4 A;  5KG6 A;  4X4O A;  4ILR A;  4KGM A;  2XHW A;  4LIW A;  2DVI A;  5FDL B;  2KT3 A;  1N5Q A;  5JJB A;  2Y1L B;  1XC9 A;  1DTQ A;  2NXC A;  1E33 P;  4D3G A;  3KHL A;  1PBU A;  3QWU A;  2PD1 A;  2KVI A;  1ALI A;  1X7V A;  2QA1 A;  3RRG A;  2ZOM A;  3O8W A;  1M1H A;  3SYZ A;  5THW A;  4K7Q A;  3FCH A;  3MMB B;  4DR5 F;  1B64 A;  5F9L A;  1R3N A;  1RWM B;  3RJM B;  4I6Y A;  1HNI A;  1SUQ A;  1M5S A;  1RLD A;  2GAH C;  3MAH A;  3C3L A;  4M94 A;  1NKC A;  4URQ U;  1KNZ A;  1N0V C;  2NZC A;  4KC5 A;  4OHV A;  4WE1 A;  2FHJ D;  5F8J A;  2VG5 B;  4H4O B;  2K3K A;  4Q5V A;  4L73 A;  3D9B A;  2HHS A;  4I56 A;  4Q8F A;  3PAC A;  4UPI A;  2BBE A;  3BV8 A;  2I6W A;  3ILI A;  6AT1 B;  1TK8 A;  2UVW A;  1FJG J;  3GCW P;  2GVZ B;  3FNN A;  3J7Y U;  1RAI B;  1L5U A;  4B3O B;  3VAF A;  1RWK B;  5EGH A;  2CUY A;  2BQR A;  2VOD A;  2ZH1 A;  3A4T A;  2BXJ A;  2DEJ A;  4LFA J;  1FRX A;  1X5P A;  4WP3 A;  3GSI A;  2J6T A;  3TAQ A;  4UOR A;  5CHC B;  1TR0 A;  3SSS A;  3MFH A;  5ETQ A;  4XDD A;  1RAB B;  3DHW C;  1RTI A;  4OI3 A;  1BMQ B;  2RU9 A;  2XSJ B;  2DGV A;  5TJ3 A;  5E3P A;  3UR3 C;  1G3O A;  1HNW J;  4DSJ A;  4HTJ A;  2V9K A;  3TAM B;  3NNH A;  3HPO A;  2APO A;  2C2D A;  4P2X A;  4CLF A;  4OZL A;  3B82 A;  1KHN A;  5E5N A;  2R7R A;  3PYF A;  5JUM A;  4F3M A;  4JI1 J;  3RBX A;  2ACM A;  1HR0 J;  3DLK B;  3K5P A;  2QT7 A;  1YZ6 A;  2UVV A;  3EXC X;  3D1H A;  4NRT A;  2B5J A;  1U1P A;  5L39 A;  4LF8 F;  2DY1 A;  4YR1 A;  3SDE A;  4F67 A;  1GK8 A;  2B9Y A;  3OTB A;  4I6A A;  2HHH J;  1P1L A;  4QPT A;  2EG2 A;  2ABY A;  1NDP A;  4JI5 J;  2J0X A;  1MMN A;  4LQ9 A;  3M2R A;  3T1H J;  2HBY B;  4RWW A;  2CPD A;  1SUQ B;  3DGP A;  2PEH A;  2HQC A;  5G4D A;  4YY3 F;  2EFG A;  1UWB B;  4ZN3 A;  2HRT A;  4DV4 J;  1WKJ A;  3MF5 A;  3IWX A;  3ITH B;  3M32 A;  4LF9 J;  5D15 A;  4B08 A;  4UW2 A;  3RRH A;  2BZ2 A;  2LMI A;  5FJ4 A;  1SC3 B;  3K2Y A;  2WB4 A;  2HMI B;  3DXS X;  3ZZU A;  3PHT A;  2V50 A;  2KB2 A;  2NCK L;  2MMY A;  2UZA A;  3M30 A;  2ADB A;  4JI4 J;  3TX0 A;  2J7W A;  2BJ1 A;  1NK8 A;  1QSS A;  1DLO A;  5M2P A;  3Q0A A;  3BQ0 A;  2FY1 A;  4JI3 F;  1RE1 B;  1NO8 A;  5AT1 B;  1RA7 A;  4P72 A;  4QBU A;  2O3D A;  3DM2 A;  3R5J B;  2NRE A;  4LT6 A;  3VQS A;  3B5Q A;  1NKE A;  1T0T V;  2CJA A;  1ZYQ A;  1WD6 A;  4DL7 A;  2W5R A;  4DOZ A;  3GMG A;  2NPF A;  1B3T A;  1RTI B;  4FYW B;  1NK0 A;  2HQI A;  3MEK A;  1SC6 A;  2I2Y A;  3V4M A;  2W5X A;  5J2N A;  3Q8U A;  2G2Z A;  4IQM A;  1VLO A;  2ANH A;  2LEP A;  4OHW A;  2VC0 A;  4PCQ A;  3ZTQ A;  1KQK A;  2Z0G A;  1N5V A;  5D8H B;  1S0V A;  3ICL A;  2WAQ D;  4J9K A;  2M9K A;  3QLH A;  4NLO A;  4X2B A;  4OYX A;  5U47 A;  2DHS A;  3KJQ B;  4N76 A;  3Q8Y A;  1N48 A;  4DG1 B;  4NX9 A;  2W2Q P;  2IM3 A;  5M2R A;  3OSN A;  2DGU A;  2F7V A;  3VAG A;  2RH3 A;  4OV6 A;  4X64 F;  2ZVS A;  3ZTR A;  1AFJ A;  4FDF A;  3KHR A;  5C66 A;  2VH7 A;  3PFO A;  2RDI A;  2YNI A;  4OHX A;  1MN9 A;  3M2R B;  5KFF A;  3PHE A;  3RB0 A;  2DNZ A;  3CJK A;  4USJ C;  2W9B A;  5GOV A;  3UD5 A;  2B4U A;  2DGQ A;  4EZ9 A;  2CQ4 A;  3KUG A;  5HAO A;  1KKH A;  2MEW A;  1DZ5 A;  1PC4 A;  1UPM B;  4G1P A;  3IBC B;  1XMQ F;  1KC8 T;  2HFV A;  1IBM J;  2UXD F;  1Q5V A;  4MKA A;  3PM9 A;  2CJ9 A;  3MUM P;  3I6P A;  2CJY B;  4GC7 A;  1P27 B;  1F9E B;  1FRI A;  4Q2M A;  4LF8 J;  4MK8 A;  2XZW A;  3DOK B;  2MY7 A;  1EP4 A;  1JJH A;  4LFB J;  3M30 B;  3VHQ A;  5DZ6 A;  2MQO A;  4WXO A;  3NAI A;  1DLO B;  2MYF A;  2ZNZ A;  4B3M F;  2DR6 A;  2AJ1 A;  1MRO A;  5D0E A;  1CJU A;  5LMU J;  4L72 B;  1FRL A;  4CCH A;  4L75 A;  4NLX A;  4TYA A;  2R8J A;  4YME A;  3T6B A;  2D1G A;  4FN5 A;  4Y65 A;  4C97 A;  4B9M A;  4IFV A;  1N5Y B;  4NLV A;  5J2N B;  4RW6 B;  4ITS A;  2IJF A;  4JI7 F;  4UOO A;  5HMW A;  1S10 A;  3P8B B;  2GS8 A;  2G4B A;  3KOA A;  4WPA A;  1RT2 A;  2CDQ A;  4CTA A;  4YR2 A;  1ULR A;  2YWH A;  3OL6 A;  2HZC A;  3RRK A;  1IKW A;  4G1Q B;  3D67 A;  5B0E A;  3M6U A;  1KHL A;  5HL7 Q;  1U4B A;  1VBK A;  1RHK B;  4WP9 A;  2YWF A;  2V67 A;  3A8K A;  4IOC Q;  5J2Q A;  1H74 A;  3LAM A;  5A0Y A;  3HVT B;  1B70 B;  2NQP A;  2YNI B;  1F2G A;  3MR3 A;  3EGN A;  4ZG9 A;  4ECX A;  5D4O A;  1FFG B;  2KN4 A;  2QLJ B;  3A52 A;  2FJW A;  1S72 S;  1OO0 B;  4DV1 F;  2C3U A;  1WC5 A;  4HH1 A;  2XY7 A;  3N6M A;  2VAS A;  2R7Q A;  2B7C B;  4V1A k;  2HVI A;  3F73 A;  2L9N A;  2E1C A;  1HQU A;  1TZ0 A;  4WF9 Q;  1ITP A;  2MZS A;  2Y1R I;  1APS A;  2CQB A;  4LQY A;  1Y4Z B;  3QID A;  4OI6 A;  3TUJ C;  2HFU A;  2DNO A;  2KI2 A;  2V63 A;  3DHX A;  1S5Z A;  4L3N A;  4C8M A;  2ZOG A;  1WEY A;  3ENV A;  4NYP A;  1RAO A;  3RW6 A;  1VBY A;  1WEX A;  1T9W A;  1EP4 B;  2MQP A;  2I0X A;  2JJ4 D;  2WW8 A;  1SQF A;  4UF4 A;  2EC2 A;  4HVZ A;  1RAC B;  3FCW A;  3V6K A;  2C3M A;  1Y7A A;  4Q0B A;  3FZ2 A;  4FNI A;  4MYT A;  1S4F A;  2A18 A;  2VG7 B;  4KKO A;  3R5A A;  3VZI A;  1FTR A;  4O4G B;  3ETM A;  2R7X A;  1EAR A;  1MRO B;  5C24 A;  2VJU A;  3M1V A;  2BYC A;  3W2W A;  4HH0 A;  4X62 F;  3T02 A;  2YKM A;  2EWH A;  4DPU A;  3DMJ B;  3SCK E;  3LOU A;  4JYA J;  2K8G A;  2XMK A;  4RKU C;  1D8Z A;  1SL1 A;  3NKO A;  1SKR A;  2HRU A;  3FUY A;  2B3T B;  3VQT A;  5AJ3 J;  3HKW A;  3RZA A;  2HQD A;  2R4F A;  1RT2 B;  4CTA B;  3LTO A;  4JI0 J;  3J81 Y;  3T01 A;  1S1T A;  5I3Q A;  5HAT A;  1TL3 B;  4OI0 A;  3NLC A;  5KFK A;  2C2K B;  2QTW A;  5HQL A;  4U67 Q;  3A8E A;  5A0Y B;  5HSP A;  5FII A;  4DMZ A;  1RTH A;  2U2F A;  5F8G A;  4ZVS B;  2W24 A;  1LWX A;  2Q6B A;  2V68 A;  2X98 A;  3O44 A;  3BDF A;  1B8J A;  4RUC A;  1JXE A;  1VQ4 S;  3OHB A;  3B4D A;  1RYS A;  3PR4 A;  1AFI A;  1Q7Y T;  1UW4 A;  1WC4 A;  3AJD A;  1L3U A;  3S1T A;  1VCT A;  3RBE A;  1FES A;  2KFY A;  2ZBI A;  2GO8 A;  4F3O A;  4PUO A;  4P2M A;  2F4F A;  1FRK A;  2GHV C;  2KXN B;  2W5W A;  1S6P A;  4U8Y A;  2FPH X;  1MW7 A;  1N34 J;  4DPW A;  1YJ9 S;  3AHP A;  2EBG A;  1UEV A;  1PAU B;  4CO4 A;  1U6F A;  2XBP A;  2P2C B;  3PCO B;  2MQN A;  4Q0B B;  1FDA A;  2AJF E;  3WAY A;  3R27 A;  4DV1 J;  1AJC A;  4KKO B;  3PIO Q;  4ER8 A;  4KH1 B;  2AJ2 A;  4DL0 C;  2B8P A;  3G82 A;  3UQS A;  4WWS A;  3M1V B;  1VHI A;  3W2W B;  3M8W A;  5AXL A;  2I5J A;  4LMZ A;  3KLF A;  3DLE A;  3Q3Q A;  1H0H B;  1W26 A;  2GVD A;  2MZ1 A;  3KK1 A;  1Q78 A;  2B43 A;  3BRE A;  1KTQ A;  1WF2 A;  1LWC A;  3UD3 P;  1F5A A;  3OTO F;  2VON A;  3MOJ B;  1U1R A;  3FEX B;  1TFY A;  1TKT B;  1I51 B;  5DM7 Q;  2NR0 A;  1C1C A;  4ANC A;  3R6G B;  1V3R A;  1QSL A;  4GTZ A;  4C0B A;  5E3A A;  1IKY A;  1S1T B;  5IT9 U;  1HYS B;  3ZNJ 1;  2FIU A;  4LF6 J;  1Z1Z A;  2DRA A;  2F4V J;  4F3Q A;  4WFX A;  2QA4 G;  1KSP A;  4FBU A;  3VAL A;  1RTH B;  3C6T B;  1CSJ A;  3AQP A;  1P9Y A;  5ETS A;  2ZJR Q;  4PG6 A;  4NCG A;  1LW0 A;  2X3G A;  4RU9 A;  1KLM A;  1FKP A;  1SJ1 A;  4A8M P;  3VR1 A;  3DLL Q;  1VQS A;  4ZVH A;  5KG5 A;  3H2U B;  2MLY A;  2FJA B;  5L0B A;  3IR7 B;  1UZH A;  1WKL A;  3GYX B;  3VAK A;  4EO8 A;  5EHH A;  4X66 J;  5F3Z A;  1X4E A;  1Y3K A;  3IRW P;  3T41 A;  4PUO B;  1U1K A;  2IVF B;  5M2U A;  2H1Y A;  2BAN A;  3IGZ B;  4DS4 A;  1S6P B;  1BUX A;  2KH9 A;  2V8P A;  4CO5 A;  1XWL A;  5GAE I;  4WII A;  3C15 A;  2OJ3 A;  1KD1 T;  1T9U A;  2V2Q A;  4M5N A;  2EPI A;  3F44 A;  4DR2 F;  4FXV A;  3UVJ A;  4J9Q A;  3MCS A;  1WHX A;  1TKD A;  4GTY A;  1NPK A;  1S9E B;  2CZV C;  4X4U A;  3FBC A;  1R8P A;  3LAN A;  2WB1 D;  5CYJ A;  3THV A;  3ZZR A;  3H5S A;  4B9L A;  1J2V A;  2Z58 B;  5C7P A;  2I5J B;  1Q7L B;  3DLE B;  1NCL A;  1HWI A;  1MNE A;  1RIS A;  1K0V A;  4RW9 B;  3G96 A;  3OR2 A;  1LWC B;  1HBU A;  3QAE A;  3ZZ0 A;  3BF4 A;  3G87 A;  2LXU A;  4MIA A;  4LBP A;  1C1C B;  4DLE A;  1SVD A;  4Y00 A;  4DXL A;  1N32 F;  2HUR A;  3VVT A;  1VRU A;  8AT1 B;  5J1E A;  3CD5 A;  4MK9 A;  4ILM A;  2H3E B;  2VOP A;  2PSZ A;  5K8O A;  3MUR P;  1N52 B;  2HZA A;  4DV7 F;  1P6T A;  1U2C A;  5L9X A;  4TU7 A;  3CJT A;  3UI3 A;  3W9H A;  3MM7 B;  4LQ3 A;  3BS9 A;  3U27 A;  1AUK A;  3WX4 A;  2YKQ A;  3HDS A;  2LLZ A;  1FFW B;  4NCG B;  1LW0 B;  1M1K T;  4CLK A;  4DV2 F;  1ZET A;  4CLP A;  1KLM B;  2MLX A;  1P9Q C;  2HHV A;  2PMZ D;  1EB0 A;  3MM6 A;  2AW0 A;  3OD2 A;  4ZPC A;  3QFH A;  4O3P A;  2PO4 A;  2V2V A;  4R5P A;  1S1V A;  1PAE X;  3JYT A;  2YNG B;  4X4S A;  3U7J A;  2RHS B;  1RAF B;  4E98 A;  2CPX A;  3UN5 A;  2OEK A;  4HR2 A;  2OFG X;  2N7C A;  5EDW A;  3DFE A;  4M5D B;  2DBB A;  3QSY B;  5H9F J;  2C2M B;  2W5Q A;  1R43 A;  4A4J A;  3CME S;  4JB8 B;  4C0O C;  5CAB A;  2G1D A;  4TN2 A;  5IQQ A;  3H90 A;  1T9V A;  5HMX A;  1S4E A;  3GYG A;  2UXB F;  2IJR A;  7FDR A;  2KHC A;  4RNF A;  4WU3 A;  3CPW R;  4J9S A;  2CYY A;  4C3K A;  4ELV A;  4W98 A;  1CC8 A;  5T7L A;  1HQE A;  1C1B B;  3C14 A;  3MEE B;  2WVD A;  3L3C A;  3SZY A;  5LMN J;  3M9N B;  4AL5 A;  5KFL A;  3BYR A;  4FYY B;  1UVJ A;  5KFV A;  2B8Q A;  1PJ6 A;  2EKY A;  1RHQ B;  2HLT A;  1N33 F;  5H9F K;  4O3O A;  1TU0 B;  3OR2 B;  3QSI A;  1HBU B;  3M7V A;  2MXY A;  3CDE A;  4LRC A;  1DAX A;  1X31 C;  3CGI A;  3UN2 A;  4KGX B;  4OIX A;  5J1E B;  4LRD A;  3FC9 A;  1C0T A;  2V5H G;  4NA2 A;  5HAN A;  2RHQ B;  2RU3 A;  4NYZ A;  2HFS A;  2DGT A;  1WOO A;  3OTE A;  3SV3 A;  4RUB A;  4DV6 J;  1F2H A;  2K3I A;  3WAV A;  5DLV A;  4UZB A;  1RAJ A;  2GJI A;  1UW9 A;  3KLH A;  4CO2 A;  2OPQ A;  2MQ8 A;  3TX8 A;  1JLF B;  2KXF A;  5GAH I;  3IAS 9;  3MM6 B;  4WBF A;  5CQG A;  3MK1 A;  4M5M A;  2QLF B;  5KFS A;  4CT9 A;  4DV5 F;  1S1V B;  3JYT B;  2CIM A;  2D41 A;  4CH0 S;  2LQB A;  2O5D A;  3AB4 B;  3N4W A;  1KHV A;  1WC3 A;  1RHR B;  4J9P A;  5K14 A;  1HNV B;  3DRX A;  5IT4 A;  3R5C A;  1J27 A;  5GAE U;  1Q8I A;  2OGU A;  4F2R A;  1VI7 A;  3QPI A;  3I55 S;  1VQM S;  1SQE A;  3D5M A;  1H2V Z;  3D0G E;  1SBR A;  4FZV A;  4BS2 A;  4WIQ A;  3TEH B;  3EGW B;  4H4K A;  1PO6 A;  5HP1 B;  2VG6 A;  4DV2 J;  4ALZ A;  1IJE B;  4ZG6 A;  4BWM A;  5H9E K;  5T7L B;  3NCP A;  2MJN A;  4USI A;  4BCA A;  3H4B A;  3VTI A;  4F4K A;  3HHN B;  2DR8 A;  2B9E A;  2H5J B;  4X65 F;  2P6T A;  2HLU A;  2D3O 1;  4P2S A;  4IDK A;  4J91 A;  3DYC A;  5EGE A;  5LSL A;  5IM0 A;  1WSR A;  3P4U B;  1KH4 A;  2FUG 9;  5HVG A;  1ED8 A;  1EHW A;  4ECT A;  2D7S A;  5AJ9 A;  1JJ2 R;  4ZN1 A;  3A3P B;  2ERR A;  3UDV A;  1ELZ A;  5B0C A;  5D4L A;  2C28 A;  2O66 A;  3W61 A;  3H59 A;  4LRA A;  1JLQ A;  3CCT A;  2G2O A;  3PDN A;  3PO4 A;  1JWW A;  4ED5 A;  4NZ7 A;  4I7F B;  4GMK A;  3JXO A;  4HHH A;  4OX8 A;  1ELO A;  4ECY A;  4A8K A;  2JFK A;  4I64 A;  4QZV B;  3ZO7 A;  1N33 J;  2OPQ B;  5L8R C;  3SCL E;  4ZIT A;  1HPZ A;  4FYD A;  3W9I A;  1UFL A;  3JSY A;  2HS3 A;  3DRP A;  2OKQ A;  1FJ7 A;  4AD6 A;  3L7P A;  3T5L A;  3EM1 A;  1QAI A;  2D3U A;  5KFG A;  1CJV A;  4OJ1 A;  5K14 B;  2W2O P;  3NP5 A;  2NXU A;  5AE2 A;  2W4P A;  5IV4 A;  3LGM A;  1VC0 A;  1MSW D;  1QUP A;  4WFA Q;  2GFF A;  4USK A;  4AL6 A;  1IBK F;  2RB7 A;  4N47 A;  4DR6 F;  1RT7 A;  3QO9 A;  1XJW B;  4ZCL A;  2E7X A;  1M5K C;  1RTZ A;  3TVK A;  2XMW A;  4DV3 F;  1HI1 A;  4HKQ A;  4ELT A;  4K2J A;  4GVB A;  4HLB A;  3C19 A;  1X4G A;  3EZ5 A;  2V6A A;  3QQC D;  4KM4 A;  3AA8 A;  1E6Y A;  1JLB A;  4N7T A;  3HD1 A;  3NGT A;  1YRU A;  3T5J A;  1B7F A;  2VQE F;  1KWM A;  1I3O B;  1KQS R;  5LRM A;  1R7I A;  4WYL A;  4NXN F;  2EEY A;  1AUS L;  1Z2L A;  2VFR A;  1SQG A;  3SMZ A;  2UXC J;  2Z56 B;  4B9N A;  3NY0 A;  1YRX A;  2NZ4 A;  1HQA A;  3L95 X;  3D2W A;  1D8Y A;  1JLQ B;  1U1N A;  2BAC A;  4I2Q A;  1EIY B;  4Y6I A;  4YDX A;  3NGK A;  2OI2 A;  2PE8 A;  5LRN A;  1SIZ A;  3JS9 A;  2M52 A;  2HHU A;  2HIQ A;  3GV8 B;  5GAH U;  2NLW A;  1M5P C;  1NJW A;  3MCO A;  4FP9 A;  4NI2 A;  4RLE A;  4DUY F;  1U8S A;  1A0O B;  4KO0 A;  4QAX A;  2LEA A;  2GMH A;  3CCS S;  2GSN A;  1IR2 A;  3M6V A;  4ILL A;  2IVY A;  5JMN A;  1S97 A;  1ZAV A;  4GKK J;  2HFN A;  4KR0 B;  4MKY A;  3DLH A;  5F3T A;  4ED2 A;  4AQY J;  1BQX A;  2RQ4 A;  2ATC B;  2GQC A;  3CJ3 A;  3MMC B;  4J9L A;  2QC3 A;  3BBB A;  3UPF A;  4HTI A;  4I69 A;  4B9S A;  1KS2 A;  3W63 A;  4O0I A;  2MLZ A;  4Y2I A;  5K8P A;  3HFK A;  1RU1 A;  2XLK A;  1UKU A;  4UOF A;  4K0K J;  2QSW A;  4FYX B;  4Y28 C;  2B6A B;  4GVB B;  2IIH A;  3GCX P;  2P5V A;  1PG5 B;  4HYK A;  1FKA F;  1F5C A;  5IZH A;  2UUA F;  3ILJ A;  3FMB A;  4QJV A;  4TLR A;  3WZ0 A;  2XCP A;  5SUH A;  4BC7 A;  1RXO B;  2ADC A;  3FEY B;  4ELU A;  2E7V A;  3QRR A;  5LSR A;  1NK9 A;  2WSE C;  3GP9 A;  2HPU A;  3MM9 B;  1S9F A;  4PG5 A;  3MXH P;  2QL9 B;  4Q43 A;  4L76 A;  4C8K A;  3GJR B;  2A0F B;  4OI1 A;  3CW2 C;  2I38 A;  2J8A A;  1SIW B;  3VAM A;  2V34 A;  4DR6 J;  3C66 A;  3PVX A;  5EWF A;  2DNQ A;  4N5S A;  2X1B A;  1HD1 A;  3FZB A;  1LWE A;  4JI8 F;  2J5A A;  4RR5 A;  2G2Y A;  3LGN A;  1UTA A;  3D68 A;  1B7Y B;  3E01 A;  2HVH A;  2ZH4 A;  2AP6 A;  2R42 A;  5KG0 A;  4U7U K;  2WHO A;  4F50 A;  4K4T A;  1M0S A;  3KUE A;  1ZH5 A;  2XS5 A;  4DDF A;  1CQN A;  3PXG a;  4ZP7 A;  2M2B A;  3NNC A;  4RPF A;  4DPO A;  1LFW A;  4M5J A;  3QIP B;  4C9D A;  1MG7 A;  1BQM B;  4ZLJ A;  2KKH A;  3MR5 A;  1UVN A;  2LCW A;  2VBZ A;  4H4K C;  2GA3 A;  2RS8 A;  1RAG B;  2HND B;  1N8R T;  4NXN J;  1OPZ A;  2BJ3 A;  2MQM A;  1JIH A;  2DYA A;  4KO0 B;  1TKZ B;  3GE9 A;  2L41 A;  2R2U A;  3PX4 A;  1WC6 A;  4WTO B;  2A6M A;  5DQI A;  3J80 Y;  4C11 B;  4HAC A;  2DNM A;  2UUT A;  4CP5 A;  2CJQ A;  2MKK A;  2IDE A;  4DCO B;  4JV1 A;  2PC6 A;  4P7V A;  3BDP A;  3OFF A;  1S79 A;  1DY3 A;  2WON A;  2VPY B;  2HNY A;  3ZTO A;  3CDU A;  2BE7 D;  3KWM A;  4PYA A;  1FRH A;  2CPZ A;  3O2I A;  4J37 A;  5CZV A;  1XNR F;  5B08 A;  3PJX A;  3IMQ J;  1X4F A;  4KGZ B;  1GNK A;  1RTD A;  2UVU A;  4Q8E A;  2OTL S;  3EIC A;  4DU7 A;  5C42 A;  2XWX A;  4AXJ A;  3IWN C;  4NEY A;  2CAJ A;  1T9T A;  1WG5 A;  3PEJ A;  2QMW A;  2QL5 B;  2M3D A;  2WZ1 A;  2JEF A;  2W4C A;  3EPG A;  4NLT A;  1B0V A;  4USH A;  2UUB F;  2M5Y A;  5B0G A;  1BWV A;  2FLL A;  4A48 A;  3RR7 A;  2UUC J;  3P45 B;  1SXL A;  1HLW A;  2WOM A;  4ZVF A;  1VRT B;  3PKM A;  2AX1 A;  4RWX A;  3IBF B;  3MEC B;  2RSQ A;  4GC6 A;  1AB8 A;  5KFR A;  1SV5 B;  5A6P A;  5IWA F;  2P9E A;  3OFG A;  3NS6 A;  4X4P A;  2GGP A;  5DLW A;  3MCN A;  2CWK A;  4G65 A;  1IM6 A;  1NKB A;  1GQE A;  1NUE A;  3HSJ A;  4DR4 F;  2BOA A;  2PFD A;  4DZD A;  2IM1 A;  2G0I A;  4XTT A;  1N56 A;  1Q8K A;  3D7S B;  3T3F A;  2QSF A;  4JUZ A;  4DPY A;  2PT0 A;  2J8S A;  2GIR A;  3PYG A;  3MDF A;  4F36 A;  2A2C A;  4QR0 A;  2XMT A;  2J6U A;  3R1H A;  3BKU A;  1S12 A;  2IPO B;  4DL2 A;  4RUH A;  4F0K A;  3SQG A;  4RUA A;  4NCA A;  4B3R F;  5I4M A;  2QGF B;  2G0J A;  2PA3 A;  4YHH J;  1T02 A;  3RB4 A;  1WC1 A;  4DX6 A;  1SJ3 P;  5DLG A;  4MY4 A;  2P9G A;  2WBM A;  5KOX A;  2VBY A;  2HS4 A;  2D1C A;  2QA4 S;  2ZJP Q;  2F5G A;  2CQP A;  2OPS A;  2VFS A;  3UNY A;  1WI8 A;  1IWG A;  3P5B P;  3EUN A;  2FZG B;  1I5O B;  1YLX A;  3MM5 A;  3GWC A;  1LV5 A;  4IR9 A;  5HQ8 A;  3DU6 A;  2E9R X;  4DR3 F;  1Q5Y A;  1KP6 A;  4ZA1 A;  4ZPT R;  3EYZ A;  1NHK L;  5GAD I;  2VPZ B;  2QL7 B;  2R2T A;  3GJQ B;  4MFB A;  1RGV A;  4PR6 A;  3KLV A;  2BKO A;  2BRK A;  2KTQ A;  4LVN P;  4QIV A;  1R6Y A;  3UDL A;  3TUI C;  2E1P A;  6FD1 A;  2ZH9 A;  1ZED A;  1RA6 A;  5LQQ A;  3MK0 A;  3NNA A;  4IYQ A;  4DR7 J;  4F0H A;  3MAQ A;  2WOM B;  1MN7 A;  3EPI A;  4CYU A;  2UV8 G;  3GYN A;  4CXK A;  1LFP A;  1AZS A;  1MWZ A;  2B51 A;  1E6V A;  2MY8 A;  1DJ0 A;  2VIH A;  5IJQ A;  5DG9 A;  2IMW P;  2GLQ A;  4OYM A;  3OFE A;  3EGV A;  1EQM A;  4DQP A;  1GEH A;  3JTN A;  8ATC B;  4PQA A;  4KAV A;  3GB0 A;  3PYE A;  5C2C A;  4RX6 A;  3POT B;  3V4I A;  2RML A;  4FDI A;  4NCB A;  3QGG A;  1Q8L A;  1YJT A;  4KHR A;  1Z4U A;  2XO6 A;  1KN6 A;  3PG9 A;  3GPA A;  1PJ7 A;  4GKJ J;  4N41 A;  3DRY A;  1M5V C;  3HF5 A;  5I3U B;  2H4Y B;  4R25 A;  5MLC V;  2C2O B;  1MU2 A;  3TWZ A;  2KZZ A;  5J2P A;  2VFU A;  3HZE A;  3DNC A;  5CAA A;  3DOM A;  1KVJ A;  4LRB A;  4DN0 A;  2QMX A;  5LOQ A;  2DXD A;  4KV8 B;  4Y2K A;  4TY8 B;  2W25 A;  3CD6 S;  4J7C A;  7FD1 A;  1GT8 A;  5D3G A;  1ANI A;  4EWT A;  2ZUG A;  2HBR B;  4USV A;  1IKX B;  2OPS B;  1BQN B;  1XQI A;  1VHF A;  1RBL A;  1DUR A;  2RQK A;  3V81 B;  2QYC A;  4RNO A;  1T7P A;  3AD9 C;  2R9L A;  1IWA A;  4HL9 A;  3J7A 1;  3LAK A;  1WWH A;  4UTG A;  3K5N A;  3R6L B;  3MTK A;  4K59 A;  2E9Z A;  1DQA A;  2AYM A;  3KLE A;  1GTE A;  3DCA A;  3UDC A;  2XMA A;  1XR5 A;  2CXE A;  3MR6 A;  2XI2 A;  4GTW A;  1TL1 A;  2G9Y A;  3O5T B;  2NUH A;  2E5I A;  1V6H A;  3CIM A;  3VGS A;  2DGX A;  2HQ3 A;  2PGC A;  1IKV B;  4NOH A;  3M8S A;  5L46 A;  1AZS B;  4LFC F;  2GSU A;  3BH6 B;  4QR2 A;  3MI7 X;  4ZLN A;  3CDB A;  1V5V A;  4ZCM A;  2EKN A;  3K5L A;  3ZC4 A;  2BUN A;  3BH7 B;  4OL8 A;  1H98 A;  1R89 A;  2YQ1 A;  3KLI B;  4TYB A;  2L48 A;  1ALJ A;  3V4I B;  1YBT A;  1PYT A;  1UZD A;  1Q81 T;  2BOP A;  4K5S A;  2VA3 A;  2HWI A;  1IR0 A;  3DLJ A;  3W5Y A;  4EMD A;  2NSC A;  4A8Q A;  3FK4 A;  2B7B B;  2K1R B;  4I2P B;  5AXM A;  2DEI A;  1WKK A;  1VRQ C;  3I87 A;  1HD0 A;  4YB7 A;  5J2P B;  1JXL A;  3DOM B;  3A3O B;  4NWB A;  2ZNY A;  1S6O A;  2XEX A;  1RT5 A;  1UFK A;  5RUB A;  4WFZ A;  2ZKU A;  5IT9 Y;  3JSM A;  2K06 A;  2BQU A;  1CC7 A;  1LWF B;  3VGU A;  2QO3 A;  1KHW A;  3JQK A;  5A2Q Y;  1HNX J;  1RT6 B;  4F25 A;  5KFN A;  4O3N A;  4NA1 A;  2ACY A;  3KK2 A;  3L4B C;  1OJ4 A;  2GIF A;  3KMS A;  3M8R A;  4DFM A;  3NMA A;  1IN0 A;  4XDC A;  1XIQ A;  2RDD A;  3RAQ A;  4F7V A;  1NEE A;  2CPF A;  4LSZ B;  3KD8 A;  3TVZ A;  1SCJ B;  1LK7 A;  1R8C A;  5D4P A;  5GAD U;  2ZM6 J;  2F9J A;  5AXK A;  4UOG A;  2EVZ A;  3M8P B;  4LRF A;  4DFP A; 
#chains in the Genus database with same CATH homology
 1KHN A;  3DPC A;  5IJQ A;  3NKR A;  3TX0 A;  1KH9 A;  2GLQ A;  3NKN A;  4LQY A;  1ALK A;  3NKQ A;  1E3C P;  3UN2 A;  1E2S P;  4CXU A;  1URB A;  4ZGA A;  3T01 A;  1FSU A;  5K4P A;  1EW9 A;  2D1G A;  4KAY A;  1URA A;  5IJS A;  3M8Z A;  4UOP A;  4KM4 A;  1ANJ A;  3NKP A;  2IUC B;  3CMR A;  4MY4 A;  1EW8 A;  4LRE A;  4LRD A;  3UN5 A;  4KAV A;  3WAY A;  5GOV A;  3WBH A;  4QAX A;  4N7T A;  4UPI A;  4NWJ A;  4UPK A;  2GSN A;  4YR1 A;  1AJC A;  5DLT A;  1ZEF A;  5L0E A;  4FDI A;  4ZG6 A;  4LR2 A;  1ALH A;  4UOO A;  3M8Y A;  3UNY A;  2W5Q A;  3MK2 A;  4MHX A;  4KJD A;  1ELX A;  4LR7 A;  1KH5 A;  3IDD A;  5L0B A;  3B5Q A;  4CYS A;  2QZU A;  2W5S A;  2XRG A;  4GTX A;  5LIA A;  1N2L A;  1Y6V A;  4MIV A;  3BDG B;  3M8W A;  3OT9 A;  1SHN A;  4B56 A;  1EI6 A;  2W5R A;  1ED9 A;  1P49 A;  1SHQ A;  1ZEB A;  4UPH A;  5EGH A;  5DLW A;  5LRM A;  2W8D A;  1E33 P;  3BDG A;  3Q3Q A;  4CYR A;  4UPL A;  4NWX A;  1Y7A A;  4ZG7 A;  4KJG A;  3UO0 A;  3WAV A;  5DLV A;  4TN0 A;  2IUC A;  2X98 A;  4GTW A;  2G9Y A;  1KHL A;  1HDH A;  1ALI A;  3IGY B;  3BDF A;  4LR8 A;  1B8J A;  2W5X A;  2W8S A;  3T00 A;  5KXA A;  3DYC A;  1N2K A;  3TWZ A;  1AJA A;  2VQR A;  2ZKT A;  1EJJ A;  1O99 A;  5EGE A;  2ANH A;  1HQA A;  3IGZ B;  1E1Z P;  3SZZ A;  4LR9 A;  1HJK A;  2GSO A;  1KH4 A;  2XR9 A;  4LRB A;  3NVL A;  3UN3 A;  4UOR A;  3ED4 A;  2GSU A;  1ED8 A;  1KHJ A;  3MK1 A;  1EQJ A;  1K7H A;  3SZY A;  1KHK A;  1O98 A;  3T02 A;  1EW2 A;  4GTZ A;  5GRR A;  3BDH A;  4ZG9 A;  1KH7 A;  2GA3 A;  4CXS A;  2IFY A;  5AJ9 A;  1AJD A;  1AUK A;  1AJB A;  1ELY A;  1ZED A;  3A52 A;  5TJ3 A;  3TG0 A;  5LQQ A;  5HRT A;  1ELZ A;  3MK0 A;  3E2D A;  5LRN A;  1ANI A;  3NKM A;  4GTY A;  5INH A;  2RH6 A;  2W5V A;  3KD8 A;  3WAW A;  5L0K A;  1ALJ A;  3M7V A;  4CXK A;  2W5W A;  3LXQ A;  2W5T A;  3NKO A;  3WAX A;  4LRC A;  4LRA A;  4FDJ A;  4LRF A;  5C66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...