4LRCA

Phosphopentomutase v158l variant
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrcA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrcA01
1ZEFA 3DYCA 1E33P 2W5WA 2W5SA 3TG0A 1EJJA 2W5VA 1E1ZP 1ELXA 1KHLA 3BDGA 4GTYA 4GTXA 1EQJA 3A52A 2GLQA 2W5QA 3NKPA 5C66A 3IGZB 5DLWA 3T01A 5LQQA 5IJSA 5DLVA 2W8SA 4CYRA 1ANIA 1AUKA 1ZEBA 1URAA 5INHA 4LR7A 4N7TA 1EW9A 4MHXA 4NWXA 4LREA 1AJCA 1FSUA 4CXSA 3DPCA 1SHQA 2IUCB 2ZKTA 5AJ9A 5HRTA 3BDHA 3M8ZA 4UPLA 4CYSA 3UNYA 1KH4A 3NKRA 3ED4A 1AJBA 4LRFA 4LRAA 5GOVA 3LXQA 1ELZA 2W8DA 2RH6A 4LRDA 1B8JA 1ED9A 4KM4A 4QAXA 4NWJA 3UN2A 4ZG7A 3WAVA 1KH7A 3SZYA 1ALHA 5IJQA 4UPKA 4CXUA 3MK0A 2ANHA 2IUCA 1EW8A 3TX0A 1ZEDA 2GA3A 3WAXA 4ZG6A 3M8WA 3CMRA 1Y6VA 3UO0A 3WAWA 5DLTA 5L0BA 5EGHA 5EGEA 1EW2A 4UORA 1Y7AA 4UOPA 1EI6A 4B56A 1ALJA 3NVLA 4YR1A 5LRMA 3E2DA 3TWZA 4UPIA 1O99A 1URBA 4GTZA 1ALKA 1O98A 1KH5A 4ZG9A 3OT9A 5L0EA 1E3CP 2D1GA 1ELYA 2X98A 4LRBA 3KD8A 4KAVA 1KH9A 1HJKA 1HQAA 3UN5A 3NKMA 2QZUA 3BDFA 5KXAA 5L0KA 1ANJA 4MY4A 2XR9A 1K7HA 2W5RA 1KHKA 2W5TA 4KJDA 3WBHA 3NKOA 3SZZA 2W5XA 4FDIA 4UOOA 3Q3QA 2GSNA 1N2LA 4MIVA 5GRRA 3M7VA 3NKNA 2GSUA 2VQRA 2XRGA 4KAYA 3NKQA 1HDHA 1P49A 3MK1A 4GTWA 4UPHA 4CXKA 1AJDA 3M8YA 3T00A 4LR2A 1ED8A 1KHNA 4LQYA 3BDGB 4KJGA 1ALIA 4LR9A 5K4PA 1N2KA 3IDDA 1E2SP 2G9YA 2IFYA 4TN0A 3WAYA 3IGYB 4ZGAA 5LIAA 2GSOA 1AJAA 3UN3A 3T02A 5TJ3A 4LR8A 5LRNA 1SHNA 3B5QA 1KHJA 3MK2A 4LRCA 4FDJA
chains in the Genus database with same CATH superfamily
4LIWA 2QMWA 3BBBA 3OLAA 3H4BA 1Q16B 3BH6B 1YJNS 3ENAA 1UP1A 1WNEA 3GQCA 2CQ4A 1EJ7L 1S7HA 3GFHA 3BDEA 2EG1A 1GXTA 1FK9B 3R5GA 1PC5A 2W2MP 2QC3A 2HNYA 2JRSA 4KGVB 1CSJA 2YNIA 4UOGA 2O66A 1JXLA 2CQHA 2OD4A 1LWFB 2QYGA 4OYPA 2AYMA 4TKTA 3M9NB 3DLHA 3M1VA 2DITA 2PC6A 1RDRA 5L38A 4B3RJ 1B64A 5AJ3F 4CZCA 2MQOA 1N8RT 1KVIA 2H3EB 3TW0A 4NLDA 3EGZA 2ZDOA 4WFYA 1WI6A 4ECTA 1B7FA 3OTCA 1S0NA 2R8KA 4XAKA 3NS7B 3QZ7A 2IM2A 2N4DA 1YTYA 4DL4A 1ZEBA 3WIUA 3JSMA 1PAEX 1CULA 2KVIA 4ED8A 1S59A 5I3PA 4QIWD 1FWPA 2X1FA 3I55S 1T9VA 1EX8A 4C3MA 3DLJA 4JI1F 4CYSA 1RHUB 1F0XA 1SPBP 2CPYA 4LF8F 3D1HA 3UDVA 4K4WA 5KG6A 1CC7A 2CG4A 2XSJB 4C97A 3IN5A 2J8AA 3PJWA 1GX6A 3GJRB 1VQSA 2VBXA 3W2WA 4O3RA 1ELZA 4WFAQ 3OFEA 5ETTA 4IRCA 1IBKF 1T9XA 3QRRA 3RW6A 4OYIA 3R5JB 4DF4A 1XBWA 2DEJA 2WHOA 1JLBA 3ISNC 1XR7A 1WKJA 2HNZB 1JXVA 1FESA 4LBPA 3UFCX 5BYRA 2MYFA 5LMNF 2VA3A 1NK8A 3T1YJ 1J5EJ 4OV1A 4DPXA 4DR6F 4NOHA 1KH7A 2E44A 2QLJB 1TK0A 1RP5A 2HRYA 1HI1A 4H4KA 2C3YA 2ZD1A 5LXRA 3J81Y 2W8KA 2IA6A 2KTQA 4LUBA 5L1KA 4IQXA 3IG1B 2VU5A 2PT0A 2FDNA 2P5VA 4ZPBA 3VALA 3ENVA 2UXCJ 1FNMA 1QUPA 2DNKA 1NBEB 4F3MA 5K8PA 4HKQA 3I5AA 5FJ4A 3BREA 4M5MA 5D78A 1PJ7A 4EI2A 5DLTA 3ZZ0A 1FKPA 2FC9A 2ATCB 2D3O1 4B9LA 1Q8IA 2M9KA 2BEFA 4J7CA 1N5TA 3R9LA 4ELVA 2FLPA 4IFYA 1OS5A 1HL6A 4MIBA 3U1NA 2EPIA 3W2VA 2HLTA 2RRNA 1NU4A 2ZDPA 1MG7A 3M6VA 4OLPA 4O3QA 2AGOA 4LIRA 2RILA 1V9OA 1N5YA 1HWUA 1NH8A 5F41A 1JLAA 3MCNA 4OHXA 1JNZB 1JXEA 5HN0A 2B5JB 2BUNA 2NYIA 1AYEA 3M2RB 4I4BA 4KFBA 2YQ0A 1NMEB 2XMAA 2WSCC 1DRZA 4IDKB 2CRLA 4LJMA 3UN5A 5HBMA 3KYLA 2QZUA 2DNZA 1N54B 1ZZFA 2VPZB 2FY8A 4P52A 1RHRB 5E3CA 4DPOA 5KOXA 4IRKA 1RBOB 3HO1A 4USHA 1TFYA 2R7VA 4ZP9A 3SIPB 2BW2A 3OFGA 4LQ9A 4RNMA 1NJWA 1NB2A 2EKYA 3HKWA 3G8QA 3PKYA 3I96A 3GB0A 2OIHA 4L76A 1RWNB 2HVZA 2NPIA 4RW4A 4TYBA 2FJVA 1L3KA 3D6MB 3JQMA 5KFJA 3HCXA 3QGPA 4CTAB 1ZM4A 5C42A 2E5LF 2IYGA 1BY9A 1FI4A 4NYOA 1S0MA 4JV5F 2V4JB 2ZC3A 1IQZA 4UPHA 4MYTA 3N28A 3KHHA 1FF2A 4X62J 2VOOA 3JB9k 3W2WB 2QLWA 1H3DA 2XHWA 3WAYA 3W9HA 4GKKJ 1QM9A 2A2DA 4G1IA 1X9MA 1I6JA 3NRBA 2JVRA 3TZZA 2GHVC 4N8OA 2ZC4A 1VIOA 2XYHB 5KG1A 3DRYA 4AT1B 1SHNA 2F8MA 2MSTA 2VV5A 4UZBA 2V8GA 1ZEFA 4LSNB 4YB5A 5DS7A 3OUYA 5D4NA 3KHRA 3HHKA 4DR6J 1PKUA 2E9TA 3AXMA 5KT5A 2D9OA 4YR3A 3RRHA 4NXNF 3CNQP 3D6FB 3FVYA 1NDLA 2YX1A 3DLKA 1REGX 3GLJA 3TAMB 3TYTA 3EDRB 3WZ0A 2V4QA 3A52A 4LFAJ 1PC4A 5D0RA 2V2VA 1FKPB 4ETZA 4EFAC 5KFAA 3PVXA 1HNVB 4AQYJ 2OTJS 5CYJA 2Z4PA 2UUAJ 4OX7A 3DLBA 5E33A 4OJ3A 3R7NB 3M6XA 1IBMJ 3IG1A 1RI7A 3IXQA 4FN5A 1Q8BA 4HHHA 4HDHA 4PXDA 3KLGB 1DTTB 4NMLA 4J91A 1R31A 1A9NB 4M5NA 3MTKA 3R6LB 4ZLJA 3SFUA 4JI3F 2FVQA 1IM6A 1C0UA 5KG5A 2AZ1A 2ZHOA 4LSZB 2IAJB 2CPXA 4DUZJ 1S7IA 3PJXA 2G2ZA 5DETA 2HHVA 4KQZA 4USVA 2AJ1A 3ED4A 5KFDA 2XCAA 3H2VE 5K9FA 3S6EA 2OPSB 4HI2A 2NPFA 4ED1A 4AXJA 4YMEA 4DV3J 5ETMA 2X1GA 2CPFA 4EZ9A 1FO1A 2F8HA 3HVTB 1FNXH 4ANDA 5DZ6A 4AFFA 3TA0A 1IKXB 3UVJA 5M2UA 4TLQA 5F9NA 2N82B 1I94F 1DTTA 3FBFA 4MYUA 4ZP6A 4NRTA 4DS4A 3PO5A 2VC1A 5KG4A 3R2CJ 1WOPA 4QQBA 3RG6A 2C3UA 4C4WA 1X4GA 3PZPA 1YDLA 4HEA9 4CXUA 4U7CA 1RKJA 1N0VC 5D4PA 2WW8A 5J1EB 2UVUA 3CC4S 2R7TA 1JKHA 1NKCA 1RA7A 2CNLB 1E6VA 3SV3A 2FZCB 3TAMA 4P2FA 2NREA 1D9AA 4ED3A 3N5BA 2GFFA 4O0IA 2XO7A 1GK8A 1FTCA 1SB6A 3GONA 1HQEB 4QWCA 4JYAF 5HROA 1FK9A 3NXZA 4FS1A 4YR1A 1S6QA 3NGSA 3TA1A 1FXRA 3OPKA 1BE4A 2KRRA 2VDIA 3UDCA 1KH5A 1H2TZ 1APSA 3I0RA 2ACYA 2HGMA 4YEAA 5ETOA 3ZC4A 5FLXU 4HI1A 4CI0B 4M8LA 1QAYA 4O44A 4LRBA 5B0AA 2G0JA 1F6TA 4F4KA 4OX8A 1IJEB 5EWEA 2E29A 3M4XA 1K7HA 4KJDA 1VC5A 1NZAA 4KRWA 1LW0A 4J9LA 3N0VA 4MH8A 2Q3PA 4I2PB 4C8OA 4QW9A 2VJUA 2W5XA 1CQMA 1UETA 3TZYA 2SXLA 3M6UA 2H48B 5KFNA 1HPZA 2BYCA 2F40A 2MPUA 2CJQA 3CCRS 4M94A 1IVZA 4MIVA 2HFNA 2O01C 3N79A 4WFZA 4ZN1A 1NK7A 5L9XA 1Y5NB 4BBYA 2ZVIA 3FFIA 2VQRA 5J2MB 3W63A 1FEHA 5DDOC 1YJUA 3H4DA 1K1QA 1HPZB 3R5BA 4DOZA 1SH2A 3BDGB 5D15A 3N01A 4CTAA 3F41A 5C42B 3QLHA 2OJ3A 1YX2A 3TEGA 2UUCJ 4NXMJ 2MKJA 4CQ1A 2KXNB 2XS5A 1N2KA 2VA2A 3FJ2A 1B0PA 2ZH5A 3OVBA 2GMHA 2OFGX 2F9JA 2RE1A 2VBYA 1U6ZA 3UN3A 4FNHA 3ZTSA 2VFVA 4NL5A 3HM9A 1VK8A 4HYKA 3QIPA 3FQLA 3B5QA 2PEBA 2YWHA 1AUDA 2UVWA 2F1FA 2KXFA 2LA4A 1F5BA 3C66A 3NBPB 4HT5A 2R8HA 2EC0A 3DYCA 2LECA 1WG4A 2W4PA 3MR7A 3PRDA 3GJQB 3RU0A 2V5HG 2W2NP 4EEYA 5HQ8A 2MGZB 4FF2A 2OMLA 3RW7A 5ETNA 2DK2A 2O5DA 2J7KA 4JV0A 4OI0A 1FJGF 3DDKA 1N5YB 2QA2A 1HD1A 1W26A 1LOUA 1V3SA 1W7WA 5KT6A 2WTFA 4WZQA 2OMOA 5AE1A 4IFYB 5L46A 1B0VA 4PABA 1YVFA 1CJKA 1WF2A 4M5DA 2QA4S 3V6DA 4BS2A 1RABB 4HDGA 4ECXA 2XO6A 2ZNZA 3K8VA 2XZWA 5A6PA 2CPHA 4IOBA 1HNWF 3NMRA 5HK4A 2A6MA 1GMUA 1Y00A 1DLOA 2RU9A 2CDRB 3DC2A 1IKYB 1YLXA 2OPPA 1IWAA 3QLHB 1XC9A 4NCGB 3GIMA 4CXSA 4NLPA 4RW6A 3LWMA 3G71S 3TI0A 4OYAA 4K0KJ 4URSA 3SCIE 3KJQB 2PN6A 1SH3A 2KHDA 2AGPA 1S57A 4NEYA 2IVFB 3UR0A 3BO3A 3HVRA 2VFRA 2ZKUA 1GTHA 4I7FB 4NI2A 1M5VC 1NHUA 2B4PA 3OFHA 1KEKA 3NY0A 4DV1F 4URGA 1GMWD 1QJHA 2D69A 5DDPC 2XTJP 3ILLA 4PG4A 3AOCA 1WTFA 3M9OB 2R2RA 1CQNA 5LL6d 1Q78A 3JTOA 3MR3A 1X4DA 5F8NA 1ED9A 3DOLB 3GV5B 3C6TB 4DR2F 2DXFA 1T3OA 2IAJA 2MKKA 1IXKA 3V4IB 3FZ2A 2JOQA 3DYAB 3V5RA 1HNIA 5J2NB 3ADAC 3I5BA 2PFDA 4CP5A 3KLHB 1FDNA 4MMOA 2YH0A 3AHPA 2QA4G 1SKUB 3GYNA 3H7HB 3K89A 3KJFB 3KMSA 3UWTA 1VQMS 1YI2S 1UA1A 2NR0A 1ZTTA 1QY7A 2YNHA 3TAPA 1WG5A 4KHPF 3ENQA 3DGPA 4LT6A 4A8OA 1DQ9A 2P8IA 1ELOA 2BZ2A 2JJ4D 2ZBCA 3OR2A 4DZ6A 3JSMB 5HROB 2XI2A 1F2GA 4ES3A 3NOGA 4ZK7M 1SJQA 2MKSA 3Q8VA 4ZLLA 2ZH6A 4N76A 3MEKA 2F4FA 4ELUA 2J0SD 2JVOA 2VHGA 2VL1A 1OPZA 4NLGA 4RW8B 3MUMP 4KB7A 1R8BA 3IWNC 2VQFJ 2V34A 2L9DA 1LWFA 1RAHB 3OR1A 3Q8UA 5J1EA 2Y1JA 1N6QB 1QSSA 2RHQB 5AT1B 3KDOA 3MGJA 4YQWA 3ZNUA 3FQKA 3HHLC 3T5LA 1IBLF 3DFEA 4B9SA 3NNCA 3PW4A 2J76E 3BS9A 1G6BA 2HFZA 2ZITA 2JEJA 4DN0A 4UUXA 2FLNA 4Q0BA 4JI1J 2W5RA 3QJPA 4NCAA 3KLEA 3UD4P 3MXHP 1L3VA 2WVEA 4CLTA 1UL3A 3TJ8A 2NUHA 2QE5A 2J6SA 2QIFA 3MPVA 1FX4A 2M88A 3SBMA 2W8LA 1RACB 4E8UA 3J7A1 3MCOA 1YBTA 4P6QA 2KZZA 4NI2B 4OX9F 5D3GB 4LR2A 5IV3A 4PQUB 1YBAA 3L3CA 3FBCA 3JAMU 1EQMA 1FWKA 3DDIA 3LOUA 1LK7A 1DTQB 3MPYA 3ISND 2X1BA 3HULA 1MLAA 4TQSA 2CVIA 2B4UA 4OMFG 3H59A 4O4GA 4CNZA 2PI5A 1T9WA 4UTGA 1G2EA 3F56A 1E6YB 3Q8RB 3LPYA 4LRCA 3QJLA 2G2YA 3QJJA 3CTRA 2KFZA 2ATLA 3B4DA 1A7GE 1CS4B 4XIUA 2DYAA 4HHJA 2ERRA 2OPQB 4PUOB 1EJJA 1KKHA 3G82A 3R1LA 3LH2S 2HS0A 2VG6B 3PX4A 1BWVA 4ZJQA 1E1ZP 2XS7A 4MK7A 4FXWA 3UD3P 2XHCA 1W2IA 2QGFB 4F26A 3EGVA 1C1BA 4ATNA 2FC8A 3POTB 2ACMA 3VAKA 1C4AA 1V5VA 4ECQA 2ZBRA 3MOJB 2R7XA 2LDIA 2MLZA 1REVB 4WKYA 3PW7A 1G3OA 2VG5B 3FCWA 1R8CA 1YJVA 3RJMB 4JI7J 4RL1A 4DV4J 2RMLA 1BQNB 5ETQA 5U47A 3NBPA 3RAMA 1PBAA 2HURA 4B3MF 2F63A 4DV6F 5DLVA 3GWCA 4CYUA 1S76D 1TKTA 4DDFA 4DSLA 2ZH8A 1JB0C 4N7TA 4U8YA 2HMIB 4F0MA 1VQ5S 2H5EA 3MFHA 4GVBB 3Q8YA 1K73T 3MM9A 2DHSA 3MR5A 3NLCA 5AJ9A 1TV6B 2WVCA 2HBYB 1P6TA 4UPLA 2QN6B 4Y65A 4AQYF 3D68A 1X5PA 1ZAVA 3P45B 1AJBA 1S6PA 2CUYA 2MHEA 3EWGA 2ZUAA 1WSVA 4C0HA 2BACA 1IBMF 3LXQA 2GHPA 2MDAA 2C3MA 3L4BC 2N3LA 2A2CA 5FIIA 1X5OA 4ANEA 2XGQA 3KK1B 4GKKF 3LAKA 1RT5B 1F3VA 5HVHA 1GFWB 3LW5C 1FEEA 4FF4A 4KM4A 3TARA 2DGTA 4F25A 5FDLB 3MEGB 1LW0B 4PWUA 4CNYA 1QTMA 3QWUA 2CQCA 1WDTA 2ROPA 3THVA 3AAWB 4KY3A 5AXNA 2LEBA 2IUCA 4ZLPA 1LK5A 4L75A 4Z37A 4LBHA 2HGLA 2OEMA 4ZG6A 1KQSR 4J9KA 3MEEB 2BV3A 2DNMA 4CWBA 1VK3A 1P8GA 2DIVA 3HHLA 4A48A 5HAOA 2WRMA 1XMBA 1RYSA 2BVZA 2ABYA 3Q89A 5GAEU 3GG1A 2W7PA 3EZOA 3I82A 5EGHA 4U8VA 2ILZA 5KG7A 1JJ2R 1QLNA 2MQLA 2DT9A 2XZTB 3DI6B 4FYWB 4QU6A 5IT0A 4A8QA 1X7VA 4B56A 3FBEA 2YKOA 2HKEA 1WKLA 1VQ7S 3G6ES 1R7IA 1BC6A 4J9PA 1Q82T 1WC0A 3CJSA 3PO4A 1Q4RA 1N32J 3H5XA 1U0SA 4ER8A 1RCOB 3AT1B 1U2FA 2DHXA 1AB8A 2F7VA 1IJFB 5A6WA 2DO0A 2IC3B 4L6V3 2EFVA 2HNZA 4PYDA 1UVLA 4DV1J 1FRHA 2W5TA 1VQ8S 3IO1A 4I6WA 1XTZA 1N5QA 1UWBB 1ZM3A 5C24A 4Y00A 4BHQA 5KFMA 3T3FA 5E3AA 2FVPA 2ZJRQ 5MAOA 2MY8A 3FUYA 3L09A 2VQEJ 3C46A 1DFDA 1X8DA 2DKOB 2VPWB 3C8YA 3W8GA 4CO1A 2EEYA 2NLWA 4JI6F 1U47A 2LYVA 4P10A 7AT1B 2Z2LA 2XS2A 4KAYA 2RS8A 1P49A 1NDKA 1T9UA 4Q43A 4X66J 1EARA 1JLQA 3FEYB 5G0RB 3W9JA 2JEFA 5I3UB 1RWKB 3GP9A 2VASA 5K4PA 3SQGB 1FNOA 2FGCA 1Y3KA 4O23A 4OLOA 4AD6A 1U6BA 1E2SP 5J2QA 4BWJA 2WZ1A 3GV8B 1TK5A 2B43A 2GMLA 4KSEB 1UAWA 4CRJA 2VICA 1RTIB 2LVWA 4RNOA 3M05A 1VI7A 1GX5A 2HVEA 5TJ3A 2H1YA 4NYZA 2IPOB 2JFKA 3DNCA 4Z7YA 3MEGA 4ZLNA 4QU7A 3D28A 4NCBA 1KLNA 5IOLA 2M0GB 5HATA 1YBUA 3ZZPA 2EFNA 2DGSA 1E33P 1Y7AA 3MD3A 4EMDA 4JOUA 2W5VA 1ELXA 4F04B 1UVIA 4RNFA 3T5JA 1HNVA 4GTYA 4CLYA 2RT3A 4GO7X 5K14A 3QIDA 4DR1J 3HZGA 3PACA 2VPYB 4A8WA 1PO6A 1QAJA 1WI8A 2ALYB 2RVJA 3FSXA 3MOZA 1S1XB 3QGHA 4HL9A 1JLFA 2MQNA 4OZJA 4HVZA 4RW9B 2K3KA 3ZXWA 1T05B 4Y2MA 3JYTB 2QMXA 1P1LA 2PO4A 3CDUA 5KFTA 3W3SA 1S49A 1RYRA 2YWKA 2CZ9A 3TEHB 3EX7B 1RK8A 5AJ3J 5IM0B 1DJ0A 2WB4A 2IFYA 2FVCA 4WFXA 1OIAA 3ET6A 4BDPA 1XJWB 1NO8A 1AUKA 1U0HB 4JYAJ 1RGVA 3CB4A 3GR0A 1U02A 5DG7A 3ULHA 1N32F 5IT4A 4JI7F 4CM2A 2CJBA 2EFPA 5K5MA 1KBRA 5LXYA 3BSNA 1S0OA 4AE5A 2DRAA 4DLGA 1BQMB 2HFUA 1KH4A 1LWCA 4O3NA 4EBDA 2GVDA 4KHRA 3HHLD 2JL9A 3BYRA 4N47A 4NMXA 5KFCA 3PW2A 1TUVA 2GMJA 2C28A 4O3SA 5L39A 2W4CA 4Z7CA 2RD5C 3MM8B 5DM6Q 2CAJA 3G86A 1CC8A 1R0BG 2BJ8A 5CYQA 3W60A 4E98A 1F5CA 3NNHA 3ILJA 4XDCA 3JXOA 3GYXB 2HQCA 3TZWA 1MWYA 3LGNA 3G87A 4PYAA 3T6JA 4WE1A 4KHMA 4A8XA 1RWMB 1TKZB 2I1RA 2MZRA 2RDDA 3SCLE 4X66F 4DUYF 4GC7A 4KKOA 1K9MT 3BKUA 1J5EF 3P6YC 3KDNA 3NCPA 2V2ZA 2ZZTA 3CMAS 1U1KA 3GSIA 4CO2A 5K8MA 1JWWA 2J7UA 4QIEA 3K57A 4DLEA 2GA3A 2WK4A 2FJEB 2G1HA 1GT8A 4KH0B 4TXSA 1TKXA 1XMQF 1SKSA 3R5DA 1N36J 2AYGA 3LQVA 4J5OA 4YY3J 4NXMF 2UXCF 5D3GA 2R7WA 4CXKA 1SJ1A 1TFWA 1S9EB 1BMQB 2KHCA 3D67A 4DUTA 2FLLA 3KMQA 2GA7A 3S8SA 3BBCA 5KG0A 4DS5A 3AD8C 1EI6A 2CZVC 3MCMA 5CXTA 2RF2B 1I94J 2M3DA 1VRUA 2OUGA 3IMQJ 2BW7A 4K4ZA 3CJKA 4OZ0A 3GYGA 2XY7A 3BQ0A 5HO4A 2ZH7A 1ITPA 1RAIB 2QFIA 4I56A 3P49B 5L0KA 1IKWA 2G2OA 2WOMA 2YBVA 2EVZA 3CGIA 3ET6B 1M5HA 5GMDA 4DPUA 5EWGA 1RWWB 2VFTA 3JTNA 3CE8A 1R8PA 2H4YB 3SZ2A 2GHWA 5AXKA 1U4BA 4W4MA 5DGBA 4JI3J 2E5HA 3E2EA 4M1KA 4OI2A 1U1LA 2R7SA 3H2UB 3BKFA 4I68A 1IBLJ 3NKQA 1HR0F 1RAGB 3T00A 3AJ2A 2YVSA 3UCZP 4LQYA 1UMJA 2KYXA 4M63A 4F2SA 4J9RA 1MMLA 4X62F 3MK0A 4WCEQ 3SSQA 4ZITA 2YNHB 2GSOA 1NNDA 4CM0A 3IAS9 1CJUB 3T02A 4ZPDA 2NQPA 1Q7YT 2RSQA 4WF9Q 5L0BA 2VJVA 2X3GA 4A47A 3AOBA 1HQUA 4PAAA 2JH3A 3QGGA 3VVUA 1WD6A 2G9OA 3ZZZA 4OX6A 2PMWA 4M95A 4NLYA 3LWLA 3T1YF 5HP1A 2DCLA 2BKNA 2DCUB 3VAFA 1MW7A 2N7YA 3DRXA 2EW9A 1VLYA 4RUHA 1Y4ZB 1YG0A 2BJ1A 1JLGB 2BJ7A 3QSIA 4IH5A 2RIJA 4DR3J 2J8SA 1R8AA 4WU3A 1N56A 3DRRA 3HMJG 4DL6A 3OSNA 3F0NA 4C9DA 1NK4A 2VH7A 1FJ7A 3KK2A 1RU1A 3ZTQA 1MN7A 4OYBA 4DV4F 2BANB 5LQQA 4N77A 4CT9A 5H9FJ 2GVZA 3MM6A 4ELTA 1EP4B 2W2OP 4F4WA 1S48A 3CJKB 4LR7A 2ZUGA 1D9FA 4LREA 3PDNA 2PD1A 2DXDA 3NAHA 4ED4A 4Q45A 3EZ5A 3Q23A 2UXDJ 4FKYA 2VQFF 4X64J 3NCRA 2R7OA 3C16B 4ZIWA 1C1CB 4PG6A 1VHIA 4JI8F 5J2PB 2HQDA 4K4TA 3ZTRA 2KJWA 3T1HF 3JTPA 3IWXA 2V8DA 4ZPAA 3HT3A 4B3RF 5ETRA 1JLEB 3GPAA 3M32A 3TVZA 1EQ0A 3IR7B 3GFZA 3H90A 3UPFA 4ZG9A 4MIWA 2OEKA 4ENOA 1S97A 3KLFB 3MMCA 1RHJB 1RISA 4LFCJ 4OI4A 1Q79A 4FKXA 4X84A 2F8EX 1Q0NA 1TL3A 3J7Z5 2DNPA 3UN2A 3LP1B 4OQJA 3ONQA 3J7YU 4ED0A 2CPJA 1RAOA 5BR8J 3FEZA 4G1QA 2MTLA 2H5JB 3NGRA 4H4KC 5ETPA 3PR5B 2LEAA 1R0CB 2ANHA 5LMUF 3BYPA 4A4JA 2NXNA 5FDLA 3TX0A 1VQ4S 4Y2IA 3TR5A 2IVMA 4C98A 1Y6VA 2DR5A 2HQFA 2MLYA 2C2ZB 2XC9A 4DV0J 3OL8A 1QVGR 4ICLB 1K0TA 1TR0A 1ZM9A 3C14A 1KFSA 3C3LA 1BD6A 5EGEA 2QA1A 2XMWA 1RBAA 3BZQA 3RBXA 2QG9B 1R3NA 1RLDA 3H20A 4HACB 5KT3A 4UT4A 4YFUA 4F4YA 1ULRA 2D3OR 1VBYA 2GIFA 4RW7A 2J6UA 2AGQA 2AEJA 4M5KA 1GMVA 1HLWA 3KWMA 1U0HA 4FNIA 5HJXA 4NWBA 2WSFC 1X4AA 3CDWA 5CCLA 2W9CA 4LF4J 2CQ3A 4MKAA 4ECRA 1I1GA 2DH7A 2NS1B 3I0SB 3MAAB 3QO9A 2BOPA 1ZAWA 2FJAB 3E3XA 5L1JA 1VMBA 3SFGA 2H5IB 4QIVA 3DM2A 2BA9A 5DQIA 1U48A 4X2BA 1N4LA 2NSCA 4TLRA 1AXQA 1NZ8A 1YRTA 2I8EA 3MM5A 3PYGA 4QPTA 4CLUA 2CYYA 3I0SA 1S1XA 4F3QA 2JWNA 3LP2B 4HR2A 1GQEA 4WP8A 3AQPA 3ZTPA 4ERDA 1YK9A 4F4ZA 4C8LA 5GRRA 3M7VA 5AE2A 4ZVHA 3TZXA 3MCSA 4XDDA 1HNXJ 3ZFVA 4IO1A 2XRGA 5GAHI 1FVSA 3BO4A 1S1UA 2HVHA 1Z1ZA 1B4SA 5B0FA 3JQKA 2RUGA 3CCSS 1IKVB 1FKAF 2C3OA 2B9EA 5E3RA 4LF1A 1BUXA 1U8SA 1XIQA 2ZOGA 3G8SA 2ZH4A 3IA0A 1B3TA 4WKRA 2IM1A 2KYZA 1VQKS 5KFOA 4C0BA 4B3OB 4QPXA 3LPEA 3B82A 3IGYB 4LF6J 3DU5A 4EO8A 4J9NA 1U49A 5K8NA 2XMVA 3I4PA 1YJWS 3SQGA 4NZ7A 4B3SJ 2RQMA 2CJYB 3P5TL 1DTQA 5LSOA 1J27A 1KLMB 3MMAB 1PAUB 2C2OB 4ZPCA 4X4TA 4I1TA 2K1RA 1V6HA 1WHWA 1YJTA 3HT0A 3N6MA 5HVFA 3VWSA 4CH7A 1HMVB 1X4HA 3SDEB 1HBUB 2XQCA 4KE5A 1S0VA 4K50A 4DUZF 1BGXT 2AV5A 2QL9B 2LKZA 2I5JB 1KVJA 5DRKA 5IQQA 2WVDA 3NKPA 2HQGA 4P7TA 4RBVA 1RZMA 5C25B 1M1KT 2FVSA 5F8JA 3VQSA 4TU7A 2DGXA 1NSKL 5D0GA 2DVIA 4EZ6A 2RS2A 4U9RA 2JDJA 2HHHJ 3EVMA 4B3SF 2FGOA 5A8KB 3RB6A 4ZVTB 3NS6A 2ZHAA 2J0QD 2FZKB 1S1VB 4YR0A 1FRIA 3C16A 3FCVA 4JV1A 1AUSL 3X1LB 5J1NA 1RT4B 1RTDA 1SJFA 1HBMB 3FDSA 1MWQA 4U7UK 2GCFA 3T41A 1ZYQA 1X9SA 2P9EA 2ASYA 3BDHA 1RE1B 4L74A 4TY9A 3N4WA 1I51B 2HHXA 1YRXA 1JLGA 1FFWB 2XSFA 4B3TJ 3IGVA 4I0WA 4EK2A 4IRDA 3IR5B 4DJBA 3A8IA 2MQPA 3QT8A 2DRBA 2UUAF 3PR4A 1VBXA 1KN6A 3CCZA 1T0TV 1TVRB 3DMJB 2WSEC 3JSYA 4HTIA 2CNNB 2JLGA 5DM7Q 2HWHA 1CJUA 1HBNB 2KH9A 4ZG7A 1AZSA 3SZYA 1SCJB 2HHTA 2CIMA 3FSIA 2ZBPA 3FBBA 1QUVA 1FRKA 1WORA 1V3ZA 1WHYA 2VBWA 1RT1B 3D1QA 3V4IA 2OTLS 3PEJA 4UUWA 2UVVA 3I87A 2LEPA 3HI9A 1FD2A 1KQFB 4NRUA 4CIOA 3IS9B 4U67Q 3KJVB 1RTJA 3I32A 1K8AT 3CWJA 3NGKA 1JMTA 1RU2A 5H1SV 3DDNA 4ZVPB 2KFNA 3FNNA 3LO3A 5DDRC 2HIYA 3V81A 2G1DA 3L7PA 3OL6A 5IV4A 3F73A 2BM1A 2PSZA 2DB1A 3DXSX 1FRJA 3EDQB 5SUHA 3W66A 4GKJF 1AFIA 4L3KA 3IM9A 4RR5A 4AXIA 2HIQA 3B6BA 3HF5A 3VR1A 3SV4A 3J80Y 3UD5A 2B4OA 4EBEA 2ADBA 2D7SA 4H4OB 4DR7J 3T5HA 2YXLA 2MQQA 4NCGA 4IH6A 4DU7A 1X31C 3ZZOA 5LSRA 2KG0A 3V6HA 2HLUA 3WBZA 5I42B 1BQNA 4C11B 1ZH5A 1HJKA 4ZVOB 4Z2XA 1VRUB 3W62A 4OI3A 1XMOF 2XR9A 1JLCB 2LXUA 2B5JA 3DOMB 1VRTB 3NP5A 4KFBB 4Y2KA 2KN4A 2XLIA 1T11A 2UXBJ 4K5SA 1C1BB 1D8ZA 2HBQB 3QQCD 4B08A 2KM8C 4DZDA 2R7RA 4DSJA 4RW7B 4OHVA 3OTOJ 1YGYA 2BMBA 1FKOA 1YJ9S 3W2VB 2YQ3A 2IRXA 1F9HA 4F7VA 4TY8B 3OVSA 5IT9U 2GSUA 3IBFB 1TKXB 3D0GE 2MKIA 3MR6A 4DFKA 6FDRA 4YS2A 2F9DA 3BGRB 1T8EA 4DSEA 4WXOA 2PE8A 1H0HB 1LXNA 5AE3A 5DJBA 3TUZC 3GSDA 1FCAA 1JIHA 3KXDA 1S99A 4DV7J 3CJ3A 5ADZA 2VD3A 2HSEB 2MZSA 4ZOSA 5G4DA 2DPJA 1CS4A 4JI5F 5KFUA 4DV2F 5GAEI 2HAFA 2P2CB 3M8PB 4ILRA 2RQCA 1ZAXA 2HBZB 4I64A 3UW1A 3T9ZA 5DG8A 1EAYC 3R7SB 3BDGA 2Z57B 1O51A 2C3PA 5D0EA 2XY5A 3EGWB 4GO5X 2XNRA 5J2MA 1N5VA 3M30B 1Q8KA 1OQ3A 3CJ8A 3WHIA 4F50A 2VG7B 1VGYA 1HFEL 2HQ3A 4CLLA 2LCWA 2YWEA 4QWAA 1H2VZ 2W5QA 1U2RA 4Y34A 3TRGA 2F65A 1L3TA 3P8BB 4Q2MA 3UI3A 1IBKJ 3R8YA 1B99A 3FC9A 1RHMB 4USWA 3MR2A 3CJTA 1SC6A 2QTWA 4G1PA 2KO1A 5CD4H 2QSWA 3S7RA 1VRTA 2WONA 1CG2A 1TL7A 3AD9C 3ETMA 5IC4B 5D6GA 5F8IA 3CCJS 4UOHA 4P75A 1C0TA 1N34J 5INHA 2RNEA 4NWXA 4O44B 2ZH3A 3K5LA 2HHHF 2VBZA 2IHR1 4WTOB 2ZKTA 3GZ7A 5JJBA 3EXCX 1HHTP 1JLFB 2FHJD 2QLBB 2XMUA 4RW9A 4NLVA 4OIXA 2HWIA 2MJUA 3TO8A 1VQ6S 4PWWA 1LFWA 3KK3B 1UW9A 3T6BA 5IM0A 3FZBA 1NK0A 1S1WA 4QR1A 3GTYX 2LP4A 4RLEA 2KG1A 3NWGA 4DN9A 8ATCB 3G6VA 3CCQS 3RR8A 1B8JA 1RCXB 2WW4A 2IJRA 1RT2A 1RTJB 2ZZNA 2BXJA 2A0FB 5F8LA 1BHNA 4ECSA 4N5SA 2QRRA 4NPOA 1JKHB 3EPGA 1JQGA 3MI7X 1RT1A 2FZGB 2R42A 3RRGA 9RUBA 3L7UA 2VDHA 3QAEA 1NM2A 3NKYA 4OX9J 1EETA 5A0YB 2QV6A 1VJQA 3O2IA 3HXMA 2KFYA 3PV8A 5H9EK 1N33J 4KO0B 2XLKA 4LF2A 3CD7A 3CO0P 3JAMY 1SQFA 2HK3A 1C2PA 3DMJA 1Q7LB 4KYZA 2O1PA 1PYOB 2AHOB 3DOLA 2DTJA 3HD1A 2B6AA 3ICLA 3Q83A 1XNQF 2AKWB 1LFPA 2Y8YA 5C24B 1XNRF 2DR8A 2NSBA 2V50A 1WG1A 1SC4B 3MEDB 1O99A 3W5YA 1ALKA 1DLOB 4IFVA 2NZ4A 3VZHA 1XQIA 3AXKA 3LTOA 2CQDA 1H72C 1OPIA 4R25A 2QYCA 2XULA 2RHSB 2CKWA 3O44A 1HI0P 1HQAA 1LKZA 2R8JA 4GMKA 2B3TB 1S1VA 2UV8G 4J9VA 3UDLA 3H5YA 4OHWA 1HI8A 1LWEA 3KKFA 3NNAA 1KOOA 3QFWA 1IKYA 3QATA 2PMZD 3RB4A 1L5UA 1N36F 3ZZYA 3SZZA 2B9XA 2IC3A 2AJ4A 2A18A 3N6NA 1N48A 2RF2A 2L9NA 1LWXA 1AJDA 3BGFA 4XO0A 3CEDA 2ZHBA 3VQTA 1RKIA 3RAQA 1ZETA 2IRUA 2J9DE 2GQQA 1SIWB 4F0HA 4GTWA 1A0OB 2YNFB 4DCOB 5DQHA 4Q7AA 2W9AA 4X4OA 4IR9A 2AJQA 4H54A 3SDEA 1UFLA 4K2JA 4ZDNA 1WC3A 3QIPB 4LR9A 2CWKA 6FD1A 4LF6F 4FYXB 2R8IA 3BPDA 3HZEA 2YKAA 1KLMA 3MMAA 5LMUJ 3PM9A 5LIAA 4RNHA 4F8RA 5MLCV 4B9NA 2F3JA 3MEEA 4B3TF 1P9YA 2HHQA 4DR5F 4KTQA 3MK2A 1PYSB 4AL7A 3M2UA 2MHNA 5A8WA 1U6FA 4URQU 3O6QA 2DNYA 4UOCA 2B9WA 1C4CA 4N56A 4RPFA 4LFCF 3CVKA 4RWWA 2W5SA 4TN0A 1FJCA 4F4AA 1J5OB 2WVFA 2BABA 1SI9A 4CLFA 1N33F 5EN1A 4ZCKA 1SKRA 1EQJA 4BCAA 1TELA 1KWMA 1X9WA 2U2FA 5GVQA 2GLQA 4Q5VA 1TV6A 2EBGA 3D6TB 3ZTOA 1S9FA 2RKIA 4UF4A 1K0VA 2XYPB 3CCVS 4DV5F 3CMQA 1LWCB 2COLA 1VYAA 4RX6A 1QAXA 3HVWA 3M2VA 2ZNYA 3FKBA 1S6PB 3HD2A 2AD9A 2HMIA 5BXIA 1RBLA 1WC4A 1RAFB 2ZWPA 4YR2A 3DGVA 5IQ6A 4J9MA 4ZCIA 4AL5A 2GQCA 4OYMA 4WU2A 3DM2B 2KM8B 1KSPA 3QAUA 4DX7A 3BN7A 1H2UX 1O6XA 1UWAA 3M6WA 4KIAA 2DNRA 2G13A 4HH0A 4X4PA 3M2RA 1YWXA 1N5SA 2DNQA 2GO8A 1DZ5A 1FSUA 1GAOA 2XZDB 1EW8A 1SHQA 4PCQA 4ZMMA 4ZJLA 4AUKA 2CZ4A 3KLIB 2IJNA 3QBCA 4WP3A 5ITHA 2XLJA 1NXIA 1SUQA 3AQOA 2MZQA 3MUTP 4LF7J 2YNFA 1NPRA 2DHAA 2E5GA 2NXUA 1GMWA 3FGVA 2JZ5A 2QX0A 3LAMA 4RBTA 2R9LA 1NK5A 1SJ3P 5KFVA 4F3OA 2RH6A 1PGZA 3LGMA 5EX3A 2V67A 2AJ2A 3KFWX 3NWRA 1UJ6A 3W9IA 3K5OA 3PJ9A 3PYEA 1S9GB 2IBOA 4FVMA 1HQEA 3W1YC 7FDRA 3THPA 4NXNJ 5KFQA 1OO0B 5F3ZA 2Y3YA 3LGHA 3GV7B 1HBOB 2JC0A 2WCXA 5CZXA 2IDEA 4TNOA 1VC6A 1IKXA 4PQAA 2VPXB 3UVJB 3TUPA 2FJBB 1YKWA 4PPDA 4A8SA 1FA0A 5JVGQ 3UCGA 2X3DA 4IFVB 1KS2A 4F36A 4JI8J 4O4GB 3O1LA 3PYDA 1U26A 2EC2A 5I3QA 1SV5B 3EXYA 3UO0A 3MMCB 1U1PA 4PWDA 5LJ5Y 1H73A 1B70B 2D74B 4KT0C 3EICA 4LSLB 1XN9A 3ILIA 2DGWA 1MU2B 5HLFA 1ZZNA 3BR9A 2YKMA 3D54A 2XMMA 4IG0B 4QWEA 1QE1A 1FTRA 4ID5B 5EUHA 2HQIA 4KBIA 3OLBA 1M5PC 2MZTA 2OPSA 2CQ0A 5BYSA 4Q0BB 1O98A 3CT9A 2J5AA 4ITSA 2RUSA 4W98A 5LOQA 2X98A 4MAKA 4J37A 2MMYA 1DQAA 3HFZB 5KXAA 4Y3CA 2IM3A 2YQ1A 4CO5A 3N6LA 1QVFR 5LT5A 3D9BA 2UXBF 3WBHA 3TUJC 5RUBA 3VAJA 3EVOA 3P96A 5JXSA 4YDXA 2ZFHA 4DG1B 2D3ZA 5K20B 4GKJJ 3CJ4A 1X4BA 3Q8PB 1L3UA 3M1VB 3KK2B 4DX8H 2OLWA 4P9SA 3MK1A 2IVYA 2KT3A 1URNA 4OI1A 3KK3A 4DR1F 3QFHA 2KKHA 3E01B 3PW5A 3RAXA 1KRPA 4LF9F 4PRFA 1WC1A 2J0XA 3G4SS 3AJ1A 2XMJA 3DLKB 3CSKA 3K0JA 2BOAA 3D0HE 1RT6B 2V0NA 3H0PA 3CD6S 4TU9A 3CJ0A 2BDPA 3R5CA 5CA5A 3BB5A 2WONB 3JSRA 4DWIA 2KXHA 5BR8F 4IG3A 3T01A 1OYDA 2VB6A 2DNNA 4B9UA 1FWLA 2CJ9A 2DH8A 4L3NA 5F3TA 3OW2R 2YX4A 3C15B 5THWA 2BQUA 1WC5A 3TG0A 4K4XA 5LMNJ 1KQKA 3PIPQ 2HHSA 3VGVA 3BBFA 1G4CA 2BJDA 1U24A 1VR6A 3CIMA 2HNDB 2IIHA 3KG4A 3KUEA 3M2VB 4H4MB 1HR0J 3MTJA 2J6TA 1UVJA 1U1NA 4JV2A 4A8KA 1SC3B 3WX8A 1RTHA 2HZVA 2IM0A 3I9V9 2AEMA 5DLWA 2OPPB 4NLQA 4EUVA 1IM4A 4I7FA 4IDKA 4TQRA 1XMOJ 4N41A 1M0SA 1R89A 1P9QC 3LP0A 4S0MA 4DSKA 3MDFA 1AA1B 3GCWP 1BQXA 4K5RA 3IGNA 2MLXA 4WFNQ 1ANIA 4Q8EA 4F02A 3UQSA 3BH7B 1Z2ZA 3FK4A 4M5DB 2V4RA 4R5PB 2BX6A 3PX0A 1EZZB 1B7YB 4NEZA 3SCJE 1Y0HA 2IYIA 4UOFA 2EKNA 3NGDA 2AEFA 2IMWP 1UVNA 5HBMB 1PG5B 3QT6A 1KONA 1REVA 1TL4A 1WJ9A 2WBRA 4BC7A 4C8KA 1KHVA 5FLXY 4CH1A 4X4QA 3CDAA 4UQGA 5DGAA 4DEZA 2HHWA 2QO3A 5C2GA 3CXCR 3QSYB 2QSFA 2B9YA 1BXNA 3HHDA 4EWTA 1IN0A 1SH0A 1SUQB 1WEZA 2HGNA 2D1CA 4NLWA 4B02A 5CCMA 4DBQA 5GAGI 2BR0A 4O0NA 2ZBIA 1HNZF 5DLGA 2BE9B 3MECA 3OFFA 2W2QP 4HHUA 1FVQA 2FYXA 2RQKA 3V6JA 2DPIA 2OI2A 2K8GA 1HHQA 3DOMA 4DV2J 1E6YA 2HK2A 2J9DA 2VONA 5IJQA 2DHHA 8RUCA 3H25A 1NJYA 4MJKA 1JLBB 4UZCA 4DL7A 1NJZA 5DQGA 1IR0A 3J7AN 4JV5J 2UVRA 1TKZA 2AZ3A 3HKZD 4H4OA 2PEHA 1PSDA 4PR6A 4DFJA 3M8WA 1UA0A 3T9NA 3ZZUA 4CLSA 2DO4A 3BF4A 3RYLA 2HNDA 2ADCA 3WAWA 5KFHA 5CYQB 4Q2LA 2HAIA 3A8KA 4CLZA 3DKDA 2CA9A 3A8JA 3QZ8A 4FDFA 3QRQA 4PQUA 1F9FA 3LANA 4UORA 3OSPA 1NCLA 4ES2A 1J5OA 2Y0BB 4I2PA 4UOPA 4USIA 2BQRA 4X4NA 2GAGC 4KH1B 4NLSA 3BO2A 4K0KF 3AB2B 1SL0A 2YWWA 1NUEA 1ACMB 2L08A 2CQIA 4ZVEA 3C6UB 2EK6A 1XEZA 4DPTA 1WTBA 4LF7F 2ZH1A 3A1YG 3DHWC 3G2XA 4K8RA 3UDEA 5D77A 4LF8J 4KO0A 2M70A 3B78A 3IP0A 3U27A 2F4VF 3G96A 3W5ZA 1LQ9A 5C2CA 2W9BA 1NDPA 5KG2A 1TP7A 3K17A 5ETSA 2XB2D 2I0XA 2H4WB 3PXGa 4DX5A 4XK8C 4FDIA 5F8MA 4IKAA 2DH9A 2L9WA 2OD6A 3RB0A 2OFHX 2D3UA 1EHWA 3JQJA 5DG9A 3US5A 4ZN3A 4RW8A 4HLBA 3VHQA 2KZMA 2QJ3A 4QR0A 3TP2A 2YTCA 1R6VA 1S6QB 1PIEA 2FHJA 2FB0A 2KT5A 2L48A 3DLGB 4IR1A 3CULA 4HT7A 2C22A 1KHNA 2CPIA 1S1WB 4RZRA 2E5IA 2DHGA 3O8WA 2HNYB 2MEWA 4BC9A 2M7SA 4EYHB 1OWXA 2E9RX 2G9YA 3DOKB 4JI2J 2HZAA 3RB3A 3ELHA 3R6GB 1SQGA 2GJIA 4PZVA 4RO0A 4DG1A 1L3SA 3R2DJ 3HFKA 1E6VB 1PJ6A 3NGTA 3G8TA 4FBUA 4ZCMA 8AT1B 2A10A 1FERA 3D3BJ 4C48A 3KLHA 5LJ3Y 2L41A 5KFRA 2NYHA 3MM7B 1YQHA 3DRSA 3OTOF 1EIYB 2GV1A 4LSLA 4F4XA 4WZMA 1R27B 2W7OA 1TUGB 2YKNA 3F44A 4FPIA 2XWXA 4X64F 1JLQB 5G0RA 4NE9C 3WQPA 3BQ1A 3DRSB 2G0IA 1MROA 1U1RA 4J9QA 4DSIA 5KT2A 4YB7A 1HMVA 5E41A 3RTVA 3A13A 4ZHRA 4OHYA 1MU2A 5HLFB 3CCES 4DV7F 2C1EB 4ED5A 5KFKA 4QR2A 2FVRA 4I2QB 3BSCA 6AT1B 2J7WA 2CFXA 1O5JA 1RQ0A 3IC1A 4OZ2A 1XNQJ 3EUNA 4YOEA 2PFFB 1FDDA 4MHXA 4NLRA 3W8PA 3I56S 5IT9Y 1J2VA 3PTWA 3VVTA 2BJ3A 2N3OA 1S4EA 2Y1IA 1RAEB 5CQGA 3M8ZA 4P2SA 4PG8A 4OV6A 2AJ0A 1GTEA 1URRA 3SXLA 2EBEA 4K4SA 2LQ8A 1Q5VA 1S1UB 4WFBQ 5DDQC 1RWXB 1S9GA 4YHHF 4EBCA 1JJCB 3VCDA 3KLIA 4FBTA 2JEGA 3GU0A 2IBKA 1I3OB 2C2KB 1OQ6A 3S1TA 3C19A 3KUGA 3TX8A 4R8UB 1IR2A 1FE0A 4QYRA 4AYBD 2Q66A 4LFBF 5E2QA 3DLEA 3LALA 1G1XA 1KTQA 2KB2A 1Y9OA 1YZ7A 2VODA 4Y6IA 3DU6A 2I6WA 1HW9A 4DR5J 4DL0C 5KFFA 1NSPA 3OUYB 2KDOA 3CCUS 1QAIA 3VF0B 1UCNA 3D7SB 3FMBA 2GIRA 2CNOB 1X4EA 3LUYA 1CJVA 4ZP7A 3EMTA 4P72A 1NSQA 4DMZA 3CF5Q 4B9TA 1M1GA 1UTAA 3KHLA 3CIZA 2E7XA 4NA2A 3G6XA 2CQBA 3Q2TC 1NJIT 3MZIA 2UUTA 4AL6A 3OL9A 1RT5A 1TAUA 4KPYA 3CDEA 3E8OA 4JUZA 5FD1A 1T05A 1T9TA 3SMZA 5IC6B 4DV3F 3HK2A 5L8RC 4C8MA 1T3NA 1TZ0A 1WEYA 1O0PA 3IBWA 2MQMA 2FJWA 4BLGA 3EYZA 3PX6A 2HW3A 4TYAA 1KDNA 1CJTB 3TWZA 5SZTA 4UPIA 3SQOP 2YWGA 5F0WA 3D3CJ 5LM7E 3V81B 1HHSA 1M1HA 1VBKA 2I9SA 3D66A 5CH7B 3M8PA 3W7BA 1WSRA 2GQ2A 4KAVA 3IS9A 3KD8A 1GXUA 5CAAA 2CQ1A 2DGOA 2LMIA 1NKEA 3PY8A 3MECB 3BDFA 1ANJA 1QTNB 4M5LA 3VAHA 4MY4A 4B17A 3ISZA 4ES1A 2PA3A 3K8WA 4DV0F 1N34F 4OZNA 4U7UD 1FXLA 2JX2A 2FQQB 3HPOA 2CDQA 4NX9A 4CO3A 1FDAA 1R6YA 2VKRA 3N5FA 4K4UA 1RA6A 4UOOA 1W2BR 1LNQA 3A3PB 4WTYA 3Q3QA 3EGNA 3BGRA 3E01A 1N2LA 2FPHX 1WF0A 3NKNA 1S5ZA 4A46A 4IQMA 2OH2A 3VAGA 3SSSA 4WBFA 4FF3A 3HHNB 3NMAA 1TVRA 2GW8A 2V8HA 4OJGA 4RU2A 3TVKA 4BWMA 3M8YA 1RTZA 3U7JA 3SI8A 1U1MA 3BR8A 4MK9A 2XY6A 2GX8A 3R97A 4OI6A 2CNKB 3BGUA 4C7QA 4DL2A 1VQNS 2E1PA 1HWKA 3LA0A 2NXCA 3BM7A 4OYWA 4XPCA 3R3TA 3NOCA 4MKBA 2Y8WA 2DY9A 3C2PA 4LR8A 2ZWOA 5EWFA 4Y2AA 5LRNA 3CJ5A 1KHJA 1CBKA 3AJDA 2N4CA 2EXUA 3T1AA 5EDWA 1R43A 1NRKA 1Q95G 2YPZA 2ZD1B 5HANA 3KNAA 4H4MA 5DZ7A 3QRPA 4PXEA 2B6AB 4CO4A 1KHLA 4DR2J 2GIQA 4ZHRB 3HVTA 5B08A 4DQQA 4GC6A 2YKMB 1U25A 4IG0A 3SYZA 1Y11A 2PMHA 5M2RA 1MN9A 1TQLA 2V8PA 2X51A 3C15A 3MEDA 1B0TA 4O3PA 3HSGA 2Y9HA 2DEIA 2NUUG 5E3PA 4C8NA 1BLUA 1ZS6A 3OTBA 2VC0A 1FFGB 1CULB 4DCPB 1HQUB 2G4BA 4NA3A 4I6AA 3MM7A 1UZDA 2MKHA 1NK9A 5IJSA 3HJFA 2EG2A 2K7KA 2W8SA 2ALZA 3S01A 2AYBA 1LW2A 1W25A 1SC1B 2DD8S 2WB1D 3WIVA 4C3KA 1RT2B 3V6KA 2Y0SD 2A6OA 1EB0A 1FRXA 2HRTA 3L7OA 5D4LA 1HBNA 2Z2MA 3KLGA 1T03B 2R3VA 4B9MA 4OYXA 3UNYA 2ZM6F 4IO9Q 4QIGA 1CEZA 2YNIB 3GCXP 5A2QY 2CJXB 3IAM9 3QWPA 3CUNA 1Z4UA 4DF8A 2E9ZA 2K7JA 5ETLA 3DLGA 1HARA 4DI6A 5EHHA 5IFMA 5HMZA 2L3MA 1ZTWA 4X4RA 2LA6A 1KP6A 2OO4A 2DY1A 4WIIA 3SCKE 1U1QA 2XCPA 1TKDA 2ZH2A 4Q44A 3OTEA 4UY85 3AA8A 2E7WA 2J0WA 3Q86A 2Q43A 2G0CA 4I6YA 1TL7B 5DLFA 2MQ8A 4LBIA 5KOWA 2W9BB 3DGPB 1DURA 4TN2A 3WAVA 2W1BA 5B0EA 3PFEA 3DXBA 5T7LA 4UPKA 2EK1A 5BYQA 5AXMA 2B7CB 1ICEB 5GMEA 5B0GA 3VGTA 5E7OB 3ZZTA 1PJ5A 1SKWA 4IOAQ 1HNIB 5J2NA 3DYAA 1Q86T 1ZEDA 2RU3A 3OTDA 5LSLA 3MAAA 2VG7A 4LVOP 4X65F 3Q8SB 2Z2ZA 3PHTA 1M5SA 4KV8A 4X4VA 1N88A 2V2KA 2Y1LB 4PPZA 2R2SA 1S4FA 3AY0A 2RKIB 4CH0S 5H9EJ 1JX4A 1VJWA 4WWSA 2RDJA 1EW2A 2MZ1A 3OV7A 1SV5A 2EFGA 1XWLA 1HNWJ 4OZ3A 2VF3A 3KTQA 4RBUA 4QBUA 3NVLA 1YJ7A 1YIJS 2ZVSA 2FY1A 1H7WA 2CJKA 2I2YA 2P9GA 1HD0A 4QYZK 1HYSA 5E3QA 3CCTA 3NEKA 5L0EA 3IBCB 3BN4A 4F2RA 2XI3A 1G7CB 3OL7A 1AW0A 2LQBA 1IBCB 3PRVA 3D6HB 2W25A 1LEOA 2JC1A 4DL3A 4USJC 1KNZA 1OSDA 5KFEA 2PGCA 2UUBF 2BE7D 1H98A 4WE1B 3MPWA 3AB4B 3AH6A 4KGZB 2MKYA 4NLUA 5T41A 2MXYA 2R2TA 5J2QB 4B3OA 3NKOA 4JB8B 4OFZA 5KFXA 2K06A 2M5YA 2OSRA 2W7AA 2XBPA 1YJRA 3FEXB 3HLUA 4X4SA 4WK1A 1JK9B 3BJYA 1V3RA 2X1AA 4DV6J 2DGVA 1WC6A 3DRPB 4CDIA 1HDHA 1HA1A 1X60A 1F2HA 4RUAA 3CC2S 4DR3F 3BQ2A 1ED8A 2J9EA 2FHOB 2HFVA 1GXLA 1JLCA 3A12A 4QWBA 2MGZA 2HZCA 1XMQJ 4LF5F 4TY8A 2Z30B 4KHPJ 3J81j 1NDCA 3BEGB 4WXWA 1FJEB 3L95X 4Q8FA 1RT3B 1ZPVA 4ECYA 2K2PA 4QIFA 4LQ3A 1JJ4A 2OHDA 1QSLA 2QZ8A 5J2PA 1ZBTA 2FIUA 2Z0GA 3UNGC 2AF6A 2HG4A 1HIYA 4FVCA 5KFIA 1SL1A 4FDJA 3BV8A 2R7UA 1H7XA 3IFEA 3LP0B 4OYOA 4YDDB 4JI4J 4C11A 4A8FA 2GO9A 4DQIA 1UJ5A 3JYTA 4O4RA 2FTRA 3VV2B 5GAHU 4P7VA 4WYWA 1WOOA 4WIQA 5KAKA 3KJVA 2UU9F 3PNIA 1WOSA 2XSJA 4ICLA 3U1LA 5CABA 2CQGA 5JUMA 3KOAA 3A4TA 1V5IB 4MK8A 9ATCB 2ZEJA 3MD1A 2C2NA 2FJXA 1FD8A 4J90A 4USMA 3IRXA 4DV5J 2V94A 1T03A 5HSPA 2GAHC 1S1TA 1WUUA 3Q2SC 5HP1B 3IRWP 2BQ3A 2IY5B 5KFLA 1X0PA 4WK3A 3EE3A 5CHCB 2E5LJ 1LXJA 4ZIVA 2OKQA 5JVHQ 2LFVA 3VZIA 1TL3B 3PEHA 1H74A 2AP6A 4DR4J 3VGSA 1AZSB 1VCTA 1KHWA 1KR4A 4K7QA 2E5JA 3Q24A 4C2MA 2E1RA 2FLOA 4J9UE 4E2FB 2D9PA 1NPKA 2OP5A 2KI2A 4W92B 2NXJA 2DR6A 3NG8A 4I69A 5GOVA 2MSSA 3R7BB 4QWDA 3QT7A 1UPPA 1RT7A 2XWYA 3CJRA 3P3DA 1HBMA 5IS2A 2ASLA 1RT4A 3RGIA 1OSCA 2AX0A 1F60B 4ANCA 5JMNA 1RTDB 1CVJA 1OMSA 2WAQD 3K5PA 2NCKL 3KNGA 2DR7A 1U2CA 2CJAA 5F8GA 4DPWA 2MY7A 1VQLS 1X5SA 3RBZA 1R0AB 2GGPA 2V9WA 1R8HA 1WDDA 2VZ9A 4DPYA 3FCHA 2UZAA 3TUIC 2GVZB 3MM6B 1AT1B 4ZPTR 3THTA 1YHQS 4JI6J 1Q5YA 1T7PA 3M8QA 2LXFA 5CYMA 4P71A 3ZNJ1 1IWGA 2ZBQA 4NLOA 3CD5A 1QE1B 4ID5A 3H8YA 4XPEA 4W90B 1WF1A 1UEKA 4ECZA 3TQEA 1X4FA 2YKQA 1Q53A 4DUYJ 3M30A 1QD1A 1HNZJ 4EGLA 1UVKA 2Q6CA 4KGKA 3PHEA 1XERA 4WPAA 2I5JA 5HMYA 1SVDA 2OSQA 1VIXA 1UFKA 4MTPA 3SEOA 1OY8A 2J9CA 2BKOA 3FRZA 3R5AA 2KJVA 4ZVFA 3PW0A 2D1GA 1RUSA 4EYIB 1OY6A 1OJ4A 2C42A 3ITHB 2K1RB 5KFBA 3Q22A 3GMGA 2HWTA 2P9CA 1S1TB 1IR1A 3CO9A 2IJFA 3PFOA 1HBOA 1KC8T 5I4MA 2CVEA 2RJZA 5IXUA 2JNJA 3BGOP 4CLWA 1JNRB 1CJTA 3D4JA 4OHZA 3VGUA 3VAMA 4NZ0A 5T14A 5L1IA 1PILA 1Y5IB 2XGPA 1K1SA 1H6KX 1P1TA 2RRBA 2YNGB 3ETOA 1S10A 4RUBA 2IA0A 1RADB 5KFGA 1PBUA 3I5CA 1YZ6A 1VC0A 1XR5A 5C5JA 2C2EA 3HP6A 1C0TB 3KJNB 2BBEA 4LF9J 3GR1A 2U1AA 1KD1T 4GVBA 4X65J 2DBBA 4NYPA 1IKWB 1UEVA 2EFQA 3HDSA 4JI0F 1VRQC 4PXBA 1SIZA 3TJ9A 4RUCA 2QL5B 2LQ5A 1VS3A 3MPUB 4OJHA 4WP9A 4CYUB 4YHHJ 4FP9A 2RB7A 2ROEA 1QDUB 3KLVA 1SXLA 4FS2A 1PCAA 1RT3A 1M5OC 5IZHA 2ZOMA 1KOHA 4B9VA 1GH8A 2M52A 4HH1A 1NHVA 3HSJA 2HFSA 4L72B 4ED2A 3NGUA 1UJ4A 4FZVA 2LXIA 4NZ6A 5KFYA 2Z2YB 4GTXA 4WJBA 2V4JA 4J9OA 5AXLA 4FPRA 3QGIA 3AODA 1T95A 1VDHA 2CPEA 4ZCLA 2VG6A 2Q1LA 5IWAJ 4IH7A 1YSJA 3T1HJ 4ZKAA 2JFDA 3MURP 3G6YA 1SBRA 2XYGB 4PG7A 4QCLA 2BRLA 2BJEA 2CXEA 4R0JA 4P74A 3M2UB 5A8WB 2XMKA 4ZGAA 5KFWA 4ZVGA 2IDLA 2V8VA 5A2QU 3GIIA 1FDBA 2HS4A 2DNHA 1WHXA 2BE2A 4PKDB 3H42A 1URAA 2A3JA 4J9SA 2HPUA 3KLFA 1TTHB 4DR7F 4FXVA 2MB0B 1CLFA 4I2QA 5CD4A 4YB6A 1D1UA 4P73A 4UQTA 2DIUA 3MMJA 1XK8A 4C0OC 4D3GA 2F4VJ 1VQOS 5GMKa 2M4MA 4K4VA 5DO2A 5B0DA 1KQGB 2JHEA 3MM8A 1YITS 3B54A 2ASJA 3NKRA 1SQEA 4IOCQ 3I31A 1NAQA 3K2YA 4KGXB 4FYDA 2IFXA 1TMJA 1RAJA 1TMMA 1C1CA 4KPCA 1F3FA 3M8QB 2KT2A 4ECUA 2GVDB 1RWVB 4KV8B 1VQ9S 3PRBA 2V9KA 4QJVA 4FF1A 3GIJA 2VFUA 1D9DA 2GGPB 3M32B 4JI4F 2OAUA 2YH1A 2DJWA 3UR3C 4C3LA 3TANA 1LWEB 2O67A 3MAQA 3K58A 5CYMB 1MMNA 5A8RA 5M2PA 3V2UC 2O3DA 3RUBL 3VAIA 1AROP 3X3UA 3HJVA 1NJXA 1N52B 1N0UA 4UW2A 1I5OB 2V6AA 4QOTA 5E5NA 3K5NA 1UEUA 4CT8A 2R8GA 4JI5J 2CPZA 3FMWA 3PG9A 2RAQA 5C25A 1NPPA 1SJRA 2BANA 2I38A 3H5UA 4USUA 1RT7B 4E0DA 2CADA 3GILA 2ZZMA 1FRMA 5LRMA 2OPRB 1NEEA 4ZVSB 5KT7A 2GC8A 1TK8A 3GIRA 3HSZA 3OR2B 3OT9A 3K5MA 1HKAA 4DQRA 1BWEA 1MWZA 2DRDA 3I9ZA 4DX6A 1VQPS 3HHLB 1ELYA 1KH9A 5A0YA 2PDAA 4OZ1A 5F9LA 2UUBJ 3IRXB 4ALZA 1DARA 1M5KC 2R2UA 3NKMA 2QMUB 1KHKA 2ZOFA 1Y3JA 1HQ2A 1RB0A 4U6PA 2A1BA 1NKBA 2VFSA 3V4MA 3RR7A 1HWIA 1QSYA 1TL5A 2GS8A 2MZJA 3NCQA 4PEOA 1NHKL 2QLXA 3P5BP 1IKVA 1IUJA 4FYYB 1FE4A 2B56A 2OELA 1F1BB 4ZP8A 2UV8A 2YPYA 3TA2A 4LF4F 3PYFA 3WX4A 5H9FK 1O8BA 3OHAA 1RHQB 1WHVA 2VKZG 3RZAA 3KHGA 4ECWA 2E66A 4ZJOA 1S12A 2WOMB 3MWBA 5ETKA 1KTVA 5KT4A 3GE9A 1VOMA 5HMXA 3IDDA 1OYEA 4HTJA 2HBRB 3HSDA 1K44A 3MM5B 2CWXA 3T5KA 3HVAA 5J1PA 1WEXA 4LFBJ 3VTIA 2EFOA 5F0UA 2HVIA 4RU9A 5HL7Q 2AMCB 4O3OA 3QNWB 4IYQA 2W24A 2HRUA 1U7LA 1T02A 4CCHA 2B7BB 1TL1A 2B8PA 2Y1RI 3CJQA 4TU8A 3D0IE 3CC7S 4CO0A 2HHUA 2Z58B 4PXCA 5A8RB 2W5WA 2LLZA 3EZUA 5KFPA 3PKMA 1TKTB 3GIKA 1D3WA 4Y2CA 1RWPB 1FX2A 3TQ1A 4DFMA 2ZE2B 2BM0A 3U1MA 3W65A 4M5JA 2Z8QA 4ZPVR 1RWUA 4HACA 3RRKA 2RDIA 2D41A 3MMBB 5B0BA 5HMWA 1FFSB 3OJSA 3M9MB 5B0CA 4GRSA 3OJUA 4G65A 4UY8T 4ILLA 2LU2A 2V68A 4MKYA 3CPWR 2W01A 3ENWA 2V63A 5L9NA 3BSAA 1HWLA 3IGZB 2XM3A 4ED7A 1U8WA 1ZA2B 5E0OA 1U45A 1MMDA 4FXDA 3GJTB 3JS9A 1DBDA 3TVYA 2HHPA 4MFBA 2WBMA 3G82B 1Q81T 2OPQA 4PUOA 4CYRA 1KFDA 3CCWA 3KG0A 3OXLA 4USTA 2KVQE 3AA9A 3IR6B 4ZA1A 4DU8A 1EW9A 2V2QA 4ZVQB 3JSBA 2AX1A 2DNGA 4MFBB 3AD7C 3FSYA 3LP1A 2ZJQQ 2E1CA 2UU9J 1X4CA 2BE2B 3G9CA 3HHEA 4G3IA 5HRTA 1VLOA 2CPDA 3I6PA 4IUFA 3CW2C 4YP3A 2HS3A 5KFSA 3KK1A 3Q0AA 4YN3B 4Y28C 4K2XA 3TJAA 4LRFA 4EU0A 4ZVUB 3AOAA 4NA1A 2NXEA 3LP2A 3E51A 4JI0J 1RAAB 2POKA 2DXEA 4OJ1A 5ETVA 2GJFA 1A6LA 3GJSB 3HX9A 4QW8A 1FKOB 4KGMA 3TAQA 1WACA 2DGQA 2Q6BA 2QFJA 1D8YA 2DNLA 1VHFA 2QT7A 3QMQA 2VIHA 1MNEA 2W4DA 4NWJA 2B51A 3MM9B 3GG0A 4OL8A 3A3NB 1FRLA 1CJVB 3OHBA 1TL1B 2XNQA 3ZZRA 2UUCF 1BQMA 1KVKA 2KRBA 2VUGA 3K7RA 5HI7A 1U09A 5L1LA 4LFAF 4V19X 1PYTA 3QPIA 3WDOA 1P27B 1RT6A 5I42A 2YKPA 1HWJA 3DHXA 1EP4A 3A8EA 3I0RB 3WAXA 2CG8A 2H9ZA 2ZM6J 3CDBA 4LMZA 1RSCA 1XR6A 5EGYA 1FT8A 2QL7B 3SSRA 2RH3A 2E1MC 3W64A 4OZ5A 4ZS6A 3POTA 2ILYA 4OZLA 4M5GA 3J81U 3OR1B 2DR9A 3DLLQ 2ZH9A 3NS5A 3UE2A 2LQ9A 4K59A 2GNKA 2H51B 2R7QA 3MAHA 2NZCA 4RKUC 4DQSA 2E7VA 3OXFA 4GTZA 3AFGA 2UXDF 1K47A 5CZVA 2YNGA 2VOPA 2QEXS 4G1QB 2AJFE 2PA8D 2YX7A 5D4OA 3EPIA 1VFJA 1Y5LB 2BRKA 2V69A 4C6AA 1FXDA 3IWLA 2MJNA 1SJ4P 2C2RA 5F8HA 1VISA 4DSFA 1UZHA 1GEHA 1ZA1B 2FHMA 4A8MP 1S6OA 4DR4F 3OD2A 4LVNP 2BJ9A 5B7WA 2WVBA 3H40A 1Q8LA 4A8YA 2HVDA 4DL5A 1LW2B 3B4MA 4NLXA 3ITHA 1RTIA 2MKCA 1DHMA 3EM1A 4C8YA 2OPRA 3ZO7A 2OEJA 3DCAA 3O5TB 4DXLA 1TU0B 1GNKA 2M8HA 1UVMA 3RBEA 5HQMA 3DN9A 2ROGA 3GFYA 4K4YA 1FJGJ 4JBCA 4ETXA 3P4UB 4PWDB 1Y7PA 2M2BA 2PIIA 3A3OB 2DNOA 3BKTA 1WKKA 4USKA 4F67A 2B4VA 2UP1A 1ALIA 3TNVA 2PI4A 1T94A 3CJ2A 3OQ2A 3W61A 2B8QA 1RJJA 1C0UB 3D5MA 2BKPA 2C2DA 1S77D 2ZJPQ 3OVAA 2EI5A 2HFOA 2N7CA 4JP8A 1NLKL 4YB1P 3J7YI 1UWBA 2H54B 3DOKA 3QYYA 3O3LA 3BDPA 2IRYA 1R0AA 5A8KA 5GAGU 3DRRB 4M5HA 1NB7A 2JSXA 5KFZA 1RLCL 2Q79A 3BGLA 3N9UC 1UPMB 5EX0A 2FJDB 3K59A 2OGUA 4YUDA 2XEXA 3V6DB 1CJKB 1S6UA 1UW4A 3MUVP 3MF5A 3QT5A 1S9EA 4LF5J 2AU0A 2B0GA 1HBUA 4JI2F 1EKRA 3DI6A 5C66A 1NH7A 2FD2A 3H2LA 1TUWA 2AQ4A 4LSNA 1FHTA 4RWXA 2VQEF 1AFJA 3EJMA 4F0KA 4Y0FA 3J7ZT 4DCJB 1HW8A 1VBZA 1WELA 3NAIA 2M8DB 2CQPA 4R0EA 2H65B 4G6VB 4V19J 1NSAA 3C6UA 4KKOB 3CCMS 1HNXF 1TAQA 1IQTA 2W2PP 1AJCA 2KL8A 1S79A 1M90T 3DPCA 3H98A 2IUCB 3C6TA 2GZOA 2YWFA 2APOA 2HEKA 1VQYA 1ZOTA 4ED6A 2RRAA 1EKSA 3KUHA 5IWAF 3NL0A 3EVWA 2E1AA 2F5GA 2CQ2A 3H5SA 1LV5A 2ASDA 2JLFA 4LRAA 5D0HA 4M5IA 5BJRA 4YY3F 3TOQA 3M8RA 2LU1A 4RW4B 2W8DA 2XMTA 2P6TA 4L73A 3KG1A 4LRDA 3J80U 4I67A 1JJHA 3FFIB 4KR0B 4DHVA 1NK6A 1CPZA 4U96A 4QAXA 3CCLS 1D09B 4RW6B 2DGUA 1DQ8A 3RBDA 4KAIA 1X0FA 2FUG9 3WC0A 1ALHA 7FD1A 3R1HA 4TVAB 2HYIB 1Q1KA 2EWHA 3QO9B 2RQ4A 5KTQA 2K3IA 4WYLA 4CLKA 1JLAB 1Y10A 5GADI 2AIRB 5HJYA 2W9CB 1ZM2A 4R8UA 1D0EA 3CMRA 3DRPA 2YY3A 4CLPA 4U95A 3CMES 2LQJA 4ECVA 1T9YA 2C2MB 3DLEB 4X4UA 3R27A 2VG5A 4RJVA 3CD0A 4ID8A 2X7IA 4PG5A 1ALJA 5K14B 5B09A 3C14B 4N8NA 3E2DA 3BSOA 3L9ZA 1URBA 2JLEA 4DFPA 3ILOA 4MKVA 3PCOB 1RWOB 3HFVA 1F9EB 2AW0A 2Z56B 3MHYA 1E3CP 2LDYA 4R5PA 4P2MA 5D8HB 4RNNA 1HYSB 1ZPWX 1SL2A 4QYZJ 2JEIA 3B8HA 3Q8QB 4C8ZA 2QLFB 4GVLA 3T19A 2DISA 2GJ2A 1XNRJ 1MSWD 5A76A 3FRYA 4KJIA 1RTHB 1YRUA 3W5XA 1Z2LA 3I4HX 1X5TA 3PIOQ 5I3UA 2GSNA 4ZVRB 2UUWA 3OXGA 1U1OA 2AWZA 4NASA 1RXOB 3U02A 1S72S 5K8OA 2AYEA 4V1Ak 3OBIA 4B3MJ 3MMBA 1OY9A 3D1OA 1JLEA 2XG8A 3BPSP 1WWHA 2FHKA 4FYVB 4MIAA 4QZVB 3MFIA 1MROB 5HQLA 2ZE2A 4KJGA 1H38A 3WC2A 5C7PA 3LF0A 1DY3A 3GFXA 4KC5A 4NLTA 2YKNB 5T7LB 3IM8A 4P2XA 5GADU 4IG3B 4XTTA 1UKUA 2IMOA 4ZPWR 2P6SA 4MT1A 3M8SA 1EETB 1RHKB 2R4FA 5KG3A 2AT1B 4D3HA 4EO6A 1UFWA 1ROFA 3D2WA 4OYZA 3UCUP 4DQPA 1AJAA 1DAXA 1N6QA 3KLEB 3MPDA 2KU7A 4ILMA 5HVGA 1F5AA
chains in the Genus database with same CATH topology
1ZEFA 3DYCA 1E33P 2W5WA 2W5SA 3TG0A 1EJJA 2W5VA 1E1ZP 1ELXA 1KHLA 3BDGA 4GTYA 4GTXA 1EQJA 3A52A 2GLQA 2W5QA 3NKPA 5C66A 3IGZB 5DLWA 3T01A 5LQQA 5IJSA 5DLVA 2W8SA 4CYRA 1ANIA 1AUKA 1ZEBA 1URAA 5INHA 4LR7A 4N7TA 1EW9A 4MHXA 4NWXA 4LREA 1AJCA 1FSUA 4CXSA 3DPCA 1SHQA 2IUCB 2ZKTA 5AJ9A 5HRTA 3BDHA 3M8ZA 4UPLA 4CYSA 3UNYA 1KH4A 3NKRA 3ED4A 1AJBA 4LRFA 4LRAA 5GOVA 3LXQA 1ELZA 2W8DA 2RH6A 4LRDA 1B8JA 1ED9A 4KM4A 4QAXA 4NWJA 3UN2A 4ZG7A 3WAVA 1KH7A 3SZYA 1ALHA 5IJQA 4UPKA 4CXUA 3MK0A 2ANHA 2IUCA 1EW8A 3TX0A 1ZEDA 2GA3A 3WAXA 4ZG6A 3M8WA 3CMRA 1Y6VA 3UO0A 3WAWA 5DLTA 5L0BA 5EGHA 5EGEA 1EW2A 4UORA 1Y7AA 4UOPA 1EI6A 4B56A 1ALJA 3NVLA 4YR1A 5LRMA 3E2DA 3TWZA 4UPIA 1O99A 1URBA 4GTZA 1ALKA 1O98A 1KH5A 4ZG9A 3OT9A 5L0EA 1E3CP 2D1GA 1ELYA 2X98A 4LRBA 3KD8A 4KAVA 1KH9A 1HJKA 1HQAA 3UN5A 3NKMA 2QZUA 3BDFA 5KXAA 5L0KA 1ANJA 4MY4A 2XR9A 1K7HA 2W5RA 1KHKA 2W5TA 4KJDA 3WBHA 3NKOA 3SZZA 2W5XA 4FDIA 4UOOA 3Q3QA 2GSNA 1N2LA 4MIVA 5GRRA 3M7VA 3NKNA 2GSUA 2VQRA 2XRGA 4KAYA 3NKQA 1HDHA 1P49A 3MK1A 4GTWA 4UPHA 4CXKA 1AJDA 3M8YA 3T00A 4LR2A 1ED8A 1KHNA 4LQYA 3BDGB 4KJGA 1ALIA 4LR9A 5K4PA 1N2KA 3IDDA 1E2SP 2G9YA 2IFYA 4TN0A 3WAYA 3IGYB 4ZGAA 5LIAA 2GSOA 1AJAA 3UN3A 3T02A 5TJ3A 4LR8A 5LRNA 1SHNA 3B5QA 1KHJA 3MK2A 4LRCA 4FDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEF A;  3DYC A;  1E33 P;  2W5W A;  2W5S A;  3TG0 A;  1EJJ A;  2W5V A;  1E1Z P;  1ELX A;  1KHL A;  3BDG A;  4GTY A;  4GTX A;  1EQJ A;  3A52 A;  2GLQ A;  2W5Q A;  3NKP A;  5C66 A;  3IGZ B;  5DLW A;  3T01 A;  5LQQ A;  5IJS A;  5DLV A;  2W8S A;  4CYR A;  1ANI A;  1AUK A;  1ZEB A;  1URA A;  5INH A;  4LR7 A;  4N7T A;  1EW9 A;  4MHX A;  4NWX A;  4LRE A;  1AJC A;  1FSU A;  4CXS A;  3DPC A;  1SHQ A;  2IUC B;  2ZKT A;  5AJ9 A;  5HRT A;  3BDH A;  3M8Z A;  4UPL A;  4CYS A;  3UNY A;  1KH4 A;  3NKR A;  3ED4 A;  1AJB A;  4LRF A;  4LRA A;  5GOV A;  3LXQ A;  1ELZ A;  2W8D A;  2RH6 A;  4LRD A;  1B8J A;  1ED9 A;  4KM4 A;  4QAX A;  4NWJ A;  3UN2 A;  4ZG7 A;  3WAV A;  1KH7 A;  3SZY A;  1ALH A;  5IJQ A;  4UPK A;  4CXU A;  3MK0 A;  2ANH A;  2IUC A;  1EW8 A;  3TX0 A;  1ZED A;  2GA3 A;  3WAX A;  4ZG6 A;  3M8W A;  3CMR A;  1Y6V A;  3UO0 A;  3WAW A;  5DLT A;  5L0B A;  5EGH A;  5EGE A;  1EW2 A;  4UOR A;  1Y7A A;  4UOP A;  1EI6 A;  4B56 A;  1ALJ A;  3NVL A;  4YR1 A;  5LRM A;  3E2D A;  3TWZ A;  4UPI A;  1O99 A;  1URB A;  4GTZ A;  1ALK A;  1O98 A;  1KH5 A;  4ZG9 A;  3OT9 A;  5L0E A;  1E3C P;  2D1G A;  1ELY A;  2X98 A;  4LRB A;  3KD8 A;  4KAV A;  1KH9 A;  1HJK A;  1HQA A;  3UN5 A;  3NKM A;  2QZU A;  3BDF A;  5KXA A;  5L0K A;  1ANJ A;  4MY4 A;  2XR9 A;  1K7H A;  2W5R A;  1KHK A;  2W5T A;  4KJD A;  3WBH A;  3NKO A;  3SZZ A;  2W5X A;  4FDI A;  4UOO A;  3Q3Q A;  2GSN A;  1N2L A;  4MIV A;  5GRR A;  3M7V A;  3NKN A;  2GSU A;  2VQR A;  2XRG A;  4KAY A;  3NKQ A;  1HDH A;  1P49 A;  3MK1 A;  4GTW A;  4UPH A;  4CXK A;  1AJD A;  3M8Y A;  3T00 A;  4LR2 A;  1ED8 A;  1KHN A;  4LQY A;  3BDG B;  4KJG A;  1ALI A;  4LR9 A;  5K4P A;  1N2K A;  3IDD A;  1E2S P;  2G9Y A;  2IFY A;  4TN0 A;  3WAY A;  3IGY B;  4ZGA A;  5LIA A;  2GSO A;  1AJA A;  3UN3 A;  3T02 A;  5TJ3 A;  4LR8 A;  5LRN A;  1SHN A;  3B5Q A;  1KHJ A;  3MK2 A;  4LRC A;  4FDJ A; 
#chains in the Genus database with same CATH topology
 4LIW A;  2QMW A;  3BBB A;  3OLA A;  3H4B A;  1Q16 B;  3BH6 B;  1YJN S;  3ENA A;  1UP1 A;  1WNE A;  3GQC A;  2CQ4 A;  1EJ7 L;  1S7H A;  3GFH A;  3BDE A;  2EG1 A;  1GXT A;  1FK9 B;  3R5G A;  1PC5 A;  2W2M P;  2QC3 A;  2HNY A;  2JRS A;  4KGV B;  1CSJ A;  2YNI A;  4UOG A;  2O66 A;  1JXL A;  2CQH A;  2OD4 A;  1LWF B;  2QYG A;  4OYP A;  2AYM A;  4TKT A;  3M9N B;  3DLH A;  3M1V A;  2DIT A;  2PC6 A;  1RDR A;  5L38 A;  4B3R J;  1B64 A;  5AJ3 F;  4CZC A;  2MQO A;  1N8R T;  1KVI A;  2H3E B;  3TW0 A;  4NLD A;  3EGZ A;  2ZDO A;  4WFY A;  1WI6 A;  4ECT A;  1B7F A;  3OTC A;  1S0N A;  2R8K A;  4XAK A;  3NS7 B;  3QZ7 A;  2IM2 A;  2N4D A;  1YTY A;  4DL4 A;  1ZEB A;  3WIU A;  3JSM A;  1PAE X;  1CUL A;  2KVI A;  4ED8 A;  1S59 A;  5I3P A;  4QIW D;  1FWP A;  2X1F A;  3I55 S;  1T9V A;  1EX8 A;  4C3M A;  3DLJ A;  4JI1 F;  4CYS A;  1RHU B;  1F0X A;  1SPB P;  2CPY A;  4LF8 F;  3D1H A;  3UDV A;  4K4W A;  5KG6 A;  1CC7 A;  2CG4 A;  2XSJ B;  4C97 A;  3IN5 A;  2J8A A;  3PJW A;  1GX6 A;  3GJR B;  1VQS A;  2VBX A;  3W2W A;  4O3R A;  1ELZ A;  4WFA Q;  3OFE A;  5ETT A;  4IRC A;  1IBK F;  1T9X A;  3QRR A;  3RW6 A;  4OYI A;  3R5J B;  4DF4 A;  1XBW A;  2DEJ A;  2WHO A;  1JLB A;  3ISN C;  1XR7 A;  1WKJ A;  2HNZ B;  1JXV A;  1FES A;  4LBP A;  3UFC X;  5BYR A;  2MYF A;  5LMN F;  2VA3 A;  1NK8 A;  3T1Y J;  1J5E J;  4OV1 A;  4DPX A;  4DR6 F;  4NOH A;  1KH7 A;  2E44 A;  2QLJ B;  1TK0 A;  1RP5 A;  2HRY A;  1HI1 A;  4H4K A;  2C3Y A;  2ZD1 A;  5LXR A;  3J81 Y;  2W8K A;  2IA6 A;  2KTQ A;  4LUB A;  5L1K A;  4IQX A;  3IG1 B;  2VU5 A;  2PT0 A;  2FDN A;  2P5V A;  4ZPB A;  3VAL A;  3ENV A;  2UXC J;  1FNM A;  1QUP A;  2DNK A;  1NBE B;  4F3M A;  5K8P A;  4HKQ A;  3I5A A;  5FJ4 A;  3BRE A;  4M5M A;  5D78 A;  1PJ7 A;  4EI2 A;  5DLT A;  3ZZ0 A;  1FKP A;  2FC9 A;  2ATC B;  2D3O 1;  4B9L A;  1Q8I A;  2M9K A;  2BEF A;  4J7C A;  1N5T A;  3R9L A;  4ELV A;  2FLP A;  4IFY A;  1OS5 A;  1HL6 A;  4MIB A;  3U1N A;  2EPI A;  3W2V A;  2HLT A;  2RRN A;  1NU4 A;  2ZDP A;  1MG7 A;  3M6V A;  4OLP A;  4O3Q A;  2AGO A;  4LIR A;  2RIL A;  1V9O A;  1N5Y A;  1HWU A;  1NH8 A;  5F41 A;  1JLA A;  3MCN A;  4OHX A;  1JNZ B;  1JXE A;  5HN0 A;  2B5J B;  2BUN A;  2NYI A;  1AYE A;  3M2R B;  4I4B A;  4KFB A;  2YQ0 A;  1NME B;  2XMA A;  2WSC C;  1DRZ A;  4IDK B;  2CRL A;  4LJM A;  3UN5 A;  5HBM A;  3KYL A;  2QZU A;  2DNZ A;  1N54 B;  1ZZF A;  2VPZ B;  2FY8 A;  4P52 A;  1RHR B;  5E3C A;  4DPO A;  5KOX A;  4IRK A;  1RBO B;  3HO1 A;  4USH A;  1TFY A;  2R7V A;  4ZP9 A;  3SIP B;  2BW2 A;  3OFG A;  4LQ9 A;  4RNM A;  1NJW A;  1NB2 A;  2EKY A;  3HKW A;  3G8Q A;  3PKY A;  3I96 A;  3GB0 A;  2OIH A;  4L76 A;  1RWN B;  2HVZ A;  2NPI A;  4RW4 A;  4TYB A;  2FJV A;  1L3K A;  3D6M B;  3JQM A;  5KFJ A;  3HCX A;  3QGP A;  4CTA B;  1ZM4 A;  5C42 A;  2E5L F;  2IYG A;  1BY9 A;  1FI4 A;  4NYO A;  1S0M A;  4JV5 F;  2V4J B;  2ZC3 A;  1IQZ A;  4UPH A;  4MYT A;  3N28 A;  3KHH A;  1FF2 A;  4X62 J;  2VOO A;  3JB9 k;  3W2W B;  2QLW A;  1H3D A;  2XHW A;  3WAY A;  3W9H A;  4GKK J;  1QM9 A;  2A2D A;  4G1I A;  1X9M A;  1I6J A;  3NRB A;  2JVR A;  3TZZ A;  2GHV C;  4N8O A;  2ZC4 A;  1VIO A;  2XYH B;  5KG1 A;  3DRY A;  4AT1 B;  1SHN A;  2F8M A;  2MST A;  2VV5 A;  4UZB A;  2V8G A;  1ZEF A;  4LSN B;  4YB5 A;  5DS7 A;  3OUY A;  5D4N A;  3KHR A;  3HHK A;  4DR6 J;  1PKU A;  2E9T A;  3AXM A;  5KT5 A;  2D9O A;  4YR3 A;  3RRH A;  4NXN F;  3CNQ P;  3D6F B;  3FVY A;  1NDL A;  2YX1 A;  3DLK A;  1REG X;  3GLJ A;  3TAM B;  3TYT A;  3EDR B;  3WZ0 A;  2V4Q A;  3A52 A;  4LFA J;  1PC4 A;  5D0R A;  2V2V A;  1FKP B;  4ETZ A;  4EFA C;  5KFA A;  3PVX A;  1HNV B;  4AQY J;  2OTJ S;  5CYJ A;  2Z4P A;  2UUA J;  4OX7 A;  3DLB A;  5E33 A;  4OJ3 A;  3R7N B;  3M6X A;  1IBM J;  3IG1 A;  1RI7 A;  3IXQ A;  4FN5 A;  1Q8B A;  4HHH A;  4HDH A;  4PXD A;  3KLG B;  1DTT B;  4NML A;  4J91 A;  1R31 A;  1A9N B;  4M5N A;  3MTK A;  3R6L B;  4ZLJ A;  3SFU A;  4JI3 F;  2FVQ A;  1IM6 A;  1C0U A;  5KG5 A;  2AZ1 A;  2ZHO A;  4LSZ B;  2IAJ B;  2CPX A;  4DUZ J;  1S7I A;  3PJX A;  2G2Z A;  5DET A;  2HHV A;  4KQZ A;  4USV A;  2AJ1 A;  3ED4 A;  5KFD A;  2XCA A;  3H2V E;  5K9F A;  3S6E A;  2OPS B;  4HI2 A;  2NPF A;  4ED1 A;  4AXJ A;  4YME A;  4DV3 J;  5ETM A;  2X1G A;  2CPF A;  4EZ9 A;  1FO1 A;  2F8H A;  3HVT B;  1FNX H;  4AND A;  5DZ6 A;  4AFF A;  3TA0 A;  1IKX B;  3UVJ A;  5M2U A;  4TLQ A;  5F9N A;  2N82 B;  1I94 F;  1DTT A;  3FBF A;  4MYU A;  4ZP6 A;  4NRT A;  4DS4 A;  3PO5 A;  2VC1 A;  5KG4 A;  3R2C J;  1WOP A;  4QQB A;  3RG6 A;  2C3U A;  4C4W A;  1X4G A;  3PZP A;  1YDL A;  4HEA 9;  4CXU A;  4U7C A;  1RKJ A;  1N0V C;  5D4P A;  2WW8 A;  5J1E B;  2UVU A;  3CC4 S;  2R7T A;  1JKH A;  1NKC A;  1RA7 A;  2CNL B;  1E6V A;  3SV3 A;  2FZC B;  3TAM A;  4P2F A;  2NRE A;  1D9A A;  4ED3 A;  3N5B A;  2GFF A;  4O0I A;  2XO7 A;  1GK8 A;  1FTC A;  1SB6 A;  3GON A;  1HQE B;  4QWC A;  4JYA F;  5HRO A;  1FK9 A;  3NXZ A;  4FS1 A;  4YR1 A;  1S6Q A;  3NGS A;  3TA1 A;  1FXR A;  3OPK A;  1BE4 A;  2KRR A;  2VDI A;  3UDC A;  1KH5 A;  1H2T Z;  1APS A;  3I0R A;  2ACY A;  2HGM A;  4YEA A;  5ETO A;  3ZC4 A;  5FLX U;  4HI1 A;  4CI0 B;  4M8L A;  1QAY A;  4O44 A;  4LRB A;  5B0A A;  2G0J A;  1F6T A;  4F4K A;  4OX8 A;  1IJE B;  5EWE A;  2E29 A;  3M4X A;  1K7H A;  4KJD A;  1VC5 A;  1NZA A;  4KRW A;  1LW0 A;  4J9L A;  3N0V A;  4MH8 A;  2Q3P A;  4I2P B;  4C8O A;  4QW9 A;  2VJU A;  2W5X A;  1CQM A;  1UET A;  3TZY A;  2SXL A;  3M6U A;  2H48 B;  5KFN A;  1HPZ A;  2BYC A;  2F40 A;  2MPU A;  2CJQ A;  3CCR S;  4M94 A;  1IVZ A;  4MIV A;  2HFN A;  2O01 C;  3N79 A;  4WFZ A;  4ZN1 A;  1NK7 A;  5L9X A;  1Y5N B;  4BBY A;  2ZVI A;  3FFI A;  2VQR A;  5J2M B;  3W63 A;  1FEH A;  5DDO C;  1YJU A;  3H4D A;  1K1Q A;  1HPZ B;  3R5B A;  4DOZ A;  1SH2 A;  3BDG B;  5D15 A;  3N01 A;  4CTA A;  3F41 A;  5C42 B;  3QLH A;  2OJ3 A;  1YX2 A;  3TEG A;  2UUC J;  4NXM J;  2MKJ A;  4CQ1 A;  2KXN B;  2XS5 A;  1N2K A;  2VA2 A;  3FJ2 A;  1B0P A;  2ZH5 A;  3OVB A;  2GMH A;  2OFG X;  2F9J A;  2RE1 A;  2VBY A;  1U6Z A;  3UN3 A;  4FNH A;  3ZTS A;  2VFV A;  4NL5 A;  3HM9 A;  1VK8 A;  4HYK A;  3QIP A;  3FQL A;  3B5Q A;  2PEB A;  2YWH A;  1AUD A;  2UVW A;  2F1F A;  2KXF A;  2LA4 A;  1F5B A;  3C66 A;  3NBP B;  4HT5 A;  2R8H A;  2EC0 A;  3DYC A;  2LEC A;  1WG4 A;  2W4P A;  3MR7 A;  3PRD A;  3GJQ B;  3RU0 A;  2V5H G;  2W2N P;  4EEY A;  5HQ8 A;  2MGZ B;  4FF2 A;  2OML A;  3RW7 A;  5ETN A;  2DK2 A;  2O5D A;  2J7K A;  4JV0 A;  4OI0 A;  1FJG F;  3DDK A;  1N5Y B;  2QA2 A;  1HD1 A;  1W26 A;  1LOU A;  1V3S A;  1W7W A;  5KT6 A;  2WTF A;  4WZQ A;  2OMO A;  5AE1 A;  4IFY B;  5L46 A;  1B0V A;  4PAB A;  1YVF A;  1CJK A;  1WF2 A;  4M5D A;  2QA4 S;  3V6D A;  4BS2 A;  1RAB B;  4HDG A;  4ECX A;  2XO6 A;  2ZNZ A;  3K8V A;  2XZW A;  5A6P A;  2CPH A;  4IOB A;  1HNW F;  3NMR A;  5HK4 A;  2A6M A;  1GMU A;  1Y00 A;  1DLO A;  2RU9 A;  2CDR B;  3DC2 A;  1IKY B;  1YLX A;  2OPP A;  1IWA A;  3QLH B;  1XC9 A;  4NCG B;  3GIM A;  4CXS A;  4NLP A;  4RW6 A;  3LWM A;  3G71 S;  3TI0 A;  4OYA A;  4K0K J;  4URS A;  3SCI E;  3KJQ B;  2PN6 A;  1SH3 A;  2KHD A;  2AGP A;  1S57 A;  4NEY A;  2IVF B;  3UR0 A;  3BO3 A;  3HVR A;  2VFR A;  2ZKU A;  1GTH A;  4I7F B;  4NI2 A;  1M5V C;  1NHU A;  2B4P A;  3OFH A;  1KEK A;  3NY0 A;  4DV1 F;  4URG A;  1GMW D;  1QJH A;  2D69 A;  5DDP C;  2XTJ P;  3ILL A;  4PG4 A;  3AOC A;  1WTF A;  3M9O B;  2R2R A;  1CQN A;  5LL6 d;  1Q78 A;  3JTO A;  3MR3 A;  1X4D A;  5F8N A;  1ED9 A;  3DOL B;  3GV5 B;  3C6T B;  4DR2 F;  2DXF A;  1T3O A;  2IAJ A;  2MKK A;  1IXK A;  3V4I B;  3FZ2 A;  2JOQ A;  3DYA B;  3V5R A;  1HNI A;  5J2N B;  3ADA C;  3I5B A;  2PFD A;  4CP5 A;  3KLH B;  1FDN A;  4MMO A;  2YH0 A;  3AHP A;  2QA4 G;  1SKU B;  3GYN A;  3H7H B;  3K89 A;  3KJF B;  3KMS A;  3UWT A;  1VQM S;  1YI2 S;  1UA1 A;  2NR0 A;  1ZTT A;  1QY7 A;  2YNH A;  3TAP A;  1WG5 A;  4KHP F;  3ENQ A;  3DGP A;  4LT6 A;  4A8O A;  1DQ9 A;  2P8I A;  1ELO A;  2BZ2 A;  2JJ4 D;  2ZBC A;  3OR2 A;  4DZ6 A;  3JSM B;  5HRO B;  2XI2 A;  1F2G A;  4ES3 A;  3NOG A;  4ZK7 M;  1SJQ A;  2MKS A;  3Q8V A;  4ZLL A;  2ZH6 A;  4N76 A;  3MEK A;  2F4F A;  4ELU A;  2J0S D;  2JVO A;  2VHG A;  2VL1 A;  1OPZ A;  4NLG A;  4RW8 B;  3MUM P;  4KB7 A;  1R8B A;  3IWN C;  2VQF J;  2V34 A;  2L9D A;  1LWF A;  1RAH B;  3OR1 A;  3Q8U A;  5J1E A;  2Y1J A;  1N6Q B;  1QSS A;  2RHQ B;  5AT1 B;  3KDO A;  3MGJ A;  4YQW A;  3ZNU A;  3FQK A;  3HHL C;  3T5L A;  1IBL F;  3DFE A;  4B9S A;  3NNC A;  3PW4 A;  2J76 E;  3BS9 A;  1G6B A;  2HFZ A;  2ZIT A;  2JEJ A;  4DN0 A;  4UUX A;  2FLN A;  4Q0B A;  4JI1 J;  2W5R A;  3QJP A;  4NCA A;  3KLE A;  3UD4 P;  3MXH P;  1L3V A;  2WVE A;  4CLT A;  1UL3 A;  3TJ8 A;  2NUH A;  2QE5 A;  2J6S A;  2QIF A;  3MPV A;  1FX4 A;  2M88 A;  3SBM A;  2W8L A;  1RAC B;  4E8U A;  3J7A 1;  3MCO A;  1YBT A;  4P6Q A;  2KZZ A;  4NI2 B;  4OX9 F;  5D3G B;  4LR2 A;  5IV3 A;  4PQU B;  1YBA A;  3L3C A;  3FBC A;  3JAM U;  1EQM A;  1FWK A;  3DDI A;  3LOU A;  1LK7 A;  1DTQ B;  3MPY A;  3ISN D;  2X1B A;  3HUL A;  1MLA A;  4TQS A;  2CVI A;  2B4U A;  4OMF G;  3H59 A;  4O4G A;  4CNZ A;  2PI5 A;  1T9W A;  4UTG A;  1G2E A;  3F56 A;  1E6Y B;  3Q8R B;  3LPY A;  4LRC A;  3QJL A;  2G2Y A;  3QJJ A;  3CTR A;  2KFZ A;  2ATL A;  3B4D A;  1A7G E;  1CS4 B;  4XIU A;  2DYA A;  4HHJ A;  2ERR A;  2OPQ B;  4PUO B;  1EJJ A;  1KKH A;  3G82 A;  3R1L A;  3LH2 S;  2HS0 A;  2VG6 B;  3PX4 A;  1BWV A;  4ZJQ A;  1E1Z P;  2XS7 A;  4MK7 A;  4FXW A;  3UD3 P;  2XHC A;  1W2I A;  2QGF B;  4F26 A;  3EGV A;  1C1B A;  4ATN A;  2FC8 A;  3POT B;  2ACM A;  3VAK A;  1C4A A;  1V5V A;  4ECQ A;  2ZBR A;  3MOJ B;  2R7X A;  2LDI A;  2MLZ A;  1REV B;  4WKY A;  3PW7 A;  1G3O A;  2VG5 B;  3FCW A;  1R8C A;  1YJV A;  3RJM B;  4JI7 J;  4RL1 A;  4DV4 J;  2RML A;  1BQN B;  5ETQ A;  5U47 A;  3NBP A;  3RAM A;  1PBA A;  2HUR A;  4B3M F;  2F63 A;  4DV6 F;  5DLV A;  3GWC A;  4CYU A;  1S76 D;  1TKT A;  4DDF A;  4DSL A;  2ZH8 A;  1JB0 C;  4N7T A;  4U8Y A;  2HMI B;  4F0M A;  1VQ5 S;  2H5E A;  3MFH A;  4GVB B;  3Q8Y A;  1K73 T;  3MM9 A;  2DHS A;  3MR5 A;  3NLC A;  5AJ9 A;  1TV6 B;  2WVC A;  2HBY B;  1P6T A;  4UPL A;  2QN6 B;  4Y65 A;  4AQY F;  3D68 A;  1X5P A;  1ZAV A;  3P45 B;  1AJB A;  1S6P A;  2CUY A;  2MHE A;  3EWG A;  2ZUA A;  1WSV A;  4C0H A;  2BAC A;  1IBM F;  3LXQ A;  2GHP A;  2MDA A;  2C3M A;  3L4B C;  2N3L A;  2A2C A;  5FII A;  1X5O A;  4ANE A;  2XGQ A;  3KK1 B;  4GKK F;  3LAK A;  1RT5 B;  1F3V A;  5HVH A;  1GFW B;  3LW5 C;  1FEE A;  4FF4 A;  4KM4 A;  3TAR A;  2DGT A;  4F25 A;  5FDL B;  3MEG B;  1LW0 B;  4PWU A;  4CNY A;  1QTM A;  3QWU A;  2CQC A;  1WDT A;  2ROP A;  3THV A;  3AAW B;  4KY3 A;  5AXN A;  2LEB A;  2IUC A;  4ZLP A;  1LK5 A;  4L75 A;  4Z37 A;  4LBH A;  2HGL A;  2OEM A;  4ZG6 A;  1KQS R;  4J9K A;  3MEE B;  2BV3 A;  2DNM A;  4CWB A;  1VK3 A;  1P8G A;  2DIV A;  3HHL A;  4A48 A;  5HAO A;  2WRM A;  1XMB A;  1RYS A;  2BVZ A;  2ABY A;  3Q89 A;  5GAE U;  3GG1 A;  2W7P A;  3EZO A;  3I82 A;  5EGH A;  4U8V A;  2ILZ A;  5KG7 A;  1JJ2 R;  1QLN A;  2MQL A;  2DT9 A;  2XZT B;  3DI6 B;  4FYW B;  4QU6 A;  5IT0 A;  4A8Q A;  1X7V A;  4B56 A;  3FBE A;  2YKO A;  2HKE A;  1WKL A;  1VQ7 S;  3G6E S;  1R7I A;  1BC6 A;  4J9P A;  1Q82 T;  1WC0 A;  3CJS A;  3PO4 A;  1Q4R A;  1N32 J;  3H5X A;  1U0S A;  4ER8 A;  1RCO B;  3AT1 B;  1U2F A;  2DHX A;  1AB8 A;  2F7V A;  1IJF B;  5A6W A;  2DO0 A;  2IC3 B;  4L6V 3;  2EFV A;  2HNZ A;  4PYD A;  1UVL A;  4DV1 J;  1FRH A;  2W5T A;  1VQ8 S;  3IO1 A;  4I6W A;  1XTZ A;  1N5Q A;  1UWB B;  1ZM3 A;  5C24 A;  4Y00 A;  4BHQ A;  5KFM A;  3T3F A;  5E3A A;  2FVP A;  2ZJR Q;  5MAO A;  2MY8 A;  3FUY A;  3L09 A;  2VQE J;  3C46 A;  1DFD A;  1X8D A;  2DKO B;  2VPW B;  3C8Y A;  3W8G A;  4CO1 A;  2EEY A;  2NLW A;  4JI6 F;  1U47 A;  2LYV A;  4P10 A;  7AT1 B;  2Z2L A;  2XS2 A;  4KAY A;  2RS8 A;  1P49 A;  1NDK A;  1T9U A;  4Q43 A;  4X66 J;  1EAR A;  1JLQ A;  3FEY B;  5G0R B;  3W9J A;  2JEF A;  5I3U B;  1RWK B;  3GP9 A;  2VAS A;  5K4P A;  3SQG B;  1FNO A;  2FGC A;  1Y3K A;  4O23 A;  4OLO A;  4AD6 A;  1U6B A;  1E2S P;  5J2Q A;  4BWJ A;  2WZ1 A;  3GV8 B;  1TK5 A;  2B43 A;  2GML A;  4KSE B;  1UAW A;  4CRJ A;  2VIC A;  1RTI B;  2LVW A;  4RNO A;  3M05 A;  1VI7 A;  1GX5 A;  2HVE A;  5TJ3 A;  2H1Y A;  4NYZ A;  2IPO B;  2JFK A;  3DNC A;  4Z7Y A;  3MEG A;  4ZLN A;  4QU7 A;  3D28 A;  4NCB A;  1KLN A;  5IOL A;  2M0G B;  5HAT A;  1YBU A;  3ZZP A;  2EFN A;  2DGS A;  1E33 P;  1Y7A A;  3MD3 A;  4EMD A;  4JOU A;  2W5V A;  1ELX A;  4F04 B;  1UVI A;  4RNF A;  3T5J A;  1HNV A;  4GTY A;  4CLY A;  2RT3 A;  4GO7 X;  5K14 A;  3QID A;  4DR1 J;  3HZG A;  3PAC A;  2VPY B;  4A8W A;  1PO6 A;  1QAJ A;  1WI8 A;  2ALY B;  2RVJ A;  3FSX A;  3MOZ A;  1S1X B;  3QGH A;  4HL9 A;  1JLF A;  2MQN A;  4OZJ A;  4HVZ A;  4RW9 B;  2K3K A;  3ZXW A;  1T05 B;  4Y2M A;  3JYT B;  2QMX A;  1P1L A;  2PO4 A;  3CDU A;  5KFT A;  3W3S A;  1S49 A;  1RYR A;  2YWK A;  2CZ9 A;  3TEH B;  3EX7 B;  1RK8 A;  5AJ3 J;  5IM0 B;  1DJ0 A;  2WB4 A;  2IFY A;  2FVC A;  4WFX A;  1OIA A;  3ET6 A;  4BDP A;  1XJW B;  1NO8 A;  1AUK A;  1U0H B;  4JYA J;  1RGV A;  3CB4 A;  3GR0 A;  1U02 A;  5DG7 A;  3ULH A;  1N32 F;  5IT4 A;  4JI7 F;  4CM2 A;  2CJB A;  2EFP A;  5K5M A;  1KBR A;  5LXY A;  3BSN A;  1S0O A;  4AE5 A;  2DRA A;  4DLG A;  1BQM B;  2HFU A;  1KH4 A;  1LWC A;  4O3N A;  4EBD A;  2GVD A;  4KHR A;  3HHL D;  2JL9 A;  3BYR A;  4N47 A;  4NMX A;  5KFC A;  3PW2 A;  1TUV A;  2GMJ A;  2C28 A;  4O3S A;  5L39 A;  2W4C A;  4Z7C A;  2RD5 C;  3MM8 B;  5DM6 Q;  2CAJ A;  3G86 A;  1CC8 A;  1R0B G;  2BJ8 A;  5CYQ A;  3W60 A;  4E98 A;  1F5C A;  3NNH A;  3ILJ A;  4XDC A;  3JXO A;  3GYX B;  2HQC A;  3TZW A;  1MWY A;  3LGN A;  3G87 A;  4PYA A;  3T6J A;  4WE1 A;  4KHM A;  4A8X A;  1RWM B;  1TKZ B;  2I1R A;  2MZR A;  2RDD A;  3SCL E;  4X66 F;  4DUY F;  4GC7 A;  4KKO A;  1K9M T;  3BKU A;  1J5E F;  3P6Y C;  3KDN A;  3NCP A;  2V2Z A;  2ZZT A;  3CMA S;  1U1K A;  3GSI A;  4CO2 A;  5K8M A;  1JWW A;  2J7U A;  4QIE A;  3K57 A;  4DLE A;  2GA3 A;  2WK4 A;  2FJE B;  2G1H A;  1GT8 A;  4KH0 B;  4TXS A;  1TKX A;  1XMQ F;  1SKS A;  3R5D A;  1N36 J;  2AYG A;  3LQV A;  4J5O A;  4YY3 J;  4NXM F;  2UXC F;  5D3G A;  2R7W A;  4CXK A;  1SJ1 A;  1TFW A;  1S9E B;  1BMQ B;  2KHC A;  3D67 A;  4DUT A;  2FLL A;  3KMQ A;  2GA7 A;  3S8S A;  3BBC A;  5KG0 A;  4DS5 A;  3AD8 C;  1EI6 A;  2CZV C;  3MCM A;  5CXT A;  2RF2 B;  1I94 J;  2M3D A;  1VRU A;  2OUG A;  3IMQ J;  2BW7 A;  4K4Z A;  3CJK A;  4OZ0 A;  3GYG A;  2XY7 A;  3BQ0 A;  5HO4 A;  2ZH7 A;  1ITP A;  1RAI B;  2QFI A;  4I56 A;  3P49 B;  5L0K A;  1IKW A;  2G2O A;  2WOM A;  2YBV A;  2EVZ A;  3CGI A;  3ET6 B;  1M5H A;  5GMD A;  4DPU A;  5EWG A;  1RWW B;  2VFT A;  3JTN A;  3CE8 A;  1R8P A;  2H4Y B;  3SZ2 A;  2GHW A;  5AXK A;  1U4B A;  4W4M A;  5DGB A;  4JI3 J;  2E5H A;  3E2E A;  4M1K A;  4OI2 A;  1U1L A;  2R7S A;  3H2U B;  3BKF A;  4I68 A;  1IBL J;  3NKQ A;  1HR0 F;  1RAG B;  3T00 A;  3AJ2 A;  2YVS A;  3UCZ P;  4LQY A;  1UMJ A;  2KYX A;  4M63 A;  4F2S A;  4J9R A;  1MML A;  4X62 F;  3MK0 A;  4WCE Q;  3SSQ A;  4ZIT A;  2YNH B;  2GSO A;  1NND A;  4CM0 A;  3IAS 9;  1CJU B;  3T02 A;  4ZPD A;  2NQP A;  1Q7Y T;  2RSQ A;  4WF9 Q;  5L0B A;  2VJV A;  2X3G A;  4A47 A;  3AOB A;  1HQU A;  4PAA A;  2JH3 A;  3QGG A;  3VVU A;  1WD6 A;  2G9O A;  3ZZZ A;  4OX6 A;  2PMW A;  4M95 A;  4NLY A;  3LWL A;  3T1Y F;  5HP1 A;  2DCL A;  2BKN A;  2DCU B;  3VAF A;  1MW7 A;  2N7Y A;  3DRX A;  2EW9 A;  1VLY A;  4RUH A;  1Y4Z B;  1YG0 A;  2BJ1 A;  1JLG B;  2BJ7 A;  3QSI A;  4IH5 A;  2RIJ A;  4DR3 J;  2J8S A;  1R8A A;  4WU3 A;  1N56 A;  3DRR A;  3HMJ G;  4DL6 A;  3OSN A;  3F0N A;  4C9D A;  1NK4 A;  2VH7 A;  1FJ7 A;  3KK2 A;  1RU1 A;  3ZTQ A;  1MN7 A;  4OYB A;  4DV4 F;  2BAN B;  5LQQ A;  4N77 A;  4CT9 A;  5H9F J;  2GVZ A;  3MM6 A;  4ELT A;  1EP4 B;  2W2O P;  4F4W A;  1S48 A;  3CJK B;  4LR7 A;  2ZUG A;  1D9F A;  4LRE A;  3PDN A;  2PD1 A;  2DXD A;  3NAH A;  4ED4 A;  4Q45 A;  3EZ5 A;  3Q23 A;  2UXD J;  4FKY A;  2VQF F;  4X64 J;  3NCR A;  2R7O A;  3C16 B;  4ZIW A;  1C1C B;  4PG6 A;  1VHI A;  4JI8 F;  5J2P B;  2HQD A;  4K4T A;  3ZTR A;  2KJW A;  3T1H F;  3JTP A;  3IWX A;  2V8D A;  4ZPA A;  3HT3 A;  4B3R F;  5ETR A;  1JLE B;  3GPA A;  3M32 A;  3TVZ A;  1EQ0 A;  3IR7 B;  3GFZ A;  3H90 A;  3UPF A;  4ZG9 A;  4MIW A;  2OEK A;  4ENO A;  1S97 A;  3KLF B;  3MMC A;  1RHJ B;  1RIS A;  4LFC J;  4OI4 A;  1Q79 A;  4FKX A;  4X84 A;  2F8E X;  1Q0N A;  1TL3 A;  3J7Z 5;  2DNP A;  3UN2 A;  3LP1 B;  4OQJ A;  3ONQ A;  3J7Y U;  4ED0 A;  2CPJ A;  1RAO A;  5BR8 J;  3FEZ A;  4G1Q A;  2MTL A;  2H5J B;  3NGR A;  4H4K C;  5ETP A;  3PR5 B;  2LEA A;  1R0C B;  2ANH A;  5LMU F;  3BYP A;  4A4J A;  2NXN A;  5FDL A;  3TX0 A;  1VQ4 S;  4Y2I A;  3TR5 A;  2IVM A;  4C98 A;  1Y6V A;  2DR5 A;  2HQF A;  2MLY A;  2C2Z B;  2XC9 A;  4DV0 J;  3OL8 A;  1QVG R;  4ICL B;  1K0T A;  1TR0 A;  1ZM9 A;  3C14 A;  1KFS A;  3C3L A;  1BD6 A;  5EGE A;  2QA1 A;  2XMW A;  1RBA A;  3BZQ A;  3RBX A;  2QG9 B;  1R3N A;  1RLD A;  3H20 A;  4HAC B;  5KT3 A;  4UT4 A;  4YFU A;  4F4Y A;  1ULR A;  2D3O R;  1VBY A;  2GIF A;  4RW7 A;  2J6U A;  2AGQ A;  2AEJ A;  4M5K A;  1GMV A;  1HLW A;  3KWM A;  1U0H A;  4FNI A;  5HJX A;  4NWB A;  2WSF C;  1X4A A;  3CDW A;  5CCL A;  2W9C A;  4LF4 J;  2CQ3 A;  4MKA A;  4ECR A;  1I1G A;  2DH7 A;  2NS1 B;  3I0S B;  3MAA B;  3QO9 A;  2BOP A;  1ZAW A;  2FJA B;  3E3X A;  5L1J A;  1VMB A;  3SFG A;  2H5I B;  4QIV A;  3DM2 A;  2BA9 A;  5DQI A;  1U48 A;  4X2B A;  1N4L A;  2NSC A;  4TLR A;  1AXQ A;  1NZ8 A;  1YRT A;  2I8E A;  3MM5 A;  3PYG A;  4QPT A;  4CLU A;  2CYY A;  3I0S A;  1S1X A;  4F3Q A;  2JWN A;  3LP2 B;  4HR2 A;  1GQE A;  4WP8 A;  3AQP A;  3ZTP A;  4ERD A;  1YK9 A;  4F4Z A;  4C8L A;  5GRR A;  3M7V A;  5AE2 A;  4ZVH A;  3TZX A;  3MCS A;  4XDD A;  1HNX J;  3ZFV A;  4IO1 A;  2XRG A;  5GAH I;  1FVS A;  3BO4 A;  1S1U A;  2HVH A;  1Z1Z A;  1B4S A;  5B0F A;  3JQK A;  2RUG A;  3CCS S;  1IKV B;  1FKA F;  2C3O A;  2B9E A;  5E3R A;  4LF1 A;  1BUX A;  1U8S A;  1XIQ A;  2ZOG A;  3G8S A;  2ZH4 A;  3IA0 A;  1B3T A;  4WKR A;  2IM1 A;  2KYZ A;  1VQK S;  5KFO A;  4C0B A;  4B3O B;  4QPX A;  3LPE A;  3B82 A;  3IGY B;  4LF6 J;  3DU5 A;  4EO8 A;  4J9N A;  1U49 A;  5K8N A;  2XMV A;  3I4P A;  1YJW S;  3SQG A;  4NZ7 A;  4B3S J;  2RQM A;  2CJY B;  3P5T L;  1DTQ A;  5LSO A;  1J27 A;  1KLM B;  3MMA B;  1PAU B;  2C2O B;  4ZPC A;  4X4T A;  4I1T A;  2K1R A;  1V6H A;  1WHW A;  1YJT A;  3HT0 A;  3N6M A;  5HVF A;  3VWS A;  4CH7 A;  1HMV B;  1X4H A;  3SDE B;  1HBU B;  2XQC A;  4KE5 A;  1S0V A;  4K50 A;  4DUZ F;  1BGX T;  2AV5 A;  2QL9 B;  2LKZ A;  2I5J B;  1KVJ A;  5DRK A;  5IQQ A;  2WVD A;  3NKP A;  2HQG A;  4P7T A;  4RBV A;  1RZM A;  5C25 B;  1M1K T;  2FVS A;  5F8J A;  3VQS A;  4TU7 A;  2DGX A;  1NSK L;  5D0G A;  2DVI A;  4EZ6 A;  2RS2 A;  4U9R A;  2JDJ A;  2HHH J;  3EVM A;  4B3S F;  2FGO A;  5A8K B;  3RB6 A;  4ZVT B;  3NS6 A;  2ZHA A;  2J0Q D;  2FZK B;  1S1V B;  4YR0 A;  1FRI A;  3C16 A;  3FCV A;  4JV1 A;  1AUS L;  3X1L B;  5J1N A;  1RT4 B;  1RTD A;  1SJF A;  1HBM B;  3FDS A;  1MWQ A;  4U7U K;  2GCF A;  3T41 A;  1ZYQ A;  1X9S A;  2P9E A;  2ASY A;  3BDH A;  1RE1 B;  4L74 A;  4TY9 A;  3N4W A;  1I51 B;  2HHX A;  1YRX A;  1JLG A;  1FFW B;  2XSF A;  4B3T J;  3IGV A;  4I0W A;  4EK2 A;  4IRD A;  3IR5 B;  4DJB A;  3A8I A;  2MQP A;  3QT8 A;  2DRB A;  2UUA F;  3PR4 A;  1VBX A;  1KN6 A;  3CCZ A;  1T0T V;  1TVR B;  3DMJ B;  2WSE C;  3JSY A;  4HTI A;  2CNN B;  2JLG A;  5DM7 Q;  2HWH A;  1CJU A;  1HBN B;  2KH9 A;  4ZG7 A;  1AZS A;  3SZY A;  1SCJ B;  2HHT A;  2CIM A;  3FSI A;  2ZBP A;  3FBB A;  1QUV A;  1FRK A;  1WOR A;  1V3Z A;  1WHY A;  2VBW A;  1RT1 B;  3D1Q A;  3V4I A;  2OTL S;  3PEJ A;  4UUW A;  2UVV A;  3I87 A;  2LEP A;  3HI9 A;  1FD2 A;  1KQF B;  4NRU A;  4CIO A;  3IS9 B;  4U67 Q;  3KJV B;  1RTJ A;  3I32 A;  1K8A T;  3CWJ A;  3NGK A;  1JMT A;  1RU2 A;  5H1S V;  3DDN A;  4ZVP B;  2KFN A;  3FNN A;  3LO3 A;  5DDR C;  2HIY A;  3V81 A;  2G1D A;  3L7P A;  3OL6 A;  5IV4 A;  3F73 A;  2BM1 A;  2PSZ A;  2DB1 A;  3DXS X;  1FRJ A;  3EDQ B;  5SUH A;  3W66 A;  4GKJ F;  1AFI A;  4L3K A;  3IM9 A;  4RR5 A;  4AXI A;  2HIQ A;  3B6B A;  3HF5 A;  3VR1 A;  3SV4 A;  3J80 Y;  3UD5 A;  2B4O A;  4EBE A;  2ADB A;  2D7S A;  4H4O B;  4DR7 J;  3T5H A;  2YXL A;  2MQQ A;  4NCG A;  4IH6 A;  4DU7 A;  1X31 C;  3ZZO A;  5LSR A;  2KG0 A;  3V6H A;  2HLU A;  3WBZ A;  5I42 B;  1BQN A;  4C11 B;  1ZH5 A;  1HJK A;  4ZVO B;  4Z2X A;  1VRU B;  3W62 A;  4OI3 A;  1XMO F;  2XR9 A;  1JLC B;  2LXU A;  2B5J A;  3DOM B;  1VRT B;  3NP5 A;  4KFB B;  4Y2K A;  2KN4 A;  2XLI A;  1T11 A;  2UXB J;  4K5S A;  1C1B B;  1D8Z A;  2HBQ B;  3QQC D;  4B08 A;  2KM8 C;  4DZD A;  2R7R A;  4DSJ A;  4RW7 B;  4OHV A;  3OTO J;  1YGY A;  2BMB A;  1FKO A;  1YJ9 S;  3W2V B;  2YQ3 A;  2IRX A;  1F9H A;  4F7V A;  4TY8 B;  3OVS A;  5IT9 U;  2GSU A;  3IBF B;  1TKX B;  3D0G E;  2MKI A;  3MR6 A;  4DFK A;  6FDR A;  4YS2 A;  2F9D A;  3BGR B;  1T8E A;  4DSE A;  4WXO A;  2PE8 A;  1H0H B;  1LXN A;  5AE3 A;  5DJB A;  3TUZ C;  3GSD A;  1FCA A;  1JIH A;  3KXD A;  1S99 A;  4DV7 J;  3CJ3 A;  5ADZ A;  2VD3 A;  2HSE B;  2MZS A;  4ZOS A;  5G4D A;  2DPJ A;  1CS4 A;  4JI5 F;  5KFU A;  4DV2 F;  5GAE I;  2HAF A;  2P2C B;  3M8P B;  4ILR A;  2RQC A;  1ZAX A;  2HBZ B;  4I64 A;  3UW1 A;  3T9Z A;  5DG8 A;  1EAY C;  3R7S B;  3BDG A;  2Z57 B;  1O51 A;  2C3P A;  5D0E A;  2XY5 A;  3EGW B;  4GO5 X;  2XNR A;  5J2M A;  1N5V A;  3M30 B;  1Q8K A;  1OQ3 A;  3CJ8 A;  3WHI A;  4F50 A;  2VG7 B;  1VGY A;  1HFE L;  2HQ3 A;  4CLL A;  2LCW A;  2YWE A;  4QWA A;  1H2V Z;  2W5Q A;  1U2R A;  4Y34 A;  3TRG A;  2F65 A;  1L3T A;  3P8B B;  4Q2M A;  3UI3 A;  1IBK J;  3R8Y A;  1B99 A;  3FC9 A;  1RHM B;  4USW A;  3MR2 A;  3CJT A;  1SC6 A;  2QTW A;  4G1P A;  2KO1 A;  5CD4 H;  2QSW A;  3S7R A;  1VRT A;  2WON A;  1CG2 A;  1TL7 A;  3AD9 C;  3ETM A;  5IC4 B;  5D6G A;  5F8I A;  3CCJ S;  4UOH A;  4P75 A;  1C0T A;  1N34 J;  5INH A;  2RNE A;  4NWX A;  4O44 B;  2ZH3 A;  3K5L A;  2HHH F;  2VBZ A;  2IHR 1;  4WTO B;  2ZKT A;  3GZ7 A;  5JJB A;  3EXC X;  1HHT P;  1JLF B;  2FHJ D;  2QLB B;  2XMU A;  4RW9 A;  4NLV A;  4OIX A;  2HWI A;  2MJU A;  3TO8 A;  1VQ6 S;  4PWW A;  1LFW A;  3KK3 B;  1UW9 A;  3T6B A;  5IM0 A;  3FZB A;  1NK0 A;  1S1W A;  4QR1 A;  3GTY X;  2LP4 A;  4RLE A;  2KG1 A;  3NWG A;  4DN9 A;  8ATC B;  3G6V A;  3CCQ S;  3RR8 A;  1B8J A;  1RCX B;  2WW4 A;  2IJR A;  1RT2 A;  1RTJ B;  2ZZN A;  2BXJ A;  2A0F B;  5F8L A;  1BHN A;  4ECS A;  4N5S A;  2QRR A;  4NPO A;  1JKH B;  3EPG A;  1JQG A;  3MI7 X;  1RT1 A;  2FZG B;  2R42 A;  3RRG A;  9RUB A;  3L7U A;  2VDH A;  3QAE A;  1NM2 A;  3NKY A;  4OX9 J;  1EET A;  5A0Y B;  2QV6 A;  1VJQ A;  3O2I A;  3HXM A;  2KFY A;  3PV8 A;  5H9E K;  1N33 J;  4KO0 B;  2XLK A;  4LF2 A;  3CD7 A;  3CO0 P;  3JAM Y;  1SQF A;  2HK3 A;  1C2P A;  3DMJ A;  1Q7L B;  4KYZ A;  2O1P A;  1PYO B;  2AHO B;  3DOL A;  2DTJ A;  3HD1 A;  2B6A A;  3ICL A;  3Q83 A;  1XNQ F;  2AKW B;  1LFP A;  2Y8Y A;  5C24 B;  1XNR F;  2DR8 A;  2NSB A;  2V50 A;  1WG1 A;  1SC4 B;  3MED B;  1O99 A;  3W5Y A;  1ALK A;  1DLO B;  4IFV A;  2NZ4 A;  3VZH A;  1XQI A;  3AXK A;  3LTO A;  2CQD A;  1H72 C;  1OPI A;  4R25 A;  2QYC A;  2XUL A;  2RHS B;  2CKW A;  3O44 A;  1HI0 P;  1HQA A;  1LKZ A;  2R8J A;  4GMK A;  2B3T B;  1S1V A;  2UV8 G;  4J9V A;  3UDL A;  3H5Y A;  4OHW A;  1HI8 A;  1LWE A;  3KKF A;  3NNA A;  1KOO A;  3QFW A;  1IKY A;  3QAT A;  2PMZ D;  3RB4 A;  1L5U A;  1N36 F;  3ZZY A;  3SZZ A;  2B9X A;  2IC3 A;  2AJ4 A;  2A18 A;  3N6N A;  1N48 A;  2RF2 A;  2L9N A;  1LWX A;  1AJD A;  3BGF A;  4XO0 A;  3CED A;  2ZHB A;  3VQT A;  1RKI A;  3RAQ A;  1ZET A;  2IRU A;  2J9D E;  2GQQ A;  1SIW B;  4F0H A;  4GTW A;  1A0O B;  2YNF B;  4DCO B;  5DQH A;  4Q7A A;  2W9A A;  4X4O A;  4IR9 A;  2AJQ A;  4H54 A;  3SDE A;  1UFL A;  4K2J A;  4ZDN A;  1WC3 A;  3QIP B;  4LR9 A;  2CWK A;  6FD1 A;  4LF6 F;  4FYX B;  2R8I A;  3BPD A;  3HZE A;  2YKA A;  1KLM A;  3MMA A;  5LMU J;  3PM9 A;  5LIA A;  4RNH A;  4F8R A;  5MLC V;  4B9N A;  2F3J A;  3MEE A;  4B3T F;  1P9Y A;  2HHQ A;  4DR5 F;  4KTQ A;  3MK2 A;  1PYS B;  4AL7 A;  3M2U A;  2MHN A;  5A8W A;  1U6F A;  4URQ U;  3O6Q A;  2DNY A;  4UOC A;  2B9W A;  1C4C A;  4N56 A;  4RPF A;  4LFC F;  3CVK A;  4RWW A;  2W5S A;  4TN0 A;  1FJC A;  4F4A A;  1J5O B;  2WVF A;  2BAB A;  1SI9 A;  4CLF A;  1N33 F;  5EN1 A;  4ZCK A;  1SKR A;  1EQJ A;  4BCA A;  1TEL A;  1KWM A;  1X9W A;  2U2F A;  5GVQ A;  2GLQ A;  4Q5V A;  1TV6 A;  2EBG A;  3D6T B;  3ZTO A;  1S9F A;  2RKI A;  4UF4 A;  1K0V A;  2XYP B;  3CCV S;  4DV5 F;  3CMQ A;  1LWC B;  2COL A;  1VYA A;  4RX6 A;  1QAX A;  3HVW A;  3M2V A;  2ZNY A;  3FKB A;  1S6P B;  3HD2 A;  2AD9 A;  2HMI A;  5BXI A;  1RBL A;  1WC4 A;  1RAF B;  2ZWP A;  4YR2 A;  3DGV A;  5IQ6 A;  4J9M A;  4ZCI A;  4AL5 A;  2GQC A;  4OYM A;  4WU2 A;  3DM2 B;  2KM8 B;  1KSP A;  3QAU A;  4DX7 A;  3BN7 A;  1H2U X;  1O6X A;  1UWA A;  3M6W A;  4KIA A;  2DNR A;  2G13 A;  4HH0 A;  4X4P A;  3M2R A;  1YWX A;  1N5S A;  2DNQ A;  2GO8 A;  1DZ5 A;  1FSU A;  1GAO A;  2XZD B;  1EW8 A;  1SHQ A;  4PCQ A;  4ZMM A;  4ZJL A;  4AUK A;  2CZ4 A;  3KLI B;  2IJN A;  3QBC A;  4WP3 A;  5ITH A;  2XLJ A;  1NXI A;  1SUQ A;  3AQO A;  2MZQ A;  3MUT P;  4LF7 J;  2YNF A;  1NPR A;  2DHA A;  2E5G A;  2NXU A;  1GMW A;  3FGV A;  2JZ5 A;  2QX0 A;  3LAM A;  4RBT A;  2R9L A;  1NK5 A;  1SJ3 P;  5KFV A;  4F3O A;  2RH6 A;  1PGZ A;  3LGM A;  5EX3 A;  2V67 A;  2AJ2 A;  3KFW X;  3NWR A;  1UJ6 A;  3W9I A;  3K5O A;  3PJ9 A;  3PYE A;  1S9G B;  2IBO A;  4FVM A;  1HQE A;  3W1Y C;  7FDR A;  3THP A;  4NXN J;  5KFQ A;  1OO0 B;  5F3Z A;  2Y3Y A;  3LGH A;  3GV7 B;  1HBO B;  2JC0 A;  2WCX A;  5CZX A;  2IDE A;  4TNO A;  1VC6 A;  1IKX A;  4PQA A;  2VPX B;  3UVJ B;  3TUP A;  2FJB B;  1YKW A;  4PPD A;  4A8S A;  1FA0 A;  5JVG Q;  3UCG A;  2X3D A;  4IFV B;  1KS2 A;  4F36 A;  4JI8 J;  4O4G B;  3O1L A;  3PYD A;  1U26 A;  2EC2 A;  5I3Q A;  1SV5 B;  3EXY A;  3UO0 A;  3MMC B;  1U1P A;  4PWD A;  5LJ5 Y;  1H73 A;  1B70 B;  2D74 B;  4KT0 C;  3EIC A;  4LSL B;  1XN9 A;  3ILI A;  2DGW A;  1MU2 B;  5HLF A;  1ZZN A;  3BR9 A;  2YKM A;  3D54 A;  2XMM A;  4IG0 B;  4QWE A;  1QE1 A;  1FTR A;  4ID5 B;  5EUH A;  2HQI A;  4KBI A;  3OLB A;  1M5P C;  2MZT A;  2OPS A;  2CQ0 A;  5BYS A;  4Q0B B;  1O98 A;  3CT9 A;  2J5A A;  4ITS A;  2RUS A;  4W98 A;  5LOQ A;  2X98 A;  4MAK A;  4J37 A;  2MMY A;  1DQA A;  3HFZ B;  5KXA A;  4Y3C A;  2IM3 A;  2YQ1 A;  4CO5 A;  3N6L A;  1QVF R;  5LT5 A;  3D9B A;  2UXB F;  3WBH A;  3TUJ C;  5RUB A;  3VAJ A;  3EVO A;  3P96 A;  5JXS A;  4YDX A;  2ZFH A;  4DG1 B;  2D3Z A;  5K20 B;  4GKJ J;  3CJ4 A;  1X4B A;  3Q8P B;  1L3U A;  3M1V B;  3KK2 B;  4DX8 H;  2OLW A;  4P9S A;  3MK1 A;  2IVY A;  2KT3 A;  1URN A;  4OI1 A;  3KK3 A;  4DR1 F;  3QFH A;  2KKH A;  3E01 B;  3PW5 A;  3RAX A;  1KRP A;  4LF9 F;  4PRF A;  1WC1 A;  2J0X A;  3G4S S;  3AJ1 A;  2XMJ A;  3DLK B;  3CSK A;  3K0J A;  2BOA A;  3D0H E;  1RT6 B;  2V0N A;  3H0P A;  3CD6 S;  4TU9 A;  3CJ0 A;  2BDP A;  3R5C A;  5CA5 A;  3BB5 A;  2WON B;  3JSR A;  4DWI A;  2KXH A;  5BR8 F;  4IG3 A;  3T01 A;  1OYD A;  2VB6 A;  2DNN A;  4B9U A;  1FWL A;  2CJ9 A;  2DH8 A;  4L3N A;  5F3T A;  3OW2 R;  2YX4 A;  3C15 B;  5THW A;  2BQU A;  1WC5 A;  3TG0 A;  4K4X A;  5LMN J;  1KQK A;  3PIP Q;  2HHS A;  3VGV A;  3BBF A;  1G4C A;  2BJD A;  1U24 A;  1VR6 A;  3CIM A;  2HND B;  2IIH A;  3KG4 A;  3KUE A;  3M2V B;  4H4M B;  1HR0 J;  3MTJ A;  2J6T A;  1UVJ A;  1U1N A;  4JV2 A;  4A8K A;  1SC3 B;  3WX8 A;  1RTH A;  2HZV A;  2IM0 A;  3I9V 9;  2AEM A;  5DLW A;  2OPP B;  4NLQ A;  4EUV A;  1IM4 A;  4I7F A;  4IDK A;  4TQR A;  1XMO J;  4N41 A;  1M0S A;  1R89 A;  1P9Q C;  3LP0 A;  4S0M A;  4DSK A;  3MDF A;  1AA1 B;  3GCW P;  1BQX A;  4K5R A;  3IGN A;  2MLX A;  4WFN Q;  1ANI A;  4Q8E A;  4F02 A;  3UQS A;  3BH7 B;  1Z2Z A;  3FK4 A;  4M5D B;  2V4R A;  4R5P B;  2BX6 A;  3PX0 A;  1EZZ B;  1B7Y B;  4NEZ A;  3SCJ E;  1Y0H A;  2IYI A;  4UOF A;  2EKN A;  3NGD A;  2AEF A;  2IMW P;  1UVN A;  5HBM B;  1PG5 B;  3QT6 A;  1KON A;  1REV A;  1TL4 A;  1WJ9 A;  2WBR A;  4BC7 A;  4C8K A;  1KHV A;  5FLX Y;  4CH1 A;  4X4Q A;  3CDA A;  4UQG A;  5DGA A;  4DEZ A;  2HHW A;  2QO3 A;  5C2G A;  3CXC R;  3QSY B;  2QSF A;  2B9Y A;  1BXN A;  3HHD A;  4EWT A;  1IN0 A;  1SH0 A;  1SUQ B;  1WEZ A;  2HGN A;  2D1C A;  4NLW A;  4B02 A;  5CCM A;  4DBQ A;  5GAG I;  2BR0 A;  4O0N A;  2ZBI A;  1HNZ F;  5DLG A;  2BE9 B;  3MEC A;  3OFF A;  2W2Q P;  4HHU A;  1FVQ A;  2FYX A;  2RQK A;  3V6J A;  2DPI A;  2OI2 A;  2K8G A;  1HHQ A;  3DOM A;  4DV2 J;  1E6Y A;  2HK2 A;  2J9D A;  2VON A;  5IJQ A;  2DHH A;  8RUC A;  3H25 A;  1NJY A;  4MJK A;  1JLB B;  4UZC A;  4DL7 A;  1NJZ A;  5DQG A;  1IR0 A;  3J7A N;  4JV5 J;  2UVR A;  1TKZ A;  2AZ3 A;  3HKZ D;  4H4O A;  2PEH A;  1PSD A;  4PR6 A;  4DFJ A;  3M8W A;  1UA0 A;  3T9N A;  3ZZU A;  4CLS A;  2DO4 A;  3BF4 A;  3RYL A;  2HND A;  2ADC A;  3WAW A;  5KFH A;  5CYQ B;  4Q2L A;  2HAI A;  3A8K A;  4CLZ A;  3DKD A;  2CA9 A;  3A8J A;  3QZ8 A;  4FDF A;  3QRQ A;  4PQU A;  1F9F A;  3LAN A;  4UOR A;  3OSP A;  1NCL A;  4ES2 A;  1J5O A;  2Y0B B;  4I2P A;  4UOP A;  4USI A;  2BQR A;  4X4N A;  2GAG C;  4KH1 B;  4NLS A;  3BO2 A;  4K0K F;  3AB2 B;  1SL0 A;  2YWW A;  1NUE A;  1ACM B;  2L08 A;  2CQI A;  4ZVE A;  3C6U B;  2EK6 A;  1XEZ A;  4DPT A;  1WTB A;  4LF7 F;  2ZH1 A;  3A1Y G;  3DHW C;  3G2X A;  4K8R A;  3UDE A;  5D77 A;  4LF8 J;  4KO0 A;  2M70 A;  3B78 A;  3IP0 A;  3U27 A;  2F4V F;  3G96 A;  3W5Z A;  1LQ9 A;  5C2C A;  2W9B A;  1NDP A;  5KG2 A;  1TP7 A;  3K17 A;  5ETS A;  2XB2 D;  2I0X A;  2H4W B;  3PXG a;  4DX5 A;  4XK8 C;  4FDI A;  5F8M A;  4IKA A;  2DH9 A;  2L9W A;  2OD6 A;  3RB0 A;  2OFH X;  2D3U A;  1EHW A;  3JQJ A;  5DG9 A;  3US5 A;  4ZN3 A;  4RW8 A;  4HLB A;  3VHQ A;  2KZM A;  2QJ3 A;  4QR0 A;  3TP2 A;  2YTC A;  1R6V A;  1S6Q B;  1PIE A;  2FHJ A;  2FB0 A;  2KT5 A;  2L48 A;  3DLG B;  4IR1 A;  3CUL A;  4HT7 A;  2C22 A;  1KHN A;  2CPI A;  1S1W B;  4RZR A;  2E5I A;  2DHG A;  3O8W A;  2HNY B;  2MEW A;  4BC9 A;  2M7S A;  4EYH B;  1OWX A;  2E9R X;  2G9Y A;  3DOK B;  4JI2 J;  2HZA A;  3RB3 A;  3ELH A;  3R6G B;  1SQG A;  2GJI A;  4PZV A;  4RO0 A;  4DG1 A;  1L3S A;  3R2D J;  3HFK A;  1E6V B;  1PJ6 A;  3NGT A;  3G8T A;  4FBU A;  4ZCM A;  8AT1 B;  2A10 A;  1FER A;  3D3B J;  4C48 A;  3KLH A;  5LJ3 Y;  2L41 A;  5KFR A;  2NYH A;  3MM7 B;  1YQH A;  3DRS A;  3OTO F;  1EIY B;  2GV1 A;  4LSL A;  4F4X A;  4WZM A;  1R27 B;  2W7O A;  1TUG B;  2YKN A;  3F44 A;  4FPI A;  2XWX A;  4X64 F;  1JLQ B;  5G0R A;  4NE9 C;  3WQP A;  3BQ1 A;  3DRS B;  2G0I A;  1MRO A;  1U1R A;  4J9Q A;  4DSI A;  5KT2 A;  4YB7 A;  1HMV A;  5E41 A;  3RTV A;  3A13 A;  4ZHR A;  4OHY A;  1MU2 A;  5HLF B;  3CCE S;  4DV7 F;  2C1E B;  4ED5 A;  5KFK A;  4QR2 A;  2FVR A;  4I2Q B;  3BSC A;  6AT1 B;  2J7W A;  2CFX A;  1O5J A;  1RQ0 A;  3IC1 A;  4OZ2 A;  1XNQ J;  3EUN A;  4YOE A;  2PFF B;  1FDD A;  4MHX A;  4NLR A;  3W8P A;  3I56 S;  5IT9 Y;  1J2V A;  3PTW A;  3VVT A;  2BJ3 A;  2N3O A;  1S4E A;  2Y1I A;  1RAE B;  5CQG A;  3M8Z A;  4P2S A;  4PG8 A;  4OV6 A;  2AJ0 A;  1GTE A;  1URR A;  3SXL A;  2EBE A;  4K4S A;  2LQ8 A;  1Q5V A;  1S1U B;  4WFB Q;  5DDQ C;  1RWX B;  1S9G A;  4YHH F;  4EBC A;  1JJC B;  3VCD A;  3KLI A;  4FBT A;  2JEG A;  3GU0 A;  2IBK A;  1I3O B;  2C2K B;  1OQ6 A;  3S1T A;  3C19 A;  3KUG A;  3TX8 A;  4R8U B;  1IR2 A;  1FE0 A;  4QYR A;  4AYB D;  2Q66 A;  4LFB F;  5E2Q A;  3DLE A;  3LAL A;  1G1X A;  1KTQ A;  2KB2 A;  1Y9O A;  1YZ7 A;  2VOD A;  4Y6I A;  3DU6 A;  2I6W A;  1HW9 A;  4DR5 J;  4DL0 C;  5KFF A;  1NSP A;  3OUY B;  2KDO A;  3CCU S;  1QAI A;  3VF0 B;  1UCN A;  3D7S B;  3FMB A;  2GIR A;  2CNO B;  1X4E A;  3LUY A;  1CJV A;  4ZP7 A;  3EMT A;  4P72 A;  1NSQ A;  4DMZ A;  3CF5 Q;  4B9T A;  1M1G A;  1UTA A;  3KHL A;  3CIZ A;  2E7X A;  4NA2 A;  3G6X A;  2CQB A;  3Q2T C;  1NJI T;  3MZI A;  2UUT A;  4AL6 A;  3OL9 A;  1RT5 A;  1TAU A;  4KPY A;  3CDE A;  3E8O A;  4JUZ A;  5FD1 A;  1T05 A;  1T9T A;  3SMZ A;  5IC6 B;  4DV3 F;  3HK2 A;  5L8R C;  4C8M A;  1T3N A;  1TZ0 A;  1WEY A;  1O0P A;  3IBW A;  2MQM A;  2FJW A;  4BLG A;  3EYZ A;  3PX6 A;  2HW3 A;  4TYA A;  1KDN A;  1CJT B;  3TWZ A;  5SZT A;  4UPI A;  3SQO P;  2YWG A;  5F0W A;  3D3C J;  5LM7 E;  3V81 B;  1HHS A;  1M1H A;  1VBK A;  2I9S A;  3D66 A;  5CH7 B;  3M8P A;  3W7B A;  1WSR A;  2GQ2 A;  4KAV A;  3IS9 A;  3KD8 A;  1GXU A;  5CAA A;  2CQ1 A;  2DGO A;  2LMI A;  1NKE A;  3PY8 A;  3MEC B;  3BDF A;  1ANJ A;  1QTN B;  4M5L A;  3VAH A;  4MY4 A;  4B17 A;  3ISZ A;  4ES1 A;  2PA3 A;  3K8W A;  4DV0 F;  1N34 F;  4OZN A;  4U7U D;  1FXL A;  2JX2 A;  2FQQ B;  3HPO A;  2CDQ A;  4NX9 A;  4CO3 A;  1FDA A;  1R6Y A;  2VKR A;  3N5F A;  4K4U A;  1RA6 A;  4UOO A;  1W2B R;  1LNQ A;  3A3P B;  4WTY A;  3Q3Q A;  3EGN A;  3BGR A;  3E01 A;  1N2L A;  2FPH X;  1WF0 A;  3NKN A;  1S5Z A;  4A46 A;  4IQM A;  2OH2 A;  3VAG A;  3SSS A;  4WBF A;  4FF3 A;  3HHN B;  3NMA A;  1TVR A;  2GW8 A;  2V8H A;  4OJG A;  4RU2 A;  3TVK A;  4BWM A;  3M8Y A;  1RTZ A;  3U7J A;  3SI8 A;  1U1M A;  3BR8 A;  4MK9 A;  2XY6 A;  2GX8 A;  3R97 A;  4OI6 A;  2CNK B;  3BGU A;  4C7Q A;  4DL2 A;  1VQN S;  2E1P A;  1HWK A;  3LA0 A;  2NXC A;  3BM7 A;  4OYW A;  4XPC A;  3R3T A;  3NOC A;  4MKB A;  2Y8W A;  2DY9 A;  3C2P A;  4LR8 A;  2ZWO A;  5EWF A;  4Y2A A;  5LRN A;  3CJ5 A;  1KHJ A;  1CBK A;  3AJD A;  2N4C A;  2EXU A;  3T1A A;  5EDW A;  1R43 A;  1NRK A;  1Q95 G;  2YPZ A;  2ZD1 B;  5HAN A;  3KNA A;  4H4M A;  5DZ7 A;  3QRP A;  4PXE A;  2B6A B;  4CO4 A;  1KHL A;  4DR2 J;  2GIQ A;  4ZHR B;  3HVT A;  5B08 A;  4DQQ A;  4GC6 A;  2YKM B;  1U25 A;  4IG0 A;  3SYZ A;  1Y11 A;  2PMH A;  5M2R A;  1MN9 A;  1TQL A;  2V8P A;  2X51 A;  3C15 A;  3MED A;  1B0T A;  4O3P A;  3HSG A;  2Y9H A;  2DEI A;  2NUU G;  5E3P A;  4C8N A;  1BLU A;  1ZS6 A;  3OTB A;  2VC0 A;  1FFG B;  1CUL B;  4DCP B;  1HQU B;  2G4B A;  4NA3 A;  4I6A A;  3MM7 A;  1UZD A;  2MKH A;  1NK9 A;  5IJS A;  3HJF A;  2EG2 A;  2K7K A;  2W8S A;  2ALZ A;  3S01 A;  2AYB A;  1LW2 A;  1W25 A;  1SC1 B;  2DD8 S;  2WB1 D;  3WIV A;  4C3K A;  1RT2 B;  3V6K A;  2Y0S D;  2A6O A;  1EB0 A;  1FRX A;  2HRT A;  3L7O A;  5D4L A;  1HBN A;  2Z2M A;  3KLG A;  1T03 B;  2R3V A;  4B9M A;  4OYX A;  3UNY A;  2ZM6 F;  4IO9 Q;  4QIG A;  1CEZ A;  2YNI B;  3GCX P;  5A2Q Y;  2CJX B;  3IAM 9;  3QWP A;  3CUN A;  1Z4U A;  4DF8 A;  2E9Z A;  2K7J A;  5ETL A;  3DLG A;  1HAR A;  4DI6 A;  5EHH A;  5IFM A;  5HMZ A;  2L3M A;  1ZTW A;  4X4R A;  2LA6 A;  1KP6 A;  2OO4 A;  2DY1 A;  4WII A;  3SCK E;  1U1Q A;  2XCP A;  1TKD A;  2ZH2 A;  4Q44 A;  3OTE A;  4UY8 5;  3AA8 A;  2E7W A;  2J0W A;  3Q86 A;  2Q43 A;  2G0C A;  4I6Y A;  1TL7 B;  5DLF A;  2MQ8 A;  4LBI A;  5KOW A;  2W9B B;  3DGP B;  1DUR A;  4TN2 A;  3WAV A;  2W1B A;  5B0E A;  3PFE A;  3DXB A;  5T7L A;  4UPK A;  2EK1 A;  5BYQ A;  5AXM A;  2B7C B;  1ICE B;  5GME A;  5B0G A;  3VGT A;  5E7O B;  3ZZT A;  1PJ5 A;  1SKW A;  4IOA Q;  1HNI B;  5J2N A;  3DYA A;  1Q86 T;  1ZED A;  2RU3 A;  3OTD A;  5LSL A;  3MAA A;  2VG7 A;  4LVO P;  4X65 F;  3Q8S B;  2Z2Z A;  3PHT A;  1M5S A;  4KV8 A;  4X4V A;  1N88 A;  2V2K A;  2Y1L B;  4PPZ A;  2R2S A;  1S4F A;  3AY0 A;  2RKI B;  4CH0 S;  5H9E J;  1JX4 A;  1VJW A;  4WWS A;  2RDJ A;  1EW2 A;  2MZ1 A;  3OV7 A;  1SV5 A;  2EFG A;  1XWL A;  1HNW J;  4OZ3 A;  2VF3 A;  3KTQ A;  4RBU A;  4QBU A;  3NVL A;  1YJ7 A;  1YIJ S;  2ZVS A;  2FY1 A;  1H7W A;  2CJK A;  2I2Y A;  2P9G A;  1HD0 A;  4QYZ K;  1HYS A;  5E3Q A;  3CCT A;  3NEK A;  5L0E A;  3IBC B;  3BN4 A;  4F2R A;  2XI3 A;  1G7C B;  3OL7 A;  1AW0 A;  2LQB A;  1IBC B;  3PRV A;  3D6H B;  2W25 A;  1LEO A;  2JC1 A;  4DL3 A;  4USJ C;  1KNZ A;  1OSD A;  5KFE A;  2PGC A;  2UUB F;  2BE7 D;  1H98 A;  4WE1 B;  3MPW A;  3AB4 B;  3AH6 A;  4KGZ B;  2MKY A;  4NLU A;  5T41 A;  2MXY A;  2R2T A;  5J2Q B;  4B3O A;  3NKO A;  4JB8 B;  4OFZ A;  5KFX A;  2K06 A;  2M5Y A;  2OSR A;  2W7A A;  2XBP A;  1YJR A;  3FEX B;  3HLU A;  4X4S A;  4WK1 A;  1JK9 B;  3BJY A;  1V3R A;  2X1A A;  4DV6 J;  2DGV A;  1WC6 A;  3DRP B;  4CDI A;  1HDH A;  1HA1 A;  1X60 A;  1F2H A;  4RUA A;  3CC2 S;  4DR3 F;  3BQ2 A;  1ED8 A;  2J9E A;  2FHO B;  2HFV A;  1GXL A;  1JLC A;  3A12 A;  4QWB A;  2MGZ A;  2HZC A;  1XMQ J;  4LF5 F;  4TY8 A;  2Z30 B;  4KHP J;  3J81 j;  1NDC A;  3BEG B;  4WXW A;  1FJE B;  3L95 X;  4Q8F A;  1RT3 B;  1ZPV A;  4ECY A;  2K2P A;  4QIF A;  4LQ3 A;  1JJ4 A;  2OHD A;  1QSL A;  2QZ8 A;  5J2P A;  1ZBT A;  2FIU A;  2Z0G A;  3UNG C;  2AF6 A;  2HG4 A;  1HIY A;  4FVC A;  5KFI A;  1SL1 A;  4FDJ A;  3BV8 A;  2R7U A;  1H7X A;  3IFE A;  3LP0 B;  4OYO A;  4YDD B;  4JI4 J;  4C11 A;  4A8F A;  2GO9 A;  4DQI A;  1UJ5 A;  3JYT A;  4O4R A;  2FTR A;  3VV2 B;  5GAH U;  4P7V A;  4WYW A;  1WOO A;  4WIQ A;  5KAK A;  3KJV A;  2UU9 F;  3PNI A;  1WOS A;  2XSJ A;  4ICL A;  3U1L A;  5CAB A;  2CQG A;  5JUM A;  3KOA A;  3A4T A;  1V5I B;  4MK8 A;  9ATC B;  2ZEJ A;  3MD1 A;  2C2N A;  2FJX A;  1FD8 A;  4J90 A;  4USM A;  3IRX A;  4DV5 J;  2V94 A;  1T03 A;  5HSP A;  2GAH C;  1S1T A;  1WUU A;  3Q2S C;  5HP1 B;  3IRW P;  2BQ3 A;  2IY5 B;  5KFL A;  1X0P A;  4WK3 A;  3EE3 A;  5CHC B;  2E5L J;  1LXJ A;  4ZIV A;  2OKQ A;  5JVH Q;  2LFV A;  3VZI A;  1TL3 B;  3PEH A;  1H74 A;  2AP6 A;  4DR4 J;  3VGS A;  1AZS B;  1VCT A;  1KHW A;  1KR4 A;  4K7Q A;  2E5J A;  3Q24 A;  4C2M A;  2E1R A;  2FLO A;  4J9U E;  4E2F B;  2D9P A;  1NPK A;  2OP5 A;  2KI2 A;  4W92 B;  2NXJ A;  2DR6 A;  3NG8 A;  4I69 A;  5GOV A;  2MSS A;  3R7B B;  4QWD A;  3QT7 A;  1UPP A;  1RT7 A;  2XWY A;  3CJR A;  3P3D A;  1HBM A;  5IS2 A;  2ASL A;  1RT4 A;  3RGI A;  1OSC A;  2AX0 A;  1F60 B;  4ANC A;  5JMN A;  1RTD B;  1CVJ A;  1OMS A;  2WAQ D;  3K5P A;  2NCK L;  3KNG A;  2DR7 A;  1U2C A;  2CJA A;  5F8G A;  4DPW A;  2MY7 A;  1VQL S;  1X5S A;  3RBZ A;  1R0A B;  2GGP A;  2V9W A;  1R8H A;  1WDD A;  2VZ9 A;  4DPY A;  3FCH A;  2UZA A;  3TUI C;  2GVZ B;  3MM6 B;  1AT1 B;  4ZPT R;  3THT A;  1YHQ S;  4JI6 J;  1Q5Y A;  1T7P A;  3M8Q A;  2LXF A;  5CYM A;  4P71 A;  3ZNJ 1;  1IWG A;  2ZBQ A;  4NLO A;  3CD5 A;  1QE1 B;  4ID5 A;  3H8Y A;  4XPE A;  4W90 B;  1WF1 A;  1UEK A;  4ECZ A;  3TQE A;  1X4F A;  2YKQ A;  1Q53 A;  4DUY J;  3M30 A;  1QD1 A;  1HNZ J;  4EGL A;  1UVK A;  2Q6C A;  4KGK A;  3PHE A;  1XER A;  4WPA A;  2I5J A;  5HMY A;  1SVD A;  2OSQ A;  1VIX A;  1UFK A;  4MTP A;  3SEO A;  1OY8 A;  2J9C A;  2BKO A;  3FRZ A;  3R5A A;  2KJV A;  4ZVF A;  3PW0 A;  2D1G A;  1RUS A;  4EYI B;  1OY6 A;  1OJ4 A;  2C42 A;  3ITH B;  2K1R B;  5KFB A;  3Q22 A;  3GMG A;  2HWT A;  2P9C A;  1S1T B;  1IR1 A;  3CO9 A;  2IJF A;  3PFO A;  1HBO A;  1KC8 T;  5I4M A;  2CVE A;  2RJZ A;  5IXU A;  2JNJ A;  3BGO P;  4CLW A;  1JNR B;  1CJT A;  3D4J A;  4OHZ A;  3VGU A;  3VAM A;  4NZ0 A;  5T14 A;  5L1I A;  1PIL A;  1Y5I B;  2XGP A;  1K1S A;  1H6K X;  1P1T A;  2RRB A;  2YNG B;  3ETO A;  1S10 A;  4RUB A;  2IA0 A;  1RAD B;  5KFG A;  1PBU A;  3I5C A;  1YZ6 A;  1VC0 A;  1XR5 A;  5C5J A;  2C2E A;  3HP6 A;  1C0T B;  3KJN B;  2BBE A;  4LF9 J;  3GR1 A;  2U1A A;  1KD1 T;  4GVB A;  4X65 J;  2DBB A;  4NYP A;  1IKW B;  1UEV A;  2EFQ A;  3HDS A;  4JI0 F;  1VRQ C;  4PXB A;  1SIZ A;  3TJ9 A;  4RUC A;  2QL5 B;  2LQ5 A;  1VS3 A;  3MPU B;  4OJH A;  4WP9 A;  4CYU B;  4YHH J;  4FP9 A;  2RB7 A;  2ROE A;  1QDU B;  3KLV A;  1SXL A;  4FS2 A;  1PCA A;  1RT3 A;  1M5O C;  5IZH A;  2ZOM A;  1KOH A;  4B9V A;  1GH8 A;  2M52 A;  4HH1 A;  1NHV A;  3HSJ A;  2HFS A;  4L72 B;  4ED2 A;  3NGU A;  1UJ4 A;  4FZV A;  2LXI A;  4NZ6 A;  5KFY A;  2Z2Y B;  4GTX A;  4WJB A;  2V4J A;  4J9O A;  5AXL A;  4FPR A;  3QGI A;  3AOD A;  1T95 A;  1VDH A;  2CPE A;  4ZCL A;  2VG6 A;  2Q1L A;  5IWA J;  4IH7 A;  1YSJ A;  3T1H J;  4ZKA A;  2JFD A;  3MUR P;  3G6Y A;  1SBR A;  2XYG B;  4PG7 A;  4QCL A;  2BRL A;  2BJE A;  2CXE A;  4R0J A;  4P74 A;  3M2U B;  5A8W B;  2XMK A;  4ZGA A;  5KFW A;  4ZVG A;  2IDL A;  2V8V A;  5A2Q U;  3GII A;  1FDB A;  2HS4 A;  2DNH A;  1WHX A;  2BE2 A;  4PKD B;  3H42 A;  1URA A;  2A3J A;  4J9S A;  2HPU A;  3KLF A;  1TTH B;  4DR7 F;  4FXV A;  2MB0 B;  1CLF A;  4I2Q A;  5CD4 A;  4YB6 A;  1D1U A;  4P73 A;  4UQT A;  2DIU A;  3MMJ A;  1XK8 A;  4C0O C;  4D3G A;  2F4V J;  1VQO S;  5GMK a;  2M4M A;  4K4V A;  5DO2 A;  5B0D A;  1KQG B;  2JHE A;  3MM8 A;  1YIT S;  3B54 A;  2ASJ A;  3NKR A;  1SQE A;  4IOC Q;  3I31 A;  1NAQ A;  3K2Y A;  4KGX B;  4FYD A;  2IFX A;  1TMJ A;  1RAJ A;  1TMM A;  1C1C A;  4KPC A;  1F3F A;  3M8Q B;  2KT2 A;  4ECU A;  2GVD B;  1RWV B;  4KV8 B;  1VQ9 S;  3PRB A;  2V9K A;  4QJV A;  4FF1 A;  3GIJ A;  2VFU A;  1D9D A;  2GGP B;  3M32 B;  4JI4 F;  2OAU A;  2YH1 A;  2DJW A;  3UR3 C;  4C3L A;  3TAN A;  1LWE B;  2O67 A;  3MAQ A;  3K58 A;  5CYM B;  1MMN A;  5A8R A;  5M2P A;  3V2U C;  2O3D A;  3RUB L;  3VAI A;  1ARO P;  3X3U A;  3HJV A;  1NJX A;  1N52 B;  1N0U A;  4UW2 A;  1I5O B;  2V6A A;  4QOT A;  5E5N A;  3K5N A;  1UEU A;  4CT8 A;  2R8G A;  4JI5 J;  2CPZ A;  3FMW A;  3PG9 A;  2RAQ A;  5C25 A;  1NPP A;  1SJR A;  2BAN A;  2I38 A;  3H5U A;  4USU A;  1RT7 B;  4E0D A;  2CAD A;  3GIL A;  2ZZM A;  1FRM A;  5LRM A;  2OPR B;  1NEE A;  4ZVS B;  5KT7 A;  2GC8 A;  1TK8 A;  3GIR A;  3HSZ A;  3OR2 B;  3OT9 A;  3K5M A;  1HKA A;  4DQR A;  1BWE A;  1MWZ A;  2DRD A;  3I9Z A;  4DX6 A;  1VQP S;  3HHL B;  1ELY A;  1KH9 A;  5A0Y A;  2PDA A;  4OZ1 A;  5F9L A;  2UUB J;  3IRX B;  4ALZ A;  1DAR A;  1M5K C;  2R2U A;  3NKM A;  2QMU B;  1KHK A;  2ZOF A;  1Y3J A;  1HQ2 A;  1RB0 A;  4U6P A;  2A1B A;  1NKB A;  2VFS A;  3V4M A;  3RR7 A;  1HWI A;  1QSY A;  1TL5 A;  2GS8 A;  2MZJ A;  3NCQ A;  4PEO A;  1NHK L;  2QLX A;  3P5B P;  1IKV A;  1IUJ A;  4FYY B;  1FE4 A;  2B56 A;  2OEL A;  1F1B B;  4ZP8 A;  2UV8 A;  2YPY A;  3TA2 A;  4LF4 F;  3PYF A;  3WX4 A;  5H9F K;  1O8B A;  3OHA A;  1RHQ B;  1WHV A;  2VKZ G;  3RZA A;  3KHG A;  4ECW A;  2E66 A;  4ZJO A;  1S12 A;  2WOM B;  3MWB A;  5ETK A;  1KTV A;  5KT4 A;  3GE9 A;  1VOM A;  5HMX A;  3IDD A;  1OYE A;  4HTJ A;  2HBR B;  3HSD A;  1K44 A;  3MM5 B;  2CWX A;  3T5K A;  3HVA A;  5J1P A;  1WEX A;  4LFB J;  3VTI A;  2EFO A;  5F0U A;  2HVI A;  4RU9 A;  5HL7 Q;  2AMC B;  4O3O A;  3QNW B;  4IYQ A;  2W24 A;  2HRU A;  1U7L A;  1T02 A;  4CCH A;  2B7B B;  1TL1 A;  2B8P A;  2Y1R I;  3CJQ A;  4TU8 A;  3D0I E;  3CC7 S;  4CO0 A;  2HHU A;  2Z58 B;  4PXC A;  5A8R B;  2W5W A;  2LLZ A;  3EZU A;  5KFP A;  3PKM A;  1TKT B;  3GIK A;  1D3W A;  4Y2C A;  1RWP B;  1FX2 A;  3TQ1 A;  4DFM A;  2ZE2 B;  2BM0 A;  3U1M A;  3W65 A;  4M5J A;  2Z8Q A;  4ZPV R;  1RWU A;  4HAC A;  3RRK A;  2RDI A;  2D41 A;  3MMB B;  5B0B A;  5HMW A;  1FFS B;  3OJS A;  3M9M B;  5B0C A;  4GRS A;  3OJU A;  4G65 A;  4UY8 T;  4ILL A;  2LU2 A;  2V68 A;  4MKY A;  3CPW R;  2W01 A;  3ENW A;  2V63 A;  5L9N A;  3BSA A;  1HWL A;  3IGZ B;  2XM3 A;  4ED7 A;  1U8W A;  1ZA2 B;  5E0O A;  1U45 A;  1MMD A;  4FXD A;  3GJT B;  3JS9 A;  1DBD A;  3TVY A;  2HHP A;  4MFB A;  2WBM A;  3G82 B;  1Q81 T;  2OPQ A;  4PUO A;  4CYR A;  1KFD A;  3CCW A;  3KG0 A;  3OXL A;  4UST A;  2KVQ E;  3AA9 A;  3IR6 B;  4ZA1 A;  4DU8 A;  1EW9 A;  2V2Q A;  4ZVQ B;  3JSB A;  2AX1 A;  2DNG A;  4MFB B;  3AD7 C;  3FSY A;  3LP1 A;  2ZJQ Q;  2E1C A;  2UU9 J;  1X4C A;  2BE2 B;  3G9C A;  3HHE A;  4G3I A;  5HRT A;  1VLO A;  2CPD A;  3I6P A;  4IUF A;  3CW2 C;  4YP3 A;  2HS3 A;  5KFS A;  3KK1 A;  3Q0A A;  4YN3 B;  4Y28 C;  4K2X A;  3TJA A;  4LRF A;  4EU0 A;  4ZVU B;  3AOA A;  4NA1 A;  2NXE A;  3LP2 A;  3E51 A;  4JI0 J;  1RAA B;  2POK A;  2DXE A;  4OJ1 A;  5ETV A;  2GJF A;  1A6L A;  3GJS B;  3HX9 A;  4QW8 A;  1FKO B;  4KGM A;  3TAQ A;  1WAC A;  2DGQ A;  2Q6B A;  2QFJ A;  1D8Y A;  2DNL A;  1VHF A;  2QT7 A;  3QMQ A;  2VIH A;  1MNE A;  2W4D A;  4NWJ A;  2B51 A;  3MM9 B;  3GG0 A;  4OL8 A;  3A3N B;  1FRL A;  1CJV B;  3OHB A;  1TL1 B;  2XNQ A;  3ZZR A;  2UUC F;  1BQM A;  1KVK A;  2KRB A;  2VUG A;  3K7R A;  5HI7 A;  1U09 A;  5L1L A;  4LFA F;  4V19 X;  1PYT A;  3QPI A;  3WDO A;  1P27 B;  1RT6 A;  5I42 A;  2YKP A;  1HWJ A;  3DHX A;  1EP4 A;  3A8E A;  3I0R B;  3WAX A;  2CG8 A;  2H9Z A;  2ZM6 J;  3CDB A;  4LMZ A;  1RSC A;  1XR6 A;  5EGY A;  1FT8 A;  2QL7 B;  3SSR A;  2RH3 A;  2E1M C;  3W64 A;  4OZ5 A;  4ZS6 A;  3POT A;  2ILY A;  4OZL A;  4M5G A;  3J81 U;  3OR1 B;  2DR9 A;  3DLL Q;  2ZH9 A;  3NS5 A;  3UE2 A;  2LQ9 A;  4K59 A;  2GNK A;  2H51 B;  2R7Q A;  3MAH A;  2NZC A;  4RKU C;  4DQS A;  2E7V A;  3OXF A;  4GTZ A;  3AFG A;  2UXD F;  1K47 A;  5CZV A;  2YNG A;  2VOP A;  2QEX S;  4G1Q B;  2AJF E;  2PA8 D;  2YX7 A;  5D4O A;  3EPI A;  1VFJ A;  1Y5L B;  2BRK A;  2V69 A;  4C6A A;  1FXD A;  3IWL A;  2MJN A;  1SJ4 P;  2C2R A;  5F8H A;  1VIS A;  4DSF A;  1UZH A;  1GEH A;  1ZA1 B;  2FHM A;  4A8M P;  1S6O A;  4DR4 F;  3OD2 A;  4LVN P;  2BJ9 A;  5B7W A;  2WVB A;  3H40 A;  1Q8L A;  4A8Y A;  2HVD A;  4DL5 A;  1LW2 B;  3B4M A;  4NLX A;  3ITH A;  1RTI A;  2MKC A;  1DHM A;  3EM1 A;  4C8Y A;  2OPR A;  3ZO7 A;  2OEJ A;  3DCA A;  3O5T B;  4DXL A;  1TU0 B;  1GNK A;  2M8H A;  1UVM A;  3RBE A;  5HQM A;  3DN9 A;  2ROG A;  3GFY A;  4K4Y A;  1FJG J;  4JBC A;  4ETX A;  3P4U B;  4PWD B;  1Y7P A;  2M2B A;  2PII A;  3A3O B;  2DNO A;  3BKT A;  1WKK A;  4USK A;  4F67 A;  2B4V A;  2UP1 A;  1ALI A;  3TNV A;  2PI4 A;  1T94 A;  3CJ2 A;  3OQ2 A;  3W61 A;  2B8Q A;  1RJJ A;  1C0U B;  3D5M A;  2BKP A;  2C2D A;  1S77 D;  2ZJP Q;  3OVA A;  2EI5 A;  2HFO A;  2N7C A;  4JP8 A;  1NLK L;  4YB1 P;  3J7Y I;  1UWB A;  2H54 B;  3DOK A;  3QYY A;  3O3L A;  3BDP A;  2IRY A;  1R0A A;  5A8K A;  5GAG U;  3DRR B;  4M5H A;  1NB7 A;  2JSX A;  5KFZ A;  1RLC L;  2Q79 A;  3BGL A;  3N9U C;  1UPM B;  5EX0 A;  2FJD B;  3K59 A;  2OGU A;  4YUD A;  2XEX A;  3V6D B;  1CJK B;  1S6U A;  1UW4 A;  3MUV P;  3MF5 A;  3QT5 A;  1S9E A;  4LF5 J;  2AU0 A;  2B0G A;  1HBU A;  4JI2 F;  1EKR A;  3DI6 A;  5C66 A;  1NH7 A;  2FD2 A;  3H2L A;  1TUW A;  2AQ4 A;  4LSN A;  1FHT A;  4RWX A;  2VQE F;  1AFJ A;  3EJM A;  4F0K A;  4Y0F A;  3J7Z T;  4DCJ B;  1HW8 A;  1VBZ A;  1WEL A;  3NAI A;  2M8D B;  2CQP A;  4R0E A;  2H65 B;  4G6V B;  4V19 J;  1NSA A;  3C6U A;  4KKO B;  3CCM S;  1HNX F;  1TAQ A;  1IQT A;  2W2P P;  1AJC A;  2KL8 A;  1S79 A;  1M90 T;  3DPC A;  3H98 A;  2IUC B;  3C6T A;  2GZO A;  2YWF A;  2APO A;  2HEK A;  1VQY A;  1ZOT A;  4ED6 A;  2RRA A;  1EKS A;  3KUH A;  5IWA F;  3NL0 A;  3EVW A;  2E1A A;  2F5G A;  2CQ2 A;  3H5S A;  1LV5 A;  2ASD A;  2JLF A;  4LRA A;  5D0H A;  4M5I A;  5BJR A;  4YY3 F;  3TOQ A;  3M8R A;  2LU1 A;  4RW4 B;  2W8D A;  2XMT A;  2P6T A;  4L73 A;  3KG1 A;  4LRD A;  3J80 U;  4I67 A;  1JJH A;  3FFI B;  4KR0 B;  4DHV A;  1NK6 A;  1CPZ A;  4U96 A;  4QAX A;  3CCL S;  1D09 B;  4RW6 B;  2DGU A;  1DQ8 A;  3RBD A;  4KAI A;  1X0F A;  2FUG 9;  3WC0 A;  1ALH A;  7FD1 A;  3R1H A;  4TVA B;  2HYI B;  1Q1K A;  2EWH A;  3QO9 B;  2RQ4 A;  5KTQ A;  2K3I A;  4WYL A;  4CLK A;  1JLA B;  1Y10 A;  5GAD I;  2AIR B;  5HJY A;  2W9C B;  1ZM2 A;  4R8U A;  1D0E A;  3CMR A;  3DRP A;  2YY3 A;  4CLP A;  4U95 A;  3CME S;  2LQJ A;  4ECV A;  1T9Y A;  2C2M B;  3DLE B;  4X4U A;  3R27 A;  2VG5 A;  4RJV A;  3CD0 A;  4ID8 A;  2X7I A;  4PG5 A;  1ALJ A;  5K14 B;  5B09 A;  3C14 B;  4N8N A;  3E2D A;  3BSO A;  3L9Z A;  1URB A;  2JLE A;  4DFP A;  3ILO A;  4MKV A;  3PCO B;  1RWO B;  3HFV A;  1F9E B;  2AW0 A;  2Z56 B;  3MHY A;  1E3C P;  2LDY A;  4R5P A;  4P2M A;  5D8H B;  4RNN A;  1HYS B;  1ZPW X;  1SL2 A;  4QYZ J;  2JEI A;  3B8H A;  3Q8Q B;  4C8Z A;  2QLF B;  4GVL A;  3T19 A;  2DIS A;  2GJ2 A;  1XNR J;  1MSW D;  5A76 A;  3FRY A;  4KJI A;  1RTH B;  1YRU A;  3W5X A;  1Z2L A;  3I4H X;  1X5T A;  3PIO Q;  5I3U A;  2GSN A;  4ZVR B;  2UUW A;  3OXG A;  1U1O A;  2AWZ A;  4NAS A;  1RXO B;  3U02 A;  1S72 S;  5K8O A;  2AYE A;  4V1A k;  3OBI A;  4B3M J;  3MMB A;  1OY9 A;  3D1O A;  1JLE A;  2XG8 A;  3BPS P;  1WWH A;  2FHK A;  4FYV B;  4MIA A;  4QZV B;  3MFI A;  1MRO B;  5HQL A;  2ZE2 A;  4KJG A;  1H38 A;  3WC2 A;  5C7P A;  3LF0 A;  1DY3 A;  3GFX A;  4KC5 A;  4NLT A;  2YKN B;  5T7L B;  3IM8 A;  4P2X A;  5GAD U;  4IG3 B;  4XTT A;  1UKU A;  2IMO A;  4ZPW R;  2P6S A;  4MT1 A;  3M8S A;  1EET B;  1RHK B;  2R4F A;  5KG3 A;  2AT1 B;  4D3H A;  4EO6 A;  1UFW A;  1ROF A;  3D2W A;  4OYZ A;  3UCU P;  4DQP A;  1AJA A;  1DAX A;  1N6Q A;  3KLE B;  3MPD A;  2KU7 A;  4ILM A;  5HVG A;  1F5A A; 
#chains in the Genus database with same CATH homology
 1ZEF A;  3DYC A;  1E33 P;  2W5W A;  2W5S A;  3TG0 A;  1EJJ A;  2W5V A;  1E1Z P;  1ELX A;  1KHL A;  3BDG A;  4GTY A;  4GTX A;  1EQJ A;  3A52 A;  2GLQ A;  2W5Q A;  3NKP A;  5C66 A;  3IGZ B;  5DLW A;  3T01 A;  5LQQ A;  5IJS A;  5DLV A;  2W8S A;  4CYR A;  1ANI A;  1AUK A;  1ZEB A;  1URA A;  5INH A;  4LR7 A;  4N7T A;  1EW9 A;  4MHX A;  4NWX A;  4LRE A;  1AJC A;  1FSU A;  4CXS A;  3DPC A;  1SHQ A;  2IUC B;  2ZKT A;  5AJ9 A;  5HRT A;  3BDH A;  3M8Z A;  4UPL A;  4CYS A;  3UNY A;  1KH4 A;  3NKR A;  3ED4 A;  1AJB A;  4LRF A;  4LRA A;  5GOV A;  3LXQ A;  1ELZ A;  2W8D A;  2RH6 A;  4LRD A;  1B8J A;  1ED9 A;  4KM4 A;  4QAX A;  4NWJ A;  3UN2 A;  4ZG7 A;  3WAV A;  1KH7 A;  3SZY A;  1ALH A;  5IJQ A;  4UPK A;  4CXU A;  3MK0 A;  2ANH A;  2IUC A;  1EW8 A;  3TX0 A;  1ZED A;  2GA3 A;  3WAX A;  4ZG6 A;  3M8W A;  3CMR A;  1Y6V A;  3UO0 A;  3WAW A;  5DLT A;  5L0B A;  5EGH A;  5EGE A;  1EW2 A;  4UOR A;  1Y7A A;  4UOP A;  1EI6 A;  4B56 A;  1ALJ A;  3NVL A;  4YR1 A;  5LRM A;  3E2D A;  3TWZ A;  4UPI A;  1O99 A;  1URB A;  4GTZ A;  1ALK A;  1O98 A;  1KH5 A;  4ZG9 A;  3OT9 A;  5L0E A;  1E3C P;  2D1G A;  1ELY A;  2X98 A;  4LRB A;  3KD8 A;  4KAV A;  1KH9 A;  1HJK A;  1HQA A;  3UN5 A;  3NKM A;  2QZU A;  3BDF A;  5KXA A;  5L0K A;  1ANJ A;  4MY4 A;  2XR9 A;  1K7H A;  2W5R A;  1KHK A;  2W5T A;  4KJD A;  3WBH A;  3NKO A;  3SZZ A;  2W5X A;  4FDI A;  4UOO A;  3Q3Q A;  2GSN A;  1N2L A;  4MIV A;  5GRR A;  3M7V A;  3NKN A;  2GSU A;  2VQR A;  2XRG A;  4KAY A;  3NKQ A;  1HDH A;  1P49 A;  3MK1 A;  4GTW A;  4UPH A;  4CXK A;  1AJD A;  3M8Y A;  3T00 A;  4LR2 A;  1ED8 A;  1KHN A;  4LQY A;  3BDG B;  4KJG A;  1ALI A;  4LR9 A;  5K4P A;  1N2K A;  3IDD A;  1E2S P;  2G9Y A;  2IFY A;  4TN0 A;  3WAY A;  3IGY B;  4ZGA A;  5LIA A;  2GSO A;  1AJA A;  3UN3 A;  3T02 A;  5TJ3 A;  4LR8 A;  5LRN A;  1SHN A;  3B5Q A;  1KHJ A;  3MK2 A;  4LRC A;  4FDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...