4LRCA

Phosphopentomutase v158l variant
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrcA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrcA01
1ED9A 4CXSA 3LXQA 1EI6A 5LRNA 1KH9A 5GRRA 3M7VA 1ANJA 1HDHA 4LRAA 2W5XA 5L0BA 4ZG6A 2GSUA 5GOVA 4N7TA 1K7HA 2ANHA 5LIAA 1EW2A 4LR8A 3E2DA 2GSNA 5LQQA 1KHNA 1AJDA 2IFYA 2W5VA 4KAVA 4CYRA 4ZGAA 4YR1A 3BDFA 4UORA 2W8SA 1ED8A 1P49A 3WAXA 3IGZB 3DYCA 3SZYA 3DPCA 1ELXA 4MHXA 2VQRA 3B5QA 1KHKA 4KJGA 1KH7A 1HJKA 1ZEDA 4QAXA 1URAA 4KAYA 5K4PA 3ED4A 1SHNA 2D1GA 2W5TA 1ELYA 4LR7A 5TJ3A 3NKRA 1Y7AA 4ZG7A 3M8WA 3WAVA 1N2LA 4LRDA 1ELZA 4CXKA 4GTWA 1EJJA 3NKNA 1O99A 4LRBA 3M8YA 1ALKA 1ALIA 1E33P 4LR2A 3WAWA 2GA3A 3TG0A 4GTZA 1AUKA 5IJQA 1KH4A 4FDIA 4UOPA 4CXUA 5L0EA 1AJAA 2IUCB 2IUCA 5L0KA 1KHLA 3TX0A 5C66A 3IGYB 2GLQA 3WAYA 5DLWA 1ZEBA 4UPIA 2G9YA 4LREA 1E1ZP 1B8JA 2ZKTA 1ALJA 4LQYA 4TN0A 3M8ZA 1E3CP 3KD8A 4NWJA 4UOOA 1KHJA 3A52A 3NKOA 1EQJA 3T01A 3UN2A 3UO0A 1ALHA 4UPLA 5DLVA 1AJBA 3T02A 2X98A 3UNYA 2GSOA 3MK2A 1EW9A 4GTYA 5INHA 3OT9A 3UN3A 3BDHA 3BDGA 1Y6VA 3BDGB 5KXAA 5LRMA 4FDJA 4ZG9A 1EW8A 3NVLA 3IDDA 4UPKA 4MY4A 4UPHA 1HQAA 3T00A 3NKPA 1SHQA 5EGHA 3TWZA 4KJDA 2QZUA 1FSUA 1AJCA 4CYSA 5EGEA 1ZEFA 2W5WA 5AJ9A 3Q3QA 3CMRA 3NKMA 5DLTA 4NWXA 1O98A 4LR9A 1E2SP 1URBA 2RH6A 5HRTA 2W5QA 4GTXA 4LRCA 3NKQA 1ANIA 2W5SA 4MIVA 3SZZA 1KH5A 3MK0A 2W5RA 2W8DA 4KM4A 1N2KA 4B56A 2XR9A 4LRFA 3UN5A 3WBHA 2XRGA 5IJSA 3MK1A
chains in the Genus database with same CATH superfamily
4PYDA 3M8PA 3HP6A 3D28A 1TL5A 2R2SA 2CNKB 2PN6A 1U2FA 1QTMA 5AXKA 4DV2J 1S4FA 1ZM4A 1QDUB 2QEXS 3JQMA 2HEKA 1RWUA 3DLKB 3EDRB 1IVZA 4K5RA 3C6UB 4FBUA 4ECQA 3FUYA 2G9OA 5D0HA 4N76A 1TFWA 2BMBA 4GKJJ 1KHNA 4C8LA 2F4VF 4F8RA 5F3TA 3QLHA 4WYLA 4NL5A 3DCAA 4DPXA 1KVIA 3SZYA 2FHJD 3DPCA 2Y1IA 4RBTA 2ASJA 2RQKA 3MFIA 4OJ1A 3DNCA 2QMXA 3OR2A 4LFBF 3KLFA 4PG4A 1WWHA 4GC7A 1U1RA 4RW8B 1S9GA 4NMXA 1JXLA 1PJ6A 3TVKA 3I56S 2Y8WA 3N28A 3ET6B 3KNGA 3IM9A 2V5HG 1FK9A 1GX5A 4X4OA 4L3NA 2R8KA 3J7AN 2CYYA 1HL6A 2DITA 2MSTA 3KLEB 3H5UA 3OL7A 3K5NA 1JLCA 5FIIA 3G4SS 3L09A 2GZOA 3A8EA 2VQFF 3JS9A 1MW7A 2C2ZB 4YUDA 2FGCA 3KK1A 2GMJA 2V9WA 3QFWA 3Q8QB 3AAWB 2F9JA 1UMJA 4G65A 5CAAA 1EAYC 5L1LA 4CO5A 2FY1A 2IY5B 4PG7A 4JI3F 4JV5F 5F8JA 3ZTRA 1YJUA 5HI7A 2QA4S 4DR4F 3M9NB 2W9CA 2VH7A 2HRTA 2SXLA 5BYRA 5KG2A 4EYHB 3D6FB 2FJEB 1BXNA 2YBVA 3BYRA 4M94A 5ADZA 1RTJB 2QV6A 2EWHA 3I0SA 3KDOA 3J80U 2MGZB 1ZAVA 4ZPVR 3VAMA 2AGQA 1LNQA 2X1GA 4N8OA 2AYGA 1ALJA 3PX4A 4DV2F 1KVJA 1WUUA 2RIJA 3G82B 4Q7AA 3MPYA 5DDOC 1N48A 2CRLA 5E41A 1WHXA 4ZP9A 2ZH7A 3WX8A 3EX7B 1QAIA 1LXNA 3E2EA 1B3TA 2R7SA 1RAJA 3LP0A 2CZVC 3G6VA 1BQMA 2DYAA 3D66A 4JV1A 1R8PA 3FSYA 5E3AA 1VJWA 4OX9F 3RAXA 2PT0A 3MR7A 1X4EA 4ZVFA 3EYZA 2BR0A 1N5YB 4R0EA 1S1UA 2IVYA 2UUAF 1F60B 1E6YB 1G1XA 4ZLJA 2C3OA 3BDGA 1B7YB 3P5BP 1LFWA 4DR1F 2PO4A 3Q8YA 5C5JA 4UPKA 4UPHA 3CD6S 1HW9A 4DPOA 4IR9A 2MDAA 2FZGB 2R7OA 4KRWA 3R7NB 2HQDA 3QFHA 2RS2A 4F2RA 5C24A 3Q0AA 5I42B 1FEHA 3CVKA 2WW4A 1U26A 4DQSA 1YHQS 2UVUA 3TYTA 1O8BA 1RCXB 3FDSA 5D6GA 1ELOA 4EUVA 2IPOB 1DJ0A 2DGOA 2HQFA 3VAIA 2BW2A 1NSKL 2R7TA 4WZQA 1LWCB 2YQ0A 2RH3A 3GR1A 1RWWB 2HS4A 4ES3A 3QIPA 5L0EA 4DFKA 2V8PA 5F8LA 4LF6J 1O0PA 3ONQA 4LRCA 5LSOA 2OPPB 2YKPA 3L7PA 1U2RA 3VGTA 5KT7A 4J9MA 4WTOB 1SKSA 4KV8A 5GMDA 1D9AA 1U49A 3IO1A 1CULA 1PAUB 2FYXA 2DR5A 4TU9A 3M6VA 4UQGA 1WI6A 1TL4A 3EXCX 3M4XA 4KO0B 4AXIA 4JI1F 4PWDB 2KRRA 4I1TA 1U1MA 1TL7B 3IG1B 1YJ7A 3PRVA 1FJEB 3TVYA 4R8UA 3DLLQ 3CD0A 1QSLA 4LF9F 4HT5A 2C2EA 2KH9A 3M8PB 3DHXA 4OZ1A 3TUZC 2HQ3A 4K4UA 5LRNA 3H90A 1OY6A 1KLMA 2A18A 4LRAA 5F0WA 2LQ9A 1QE1B 1R6YA 3I5CA 4Y28C 2IDLA 1DTTB 4WE1A 1RWMB 4KH1B 4WK3A 3RR8A 4FF3A 2ANHA 3DLKA 5D3GB 5LMUJ 5LIAA 1M1HA 1R3NA 1IQTA 1MLAA 4NLXA 1KVKA 1QUPA 3V6DB 4F02A 1FXRA 2KTQA 2HFZA 1PYOB 1GX6A 2IYIA 1GXTA 2Y1LB 2DH9A 4NZ0A 5HN0A 1IBKJ 3CTRA 2E9RX 1RYSA 1CQNA 1L3KA 4KYZA 3GQCA 1YDLA 1ZBTA 3FBCA 3BGUA 2HHHF 1ZA1B 1HPZB 4Y2AA 1KWMA 4A8WA 3HZGA 4HEA9 2RHSB 1DAXA 3BKTA 3RB3A 3CJ8A 1ACMB 2CWKA 1WKLA 4BS2A 2E7XA 5AXNA 2E7VA 4MK8A 4YR0A 3GB0A 4NI2A 2ZDPA 3O1LA 3IGVA 3E3XA 3MM6B 3LP2A 2OFGX 2HK3A 2XNQA 1Y7AA 1ULRA 1NU4A 5DDPC 4DPWA 3PCOB 2L08A 2DRDA 3TW0A 3MEDB 3CMQA 4FDFA 4WTYA 4FF4A 2BE2B 2EG1A 1E33P 3MM5A 3MGJA 4S0MA 4DL0C 4JI8J 2V2QA 1RTIB 3DMJA 4GVBA 1N8RT 4JYAF 2GA3A 1CQMA 3AQPA 4CLPA 3N9UC 3IGNA 4OZJA 5KG3A 4KGZB 1IUJA 1G2EA 5DRKA 5IJQA 3MTKA 4UZBA 4UOPA 2DR9A 1AJAA 4DOZA 4I6AA 4FNIA 5B0FA 4LF6F 4CLUA 3MURP 1DHMA 3TX0A 1YJWS 3GG1A 3R5BA 4NCGB 4B17A 1X5OA 6FDRA 3AB2B 1PC5A 3OHBA 3JTOA 4RLEA 4MK9A 3MEGB 3OJSA 1S1WA 3AXKA 3ZZRA 1TV6A 1RAAB 1N33J 4J37A 2P9GA 2XZWA 4TYAA 3JB9k 4IYQA 4ED5A 2AEJA 3QJPA 5U47A 2HNDB 4MT1A 4EI2A 2HQCA 1WNEA 1TR0A 1F5AA 2D3ZA 2BKNA 3N01A 3FSXA 3TO8A 2A1BA 2H54B 4X65F 1IN0A 1S1UB 4M5DB 4CLTA 3F73A 2HHUA 2NSBA 2E5JA 2ABYA 2VG6B 3EM1A 4OYOA 4Q5VA 1HBNA 1NEEA 1RUSA 4F04B 1WELA 3UVJB 1KTQA 3HSGA 1RHRB 1UVIA 4N8NA 3BH6B 5FDLB 2NQPA 2VZ9A 1W2BR 1RQ0A 6FD1A 2FVSA 3O5TB 1NDCA 3NBPA 1ZM9A 4XK8C 5KFKA 1ZH5A 4OI3A 2MQOA 1X4BA 1TAQA 3GCXP 3H5SA 3PG9A 2ZOMA 1J5EF 4DQRA 1HNIA 3D0HE 5EGEA 2MKHA 2KRBA 4NA2A 4P2FA 3BSOA 4JI2F 4ILLA 2OPQA 4EZ6A 2BE7D 1CJTB 4PG5A 1NK6A 3C46A 2MQNA 3ZXWA 5KFDA 1LW0A 2KO1A 4A4JA 2N7YA 2YKMA 5D0GA 2M9KA 3EPGA 1IKYA 3RRKA 3QIPB 1P1LA 5T41A 4K2XA 1R27B 3KFWX 3UI3A 3CC4S 2JSXA 5LSLA 2W5RA 3HT0A 1L3TA 4K4WA 5IM0A 2MYFA 2V4JB 3I31A 4KV8B 1C1BB 3R5GA 2V50A 1S6QB 4FYXB 3W7BA 2RU9A 3JAMU 2VPZB 3KMSA 1WOPA 4ZP7A 3G6XA 1QAJA 4LSNB 2RRNA 4MTPA 1GNKA 2HBYB 4MKVA 5IT4A 2DPJA 4O3RA 1RBLA 1RTHA 2YKOA 4F0MA 1JLBA 1NCLA 4F50A 1B7FA 4DI6A 2ZJRQ 1ED9A 2M3DA 4FBTA 1UEKA 3BQ0A 4DZDA 1U48A 1UPMB 1QJHA 4V1Ak 2BACA 4NLDA 2LDIA 3EJMA 2MQLA 2BABA 2NPFA 5CYJA 2HLUA 2IHR1 3DRPA 2VHGA 2ASDA 3VF0B 2IA6A 1VRUA 2XS7A 2VODA 5EN1A 3E2DA 1G6BA 1HHQA 1SH3A 1VYAA 5HBMB 2E5GA 3PYEA 4YDDB 1VRTB 4ZPTR 3Q2TC 4GKKF 2R7UA 1APSA 2A6OA 5GAEU 2DR6A 5AJ3F 2NPIA 4ELUA 3NGSA 1RE1B 2PMWA 4UZCA 1SIZA 2CQ4A 3UDVA 2GHWA 2V6AA 3U27A 4RNFA 2WONB 2BDPA 3CDWA 4FZVA 4QPXA 2R8IA 1DLOA 1Q8LA 4Q2MA 4R0JA 1NLKL 3OTDA 2CJYB 4DX5A 4NI2B 1AFIA 1HBMB 1WC5A 1M90T 2CWXA 4JP8A 4LBHA 3GR0A 3HI9A 1U1NA 3HVTA 3BGOP 2AT1B 2WOMA 2P2CB 4USUA 4HH1A 4LR2A 2NXUA 8AT1B 5LT5A 3CE8A 3N6NA 1PC4A 4I68A 4JI2J 4NXNF 3TG0A 1Q8IA 3G71S 2ZHBA 1YX2A 4EEYA 4CTAB 3SV3A 4DPTA 3R7BB 3A3PB 4LVOP 4NLGA 1SJ1A 1QUVA 2I38A 1C0TB 2VV5A 3E51A 3IWXA 4NRUA 4LSZB 1KQKA 9RUBA 1VC6A 1JKHA 3IFEA 4WJBA 1H0HB 2AU0A 4DU8A 3H2LA 3RW6A 4DN0A 1XERA 4W98A 5J2MB 3C16B 1E1ZP 2MJNA 2ZUAA 2R2RA 2YTCA 4TN0A 3F41A 3M8ZA 4MKYA 2WSEC 1AA1B 1HD0A 1VOMA 2HVZA 3NKYA 4QJVA 4BC9A 4URGA 3FFIB 1FNMA 1S9EA 2ZH4A 1Q82T 4BDPA 1T95A 1VIOA 5HMXA 5DQIA 4BWJA 2ZH8A 1C0UA 1OQ6A 3I4HX 4PYAA 1GK8A 3QGPA 4X4SA 3T01A 1U24A 1ALHA 2EC2A 1GMVA 2H65B 5D8HB 2LQ8A 3V6JA 2X3DA 4Y2IA 3MMAB 3WIUA 5C42A 4O3SA 2QIFA 3KLVA 4USVA 4Q43A 5J2NB 2GVDA 4F0HA 3K0JA 4QIEA 1XC9A 1WEXA 2LA6A 5KFNA 4IG3B 1TAUA 3RBZA 1ZAXA 4USIA 3W2VA 1Q8BA 2JWNA 3N5BA 1XR7A 4E98A 3DYAB 5AE1A 3QZ8A 3K8VA 4MY4A 2KM8B 3CCSS 3PW5A 2GNKA 2M5YA 2ZKUA 1W7WA 1YSJA 5ETNA 4IDKB 2BEFA 2VG7B 1RU2A 4P73A 2WSCC 3F44A 4MYUA 3GFXA 6AT1B 1LWFB 2V0NA 1K0VA 2C3UA 2JZ5A 1S0OA 5A2QY 2ZE2B 3BDEA 3GCWP 3LANA 4GTYA 3Q8VA 2DNOA 1HHTP 1UZDA 2OPQB 5AE3A 3LQVA 3KLGA 1EP4B 4X62J 2YKMB 2ZBIA 2GV1A 4JI6J 3Q8PB 1IWGA 2BBEA 1WORA 4DL3A 1S12A 2LEPA 4Y0FA 2OAUA 1JMTA 5DZ7A 1RA6A 3W8GA 3DRYA 4MJKA 5EUHA 3HKZD 4EBDA 5D4OA 2CPEA 3NS6A 3PR4A 1TMMA 2DR8A 1N2KA 3H25A 1S76D 2FHOB 1Q8KA 3UWTA 2HQGA 3M8SA 2MZSA 1UJ6A 1IBMJ 1MSWD 5HMYA 2W8KA 2K3IA 2BUNA 4R5PA 4CXSA 1WF1A 3QRQA 4HHHA 1EKRA 1CC7A 4YQWA 2YWWA 4QPTA 1D8YA 3HM9A 2BZ2A 3ITHB 2IJFA 3OFEA 1AB8A 5GOVA 2NYIA 4IRKA 4W4MA 4DS5A 2R8JA 5LQQA 2BYCA 1AJDA 1UJ5A 1RT6A 1OSCA 1IWAA 1KDNA 2W4PA 3NCQA 2ZFHA 4OI4A 5KG1A 4OJHA 2MKSA 2QRRA 3PFEA 3QGIA 2OUGA 2AJ4A 1AZSB 3ZZPA 2E66A 4WFYA 4KHPF 1JIHA 5F3ZA 4OYPA 2I6WA 3GV5B 2VQEJ 2JHEA 3KJVB 3BF4A 2UVWA 3BKUA 3KLFB 3CULA 2R9LA 2NZ4A 1VQ9S 1URAA 2VUGA 4QU7A 2KT2A 5GAHU 2ZM6J 2WONA 3JXOA 1M5KC 3R2CJ 3SSSA 2W2MP 2AHOB 3CJ5A 4MYTA 2CJXB 4DV5J 1WEZA 4OYMA 2VA2A 3MAAA 1EZZB 2L48A 4CO3A 2R8HA 1SH0A 4DL6A 4ZA1A 3OTOJ 1YBTA 4J90A 3M8WA 4X64F 3QT5A 2XSJB 1ELZA 4ECTA 1S4EA 2CQGA 2A3JA 1HD1A 3JSYA 2WSFC 5L46A 2FB0A 1AJCA 1QD1A 2B6AA 4DR7J 1PBUA 2UUBF 1S77D 1GT8A 4N41A 1UVNA 2O67A 2FPHX 3HHNB 1RHJB 3VCDA 5KOXA 1AUKA 1R7IA 2J0WA 3DU5A 3Q24A 1N36J 5ETSA 3ZO7A 4CTAA 4FDIA 3GFHA 4TY8B 3CCLS 2RDIA 4N77A 5H9FK 3KG0A 3CCZA 1O5JA 4NOHA 1HNZJ 3TUPA 3WAYA 3ISZA 5J2MA 2W4DA 1VC0A 4A48A 4OYIA 5E3QA 3MM7A 1XWLA 3THVA 1NB7A 1I6JA 1QSYA 2GA7A 3TEGA 3QPIA 4RNMA 3I0RB 5B7WA 3EICA 3KJFB 2IIHA 4IFYA 2N4DA 2V2ZA 2DXFA 2CQ1A 4C3MA 4CP5A 5B09A 1S6OA 4J5OA 4OZ2A 5EWEA 4TKTA 5K8MA 4OX9J 4KSEB 2CJ9A 3LP0B 2PC6A 5LL6d 5MAOA 2Y8YA 1X4DA 4FVMA 1VDHA 3HHDA 2R7RA 1Q5VA 2ZHOA 3PW2A 1X5SA 1VI7A 5C7PA 4RW9B 1EW9A 4KPYA 4F67A 5I3UA 4C11B 2YNFB 3NEKA 4WFZA 2HWTA 3CB4A 4ZPDA 4USWA 3CCVS 3KWMA 4J9QA 4DFJA 1PSDA 1U2CA 2DBBA 2VC0A 2FIUA 3ZNJ1 3LALA 3G8TA 3ENWA 4OZLA 4ZVPB 3KLHB 3BB5A 2Y3YA 3AQOA 1SH2A 4KGXB 4OLOA 2C3PA 4UOCA 3TWZA 5KG5A 3BQ2A 2AEMA 2NSCA 4ED2A 1Q86T 4WKRA 5DQHA 5DDRC 4OX6A 1YI2S 1T9VA 2DO0A 2GO9A 2GS8A 3CPWR 5K5MA 1RJJA 1TFYA 4IOCQ 4DWIA 3CMRA 1N34F 1N36F 2Q6CA 5B0GA 2ACMA 2MJUA 1F9FA 2OFHX 3O6QA 1FFSB 3VAJA 3EVWA 3KHLA 1B4SA 3TARA 2HBZB 2ERRA 1G4CA 1NJXA 2OLWA 3H7HB 5A8KA 2OPPA 2OPSA 5G0RB 4Z2XA 4X62F 2JJ4D 2V69A 3TOQA 4LF7F 3H4DA 3HLUA 1R0BG 1A0OB 3MWBA 3JYTA 2B3TB 2J5AA 4WP9A 1F6TA 2YPYA 2CQBA 4RO0A 5G4DA 5A0YA 3PHEA 3GJQB 3VQSA 1YRTA 2Q43A 1RTDA 1SBRA 2WB4A 4WYWA 1MWZA 1LK5A 2QX0A 4L6V3 4CNZA 4A8YA 4IR1A 4B56A 3MM9A 3CO9A 3HSJA 2W2PP 1TL7A 3ISNC 4MFBB 2GCFA 3C8YA 3A13A 1Y3KA 4M5HA 1U1PA 2WTFA 2KVQE 2MLZA 1LEOA 1S99A 3D9BA 1XMOJ 5CYQB 2VB6A 1K73T 2AX1A 1AW0A 5D4LA 3PR5B 4FS2A 2XTJP 3ITHA 4CDIA 4YR3A 3TZYA 4NLSA 4JI4F 2UXDJ 1Q4RA 2DHAA 2D9PA 2H48B 1MG7A 2Y0SD 4YS2A 1SKWA 1D09B 3IR6B 4OHYA 5E3CA 3RBXA 3RB0A 1URRA 2LQBA 4IH7A 4OZ3A 4A8KA 3QMQA 2ZJPQ 4I6YA 3SQOP 3QO9A 4AE5A 3BQ1A 2H1YA 1M5PC 4OI0A 1IM4A 2APOA 2B9EA 4ZP8A 4DU7A 2HHSA 2F63A 5M2UA 3J81Y 1D1UA 2CPHA 4ZKAA 1SUQA 2MLXA 4EBEA 4C97A 3A4TA 2UUAJ 3QJJA 1HJKA 1NJIT 1NKBA 3NL0A 2IBOA 3HSZA 4MK7A 2VQEF 1FJCA 3K89A 3OVBA 2XCAA 4K59A 3C2PA 2VPYB 2YVSA 1M1KT 1RK8A 1GFWB 4J9PA 1FHTA 3D1HA 3RJMB 3UE2A 3P8BB 3W2WA 2I5JA 2RF2B 1I94J 2IMWP 3IAM9 3W8PA 4MIBA 2HFVA 1LKZA 2J6TA 2C42A 4LT6A 5HAOA 4DV3J 1U8SA 2KDOA 4U8YA 3W64A 3A3OB 3K5MA 2G4BA 4TXSA 2FJAB 2QGFB 1KD1T 2O1PA 3GG0A 3DMJB 2UV8G 4QCLA 1IR2A 3EZOA 2W1BA 1X9MA 4B9SA 5I4MA 4PUOA 4C8ZA 1S1VB 3DKDA 4JI1J 3NNCA 3ILIA 2XBPA 4DR6J 5HQ8A 4E8UA 2HZAA 2O01C 2IFXA 3OXGA 4DS4A 3PZPA 4RW6B 4HHUA 2XMJA 3DXSX 1NK5A 2GLQA 3IGYB 1XMBA 3QZ7A 2LDYA 4QYZK 2W01A 4NWJA 4X4TA 1Y5IB 5DG9A 2K8GA 4E2FB 4ECWA 1TP7A 2ZITA 4G1PA 1JLFB 2B8QA 2B4PA 4OIXA 2IFYA 1MROB 1RYRA 3KOAA 2VJVA 1S49A 2V8GA 2CZ4A 2QLJB 1OPIA 4O4RA 1XN9A 4ICLA 1M0SA 1RLCL 2OEJA 5EX3A 3EGWB 4EZ9A 3H20A 2KHCA 2VOOA 2IC3B 4ZLNA 1O51A 5HLFB 2HVEA 4IG0B 2KM8C 2ZM6F 1YJVA 3G9CA 4KGKA 4KGVB 2XMAA 4DCJB 3UVJA 3MMCB 4U6PA 3IWLA 4M5MA 1XJWB 3IDDA 3TA2A 3IS9A 5GMKa 4CLYA 5F8GA 1S1TB 4KHPJ 3ETOA 3QT8A 4IQMA 1RWVB 2XMTA 1CG2A 1SJQA 1WC0A 5M2RA 2VF3A 4O4GA 2HNZB 4IO9Q 2HW3A 2W9BA 1N5SA 1V3ZA 4Z37A 1URNA 2RKIA 4J9VA 1CJTA 1RI7A 4HDGA 2QYGA 3DLBA 2DH8A 1LW0B 1VK8A 3ILOA 4NASA 3K7RA 1IKYB 4J9SA 3MUMP 3MMJA 4MKAA 2RRAA 3HFZB 1VQPS 2X1FA 2YX4A 4WFNQ 1JXVA 2P6TA 3TA1A 5KFJA 3FRYA 2ACYA 3KUGA 3KK3A 4LF4J 5LXYA 2KB2A 3OD2A 1NHUA 1PAEX 3GFYA 3B4DA 3R6GB 2OGUA 5ETOA 3TX8A 2W4CA 3CIZA 3I9V9 1RKIA 1WSRA 2QA2A 4MH8A 4PAAA 5KOWA 2XR9A 4KM4A 4LRFA 3HX9A 1FDBA 1UETA 4LSNA 1H2UX 1X4HA 3SDEA 3OR1A 5BXIA 4ZITA 3PO5A 4QOTA 1FFGB 1RTHB 2CNNB 2M7SA 5J2QA 3FVYA 4DV4F 1TMJA 2F1FA 2J7WA 2PMZD 4C8MA 1U0SA 3ULHA 5CYQA 1VBXA 4LF9J 1TK8A 2G2ZA 5GRRA 3B6BA 1HI1A 1VQ8S 5L0BA 5CA5A 2RHQB 2J76E 2VC1A 3CT9A 5BYQA 3THPA 2ZH1A 3C6UA 5IOLA 2LXUA 3MECA 4IFVA 2U1AA 2ZH6A 4CYRA 1JK9B 5A76A 1HI0P 4OYXA 4K50A 2W8SA 1D9FA 3DRSB 4UORA 3L7OA 2VD3A 4M5LA 2HHVA 1VQLS 1HWIA 2RILA 2XO6A 1S5ZA 3OR2B 2CDQA 3OXLA 4RKUC 3DGVA 3PEJA 3DOMA 1ZEDA 1X5TA 2C2DA 4QIWD 1DTQB 1SHNA 1MN7A 4AQYF 4X4UA 3OTEA 4MIWA 4LFBJ 2MZTA 4F26A 1FESA 1J2VA 1S59A 2BXJA 1HBMA 3C15A 2HMIB 4JI7F 2OP5A 4DG1B 4RBUA 3KLEA 1GTHA 5M2PA 4ECYA 4QR1A 3HVTB 2KXNB 2H3EB 4JI0F 3NKNA 4ZVHA 4U96A 5RUBA 4C8OA 3JQKA 3ZC4A 1SC1B 5DLFA 2DNGA 3V4IB 2WOMB 1S97A 4ANDA 1MWYA 2FLOA 1EJ7L 1RAIB 4K4ZA 3A12A 4AFFA 2Z30B 1FT8A 3EGNA 4ZP6A 1TKTA 1KH4A 4Q44A 2W9CB 1D3WA 1XK8A 5KFAA 4DUTA 5HVGA 2FDNA 2IUCA 3DI6A 4HHJA 4KT0C 2FHKA 3KMQA 1WC3A 1JKHB 1S7IA 2ZBRA 2MGZA 1FWLA 4L76A 1UA1A 4MMOA 2CPJA 4ER8A 4C4WA 2LQJA 2R8GA 3H2VE 1PYSB 5HP1A 3KD8A 2O3DA 3G82A 4UOOA 1NAQA 3MPDA 2PA3A 3MFHA 4YHHJ 1SL0A 1HA1A 4OI1A 4ANEA 3AA9A 3KG4A 3TNVA 3Q8RB 2KVIA 3NKOA 1MROA 4FXWA 1YLXA 2RQ4A 3GSIA 3AY0A 4KGMA 4KB7A 4PXBA 3UD5A 4ENOA 4ZVEA 4ATNA 2HLTA 1D9DA 1HMVB 4DV7F 2VDIA 3JQJA 3DGPB 2ROEA 4OHWA 1FRLA 2JVOA 2VL1A 3DC2A 3LW5C 1AXQA 3HCXA 3MMAA 4NA3A 5A8RA 3MCMA 3PEHA 4OV1A 4PR6A 4DCPB 2HFNA 1VQSA 5LXRA 1N5YA 2LMIA 3H40A 2E5LF 3LOUA 4F4KA 1EARA 4LVNP 2D41A 1Z2ZA 4LIRA 1BWVA 2G2YA 3CCES 3CMES 1VJQA 1F3VA 1EW8A 3H98A 3QAEA 2R7QA 3DYAA 3EDQB 4X2BA 1WI8A 1AUDA 4DF8A 4ES1A 2YWFA 4J7CA 3G87A 3M05A 4IDKA 3HFVA 4KJDA 1RACB 4C48A 3VAHA 4D3HA 5LM7E 1FRKA 4RUHA 2V4QA 4HYKA 3RBEA 2OH2A 2B7BB 2MTLA 4X4NA 2MY7A 5L8RC 3VHQA 4Y3CA 2W9BB 3EZ5A 1RWXB 3GSDA 1CJUA 3MM8B 3BS9A 4Y34A 2MMYA 2RKIB 5K14B 4F36A 4ZIVA 1EP4A 2E44A 2YNIB 2UZAA 3RB6A 4TVAB 2RQCA 3OUYA 2ATLA 2J8SA 2FLNA 1AYEA 5J2PB 3FSIA 1URBA 4EO8A 1WKKA 3AJ1A 2XHWA 4FYYB 4BWMA 2XMKA 4PQAA 3MEEA 1GMWD 3FCVA 2LFVA 5GAGU 2HQIA 1CSJA 1DY3A 5GADU 4DX7A 3MR2A 2UU9F 1CULB 1YTYA 3HHKA 4XDCA 4J91A 4KO0A 1NXIA 3V81A 2EFQA 2DRAA 1KHWA 1RAHB 2HHTA 2OTLS 3IBWA 1TK5A 2QMUB 1YZ7A 4LMZA 1BQNA 2V9KA 5ETMA 3W66A 1TKZA 5LMNJ 3QGHA 1KSPA 2ZWPA 5K8PA 2GMLA 3FBFA 1N32J 2K7KA 4DR5J 2OI2A 2JDJA 2DY1A 3HHLB 4C2MA 2D74B 3QAUA 2FTRA 3IXQA 2CQ2A 2QLWA 1DTTA 2NXEA 3AJ2A 3NWRA 4PWWA 4WE1B 3WHIA 4ES2A 3PKYA 2GSUA 1VGYA 1KQSR 5D3GA 3ISND 4K4YA 1RT6B 2BA9A 4HTIA 1PCAA 3BJYA 2DNPA 2GAGC 3GIIA 4DX6A 3BGLA 4PWUA 3D2WA 4DSKA 4ZPWR 1QVGR 2IMOA 4CRJA 4DEZA 4DLEA 2ZH9A 1X0FA 5IT0A 1NUEA 3NGTA 4B3SF 4OYBA 1KHKA 4USTA 5HO4A 2N82B 4FKXA 4NLWA 3ED4A 3ETMA 4DJBA 2XYPB 3N6LA 1I51B 3B8HA 2JEJA 3MAAB 4FYVB 2XI3A 3CJQA 3M2VB 1KTVA 4JBCA 4ANCA 2DXDA 5ITHA 2N7CA 3J7ZT 3M2UB 2GX8A 2YX1A 3PYFA 3QYYA 2JEFA 3NKRA 1Q1KA 2MQMA 4M5NA 4LRDA 2Y9HA 3PJWA 4KFBA 1R0CB 1VBYA 3PVXA 4OLPA 4DR4J 2B6AB 1UVJA 2OEKA 4YY3J 3MR5A 1NH7A 4FF1A 3VWSA 1RT2B 1KNZA 3NS5A 1LK7A 2MY8A 1RCOB 1WC1A 2A2DA 1U45A 4PG8A 2HSEB 2RAQA 3NLCA 1UJ4A 3FBBA 1HQEA 2VU5A 3NP5A 4XPEA 4DUYF 2NLWA 1S72S 1G3OA 4KKOB 3VALA 3OLBA 1Q5YA 2VASA 2B4OA 4CI0B 2LEBA 2DB1A 2P8IA 5AT1B 3I87A 2C28A 2LXFA 4A8OA 5AXMA 4ZVQB 1REVB 2DNRA 2YH1A 2KG0A 4FPRA 2PI5A 1XNRF 1P6TA 5D77A 1SL2A 4OX8A 1QAYA 3FEYB 4PQUB 2CNLB 5DG7A 3QRPA 4QU6A 1KN6A 1JNRB 3FC9A 5IZHA 4I4BA 1FDAA 1MWQA 1R0AB 2CVIA 2UUWA 3CCMS 3J81j 5FJ4A 1FRXA 5GAHI 1K1SA 1H73A 1MN9A 2BOAA 4ZK7M 1VQ4S 2Z4PA 2OD6A 3TZZA 4TQRA 4ZVTB 2MZ1A 3T02A 1RADB 4QR2A 4RWWA 4LSLA 3KKFA 4RW9A 1ZZNA 2R7XA 3Q22A 2BJ7A 2CJQA 4M5DA 5INHA 2DNLA 1S1XB 4C0HA 5I3UB 3SYZA 5KFSA 2CKWA 4ILMA 3HFKA 4URSA 5KFIA 3NVLA 3F56A 3FQKA 4IRCA 5J1NA 3W5XA 3W5ZA 3CJSA 2FHJA 1VQMS 2Z57B 2PI4A 2GHVC 3VZHA 4CLLA 3KLHA 1QLNA 1T9UA 3ENQA 4B3SJ 2QZUA 2H51B 3ILJA 1NDKA 1YJTA 1RGVA 1Y0HA 2HHWA 5D0RA 4FPIA 3FQLA 4CO0A 2G0IA 4WXOA 4LQ9A 1HNIB 5H9EJ 3HO1A 3QRRA 3DLGA 2G1HA 1NHVA 2YQ3A 2BV3A 2HKEA 3LO3A 2HVHA 5K14A 3R5JB 4HVZA 2GVZA 4JI7J 3OUYB 5D0EA 5KFUA 1IKVA 1RWPB 2WVBA 4J9NA 2KFZA 2CQCA 4UTGA 3DRRA 3DM2B 4FF2A 4F3QA 2VQFJ 2OPSB 5G0RA 2D3OR 1BD6A 3MEEB 4A8FA 5IC6B 1NPPA 3HXMA 5F41A 3PV8A 1C1BA 2EKYA 3RUBL 4XAKA 1HKAA 4LFAF 3S7RA 5KFFA 3T1HF 1T9WA 4H4OB 4ED0A 5CCLA 4CH0S 2QL9B 2V2KA 2CZ9A 1Y10A 2K7JA 2MHNA 3BN7A 3GTYX 4GMKA 3ZZOA 2DO4A 1BQNB 1C2PA 1RT7B 4ZPBA 3JSMA 1WG4A 4P2XA 3T1YF 1UCNA 2D3O1 4CNYA 2MZJA 3AODA 4QIFA 2PEHA 3WC2A 1T94A 2QLBB 3GLJA 4TLQA 4CO1A 3K59A 4B3RF 4NX9A 2W5XA 4X4RA 2F8EX 2G13A 3GJSB 1J5OB 3A3NB 5HATA 1NKCA 4IOBA 3DRPB 4ZVGA 1MMNA 2E9ZA 4H4KA 1M5OC 3UCZP 4FXDA 3K5PA 2KKHA 4PPZA 5IFMA 1HIYA 5CCMA 2DVIA 4O3QA 3K5OA 4FS1A 2QA4G 4GC6A 3W9IA 1GXLA 4A8MP 2CG4A 1RHQB 2ZVIA 3GJTB 3H2UB 3NS7B 4K5SA 4NWBA 3M30A 3ZTPA 2DNYA 4RW8A 1F2HA 2XLIA 4EBCA 4ECUA 3OPKA 4WBFA 3V6HA 4B9TA 3CD5A 4N56A 1BLUA 1DLOB 3FEXB 2V34A 4DQQA 5HMZA 2F5GA 3VAKA 1BC6A 4Q8EA 1F2GA 1C4AA 2MPUA 1NZAA 2I5JB 2RF2A 4PXEA 3CO0P 4KHMA 2J9EA 4PXDA 3W2WB 1UVMA 1HWUA 1PJ5A 1TKXA 4C8NA 1DQ9A 2EK1A 1AUSL 4QBUA 3TRGA 3L3CA 2E1RA 2P9EA 1F5CA 3VZIA 5BR8F 1Y9OA 2NCKL 3Q2SC 2XEXA 4I64A 2XYHB 4RU2A 1RT2A 5HL7Q 4PUOB 4WK1A 5J1PA 5KFOA 2LU1A 3FKBA 4E0DA 3W65A 4DF4A 1YRXA 1KOHA 4RBVA 1OYDA 4KJIA 2H4YB 4RW6A 1RTJA 2XMMA 1HHSA 2E5IA 2E7WA 4B3TJ 3X1LB 3AHPA 2XULA 5DLWA 1T3OA 1TUGB 2FQQB 4FXVA 4X66F 4LREA 1IR0A 2UU9J 4P72A 5F9NA 2BKOA 4ECRA 4LF8F 1D8ZA 2VPWB 4O3OA 3R9LA 2DHXA 3OJUA 3PYDA 1S9EB 2OJ3A 1KHJA 3QBCA 5CYMB 4JI4J 4O44A 4NXMF 4CLFA 1F5BA 2YNHB 1C0UB 2QL5B 3POTA 3T5LA 3TAMB 2MB0B 3P5TL 1TL1A 4Q0BB 3T9ZA 1E6VB 2VFTA 5ETRA 4DBQA 2R2TA 1XMOF 2Z0GA 2C22A 4P2MA 4ZPAA 1RT4A 2AQ4A 4L72B 2JC0A 5HANA 4LSLB 3SCIE 5KG7A 3S6EA 1WC6A 2ROPA 3NWGA 3UN3A 4DZ6A 1E6YA 4PZVA 1NJZA 3BDGB 4FDJA 4IG0A 4X65J 3A8JA 4DSJA 2HHPA 4JUZA 1FKOB 3MMCA 4Y65A 4XO0A 2IJNA 3HVAA 4Q2LA 4NYZA 1KQFB 3O8WA 3GILA 1HFEL 2M4MA 3GU0A 3CUNA 1T05A 1HBUB 2VG5A 3LGHA 1FNOA 3HZEA 3D1OA 3IBFB 4TYBA 1FDNA 2QO3A 1FO1A 2RRBA 5DLGA 3QSYB 4UOFA 1HQ2A 1WDTA 4KTQA 3ZZZA 4O4GB 2HNZA 4P6QA 5AJ9A 5HJYA 2EEYA 3LWMA 4LFCF 4LUBA 2DHGA 3GWCA 1PYTA 1M5VC 1WDDA 3H5YA 1T9TA 1FI4A 2DGWA 3I96A 4F4XA 1DBDA 3F0NA 2L9WA 1O98A 1Y3JA 5KG4A 4GRSA 2P6SA 1FJGJ 4GTXA 2UXCJ 2ADCA 4OJ3A 2RDJA 4AL5A 2M2BA 3BPSP 4MIVA 4W90B 1HYSB 2FLPA 1EQJA 2CQPA 4OFZA 4EYIB 2Z2ZA 2YQ1A 1WG5A 3M8QA 3NAIA 4LJMA 4A8XA 4DL2A 1BY9A 3IR7B 4K4SA 4PWDA 3G8SA 1IKXB 2W2NP 1RT5B 1F3FA 4A8SA 1R43A 2CQ3A 2XRGA 3WBHA 4R8UB 2ZC4A 1FRMA 2A6MA 1IKWB 4FN5A 1RT7A 3JSMB 4NLTA 4R5PB 2JRSA 5I3PA 1FVQA 3UNGC 2AJQA 1SC6A 3T6JA 3R7SB 5FLXY 1OYEA 1IBMF 1QE1A 1A6LA 5LMNF 2FJBB 1NRKA 1BMQB 4NCAA 3CJ4A 2AYMA 2N4CA 5ETKA 1N88A 1WACA 2CIMA 2XG8A 2XMVA 4DL5A 1U47A 1WKJA 1CLFA 5B0EA 2B5JB 4H54A 1RHUB 2OKQA 4KR0B 5L9NA 5FLXU 5JVGQ 2J0SD 1U0HB 2LVWA 4USHA 3N5FA 2KFNA 2Z2MA 1UVKA 3V2UC 3EPIA 1VFJA 3RZAA 2EFGA 1HPZA 2B43A 3J7Z5 3PW4A 1V3SA 2O5DA 4URQU 3VTIA 2JLEA 1PIEA 3UD3P 4QAXA 3MR3A 1DTQA 1DARA 3X3UA 5H9EK 3W63A 3MCOA 3U1MA 3VGSA 1X9SA 3GYXB 4UT4A 1WHWA 2CJAA 2IAJB 2HFOA 3OXFA 3LP2B 2HMIA 1ELYA 5BJRA 2UUBJ 4ZGAA 3DOLB 5KAKA 5H1SV 1B99A 4JYAJ 3K57A 3FRZA 3WAVA 4OHXA 5J1EB 1WEYA 3O44A 2DHSA 2ZWOA 5KFLA 5A6PA 5DM7Q 2AD9A 3TP2A 1U1QA 3H0PA 2RD5C 2CQHA 3A8IA 1RAFB 3HKWA 3W62A 4C0OC 4DUYJ 4GTZA 4IQXA 1RSCA 3MUTP 1VQ5S 1UL3A 1WSVA 3QQCD 3DU6A 3TJAA 1DZ5A 3SXLA 1N4LA 4TY8A 4YN3B 3DI6B 3NOGA 2J6UA 1SL1A 2CFXA 4IOAQ 4WFAQ 1KHLA 4B9LA 3SFGA 1NM2A 2YKQA 3O3LA 4DV0F 2FLLA 4LF7J 4LF8J 5C66A 5JVHQ 2LEAA 4RL1A 1RISA 3M32B 4FYDA 1FX2A 5LJ3Y 4LQYA 1Y5LB 2GAHC 3MM7B 5HP1B 3W3SA 3KHGA 3TEHB 2HAIA 5F8IA 4IFYB 1JJCB 2OEMA 5D4PA 4ZMMA 2CPDA 2YKNA 1KEKA 2ZD1B 3OBIA 1IJFB 4I56A 4IH5A 4OI2A 5A8WB 5KFEA 2WB1D 1FCAA 3L4BC 2DXEA 1H3DA 2VBXA 2L41A 3ILLA 1S9FA 1SV5A 4QWBA 1E6VA 2A10A 2B0GA 1JWWA 1X9WA 4UPLA 3DGPA 4QWEA 1AJBA 4CLWA 2RSQA 2XY7A 3IWNC 2XLKA 1JJHA 5IS2A 2QJ3A 2NZCA 5GAEI 1O6XA 5EHHA 3TZWA 2KG1A 2R7WA 1Q16B 5KT5A 3BDHA 1Y6VA 1G7CB 4RNHA 2ADBA 1XTZA 1VS3A 2KXHA 4USJC 5DO2A 3H5XA 2DD8S 4ZG9A 2JL9A 2DY9A 4M5GA 1NSAA 2AYEA 3DDKA 5E3PA 2IRXA 4LF1A 3TA0A 2J8AA 2F7VA 3CCJS 2BQRA 2V8DA 1IXKA 4RW7A 1HBUA 2VG5B 3IP0A 4XPCA 3VV2B 8RUCA 3IN5A 1X4GA 3IR5B 1YGYA 1FSUA 1C4CA 1SVDA 2LP4A 4ZCIA 1ZEFA 4HACB 3OLAA 3MM8A 4NYPA 1I3OB 2H5JB 1N56A 2F40A 2YNIA 3ZTOA 3CSKA 3KXDA 3PM9A 3KHRA 1FWPA 1ZPVA 2VICA 2PEBA 2Z8QA 3EVOA 2AKWB 4I69A 4PEOA 2FVQA 2AJFE 4JI0J 3CJKA 1HNZF 2W2OP 3UW1A 1NK8A 5F0UA 2QLFB 4WWSA 5KFCA 2IA0A 1FFWB 2HBRB 2YWHA 1T11A 3GYNA 4WFXA 5B08A 5A0YB 3EXYA 3JTNA 2VA3A 3BSAA 1LQ9A 1SQFA 4M5JA 5KFGA 2AF6A 5KFZA 5L39A 1IKXA 1JLEA 1X31C 1ZA2B 2JFKA 4DV4J 3SZ2A 4CO4A 4B3MF 3MK1A 1GMWA 1V5VA 3ZZ0A 2KFYA 5KFRA 2HHQA 1SXLA 1ITPA 3BGRB 3LF0A 1UEVA 3M2RA 4K4VA 1U6FA 2CG8A 3HHLA 4I2PB 3WQPA 3NCPA 3CGIA 3GIJA 5CXTA 4O3PA 4USMA 1NZ8A 1S79A 2FUG9 1FTRA 2QZ8A 1I5OB 1UW4A 1CEZA 3GPAA 4EWTA 4F7VA 2FC9A 5B0AA 2GQQA 3OV7A 3M6WA 4GKJF 3QGGA 3AOBA 4BC7A 4X4VA 2RNEA 3AD8C 5DQGA 1SUQB 3NAHA 3AD9C 4QWAA 4G1IA 2MLYA 3CXCR 3CCRS 3LAMA 3TI0A 4Y2CA 2BJDA 3M2VA 1JLGB 3QT6A 3J7YI 1K44A 3MCSA 2QE5A 4Q45A 2J9DA 4IO1A 1JLCB 2B9XA 3CCTA 4QYZJ 5KFTA 4MAKA 2YXLA 5L9XA 4GTWA 5K20B 1EJJA 4KFBB 2VBYA 3DLJA 1YK9A 2BJ8A 3RYLA 4AT1B 3PX6A 4U7UD 4PG6A 3CDBA 2CPYA 4WPAA 2MHEA 4AD6A 1DURA 4CM2A 5KT6A 5DG8A 4UY8T 1S1VA 1T3NA 1Y11A 5KT3A 2QSWA 3CDUA 3UR0A 1YIJS 4TN2A 3N79A 1HQEB 4CT9A 2CPZA 3GIMA 1RBAA 3GV7B 3I4PA 3UCUP 4KKOA 4NLQA 4AYBD 3I0SB 3PY8A 4C3LA 1K8AT 3MD3A 1CJKB 1Q7LB 2V67A 3C16A 4C7QA 3FZBA 1EETB 1KQGB 4HT7A 4ZVSB 4DCOB 2MSSA 2EBGA 5KFMA 4TU7A 1VMBA 4CH1A 4ELTA 1R31A 3H42A 3OFHA 4Y2KA 3Q86A 4B3MJ 2ZUGA 2HHXA 3CC2S 1R0AA 4QW9A 2BJ3A 4WP3A 1VBKA 2JLFA 4HTJA 4M5IA 4O0NA 4TY9A 2BJEA 5T7LB 1L5UA 3J81U 1FRIA 3QJLA 5DLVA 2GIRA 1WHYA 5EWGA 2QMWA 1XNQJ 4ICLB 1UVLA 1UWBA 3KLIA 4LF2A 3WZ0A 2FJXA 1S1XA 2JC1A 5KFHA 3FK4A 3IGZB 3I82A 2IC3A 2GGPA 2OSRA 5CHCB 3OW2R 3BBFA 5HLFA 3FNNA 1TL3A 3W60A 2W9AA 2HFSA 4ZVUB 1X0PA 3PRBA 1H98A 1H38A 2CJBA 3OFFA 1HNVB 2OD4A 3IAS9 4NA1A 1MMLA 3TJ9A 2R42A 1SHQA 3TANA 4I67A 2V63A 5H9FJ 2LXIA 2OPRB 3NGUA 4L75A 2QFJA 5I42A 1FD8A 4HDHA 2YPZA 4J9KA 2ZBCA 4PXCA 1LV5A 3NMAA 1KC8T 4B3OB 2ZE2A 2ROGA 2IRYA 1KBRA 3DLGB 2AX0A 4O23A 4HACA 3KUHA 3NKMA 5KFVA 4YB6A 3R2DJ 3KHHA 3UDLA 2EFVA 4F4ZA 2HS3A 5CZVA 2XZDB 1B70B 1UEUA 1ANIA 2M8DB 3R5CA 3QATA 3RTVA 2IM3A 2XZTB 3SZZA 1UP1A 1JLQA 2DNQA 4LBIA 4ZVOB 1FA0A 5GMEA 3PXGa 1KS2A 2DJWA 1NB2A 4N5SA 2HYIB 1XNRJ 2GIQA 3VGUA 1BE4A 1YZ6A 4DHVA 4H4OA 4ECSA 2WVDA 3UQSA 3L9ZA 3ENAA 2HAFA 2BM0A 4DR3F 1UFKA 2E1PA 1JLAB 2D9OA 4U8VA 1RT3B 2MKCA 2JNJA 3RAMA 1HNWF 1EI6A 2XI2A 2AIRB 2OELA 2F65A 3M9MB 1HDHA 3QWUA 2PFFB 1MU2A 2K3KA 4HLBA 3MTJA 3VVUA 3D1QA 1GMUA 2E1CA 4B9NA 3K2YA 3SQGB 4ZCKA 5B0CA 1J5OA 2R7VA 7AT1B 3KG1A 4DR2F 1IBLJ 4HKQA 3C6TB 3MECB 4IFVB 1NK9A 1OJ4A 1XMQF 5AJ3J 1Y5NB 5C25B 1AZSA 2ZZNA 5IV3A 1RKJA 2BRKA 1T0TV 3RW7A 3OSPA 1TUWA 2BM1A 4NZ6A 3D6HB 2JFDA 4QZVB 4CZCA 1KH7A 3DOMB 4ITSA 4X84A 2FZCB 3G6YA 2UXCF 2W25A 3PJXA 2RE1A 3SMZA 3WX4A 5DJBA 1LW2A 4G1QB 4OZ0A 4K7QA 2MEWA 3SCKE 3TUJC 2NS1B 1L3SA 4UUXA 1RWNB 2FD2A 1NBEB 2D3UA 2B7CB 5KG6A 1TQLA 1BGXT 4UQTA 4DG1A 3RR7A 1PGZA 5C2GA 5TJ3A 5JJBA 2PFDA 3TZXA 3MEKA 4JV0A 2ALZA 4WCEQ 3NNAA 4LRBA 4DFPA 3MM5B 5F9LA 3OTOF 4IUFA 4DL4A 1D0EA 1E2SP 1V3RA 2E5HA 1N34J 4C6AA 2VONA 4DSLA 1HWJA 2ZVSA 1TKTB 2R4FA 2WVCA 4GVLA 2Z58B 5AE2A 5L1KA 3TAPA 3GJRB 3M1VA 2VFVA 4NPOA 3BBCA 1HQUB 4OYZA 1FJGF 2ZBQA 3FMWA 4AL6A 5I3QA 2ILYA 2XC9A 1NMEB 4NCGA 4UUWA 5CQGA 1ZEBA 3FBEA 1IJEB 1F0XA 1OY9A 1B8JA 1EETA 2QT7A 3MMBB 2UP1A 3C14A 1ZTTA 3CJ2A 2FZKB 1FRHA 2WK4A 1SC4B 4ZJOA 3KK2A 3I0RA 3TQ1A 2UUCJ 3EGZA 4QW8A 1ZAWA 2EPIA 2XMUA 3MEGA 5CYMA 2ZJQQ 1R8HA 5LMUF 1U1KA 2LCWA 1TV6B 2MZQA 1UPPA 3CJ3A 3NOCA 4FNHA 3WBZA 4ECXA 2B9WA 2X1BA 3HDSA 3POTB 2XQCA 3UO0A 4C8YA 4Q0BA 5T7LA 3IA0A 4J9OA 1S0NA 4DUZF 4ZJLA 2XYGB 4ED3A 1VQYA 3BREA 3DHWC 2OO4A 4QR0A 1HBOA 2KJVA 1ROFA 4EMDA 5HROB 4YR1A 2YWGA 2V8VA 3HVWA 3SIPB 2M0GB 2PGCA 1YG0A 2D1CA 1UKUA 2GGPB 2RT3A 3JAMY 4ZCMA 2X7IA 1XNQF 4HL9A 3LAKA 3MCNA 2KYZA 3JSBA 3FGVA 3OVAA 3CJRA 2C1EB 2HGMA 5KG0A 1T05B 1A7GE 2WVEA 4WF9Q 3CEDA 2IM0A 2OHDA 3ZNUA 3T6BA 4DV6F 2XSFA 4K2JA 1LWEA 2AWZA 1ALIA 4CYSA 1U6BA 4HH0A 2ASLA 3J7YU 1R8CA 3UPFA 4I6WA 3IBCB 1I1GA 2Z56B 4NWXA 4DR6F 5J2PA 2AMCB 5HRTA 1RDRA 2POKA 3K8WA 3M8RA 2GMHA 1NNDA 3NNHA 2W8LA 2G1DA 5IM0B 1SI9A 1W25A 4BLGA 4J9RA 1HYSA 2DTJA 2F8HA 1V5IB 2VFUA 2W24A 3B82A 3M6UA 5IQQA 4U7UK 2AJ1A 2W8DA 2UUCF 3J7A1 2YX7A 3VAGA 2NXJA 2X51A 1RT5A 1LWXA 2Q6BA 2WZ1A 4KHRA 4OI6A 2H5EA 2V94A 4J9UE 2F8MA 2OMOA 1JXEA 2ZZTA 1RT3A 5CD4A 3PYGA 4P75A 1VK3A 2MZRA 1Y4ZB 1FDDA 3CMAS 2RDDA 1SQEA 1U1OA 5F8NA 2BOPA 3MPWA 2C2OB 3M6XA 3QSIA 3SQGA 1IBKF 4Z7YA 1EW2A 3KUEA 4IKAA 3MR6A 3IRXB 2C2MB 1T9YA 2PE8A 2MXYA 1QY7A 2CQ0A 2IVMA 3D6TB 4P9SA 2G2OA 1N6QB 2UXBJ 1JB0C 2LLZA 3KDNA 4NCBA 2I0XA 2YH0A 2DPIA 2DGUA 3DYCA 1U4BA 4A8QA 5ETTA 2RQMA 2K06A 2HGLA 3N6MA 2G0CA 4C98A 1Q79A 2EVZA 1PG5B 3HD1A 3DOKA 1U1LA 4GKKJ 1UTAA 1WTFA 4LIWA 1LW2B 1R89A 3AD7C 4G1QA 2GJIA 1JJ4A 2AYBA 2W5TA 4ERDA 3WIVA 3BPDA 3A1YG 4ZG7A 2LA4A 4L3KA 1XIQA 4AQYJ 1FEEA 4CQ1A 3DDNA 3L7UA 3PO4A 1B64A 4M8LA 4CH7A 1NDPA 1RZMA 4F4AA 3KK1B 2E9TA 4KPCA 4WKYA 2BANB 2EXUA 2Z2YB 4RUCA 3OL8A 1H2VZ 1KOOA 3VAFA 2UVVA 2DGXA 1M5SA 4CXUA 2R2UA 1TKDA 4WXWA 5HMWA 1OMSA 2HBQB 4X66J 1C0TA 2L9NA 1LFPA 1SIWB 1ICEB 4K8RA 4ZPCA 3R6LB 3NMRA 1ZS6A 5FD1A 2CADA 1S48A 3M32A 3SSRA 2C2RA 5HJXA 1N5VA 4KIAA 1P8GA 4GO7X 1R8AA 3MMBA 3NGRA 4YB7A 4ZDNA 3KJNB 3RG6A 3OHAA 4J9LA 4ED7A 4PQUA 1T03A 2E29A 3EE3A 3FFIA 3NG8A 4N47A 1YITS 2YKNB 3I5BA 1JLFA 3CIMA 4DUZJ 5A8WA 4DR3J 2FJWA 1FWKA 3C66A 2BE9B 3G8QA 5E7OB 4V19J 2E5LJ 2HGNA 3THTA 1KLNA 1JQGA 3MI7X 2WW8A 3OTCA 1Y00A 3FCHA 4NRTA 1QSSA 3UNYA 5C42B 8ATCB 2GSOA 2AZ3A 3BZQA 4FKYA 3OT9A 3EUNA 2PD1A 4UOGA 1SB6A 2DGQA 3CF5Q 3W2VB 3ZTQA 1Q81T 3SI8A 1OSDA 3HT3A 1NKEA 1WC4A 2DIUA 3P4UB 1S1TA 1T02A 2HURA 2CPXA 2Y0BB 3A8KA 2HHHJ 4RW7B 4H4MB 3ZZUA 2VOPA 1KR4A 2HWIA 2IBKA 1Q0NA 4ETZA 2XGQA 1X4CA 2JVRA 3UD4P 1REGX 4PRFA 5E3RA 2F4FA 2QLXA 4QYRA 1GTEA 3CDAA 4RW4B 5LJ5Y 2MKKA 4JI6F 4ZLPA 5DDQC 4RPFA 3GV8B 1VR6A 1FF2A 1RT1B 2BRLA 3GMGA 2BVZA 4LR9A 1NDLA 1X8DA 3P3DA 2CUYA 3DM2A 3NKQA 2ALYB 4KBIA 1VRQC 3CJKB 4U7CA 3HSDA 3DLEA 1KH5A 2WAQD 2MKIA 3SBMA 3OFGA 3R27A 2VFRA 1DQAA 1TVRA 3OR1B 1UW9A 4FP9A 4KC5A 2IDEA 2VJUA 3P96A 3LPYA 3HK2A 2AEFA 3RRGA 3TUIC 3D6MB 5ETQA 2GQCA 3BGRA 4EK2A 1KLMB 2XY6A 4DFMA 2J9CA 4I2PA 1HR0F 3CW2C 1U02A 3CWJA 4CYUB 4P71A 4ZCLA 1WJ9A 5ETLA 2V4RA 2DGTA 1YJ9S 2KXFA 1R6VA 2B51A 2VKRA 1Q95G 1U6ZA 2DK2A 2EK6A 5GVQA 3IRXA 3T19A 3V6DA 2EW9A 1EIYB 3BYPA 3PIOQ 1VISA 3BH7B 1FXDA 3MHYA 4HI1A 1J27A 2JLGA 3BDFA 2K1RB 4WU3A 4ECVA 4NLOA 3H59A 1SKRA 5L1JA 1Q53A 2KZZA 1C1CB 1W26A 1P49A 1NHKL 4RNOA 4DQPA 2NUHA 1SJ3P 2UXBF 2VQRA 4MHXA 3KJVA 4KJGA 3R3TA 3E01A 3I32A 2KJWA 5MLCV 1H7WA 1OWXA 4NMLA 1N5QA 1NK0A 4OHVA 1NSQA 2D1GA 5K4PA 3RGIA 3TVZA 5EX0A 2C3YA 5HQLA 3VQTA 3CJTA 4ELVA 1OQ3A 1ZZFA 1JLGA 1N6QA 3C15B 2H5IB 2LQ5A 2PSZA 3MM6A 3S01A 4YP3A 1WTBA 2X3GA 4ID5A 4ALZA 2NR0A 3T00A 1KKHA 2FGOA 3KYLA 2XSJA 3MOZA 1R8BA 2AGPA 2KN4A 2JOQA 2WVFA 1O99A 5ETPA 4B08A 1S57A 1ALKA 3WAWA 1YBUA 3V4IA 4I7FB 4NLRA 5EWFA 4LFCJ 2BANA 2DNKA 2DISA 2DEJA 2EI5A 3EVMA 3EZUA 3NGDA 2E1AA 2GHPA 3H8YA 3BSCA 2PMHA 3DFEA 5AXLA 1U8WA 2XHCA 4MKBA 5F8HA 4F4YA 1NJWA 4NXNJ 4JV5J 2IUCB 5IWAJ 3HJFA 2HS0A 4WIQA 1GAOA 3D3BJ 4NYOA 3GE9A 1CJKA 5SZTA 3R1LA 3K5LA 1HI8A 2F3JA 7FD1A 4DR5F 2HG4A 4CO2A 4NE9C 5EDWA 5A6WA 1T03B 4YEAA 4W92B 5B0DA 1OPZA 2OMLA 1S1WB 1VQKS 1JJ2R 1UFLA 5D15A 3I6PA 2UXDF 2QFIA 3MF5A 2YNHA 1S6PA 4ETXA 2HIQA 4F3MA 4F2SA 3RB4A 3MOJB 3TAMA 3ADAC 2CDRB 4V19X 2JH3A 2DHHA 4Y6IA 5IV4A 1HNXJ 5HVFA 2RJZA 4YDXA 5A8RB 5K8OA 2X98A 2Q66A 4ZJQA 1UWBB 2DEIA 1GXUA 3KLIB 1GH8A 3MK2A 4C11A 2YNFA 1HLWA 2VPXB 2HZVA 2QC3A 2VG6A 3GONA 1HARA 2CPIA 2GO8A 1ZOTA 4FYWB 4OZ5A 1HBNB 4ED4A 1NJYA 4P7TA 1V9OA 2I9SA 3LP1A 3CNQP 1HNVA 2HPUA 4DXLA 3OVSA 2ASYA 3BO4A 3T5KA 5IT9Y 3I5AA 3Q8SB 1H7XA 1FERA 2DGVA 3UR3C 1N0VC 2OPRA 2P5VA 3HPOA 4YB5A 3D54A 3MUVP 4B3OA 1FJ7A 5KT4A 2ILZA 4M63A 1CJUB 2FJDB 3DDIA 3R5DA 2ZHAA 4DV5F 5KTQA 2ZZMA 3S8SA 4NLVA 4WU2A 4R25A 1YQHA 2WBMA 1I94F 1RBOB 2EKNA 3SEOA 1RHKB 4JV2A 2A0FB 3B54A 2W2QP 3Q83A 4ZN1A 1X4FA 3ZFVA 4K0KF 4DX8H 5LSRA 3C3LA 3BV8A 3W61A 2HVIA 4CLZA 3K17A 3DLEB 1UA0A 2BJ1A 4ID8A 5DZ6A 4CWBA 3M8QB 4XDDA 1RTDB 4XTTA 4RUBA 3R8YA 5E33A 1N32F 3GFZA 2CQIA 2BQUA 2W5VA 2U2FA 1SJ4P 2BX6A 4GO5X 5KFWA 2MKJA 4DV0J 2FVRA 4C9DA 1JLBB 5E2QA 2DNZA 3LXQA 2XS5A 1U09A 1FKPB 3KTQA 1KH9A 1Y7PA 1H2TZ 3M7VA 1JX4A 1NPRA 2DKOB 4CIOA 1RXOB 2NUUG 1XQIA 4NEYA 2QYCA 3W1YC 5IQ6A 1K7HA 4Q8FA 5HVHA 3QNWB 2GSNA 1CS4A 4HI2A 3B4MA 3NY0A 4DSEA 2GW8A 1IBCB 3FCWA 2HNYA 1EHWA 5C25A 1ED8A 2RVJA 4Y2MA 3AA8A 3WAXA 2PIIA 1HNXF 3QO9B 1KONA 3IMQJ 1CVJA 3V4MA 2XWYA 1XMQJ 2J6SA 2XS2A 3DN9A 2ZDOA 4ED1A 3HHLD 3B5QA 3G86A 1VQOS 4YMEA 3E01B 3U1LA 1FRJA 3VGVA 1VQ6S 1S9GB 2FJVA 1RWKB 1NH8A 1S0MA 3ICLA 2MQQA 1K0TA 2I1RA 1LXJA 4M95A 3ET6A 1QVFR 5K8NA 2KU7A 2QN6B 2XGPA 2B4UA 3D7SB 2EFOA 4RX6A 3MAQA 1TZ0A 1N2LA 1RAOA 4ECZA 1SCJB 4WFBQ 3PW7A 2YNGA 4A46A 3I55S 3N4WA 2Q79A 2XWXA 4Z7CA 4X64J 1TELA 4I7FA 4OYAA 2LU2A 4AUKA 4G6VB 2Y1RI 5A2QU 4EO6A 2AV5A 5E0OA 4QQBA 2J0XA 2VBZA 5BR8J 1ZPWX 2GJ2A 3UFCX 4DDFA 3Q23A 1HQUA 4UW2A 3UDCA 5E5NA 1GEHA 4DN9A 2IM1A 2P9CA 5ETVA 4CCHA 1FTCA 4RUAA 2XM3A 2I2YA 1RHMB 2ZKTA 1REVA 4OX7A 3JSRA 5K9FA 3C14B 2MQPA 1X7VA 3ELHA 4O0IA 3BSNA 1PILA 3N0VA 2GIFA 1FX4A 3H4BA 2M52A 2ZD1A 3C19A 1S6PB 2CPFA 3NRBA 4EFAC 2R3VA 2LYVA 3BO3A 2KYXA 4YHHF 3AJDA 1BQMB 4X4QA 1N52B 1UAWA 2H9ZA 3EGVA 2NYHA 4NLPA 3W5YA 1UZHA 5F8MA 5DM6Q 4DV1J 4YOEA 2KL8A 1HBOB 1FNXH 4G3IA 4DPYA 5CD4H 1XR5A 2L9DA 1WD6A 4KY3A 2GVDB 1KP6A 5J2NA 4C8KA 3PKMA 3CJ0A 1FD2A 3FMBA 3SFUA 4IG3A 4CLKA 2X1AA 5LRMA 3FEZA 3DXBA 1HWKA 3LP1B 4PCQA 2N3OA 3IS9B 5LOQA 5EGHA 4ZLLA 2VG7A 2CVEA 4B9UA 2C2NA 1VHFA 1YVFA 3AT1B 1BQXA 1RWOB 4QIVA 5CZXA 5C24B 4P7VA 4ZHRA 4DR7F 3J80Y 4IH6A 3Q3QA 2KZMA 4JI3J 1YWXA 1EKSA 2RU3A 2MKYA 3LGNA 4I0WA 2AGOA 1LWCA 1IKVB 2W7PA 3TJ8A 1SKUB 1YBAA 2W5QA 1UFWA 3BR8A 3UCGA 3WC0A 3D0IE 2W5SA 2COLA 4ZIWA 3T1HJ 1VBZA 3KK3B 4YY3F 1YJRA 3IRWP 1H6KX 3D5MA 3MK0A 4DV1F 3BBBA 1BWEA 2HVDA 2B8PA 1VQ7S 3BGFA 3T3FA 2OTJS 3T1YJ 3LH2S 1F9HA 1JLEB 3SDEB 4JI5J 4LF4F 3RBDA 5B0BA 2V2VA 3SV4A 2CXEA 4RJVA 2BKPA 4B3TF 2IVFB 5J2QB 2YWEA 4P10A 2ZH3A 4JOUA 1FE4A 3QT7A 3VR1A 1MMDA 3OQ2A 1FKPA 1S10A 1RP5A 3M2RB 3EWGA 4QWDA 1ANJA 2DNHA 2F4VJ 1Q78A 2XNRA 3FZ2A 9ATCB 1Z1ZA 2M70A 4LR8A 3OL6A 4NLYA 1CS4B 1V6HA 4MIAA 4BCAA 3PFOA 2VBWA 1XEZA 4TLRA 3R97A 5KFXA 5IXUA 4QWCA 2ZH5A 4B9MA 3QWPA 4DL7A 3BR9A 3I9ZA 2HNYB 1HWLA 2ZBPA 3DRSA 3LPEA 1TUVA 3QIDA 2BJ9A 3SSQA 3W9HA 4XIUA 1VHIA 4USKA 1K9MT 1TK0A 1ELXA 2Z2LA 3PACA 2QSFA 1VLYA 2GFFA 3D0GE 7FDRA 3MZIA 3M30B 3DOKB 2KI2A 1SJRA 4F0KA 3LWLA 2DNNA 4I2QA 3PDNA 1YKWA 4LR7A 1XR6A 1B0VA 3PTWA 4Y00A 1M1GA 1NO8A 1S0VA 1EX8A 4C3KA 3IM8A 4DV6J 3AOCA 1RA7A 1TKXB 1TU0B 2YNGB 3MEDA 4ED8A 3HD2A 2AW0A 2BE2A 1RTZA 4LQ3A 1X4AA 3PW0A 3BEGB 1RTIA 4GVBB 1FVSA 3MPVA 3Q89A 4RZRA 4WZMA 2WBRA 3CDEA 4UOHA 4LFAJ 1NK4A 3CCUS 1VCTA 1S7HA 2IJRA 3AXMA 4P2SA 1U7LA 4RWXA 3T5HA 2XB2D 1Z2LA 1RB0A 4LBPA 1W2IA 4M1KA 4WIIA 3MXHP 2AJ0A 1WG1A 4KE5A 5CH7B 3RAQA 1A9NB 2DRBA 1ZYQA 1LOUA 4NZ7A 5KFBA 3G6ES 4X4PA 4NXMJ 1E3CP 1WF0A 5IWAF 4B3RJ 3D68A 4OZNA 1DRZA 4DSFA 3ENVA 2AZ1A 4O44B 1PJ7A 1CPZA 2D7SA 3T9NA 4YR2A 2CNOB 1EQMA 2EFPA 3AFGA 4KAIA 1TL1B 4UF4A 3UN2A 1Q7YT 1HMVA 2HNDA 1IQZA 3W9JA 4F25A 4OHZA 2PA8D 1RT4B 4DQIA 4OMFG 3OL9A 2B56A 2FVCA 3KNAA 3MD1A 1S6UA 5KXAA 4D3GA 1UWAA 2F9DA 2AJ2A 4DMZA 3AH6A 2Y1JA 3T5JA 4WP8A 1TL3B 5C2CA 2GJFA 2C3MA 3DRXA 1JNZB 1FKOA 1RLDA 5SUHA 2W7OA 2AP6A 2HRUA 5FDLA 3GYGA 2M8HA 1DQ8A 5DGAA 3DLHA 3NKPA 1N5TA 3NBPB 5KFPA 1CJVB 4H4MA 2LKZA 2RUGA 4K4TA 2H4WB 2NXNA 1OIAA 1VQNS 3BKFA 3AOAA 1SQGA 1X60A 2QL7B 2CQDA 2RUSA 2ZOFA 3KJQB 4ZHRB 3BO2A 4RW4A 2KT5A 5KFYA 4B9VA 1M5HA 2J7KA 4NEZA 5JXSA 4H4KC 1IR1A 1H72C 1T9XA 4ZN3A 5BYSA 1L3VA 1RT1A 2RH6A 3CC7S 1GQEA 4CLSA 2G0JA 5A8KB 3HJVA 4AL7A 3GIRA 3TR5A 1P9QC 4B02A 2XY5A 2UV8A 2HWHA 1B0TA 2V4JA 3JYTB 1SJFA 1JLQB 1HW8A 4UY85 1S6QA 3PRDA 2HFUA 3ZTSA 3CD7A 2OIHA 3V81B 4LF5F 3MM9B 4MFBA 2YY3A 4EGLA 1TVRB 4YB1P 5KFQA 1ZM2A 1F9EB 2YWKA 3CCQS 1N33F 5IJSA 5CABA 3OSNA 1HR0J 1IKWA 2J0QD 2FHMA 1JLAA 2GC8A 3ZZYA 1TKZB 1XBWA 4LF5J 2UUTA 1FE0A 2HRYA 2VFSA 3PX0A 4TQSA 4C0BA 4CM0A 5D4NA 2M88A 3NGKA 4TNOA 2CA9A 1OY8A 3NXZA 2N3LA 3HULA 4U67Q 1MU2B 1WF2A 2IRUA 2RS8A 3G2XA 1VLOA 4CYUA 4U95A 1HNWJ 2XMWA 5IT9U 4N7TA 4ZG6A 2JEGA 2J9DE 2HZCA 1VRUB 3BDPA 3P6YC 1T8EA 3C6TA 1N54B 2DGSA 4KAVA 3FJ2A 5HBMA 1B0PA 1P1TA 2B5JA 3SCLE 2DR7A 2K1RA 3O2IA 1U0HA 1OS5A 2J7UA 3HVRA 3QLHB 3UDEA 4DV7J 1C1CA 1VRTA 1P27B 2CJKA 5L38A 3PHTA 4YFUA 3HHEA 3R1HA 3US5A 2FY8A 5THWA 4A47A 2HIYA 5DGBA 2A2CA 4BBYA 4KAYA 1KHVA 2I8EA 2ZNZA 3A52A 1QM9A 4K4XA 4I2QB 1QAXA 4DV3F 1FK9B 2GQ2A 2NXCA 2IAJA 2ZNYA 3IC1A 4L74A 4ZOSA 1TTHB 3M2UA 4ID5B 5JMNA 3DOLA 4JI8F 4JB8B 3P49B 2YKAA 2W7AA 2IYGA 4CXKA 1K1QA 2V8HA 3LUYA 3MAHA 5J1EA 3L95X 2E1MC 2DNMA 2QTWA 3HHLC 3M9OB 3M8YA 2VKZG 5T14A 3D4JA 3RRHA 2LECA 1ZTWA 1J5EJ 2QA1A 1CC8A 1RU1A 2KT3A 2RB7A 3SCJE 4RNNA 4DSIA 2FVPA 1ZETA 1DFDA 3JTPA 3HMJG 1BUXA 5IC4B 3BM7A 5DS7A 3M1VB 2DH7A 1IM6A 3GP9A 3G96A 1ZM3A 3LGMA 4IRDA 4F3OA 5GAGI 4K0KJ 3ZZTA 5EGYA 3HF5A 5GADI 3V6KA 4UPIA 2G9YA 2EBEA 2K2PA 1WOOA 5HSPA 3P45B 2WHOA 3KK2B 1EB0A 1CBKA 2B9YA 3LTOA 4ILRA 2ZH2A 4JI5F 1RAEB 2EG2A 2DT9A 2KHDA 4L73A 3VVTA 4DPUA 1PO6A 1IBLF 3S1TA 2JEIA 1RABB 1NSPA 2PDAA 4U9RA 2BW7A 2DCUB 2DIVA 1SV5B 3PJ9A 1FXLA 2OSQA 3E8OA 1H74A 4KH0B 3GZ7A 3V5RA 3WDOA 5KT2A 2RMLA 1WOSA 4DLGA 5HROA 2JX2A 1FKAF 4F4WA 1YRUA 5L1IA 4OL8A 2WCXA 2BQ3A 1N0UA 3D67A 3U7JA 1VC5A 2HK2A 2FC8A 2ZOGA 4DR2J 1OO0B 1MNEA 2UVRA 1SPBP 4EU0A 2L3MA 3CCWA 3NCRA 1AROP 3MPUB 2EFNA 2O66A 4FVCA 1HQAA 3U1NA 4BHQA 1QTNB 2EC0A 4QIGA 3PNIA 5HK4A 1KFSA 1CJVA 1BHNA 4DR1J 1K47A 4TU8A 4OV6A 1LWFA 1LWEB 1P9YA 3AB4B 3EMTA 1VIXA 4CT8A 1U25A 3MDFA 1YJNS 2W5WA 2V68A 4NLUA 4RU9A 4PABA 1NPKA 4O3NA 2XLJA 2MQ8A 2Q1LA 4P74A 4ZVRB 3KLGB 2ZC3A 2GVZB 5DETA 2QG9B 2Q3PA 4AXJA 2IM2A 1Z4UA 3GIKA 5DLTA 4OQJA 1EQ0A 4OJGA 3D3CJ 1WHVA 2WRMA 5D78A 2CAJA 3DRRB 3LA0A 3TAQA 1NK7A 1L3UA 1T7PA 2DCLA 1PBAA 1SC3B 2D69A 3Q8UA 2C2KB 4PKDB 3T41A 2VDHA 4ED6A 3OTBA 1RAGB 1X5PA 3B78A 1AT1B 4M5KA 4OYWA 1PKUA 4P52A 2VIHA 2ATCB 3U02A 2XO7A 1KFDA 3T1AA 4KQZA 5L0KA 4RR5A 2XCPA 3R5AA 3RU0A 3TQEA 1F1BB 4HR2A 5HQMA 3UN5A 2NREA 1AFJA 2ZEJA 3IG1A 2B4VA 3BN4A 3PIPQ 4PPDA 4ZS6A 3K58A 1KRPA 5JUMA
chains in the Genus database with same CATH topology
1ED9A 4CXSA 3LXQA 1EI6A 5LRNA 1KH9A 5GRRA 3M7VA 1ANJA 1HDHA 4LRAA 2W5XA 5L0BA 4ZG6A 2GSUA 5GOVA 4N7TA 1K7HA 2ANHA 5LIAA 1EW2A 4LR8A 3E2DA 2GSNA 5LQQA 1KHNA 1AJDA 2IFYA 2W5VA 4KAVA 4CYRA 4ZGAA 4YR1A 3BDFA 4UORA 2W8SA 1ED8A 1P49A 3WAXA 3IGZB 3DYCA 3SZYA 3DPCA 1ELXA 4MHXA 2VQRA 3B5QA 1KHKA 4KJGA 1KH7A 1HJKA 1ZEDA 4QAXA 1URAA 4KAYA 5K4PA 3ED4A 1SHNA 2D1GA 2W5TA 1ELYA 4LR7A 5TJ3A 3NKRA 1Y7AA 4ZG7A 3M8WA 3WAVA 1N2LA 4LRDA 1ELZA 4CXKA 4GTWA 1EJJA 3NKNA 1O99A 4LRBA 3M8YA 1ALKA 1ALIA 1E33P 4LR2A 3WAWA 2GA3A 3TG0A 4GTZA 1AUKA 5IJQA 1KH4A 4FDIA 4UOPA 4CXUA 5L0EA 1AJAA 2IUCB 2IUCA 5L0KA 1KHLA 3TX0A 5C66A 3IGYB 2GLQA 3WAYA 5DLWA 1ZEBA 4UPIA 2G9YA 4LREA 1E1ZP 1B8JA 2ZKTA 1ALJA 4LQYA 4TN0A 3M8ZA 1E3CP 3KD8A 4NWJA 4UOOA 1KHJA 3A52A 3NKOA 1EQJA 3T01A 3UN2A 3UO0A 1ALHA 4UPLA 5DLVA 1AJBA 3T02A 2X98A 3UNYA 2GSOA 3MK2A 1EW9A 4GTYA 5INHA 3OT9A 3UN3A 3BDHA 3BDGA 1Y6VA 3BDGB 5KXAA 5LRMA 4FDJA 4ZG9A 1EW8A 3NVLA 3IDDA 4UPKA 4MY4A 4UPHA 1HQAA 3T00A 3NKPA 1SHQA 5EGHA 3TWZA 4KJDA 2QZUA 1FSUA 1AJCA 4CYSA 5EGEA 1ZEFA 2W5WA 5AJ9A 3Q3QA 3CMRA 3NKMA 5DLTA 4NWXA 1O98A 4LR9A 1E2SP 1URBA 2RH6A 5HRTA 2W5QA 4GTXA 4LRCA 3NKQA 1ANIA 2W5SA 4MIVA 3SZZA 1KH5A 3MK0A 2W5RA 2W8DA 4KM4A 1N2KA 4B56A 2XR9A 4LRFA 3UN5A 3WBHA 2XRGA 5IJSA 3MK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ED9 A;  4CXS A;  3LXQ A;  1EI6 A;  5LRN A;  1KH9 A;  5GRR A;  3M7V A;  1ANJ A;  1HDH A;  4LRA A;  2W5X A;  5L0B A;  4ZG6 A;  2GSU A;  5GOV A;  4N7T A;  1K7H A;  2ANH A;  5LIA A;  1EW2 A;  4LR8 A;  3E2D A;  2GSN A;  5LQQ A;  1KHN A;  1AJD A;  2IFY A;  2W5V A;  4KAV A;  4CYR A;  4ZGA A;  4YR1 A;  3BDF A;  4UOR A;  2W8S A;  1ED8 A;  1P49 A;  3WAX A;  3IGZ B;  3DYC A;  3SZY A;  3DPC A;  1ELX A;  4MHX A;  2VQR A;  3B5Q A;  1KHK A;  4KJG A;  1KH7 A;  1HJK A;  1ZED A;  4QAX A;  1URA A;  4KAY A;  5K4P A;  3ED4 A;  1SHN A;  2D1G A;  2W5T A;  1ELY A;  4LR7 A;  5TJ3 A;  3NKR A;  1Y7A A;  4ZG7 A;  3M8W A;  3WAV A;  1N2L A;  4LRD A;  1ELZ A;  4CXK A;  4GTW A;  1EJJ A;  3NKN A;  1O99 A;  4LRB A;  3M8Y A;  1ALK A;  1ALI A;  1E33 P;  4LR2 A;  3WAW A;  2GA3 A;  3TG0 A;  4GTZ A;  1AUK A;  5IJQ A;  1KH4 A;  4FDI A;  4UOP A;  4CXU A;  5L0E A;  1AJA A;  2IUC B;  2IUC A;  5L0K A;  1KHL A;  3TX0 A;  5C66 A;  3IGY B;  2GLQ A;  3WAY A;  5DLW A;  1ZEB A;  4UPI A;  2G9Y A;  4LRE A;  1E1Z P;  1B8J A;  2ZKT A;  1ALJ A;  4LQY A;  4TN0 A;  3M8Z A;  1E3C P;  3KD8 A;  4NWJ A;  4UOO A;  1KHJ A;  3A52 A;  3NKO A;  1EQJ A;  3T01 A;  3UN2 A;  3UO0 A;  1ALH A;  4UPL A;  5DLV A;  1AJB A;  3T02 A;  2X98 A;  3UNY A;  2GSO A;  3MK2 A;  1EW9 A;  4GTY A;  5INH A;  3OT9 A;  3UN3 A;  3BDH A;  3BDG A;  1Y6V A;  3BDG B;  5KXA A;  5LRM A;  4FDJ A;  4ZG9 A;  1EW8 A;  3NVL A;  3IDD A;  4UPK A;  4MY4 A;  4UPH A;  1HQA A;  3T00 A;  3NKP A;  1SHQ A;  5EGH A;  3TWZ A;  4KJD A;  2QZU A;  1FSU A;  1AJC A;  4CYS A;  5EGE A;  1ZEF A;  2W5W A;  5AJ9 A;  3Q3Q A;  3CMR A;  3NKM A;  5DLT A;  4NWX A;  1O98 A;  4LR9 A;  1E2S P;  1URB A;  2RH6 A;  5HRT A;  2W5Q A;  4GTX A;  4LRC A;  3NKQ A;  1ANI A;  2W5S A;  4MIV A;  3SZZ A;  1KH5 A;  3MK0 A;  2W5R A;  2W8D A;  4KM4 A;  1N2K A;  4B56 A;  2XR9 A;  4LRF A;  3UN5 A;  3WBH A;  2XRG A;  5IJS A;  3MK1 A; 
#chains in the Genus database with same CATH topology
 4PYD A;  3M8P A;  3HP6 A;  3D28 A;  1TL5 A;  2R2S A;  2CNK B;  2PN6 A;  1U2F A;  1QTM A;  5AXK A;  4DV2 J;  1S4F A;  1ZM4 A;  1QDU B;  2QEX S;  3JQM A;  2HEK A;  1RWU A;  3DLK B;  3EDR B;  1IVZ A;  4K5R A;  3C6U B;  4FBU A;  4ECQ A;  3FUY A;  2G9O A;  5D0H A;  4N76 A;  1TFW A;  2BMB A;  4GKJ J;  1KHN A;  4C8L A;  2F4V F;  4F8R A;  5F3T A;  3QLH A;  4WYL A;  4NL5 A;  3DCA A;  4DPX A;  1KVI A;  3SZY A;  2FHJ D;  3DPC A;  2Y1I A;  4RBT A;  2ASJ A;  2RQK A;  3MFI A;  4OJ1 A;  3DNC A;  2QMX A;  3OR2 A;  4LFB F;  3KLF A;  4PG4 A;  1WWH A;  4GC7 A;  1U1R A;  4RW8 B;  1S9G A;  4NMX A;  1JXL A;  1PJ6 A;  3TVK A;  3I56 S;  2Y8W A;  3N28 A;  3ET6 B;  3KNG A;  3IM9 A;  2V5H G;  1FK9 A;  1GX5 A;  4X4O A;  4L3N A;  2R8K A;  3J7A N;  2CYY A;  1HL6 A;  2DIT A;  2MST A;  3KLE B;  3H5U A;  3OL7 A;  3K5N A;  1JLC A;  5FII A;  3G4S S;  3L09 A;  2GZO A;  3A8E A;  2VQF F;  3JS9 A;  1MW7 A;  2C2Z B;  4YUD A;  2FGC A;  3KK1 A;  2GMJ A;  2V9W A;  3QFW A;  3Q8Q B;  3AAW B;  2F9J A;  1UMJ A;  4G65 A;  5CAA A;  1EAY C;  5L1L A;  4CO5 A;  2FY1 A;  2IY5 B;  4PG7 A;  4JI3 F;  4JV5 F;  5F8J A;  3ZTR A;  1YJU A;  5HI7 A;  2QA4 S;  4DR4 F;  3M9N B;  2W9C A;  2VH7 A;  2HRT A;  2SXL A;  5BYR A;  5KG2 A;  4EYH B;  3D6F B;  2FJE B;  1BXN A;  2YBV A;  3BYR A;  4M94 A;  5ADZ A;  1RTJ B;  2QV6 A;  2EWH A;  3I0S A;  3KDO A;  3J80 U;  2MGZ B;  1ZAV A;  4ZPV R;  3VAM A;  2AGQ A;  1LNQ A;  2X1G A;  4N8O A;  2AYG A;  1ALJ A;  3PX4 A;  4DV2 F;  1KVJ A;  1WUU A;  2RIJ A;  3G82 B;  4Q7A A;  3MPY A;  5DDO C;  1N48 A;  2CRL A;  5E41 A;  1WHX A;  4ZP9 A;  2ZH7 A;  3WX8 A;  3EX7 B;  1QAI A;  1LXN A;  3E2E A;  1B3T A;  2R7S A;  1RAJ A;  3LP0 A;  2CZV C;  3G6V A;  1BQM A;  2DYA A;  3D66 A;  4JV1 A;  1R8P A;  3FSY A;  5E3A A;  1VJW A;  4OX9 F;  3RAX A;  2PT0 A;  3MR7 A;  1X4E A;  4ZVF A;  3EYZ A;  2BR0 A;  1N5Y B;  4R0E A;  1S1U A;  2IVY A;  2UUA F;  1F60 B;  1E6Y B;  1G1X A;  4ZLJ A;  2C3O A;  3BDG A;  1B7Y B;  3P5B P;  1LFW A;  4DR1 F;  2PO4 A;  3Q8Y A;  5C5J A;  4UPK A;  4UPH A;  3CD6 S;  1HW9 A;  4DPO A;  4IR9 A;  2MDA A;  2FZG B;  2R7O A;  4KRW A;  3R7N B;  2HQD A;  3QFH A;  2RS2 A;  4F2R A;  5C24 A;  3Q0A A;  5I42 B;  1FEH A;  3CVK A;  2WW4 A;  1U26 A;  4DQS A;  1YHQ S;  2UVU A;  3TYT A;  1O8B A;  1RCX B;  3FDS A;  5D6G A;  1ELO A;  4EUV A;  2IPO B;  1DJ0 A;  2DGO A;  2HQF A;  3VAI A;  2BW2 A;  1NSK L;  2R7T A;  4WZQ A;  1LWC B;  2YQ0 A;  2RH3 A;  3GR1 A;  1RWW B;  2HS4 A;  4ES3 A;  3QIP A;  5L0E A;  4DFK A;  2V8P A;  5F8L A;  4LF6 J;  1O0P A;  3ONQ A;  4LRC A;  5LSO A;  2OPP B;  2YKP A;  3L7P A;  1U2R A;  3VGT A;  5KT7 A;  4J9M A;  4WTO B;  1SKS A;  4KV8 A;  5GMD A;  1D9A A;  1U49 A;  3IO1 A;  1CUL A;  1PAU B;  2FYX A;  2DR5 A;  4TU9 A;  3M6V A;  4UQG A;  1WI6 A;  1TL4 A;  3EXC X;  3M4X A;  4KO0 B;  4AXI A;  4JI1 F;  4PWD B;  2KRR A;  4I1T A;  1U1M A;  1TL7 B;  3IG1 B;  1YJ7 A;  3PRV A;  1FJE B;  3TVY A;  4R8U A;  3DLL Q;  3CD0 A;  1QSL A;  4LF9 F;  4HT5 A;  2C2E A;  2KH9 A;  3M8P B;  3DHX A;  4OZ1 A;  3TUZ C;  2HQ3 A;  4K4U A;  5LRN A;  3H90 A;  1OY6 A;  1KLM A;  2A18 A;  4LRA A;  5F0W A;  2LQ9 A;  1QE1 B;  1R6Y A;  3I5C A;  4Y28 C;  2IDL A;  1DTT B;  4WE1 A;  1RWM B;  4KH1 B;  4WK3 A;  3RR8 A;  4FF3 A;  2ANH A;  3DLK A;  5D3G B;  5LMU J;  5LIA A;  1M1H A;  1R3N A;  1IQT A;  1MLA A;  4NLX A;  1KVK A;  1QUP A;  3V6D B;  4F02 A;  1FXR A;  2KTQ A;  2HFZ A;  1PYO B;  1GX6 A;  2IYI A;  1GXT A;  2Y1L B;  2DH9 A;  4NZ0 A;  5HN0 A;  1IBK J;  3CTR A;  2E9R X;  1RYS A;  1CQN A;  1L3K A;  4KYZ A;  3GQC A;  1YDL A;  1ZBT A;  3FBC A;  3BGU A;  2HHH F;  1ZA1 B;  1HPZ B;  4Y2A A;  1KWM A;  4A8W A;  3HZG A;  4HEA 9;  2RHS B;  1DAX A;  3BKT A;  3RB3 A;  3CJ8 A;  1ACM B;  2CWK A;  1WKL A;  4BS2 A;  2E7X A;  5AXN A;  2E7V A;  4MK8 A;  4YR0 A;  3GB0 A;  4NI2 A;  2ZDP A;  3O1L A;  3IGV A;  3E3X A;  3MM6 B;  3LP2 A;  2OFG X;  2HK3 A;  2XNQ A;  1Y7A A;  1ULR A;  1NU4 A;  5DDP C;  4DPW A;  3PCO B;  2L08 A;  2DRD A;  3TW0 A;  3MED B;  3CMQ A;  4FDF A;  4WTY A;  4FF4 A;  2BE2 B;  2EG1 A;  1E33 P;  3MM5 A;  3MGJ A;  4S0M A;  4DL0 C;  4JI8 J;  2V2Q A;  1RTI B;  3DMJ A;  4GVB A;  1N8R T;  4JYA F;  2GA3 A;  1CQM A;  3AQP A;  4CLP A;  3N9U C;  3IGN A;  4OZJ A;  5KG3 A;  4KGZ B;  1IUJ A;  1G2E A;  5DRK A;  5IJQ A;  3MTK A;  4UZB A;  4UOP A;  2DR9 A;  1AJA A;  4DOZ A;  4I6A A;  4FNI A;  5B0F A;  4LF6 F;  4CLU A;  3MUR P;  1DHM A;  3TX0 A;  1YJW S;  3GG1 A;  3R5B A;  4NCG B;  4B17 A;  1X5O A;  6FDR A;  3AB2 B;  1PC5 A;  3OHB A;  3JTO A;  4RLE A;  4MK9 A;  3MEG B;  3OJS A;  1S1W A;  3AXK A;  3ZZR A;  1TV6 A;  1RAA B;  1N33 J;  4J37 A;  2P9G A;  2XZW A;  4TYA A;  3JB9 k;  4IYQ A;  4ED5 A;  2AEJ A;  3QJP A;  5U47 A;  2HND B;  4MT1 A;  4EI2 A;  2HQC A;  1WNE A;  1TR0 A;  1F5A A;  2D3Z A;  2BKN A;  3N01 A;  3FSX A;  3TO8 A;  2A1B A;  2H54 B;  4X65 F;  1IN0 A;  1S1U B;  4M5D B;  4CLT A;  3F73 A;  2HHU A;  2NSB A;  2E5J A;  2ABY A;  2VG6 B;  3EM1 A;  4OYO A;  4Q5V A;  1HBN A;  1NEE A;  1RUS A;  4F04 B;  1WEL A;  3UVJ B;  1KTQ A;  3HSG A;  1RHR B;  1UVI A;  4N8N A;  3BH6 B;  5FDL B;  2NQP A;  2VZ9 A;  1W2B R;  1RQ0 A;  6FD1 A;  2FVS A;  3O5T B;  1NDC A;  3NBP A;  1ZM9 A;  4XK8 C;  5KFK A;  1ZH5 A;  4OI3 A;  2MQO A;  1X4B A;  1TAQ A;  3GCX P;  3H5S A;  3PG9 A;  2ZOM A;  1J5E F;  4DQR A;  1HNI A;  3D0H E;  5EGE A;  2MKH A;  2KRB A;  4NA2 A;  4P2F A;  3BSO A;  4JI2 F;  4ILL A;  2OPQ A;  4EZ6 A;  2BE7 D;  1CJT B;  4PG5 A;  1NK6 A;  3C46 A;  2MQN A;  3ZXW A;  5KFD A;  1LW0 A;  2KO1 A;  4A4J A;  2N7Y A;  2YKM A;  5D0G A;  2M9K A;  3EPG A;  1IKY A;  3RRK A;  3QIP B;  1P1L A;  5T41 A;  4K2X A;  1R27 B;  3KFW X;  3UI3 A;  3CC4 S;  2JSX A;  5LSL A;  2W5R A;  3HT0 A;  1L3T A;  4K4W A;  5IM0 A;  2MYF A;  2V4J B;  3I31 A;  4KV8 B;  1C1B B;  3R5G A;  2V50 A;  1S6Q B;  4FYX B;  3W7B A;  2RU9 A;  3JAM U;  2VPZ B;  3KMS A;  1WOP A;  4ZP7 A;  3G6X A;  1QAJ A;  4LSN B;  2RRN A;  4MTP A;  1GNK A;  2HBY B;  4MKV A;  5IT4 A;  2DPJ A;  4O3R A;  1RBL A;  1RTH A;  2YKO A;  4F0M A;  1JLB A;  1NCL A;  4F50 A;  1B7F A;  4DI6 A;  2ZJR Q;  1ED9 A;  2M3D A;  4FBT A;  1UEK A;  3BQ0 A;  4DZD A;  1U48 A;  1UPM B;  1QJH A;  4V1A k;  2BAC A;  4NLD A;  2LDI A;  3EJM A;  2MQL A;  2BAB A;  2NPF A;  5CYJ A;  2HLU A;  2IHR 1;  3DRP A;  2VHG A;  2ASD A;  3VF0 B;  2IA6 A;  1VRU A;  2XS7 A;  2VOD A;  5EN1 A;  3E2D A;  1G6B A;  1HHQ A;  1SH3 A;  1VYA A;  5HBM B;  2E5G A;  3PYE A;  4YDD B;  1VRT B;  4ZPT R;  3Q2T C;  4GKK F;  2R7U A;  1APS A;  2A6O A;  5GAE U;  2DR6 A;  5AJ3 F;  2NPI A;  4ELU A;  3NGS A;  1RE1 B;  2PMW A;  4UZC A;  1SIZ A;  2CQ4 A;  3UDV A;  2GHW A;  2V6A A;  3U27 A;  4RNF A;  2WON B;  2BDP A;  3CDW A;  4FZV A;  4QPX A;  2R8I A;  1DLO A;  1Q8L A;  4Q2M A;  4R0J A;  1NLK L;  3OTD A;  2CJY B;  4DX5 A;  4NI2 B;  1AFI A;  1HBM B;  1WC5 A;  1M90 T;  2CWX A;  4JP8 A;  4LBH A;  3GR0 A;  3HI9 A;  1U1N A;  3HVT A;  3BGO P;  2AT1 B;  2WOM A;  2P2C B;  4USU A;  4HH1 A;  4LR2 A;  2NXU A;  8AT1 B;  5LT5 A;  3CE8 A;  3N6N A;  1PC4 A;  4I68 A;  4JI2 J;  4NXN F;  3TG0 A;  1Q8I A;  3G71 S;  2ZHB A;  1YX2 A;  4EEY A;  4CTA B;  3SV3 A;  4DPT A;  3R7B B;  3A3P B;  4LVO P;  4NLG A;  1SJ1 A;  1QUV A;  2I38 A;  1C0T B;  2VV5 A;  3E51 A;  3IWX A;  4NRU A;  4LSZ B;  1KQK A;  9RUB A;  1VC6 A;  1JKH A;  3IFE A;  4WJB A;  1H0H B;  2AU0 A;  4DU8 A;  3H2L A;  3RW6 A;  4DN0 A;  1XER A;  4W98 A;  5J2M B;  3C16 B;  1E1Z P;  2MJN A;  2ZUA A;  2R2R A;  2YTC A;  4TN0 A;  3F41 A;  3M8Z A;  4MKY A;  2WSE C;  1AA1 B;  1HD0 A;  1VOM A;  2HVZ A;  3NKY A;  4QJV A;  4BC9 A;  4URG A;  3FFI B;  1FNM A;  1S9E A;  2ZH4 A;  1Q82 T;  4BDP A;  1T95 A;  1VIO A;  5HMX A;  5DQI A;  4BWJ A;  2ZH8 A;  1C0U A;  1OQ6 A;  3I4H X;  4PYA A;  1GK8 A;  3QGP A;  4X4S A;  3T01 A;  1U24 A;  1ALH A;  2EC2 A;  1GMV A;  2H65 B;  5D8H B;  2LQ8 A;  3V6J A;  2X3D A;  4Y2I A;  3MMA B;  3WIU A;  5C42 A;  4O3S A;  2QIF A;  3KLV A;  4USV A;  4Q43 A;  5J2N B;  2GVD A;  4F0H A;  3K0J A;  4QIE A;  1XC9 A;  1WEX A;  2LA6 A;  5KFN A;  4IG3 B;  1TAU A;  3RBZ A;  1ZAX A;  4USI A;  3W2V A;  1Q8B A;  2JWN A;  3N5B A;  1XR7 A;  4E98 A;  3DYA B;  5AE1 A;  3QZ8 A;  3K8V A;  4MY4 A;  2KM8 B;  3CCS S;  3PW5 A;  2GNK A;  2M5Y A;  2ZKU A;  1W7W A;  1YSJ A;  5ETN A;  4IDK B;  2BEF A;  2VG7 B;  1RU2 A;  4P73 A;  2WSC C;  3F44 A;  4MYU A;  3GFX A;  6AT1 B;  1LWF B;  2V0N A;  1K0V A;  2C3U A;  2JZ5 A;  1S0O A;  5A2Q Y;  2ZE2 B;  3BDE A;  3GCW P;  3LAN A;  4GTY A;  3Q8V A;  2DNO A;  1HHT P;  1UZD A;  2OPQ B;  5AE3 A;  3LQV A;  3KLG A;  1EP4 B;  4X62 J;  2YKM B;  2ZBI A;  2GV1 A;  4JI6 J;  3Q8P B;  1IWG A;  2BBE A;  1WOR A;  4DL3 A;  1S12 A;  2LEP A;  4Y0F A;  2OAU A;  1JMT A;  5DZ7 A;  1RA6 A;  3W8G A;  3DRY A;  4MJK A;  5EUH A;  3HKZ D;  4EBD A;  5D4O A;  2CPE A;  3NS6 A;  3PR4 A;  1TMM A;  2DR8 A;  1N2K A;  3H25 A;  1S76 D;  2FHO B;  1Q8K A;  3UWT A;  2HQG A;  3M8S A;  2MZS A;  1UJ6 A;  1IBM J;  1MSW D;  5HMY A;  2W8K A;  2K3I A;  2BUN A;  4R5P A;  4CXS A;  1WF1 A;  3QRQ A;  4HHH A;  1EKR A;  1CC7 A;  4YQW A;  2YWW A;  4QPT A;  1D8Y A;  3HM9 A;  2BZ2 A;  3ITH B;  2IJF A;  3OFE A;  1AB8 A;  5GOV A;  2NYI A;  4IRK A;  4W4M A;  4DS5 A;  2R8J A;  5LQQ A;  2BYC A;  1AJD A;  1UJ5 A;  1RT6 A;  1OSC A;  1IWA A;  1KDN A;  2W4P A;  3NCQ A;  2ZFH A;  4OI4 A;  5KG1 A;  4OJH A;  2MKS A;  2QRR A;  3PFE A;  3QGI A;  2OUG A;  2AJ4 A;  1AZS B;  3ZZP A;  2E66 A;  4WFY A;  4KHP F;  1JIH A;  5F3Z A;  4OYP A;  2I6W A;  3GV5 B;  2VQE J;  2JHE A;  3KJV B;  3BF4 A;  2UVW A;  3BKU A;  3KLF B;  3CUL A;  2R9L A;  2NZ4 A;  1VQ9 S;  1URA A;  2VUG A;  4QU7 A;  2KT2 A;  5GAH U;  2ZM6 J;  2WON A;  3JXO A;  1M5K C;  3R2C J;  3SSS A;  2W2M P;  2AHO B;  3CJ5 A;  4MYT A;  2CJX B;  4DV5 J;  1WEZ A;  4OYM A;  2VA2 A;  3MAA A;  1EZZ B;  2L48 A;  4CO3 A;  2R8H A;  1SH0 A;  4DL6 A;  4ZA1 A;  3OTO J;  1YBT A;  4J90 A;  3M8W A;  4X64 F;  3QT5 A;  2XSJ B;  1ELZ A;  4ECT A;  1S4E A;  2CQG A;  2A3J A;  1HD1 A;  3JSY A;  2WSF C;  5L46 A;  2FB0 A;  1AJC A;  1QD1 A;  2B6A A;  4DR7 J;  1PBU A;  2UUB F;  1S77 D;  1GT8 A;  4N41 A;  1UVN A;  2O67 A;  2FPH X;  3HHN B;  1RHJ B;  3VCD A;  5KOX A;  1AUK A;  1R7I A;  2J0W A;  3DU5 A;  3Q24 A;  1N36 J;  5ETS A;  3ZO7 A;  4CTA A;  4FDI A;  3GFH A;  4TY8 B;  3CCL S;  2RDI A;  4N77 A;  5H9F K;  3KG0 A;  3CCZ A;  1O5J A;  4NOH A;  1HNZ J;  3TUP A;  3WAY A;  3ISZ A;  5J2M A;  2W4D A;  1VC0 A;  4A48 A;  4OYI A;  5E3Q A;  3MM7 A;  1XWL A;  3THV A;  1NB7 A;  1I6J A;  1QSY A;  2GA7 A;  3TEG A;  3QPI A;  4RNM A;  3I0R B;  5B7W A;  3EIC A;  3KJF B;  2IIH A;  4IFY A;  2N4D A;  2V2Z A;  2DXF A;  2CQ1 A;  4C3M A;  4CP5 A;  5B09 A;  1S6O A;  4J5O A;  4OZ2 A;  5EWE A;  4TKT A;  5K8M A;  4OX9 J;  4KSE B;  2CJ9 A;  3LP0 B;  2PC6 A;  5LL6 d;  5MAO A;  2Y8Y A;  1X4D A;  4FVM A;  1VDH A;  3HHD A;  2R7R A;  1Q5V A;  2ZHO A;  3PW2 A;  1X5S A;  1VI7 A;  5C7P A;  4RW9 B;  1EW9 A;  4KPY A;  4F67 A;  5I3U A;  4C11 B;  2YNF B;  3NEK A;  4WFZ A;  2HWT A;  3CB4 A;  4ZPD A;  4USW A;  3CCV S;  3KWM A;  4J9Q A;  4DFJ A;  1PSD A;  1U2C A;  2DBB A;  2VC0 A;  2FIU A;  3ZNJ 1;  3LAL A;  3G8T A;  3ENW A;  4OZL A;  4ZVP B;  3KLH B;  3BB5 A;  2Y3Y A;  3AQO A;  1SH2 A;  4KGX B;  4OLO A;  2C3P A;  4UOC A;  3TWZ A;  5KG5 A;  3BQ2 A;  2AEM A;  2NSC A;  4ED2 A;  1Q86 T;  4WKR A;  5DQH A;  5DDR C;  4OX6 A;  1YI2 S;  1T9V A;  2DO0 A;  2GO9 A;  2GS8 A;  3CPW R;  5K5M A;  1RJJ A;  1TFY A;  4IOC Q;  4DWI A;  3CMR A;  1N34 F;  1N36 F;  2Q6C A;  5B0G A;  2ACM A;  2MJU A;  1F9F A;  2OFH X;  3O6Q A;  1FFS B;  3VAJ A;  3EVW A;  3KHL A;  1B4S A;  3TAR A;  2HBZ B;  2ERR A;  1G4C A;  1NJX A;  2OLW A;  3H7H B;  5A8K A;  2OPP A;  2OPS A;  5G0R B;  4Z2X A;  4X62 F;  2JJ4 D;  2V69 A;  3TOQ A;  4LF7 F;  3H4D A;  3HLU A;  1R0B G;  1A0O B;  3MWB A;  3JYT A;  2B3T B;  2J5A A;  4WP9 A;  1F6T A;  2YPY A;  2CQB A;  4RO0 A;  5G4D A;  5A0Y A;  3PHE A;  3GJQ B;  3VQS A;  1YRT A;  2Q43 A;  1RTD A;  1SBR A;  2WB4 A;  4WYW A;  1MWZ A;  1LK5 A;  2QX0 A;  4L6V 3;  4CNZ A;  4A8Y A;  4IR1 A;  4B56 A;  3MM9 A;  3CO9 A;  3HSJ A;  2W2P P;  1TL7 A;  3ISN C;  4MFB B;  2GCF A;  3C8Y A;  3A13 A;  1Y3K A;  4M5H A;  1U1P A;  2WTF A;  2KVQ E;  2MLZ A;  1LEO A;  1S99 A;  3D9B A;  1XMO J;  5CYQ B;  2VB6 A;  1K73 T;  2AX1 A;  1AW0 A;  5D4L A;  3PR5 B;  4FS2 A;  2XTJ P;  3ITH A;  4CDI A;  4YR3 A;  3TZY A;  4NLS A;  4JI4 F;  2UXD J;  1Q4R A;  2DHA A;  2D9P A;  2H48 B;  1MG7 A;  2Y0S D;  4YS2 A;  1SKW A;  1D09 B;  3IR6 B;  4OHY A;  5E3C A;  3RBX A;  3RB0 A;  1URR A;  2LQB A;  4IH7 A;  4OZ3 A;  4A8K A;  3QMQ A;  2ZJP Q;  4I6Y A;  3SQO P;  3QO9 A;  4AE5 A;  3BQ1 A;  2H1Y A;  1M5P C;  4OI0 A;  1IM4 A;  2APO A;  2B9E A;  4ZP8 A;  4DU7 A;  2HHS A;  2F63 A;  5M2U A;  3J81 Y;  1D1U A;  2CPH A;  4ZKA A;  1SUQ A;  2MLX A;  4EBE A;  4C97 A;  3A4T A;  2UUA J;  3QJJ A;  1HJK A;  1NJI T;  1NKB A;  3NL0 A;  2IBO A;  3HSZ A;  4MK7 A;  2VQE F;  1FJC A;  3K89 A;  3OVB A;  2XCA A;  4K59 A;  3C2P A;  2VPY B;  2YVS A;  1M1K T;  1RK8 A;  1GFW B;  4J9P A;  1FHT A;  3D1H A;  3RJM B;  3UE2 A;  3P8B B;  3W2W A;  2I5J A;  2RF2 B;  1I94 J;  2IMW P;  3IAM 9;  3W8P A;  4MIB A;  2HFV A;  1LKZ A;  2J6T A;  2C42 A;  4LT6 A;  5HAO A;  4DV3 J;  1U8S A;  2KDO A;  4U8Y A;  3W64 A;  3A3O B;  3K5M A;  2G4B A;  4TXS A;  2FJA B;  2QGF B;  1KD1 T;  2O1P A;  3GG0 A;  3DMJ B;  2UV8 G;  4QCL A;  1IR2 A;  3EZO A;  2W1B A;  1X9M A;  4B9S A;  5I4M A;  4PUO A;  4C8Z A;  1S1V B;  3DKD A;  4JI1 J;  3NNC A;  3ILI A;  2XBP A;  4DR6 J;  5HQ8 A;  4E8U A;  2HZA A;  2O01 C;  2IFX A;  3OXG A;  4DS4 A;  3PZP A;  4RW6 B;  4HHU A;  2XMJ A;  3DXS X;  1NK5 A;  2GLQ A;  3IGY B;  1XMB A;  3QZ7 A;  2LDY A;  4QYZ K;  2W01 A;  4NWJ A;  4X4T A;  1Y5I B;  5DG9 A;  2K8G A;  4E2F B;  4ECW A;  1TP7 A;  2ZIT A;  4G1P A;  1JLF B;  2B8Q A;  2B4P A;  4OIX A;  2IFY A;  1MRO B;  1RYR A;  3KOA A;  2VJV A;  1S49 A;  2V8G A;  2CZ4 A;  2QLJ B;  1OPI A;  4O4R A;  1XN9 A;  4ICL A;  1M0S A;  1RLC L;  2OEJ A;  5EX3 A;  3EGW B;  4EZ9 A;  3H20 A;  2KHC A;  2VOO A;  2IC3 B;  4ZLN A;  1O51 A;  5HLF B;  2HVE A;  4IG0 B;  2KM8 C;  2ZM6 F;  1YJV A;  3G9C A;  4KGK A;  4KGV B;  2XMA A;  4DCJ B;  3UVJ A;  3MMC B;  4U6P A;  3IWL A;  4M5M A;  1XJW B;  3IDD A;  3TA2 A;  3IS9 A;  5GMK a;  4CLY A;  5F8G A;  1S1T B;  4KHP J;  3ETO A;  3QT8 A;  4IQM A;  1RWV B;  2XMT A;  1CG2 A;  1SJQ A;  1WC0 A;  5M2R A;  2VF3 A;  4O4G A;  2HNZ B;  4IO9 Q;  2HW3 A;  2W9B A;  1N5S A;  1V3Z A;  4Z37 A;  1URN A;  2RKI A;  4J9V A;  1CJT A;  1RI7 A;  4HDG A;  2QYG A;  3DLB A;  2DH8 A;  1LW0 B;  1VK8 A;  3ILO A;  4NAS A;  3K7R A;  1IKY B;  4J9S A;  3MUM P;  3MMJ A;  4MKA A;  2RRA A;  3HFZ B;  1VQP S;  2X1F A;  2YX4 A;  4WFN Q;  1JXV A;  2P6T A;  3TA1 A;  5KFJ A;  3FRY A;  2ACY A;  3KUG A;  3KK3 A;  4LF4 J;  5LXY A;  2KB2 A;  3OD2 A;  1NHU A;  1PAE X;  3GFY A;  3B4D A;  3R6G B;  2OGU A;  5ETO A;  3TX8 A;  2W4C A;  3CIZ A;  3I9V 9;  1RKI A;  1WSR A;  2QA2 A;  4MH8 A;  4PAA A;  5KOW A;  2XR9 A;  4KM4 A;  4LRF A;  3HX9 A;  1FDB A;  1UET A;  4LSN A;  1H2U X;  1X4H A;  3SDE A;  3OR1 A;  5BXI A;  4ZIT A;  3PO5 A;  4QOT A;  1FFG B;  1RTH B;  2CNN B;  2M7S A;  5J2Q A;  3FVY A;  4DV4 F;  1TMJ A;  2F1F A;  2J7W A;  2PMZ D;  4C8M A;  1U0S A;  3ULH A;  5CYQ A;  1VBX A;  4LF9 J;  1TK8 A;  2G2Z A;  5GRR A;  3B6B A;  1HI1 A;  1VQ8 S;  5L0B A;  5CA5 A;  2RHQ B;  2J76 E;  2VC1 A;  3CT9 A;  5BYQ A;  3THP A;  2ZH1 A;  3C6U A;  5IOL A;  2LXU A;  3MEC A;  4IFV A;  2U1A A;  2ZH6 A;  4CYR A;  1JK9 B;  5A76 A;  1HI0 P;  4OYX A;  4K50 A;  2W8S A;  1D9F A;  3DRS B;  4UOR A;  3L7O A;  2VD3 A;  4M5L A;  2HHV A;  1VQL S;  1HWI A;  2RIL A;  2XO6 A;  1S5Z A;  3OR2 B;  2CDQ A;  3OXL A;  4RKU C;  3DGV A;  3PEJ A;  3DOM A;  1ZED A;  1X5T A;  2C2D A;  4QIW D;  1DTQ B;  1SHN A;  1MN7 A;  4AQY F;  4X4U A;  3OTE A;  4MIW A;  4LFB J;  2MZT A;  4F26 A;  1FES A;  1J2V A;  1S59 A;  2BXJ A;  1HBM A;  3C15 A;  2HMI B;  4JI7 F;  2OP5 A;  4DG1 B;  4RBU A;  3KLE A;  1GTH A;  5M2P A;  4ECY A;  4QR1 A;  3HVT B;  2KXN B;  2H3E B;  4JI0 F;  3NKN A;  4ZVH A;  4U96 A;  5RUB A;  4C8O A;  3JQK A;  3ZC4 A;  1SC1 B;  5DLF A;  2DNG A;  3V4I B;  2WOM B;  1S97 A;  4AND A;  1MWY A;  2FLO A;  1EJ7 L;  1RAI B;  4K4Z A;  3A12 A;  4AFF A;  2Z30 B;  1FT8 A;  3EGN A;  4ZP6 A;  1TKT A;  1KH4 A;  4Q44 A;  2W9C B;  1D3W A;  1XK8 A;  5KFA A;  4DUT A;  5HVG A;  2FDN A;  2IUC A;  3DI6 A;  4HHJ A;  4KT0 C;  2FHK A;  3KMQ A;  1WC3 A;  1JKH B;  1S7I A;  2ZBR A;  2MGZ A;  1FWL A;  4L76 A;  1UA1 A;  4MMO A;  2CPJ A;  4ER8 A;  4C4W A;  2LQJ A;  2R8G A;  3H2V E;  1PYS B;  5HP1 A;  3KD8 A;  2O3D A;  3G82 A;  4UOO A;  1NAQ A;  3MPD A;  2PA3 A;  3MFH A;  4YHH J;  1SL0 A;  1HA1 A;  4OI1 A;  4ANE A;  3AA9 A;  3KG4 A;  3TNV A;  3Q8R B;  2KVI A;  3NKO A;  1MRO A;  4FXW A;  1YLX A;  2RQ4 A;  3GSI A;  3AY0 A;  4KGM A;  4KB7 A;  4PXB A;  3UD5 A;  4ENO A;  4ZVE A;  4ATN A;  2HLT A;  1D9D A;  1HMV B;  4DV7 F;  2VDI A;  3JQJ A;  3DGP B;  2ROE A;  4OHW A;  1FRL A;  2JVO A;  2VL1 A;  3DC2 A;  3LW5 C;  1AXQ A;  3HCX A;  3MMA A;  4NA3 A;  5A8R A;  3MCM A;  3PEH A;  4OV1 A;  4PR6 A;  4DCP B;  2HFN A;  1VQS A;  5LXR A;  1N5Y A;  2LMI A;  3H40 A;  2E5L F;  3LOU A;  4F4K A;  1EAR A;  4LVN P;  2D41 A;  1Z2Z A;  4LIR A;  1BWV A;  2G2Y A;  3CCE S;  3CME S;  1VJQ A;  1F3V A;  1EW8 A;  3H98 A;  3QAE A;  2R7Q A;  3DYA A;  3EDQ B;  4X2B A;  1WI8 A;  1AUD A;  4DF8 A;  4ES1 A;  2YWF A;  4J7C A;  3G87 A;  3M05 A;  4IDK A;  3HFV A;  4KJD A;  1RAC B;  4C48 A;  3VAH A;  4D3H A;  5LM7 E;  1FRK A;  4RUH A;  2V4Q A;  4HYK A;  3RBE A;  2OH2 A;  2B7B B;  2MTL A;  4X4N A;  2MY7 A;  5L8R C;  3VHQ A;  4Y3C A;  2W9B B;  3EZ5 A;  1RWX B;  3GSD A;  1CJU A;  3MM8 B;  3BS9 A;  4Y34 A;  2MMY A;  2RKI B;  5K14 B;  4F36 A;  4ZIV A;  1EP4 A;  2E44 A;  2YNI B;  2UZA A;  3RB6 A;  4TVA B;  2RQC A;  3OUY A;  2ATL A;  2J8S A;  2FLN A;  1AYE A;  5J2P B;  3FSI A;  1URB A;  4EO8 A;  1WKK A;  3AJ1 A;  2XHW A;  4FYY B;  4BWM A;  2XMK A;  4PQA A;  3MEE A;  1GMW D;  3FCV A;  2LFV A;  5GAG U;  2HQI A;  1CSJ A;  1DY3 A;  5GAD U;  4DX7 A;  3MR2 A;  2UU9 F;  1CUL B;  1YTY A;  3HHK A;  4XDC A;  4J91 A;  4KO0 A;  1NXI A;  3V81 A;  2EFQ A;  2DRA A;  1KHW A;  1RAH B;  2HHT A;  2OTL S;  3IBW A;  1TK5 A;  2QMU B;  1YZ7 A;  4LMZ A;  1BQN A;  2V9K A;  5ETM A;  3W66 A;  1TKZ A;  5LMN J;  3QGH A;  1KSP A;  2ZWP A;  5K8P A;  2GML A;  3FBF A;  1N32 J;  2K7K A;  4DR5 J;  2OI2 A;  2JDJ A;  2DY1 A;  3HHL B;  4C2M A;  2D74 B;  3QAU A;  2FTR A;  3IXQ A;  2CQ2 A;  2QLW A;  1DTT A;  2NXE A;  3AJ2 A;  3NWR A;  4PWW A;  4WE1 B;  3WHI A;  4ES2 A;  3PKY A;  2GSU A;  1VGY A;  1KQS R;  5D3G A;  3ISN D;  4K4Y A;  1RT6 B;  2BA9 A;  4HTI A;  1PCA A;  3BJY A;  2DNP A;  2GAG C;  3GII A;  4DX6 A;  3BGL A;  4PWU A;  3D2W A;  4DSK A;  4ZPW R;  1QVG R;  2IMO A;  4CRJ A;  4DEZ A;  4DLE A;  2ZH9 A;  1X0F A;  5IT0 A;  1NUE A;  3NGT A;  4B3S F;  4OYB A;  1KHK A;  4UST A;  5HO4 A;  2N82 B;  4FKX A;  4NLW A;  3ED4 A;  3ETM A;  4DJB A;  2XYP B;  3N6L A;  1I51 B;  3B8H A;  2JEJ A;  3MAA B;  4FYV B;  2XI3 A;  3CJQ A;  3M2V B;  1KTV A;  4JBC A;  4ANC A;  2DXD A;  5ITH A;  2N7C A;  3J7Z T;  3M2U B;  2GX8 A;  2YX1 A;  3PYF A;  3QYY A;  2JEF A;  3NKR A;  1Q1K A;  2MQM A;  4M5N A;  4LRD A;  2Y9H A;  3PJW A;  4KFB A;  1R0C B;  1VBY A;  3PVX A;  4OLP A;  4DR4 J;  2B6A B;  1UVJ A;  2OEK A;  4YY3 J;  3MR5 A;  1NH7 A;  4FF1 A;  3VWS A;  1RT2 B;  1KNZ A;  3NS5 A;  1LK7 A;  2MY8 A;  1RCO B;  1WC1 A;  2A2D A;  1U45 A;  4PG8 A;  2HSE B;  2RAQ A;  3NLC A;  1UJ4 A;  3FBB A;  1HQE A;  2VU5 A;  3NP5 A;  4XPE A;  4DUY F;  2NLW A;  1S72 S;  1G3O A;  4KKO B;  3VAL A;  3OLB A;  1Q5Y A;  2VAS A;  2B4O A;  4CI0 B;  2LEB A;  2DB1 A;  2P8I A;  5AT1 B;  3I87 A;  2C28 A;  2LXF A;  4A8O A;  5AXM A;  4ZVQ B;  1REV B;  2DNR A;  2YH1 A;  2KG0 A;  4FPR A;  2PI5 A;  1XNR F;  1P6T A;  5D77 A;  1SL2 A;  4OX8 A;  1QAY A;  3FEY B;  4PQU B;  2CNL B;  5DG7 A;  3QRP A;  4QU6 A;  1KN6 A;  1JNR B;  3FC9 A;  5IZH A;  4I4B A;  1FDA A;  1MWQ A;  1R0A B;  2CVI A;  2UUW A;  3CCM S;  3J81 j;  5FJ4 A;  1FRX A;  5GAH I;  1K1S A;  1H73 A;  1MN9 A;  2BOA A;  4ZK7 M;  1VQ4 S;  2Z4P A;  2OD6 A;  3TZZ A;  4TQR A;  4ZVT B;  2MZ1 A;  3T02 A;  1RAD B;  4QR2 A;  4RWW A;  4LSL A;  3KKF A;  4RW9 A;  1ZZN A;  2R7X A;  3Q22 A;  2BJ7 A;  2CJQ A;  4M5D A;  5INH A;  2DNL A;  1S1X B;  4C0H A;  5I3U B;  3SYZ A;  5KFS A;  2CKW A;  4ILM A;  3HFK A;  4URS A;  5KFI A;  3NVL A;  3F56 A;  3FQK A;  4IRC A;  5J1N A;  3W5X A;  3W5Z A;  3CJS A;  2FHJ A;  1VQM S;  2Z57 B;  2PI4 A;  2GHV C;  3VZH A;  4CLL A;  3KLH A;  1QLN A;  1T9U A;  3ENQ A;  4B3S J;  2QZU A;  2H51 B;  3ILJ A;  1NDK A;  1YJT A;  1RGV A;  1Y0H A;  2HHW A;  5D0R A;  4FPI A;  3FQL A;  4CO0 A;  2G0I A;  4WXO A;  4LQ9 A;  1HNI B;  5H9E J;  3HO1 A;  3QRR A;  3DLG A;  2G1H A;  1NHV A;  2YQ3 A;  2BV3 A;  2HKE A;  3LO3 A;  2HVH A;  5K14 A;  3R5J B;  4HVZ A;  2GVZ A;  4JI7 J;  3OUY B;  5D0E A;  5KFU A;  1IKV A;  1RWP B;  2WVB A;  4J9N A;  2KFZ A;  2CQC A;  4UTG A;  3DRR A;  3DM2 B;  4FF2 A;  4F3Q A;  2VQF J;  2OPS B;  5G0R A;  2D3O R;  1BD6 A;  3MEE B;  4A8F A;  5IC6 B;  1NPP A;  3HXM A;  5F41 A;  3PV8 A;  1C1B A;  2EKY A;  3RUB L;  4XAK A;  1HKA A;  4LFA F;  3S7R A;  5KFF A;  3T1H F;  1T9W A;  4H4O B;  4ED0 A;  5CCL A;  4CH0 S;  2QL9 B;  2V2K A;  2CZ9 A;  1Y10 A;  2K7J A;  2MHN A;  3BN7 A;  3GTY X;  4GMK A;  3ZZO A;  2DO4 A;  1BQN B;  1C2P A;  1RT7 B;  4ZPB A;  3JSM A;  1WG4 A;  4P2X A;  3T1Y F;  1UCN A;  2D3O 1;  4CNY A;  2MZJ A;  3AOD A;  4QIF A;  2PEH A;  3WC2 A;  1T94 A;  2QLB B;  3GLJ A;  4TLQ A;  4CO1 A;  3K59 A;  4B3R F;  4NX9 A;  2W5X A;  4X4R A;  2F8E X;  2G13 A;  3GJS B;  1J5O B;  3A3N B;  5HAT A;  1NKC A;  4IOB A;  3DRP B;  4ZVG A;  1MMN A;  2E9Z A;  4H4K A;  1M5O C;  3UCZ P;  4FXD A;  3K5P A;  2KKH A;  4PPZ A;  5IFM A;  1HIY A;  5CCM A;  2DVI A;  4O3Q A;  3K5O A;  4FS1 A;  2QA4 G;  4GC6 A;  3W9I A;  1GXL A;  4A8M P;  2CG4 A;  1RHQ B;  2ZVI A;  3GJT B;  3H2U B;  3NS7 B;  4K5S A;  4NWB A;  3M30 A;  3ZTP A;  2DNY A;  4RW8 A;  1F2H A;  2XLI A;  4EBC A;  4ECU A;  3OPK A;  4WBF A;  3V6H A;  4B9T A;  3CD5 A;  4N56 A;  1BLU A;  1DLO B;  3FEX B;  2V34 A;  4DQQ A;  5HMZ A;  2F5G A;  3VAK A;  1BC6 A;  4Q8E A;  1F2G A;  1C4A A;  2MPU A;  1NZA A;  2I5J B;  2RF2 A;  4PXE A;  3CO0 P;  4KHM A;  2J9E A;  4PXD A;  3W2W B;  1UVM A;  1HWU A;  1PJ5 A;  1TKX A;  4C8N A;  1DQ9 A;  2EK1 A;  1AUS L;  4QBU A;  3TRG A;  3L3C A;  2E1R A;  2P9E A;  1F5C A;  3VZI A;  5BR8 F;  1Y9O A;  2NCK L;  3Q2S C;  2XEX A;  4I64 A;  2XYH B;  4RU2 A;  1RT2 A;  5HL7 Q;  4PUO B;  4WK1 A;  5J1P A;  5KFO A;  2LU1 A;  3FKB A;  4E0D A;  3W65 A;  4DF4 A;  1YRX A;  1KOH A;  4RBV A;  1OYD A;  4KJI A;  2H4Y B;  4RW6 A;  1RTJ A;  2XMM A;  1HHS A;  2E5I A;  2E7W A;  4B3T J;  3X1L B;  3AHP A;  2XUL A;  5DLW A;  1T3O A;  1TUG B;  2FQQ B;  4FXV A;  4X66 F;  4LRE A;  1IR0 A;  2UU9 J;  4P72 A;  5F9N A;  2BKO A;  4ECR A;  4LF8 F;  1D8Z A;  2VPW B;  4O3O A;  3R9L A;  2DHX A;  3OJU A;  3PYD A;  1S9E B;  2OJ3 A;  1KHJ A;  3QBC A;  5CYM B;  4JI4 J;  4O44 A;  4NXM F;  4CLF A;  1F5B A;  2YNH B;  1C0U B;  2QL5 B;  3POT A;  3T5L A;  3TAM B;  2MB0 B;  3P5T L;  1TL1 A;  4Q0B B;  3T9Z A;  1E6V B;  2VFT A;  5ETR A;  4DBQ A;  2R2T A;  1XMO F;  2Z0G A;  2C22 A;  4P2M A;  4ZPA A;  1RT4 A;  2AQ4 A;  4L72 B;  2JC0 A;  5HAN A;  4LSL B;  3SCI E;  5KG7 A;  3S6E A;  1WC6 A;  2ROP A;  3NWG A;  3UN3 A;  4DZ6 A;  1E6Y A;  4PZV A;  1NJZ A;  3BDG B;  4FDJ A;  4IG0 A;  4X65 J;  3A8J A;  4DSJ A;  2HHP A;  4JUZ A;  1FKO B;  3MMC A;  4Y65 A;  4XO0 A;  2IJN A;  3HVA A;  4Q2L A;  4NYZ A;  1KQF B;  3O8W A;  3GIL A;  1HFE L;  2M4M A;  3GU0 A;  3CUN A;  1T05 A;  1HBU B;  2VG5 A;  3LGH A;  1FNO A;  3HZE A;  3D1O A;  3IBF B;  4TYB A;  1FDN A;  2QO3 A;  1FO1 A;  2RRB A;  5DLG A;  3QSY B;  4UOF A;  1HQ2 A;  1WDT A;  4KTQ A;  3ZZZ A;  4O4G B;  2HNZ A;  4P6Q A;  5AJ9 A;  5HJY A;  2EEY A;  3LWM A;  4LFC F;  4LUB A;  2DHG A;  3GWC A;  1PYT A;  1M5V C;  1WDD A;  3H5Y A;  1T9T A;  1FI4 A;  2DGW A;  3I96 A;  4F4X A;  1DBD A;  3F0N A;  2L9W A;  1O98 A;  1Y3J A;  5KG4 A;  4GRS A;  2P6S A;  1FJG J;  4GTX A;  2UXC J;  2ADC A;  4OJ3 A;  2RDJ A;  4AL5 A;  2M2B A;  3BPS P;  4MIV A;  4W90 B;  1HYS B;  2FLP A;  1EQJ A;  2CQP A;  4OFZ A;  4EYI B;  2Z2Z A;  2YQ1 A;  1WG5 A;  3M8Q A;  3NAI A;  4LJM A;  4A8X A;  4DL2 A;  1BY9 A;  3IR7 B;  4K4S A;  4PWD A;  3G8S A;  1IKX B;  2W2N P;  1RT5 B;  1F3F A;  4A8S A;  1R43 A;  2CQ3 A;  2XRG A;  3WBH A;  4R8U B;  2ZC4 A;  1FRM A;  2A6M A;  1IKW B;  4FN5 A;  1RT7 A;  3JSM B;  4NLT A;  4R5P B;  2JRS A;  5I3P A;  1FVQ A;  3UNG C;  2AJQ A;  1SC6 A;  3T6J A;  3R7S B;  5FLX Y;  1OYE A;  1IBM F;  1QE1 A;  1A6L A;  5LMN F;  2FJB B;  1NRK A;  1BMQ B;  4NCA A;  3CJ4 A;  2AYM A;  2N4C A;  5ETK A;  1N88 A;  1WAC A;  2CIM A;  2XG8 A;  2XMV A;  4DL5 A;  1U47 A;  1WKJ A;  1CLF A;  5B0E A;  2B5J B;  4H54 A;  1RHU B;  2OKQ A;  4KR0 B;  5L9N A;  5FLX U;  5JVG Q;  2J0S D;  1U0H B;  2LVW A;  4USH A;  3N5F A;  2KFN A;  2Z2M A;  1UVK A;  3V2U C;  3EPI A;  1VFJ A;  3RZA A;  2EFG A;  1HPZ A;  2B43 A;  3J7Z 5;  3PW4 A;  1V3S A;  2O5D A;  4URQ U;  3VTI A;  2JLE A;  1PIE A;  3UD3 P;  4QAX A;  3MR3 A;  1DTQ A;  1DAR A;  3X3U A;  5H9E K;  3W63 A;  3MCO A;  3U1M A;  3VGS A;  1X9S A;  3GYX B;  4UT4 A;  1WHW A;  2CJA A;  2IAJ B;  2HFO A;  3OXF A;  3LP2 B;  2HMI A;  1ELY A;  5BJR A;  2UUB J;  4ZGA A;  3DOL B;  5KAK A;  5H1S V;  1B99 A;  4JYA J;  3K57 A;  3FRZ A;  3WAV A;  4OHX A;  5J1E B;  1WEY A;  3O44 A;  2DHS A;  2ZWO A;  5KFL A;  5A6P A;  5DM7 Q;  2AD9 A;  3TP2 A;  1U1Q A;  3H0P A;  2RD5 C;  2CQH A;  3A8I A;  1RAF B;  3HKW A;  3W62 A;  4C0O C;  4DUY J;  4GTZ A;  4IQX A;  1RSC A;  3MUT P;  1VQ5 S;  1UL3 A;  1WSV A;  3QQC D;  3DU6 A;  3TJA A;  1DZ5 A;  3SXL A;  1N4L A;  4TY8 A;  4YN3 B;  3DI6 B;  3NOG A;  2J6U A;  1SL1 A;  2CFX A;  4IOA Q;  4WFA Q;  1KHL A;  4B9L A;  3SFG A;  1NM2 A;  2YKQ A;  3O3L A;  4DV0 F;  2FLL A;  4LF7 J;  4LF8 J;  5C66 A;  5JVH Q;  2LEA A;  4RL1 A;  1RIS A;  3M32 B;  4FYD A;  1FX2 A;  5LJ3 Y;  4LQY A;  1Y5L B;  2GAH C;  3MM7 B;  5HP1 B;  3W3S A;  3KHG A;  3TEH B;  2HAI A;  5F8I A;  4IFY B;  1JJC B;  2OEM A;  5D4P A;  4ZMM A;  2CPD A;  2YKN A;  1KEK A;  2ZD1 B;  3OBI A;  1IJF B;  4I56 A;  4IH5 A;  4OI2 A;  5A8W B;  5KFE A;  2WB1 D;  1FCA A;  3L4B C;  2DXE A;  1H3D A;  2VBX A;  2L41 A;  3ILL A;  1S9F A;  1SV5 A;  4QWB A;  1E6V A;  2A10 A;  2B0G A;  1JWW A;  1X9W A;  4UPL A;  3DGP A;  4QWE A;  1AJB A;  4CLW A;  2RSQ A;  2XY7 A;  3IWN C;  2XLK A;  1JJH A;  5IS2 A;  2QJ3 A;  2NZC A;  5GAE I;  1O6X A;  5EHH A;  3TZW A;  2KG1 A;  2R7W A;  1Q16 B;  5KT5 A;  3BDH A;  1Y6V A;  1G7C B;  4RNH A;  2ADB A;  1XTZ A;  1VS3 A;  2KXH A;  4USJ C;  5DO2 A;  3H5X A;  2DD8 S;  4ZG9 A;  2JL9 A;  2DY9 A;  4M5G A;  1NSA A;  2AYE A;  3DDK A;  5E3P A;  2IRX A;  4LF1 A;  3TA0 A;  2J8A A;  2F7V A;  3CCJ S;  2BQR A;  2V8D A;  1IXK A;  4RW7 A;  1HBU A;  2VG5 B;  3IP0 A;  4XPC A;  3VV2 B;  8RUC A;  3IN5 A;  1X4G A;  3IR5 B;  1YGY A;  1FSU A;  1C4C A;  1SVD A;  2LP4 A;  4ZCI A;  1ZEF A;  4HAC B;  3OLA A;  3MM8 A;  4NYP A;  1I3O B;  2H5J B;  1N56 A;  2F40 A;  2YNI A;  3ZTO A;  3CSK A;  3KXD A;  3PM9 A;  3KHR A;  1FWP A;  1ZPV A;  2VIC A;  2PEB A;  2Z8Q A;  3EVO A;  2AKW B;  4I69 A;  4PEO A;  2FVQ A;  2AJF E;  4JI0 J;  3CJK A;  1HNZ F;  2W2O P;  3UW1 A;  1NK8 A;  5F0U A;  2QLF B;  4WWS A;  5KFC A;  2IA0 A;  1FFW B;  2HBR B;  2YWH A;  1T11 A;  3GYN A;  4WFX A;  5B08 A;  5A0Y B;  3EXY A;  3JTN A;  2VA3 A;  3BSA A;  1LQ9 A;  1SQF A;  4M5J A;  5KFG A;  2AF6 A;  5KFZ A;  5L39 A;  1IKX A;  1JLE A;  1X31 C;  1ZA2 B;  2JFK A;  4DV4 J;  3SZ2 A;  4CO4 A;  4B3M F;  3MK1 A;  1GMW A;  1V5V A;  3ZZ0 A;  2KFY A;  5KFR A;  2HHQ A;  1SXL A;  1ITP A;  3BGR B;  3LF0 A;  1UEV A;  3M2R A;  4K4V A;  1U6F A;  2CG8 A;  3HHL A;  4I2P B;  3WQP A;  3NCP A;  3CGI A;  3GIJ A;  5CXT A;  4O3P A;  4USM A;  1NZ8 A;  1S79 A;  2FUG 9;  1FTR A;  2QZ8 A;  1I5O B;  1UW4 A;  1CEZ A;  3GPA A;  4EWT A;  4F7V A;  2FC9 A;  5B0A A;  2GQQ A;  3OV7 A;  3M6W A;  4GKJ F;  3QGG A;  3AOB A;  4BC7 A;  4X4V A;  2RNE A;  3AD8 C;  5DQG A;  1SUQ B;  3NAH A;  3AD9 C;  4QWA A;  4G1I A;  2MLY A;  3CXC R;  3CCR S;  3LAM A;  3TI0 A;  4Y2C A;  2BJD A;  3M2V A;  1JLG B;  3QT6 A;  3J7Y I;  1K44 A;  3MCS A;  2QE5 A;  4Q45 A;  2J9D A;  4IO1 A;  1JLC B;  2B9X A;  3CCT A;  4QYZ J;  5KFT A;  4MAK A;  2YXL A;  5L9X A;  4GTW A;  5K20 B;  1EJJ A;  4KFB B;  2VBY A;  3DLJ A;  1YK9 A;  2BJ8 A;  3RYL A;  4AT1 B;  3PX6 A;  4U7U D;  4PG6 A;  3CDB A;  2CPY A;  4WPA A;  2MHE A;  4AD6 A;  1DUR A;  4CM2 A;  5KT6 A;  5DG8 A;  4UY8 T;  1S1V A;  1T3N A;  1Y11 A;  5KT3 A;  2QSW A;  3CDU A;  3UR0 A;  1YIJ S;  4TN2 A;  3N79 A;  1HQE B;  4CT9 A;  2CPZ A;  3GIM A;  1RBA A;  3GV7 B;  3I4P A;  3UCU P;  4KKO A;  4NLQ A;  4AYB D;  3I0S B;  3PY8 A;  4C3L A;  1K8A T;  3MD3 A;  1CJK B;  1Q7L B;  2V67 A;  3C16 A;  4C7Q A;  3FZB A;  1EET B;  1KQG B;  4HT7 A;  4ZVS B;  4DCO B;  2MSS A;  2EBG A;  5KFM A;  4TU7 A;  1VMB A;  4CH1 A;  4ELT A;  1R31 A;  3H42 A;  3OFH A;  4Y2K A;  3Q86 A;  4B3M J;  2ZUG A;  2HHX A;  3CC2 S;  1R0A A;  4QW9 A;  2BJ3 A;  4WP3 A;  1VBK A;  2JLF A;  4HTJ A;  4M5I A;  4O0N A;  4TY9 A;  2BJE A;  5T7L B;  1L5U A;  3J81 U;  1FRI A;  3QJL A;  5DLV A;  2GIR A;  1WHY A;  5EWG A;  2QMW A;  1XNQ J;  4ICL B;  1UVL A;  1UWB A;  3KLI A;  4LF2 A;  3WZ0 A;  2FJX A;  1S1X A;  2JC1 A;  5KFH A;  3FK4 A;  3IGZ B;  3I82 A;  2IC3 A;  2GGP A;  2OSR A;  5CHC B;  3OW2 R;  3BBF A;  5HLF A;  3FNN A;  1TL3 A;  3W60 A;  2W9A A;  2HFS A;  4ZVU B;  1X0P A;  3PRB A;  1H98 A;  1H38 A;  2CJB A;  3OFF A;  1HNV B;  2OD4 A;  3IAS 9;  4NA1 A;  1MML A;  3TJ9 A;  2R42 A;  1SHQ A;  3TAN A;  4I67 A;  2V63 A;  5H9F J;  2LXI A;  2OPR B;  3NGU A;  4L75 A;  2QFJ A;  5I42 A;  1FD8 A;  4HDH A;  2YPZ A;  4J9K A;  2ZBC A;  4PXC A;  1LV5 A;  3NMA A;  1KC8 T;  4B3O B;  2ZE2 A;  2ROG A;  2IRY A;  1KBR A;  3DLG B;  2AX0 A;  4O23 A;  4HAC A;  3KUH A;  3NKM A;  5KFV A;  4YB6 A;  3R2D J;  3KHH A;  3UDL A;  2EFV A;  4F4Z A;  2HS3 A;  5CZV A;  2XZD B;  1B70 B;  1UEU A;  1ANI A;  2M8D B;  3R5C A;  3QAT A;  3RTV A;  2IM3 A;  2XZT B;  3SZZ A;  1UP1 A;  1JLQ A;  2DNQ A;  4LBI A;  4ZVO B;  1FA0 A;  5GME A;  3PXG a;  1KS2 A;  2DJW A;  1NB2 A;  4N5S A;  2HYI B;  1XNR J;  2GIQ A;  3VGU A;  1BE4 A;  1YZ6 A;  4DHV A;  4H4O A;  4ECS A;  2WVD A;  3UQS A;  3L9Z A;  3ENA A;  2HAF A;  2BM0 A;  4DR3 F;  1UFK A;  2E1P A;  1JLA B;  2D9O A;  4U8V A;  1RT3 B;  2MKC A;  2JNJ A;  3RAM A;  1HNW F;  1EI6 A;  2XI2 A;  2AIR B;  2OEL A;  2F65 A;  3M9M B;  1HDH A;  3QWU A;  2PFF B;  1MU2 A;  2K3K A;  4HLB A;  3MTJ A;  3VVU A;  3D1Q A;  1GMU A;  2E1C A;  4B9N A;  3K2Y A;  3SQG B;  4ZCK A;  5B0C A;  1J5O A;  2R7V A;  7AT1 B;  3KG1 A;  4DR2 F;  1IBL J;  4HKQ A;  3C6T B;  3MEC B;  4IFV B;  1NK9 A;  1OJ4 A;  1XMQ F;  5AJ3 J;  1Y5N B;  5C25 B;  1AZS A;  2ZZN A;  5IV3 A;  1RKJ A;  2BRK A;  1T0T V;  3RW7 A;  3OSP A;  1TUW A;  2BM1 A;  4NZ6 A;  3D6H B;  2JFD A;  4QZV B;  4CZC A;  1KH7 A;  3DOM B;  4ITS A;  4X84 A;  2FZC B;  3G6Y A;  2UXC F;  2W25 A;  3PJX A;  2RE1 A;  3SMZ A;  3WX4 A;  5DJB A;  1LW2 A;  4G1Q B;  4OZ0 A;  4K7Q A;  2MEW A;  3SCK E;  3TUJ C;  2NS1 B;  1L3S A;  4UUX A;  1RWN B;  2FD2 A;  1NBE B;  2D3U A;  2B7C B;  5KG6 A;  1TQL A;  1BGX T;  4UQT A;  4DG1 A;  3RR7 A;  1PGZ A;  5C2G A;  5TJ3 A;  5JJB A;  2PFD A;  3TZX A;  3MEK A;  4JV0 A;  2ALZ A;  4WCE Q;  3NNA A;  4LRB A;  4DFP A;  3MM5 B;  5F9L A;  3OTO F;  4IUF A;  4DL4 A;  1D0E A;  1E2S P;  1V3R A;  2E5H A;  1N34 J;  4C6A A;  2VON A;  4DSL A;  1HWJ A;  2ZVS A;  1TKT B;  2R4F A;  2WVC A;  4GVL A;  2Z58 B;  5AE2 A;  5L1K A;  3TAP A;  3GJR B;  3M1V A;  2VFV A;  4NPO A;  3BBC A;  1HQU B;  4OYZ A;  1FJG F;  2ZBQ A;  3FMW A;  4AL6 A;  5I3Q A;  2ILY A;  2XC9 A;  1NME B;  4NCG A;  4UUW A;  5CQG A;  1ZEB A;  3FBE A;  1IJE B;  1F0X A;  1OY9 A;  1B8J A;  1EET A;  2QT7 A;  3MMB B;  2UP1 A;  3C14 A;  1ZTT A;  3CJ2 A;  2FZK B;  1FRH A;  2WK4 A;  1SC4 B;  4ZJO A;  3KK2 A;  3I0R A;  3TQ1 A;  2UUC J;  3EGZ A;  4QW8 A;  1ZAW A;  2EPI A;  2XMU A;  3MEG A;  5CYM A;  2ZJQ Q;  1R8H A;  5LMU F;  1U1K A;  2LCW A;  1TV6 B;  2MZQ A;  1UPP A;  3CJ3 A;  3NOC A;  4FNH A;  3WBZ A;  4ECX A;  2B9W A;  2X1B A;  3HDS A;  3POT B;  2XQC A;  3UO0 A;  4C8Y A;  4Q0B A;  5T7L A;  3IA0 A;  4J9O A;  1S0N A;  4DUZ F;  4ZJL A;  2XYG B;  4ED3 A;  1VQY A;  3BRE A;  3DHW C;  2OO4 A;  4QR0 A;  1HBO A;  2KJV A;  1ROF A;  4EMD A;  5HRO B;  4YR1 A;  2YWG A;  2V8V A;  3HVW A;  3SIP B;  2M0G B;  2PGC A;  1YG0 A;  2D1C A;  1UKU A;  2GGP B;  2RT3 A;  3JAM Y;  4ZCM A;  2X7I A;  1XNQ F;  4HL9 A;  3LAK A;  3MCN A;  2KYZ A;  3JSB A;  3FGV A;  3OVA A;  3CJR A;  2C1E B;  2HGM A;  5KG0 A;  1T05 B;  1A7G E;  2WVE A;  4WF9 Q;  3CED A;  2IM0 A;  2OHD A;  3ZNU A;  3T6B A;  4DV6 F;  2XSF A;  4K2J A;  1LWE A;  2AWZ A;  1ALI A;  4CYS A;  1U6B A;  4HH0 A;  2ASL A;  3J7Y U;  1R8C A;  3UPF A;  4I6W A;  3IBC B;  1I1G A;  2Z56 B;  4NWX A;  4DR6 F;  5J2P A;  2AMC B;  5HRT A;  1RDR A;  2POK A;  3K8W A;  3M8R A;  2GMH A;  1NND A;  3NNH A;  2W8L A;  2G1D A;  5IM0 B;  1SI9 A;  1W25 A;  4BLG A;  4J9R A;  1HYS A;  2DTJ A;  2F8H A;  1V5I B;  2VFU A;  2W24 A;  3B82 A;  3M6U A;  5IQQ A;  4U7U K;  2AJ1 A;  2W8D A;  2UUC F;  3J7A 1;  2YX7 A;  3VAG A;  2NXJ A;  2X51 A;  1RT5 A;  1LWX A;  2Q6B A;  2WZ1 A;  4KHR A;  4OI6 A;  2H5E A;  2V94 A;  4J9U E;  2F8M A;  2OMO A;  1JXE A;  2ZZT A;  1RT3 A;  5CD4 A;  3PYG A;  4P75 A;  1VK3 A;  2MZR A;  1Y4Z B;  1FDD A;  3CMA S;  2RDD A;  1SQE A;  1U1O A;  5F8N A;  2BOP A;  3MPW A;  2C2O B;  3M6X A;  3QSI A;  3SQG A;  1IBK F;  4Z7Y A;  1EW2 A;  3KUE A;  4IKA A;  3MR6 A;  3IRX B;  2C2M B;  1T9Y A;  2PE8 A;  2MXY A;  1QY7 A;  2CQ0 A;  2IVM A;  3D6T B;  4P9S A;  2G2O A;  1N6Q B;  2UXB J;  1JB0 C;  2LLZ A;  3KDN A;  4NCB A;  2I0X A;  2YH0 A;  2DPI A;  2DGU A;  3DYC A;  1U4B A;  4A8Q A;  5ETT A;  2RQM A;  2K06 A;  2HGL A;  3N6M A;  2G0C A;  4C98 A;  1Q79 A;  2EVZ A;  1PG5 B;  3HD1 A;  3DOK A;  1U1L A;  4GKK J;  1UTA A;  1WTF A;  4LIW A;  1LW2 B;  1R89 A;  3AD7 C;  4G1Q A;  2GJI A;  1JJ4 A;  2AYB A;  2W5T A;  4ERD A;  3WIV A;  3BPD A;  3A1Y G;  4ZG7 A;  2LA4 A;  4L3K A;  1XIQ A;  4AQY J;  1FEE A;  4CQ1 A;  3DDN A;  3L7U A;  3PO4 A;  1B64 A;  4M8L A;  4CH7 A;  1NDP A;  1RZM A;  4F4A A;  3KK1 B;  2E9T A;  4KPC A;  4WKY A;  2BAN B;  2EXU A;  2Z2Y B;  4RUC A;  3OL8 A;  1H2V Z;  1KOO A;  3VAF A;  2UVV A;  2DGX A;  1M5S A;  4CXU A;  2R2U A;  1TKD A;  4WXW A;  5HMW A;  1OMS A;  2HBQ B;  4X66 J;  1C0T A;  2L9N A;  1LFP A;  1SIW B;  1ICE B;  4K8R A;  4ZPC A;  3R6L B;  3NMR A;  1ZS6 A;  5FD1 A;  2CAD A;  1S48 A;  3M32 A;  3SSR A;  2C2R A;  5HJX A;  1N5V A;  4KIA A;  1P8G A;  4GO7 X;  1R8A A;  3MMB A;  3NGR A;  4YB7 A;  4ZDN A;  3KJN B;  3RG6 A;  3OHA A;  4J9L A;  4ED7 A;  4PQU A;  1T03 A;  2E29 A;  3EE3 A;  3FFI A;  3NG8 A;  4N47 A;  1YIT S;  2YKN B;  3I5B A;  1JLF A;  3CIM A;  4DUZ J;  5A8W A;  4DR3 J;  2FJW A;  1FWK A;  3C66 A;  2BE9 B;  3G8Q A;  5E7O B;  4V19 J;  2E5L J;  2HGN A;  3THT A;  1KLN A;  1JQG A;  3MI7 X;  2WW8 A;  3OTC A;  1Y00 A;  3FCH A;  4NRT A;  1QSS A;  3UNY A;  5C42 B;  8ATC B;  2GSO A;  2AZ3 A;  3BZQ A;  4FKY A;  3OT9 A;  3EUN A;  2PD1 A;  4UOG A;  1SB6 A;  2DGQ A;  3CF5 Q;  3W2V B;  3ZTQ A;  1Q81 T;  3SI8 A;  1OSD A;  3HT3 A;  1NKE A;  1WC4 A;  2DIU A;  3P4U B;  1S1T A;  1T02 A;  2HUR A;  2CPX A;  2Y0B B;  3A8K A;  2HHH J;  4RW7 B;  4H4M B;  3ZZU A;  2VOP A;  1KR4 A;  2HWI A;  2IBK A;  1Q0N A;  4ETZ A;  2XGQ A;  1X4C A;  2JVR A;  3UD4 P;  1REG X;  4PRF A;  5E3R A;  2F4F A;  2QLX A;  4QYR A;  1GTE A;  3CDA A;  4RW4 B;  5LJ5 Y;  2MKK A;  4JI6 F;  4ZLP A;  5DDQ C;  4RPF A;  3GV8 B;  1VR6 A;  1FF2 A;  1RT1 B;  2BRL A;  3GMG A;  2BVZ A;  4LR9 A;  1NDL A;  1X8D A;  3P3D A;  2CUY A;  3DM2 A;  3NKQ A;  2ALY B;  4KBI A;  1VRQ C;  3CJK B;  4U7C A;  3HSD A;  3DLE A;  1KH5 A;  2WAQ D;  2MKI A;  3SBM A;  3OFG A;  3R27 A;  2VFR A;  1DQA A;  1TVR A;  3OR1 B;  1UW9 A;  4FP9 A;  4KC5 A;  2IDE A;  2VJU A;  3P96 A;  3LPY A;  3HK2 A;  2AEF A;  3RRG A;  3TUI C;  3D6M B;  5ETQ A;  2GQC A;  3BGR A;  4EK2 A;  1KLM B;  2XY6 A;  4DFM A;  2J9C A;  4I2P A;  1HR0 F;  3CW2 C;  1U02 A;  3CWJ A;  4CYU B;  4P71 A;  4ZCL A;  1WJ9 A;  5ETL A;  2V4R A;  2DGT A;  1YJ9 S;  2KXF A;  1R6V A;  2B51 A;  2VKR A;  1Q95 G;  1U6Z A;  2DK2 A;  2EK6 A;  5GVQ A;  3IRX A;  3T19 A;  3V6D A;  2EW9 A;  1EIY B;  3BYP A;  3PIO Q;  1VIS A;  3BH7 B;  1FXD A;  3MHY A;  4HI1 A;  1J27 A;  2JLG A;  3BDF A;  2K1R B;  4WU3 A;  4ECV A;  4NLO A;  3H59 A;  1SKR A;  5L1J A;  1Q53 A;  2KZZ A;  1C1C B;  1W26 A;  1P49 A;  1NHK L;  4RNO A;  4DQP A;  2NUH A;  1SJ3 P;  2UXB F;  2VQR A;  4MHX A;  3KJV A;  4KJG A;  3R3T A;  3E01 A;  3I32 A;  2KJW A;  5MLC V;  1H7W A;  1OWX A;  4NML A;  1N5Q A;  1NK0 A;  4OHV A;  1NSQ A;  2D1G A;  5K4P A;  3RGI A;  3TVZ A;  5EX0 A;  2C3Y A;  5HQL A;  3VQT A;  3CJT A;  4ELV A;  1OQ3 A;  1ZZF A;  1JLG A;  1N6Q A;  3C15 B;  2H5I B;  2LQ5 A;  2PSZ A;  3MM6 A;  3S01 A;  4YP3 A;  1WTB A;  2X3G A;  4ID5 A;  4ALZ A;  2NR0 A;  3T00 A;  1KKH A;  2FGO A;  3KYL A;  2XSJ A;  3MOZ A;  1R8B A;  2AGP A;  2KN4 A;  2JOQ A;  2WVF A;  1O99 A;  5ETP A;  4B08 A;  1S57 A;  1ALK A;  3WAW A;  1YBU A;  3V4I A;  4I7F B;  4NLR A;  5EWF A;  4LFC J;  2BAN A;  2DNK A;  2DIS A;  2DEJ A;  2EI5 A;  3EVM A;  3EZU A;  3NGD A;  2E1A A;  2GHP A;  3H8Y A;  3BSC A;  2PMH A;  3DFE A;  5AXL A;  1U8W A;  2XHC A;  4MKB A;  5F8H A;  4F4Y A;  1NJW A;  4NXN J;  4JV5 J;  2IUC B;  5IWA J;  3HJF A;  2HS0 A;  4WIQ A;  1GAO A;  3D3B J;  4NYO A;  3GE9 A;  1CJK A;  5SZT A;  3R1L A;  3K5L A;  1HI8 A;  2F3J A;  7FD1 A;  4DR5 F;  2HG4 A;  4CO2 A;  4NE9 C;  5EDW A;  5A6W A;  1T03 B;  4YEA A;  4W92 B;  5B0D A;  1OPZ A;  2OML A;  1S1W B;  1VQK S;  1JJ2 R;  1UFL A;  5D15 A;  3I6P A;  2UXD F;  2QFI A;  3MF5 A;  2YNH A;  1S6P A;  4ETX A;  2HIQ A;  4F3M A;  4F2S A;  3RB4 A;  3MOJ B;  3TAM A;  3ADA C;  2CDR B;  4V19 X;  2JH3 A;  2DHH A;  4Y6I A;  5IV4 A;  1HNX J;  5HVF A;  2RJZ A;  4YDX A;  5A8R B;  5K8O A;  2X98 A;  2Q66 A;  4ZJQ A;  1UWB B;  2DEI A;  1GXU A;  3KLI B;  1GH8 A;  3MK2 A;  4C11 A;  2YNF A;  1HLW A;  2VPX B;  2HZV A;  2QC3 A;  2VG6 A;  3GON A;  1HAR A;  2CPI A;  2GO8 A;  1ZOT A;  4FYW B;  4OZ5 A;  1HBN B;  4ED4 A;  1NJY A;  4P7T A;  1V9O A;  2I9S A;  3LP1 A;  3CNQ P;  1HNV A;  2HPU A;  4DXL A;  3OVS A;  2ASY A;  3BO4 A;  3T5K A;  5IT9 Y;  3I5A A;  3Q8S B;  1H7X A;  1FER A;  2DGV A;  3UR3 C;  1N0V C;  2OPR A;  2P5V A;  3HPO A;  4YB5 A;  3D54 A;  3MUV P;  4B3O A;  1FJ7 A;  5KT4 A;  2ILZ A;  4M63 A;  1CJU B;  2FJD B;  3DDI A;  3R5D A;  2ZHA A;  4DV5 F;  5KTQ A;  2ZZM A;  3S8S A;  4NLV A;  4WU2 A;  4R25 A;  1YQH A;  2WBM A;  1I94 F;  1RBO B;  2EKN A;  3SEO A;  1RHK B;  4JV2 A;  2A0F B;  3B54 A;  2W2Q P;  3Q83 A;  4ZN1 A;  1X4F A;  3ZFV A;  4K0K F;  4DX8 H;  5LSR A;  3C3L A;  3BV8 A;  3W61 A;  2HVI A;  4CLZ A;  3K17 A;  3DLE B;  1UA0 A;  2BJ1 A;  4ID8 A;  5DZ6 A;  4CWB A;  3M8Q B;  4XDD A;  1RTD B;  4XTT A;  4RUB A;  3R8Y A;  5E33 A;  1N32 F;  3GFZ A;  2CQI A;  2BQU A;  2W5V A;  2U2F A;  1SJ4 P;  2BX6 A;  4GO5 X;  5KFW A;  2MKJ A;  4DV0 J;  2FVR A;  4C9D A;  1JLB B;  5E2Q A;  2DNZ A;  3LXQ A;  2XS5 A;  1U09 A;  1FKP B;  3KTQ A;  1KH9 A;  1Y7P A;  1H2T Z;  3M7V A;  1JX4 A;  1NPR A;  2DKO B;  4CIO A;  1RXO B;  2NUU G;  1XQI A;  4NEY A;  2QYC A;  3W1Y C;  5IQ6 A;  1K7H A;  4Q8F A;  5HVH A;  3QNW B;  2GSN A;  1CS4 A;  4HI2 A;  3B4M A;  3NY0 A;  4DSE A;  2GW8 A;  1IBC B;  3FCW A;  2HNY A;  1EHW A;  5C25 A;  1ED8 A;  2RVJ A;  4Y2M A;  3AA8 A;  3WAX A;  2PII A;  1HNX F;  3QO9 B;  1KON A;  3IMQ J;  1CVJ A;  3V4M A;  2XWY A;  1XMQ J;  2J6S A;  2XS2 A;  3DN9 A;  2ZDO A;  4ED1 A;  3HHL D;  3B5Q A;  3G86 A;  1VQO S;  4YME A;  3E01 B;  3U1L A;  1FRJ A;  3VGV A;  1VQ6 S;  1S9G B;  2FJV A;  1RWK B;  1NH8 A;  1S0M A;  3ICL A;  2MQQ A;  1K0T A;  2I1R A;  1LXJ A;  4M95 A;  3ET6 A;  1QVF R;  5K8N A;  2KU7 A;  2QN6 B;  2XGP A;  2B4U A;  3D7S B;  2EFO A;  4RX6 A;  3MAQ A;  1TZ0 A;  1N2L A;  1RAO A;  4ECZ A;  1SCJ B;  4WFB Q;  3PW7 A;  2YNG A;  4A46 A;  3I55 S;  3N4W A;  2Q79 A;  2XWX A;  4Z7C A;  4X64 J;  1TEL A;  4I7F A;  4OYA A;  2LU2 A;  4AUK A;  4G6V B;  2Y1R I;  5A2Q U;  4EO6 A;  2AV5 A;  5E0O A;  4QQB A;  2J0X A;  2VBZ A;  5BR8 J;  1ZPW X;  2GJ2 A;  3UFC X;  4DDF A;  3Q23 A;  1HQU A;  4UW2 A;  3UDC A;  5E5N A;  1GEH A;  4DN9 A;  2IM1 A;  2P9C A;  5ETV A;  4CCH A;  1FTC A;  4RUA A;  2XM3 A;  2I2Y A;  1RHM B;  2ZKT A;  1REV A;  4OX7 A;  3JSR A;  5K9F A;  3C14 B;  2MQP A;  1X7V A;  3ELH A;  4O0I A;  3BSN A;  1PIL A;  3N0V A;  2GIF A;  1FX4 A;  3H4B A;  2M52 A;  2ZD1 A;  3C19 A;  1S6P B;  2CPF A;  3NRB A;  4EFA C;  2R3V A;  2LYV A;  3BO3 A;  2KYX A;  4YHH F;  3AJD A;  1BQM B;  4X4Q A;  1N52 B;  1UAW A;  2H9Z A;  3EGV A;  2NYH A;  4NLP A;  3W5Y A;  1UZH A;  5F8M A;  5DM6 Q;  4DV1 J;  4YOE A;  2KL8 A;  1HBO B;  1FNX H;  4G3I A;  4DPY A;  5CD4 H;  1XR5 A;  2L9D A;  1WD6 A;  4KY3 A;  2GVD B;  1KP6 A;  5J2N A;  4C8K A;  3PKM A;  3CJ0 A;  1FD2 A;  3FMB A;  3SFU A;  4IG3 A;  4CLK A;  2X1A A;  5LRM A;  3FEZ A;  3DXB A;  1HWK A;  3LP1 B;  4PCQ A;  2N3O A;  3IS9 B;  5LOQ A;  5EGH A;  4ZLL A;  2VG7 A;  2CVE A;  4B9U A;  2C2N A;  1VHF A;  1YVF A;  3AT1 B;  1BQX A;  1RWO B;  4QIV A;  5CZX A;  5C24 B;  4P7V A;  4ZHR A;  4DR7 F;  3J80 Y;  4IH6 A;  3Q3Q A;  2KZM A;  4JI3 J;  1YWX A;  1EKS A;  2RU3 A;  2MKY A;  3LGN A;  4I0W A;  2AGO A;  1LWC A;  1IKV B;  2W7P A;  3TJ8 A;  1SKU B;  1YBA A;  2W5Q A;  1UFW A;  3BR8 A;  3UCG A;  3WC0 A;  3D0I E;  2W5S A;  2COL A;  4ZIW A;  3T1H J;  1VBZ A;  3KK3 B;  4YY3 F;  1YJR A;  3IRW P;  1H6K X;  3D5M A;  3MK0 A;  4DV1 F;  3BBB A;  1BWE A;  2HVD A;  2B8P A;  1VQ7 S;  3BGF A;  3T3F A;  2OTJ S;  3T1Y J;  3LH2 S;  1F9H A;  1JLE B;  3SDE B;  4JI5 J;  4LF4 F;  3RBD A;  5B0B A;  2V2V A;  3SV4 A;  2CXE A;  4RJV A;  2BKP A;  4B3T F;  2IVF B;  5J2Q B;  2YWE A;  4P10 A;  2ZH3 A;  4JOU A;  1FE4 A;  3QT7 A;  3VR1 A;  1MMD A;  3OQ2 A;  1FKP A;  1S10 A;  1RP5 A;  3M2R B;  3EWG A;  4QWD A;  1ANJ A;  2DNH A;  2F4V J;  1Q78 A;  2XNR A;  3FZ2 A;  9ATC B;  1Z1Z A;  2M70 A;  4LR8 A;  3OL6 A;  4NLY A;  1CS4 B;  1V6H A;  4MIA A;  4BCA A;  3PFO A;  2VBW A;  1XEZ A;  4TLR A;  3R97 A;  5KFX A;  5IXU A;  4QWC A;  2ZH5 A;  4B9M A;  3QWP A;  4DL7 A;  3BR9 A;  3I9Z A;  2HNY B;  1HWL A;  2ZBP A;  3DRS A;  3LPE A;  1TUV A;  3QID A;  2BJ9 A;  3SSQ A;  3W9H A;  4XIU A;  1VHI A;  4USK A;  1K9M T;  1TK0 A;  1ELX A;  2Z2L A;  3PAC A;  2QSF A;  1VLY A;  2GFF A;  3D0G E;  7FDR A;  3MZI A;  3M30 B;  3DOK B;  2KI2 A;  1SJR A;  4F0K A;  3LWL A;  2DNN A;  4I2Q A;  3PDN A;  1YKW A;  4LR7 A;  1XR6 A;  1B0V A;  3PTW A;  4Y00 A;  1M1G A;  1NO8 A;  1S0V A;  1EX8 A;  4C3K A;  3IM8 A;  4DV6 J;  3AOC A;  1RA7 A;  1TKX B;  1TU0 B;  2YNG B;  3MED A;  4ED8 A;  3HD2 A;  2AW0 A;  2BE2 A;  1RTZ A;  4LQ3 A;  1X4A A;  3PW0 A;  3BEG B;  1RTI A;  4GVB B;  1FVS A;  3MPV A;  3Q89 A;  4RZR A;  4WZM A;  2WBR A;  3CDE A;  4UOH A;  4LFA J;  1NK4 A;  3CCU S;  1VCT A;  1S7H A;  2IJR A;  3AXM A;  4P2S A;  1U7L A;  4RWX A;  3T5H A;  2XB2 D;  1Z2L A;  1RB0 A;  4LBP A;  1W2I A;  4M1K A;  4WII A;  3MXH P;  2AJ0 A;  1WG1 A;  4KE5 A;  5CH7 B;  3RAQ A;  1A9N B;  2DRB A;  1ZYQ A;  1LOU A;  4NZ7 A;  5KFB A;  3G6E S;  4X4P A;  4NXM J;  1E3C P;  1WF0 A;  5IWA F;  4B3R J;  3D68 A;  4OZN A;  1DRZ A;  4DSF A;  3ENV A;  2AZ1 A;  4O44 B;  1PJ7 A;  1CPZ A;  2D7S A;  3T9N A;  4YR2 A;  2CNO B;  1EQM A;  2EFP A;  3AFG A;  4KAI A;  1TL1 B;  4UF4 A;  3UN2 A;  1Q7Y T;  1HMV A;  2HND A;  1IQZ A;  3W9J A;  4F25 A;  4OHZ A;  2PA8 D;  1RT4 B;  4DQI A;  4OMF G;  3OL9 A;  2B56 A;  2FVC A;  3KNA A;  3MD1 A;  1S6U A;  5KXA A;  4D3G A;  1UWA A;  2F9D A;  2AJ2 A;  4DMZ A;  3AH6 A;  2Y1J A;  3T5J A;  4WP8 A;  1TL3 B;  5C2C A;  2GJF A;  2C3M A;  3DRX A;  1JNZ B;  1FKO A;  1RLD A;  5SUH A;  2W7O A;  2AP6 A;  2HRU A;  5FDL A;  3GYG A;  2M8H A;  1DQ8 A;  5DGA A;  3DLH A;  3NKP A;  1N5T A;  3NBP B;  5KFP A;  1CJV B;  4H4M A;  2LKZ A;  2RUG A;  4K4T A;  2H4W B;  2NXN A;  1OIA A;  1VQN S;  3BKF A;  3AOA A;  1SQG A;  1X60 A;  2QL7 B;  2CQD A;  2RUS A;  2ZOF A;  3KJQ B;  4ZHR B;  3BO2 A;  4RW4 A;  2KT5 A;  5KFY A;  4B9V A;  1M5H A;  2J7K A;  4NEZ A;  5JXS A;  4H4K C;  1IR1 A;  1H72 C;  1T9X A;  4ZN3 A;  5BYS A;  1L3V A;  1RT1 A;  2RH6 A;  3CC7 S;  1GQE A;  4CLS A;  2G0J A;  5A8K B;  3HJV A;  4AL7 A;  3GIR A;  3TR5 A;  1P9Q C;  4B02 A;  2XY5 A;  2UV8 A;  2HWH A;  1B0T A;  2V4J A;  3JYT B;  1SJF A;  1JLQ B;  1HW8 A;  4UY8 5;  1S6Q A;  3PRD A;  2HFU A;  3ZTS A;  3CD7 A;  2OIH A;  3V81 B;  4LF5 F;  3MM9 B;  4MFB A;  2YY3 A;  4EGL A;  1TVR B;  4YB1 P;  5KFQ A;  1ZM2 A;  1F9E B;  2YWK A;  3CCQ S;  1N33 F;  5IJS A;  5CAB A;  3OSN A;  1HR0 J;  1IKW A;  2J0Q D;  2FHM A;  1JLA A;  2GC8 A;  3ZZY A;  1TKZ B;  1XBW A;  4LF5 J;  2UUT A;  1FE0 A;  2HRY A;  2VFS A;  3PX0 A;  4TQS A;  4C0B A;  4CM0 A;  5D4N A;  2M88 A;  3NGK A;  4TNO A;  2CA9 A;  1OY8 A;  3NXZ A;  2N3L A;  3HUL A;  4U67 Q;  1MU2 B;  1WF2 A;  2IRU A;  2RS8 A;  3G2X A;  1VLO A;  4CYU A;  4U95 A;  1HNW J;  2XMW A;  5IT9 U;  4N7T A;  4ZG6 A;  2JEG A;  2J9D E;  2HZC A;  1VRU B;  3BDP A;  3P6Y C;  1T8E A;  3C6T A;  1N54 B;  2DGS A;  4KAV A;  3FJ2 A;  5HBM A;  1B0P A;  1P1T A;  2B5J A;  3SCL E;  2DR7 A;  2K1R A;  3O2I A;  1U0H A;  1OS5 A;  2J7U A;  3HVR A;  3QLH B;  3UDE A;  4DV7 J;  1C1C A;  1VRT A;  1P27 B;  2CJK A;  5L38 A;  3PHT A;  4YFU A;  3HHE A;  3R1H A;  3US5 A;  2FY8 A;  5THW A;  4A47 A;  2HIY A;  5DGB A;  2A2C A;  4BBY A;  4KAY A;  1KHV A;  2I8E A;  2ZNZ A;  3A52 A;  1QM9 A;  4K4X A;  4I2Q B;  1QAX A;  4DV3 F;  1FK9 B;  2GQ2 A;  2NXC A;  2IAJ A;  2ZNY A;  3IC1 A;  4L74 A;  4ZOS A;  1TTH B;  3M2U A;  4ID5 B;  5JMN A;  3DOL A;  4JI8 F;  4JB8 B;  3P49 B;  2YKA A;  2W7A A;  2IYG A;  4CXK A;  1K1Q A;  2V8H A;  3LUY A;  3MAH A;  5J1E A;  3L95 X;  2E1M C;  2DNM A;  2QTW A;  3HHL C;  3M9O B;  3M8Y A;  2VKZ G;  5T14 A;  3D4J A;  3RRH A;  2LEC A;  1ZTW A;  1J5E J;  2QA1 A;  1CC8 A;  1RU1 A;  2KT3 A;  2RB7 A;  3SCJ E;  4RNN A;  4DSI A;  2FVP A;  1ZET A;  1DFD A;  3JTP A;  3HMJ G;  1BUX A;  5IC4 B;  3BM7 A;  5DS7 A;  3M1V B;  2DH7 A;  1IM6 A;  3GP9 A;  3G96 A;  1ZM3 A;  3LGM A;  4IRD A;  4F3O A;  5GAG I;  4K0K J;  3ZZT A;  5EGY A;  3HF5 A;  5GAD I;  3V6K A;  4UPI A;  2G9Y A;  2EBE A;  2K2P A;  1WOO A;  5HSP A;  3P45 B;  2WHO A;  3KK2 B;  1EB0 A;  1CBK A;  2B9Y A;  3LTO A;  4ILR A;  2ZH2 A;  4JI5 F;  1RAE B;  2EG2 A;  2DT9 A;  2KHD A;  4L73 A;  3VVT A;  4DPU A;  1PO6 A;  1IBL F;  3S1T A;  2JEI A;  1RAB B;  1NSP A;  2PDA A;  4U9R A;  2BW7 A;  2DCU B;  2DIV A;  1SV5 B;  3PJ9 A;  1FXL A;  2OSQ A;  3E8O A;  1H74 A;  4KH0 B;  3GZ7 A;  3V5R A;  3WDO A;  5KT2 A;  2RML A;  1WOS A;  4DLG A;  5HRO A;  2JX2 A;  1FKA F;  4F4W A;  1YRU A;  5L1I A;  4OL8 A;  2WCX A;  2BQ3 A;  1N0U A;  3D67 A;  3U7J A;  1VC5 A;  2HK2 A;  2FC8 A;  2ZOG A;  4DR2 J;  1OO0 B;  1MNE A;  2UVR A;  1SPB P;  4EU0 A;  2L3M A;  3CCW A;  3NCR A;  1ARO P;  3MPU B;  2EFN A;  2O66 A;  4FVC A;  1HQA A;  3U1N A;  4BHQ A;  1QTN B;  2EC0 A;  4QIG A;  3PNI A;  5HK4 A;  1KFS A;  1CJV A;  1BHN A;  4DR1 J;  1K47 A;  4TU8 A;  4OV6 A;  1LWF A;  1LWE B;  1P9Y A;  3AB4 B;  3EMT A;  1VIX A;  4CT8 A;  1U25 A;  3MDF A;  1YJN S;  2W5W A;  2V68 A;  4NLU A;  4RU9 A;  4PAB A;  1NPK A;  4O3N A;  2XLJ A;  2MQ8 A;  2Q1L A;  4P74 A;  4ZVR B;  3KLG B;  2ZC3 A;  2GVZ B;  5DET A;  2QG9 B;  2Q3P A;  4AXJ A;  2IM2 A;  1Z4U A;  3GIK A;  5DLT A;  4OQJ A;  1EQ0 A;  4OJG A;  3D3C J;  1WHV A;  2WRM A;  5D78 A;  2CAJ A;  3DRR B;  3LA0 A;  3TAQ A;  1NK7 A;  1L3U A;  1T7P A;  2DCL A;  1PBA A;  1SC3 B;  2D69 A;  3Q8U A;  2C2K B;  4PKD B;  3T41 A;  2VDH A;  4ED6 A;  3OTB A;  1RAG B;  1X5P A;  3B78 A;  1AT1 B;  4M5K A;  4OYW A;  1PKU A;  4P52 A;  2VIH A;  2ATC B;  3U02 A;  2XO7 A;  1KFD A;  3T1A A;  4KQZ A;  5L0K A;  4RR5 A;  2XCP A;  3R5A A;  3RU0 A;  3TQE A;  1F1B B;  4HR2 A;  5HQM A;  3UN5 A;  2NRE A;  1AFJ A;  2ZEJ A;  3IG1 A;  2B4V A;  3BN4 A;  3PIP Q;  4PPD A;  4ZS6 A;  3K58 A;  1KRP A;  5JUM A; 
#chains in the Genus database with same CATH homology
 1ED9 A;  4CXS A;  3LXQ A;  1EI6 A;  5LRN A;  1KH9 A;  5GRR A;  3M7V A;  1ANJ A;  1HDH A;  4LRA A;  2W5X A;  5L0B A;  4ZG6 A;  2GSU A;  5GOV A;  4N7T A;  1K7H A;  2ANH A;  5LIA A;  1EW2 A;  4LR8 A;  3E2D A;  2GSN A;  5LQQ A;  1KHN A;  1AJD A;  2IFY A;  2W5V A;  4KAV A;  4CYR A;  4ZGA A;  4YR1 A;  3BDF A;  4UOR A;  2W8S A;  1ED8 A;  1P49 A;  3WAX A;  3IGZ B;  3DYC A;  3SZY A;  3DPC A;  1ELX A;  4MHX A;  2VQR A;  3B5Q A;  1KHK A;  4KJG A;  1KH7 A;  1HJK A;  1ZED A;  4QAX A;  1URA A;  4KAY A;  5K4P A;  3ED4 A;  1SHN A;  2D1G A;  2W5T A;  1ELY A;  4LR7 A;  5TJ3 A;  3NKR A;  1Y7A A;  4ZG7 A;  3M8W A;  3WAV A;  1N2L A;  4LRD A;  1ELZ A;  4CXK A;  4GTW A;  1EJJ A;  3NKN A;  1O99 A;  4LRB A;  3M8Y A;  1ALK A;  1ALI A;  1E33 P;  4LR2 A;  3WAW A;  2GA3 A;  3TG0 A;  4GTZ A;  1AUK A;  5IJQ A;  1KH4 A;  4FDI A;  4UOP A;  4CXU A;  5L0E A;  1AJA A;  2IUC B;  2IUC A;  5L0K A;  1KHL A;  3TX0 A;  5C66 A;  3IGY B;  2GLQ A;  3WAY A;  5DLW A;  1ZEB A;  4UPI A;  2G9Y A;  4LRE A;  1E1Z P;  1B8J A;  2ZKT A;  1ALJ A;  4LQY A;  4TN0 A;  3M8Z A;  1E3C P;  3KD8 A;  4NWJ A;  4UOO A;  1KHJ A;  3A52 A;  3NKO A;  1EQJ A;  3T01 A;  3UN2 A;  3UO0 A;  1ALH A;  4UPL A;  5DLV A;  1AJB A;  3T02 A;  2X98 A;  3UNY A;  2GSO A;  3MK2 A;  1EW9 A;  4GTY A;  5INH A;  3OT9 A;  3UN3 A;  3BDH A;  3BDG A;  1Y6V A;  3BDG B;  5KXA A;  5LRM A;  4FDJ A;  4ZG9 A;  1EW8 A;  3NVL A;  3IDD A;  4UPK A;  4MY4 A;  4UPH A;  1HQA A;  3T00 A;  3NKP A;  1SHQ A;  5EGH A;  3TWZ A;  4KJD A;  2QZU A;  1FSU A;  1AJC A;  4CYS A;  5EGE A;  1ZEF A;  2W5W A;  5AJ9 A;  3Q3Q A;  3CMR A;  3NKM A;  5DLT A;  4NWX A;  1O98 A;  4LR9 A;  1E2S P;  1URB A;  2RH6 A;  5HRT A;  2W5Q A;  4GTX A;  4LRC A;  3NKQ A;  1ANI A;  2W5S A;  4MIV A;  3SZZ A;  1KH5 A;  3MK0 A;  2W5R A;  2W8D A;  4KM4 A;  1N2K A;  4B56 A;  2XR9 A;  4LRF A;  3UN5 A;  3WBH A;  2XRG A;  5IJS A;  3MK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...