4LRCA

Phosphopentomutase v158l variant
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrcA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrcA01
3WAXA 5L0KA 1E2SP 4KAYA 1ALHA 1EW9A 4CXKA 4GTWA 1KHNA 3DYCA 3DPCA 5HRTA 5KXAA 4GTXA 3BDHA 3M7VA 1EQJA 1KH5A 3LXQA 4LREA 1ELXA 1HJKA 3IDDA 3WBHA 4TN0A 5L0BA 4QAXA 4LRDA 2VQRA 1KH4A 1AJDA 4LQYA 5INHA 3UO0A 1EW2A 2GSOA 5GOVA 3T00A 1ZEBA 4UPLA 3IGYB 4GTYA 5AJ9A 3T02A 2IUCA 2ANHA 3Q3QA 1KH9A 4MY4A 5EGHA 2IFYA 4LR8A 3NKPA 2GSUA 1ELYA 1E33P 4UPIA 3SZZA 3MK2A 4ZG9A 1P49A 1AJBA 5GRRA 3TWZA 2XRGA 4KM4A 1K7HA 1E1ZP 1KHKA 5EGEA 3IGZB 3UN5A 5DLTA 4YR1A 3T01A 2G9YA 2W5QA 1ED9A 1KHLA 2GA3A 1N2LA 4LR2A 4N7TA 3TX0A 2W8SA 3NKRA 5LRMA 4KJDA 1ALJA 3NKOA 5DLVA 3UN3A 1HQAA 5L0EA 3WAYA 4NWJA 5DLWA 5LIAA 4KJGA 1N2KA 5C66A 1URBA 2W5TA 4FDJA 1ANJA 4LRCA 5LRNA 2W5RA 1Y6VA 2W5VA 1ED8A 5TJ3A 1HDHA 1SHQA 1ZEDA 1AJAA 4ZGAA 3M8ZA 2W8DA 2D1GA 2X98A 4LRFA 1FSUA 4UOPA 4UORA 4KAVA 1ZEFA 4CYSA 5IJQA 3WAWA 4LR7A 3SZYA 3NVLA 1KH7A 1AUKA 2ZKTA 3UNYA 3B5QA 3MK1A 3MK0A 1SHNA 4LR9A 3BDGB 4MHXA 4LRAA 3NKNA 1ALKA 4FDIA 5LQQA 4MIVA 4UOOA 4CXUA 3E2DA 3TG0A 3CMRA 5IJSA 3BDFA 2W5WA 2W5XA 1O98A 4UPKA 1ELZA 4GTZA 1AJCA 3OT9A 1Y7AA 1O99A 3NKMA 2XR9A 3KD8A 1EI6A 3M8WA 1KHJA 1ALIA 3WAVA 1EJJA 1ANIA 2GLQA 1E3CP 3UN2A 1B8JA 2GSNA 2QZUA 2RH6A 2W5SA 3A52A 2IUCB 4CYRA 4ZG6A 4B56A 1EW8A 4NWXA 1URAA 4UPHA 5K4PA 4ZG7A 4CXSA 3M8YA 4LRBA 3BDGA 3ED4A 3NKQA
chains in the Genus database with same CATH superfamily
4CXKA 2WCXA 3KWMA 1B3TA 1GNKA 4C2MA 4KKOA 3W2WB 1C4CA 3W1YC 1XNQJ 2CQ0A 1R8PA 4DUZJ 1F5CA 2OPQA 3UD4P 4J91A 2Z2ZA 1PKUA 3DLGB 2V8VA 4JI2F 2VG7A 4M5KA 1S5ZA 3EPGA 4NLYA 3P6YC 4Q2LA 3N6LA 2KTQA 3ILIA 5KTQA 4RKUC 5IM0A 1ACMB 2DYAA 3DRPA 3U27A 3GB0A 2UV8A 4P2SA 2CQPA 3DFEA 2AZ1A 4DR3F 2HHHJ 3RB3A 4DN0A 4V19J 2UUTA 1CPZA 2IJRA 4O0IA 3IFEA 3C15B 1CC7A 3JTNA 2ZOFA 4IG3A 4PWUA 8ATCB 1NHUA 3BQ0A 2LMIA 4K5RA 1RYSA 4Q8EA 1UA1A 3PVXA 1S10A 1HARA 2HNDB 3GMGA 3IBCB 2UXDF 4LREA 1HQUB 1KWMA 1S9FA 4DSFA 3GPAA 1NSKL 4DSEA 1X5TA 4WXOA 3K5MA 1HNZJ 1BY9A 2HRYA 3JTPA 1YI2S 5J2PB 2ZD1A 5LT5A 2JNJA 1WI6A 1KOHA 4ZJOA 3EPIA 3MWBA 2V8PA 4ZLJA 1UVJA 5KFAA 2E9ZA 4WP3A 2LQ8A 4KGMA 4EBDA 4N47A 2LFVA 5IFMA 3BSAA 2E1MC 3G6YA 1Z2LA 4XAKA 2KO1A 5FIIA 3SXLA 2HGNA 1REVA 3ETOA 2UVUA 1FE4A 2HURA 5KFVA 4MFBA 4DX5A 3Q86A 5KG1A 2VPWB 4XDDA 1EIYB 3WC2A 1D9FA 4XTTA 2KRRA 3JB9k 2OEMA 2XI2A 3ETMA 2E29A 4C3KA 2HVHA 1OJ4A 1RHMB 4MIWA 4ECRA 3AH6A 3HM9A 2C2NA 1LWEA 3IDDA 4X62J 4ZKAA 2EXUA 4WU3A 5DG7A 2W9BA 4Y65A 2IUCA 3LP2A 4NWBA 4RPFA 3R7SB 3IRWP 2CYYA 3FKBA 4HT5A 1TK8A 3LW5C 2B8PA 1C1CB 4E8UA 2CJAA 4KFBA 2C2OB 3ENQA 2HKEA 5HSPA 4DL5A 3R8YA 4CT8A 2MGZB 2MEWA 5KT2A 4X64J 3FBBA 3CDBA 4NA1A 3FMWA 3QRPA 4DSIA 2B4OA 4NXMJ 4CYSA 4K4TA 4I68A 3P45B 2HHSA 2D3O1 1N36J 1FA0A 4MHXA 1DLOB 4ZPDA 4RR5A 3CMRA 1SC6A 2BE2A 5JVGQ 1VQSA 1E3CP 3Q8RB 2C3YA 3TO8A 1QDUB 2HBQB 4LFBF 3GIKA 4KJIA 1AJDA 2GSOA 3WIVA 3FRZA 3V5RA 2YWEA 2J8AA 4I2PA 2WRMA 5DDQC 3DNCA 1WG5A 4ZP8A 2EK6A 2FZKB 1WELA 1T02A 3SQGA 5DG9A 3MM5A 2G2ZA 4X4OA 1ZAWA 1RZMA 2B6AA 1YSJA 3K8VA 1Q8IA 3HSZA 2DY9A 4KPCA 1U1QA 3N5BA 2X1FA 3BGRB 1U25A 2AHOB 1KSPA 4D3GA 1O5JA 2HNYB 4U96A 1WTFA 2MQMA 2PEHA 1HNWJ 2DNMA 2XMVA 2QGFB 4EEYA 4LRAA 1Y00A 2NXUA 4MIVA 4CXUA 2JLEA 3LGNA 3M2VB 2JFKA 3NS5A 4RW4A 3UI3A 5KFYA 2GGPB 2V0NA 3BO4A 3MEEA 1XWLA 3CCSS 1EJJA 2IC3B 1PBUA 4USWA 4F7VA 4KIAA 1SKRA 5M2UA 4ANEA 4FF3A 2Z8QA 3BSCA 1V3SA 2OIHA 2MZTA 4LRDA 2F40A 3U1NA 2JVOA 3C16A 3C6TB 3JSBA 4WCEQ 4U8VA 1P49A 2HIYA 2OTLS 1KD1T 2H51B 2UZAA 4OHZA 5GMDA 3HHDA 1U2FA 3EVMA 2LEAA 3D67A 1BE4A 2PMWA 3UN3A 2PFDA 1RTIB 1JQGA 2YWHA 4FYXB 5LOQA 2BZ2A 4TY8A 3AB4B 1IR0A 3GJRB 3Q8SB 4N41A 2ZVIA 2MSSA 4RWWA 4IFVB 2VG6B 1K47A 2VB6A 3VTIA 1RLDA 3TARA 3D1HA 1B7YB 3NKMA 4WXWA 4CI0B 3LA0A 4ELUA 2Z56B 3THVA 1KQFB 4YMEA 4EWTA 2A0FB 4CO1A 4WTYA 2A18A 1YBUA 4CLLA 1IBLJ 4ZG7A 4Y0FA 3LF0A 1H98A 1EETA 3HVRA 3ED4A 5F0WA 3DPCA 3J81Y 2XZWA 2XG8A 5KG6A 2RHQB 1NDKA 1I51B 2Y8YA 3RUBL 3UPFA 5GAHU 4K4WA 4NEZA 4OHWA 4UY8T 3Q8VA 2CNNB 5CYMB 2RQKA 4IOAQ 4RNHA 4KH0B 2DR5A 4YQWA 3LUYA 4NLRA 4DV5J 3FEXB 1OSDA 5HP1B 4DSJA 4NWJA 4XDCA 3KDOA 3R5GA 1OYEA 2VPXB 3HVAA 3T1AA 4KV8A 4ES3A 2DNQA 2F65A 3OL7A 2LKZA 3A8KA 4K0KJ 2QA4S 1FKOA 2HZVA 4UTGA 2A2CA 4ZVOB 1FFSB 3OV7A 1WC1A 5H9EK 3O1LA 1ITPA 4OX7A 2UUAJ 1MNEA 1LW0A 3NG8A 4MYTA 5AE2A 4OI2A 1HI8A 1IBKJ 4OLPA 4OZ3A 4UUXA 3Q8QB 3TAQA 1EW9A 1TKDA 3CCMS 2LQ9A 4IFYA 1VIXA 3V6JA 2JLFA 1RWOB 3M6VA 2B9WA 5KG0A 4LF9F 3IGYB 3CIMA 2FZGB 3UFCX 1T3NA 4RW8A 2V63A 2VIHA 1ZZNA 5DGAA 5IC4B 4DV1F 4KC5A 1LWFA 1H7XA 4YB5A 1VLYA 4A8FA 4ZS6A 4IKAA 2Y0BB 5ETNA 2VOOA 1S0VA 2J0QD 5KAKA 1PIEA 3D6TB 2QT7A 1JLCB 2GZOA 3IG1A 2QL5B 4B08A 4CLFA 3RAXA 4DQIA 2ZBRA 5IOLA 1RAGB 1TV6A 3TOQA 3MMBA 5KFTA 2YVSA 1R6VA 5E3RA 1FESA 3TQEA 3ADAC 3I87A 5CZXA 3DM2B 4WKYA 1QM9A 2D41A 4R5PA 4J9NA 1LW2A 2VJUA 4TKTA 1RJJA 2QMUB 1OPZA 2WVCA 4LR9A 4EO6A 4AL7A 4ZITA 5E33A 1S1VA 1PGZA 2N82B 1GT8A 1G3OA 1VBYA 1H38A 3J7Z5 3FZBA 3OVBA 5KFWA 4CYRA 1RAFB 2Y0SD 1JXLA 4NZ0A 1ICEB 2HGLA 3PHTA 4QIEA 2VU5A 1WKKA 3VWSA 3HHEA 3DRRB 3W62A 2W8LA 4P9SA 3HHLA 4X4VA 3NOCA 4USIA 5SZTA 1WKJA 4HH1A 2C2ZB 1E6VB 3IWLA 4UOHA 2B56A 3CJ3A 3MEGB 3HLUA 1NJXA 4PG5A 1GX6A 1FNXH 2K7JA 2DTJA 2WAQD 2N3LA 5DQGA 2DCLA 1L3TA 2AP6A 1TMMA 1NDPA 3KUHA 4ZLNA 3R5DA 4BC7A 1PJ5A 5LIAA 1IKWA 1WACA 4RW9B 2EC0A 4JI6F 4UOGA 2UV8G 3IXQA 4IOCQ 1NU4A 3G82B 1NJYA 1ZH5A 3PIOQ 2CQ1A 5HLFA 1NKBA 5J2MB 1URRA 1YJ9S 2OLWA 2ZBQA 1NK4A 1ALKA 1VBKA 2XNQA 4UOOA 4A8KA 2ZDPA 3PXGa 4DFPA 2FHJD 2YKMA 1JLEA 4X4SA 1L3VA 1Y3JA 3Q2SC 4IOBA 1IXKA 1M5PC 4DG1A 1HW8A 3T41A 4OYXA 5F0UA 1FWLA 3DRYA 3DLEA 2VOPA 3WAXA 2MY7A 1KVKA 2BM1A 3D68A 1S1UA 3BBFA 3CD0A 1F9HA 4F26A 3RJMB 5INHA 2QYGA 3M4XA 5DDRC 4WU2A 3FCVA 3BO3A 1MWYA 1WC3A 1AUSL 5ETQA 2CRLA 1ZAXA 2ASJA 3D3BJ 2FLLA 1YZ6A 2GJIA 3HCXA 4FYWB 4DV7F 4DL4A 9RUBA 1RXOB 5ETTA 1ZBTA 2E1CA 4DQPA 4TU8A 4NLPA 3R1HA 3AD7C 1SIWB 1BQMB 4KRWA 3CCWA 4CO4A 4QWEA 1UL3A 2KJVA 4O0NA 4LR7A 1XN9A 2RQMA 5IC6B 4ZCIA 2DHAA 4V1Ak 5J1PA 1U1OA 5L1LA 3Q0AA 3E8OA 4LSNB 4ZCMA 4B9LA 3R3TA 2RH6A 1LFPA 3D54A 2YWGA 4FP9A 3OD2A 3SZ2A 2J0SD 3NWRA 4UPHA 2QFJA 4U6PA 4DCPB 1K1QA 1RUSA 2J9DA 4JI8J 2J6UA 3LH2S 1QSLA 1SJRA 3OLBA 1UEKA 2KKHA 1WDTA 1H6KX 3RRHA 1GXUA 2ZHOA 2MLYA 3TA1A 5C2CA 2XRGA 1F3FA 1QVGR 4QQBA 2I5JA 1AYEA 2CPDA 1T9TA 2MLXA 3FQKA 1J5OA 3WIUA 2CNKB 4YY3F 1R89A 4ZK7M 5C25A 2DXDA 2BW2A 3RBXA 3I6PA 1DHMA 2IBOA 3THTA 4C0HA 4LRFA 2J9DE 2RNEA 2YPZA 1M0SA 3M30A 3R2CJ 3SCJE 4QYZK 1N6QA 2QSFA 2VG5A 4WIQA 4OYAA 1WF2A 3OSNA 3MAAA 2V68A 3BDFA 3IWNC 4ZLPA 5AXKA 3BQ2A 3POTB 4KHPF 2W2PP 2VBXA 5BYQA 2DEJA 1RT2B 2JLGA 3SSQA 4QR1A 3UR3C 2CUYA 3EGZA 4XPEA 1A6LA 2W1BA 5AXNA 3H40A 4TN0A 2XYHB 3GIMA 2XGQA 4HACA 5KFHA 4LQYA 4JI7J 3TUZC 3SSRA 3MURP 4LVNP 1UETA 3PFOA 2A10A 1WOOA 2XZDB 2YNIA 1JLFA 2EEYA 2M3DA 2L08A 5A2QY 2Y1IA 2O3DA 4PG7A 2ZH9A 4HHJA 1VS3A 4EO8A 3BYRA 2H1YA 3Q24A 1QVFR 3R5CA 1ANJA 2E5GA 3D2WA 4O44B 4X4RA 4P2FA 1UVNA 3TZZA 3QGHA 4CYUB 2DVIA 2D9PA 2AT1B 2FHKA 4KE5A 5B08A 4B3MF 4DF4A 3O5TB 1RACB 1CSJA 4QYRA 3ZTRA 1YIJS 2DNYA 2Z57B 3EXYA 1ZTTA 3HHLC 2XR9A 1KHJA 3A13A 3Q22A 2XHCA 3HKWA 2UU9J 4K2JA 1FWPA 2HMIB 4JV5J 3MD3A 3CULA 2VQRA 5BR8J 3B82A 1R7IA 2LDIA 1K8AT 4HR2A 3I0RB 2YWWA 4G3IA 3NNHA 3M6UA 3FBFA 1HWKA 1K73T 3GE9A 2HNZB 4NYZA 2YNGB 4DPTA 4TYAA 3MPVA 2Z2YB 4I7FB 3M2UB 2L9NA 4ZPWR 1ED8A 3PZPA 3ILJA 4JB8B 2RSQA 1E6YB 2CA9A 1RT7A 2W8KA 1YITS 3G9CA 4PZVA 3ZZOA 5IT9U 3LP1A 2RU9A 3BGOP 3CEDA 1MMDA 2OO4A 1FJEB 4HHUA 2W9CA 4HHHA 3KNAA 4O4GA 2VFRA 2MSTA 1RCOB 3PYFA 4N76A 1LQ9A 2RQ4A 3M05A 1FWKA 2B8QA 2M88A 1IUJA 4NWXA 1URAA 3JXOA 5HAOA 3FRYA 5A0YB 1VC6A 1JLBB 2BANA 4KAYA 2JC1A 3N6NA 1JLAB 3US5A 3GYXB 1WDDA 1YHQS 4K59A 1SB6A 1TL1B 4LIRA 5HJXA 2KT5A 1R43A 4OQJA 3NNCA 2I0XA 4MKAA 2DY1A 4DR3J 3DGVA 4K4ZA 1S72S 2GCFA 2QX0A 3OL6A 1KKHA 2H4YB 1GH8A 2AEMA 4OZNA 3UNGC 1QE1A 4IRKA 2R8JA 4C0OC 4JI4J 2KT2A 4C97A 1KTQA 2YQ3A 3KDNA 1SVDA 4LRCA 1SKSA 4F25A 4NCBA 3GSIA 1HNVB 2UXDJ 3IS9A 1V5VA 5J2QA 4MT1A 2Z2LA 1HNXF 4AXIA 1TR0A 3FFIA 3GJSB 2DIVA 4DUYF 2AGPA 3HJVA 3TANA 4CLUA 3R7BB 4GTZA 1Y7AA 5KFOA 2W01A 1RAAB 2QA4G 1XMBA 1RT4B 2V4JB 4E98A 5LSOA 4FKYA 2B7CB 1IBCB 1UWAA 3MUVP 2ZH1A 2G2YA 3MMAB 4C9DA 3O44A 3DOKB 4M94A 2IRYA 1T95A 4ZPAA 3PW7A 3EDQB 1YKWA 3V4MA 3EDRB 4CWBA 4Q44A 3J81j 4ED5A 4RO0A 1W2BR 3RYLA 2NPFA 3I82A 3JSRA 5FD1A 4UF4A 3DHXA 1VQ5S 3OXGA 2M2BA 1KFSA 5DLWA 1Q8KA 2BJ8A 2EI5A 3MGJA 4ERDA 1RB0A 1S6PB 3NP5A 3R6LB 2R7UA 4HTIA 2V4QA 3K8WA 1RT5B 4BWJA 4GO5X 1UZDA 1QY7A 1GFWB 3DI6B 1F9FA 3SDEB 3UW1A 4C6AA 2QN6B 2ZKTA 3ZFVA 3C19A 3QT8A 3IR7B 1NH8A 1I1GA 2IDEA 1U0HB 3ICLA 3GR1A 4DV0F 2OELA 3QGPA 1VRUA 4C7QA 1B8JA 4CH7A 4FYDA 3RBEA 2HW3A 1E2SP 2UUBJ 1HYSA 4OZLA 1Q7YT 2QV6A 4MAKA 5HMZA 2VFSA 3T6JA 5HVHA 1DTTB 2MYFA 4DR6F 3VVUA 4ATNA 1F0XA 3T5KA 1HNIB 2YKQA 3OLAA 4N8NA 3VGVA 3L7PA 5AE1A 4A8XA 1Z2ZA 4IO1A 4M5JA 1E1ZP 1WWHA 1TKTA 3GQCA 2YKAA 2YXLA 3SYZA 4EYHB 5KFNA 1FRIA 4Q0BB 1S1XB 2FTRA 4PYAA 4Z7CA 4ECUA 2DGQA 1QTNB 5EWEA 4NLGA 1RWVB 3OTCA 1UVKA 1G2EA 2MY8A 2ASYA 2NREA 1TL3A 5C5JA 2L9DA 3K5OA 1HR0J 1R0AB 2YKNB 2MMYA 1U47A 3KLHA 3M8RA 4ANDA 4LBPA 2BXJA 4UT4A 2WSEC 2YKOA 1RWMB 2V2QA 3W7BA 3HFZB 1S57A 1ZM9A 2BKOA 3IRXB 3QO9A 2RE1A 4PPZA 5GMKa 2BMBA 2W5SA 1WJ9A 2BYCA 4ICLA 3FK4A 3M9OB 4IG0B 4PUOA 1IVZA 4KSEB 4J9KA 1S49A 3FCHA 1BHNA 5LJ3Y 1Q7LB 4JI3F 2HHXA 2OAUA 5AJ9A 3F0NA 1ZM4A 1T9YA 4RUBA 2ZFHA 1Q1KA 1X4EA 1KQGB 1DURA 1TELA 2G9OA 1XNQF 2J8SA 1OPIA 1D8ZA 4DUZF 2WOMA 3H98A 5G0RB 2R2UA 5CA5A 2KDOA 1UA0A 3PEJA 3MZIA 2R7WA 1FDBA 3RW6A 1K0VA 5CQGA 1PJ6A 3OFEA 1DJ0A 2D9OA 1N54B 4C4WA 1I3OB 1AB8A 5J2NB 3SZYA 4I6YA 3O8WA 4CNZA 1MSWD 3J80U 1N4LA 5IJSA 1X4AA 1T9WA 4DV2J 1DQ8A 5RUBA 2HHHF 1UJ6A 2BJEA 1RYRA 1C1BB 3MFHA 2XWYA 2DRBA 2OUGA 1OO0B 3HK2A 3X3UA 2GVDA 2MB0B 1ZZFA 4C11A 1FD8A 3DU5A 3QJPA 2KG0A 5B0GA 3NGRA 3LAMA 4EZ9A 5E7OB 2L41A 2XC9A 4EBEA 2KI2A 2HLUA 3FQLA 1MU2B 3MMCA 3WC0A 5KFBA 4K8RA 2Z30B 3AY0A 4QOTA 1NK7A 1OY6A 1WG4A 2XMWA 3S7RA 3DCAA 3PX0A 3IP0A 4PRFA 4W98A 2FPHX 3V6DA 2CZ4A 3TVYA 2BABA 3LGMA 3W3SA 1U24A 4FF2A 1BQXA 2IAJA 2J0XA 4HLBA 4I6WA 3NGSA 3W64A 3KK3B 1FK9A 5KFLA 4DSLA 3ENVA 3HPOA 4WIIA 3CVKA 2VHGA 4C48A 3A1YG 3LWLA 2JEFA 3DLHA 3QIPA 4EK2A 1N5TA 1QJHA 4DLEA 1DY3A 2BRLA 1I94J 1RHJB 3I9ZA 1RHRB 5KFRA 4LBIA 3KLEA 5LM7E 4QU7A 4DHVA 1WNEA 1N5SA 2QYCA 2UXBF 1S1WB 1U6FA 2FY8A 3P5TL 5DDPC 4TN2A 2KU7A 1JIHA 3GYNA 5IV4A 1RAOA 1KH5A 3E01A 1U1RA 4X4NA 1KH4A 4DPXA 4UW2A 3PKYA 2QEXS 4UY85 1YG0A 2XMMA 4NCGA 2OPQB 3NNAA 4X62F 1D0EA 1WG1A 4J37A 2VG7B 1WC6A 2GX8A 1RT6B 1SJQA 3KJVA 2MKHA 3FGVA 4Y6IA 4ES2A 3TJAA 3SCKE 5IM0B 2DGTA 1KVJA 4PXEA 3TJ8A 4USKA 5L9XA 2GFFA 3MEKA 3ULHA 2CXEA 2GIRA 4B3TF 3JSMB 2H5EA 2HS3A 1X4BA 4LF9J 4M5MA 1T94A 6FD1A 1UCNA 4W92B 2Z2MA 2MTLA 1FX4A 4HI2A 3R2DJ 2WONA 5HI7A 2PMHA 1N36F 3CJ0A 2V8HA 3M6WA 4KGZB 1RWXB 2Q6BA 1UTAA 2L3MA 4I69A 3HFVA 2BE9B 2CG8A 1HA1A 3MECA 4C8KA 2AEFA 1O0PA 2XEXA 1T9UA 3WX4A 5KT3A 4GTXA 1FRHA 2E5IA 3K5LA 3VGSA 1Y11A 5H9FJ 4WFAQ 2XM3A 1X4CA 4LFCF 4W4MA 4JV0A 1M1GA 2DNGA 1RWPB 2EC2A 4ZCKA 3C2PA 1VQ6S 2UVVA 1CJVA 4JBCA 4OZJA 1TFYA 4URSA 2KZZA 4ED2A 2MQLA 3TX8A 1P1LA 1VRTB 1S97A 1Q5YA 1UVLA 3NLCA 2ZH2A 1REGX 4MK7A 3W8GA 3GCXP 3GFYA 1REVB 2ACYA 2A2DA 1ZM2A 3DRXA 1ZA2B 1DQ9A 5KT6A 2NSCA 3MM7A 4NI2B 1HNWF 3RB4A 2OHDA 2CPJA 2EVZA 3T1YF 5CHCB 2ZZNA 1T9VA 2R2TA 2DXFA 3VAIA 1LXNA 1UP1A 2CJQA 2YWKA 2POKA 1AA1B 3BBCA 4OV1A 2AU0A 4QWBA 1LWEB 1Z1ZA 3W9IA 5T41A 4Q2MA 4JI6J 2BOPA 1F2GA 2W9BB 1YJWS 5HBMA 4DL3A 4USVA 3MUTP 2FYXA 2U2FA 2OMOA 5KT4A 2O1PA 3LANA 2BV3A 4O3SA 1DAXA 1SC4B 5FDLA 1IKXB 2DH7A 3KXDA 3FNNA 1RQ0A 4Y2CA 3GJQB 2KL8A 5EDWA 5A8WA 1CS4A 4ZPTR 2W5VA 2YX7A 3UWTA 3EGWB 4UOPA 4C8ZA 1R27B 3MTJA 4KGKA 3TYTA 1FXRA 3C6UB 2GIQA 4W90B 3E51A 2L48A 1RCXB 5E3CA 3TNVA 1JLGA 2DPJA 2GSNA 2E9RX 5KFZA 1YGYA 2LXUA 4DV7J 3PHEA 2QJ3A 3AOCA 3CF5Q 3EMTA 1X4FA 3TAMB 1HBOA 4RJVA 3SQOP 3MM6A 4P73A 4GTYA 2B7BB 2LXIA 5CH7B 2W4PA 2RF2B 2Q6CA 4HVZA 1RAJA 1NH7A 3RG6A 1MN9A 4OHXA 3RW7A 4ZG9A 3SQGB 4Z7YA 2YQ1A 2RJZA 3MM5B 2WW4A 5KFUA 3NBPB 3K0JA 1ZPWX 1R8CA 2AX1A 2B6AB 1MN7A 1Y3KA 1UJ4A 2MKJA 2N7CA 1UFKA 4GMKA 2XY5A 4DV5F 1GK8A 2YTCA 3KKFA 1FSUA 2UXCJ 4ZPCA 4CLYA 4J7CA 3DXBA 4WTOB 4F0KA 3PEHA 4U8YA 2YWFA 3RBZA 2GHWA 4LSLB 1VGYA 1UW4A 1FX2A 4RW4B 2XQCA 3MEEB 5DQIA 2HQIA 2UUAF 2DGOA 2QA1A 3A8JA 3NS6A 4X2BA 3H5SA 5ETLA 4J9QA 2CPYA 2W2OP 1IBKF 4B9TA 4CZCA 1BMQB 1NK9A 4K4XA 1UEVA 2AGOA 3BV8A 2MKCA 1U6ZA 5HN0A 2VICA 5IXUA 1U7LA 5LXYA 4QCLA 3RTVA 4FBUA 2HNDA 1JWWA 3AA9A 3D5MA 2FJXA 3I96A 2GAGC 1FKPA 1FE0A 3C8YA 2R42A 4CLPA 3TUJC 4KHPJ 4P7VA 3VAFA 2DNPA 1N56A 1QAJA 1CBKA 2RIJA 1RA6A 1HDHA 1Q0NA 2GS8A 3QATA 2F7VA 3M8ZA 3S1TA 4TU9A 4IDKA 2F8EX 1Y5IB 3J7ZT 3BDGB 3DKDA 3IGVA 1SC1B 2WVEA 4NE9C 2J6SA 4UZCA 3PKMA 4CQ1A 3GZ7A 3VAKA 1H0HB 2ADBA 4U95A 4B56A 3VALA 3PX6A 1EW8A 2NUHA 4Y28C 1EETB 5CYQA 3UVJA 2DRDA 3QJJA 3F56A 3HKZD 1I6JA 2AYMA 3PM9A 1P1TA 4IH5A 4RNMA 4O3PA 1HL6A 2EK1A 4X4TA 2HHQA 1T7PA 3CDUA 2WB4A 2EBGA 3JYTA 2CADA 4OI6A 2DGXA 5KOXA 3I9V9 3CMAS 1S6QA 2ASDA 1GTEA 3D66A 1M90T 2E66A 2RMLA 3D28A 2X3DA 3MPDA 5C24A 2JHEA 3MCSA 4KV8B 3OHBA 4ED3A 3SEOA 3CNQP 2ZJQQ 5GADU 1C1CA 3CIZA 3RAMA 1VQYA 1K44A 4Q45A 2XBPA 1FKOB 2HBYB 4O4RA 2RB7A 2OPSA 2WSCC 5F8HA 5I3UA 4JOUA 3TG0A 4I64A 3G4SS 3U1MA 1LW0B 3MMJA 3L95X 4R8UA 2F4VJ 5CD4H 1CEZA 1EQMA 1VJQA 5AJ3J 1DLOA 2ADCA 2NZCA 4ALZA 3H2LA 1BGXT 3R7NB 1ZOTA 4DUTA 2XWXA 4OYIA 3ILLA 4RW8B 4DEZA 1LWFB 4UOCA 1YJVA 4F67A 3BGUA 5DJBA 3A8EA 2DISA 4M63A 5LL6d 3T1HF 3PYDA 2VC1A 1YBAA 4B3OA 1T8EA 2LEPA 2V2KA 1KNZA 3IG1B 5J1NA 4UQGA 2QL9B 2FDNA 2IJNA 2AMCB 1TV6B 3MMBB 3H8YA 2HAFA 5LMNJ 2ZC3A 3GIRA 4EFAC 3V81A 4IUFA 1FERA 3HSGA 1LW2B 4LMZA 4WWSA 4I67A 3GIIA 3CXCR 3RB0A 4A8YA 1PC4A 1U2CA 2CQ2A 3BGRA 3UDCA 2PDAA 1S1TA 1VJWA 1S1VB 3OFHA 2QTWA 3AAWB 2P9CA 3HHKA 4F2RA 4YR2A 2CNLB 3WAVA 3IBWA 3UD5A 2KJWA 2UP1A 3NKQA 1FEHA 4OX8A 3J81U 3OR1A 4IH7A 4C3LA 1SV5A 2ILZA 2W24A 1HIYA 3HHLB 2PD1A 2GGPA 1JNZB 2Q1LA 1ZS6A 2N4DA 4JI8F 2V6AA 1YZ7A 4YB6A 2M0GB 4KAIA 4DUYJ 4IO9Q 4DL6A 4I4BA 3WBZA 1N48A 2C3OA 1C4AA 4JI0F 1UMJA 3C6TA 4EUVA 5EN1A 1RADB 1TP7A 4H4KC 4C8NA 5HLFB 2X3GA 1K9MT 1VBXA 2VBWA 1M5VC 4CLWA 1RTIA 4CO2A 5D0GA 1JLEB 3BREA 2VC0A 4IFVA 4BCAA 4DG1B 4GKKF 2P8IA 3DLEB 2RS8A 5K8NA 5L39A 5EWGA 1F60B 1L5UA 2IMWP 3T5HA 3HP6A 4OHVA 4EI2A 1D3WA 2C2KB 3HZGA 2XI3A 2CQBA 3ISNC 2B5JB 2GMJA 2DNOA 2CPEA 5F9LA 2MZRA 3CCLS 1RAEB 2HIQA 1P27B 1X9MA 4JI7F 2FLNA 1RA7A 3IGZB 1KDNA 4PXCA 2V50A 3A3OB 5F8LA 3LGHA 2ZBCA 2FZCB 4H4MB 2GW8A 1G7CB 3V4IB 1BWVA 4F2SA 1SJ4P 2DHGA 1U1LA 5HROB 5F3ZA 4ECWA 2MZSA 2PN6A 2LLZA 3Q8PB 3QSYB 2ZZMA 2PT0A 1VYAA 3NOGA 4FF4A 5DO2A 3CJSA 2PEBA 1N5YA 2PE8A 2G2OA 4DR6J 3BKTA 2W5XA 2HQCA 3BN4A 4IR9A 5LMUF 4U67Q 3TAPA 4OZ5A 2BQRA 1OY9A 2Y1JA 4ANCA 4F4AA 2QL7B 2A3JA 4Y2MA 1CG2A 4R0JA 2UU9F 3UR0A 1U1NA 4KH1B 1W26A 2XLJA 1NO8A 3L9ZA 2W7OA 1HBNA 4DN9A 4WZMA 4YUDA 2EFOA 4CO3A 3GR0A 2UUCJ 2OSQA 4WK1A 2XNRA 3GSDA 2OEKA 3A3PB 2I5JB 2OEJA 1AROP 2QLXA 1J5OB 2XYGB 2RVJA 5B0DA 5E41A 4R25A 2FVRA 5C25B 2MDAA 3BGFA 3NGKA 5IT4A 4ZGAA 1XTZA 4DV6J 2DXEA 2P5VA 1JLCA 1M1HA 3NVLA 4RNNA 4M5LA 1PILA 4FXDA 2VG5B 3HSDA 2ZEJA 3PJ9A 3GU0A 4RWXA 3TJ9A 1RGVA 4MJKA 2AJ1A 4LFAJ 4A46A 5B0CA 3UN2A 1TUGB 2HQFA 4ED1A 2EKNA 1APSA 3DOLA 4DPOA 1XEZA 2CQDA 2EFPA 3ILOA 5JXSA 2ZM6J 3G6XA 5CZVA 1C0TA 3ZZPA 4JUZA 4A47A 1NM2A 4DX6A 3HHLD 2AYEA 3O2IA 1T9XA 2YNIB 1JLFB 4GVLA 5LSLA 1HHTP 5L46A 4YFUA 4KM4A 1NK6A 3UN5A 2K7KA 2EBEA 1HBMA 1JX4A 1N2LA 9ATCB 3W9HA 1S79A 3CJ8A 1TFWA 3R9LA 3JAMY 3WAYA 3I5BA 4G1PA 1S4EA 3ZZ0A 5ETVA 2W5TA 4NLXA 4PXDA 4JI4F 1KC8T 1DZ5A 1TVRA 4NXNJ 5K8MA 2RDDA 3B5QA 3K59A 4ZPBA 3BN7A 4P74A 2PGCA 4AFFA 4QR2A 4RW9A 2JSXA 2NR0A 1CC8A 5DETA 3G82A 4ZMMA 1X4GA 2J9CA 2EW9A 2GHPA 3NAIA 4PQUA 5J2MA 4ZJQA 2BKPA 1U1MA 4PXBA 3DOMA 4DWIA 4MK9A 1Y0HA 3FEYB 4ZIWA 1EKRA 2M5YA 1U6BA 3BR9A 2DIUA 1RAIB 2R8IA 4J9MA 4TY9A 2B9YA 2Q79A 2BJ3A 2CQ3A 2OP5A 5KFKA 1S0MA 5D0RA 2BE7D 5B0BA 5B09A 1EQ0A 1FDDA 3TX0A 1BLUA 1NAQA 4YDDB 1RBLA 3ZO7A 3ZTPA 1G1XA 2DNLA 4ECVA 4F4WA 4KTQA 2OPRA 2UXBJ 3KTQA 3NMRA 1MWZA 1X8DA 2G0IA 1RWUA 1F1BB 3OUYA 2QZ8A 3WDOA 1UVMA 1RT7B 2DHHA 1SC3B 2MJNA 3OL8A 2F9DA 1BQNA 1OYDA 2OTJS 3GV5B 3VGTA 4KT0C 1SQGA 2EG2A 1AXQA 1TL7A 3M8QB 1YK9A 3ZTQA 4IQMA 3HVWA 3KJNB 1RWWB 1U8SA 3THPA 2DEIA 2RQCA 3EVWA 4BBYA 2BANB 1L3KA 3OTEA 4AD6A 2QMXA 3CJ2A 5E3QA 3KLGA 3CCES 2VPYB 4DPYA 4J9PA 5CD4A 1FEEA 5A8KA 4ZVHA 2UUBF 8AT1B 3AJ2A 3K2YA 2APOA 2B51A 4MYUA 4B3TJ 5A2QU 3PW5A 3OL9A 2OI2A 4C98A 2EPIA 2O66A 5T14A 1S0OA 3OJSA 4N7TA 2QLFB 3FVYA 5KFQA 4NZ7A 1NMEB 3LALA 4GVBA 2ROPA 1NPRA 3D6FB 3Q2TC 1WKLA 3IS9B 5ETSA 5J2QB 4FXWA 4LVOP 1TL5A 3FFIB 5L8RC 3AQPA 3R5AA 4LFCJ 1HR0F 4I2QA 3TQ1A 3OQ2A 3J7YU 4B9NA 1Y7PA 1N0UA 5F8JA 4ED4A 1RTHA 3QT7A 2KVQE 3RGIA 2K1RB 3OXFA 3IO1A 2JC0A 1FFGB 5KT5A 1ELOA 1TK5A 4WK3A 2ANHA 1NSAA 2IFYA 3MXHP 2VV5A 4KB7A 1SBRA 2J0WA 3G6VA 4IRCA 1NJIT 2HVDA 2HEKA 3EWGA 1C2PA 3KK1A 2CVIA 1RHKB 3L3CA 2C2EA 3T1YJ 2CIMA 3DLLQ 2FVPA 1QAIA 3VF0B 1PG5B 3IA0A 2CAJA 3NXZA 3HO1A 4J9VA 2V69A 1YRTA 1IBMJ 1N88A 2YNFA 3PY8A 3FSYA 3QAEA 1S7HA 3MFIA 3FC9A 1CJUB 1YVFA 4B3RJ 2RUSA 2O67A 4O44A 3KHGA 1VRUB 2H5JB 1W2IA 2V9KA 4CT9A 1YJ7A 2XZTB 2E1PA 4F36A 5K4PA 2OPPA 4DV2F 3RB6A 2XGPA 3G87A 2LECA 5HVGA 1HYSB 3CTRA 3EGVA 3GG1A 2DRAA 3G6ES 3GIJA 3GLJA 2IRXA 4PKDB 2VKRA 1WEYA 1S0NA 4UPIA 1X5OA 4LBHA 2Y3YA 4ZJLA 4A8WA 2AD9A 4QPTA 2WBMA 4RBUA 1K7HA 5A6PA 1TKTB 1X60A 2GVZA 3T9NA 2IIHA 3R1LA 4NRTA 2HHWA 1LXJA 3BJYA 2RUGA 5CCMA 1IM4A 4KJGA 3NKYA 3I0RA 2B3TB 5F8MA 2J5AA 4OZ1A 1SIZA 5F9NA 4B3SJ 4ZPVR 4K7QA 3WZ0A 4B9MA 2V8DA 4J90A 5IJQA 2HNZA 4XIUA 3QSIA 2YNGA 3HSJA 4LF6J 1SL1A 1TL3B 5GAGU 1TQLA 2CQ4A 4TU7A 2QLWA 4WZQA 4I7FA 2ZBIA 4X4PA 3KLHB 1SKWA 1ZPVA 3QO9B 4MKYA 2CDRB 3J7YI 1PC5A 4A4JA 4ICLB 3QLHA 4F0MA 1I94F 1IKYA 3AT1B 4PUOB 3SV3A 1CJTB 2FHMA 2Y1RI 4X65J 5HRTA 3W8PA 4RUCA 4G1QA 2KXFA 3BKFA 2NLWA 4ZHRA 2RRNA 1IR1A 1HQEA 4MH8A 4NZ6A 2QFIA 4QZVB 2C28A 1JLBA 3T9ZA 4P75A 1F5BA 1JLAA 1ROFA 3ZNUA 1A9NB 4ZA1A 1TL1A 3I5CA 2YX4A 4I56A 2R3VA 5C42A 2MHNA 1Y6VA 2MQOA 3EZ5A 2JEGA 1SJ1A 1RT3B 3DMJA 4NLWA 1ZM3A 2DO0A 4K4SA 1WORA 2A1BA 1P6TA 3W65A 5HQLA 3PYEA 3QMQA 3ZNJ1 1VQ7S 4DL2A 3VAJA 1HNVA 3M8WA 1ALIA 2M52A 2IMOA 2N3OA 2J7KA 4C11B 5F8GA 1FO1A 1B99A 2FJEB 3AQOA 3K7RA 3KLIB 3BDHA 1DFDA 4BS2A 3DHWC 2RKIA 3OFFA 1EX8A 2FB0A 4RNOA 2V4JA 2CJYB 3LPEA 4J5OA 2HBRB 3LWMA 3SZZA 4P52A 3IAS9 3I4PA 4JYAJ 4IRDA 1X5PA 4LQ3A 1NK5A 3D9BA 3V6DB 7FD1A 2XSJA 5IT0A 1J5EF 2C2DA 4ES1A 2CG4A 2IAJB 3DN9A 2VQFJ 4FDJA 4H54A 1VOMA 5D78A 3W63A 3G8SA 1SJ3P 3GYGA 3BKUA 4KAVA 1AUDA 5GAGI 1RWNB 2F63A 3QIPB 2QE5A 3MM9B 4WE1B 3AODA 3DLKA 4DV3J 3RRKA 2VA2A 3DGPB 1S6PA 3MI7X 1BWEA 2R7QA 1K0TA 3RU0A 2CZ9A 1HWJA 3KLEB 4FPRA 3EZUA 1C0UA 2CFXA 4P2MA 3CCVS 2J7UA 1NHKL 2NYHA 5K9FA 4OFZA 3D0IE 1HJKA 3QFWA 3E01B 1U0HA 2VJVA 2XO6A 3T00A 4OJ3A 3U1LA 2A6OA 1SUQB 5H9EJ 2JEIA 5DZ6A 5M2PA 1GX5A 3A4TA 1S59A 3AD8C 4ZVEA 3SSSA 4FN5A 1U1KA 2Q66A 4XPCA 4P7TA 3AOBA 3KJVB 2XMUA 1KLNA 2GA7A 1FRJA 3A8IA 4FYVB 3I4HX 3H0PA 3D6HB 3QWUA 1KOOA 1SHQA 4NA3A 2WSFC 2E1RA 4PPDA 1NK8A 2E7WA 4ELVA 1GQEA 1EHWA 1S1XA 3I0SA 3MK0A 3IR6B 5HQMA 3AXMA 5KFDA 2FIUA 3ITHA 2GHVC 4OI1A 1FRLA 1HPZA 2WONB 3OT9A 1J2VA 2J9EA 4NOHA 3K17A 1TUWA 3M32B 4J9LA 3T1HJ 4ECXA 4OZ0A 1VDHA 5H1SV 4WFYA 3MECB 5IWAF 3DDNA 1R0AA 1KN6A 2YKNA 3KOAA 4ZCLA 4Q7AA 1Y5NB 4OYWA 3E3XA 1T03A 2DNNA 2M9KA 4KBIA 4OZ2A 1RE1B 4M5IA 3PDNA 2CNOB 3NKPA 3M6XA 1Q81T 3J7AN 4DR1F 1M5KC 4C3MA 1AJBA 2FLOA 5JUMA 1NSPA 1CJVB 1NKCA 2BRKA 4ETZA 4CTAA 3H90A 3BH7B 1RTDB 3KUEA 1LNQA 5HVFA 4OV6A 3BS9A 5L1KA 4DFJA 4CH0S 1GMWD 2ABYA 2MQPA 2V67A 2W2QP 2HHVA 3PW4A 4DBQA 2AYGA 4PABA 1XMOJ 2ZE2A 1JKHB 3PRBA 3Q8UA 2X1GA 2N4CA 3MR5A 3D1OA 4IQXA 1PYTA 3L7OA 3MK1A 1FJGF 1FXLA 3MM7B 2UXCF 1YX2A 4N5SA 4ZVSB 2B4PA 1R31A 4QWCA 2W25A 3EYZA 3OR2A 3TVZA 4ZN3A 4I0WA 4ZLLA 2D3ZA 4NX9A 2HLTA 4JI0J 4DQRA 1EJ7L 3CB4A 3MTKA 4F4ZA 1T11A 3H7HB 4L6V3 2GMLA 4NA2A 4J9SA 1EW2A 2AW0A 1U1PA 2K3IA 3N6MA 5HBMB 4KGXB 2QO3A 2KXHA 3CO0P 5AXMA 4AXJA 2XMKA 4DR2F 4FXVA 4ID8A 4ED0A 1KHLA 1V5IB 1MU2A 2L9WA 3MAQA 4UZBA 1ALJA 3MR3A 4QU6A 1BUXA 2HFVA 4MKBA 2F9JA 5A8WB 4GKKJ 3CCQS 1TU0B 2IRUA 5D3GA 4CH1A 1Q16B 2JOQA 4Z2XA 3SCLE 2AKWB 2GMHA 3PJXA 2MXYA 4JI5J 2PFFB 5B0EA 3M9NB 4J9OA 2DNZA 3T19A 4ECQA 4YHHJ 4JV1A 1ELZA 2ZKUA 1KHVA 1JLGB 2KRBA 3OXLA 1FVSA 1U2RA 1HLWA 1S9GA 2HWHA 1KHNA 3MPWA 5E5NA 4GC6A 2Q3PA 1HBOB 2MQNA 2ILYA 3MM6B 2ZDOA 1YJTA 2E7VA 1S1WA 2DR8A 2UVWA 1XMQJ 3HD1A 2RHSB 1DBDA 1TAQA 4Y3CA 3K89A 4E0DA 3LOUA 2JWNA 4OYBA 3FBCA 1Q82T 3HF5A 4ID5A 5LMUJ 5L0EA 1NNDA 1O8BA 2DPIA 2DH9A 3AXKA 1TKXB 4FZVA 2WZ1A 2I2YA 2IBKA 1O6XA 4MKVA 3VHQA 5A8RA 4ZP7A 2F1FA 1RT6A 2MQ8A 3Q83A 3UQSA 3CJKA 2YNHB 2IVFB 2OH2A 2K8GA 2WVDA 3UCZP 4TLQA 1U49A 1N32J 3QT6A 1YJRA 3MHYA 4OIXA 1Y9OA 1S76D 2KM8C 4ECZA 2V5HG 2NXCA 3JSMA 1HMVA 1NXIA 1VCTA 3W61A 5KFSA 4NMLA 3SV4A 4IR1A 4DR4J 2HRTA 2F4VF 1FHTA 5KG5A 4KO0A 5AJ3F 4QYZJ 2K3KA 1KHWA 4M5DA 2ACMA 2ERRA 2HHUA 1S4FA 1Y4ZB 4F0HA 6FDRA 3QZ8A 1LWCA 3M2RA 1CJKB 1T05B 1FKPB 1OY8A 1PYSB 4LR2A 3P96A 3BPSP 2IVMA 5KFMA 4ED7A 2E5LF 5ETPA 1KVIA 1NJZA 3VAGA 3PO4A 1WD6A 2XSFA 2IM1A 3V6KA 3I32A 3OHAA 3JQMA 3OVAA 4DCOB 4IDKB 2QLJB 4DU7A 5LMNF 2BJDA 4P71A 1VRTA 3H59A 1JNRB 3JTOA 3BH6B 2HFNA 4JI1F 2KFNA 2MHEA 1B7FA 5DS7A 1HI1A 1OWXA 3CJQA 4ED6A 2GAHC 5I42A 5CYQB 3UVJB 1L3UA 1EB0A 5K14A 4GTWA 3QWPA 4N8OA 4ELTA 1EQJA 4NI2A 5IQ6A 5D0HA 1VBZA 1VIOA 5A76A 2J76E 1J27A 3B8HA 3KMQA 3M8PB 5CXTA 3NGUA 5KFPA 2R4FA 1NBEB 1XNRJ 3PX4A 3JYTB 4QW8A 2B43A 2XY7A 1RHUB 1S6QB 5HJYA 1JK9B 3TVKA 5MLCV 5LRMA 1YQHA 2HRUA 3OJUA 2DGSA 2KB2A 5C24B 2JX2A 3HT0A 3T3FA 4PAAA 3ZC4A 4TXSA 4Y00A 1IKXA 1OIAA 1EAYC 2VQEJ 2ZHAA 3EICA 1QD1A 2OPSB 5I3UB 1CULB 4WF9Q 2MKSA 3QAUA 2QC3A 1NZAA 3ELHA 4R8UB 3TRGA 2XMTA 2FJWA 1NUEA 3ET6B 4AE5A 3C6UA 3KG4A 2Z0GA 1VK3A 5G4DA 2OGUA 3DLBA 4UPLA 5KFIA 2FVSA 1TKZB 3BYPA 4R0EA 3TEGA 5EGHA 5D4LA 2C3MA 3L7UA 5E3AA 1MROB 4CLKA 3KYLA 2J6TA 5EGEA 3TAMA 3CPWR 4DL7A 4LIWA 4B3OB 1BC6A 1T0TV 3D0HE 2VA3A 4NASA 5L1JA 2RF2A 1R3NA 1VISA 4B17A 2K06A 3N79A 4X4UA 3H5UA 3HVTB 3H5XA 5EX0A 3B6BA 5L38A 3NBPA 3DRSB 3V81B 1X7VA 2MKYA 1V6HA 1IQZA 4J9RA 2DKOB 2R7OA 2NZ4A 2VONA 3PCOB 1WHVA 3IC1A 2E5JA 1HBUA 2CPHA 3MM8A 2DITA 2PIIA 2B9XA 1S1TB 4NLQA 4P72A 2ALZA 3CC2S 1WI8A 3OFGA 1LWXA 3MCMA 3D7SB 1BD6A 1PCAA 4GKJF 3G96A 3PW2A 2WW8A 4LSLA 1FNMA 4OI4A 4P10A 3OR1B 4AT1B 1SV5B 5L0BA 5HMXA 3UDLA 2NXEA 3NAHA 1RBOB 3TR5A 5KOWA 5IV3A 2Z58B 4LR8A 3SMZA 3NEKA 4RUHA 3F73A 4U7UD 2WVBA 2X1AA 4FVMA 4X66J 1IKVB 2GQ2A 2BR0A 1B70B 2MZQA 1UW9A 2GA3A 4RNFA 2W8SA 3G8QA 1UWBA 4JV2A 1HQAA 3LP0B 2HQDA 1WEZA 1U02A 4PWWA 4IYQA 3BGLA 2UUCF 3PACA 3ISND 1PAEX 3N28A 1FJ7A 1VI7A 4RW6A 2UVRA 2EFGA 4X84A 1SCJB 4TLRA 4DDFA 1QLNA 3GFHA 1HD1A 4QIVA 3CMES 1KEKA 1MWQA 1VR6A 3UCGA 3I55S 4DV6F 3PIPQ 3CC4S 3MR2A 5C2GA 4LF4J 2W5WA 2E7XA 1AT1B 1VHFA 1EI6A 3HD2A 1MMNA 3OBIA 2B0GA 4ZG6A 4EU0A 1SPBP 3BDGA 1OS5A 4LFAF 3KJFB 2VBZA 3VGUA 1WUUA 2CWXA 3C14B 3WBHA 5FLXY 4HL9A 4QAXA 2VKZG 4YP3A 1X9WA 1IQTA 1URNA 1K1SA 2XLKA 4F04B 1ZAVA 4YEAA 2ZM6F 4K4VA 3MK2A 5ITHA 3MEDB 1SL2A 3JS9A 1WOSA 3MR6A 4O3OA 2QMWA 2O5DA 2KYZA 2ZVSA 2R9LA 3D0GE 1GTHA 4NLDA 1S6OA 1H74A 2QIFA 4HDGA 1F2HA 3JQKA 3R5BA 1HW9A 2W4DA 3IMQJ 2QA2A 2WB1D 1SKUB 1RKJA 4AL5A 3HX9A 4RW7B 2YBVA 4Y2AA 3KLVA 3R5JB 2PC6A 1UAWA 1N5YB 2ZOGA 2WTFA 3KK2A 2R7RA 1TAUA 1U4BA 1KQKA 2AJQA 1IWGA 4L3NA 1EKSA 4NXNF 5T7LA 4UOFA 1U48A 3MR7A 3R6GB 4TYBA 2FJDB 2GNKA 2G1DA 1RP5A 2HS0A 3M1VB 3N0VA 4RU2A 2XTJP 2R8KA 2HHTA 2FJVA 1KONA 3D6MB 1NCLA 2CJXB 2PI4A 2P9EA 2VBYA 2XY6A 5DZ7A 1AZSA 2ZITA 4OMFG 1RTJA 1UJ5A 2HQ3A 1FD2A 1SH0A 5I4MA 4A8QA 2ATLA 2DR7A 1HBNB 3CCJS 3SI8A 1TL4A 3K5PA 5F8IA 4HKQA 1OQ3A 2W7AA 3KG0A 2CPFA 1RBAA 2CZVC 3PG9A 2LU1A 1VQPS 1JLQA 3HT3A 1WSVA 3BF4A 2VZ9A 3DYAA 4GO7X 3PR4A 1AJAA 1D9DA 1ZEDA 2X98A 4X4QA 2HGMA 2VFUA 2F3JA 1F3VA 4ZP9A 4URGA 2LA6A 4L3KA 3W2VA 3HJFA 1X4HA 4KPYA 1XK8A 1KS2A 3TZYA 5KG4A 1FTRA 3U7JA 1Q86T 1YLXA 1DQAA 1PO6A 1Z4UA 4KKOB 3KHRA 3UD3P 8RUCA 2DNKA 5THWA 3CO9A 2OMLA 1R6YA 4PQAA 2XS7A 2BUNA 5EGYA 4G65A 4LUBA 3DOLB 1H7WA 5L1IA 2H4WB 1DRZA 3IWXA 3OTOJ 3WX8A 4ETXA 2DGVA 4DR5F 1C0TB 2P6SA 3EUNA 3D3CJ 3PV8A 2F8MA 2IYIA 2X7IA 4PWDA 4RZRA 4LF8F 2DGWA 3NCPA 3FSXA 2MKKA 1M5OC 3AB2B 3DRPB 2AV5A 2NYIA 1XR6A 1HBMB 2M8DB 4DL0C 5GAHI 4K4YA 1RSCA 5HMYA 4IG3B 2P2CB 1EP4A 2AQ4A 1HHSA 2H5IB 4LF5J 3GTYX 3N5FA 1TVRB 3KHLA 1KLMA 2VF3A 4WP9A 1FI4A 1NKEA 1R8BA 2C1EB 3H2VE 4BLGA 2PA8D 4PQUB 3ISZA 1WTBA 4TVAB 4DFKA 3DOMB 1PBAA 2ZD1B 1ZA1B 1J5EJ 2IFXA 4HEA9 1ELXA 3QT5A 5FJ4A 2BM0A 2ZJRQ 5KFGA 3DDKA 3MPUB 3CGIA 2BQ3A 4B9VA 2ZUAA 4ZVTB 3TWZA 2YKPA 1VQ8S 5HK4A 3MDFA 2F4FA 3QPIA 1MW7A 5I3PA 2B5JA 3NS7B 4BDPA 2OPRB 4MFBB 1S9EA 2XHWA 1N34F 1D9AA 3NL0A 3V2UC 1VRQC 3OUYB 2BOAA 4UORA 4H4MA 4LF1A 4CM0A 1DARA 3V4IA 1UPPA 1UFWA 4OX9J 5DLGA 4NMXA 4QIWD 1CVJA 2EG1A 5HROA 2QSWA 1JJ2R 1DTQA 1BQNB 3HZEA 1IBMF 4CLSA 4ZP6A 4WFBQ 1ZETA 3J7A1 1GMVA 5I3QA 3ZTOA 1TL7B 2NS1B 2IUCB 4F3OA 3LP2B 4QR0A 4B3RF 2IY5B 2JZ5A 3IBFB 1KBRA 3LTOA 1FDNA 3KLGB 3LQVA 2JJ4D 4ER8A 4MMOA 5A8KB 1ZEBA 4KFBB 4G1IA 2UUWA 3CJTA 4DQQA 3T5LA 4M5HA 1RT1A 2FC8A 3H2UB 1NHVA 2G9YA 4USJC 1XR5A 1U0SA 3S6EA 3BB5A 3JAMU 1QSSA 1SQFA 1WHWA 2GO9A 1S48A 4RUAA 4F4XA 5J1EA 4H4OA 1VQOS 2BE2B 1YWXA 3I31A 5IWAJ 4ZVQB 4GVBB 3T5JA 2HWIA 3ZZZA 2D1CA 2CPZA 3X1LB 1KH7A 1X9SA 4XK8C 4B3SF 4PG4A 1NPKA 3QRRA 1D09B 2P6TA 3PNIA 3KLFA 3CMQA 1T3OA 4DR1J 4LF6F 3CCTA 3UE2A 1FT8A 2V2VA 2GLQA 1SL0A 3A52A 4I2QB 1B0VA 4I2PB 3C46A 4RX6A 2GIFA 3PRVA 3FUYA 4DXLA 4PR6A 4P6QA 1RTHB 5DQHA 4C8OA 1VK8A 3M7VA 3W2WA 1GMUA 2GJ2A 2KZMA 5D6GA 2ZH7A 3GWCA 4X65F 3KNGA 2D69A 3CD6S 3DLGA 4DU8A 1FJGJ 1WF1A 4A8MP 3CDWA 4YS2A 4YR1A 2FLPA 2W2NP 1O51A 1VQKS 3KK1B 3GFXA 5DLVA 4M8LA 4OYOA 1VHIA 2FGOA 3TA2A 3SFUA 2LYVA 2BEFA 1S7IA 4DX7A 1OSCA 4OHYA 3FEZA 2R8HA 2DNRA 2YNFB 3MCOA 3BPDA 3C15A 4DS5A 3HDSA 1SXLA 4D3HA 4DZDA 2I8EA 1U09A 4G6VB 4DR2J 4F3QA 1W25A 1RI7A 1P8GA 3C16B 1NJWA 3NGTA 3H5YA 4CXSA 4F4YA 1FF2A 2OPPB 3D1QA 2GV1A 3S8SA 1N33J 5KFCA 4CNYA 2KN4A 1L3SA 4DF8A 4NRUA 1HQUA 4DV4J 3K5NA 2LQJA 1NB7A 1H2TZ 1FTCA 3PYGA 2N7YA 2ZWPA 1WHXA 4KGVB 4GC7A 5J2PA 2CKWA 2D3OR 1Q4RA 4LF7J 4LQ9A 4HT7A 2RT3A 1V3ZA 4TY8B 5DLTA 4EZ6A 3CDAA 2OKQA 4USTA 2M7SA 2GVZB 3RZAA 5B7WA 4GRSA 4OJ1A 1W7WA 1FJCA 1R8HA 4YOEA 4JYAF 2XB2D 2P9GA 2GJFA 1NDLA 4OI0A 4MIAA 1LKZA 2EFVA 2VQFF 4Y2KA 3CCUS 4FPIA 4OYMA 2X1BA 4A48A 1YBTA 5CABA 3CD7A 3EXCX 2G0CA 5C7PA 2C42A 3G71S 4O23A 2BW7A 3KG1A 4DFMA 4DV3F 1XJWB 4RLEA 2I38A 2VUGA 3SCIE 3TA0A 4ILRA 3QLHB 4O3NA 1IKYB 2OD6A 2BJ9A 2HG4A 4G1QB 2KFZA 4AQYF 2DK2A 4ZHRB 3M8QA 4JI2J 1KTVA 5K8PA 1RWKB 1JJCB 1HQEB 1B0PA 1UKUA 2XCAA 2E9TA 1VC5A 2C3UA 2ZJPQ 4Q43A 3AFGA 1Q78A 2ZC4A 4ZDNA 1MLAA 3GV7B 3QJLA 1KFDA 2E44A 2ZOMA 2MGZA 2FD2A 4YB7A 2RDIA 4DOZA 5C42B 3CSKA 4WBFA 3B4MA 3W5ZA 2KVIA 5U47A 3DMJB 2KHDA 3KJQB 1XR7A 2C22A 4CO5A 1VMBA 2FC9A 4TQRA 4OL8A 4IFYB 4TQSA 4URQU 3R97A 1N8RT 1WEXA 4I6AA 2ZZTA 3LPYA 1XERA 5ADZA 2LQ5A 3M8YA 3W9JA 3L09A 3MOJB 4BHQA 3TZXA 1KP6A 2NCKL 4O3QA 5BYSA 2V94A 2CJKA 2E5LJ 5B0FA 1RDRA 1TTHB 3L4BC 2RKIB 4B02A 1P9QC 1F5AA 2KH9A 2CJBA 1H72C 4MY4A 2BVZA 1FRKA 1X0PA 1UVIA 3ENWA 2LXFA 1Q8BA 2K1RA 3MF5A 1WC4A 4R5PB 4EBCA 2FJAB 3TP2A 4K50A 3NY0A 4NEYA 3B54A 4OLOA 2XSJB 4JI1J 3VVTA 3SFGA 3FDSA 4DQSA 1Y10A 1A0OB 4ILMA 2D1GA 2W8DA 2DBBA 2HNYA 3BDEA 5K5MA 2F8HA 1JB0C 3EM1A 1XMOF 3DLKB 4C8LA 2YPYA 3IR5B 2JRSA 3M2VA 2JH3A 3MCNA 2HFZA 3B78A 4DR7F 5KFXA 3C66A 2DD8S 2IC3A 5KG2A 4DMZA 4ILLA 3ZTSA 2NUUG 1B4SA 2K2PA 1RTZA 2HWTA 1SH2A 3IGNA 1C0UB 3EX7B 5K20B 5KXAA 1CJUA 2LEBA 3OW2R 2IM3A 3HFKA 1UPMB 5JMNA 2KM8B 3PRDA 2D7SA 4BWMA 1AFIA 3QGGA 2BBEA 1H2UX 1IKWB 1S6UA 3BZQA 2KYXA 4L74A 2DCUB 1NRKA 4L72B 4KR0B 2C3PA 2KT3A 2U1AA 4WYLA 1Q79A 4F8RA 4YR0A 3SIPB 1QUPA 2C2RA 4KJDA 2MZJA 3PTWA 1M5HA 4ZVGA 2PMZD 2M8HA 7FDRA 5KFEA 3RRGA 5HATA 2YKMB 1NK0A 4M5NA 3Q23A 3QIDA 3I0SB 4WKRA 2VG6A 2Y1LB 1VC0A 2M4MA 3ITHB 2FHJA 3OVSA 2D3UA 5D4PA 4UPKA 1HPZB 1S1UB 2R7XA 3OTDA 3R27A 1LV5A 4QIGA 4ED8A 4JI5F 4RBVA 4LFBJ 5JVHQ 3QRQA 4YHHF 3IN5A 1FKAF 3CC7S 5BYRA 2XO7A 3DYCA 3ZZUA 2B4UA 5DG8A 1YRUA 4L73A 1T03B 3UO0A 5GOVA 1S99A 3IM9A 1VQLS 4QJVA 2RH3A 4EYIB 1KH9A 4N56A 1LK7A 2EWHA 1ZTWA 2VODA 4DI6A 2FVQA 1OMSA 3A12A 5GAEU 4ENOA 5M2RA 1RK8A 1CJTA 3U02A 5CYMA 5DGBA 4HI1A 3V6HA 2FY1A 2I1RA 1VQNS 1ED9A 2W5QA 1XMQF 2VFVA 3DXSX 4CTAB 4FYYB 2R7VA 3EVOA 5HP1A 1QUVA 1KQSR 5CYJA 2QG9B 1R8AA 5HQ8A 4IH6A 4DJBA 4GKJJ 2ZE2B 4RBTA 1FRMA 4UQTA 3CUNA 1WHYA 3QYYA 4CLZA 1Q53A 1GMWA 3UDVA 3OPKA 1AUKA 3QZ7A 4AL6A 4UUWA 2HAIA 3ZXWA 1PSDA 4U9RA 3EGNA 4CRJA 3HXMA 3O3LA 2BJ1A 1RT3A 2CQCA 3OR2B 1N32F 2SXLA 3H4DA 2Z4PA 1SI9A 3N01A 3HI9A 1IJEB 2IVYA 5ETRA 1VQ4S 4FKXA 1ZYQA 1WF0A 4M5GA 3VZHA 4DR4F 3VV2B 2LCWA 3LAKA 3HULA 4NCAA 4MIBA 4K4UA 3KLIA 1YTYA 2WHOA 2HQGA 1JJ4A 1VFJA 3M30B 4A8SA 3ZZYA 1NEEA 2VH7A 1N6QB 3AJ1A 2AIRB 5DRKA 2V2ZA 3MAAB 2W5RA 3DM2A 2W2MP 5D3GB 5ETOA 2CDQA 2X51A 1HNZF 4B9UA 1XIQA 2HK3A 1WC0A 1SJFA 3FJ2A 5H9FK 3UNYA 2XMAA 1TMJA 2DJWA 1EARA 1R0BG 3RR7A 1NSQA 3QBCA 2ZNYA 1Y5LB 1XC9A 2VDHA 3GONA 2VDIA 4HACB 5HO4A 1ANIA 3MM9A 4WE1A 1N0VC 1S9GB 3BR8A 3VQSA 2RS2A 3MAHA 1HFEL 1CLFA 3DGPA 3DRRA 1AW0A 3MOZA 1E6VA 1S77D 5EUHA 5GAEI 3ENAA 3MEGA 1E33P 2IDLA 2CPIA 4DS4A 3QGIA 3P3DA 5GRRA 2FJBB 5ETKA 4C8YA 5F3TA 5KG3A 2E1AA 1GAOA 2VPZB 1IJFB 1XNRF 3NKRA 1FDAA 2MZ1A 3W5XA 4ID5B 2CPXA 4NLVA 3CCRS 1F6TA 1SUQA 2ZH5A 3PR5B 4KHMA 4ZVFA 3FZ2A 1IM6A 1FVQA 3VR1A 2NXNA 5EHHA 1A7GE 2AEJA 1U45A 5A8RB 1I5OB 4KHRA 3OTBA 3CJKB 3S01A 1D8YA 4MK8A 1FCAA 4NYPA 3O6QA 1UZHA 2ZHBA 3E2DA 3W5YA 4OYPA 1AJCA 2VQEF 2F5GA 2DT9A 4X64F 4CIOA 1HMVB 2COLA 1H2VZ 5SUHA 2I9SA 2EFNA 3EE3A 4NXMF 3CD5A 5AXLA 4DV1J 3VQTA 1M5SA 4BC9A 2AGQA 1HHQA 4KO0B 3M32A 2GO8A 2CJ9A 2KG1A 3Q3QA 4M5DB 2JL9A 3GV8B 3FCWA 1U26A 1OQ6A 2V9WA 2DHXA 2ZH4A 1LWCB 3M2RB 3T01A 2B9EA 2W9AA 2MLZA 4ZVPB 3LP1B 5DM6Q 4DPWA 2LVWA 2RAQA 1UEUA 2W9CB 2JDJA 4CCHA 4O4GB 1NB2A 5IQQA 1CQNA 1RKIA 2JEJA 1BQMA 4PG6A 4DR5J 1RTDA 2AX0A 2AJ2A 3PO5A 2BA9A 3CWJA 2AF6A 2XMJA 4LF8J 4LSNA 1N5QA 1JKHA 3BM7A 4YB1P 4OX6A 2AZ3A 3NCQA 3DU6A 1B0TA 3BSOA 4LRBA 3CE8A 3VZIA 5I42B 1SH3A 2GC8A 4LF2A 3UCUP 5K14B 1JMTA 2A6MA 5GVQA 2RRAA 1RAHB 4WYWA 4EGLA 4PCQA 1WC5A 3CJ4A 3D4JA 1GXLA 3T6BA 1QE1B 3P5BP 4NLUA 2DH8A 4DZ6A 3RR8A 3NWGA 1JJHA 2OFGX 4USUA 4F3MA 3W66A 2VASA 3ZZTA 2IM2A 4ITSA 1KR4A 4JP8A 1KHKA 4QWDA 2HVZA 1FFWB 1P9YA 3QQCD 2JFDA 4X66F 2D74B 2FVCA 3EZOA 4A8OA 2VL1A 2ALYB 1LFWA 2DHSA 3DDIA 5IT9Y 1MMLA 3JSYA 4HTJA 3NCRA 4M1KA 2W4CA 3M9MB 3POTA 2XLIA 4YDXA 1LOUA 1RLCL 1RT2A 2LU2A 3BQ1A 3MPYA 4WP8A 3GP9A 4K2XA 2RILA 4LF4F 4QPXA 4QIFA 5HANA 5CAAA 3AD9C 3VAHA 2RU3A 3QFHA 3AJDA 2HPUA 4CO0A 4O3RA 1N34J 2AWZA 4Q8FA 4ECSA 3RBDA 5LJ5Y 2KHCA 3TI0A 1N5VA 1QTMA 3NMAA 1H3DA 3PW0A 1QAYA 1IBLF 1SQEA 3GG0A 2H65B 1X4DA 1ULRA 3BBBA 2ZBPA 2BQUA 1HWLA 5LSRA 5DM7Q 2LP4A 5IS2A 5D77A 5E2QA 4RU9A 3I5AA 4N77A 4CYUA 2M70A 1FXDA 4RL1A 3QNWB 4L76A 1Q95G 1SHNA 1IWAA 1H73A 1HBUB 3MM8B 1VLOA 5BXIA 2MPUA 2G0JA 1TKXA 3GCWP 1NZ8A 5K8OA 1HWIA 1YJUA 2LQBA 1TK0A 2LA4A 3C3LA 1Q8LA 2YNHA 4CP5A 3AHPA 5MAOA 4K0KF 2V4RA 2HMIA 2CQIA 2RDJA 4LT6A 2GQQA 5BJRA 4H4KA 2VFTA 3TUPA 2BACA 2MQQA 1N52B 3KMSA 5KG7A 4YY3J 3NRBA 4ZOSA 4PYDA 2XULA 2PO4A 3H25A 1G4CA 3FMBA 1UWBB 2HBZB 3M2UA 2HZAA 3P4UB 2RRBA 3AOAA 2ZUGA 5TJ3A 4PG8A 4RW6B 1JXVA 1CJKA 2H3EB 1T05A 1E6YA 2QLBB 3I56S 1PAUB 2MJUA 1HD0A 2WK4A 2AJ4A 1V3RA 1MG7A 1IR2A 3ONQA 3VCDA 2YH1A 1WSRA 2R2SA 4OJGA 4WPAA 2PI5A 2QRRA 4FVCA 4CLTA 1O98A 4NLSA 3TZWA 2E5HA 5F8NA 3KD8A 1NDCA 1B64A 4OYZA 1RISA 2DB1A 3CW2C 2G4BA 3MUMP 3BSNA 4L75A 5A0YA 5ETMA 2ZH3A 1RU1A 2DGUA 4K5SA 3HMJG 3H20A 3HHNB 3LXQA 2I6WA 4CDIA 2WOMB 5E3PA 1X0FA 4C8MA 3OTOF 5F41A 2FGCA 2ZH6A 1GXTA 1HWUA 4FS1A 5EWFA 4FF1A 1RU2A 2DNHA 3K57A 3M8PA 2J7WA 7AT1B 5A6WA 2CQGA 3WQPA 3WHIA 2YX1A 1FNOA 2OD4A 2OSRA 4B3MJ 3G86A 3E2EA 1HKAA 3CCZA 2R2RA 2GVDB 2NQPA 2Y8WA 1WOPA 4ZIVA 4NLTA 4TNOA 2HS4A 3NKNA 3JQJA 4FDIA 5AT1B 3KK2B 4NLOA 4LF5F 1O99A 5T7LB 2YH0A 2ROGA 2VD3A 2WBRA 2AJ0A 3MMCB 1RT4A 5JJBA 3VAMA 1F9EB 5IZHA 3FBEA 2XS5A 3IAM9 2G1HA 5DLFA 1KRPA 2HK2A 1TUVA 2EFQA 2H48B 1LEOA 3MMAA 1CULA 1YRXA 4ZN1A 3DOKA 4OI3A 1TZ0A 1AZSB 2ROEA 3ET6A 1V9OA 3BEGB 3UDEA 2IM0A 4HH0A 3P8BB 1RTJB 3G8TA 1FK9B 1CQMA 1UFLA 5HL7Q 1TKZA 4FS2A 2ATCB 1S12A 4DCJB 1MROA 2HFSA 1JLQB 5D4NA 2PSZA 3DYAB 3IM8A 4WJBA 4ZVRB 1VQMS 1RT5A 4B9SA 3GJTB 3DI6A 4WFXA 4AQYJ 3SDEA 4F50A 4M95A 3PFEA 2FQQB 2Q43A 4KYZA 3K58A 3J80Y 5L9NA 3W2VB 4FBTA 1XBWA 2R7SA 2IA6A 3HVTA 4NL5A 3DRSA 3CDEA 4OX9F 4DPUA 4NCGB 4AYBD 2IA0A 3RAQA 1JXEA 1ALHA 4FNHA 2FUG9 4PEOA 4WFNQ 3LO3A 5FLXU 1QAXA 3KUGA 2YQ0A 2XYPB 3T02A 1DTTA 3A3NB 2LDYA 1X5SA 4PWDB 2BDPA 1GEHA 3EJMA 4Q5VA 1HNIA 2GSUA 1ELYA 5D15A 5D4OA 2CWKA 4NPOA 5E0OA 3M8SA 4AUKA 4V19X 3N4WA 4Q0BA 2DR9A 3NKOA 3F41A 3TUIC 4I1TA 2DO4A 2BJ7A 4KQZA 3W60A 4F4KA 3P49B 1HNXJ 2JVRA 3KHHA 3ZZRA 2V8GA 1IKVA 1EP4B 2C2MB 3H4BA 2IHR1 1AFJA 2ZWOA 3LP0A 1KLMB 4KY3A 2YY3A 1YDLA 3B4DA 5LQQA 1QSYA 1FRXA 2W7PA 4LSZB 5GADI 3IRXA 2ASLA 4ECTA 1HQ2A 2QZUA 3CJRA 2R8GA 4IG0A 2HFOA 5L0KA 4U7CA 4QW9A 1EZZB 5KFJA 1IN0A 3MD1A 2G13A 2ZNZA 4FNIA 2HSEB 2WVFA 3N9UC 4J9UE 1U8WA 2BKNA 4XO0A 1NLKL 3CJ5A 1RHQB 2GQCA 3H42A 4DLGA 2HVEA 3GFZA 2ZH8A 2XCPA 4QBUA 3FSIA 5AE3A 2NSBA 3C14A 4FDFA 5G0RA 4DX8H 3KFWX 2MKIA 3OSPA 3TEHB 4HDHA 4DR7J 5D8HB 2HZCA 2H54B 1BXNA 3BDPA 1VQ9S 1N2KA 2HFUA 1S9EB 4MTPA 5LRNA 3DLJA 3MEDA 2RD5C 2IPOB 4ZVUB 2AYBA 3DC2A 4LJMA 2XS2A 4Y2IA 1ZEFA 3WAWA 5J2NA 1LK5A 4DV0J 1YJNS 4S0MA 1X31C 3NGDA 4USMA 3F44A 1DTQB 4HYKA 2CVEA 2FHOB 1C1BA 1G6BA 2NXJA 4RW7A 5KFFA 1M1KT 4NYOA 2KFYA 5D0EA 5GMEA 5LXRA 1PJ7A 3SBMA 2PA3A 3TW0A 3GILA 4CM2A 4WFZA 4YR3A 4QWAA 2KXNB 2H9ZA 5FDLB 3G2XA 3CT9A 2OJ3A 1Q5VA 3PJWA 1N33F 5KT7A 4DV4F 1CS4B 1RT1B 2BX6A 3Q89A 1HI0P 4P2XA 3M1VA 6AT1B 5HMWA 1PYOB 4C0BA 5B0AA 4LF7F 4OJHA 5EX3A 4EMDA 3BO2A 4JV5F 2CQHA 5C66A 2AJFE 1NPPA 1URBA 4U7UK 2O01C 3KK3A 5BR8F 5J1EB 4H4OB 2EKYA 3Q8YA 1D1UA 2DR6A 2HHPA 2R7TA 2HVIA 5CCLA 2B4VA 4E2FB 5DDOC 1RABB 4YN3B 4DSKA 3AA8A 2NPIA 4ECYA 4USHA 2IYGA 2Y9HA 3KLFB 1XQIA 2V34A 2OFHX 2IJFA 4F02A 2HYIB 4Y34A 4Z37A 4JI3J 1R0CB
chains in the Genus database with same CATH topology
3WAXA 5L0KA 1E2SP 4KAYA 1ALHA 1EW9A 4CXKA 4GTWA 1KHNA 3DYCA 3DPCA 5HRTA 5KXAA 4GTXA 3BDHA 3M7VA 1EQJA 1KH5A 3LXQA 4LREA 1ELXA 1HJKA 3IDDA 3WBHA 4TN0A 5L0BA 4QAXA 4LRDA 2VQRA 1KH4A 1AJDA 4LQYA 5INHA 3UO0A 1EW2A 2GSOA 5GOVA 3T00A 1ZEBA 4UPLA 3IGYB 4GTYA 5AJ9A 3T02A 2IUCA 2ANHA 3Q3QA 1KH9A 4MY4A 5EGHA 2IFYA 4LR8A 3NKPA 2GSUA 1ELYA 1E33P 4UPIA 3SZZA 3MK2A 4ZG9A 1P49A 1AJBA 5GRRA 3TWZA 2XRGA 4KM4A 1K7HA 1E1ZP 1KHKA 5EGEA 3IGZB 3UN5A 5DLTA 4YR1A 3T01A 2G9YA 2W5QA 1ED9A 1KHLA 2GA3A 1N2LA 4LR2A 4N7TA 3TX0A 2W8SA 3NKRA 5LRMA 4KJDA 1ALJA 3NKOA 5DLVA 3UN3A 1HQAA 5L0EA 3WAYA 4NWJA 5DLWA 5LIAA 4KJGA 1N2KA 5C66A 1URBA 2W5TA 4FDJA 1ANJA 4LRCA 5LRNA 2W5RA 1Y6VA 2W5VA 1ED8A 5TJ3A 1HDHA 1SHQA 1ZEDA 1AJAA 4ZGAA 3M8ZA 2W8DA 2D1GA 2X98A 4LRFA 1FSUA 4UOPA 4UORA 4KAVA 1ZEFA 4CYSA 5IJQA 3WAWA 4LR7A 3SZYA 3NVLA 1KH7A 1AUKA 2ZKTA 3UNYA 3B5QA 3MK1A 3MK0A 1SHNA 4LR9A 3BDGB 4MHXA 4LRAA 3NKNA 1ALKA 4FDIA 5LQQA 4MIVA 4UOOA 4CXUA 3E2DA 3TG0A 3CMRA 5IJSA 3BDFA 2W5WA 2W5XA 1O98A 4UPKA 1ELZA 4GTZA 1AJCA 3OT9A 1Y7AA 1O99A 3NKMA 2XR9A 3KD8A 1EI6A 3M8WA 1KHJA 1ALIA 3WAVA 1EJJA 1ANIA 2GLQA 1E3CP 3UN2A 1B8JA 2GSNA 2QZUA 2RH6A 2W5SA 3A52A 2IUCB 4CYRA 4ZG6A 4B56A 1EW8A 4NWXA 1URAA 4UPHA 5K4PA 4ZG7A 4CXSA 3M8YA 4LRBA 3BDGA 3ED4A 3NKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAX A;  5L0K A;  1E2S P;  4KAY A;  1ALH A;  1EW9 A;  4CXK A;  4GTW A;  1KHN A;  3DYC A;  3DPC A;  5HRT A;  5KXA A;  4GTX A;  3BDH A;  3M7V A;  1EQJ A;  1KH5 A;  3LXQ A;  4LRE A;  1ELX A;  1HJK A;  3IDD A;  3WBH A;  4TN0 A;  5L0B A;  4QAX A;  4LRD A;  2VQR A;  1KH4 A;  1AJD A;  4LQY A;  5INH A;  3UO0 A;  1EW2 A;  2GSO A;  5GOV A;  3T00 A;  1ZEB A;  4UPL A;  3IGY B;  4GTY A;  5AJ9 A;  3T02 A;  2IUC A;  2ANH A;  3Q3Q A;  1KH9 A;  4MY4 A;  5EGH A;  2IFY A;  4LR8 A;  3NKP A;  2GSU A;  1ELY A;  1E33 P;  4UPI A;  3SZZ A;  3MK2 A;  4ZG9 A;  1P49 A;  1AJB A;  5GRR A;  3TWZ A;  2XRG A;  4KM4 A;  1K7H A;  1E1Z P;  1KHK A;  5EGE A;  3IGZ B;  3UN5 A;  5DLT A;  4YR1 A;  3T01 A;  2G9Y A;  2W5Q A;  1ED9 A;  1KHL A;  2GA3 A;  1N2L A;  4LR2 A;  4N7T A;  3TX0 A;  2W8S A;  3NKR A;  5LRM A;  4KJD A;  1ALJ A;  3NKO A;  5DLV A;  3UN3 A;  1HQA A;  5L0E A;  3WAY A;  4NWJ A;  5DLW A;  5LIA A;  4KJG A;  1N2K A;  5C66 A;  1URB A;  2W5T A;  4FDJ A;  1ANJ A;  4LRC A;  5LRN A;  2W5R A;  1Y6V A;  2W5V A;  1ED8 A;  5TJ3 A;  1HDH A;  1SHQ A;  1ZED A;  1AJA A;  4ZGA A;  3M8Z A;  2W8D A;  2D1G A;  2X98 A;  4LRF A;  1FSU A;  4UOP A;  4UOR A;  4KAV A;  1ZEF A;  4CYS A;  5IJQ A;  3WAW A;  4LR7 A;  3SZY A;  3NVL A;  1KH7 A;  1AUK A;  2ZKT A;  3UNY A;  3B5Q A;  3MK1 A;  3MK0 A;  1SHN A;  4LR9 A;  3BDG B;  4MHX A;  4LRA A;  3NKN A;  1ALK A;  4FDI A;  5LQQ A;  4MIV A;  4UOO A;  4CXU A;  3E2D A;  3TG0 A;  3CMR A;  5IJS A;  3BDF A;  2W5W A;  2W5X A;  1O98 A;  4UPK A;  1ELZ A;  4GTZ A;  1AJC A;  3OT9 A;  1Y7A A;  1O99 A;  3NKM A;  2XR9 A;  3KD8 A;  1EI6 A;  3M8W A;  1KHJ A;  1ALI A;  3WAV A;  1EJJ A;  1ANI A;  2GLQ A;  1E3C P;  3UN2 A;  1B8J A;  2GSN A;  2QZU A;  2RH6 A;  2W5S A;  3A52 A;  2IUC B;  4CYR A;  4ZG6 A;  4B56 A;  1EW8 A;  4NWX A;  1URA A;  4UPH A;  5K4P A;  4ZG7 A;  4CXS A;  3M8Y A;  4LRB A;  3BDG A;  3ED4 A;  3NKQ A; 
#chains in the Genus database with same CATH topology
 4CXK A;  2WCX A;  3KWM A;  1B3T A;  1GNK A;  4C2M A;  4KKO A;  3W2W B;  1C4C A;  3W1Y C;  1XNQ J;  2CQ0 A;  1R8P A;  4DUZ J;  1F5C A;  2OPQ A;  3UD4 P;  4J91 A;  2Z2Z A;  1PKU A;  3DLG B;  2V8V A;  4JI2 F;  2VG7 A;  4M5K A;  1S5Z A;  3EPG A;  4NLY A;  3P6Y C;  4Q2L A;  3N6L A;  2KTQ A;  3ILI A;  5KTQ A;  4RKU C;  5IM0 A;  1ACM B;  2DYA A;  3DRP A;  3U27 A;  3GB0 A;  2UV8 A;  4P2S A;  2CQP A;  3DFE A;  2AZ1 A;  4DR3 F;  2HHH J;  3RB3 A;  4DN0 A;  4V19 J;  2UUT A;  1CPZ A;  2IJR A;  4O0I A;  3IFE A;  3C15 B;  1CC7 A;  3JTN A;  2ZOF A;  4IG3 A;  4PWU A;  8ATC B;  1NHU A;  3BQ0 A;  2LMI A;  4K5R A;  1RYS A;  4Q8E A;  1UA1 A;  3PVX A;  1S10 A;  1HAR A;  2HND B;  3GMG A;  3IBC B;  2UXD F;  4LRE A;  1HQU B;  1KWM A;  1S9F A;  4DSF A;  3GPA A;  1NSK L;  4DSE A;  1X5T A;  4WXO A;  3K5M A;  1HNZ J;  1BY9 A;  2HRY A;  3JTP A;  1YI2 S;  5J2P B;  2ZD1 A;  5LT5 A;  2JNJ A;  1WI6 A;  1KOH A;  4ZJO A;  3EPI A;  3MWB A;  2V8P A;  4ZLJ A;  1UVJ A;  5KFA A;  2E9Z A;  4WP3 A;  2LQ8 A;  4KGM A;  4EBD A;  4N47 A;  2LFV A;  5IFM A;  3BSA A;  2E1M C;  3G6Y A;  1Z2L A;  4XAK A;  2KO1 A;  5FII A;  3SXL A;  2HGN A;  1REV A;  3ETO A;  2UVU A;  1FE4 A;  2HUR A;  5KFV A;  4MFB A;  4DX5 A;  3Q86 A;  5KG1 A;  2VPW B;  4XDD A;  1EIY B;  3WC2 A;  1D9F A;  4XTT A;  2KRR A;  3JB9 k;  2OEM A;  2XI2 A;  3ETM A;  2E29 A;  4C3K A;  2HVH A;  1OJ4 A;  1RHM B;  4MIW A;  4ECR A;  3AH6 A;  3HM9 A;  2C2N A;  1LWE A;  3IDD A;  4X62 J;  4ZKA A;  2EXU A;  4WU3 A;  5DG7 A;  2W9B A;  4Y65 A;  2IUC A;  3LP2 A;  4NWB A;  4RPF A;  3R7S B;  3IRW P;  2CYY A;  3FKB A;  4HT5 A;  1TK8 A;  3LW5 C;  2B8P A;  1C1C B;  4E8U A;  2CJA A;  4KFB A;  2C2O B;  3ENQ A;  2HKE A;  5HSP A;  4DL5 A;  3R8Y A;  4CT8 A;  2MGZ B;  2MEW A;  5KT2 A;  4X64 J;  3FBB A;  3CDB A;  4NA1 A;  3FMW A;  3QRP A;  4DSI A;  2B4O A;  4NXM J;  4CYS A;  4K4T A;  4I68 A;  3P45 B;  2HHS A;  2D3O 1;  1N36 J;  1FA0 A;  4MHX A;  1DLO B;  4ZPD A;  4RR5 A;  3CMR A;  1SC6 A;  2BE2 A;  5JVG Q;  1VQS A;  1E3C P;  3Q8R B;  2C3Y A;  3TO8 A;  1QDU B;  2HBQ B;  4LFB F;  3GIK A;  4KJI A;  1AJD A;  2GSO A;  3WIV A;  3FRZ A;  3V5R A;  2YWE A;  2J8A A;  4I2P A;  2WRM A;  5DDQ C;  3DNC A;  1WG5 A;  4ZP8 A;  2EK6 A;  2FZK B;  1WEL A;  1T02 A;  3SQG A;  5DG9 A;  3MM5 A;  2G2Z A;  4X4O A;  1ZAW A;  1RZM A;  2B6A A;  1YSJ A;  3K8V A;  1Q8I A;  3HSZ A;  2DY9 A;  4KPC A;  1U1Q A;  3N5B A;  2X1F A;  3BGR B;  1U25 A;  2AHO B;  1KSP A;  4D3G A;  1O5J A;  2HNY B;  4U96 A;  1WTF A;  2MQM A;  2PEH A;  1HNW J;  2DNM A;  2XMV A;  2QGF B;  4EEY A;  4LRA A;  1Y00 A;  2NXU A;  4MIV A;  4CXU A;  2JLE A;  3LGN A;  3M2V B;  2JFK A;  3NS5 A;  4RW4 A;  3UI3 A;  5KFY A;  2GGP B;  2V0N A;  3BO4 A;  3MEE A;  1XWL A;  3CCS S;  1EJJ A;  2IC3 B;  1PBU A;  4USW A;  4F7V A;  4KIA A;  1SKR A;  5M2U A;  4ANE A;  4FF3 A;  2Z8Q A;  3BSC A;  1V3S A;  2OIH A;  2MZT A;  4LRD A;  2F40 A;  3U1N A;  2JVO A;  3C16 A;  3C6T B;  3JSB A;  4WCE Q;  4U8V A;  1P49 A;  2HIY A;  2OTL S;  1KD1 T;  2H51 B;  2UZA A;  4OHZ A;  5GMD A;  3HHD A;  1U2F A;  3EVM A;  2LEA A;  3D67 A;  1BE4 A;  2PMW A;  3UN3 A;  2PFD A;  1RTI B;  1JQG A;  2YWH A;  4FYX B;  5LOQ A;  2BZ2 A;  4TY8 A;  3AB4 B;  1IR0 A;  3GJR B;  3Q8S B;  4N41 A;  2ZVI A;  2MSS A;  4RWW A;  4IFV B;  2VG6 B;  1K47 A;  2VB6 A;  3VTI A;  1RLD A;  3TAR A;  3D1H A;  1B7Y B;  3NKM A;  4WXW A;  4CI0 B;  3LA0 A;  4ELU A;  2Z56 B;  3THV A;  1KQF B;  4YME A;  4EWT A;  2A0F B;  4CO1 A;  4WTY A;  2A18 A;  1YBU A;  4CLL A;  1IBL J;  4ZG7 A;  4Y0F A;  3LF0 A;  1H98 A;  1EET A;  3HVR A;  3ED4 A;  5F0W A;  3DPC A;  3J81 Y;  2XZW A;  2XG8 A;  5KG6 A;  2RHQ B;  1NDK A;  1I51 B;  2Y8Y A;  3RUB L;  3UPF A;  5GAH U;  4K4W A;  4NEZ A;  4OHW A;  4UY8 T;  3Q8V A;  2CNN B;  5CYM B;  2RQK A;  4IOA Q;  4RNH A;  4KH0 B;  2DR5 A;  4YQW A;  3LUY A;  4NLR A;  4DV5 J;  3FEX B;  1OSD A;  5HP1 B;  4DSJ A;  4NWJ A;  4XDC A;  3KDO A;  3R5G A;  1OYE A;  2VPX B;  3HVA A;  3T1A A;  4KV8 A;  4ES3 A;  2DNQ A;  2F65 A;  3OL7 A;  2LKZ A;  3A8K A;  4K0K J;  2QA4 S;  1FKO A;  2HZV A;  4UTG A;  2A2C A;  4ZVO B;  1FFS B;  3OV7 A;  1WC1 A;  5H9E K;  3O1L A;  1ITP A;  4OX7 A;  2UUA J;  1MNE A;  1LW0 A;  3NG8 A;  4MYT A;  5AE2 A;  4OI2 A;  1HI8 A;  1IBK J;  4OLP A;  4OZ3 A;  4UUX A;  3Q8Q B;  3TAQ A;  1EW9 A;  1TKD A;  3CCM S;  2LQ9 A;  4IFY A;  1VIX A;  3V6J A;  2JLF A;  1RWO B;  3M6V A;  2B9W A;  5KG0 A;  4LF9 F;  3IGY B;  3CIM A;  2FZG B;  3UFC X;  1T3N A;  4RW8 A;  2V63 A;  2VIH A;  1ZZN A;  5DGA A;  5IC4 B;  4DV1 F;  4KC5 A;  1LWF A;  1H7X A;  4YB5 A;  1VLY A;  4A8F A;  4ZS6 A;  4IKA A;  2Y0B B;  5ETN A;  2VOO A;  1S0V A;  2J0Q D;  5KAK A;  1PIE A;  3D6T B;  2QT7 A;  1JLC B;  2GZO A;  3IG1 A;  2QL5 B;  4B08 A;  4CLF A;  3RAX A;  4DQI A;  2ZBR A;  5IOL A;  1RAG B;  1TV6 A;  3TOQ A;  3MMB A;  5KFT A;  2YVS A;  1R6V A;  5E3R A;  1FES A;  3TQE A;  3ADA C;  3I87 A;  5CZX A;  3DM2 B;  4WKY A;  1QM9 A;  2D41 A;  4R5P A;  4J9N A;  1LW2 A;  2VJU A;  4TKT A;  1RJJ A;  2QMU B;  1OPZ A;  2WVC A;  4LR9 A;  4EO6 A;  4AL7 A;  4ZIT A;  5E33 A;  1S1V A;  1PGZ A;  2N82 B;  1GT8 A;  1G3O A;  1VBY A;  1H38 A;  3J7Z 5;  3FZB A;  3OVB A;  5KFW A;  4CYR A;  1RAF B;  2Y0S D;  1JXL A;  4NZ0 A;  1ICE B;  2HGL A;  3PHT A;  4QIE A;  2VU5 A;  1WKK A;  3VWS A;  3HHE A;  3DRR B;  3W62 A;  2W8L A;  4P9S A;  3HHL A;  4X4V A;  3NOC A;  4USI A;  5SZT A;  1WKJ A;  4HH1 A;  2C2Z B;  1E6V B;  3IWL A;  4UOH A;  2B56 A;  3CJ3 A;  3MEG B;  3HLU A;  1NJX A;  4PG5 A;  1GX6 A;  1FNX H;  2K7J A;  2DTJ A;  2WAQ D;  2N3L A;  5DQG A;  2DCL A;  1L3T A;  2AP6 A;  1TMM A;  1NDP A;  3KUH A;  4ZLN A;  3R5D A;  4BC7 A;  1PJ5 A;  5LIA A;  1IKW A;  1WAC A;  4RW9 B;  2EC0 A;  4JI6 F;  4UOG A;  2UV8 G;  3IXQ A;  4IOC Q;  1NU4 A;  3G82 B;  1NJY A;  1ZH5 A;  3PIO Q;  2CQ1 A;  5HLF A;  1NKB A;  5J2M B;  1URR A;  1YJ9 S;  2OLW A;  2ZBQ A;  1NK4 A;  1ALK A;  1VBK A;  2XNQ A;  4UOO A;  4A8K A;  2ZDP A;  3PXG a;  4DFP A;  2FHJ D;  2YKM A;  1JLE A;  4X4S A;  1L3V A;  1Y3J A;  3Q2S C;  4IOB A;  1IXK A;  1M5P C;  4DG1 A;  1HW8 A;  3T41 A;  4OYX A;  5F0U A;  1FWL A;  3DRY A;  3DLE A;  2VOP A;  3WAX A;  2MY7 A;  1KVK A;  2BM1 A;  3D68 A;  1S1U A;  3BBF A;  3CD0 A;  1F9H A;  4F26 A;  3RJM B;  5INH A;  2QYG A;  3M4X A;  5DDR C;  4WU2 A;  3FCV A;  3BO3 A;  1MWY A;  1WC3 A;  1AUS L;  5ETQ A;  2CRL A;  1ZAX A;  2ASJ A;  3D3B J;  2FLL A;  1YZ6 A;  2GJI A;  3HCX A;  4FYW B;  4DV7 F;  4DL4 A;  9RUB A;  1RXO B;  5ETT A;  1ZBT A;  2E1C A;  4DQP A;  4TU8 A;  4NLP A;  3R1H A;  3AD7 C;  1SIW B;  1BQM B;  4KRW A;  3CCW A;  4CO4 A;  4QWE A;  1UL3 A;  2KJV A;  4O0N A;  4LR7 A;  1XN9 A;  2RQM A;  5IC6 B;  4ZCI A;  2DHA A;  4V1A k;  5J1P A;  1U1O A;  5L1L A;  3Q0A A;  3E8O A;  4LSN B;  4ZCM A;  4B9L A;  3R3T A;  2RH6 A;  1LFP A;  3D54 A;  2YWG A;  4FP9 A;  3OD2 A;  3SZ2 A;  2J0S D;  3NWR A;  4UPH A;  2QFJ A;  4U6P A;  4DCP B;  1K1Q A;  1RUS A;  2J9D A;  4JI8 J;  2J6U A;  3LH2 S;  1QSL A;  1SJR A;  3OLB A;  1UEK A;  2KKH A;  1WDT A;  1H6K X;  3RRH A;  1GXU A;  2ZHO A;  2MLY A;  3TA1 A;  5C2C A;  2XRG A;  1F3F A;  1QVG R;  4QQB A;  2I5J A;  1AYE A;  2CPD A;  1T9T A;  2MLX A;  3FQK A;  1J5O A;  3WIU A;  2CNK B;  4YY3 F;  1R89 A;  4ZK7 M;  5C25 A;  2DXD A;  2BW2 A;  3RBX A;  3I6P A;  1DHM A;  2IBO A;  3THT A;  4C0H A;  4LRF A;  2J9D E;  2RNE A;  2YPZ A;  1M0S A;  3M30 A;  3R2C J;  3SCJ E;  4QYZ K;  1N6Q A;  2QSF A;  2VG5 A;  4WIQ A;  4OYA A;  1WF2 A;  3OSN A;  3MAA A;  2V68 A;  3BDF A;  3IWN C;  4ZLP A;  5AXK A;  3BQ2 A;  3POT B;  4KHP F;  2W2P P;  2VBX A;  5BYQ A;  2DEJ A;  1RT2 B;  2JLG A;  3SSQ A;  4QR1 A;  3UR3 C;  2CUY A;  3EGZ A;  4XPE A;  1A6L A;  2W1B A;  5AXN A;  3H40 A;  4TN0 A;  2XYH B;  3GIM A;  2XGQ A;  4HAC A;  5KFH A;  4LQY A;  4JI7 J;  3TUZ C;  3SSR A;  3MUR P;  4LVN P;  1UET A;  3PFO A;  2A10 A;  1WOO A;  2XZD B;  2YNI A;  1JLF A;  2EEY A;  2M3D A;  2L08 A;  5A2Q Y;  2Y1I A;  2O3D A;  4PG7 A;  2ZH9 A;  4HHJ A;  1VS3 A;  4EO8 A;  3BYR A;  2H1Y A;  3Q24 A;  1QVF R;  3R5C A;  1ANJ A;  2E5G A;  3D2W A;  4O44 B;  4X4R A;  4P2F A;  1UVN A;  3TZZ A;  3QGH A;  4CYU B;  2DVI A;  2D9P A;  2AT1 B;  2FHK A;  4KE5 A;  5B08 A;  4B3M F;  4DF4 A;  3O5T B;  1RAC B;  1CSJ A;  4QYR A;  3ZTR A;  1YIJ S;  2DNY A;  2Z57 B;  3EXY A;  1ZTT A;  3HHL C;  2XR9 A;  1KHJ A;  3A13 A;  3Q22 A;  2XHC A;  3HKW A;  2UU9 J;  4K2J A;  1FWP A;  2HMI B;  4JV5 J;  3MD3 A;  3CUL A;  2VQR A;  5BR8 J;  3B82 A;  1R7I A;  2LDI A;  1K8A T;  4HR2 A;  3I0R B;  2YWW A;  4G3I A;  3NNH A;  3M6U A;  3FBF A;  1HWK A;  1K73 T;  3GE9 A;  2HNZ B;  4NYZ A;  2YNG B;  4DPT A;  4TYA A;  3MPV A;  2Z2Y B;  4I7F B;  3M2U B;  2L9N A;  4ZPW R;  1ED8 A;  3PZP A;  3ILJ A;  4JB8 B;  2RSQ A;  1E6Y B;  2CA9 A;  1RT7 A;  2W8K A;  1YIT S;  3G9C A;  4PZV A;  3ZZO A;  5IT9 U;  3LP1 A;  2RU9 A;  3BGO P;  3CED A;  1MMD A;  2OO4 A;  1FJE B;  4HHU A;  2W9C A;  4HHH A;  3KNA A;  4O4G A;  2VFR A;  2MST A;  1RCO B;  3PYF A;  4N76 A;  1LQ9 A;  2RQ4 A;  3M05 A;  1FWK A;  2B8Q A;  2M88 A;  1IUJ A;  4NWX A;  1URA A;  3JXO A;  5HAO A;  3FRY A;  5A0Y B;  1VC6 A;  1JLB B;  2BAN A;  4KAY A;  2JC1 A;  3N6N A;  1JLA B;  3US5 A;  3GYX B;  1WDD A;  1YHQ S;  4K59 A;  1SB6 A;  1TL1 B;  4LIR A;  5HJX A;  2KT5 A;  1R43 A;  4OQJ A;  3NNC A;  2I0X A;  4MKA A;  2DY1 A;  4DR3 J;  3DGV A;  4K4Z A;  1S72 S;  2GCF A;  2QX0 A;  3OL6 A;  1KKH A;  2H4Y B;  1GH8 A;  2AEM A;  4OZN A;  3UNG C;  1QE1 A;  4IRK A;  2R8J A;  4C0O C;  4JI4 J;  2KT2 A;  4C97 A;  1KTQ A;  2YQ3 A;  3KDN A;  1SVD A;  4LRC A;  1SKS A;  4F25 A;  4NCB A;  3GSI A;  1HNV B;  2UXD J;  3IS9 A;  1V5V A;  5J2Q A;  4MT1 A;  2Z2L A;  1HNX F;  4AXI A;  1TR0 A;  3FFI A;  3GJS B;  2DIV A;  4DUY F;  2AGP A;  3HJV A;  3TAN A;  4CLU A;  3R7B B;  4GTZ A;  1Y7A A;  5KFO A;  2W01 A;  1RAA B;  2QA4 G;  1XMB A;  1RT4 B;  2V4J B;  4E98 A;  5LSO A;  4FKY A;  2B7C B;  1IBC B;  1UWA A;  3MUV P;  2ZH1 A;  2G2Y A;  3MMA B;  4C9D A;  3O44 A;  3DOK B;  4M94 A;  2IRY A;  1T95 A;  4ZPA A;  3PW7 A;  3EDQ B;  1YKW A;  3V4M A;  3EDR B;  4CWB A;  4Q44 A;  3J81 j;  4ED5 A;  4RO0 A;  1W2B R;  3RYL A;  2NPF A;  3I82 A;  3JSR A;  5FD1 A;  4UF4 A;  3DHX A;  1VQ5 S;  3OXG A;  2M2B A;  1KFS A;  5DLW A;  1Q8K A;  2BJ8 A;  2EI5 A;  3MGJ A;  4ERD A;  1RB0 A;  1S6P B;  3NP5 A;  3R6L B;  2R7U A;  4HTI A;  2V4Q A;  3K8W A;  1RT5 B;  4BWJ A;  4GO5 X;  1UZD A;  1QY7 A;  1GFW B;  3DI6 B;  1F9F A;  3SDE B;  3UW1 A;  4C6A A;  2QN6 B;  2ZKT A;  3ZFV A;  3C19 A;  3QT8 A;  3IR7 B;  1NH8 A;  1I1G A;  2IDE A;  1U0H B;  3ICL A;  3GR1 A;  4DV0 F;  2OEL A;  3QGP A;  1VRU A;  4C7Q A;  1B8J A;  4CH7 A;  4FYD A;  3RBE A;  2HW3 A;  1E2S P;  2UUB J;  1HYS A;  4OZL A;  1Q7Y T;  2QV6 A;  4MAK A;  5HMZ A;  2VFS A;  3T6J A;  5HVH A;  1DTT B;  2MYF A;  4DR6 F;  3VVU A;  4ATN A;  1F0X A;  3T5K A;  1HNI B;  2YKQ A;  3OLA A;  4N8N A;  3VGV A;  3L7P A;  5AE1 A;  4A8X A;  1Z2Z A;  4IO1 A;  4M5J A;  1E1Z P;  1WWH A;  1TKT A;  3GQC A;  2YKA A;  2YXL A;  3SYZ A;  4EYH B;  5KFN A;  1FRI A;  4Q0B B;  1S1X B;  2FTR A;  4PYA A;  4Z7C A;  4ECU A;  2DGQ A;  1QTN B;  5EWE A;  4NLG A;  1RWV B;  3OTC A;  1UVK A;  1G2E A;  2MY8 A;  2ASY A;  2NRE A;  1TL3 A;  5C5J A;  2L9D A;  3K5O A;  1HR0 J;  1R0A B;  2YKN B;  2MMY A;  1U47 A;  3KLH A;  3M8R A;  4AND A;  4LBP A;  2BXJ A;  4UT4 A;  2WSE C;  2YKO A;  1RWM B;  2V2Q A;  3W7B A;  3HFZ B;  1S57 A;  1ZM9 A;  2BKO A;  3IRX B;  3QO9 A;  2RE1 A;  4PPZ A;  5GMK a;  2BMB A;  2W5S A;  1WJ9 A;  2BYC A;  4ICL A;  3FK4 A;  3M9O B;  4IG0 B;  4PUO A;  1IVZ A;  4KSE B;  4J9K A;  1S49 A;  3FCH A;  1BHN A;  5LJ3 Y;  1Q7L B;  4JI3 F;  2HHX A;  2OAU A;  5AJ9 A;  3F0N A;  1ZM4 A;  1T9Y A;  4RUB A;  2ZFH A;  1Q1K A;  1X4E A;  1KQG B;  1DUR A;  1TEL A;  2G9O A;  1XNQ F;  2J8S A;  1OPI A;  1D8Z A;  4DUZ F;  2WOM A;  3H98 A;  5G0R B;  2R2U A;  5CA5 A;  2KDO A;  1UA0 A;  3PEJ A;  3MZI A;  2R7W A;  1FDB A;  3RW6 A;  1K0V A;  5CQG A;  1PJ6 A;  3OFE A;  1DJ0 A;  2D9O A;  1N54 B;  4C4W A;  1I3O B;  1AB8 A;  5J2N B;  3SZY A;  4I6Y A;  3O8W A;  4CNZ A;  1MSW D;  3J80 U;  1N4L A;  5IJS A;  1X4A A;  1T9W A;  4DV2 J;  1DQ8 A;  5RUB A;  2HHH F;  1UJ6 A;  2BJE A;  1RYR A;  1C1B B;  3MFH A;  2XWY A;  2DRB A;  2OUG A;  1OO0 B;  3HK2 A;  3X3U A;  2GVD A;  2MB0 B;  1ZZF A;  4C11 A;  1FD8 A;  3DU5 A;  3QJP A;  2KG0 A;  5B0G A;  3NGR A;  3LAM A;  4EZ9 A;  5E7O B;  2L41 A;  2XC9 A;  4EBE A;  2KI2 A;  2HLU A;  3FQL A;  1MU2 B;  3MMC A;  3WC0 A;  5KFB A;  4K8R A;  2Z30 B;  3AY0 A;  4QOT A;  1NK7 A;  1OY6 A;  1WG4 A;  2XMW A;  3S7R A;  3DCA A;  3PX0 A;  3IP0 A;  4PRF A;  4W98 A;  2FPH X;  3V6D A;  2CZ4 A;  3TVY A;  2BAB A;  3LGM A;  3W3S A;  1U24 A;  4FF2 A;  1BQX A;  2IAJ A;  2J0X A;  4HLB A;  4I6W A;  3NGS A;  3W64 A;  3KK3 B;  1FK9 A;  5KFL A;  4DSL A;  3ENV A;  3HPO A;  4WII A;  3CVK A;  2VHG A;  4C48 A;  3A1Y G;  3LWL A;  2JEF A;  3DLH A;  3QIP A;  4EK2 A;  1N5T A;  1QJH A;  4DLE A;  1DY3 A;  2BRL A;  1I94 J;  1RHJ B;  3I9Z A;  1RHR B;  5KFR A;  4LBI A;  3KLE A;  5LM7 E;  4QU7 A;  4DHV A;  1WNE A;  1N5S A;  2QYC A;  2UXB F;  1S1W B;  1U6F A;  2FY8 A;  3P5T L;  5DDP C;  4TN2 A;  2KU7 A;  1JIH A;  3GYN A;  5IV4 A;  1RAO A;  1KH5 A;  3E01 A;  1U1R A;  4X4N A;  1KH4 A;  4DPX A;  4UW2 A;  3PKY A;  2QEX S;  4UY8 5;  1YG0 A;  2XMM A;  4NCG A;  2OPQ B;  3NNA A;  4X62 F;  1D0E A;  1WG1 A;  4J37 A;  2VG7 B;  1WC6 A;  2GX8 A;  1RT6 B;  1SJQ A;  3KJV A;  2MKH A;  3FGV A;  4Y6I A;  4ES2 A;  3TJA A;  3SCK E;  5IM0 B;  2DGT A;  1KVJ A;  4PXE A;  3TJ8 A;  4USK A;  5L9X A;  2GFF A;  3MEK A;  3ULH A;  2CXE A;  2GIR A;  4B3T F;  3JSM B;  2H5E A;  2HS3 A;  1X4B A;  4LF9 J;  4M5M A;  1T94 A;  6FD1 A;  1UCN A;  4W92 B;  2Z2M A;  2MTL A;  1FX4 A;  4HI2 A;  3R2D J;  2WON A;  5HI7 A;  2PMH A;  1N36 F;  3CJ0 A;  2V8H A;  3M6W A;  4KGZ B;  1RWX B;  2Q6B A;  1UTA A;  2L3M A;  4I69 A;  3HFV A;  2BE9 B;  2CG8 A;  1HA1 A;  3MEC A;  4C8K A;  2AEF A;  1O0P A;  2XEX A;  1T9U A;  3WX4 A;  5KT3 A;  4GTX A;  1FRH A;  2E5I A;  3K5L A;  3VGS A;  1Y11 A;  5H9F J;  4WFA Q;  2XM3 A;  1X4C A;  4LFC F;  4W4M A;  4JV0 A;  1M1G A;  2DNG A;  1RWP B;  2EC2 A;  4ZCK A;  3C2P A;  1VQ6 S;  2UVV A;  1CJV A;  4JBC A;  4OZJ A;  1TFY A;  4URS A;  2KZZ A;  4ED2 A;  2MQL A;  3TX8 A;  1P1L A;  1VRT B;  1S97 A;  1Q5Y A;  1UVL A;  3NLC A;  2ZH2 A;  1REG X;  4MK7 A;  3W8G A;  3GCX P;  3GFY A;  1REV B;  2ACY A;  2A2D A;  1ZM2 A;  3DRX A;  1ZA2 B;  1DQ9 A;  5KT6 A;  2NSC A;  3MM7 A;  4NI2 B;  1HNW F;  3RB4 A;  2OHD A;  2CPJ A;  2EVZ A;  3T1Y F;  5CHC B;  2ZZN A;  1T9V A;  2R2T A;  2DXF A;  3VAI A;  1LXN A;  1UP1 A;  2CJQ A;  2YWK A;  2POK A;  1AA1 B;  3BBC A;  4OV1 A;  2AU0 A;  4QWB A;  1LWE B;  1Z1Z A;  3W9I A;  5T41 A;  4Q2M A;  4JI6 J;  2BOP A;  1F2G A;  2W9B B;  1YJW S;  5HBM A;  4DL3 A;  4USV A;  3MUT P;  2FYX A;  2U2F A;  2OMO A;  5KT4 A;  2O1P A;  3LAN A;  2BV3 A;  4O3S A;  1DAX A;  1SC4 B;  5FDL A;  1IKX B;  2DH7 A;  3KXD A;  3FNN A;  1RQ0 A;  4Y2C A;  3GJQ B;  2KL8 A;  5EDW A;  5A8W A;  1CS4 A;  4ZPT R;  2W5V A;  2YX7 A;  3UWT A;  3EGW B;  4UOP A;  4C8Z A;  1R27 B;  3MTJ A;  4KGK A;  3TYT A;  1FXR A;  3C6U B;  2GIQ A;  4W90 B;  3E51 A;  2L48 A;  1RCX B;  5E3C A;  3TNV A;  1JLG A;  2DPJ A;  2GSN A;  2E9R X;  5KFZ A;  1YGY A;  2LXU A;  4DV7 J;  3PHE A;  2QJ3 A;  3AOC A;  3CF5 Q;  3EMT A;  1X4F A;  3TAM B;  1HBO A;  4RJV A;  3SQO P;  3MM6 A;  4P73 A;  4GTY A;  2B7B B;  2LXI A;  5CH7 B;  2W4P A;  2RF2 B;  2Q6C A;  4HVZ A;  1RAJ A;  1NH7 A;  3RG6 A;  1MN9 A;  4OHX A;  3RW7 A;  4ZG9 A;  3SQG B;  4Z7Y A;  2YQ1 A;  2RJZ A;  3MM5 B;  2WW4 A;  5KFU A;  3NBP B;  3K0J A;  1ZPW X;  1R8C A;  2AX1 A;  2B6A B;  1MN7 A;  1Y3K A;  1UJ4 A;  2MKJ A;  2N7C A;  1UFK A;  4GMK A;  2XY5 A;  4DV5 F;  1GK8 A;  2YTC A;  3KKF A;  1FSU A;  2UXC J;  4ZPC A;  4CLY A;  4J7C A;  3DXB A;  4WTO B;  4F0K A;  3PEH A;  4U8Y A;  2YWF A;  3RBZ A;  2GHW A;  4LSL B;  1VGY A;  1UW4 A;  1FX2 A;  4RW4 B;  2XQC A;  3MEE B;  5DQI A;  2HQI A;  2UUA F;  2DGO A;  2QA1 A;  3A8J A;  3NS6 A;  4X2B A;  3H5S A;  5ETL A;  4J9Q A;  2CPY A;  2W2O P;  1IBK F;  4B9T A;  4CZC A;  1BMQ B;  1NK9 A;  4K4X A;  1UEV A;  2AGO A;  3BV8 A;  2MKC A;  1U6Z A;  5HN0 A;  2VIC A;  5IXU A;  1U7L A;  5LXY A;  4QCL A;  3RTV A;  4FBU A;  2HND A;  1JWW A;  3AA9 A;  3D5M A;  2FJX A;  3I96 A;  2GAG C;  1FKP A;  1FE0 A;  3C8Y A;  2R42 A;  4CLP A;  3TUJ C;  4KHP J;  4P7V A;  3VAF A;  2DNP A;  1N56 A;  1QAJ A;  1CBK A;  2RIJ A;  1RA6 A;  1HDH A;  1Q0N A;  2GS8 A;  3QAT A;  2F7V A;  3M8Z A;  3S1T A;  4TU9 A;  4IDK A;  2F8E X;  1Y5I B;  3J7Z T;  3BDG B;  3DKD A;  3IGV A;  1SC1 B;  2WVE A;  4NE9 C;  2J6S A;  4UZC A;  3PKM A;  4CQ1 A;  3GZ7 A;  3VAK A;  1H0H B;  2ADB A;  4U95 A;  4B56 A;  3VAL A;  3PX6 A;  1EW8 A;  2NUH A;  4Y28 C;  1EET B;  5CYQ A;  3UVJ A;  2DRD A;  3QJJ A;  3F56 A;  3HKZ D;  1I6J A;  2AYM A;  3PM9 A;  1P1T A;  4IH5 A;  4RNM A;  4O3P A;  1HL6 A;  2EK1 A;  4X4T A;  2HHQ A;  1T7P A;  3CDU A;  2WB4 A;  2EBG A;  3JYT A;  2CAD A;  4OI6 A;  2DGX A;  5KOX A;  3I9V 9;  3CMA S;  1S6Q A;  2ASD A;  1GTE A;  3D66 A;  1M90 T;  2E66 A;  2RML A;  3D28 A;  2X3D A;  3MPD A;  5C24 A;  2JHE A;  3MCS A;  4KV8 B;  3OHB A;  4ED3 A;  3SEO A;  3CNQ P;  2ZJQ Q;  5GAD U;  1C1C A;  3CIZ A;  3RAM A;  1VQY A;  1K44 A;  4Q45 A;  2XBP A;  1FKO B;  2HBY B;  4O4R A;  2RB7 A;  2OPS A;  2WSC C;  5F8H A;  5I3U A;  4JOU A;  3TG0 A;  4I64 A;  3G4S S;  3U1M A;  1LW0 B;  3MMJ A;  3L95 X;  4R8U A;  2F4V J;  5CD4 H;  1CEZ A;  1EQM A;  1VJQ A;  5AJ3 J;  1DLO A;  2ADC A;  2NZC A;  4ALZ A;  3H2L A;  1BGX T;  3R7N B;  1ZOT A;  4DUT A;  2XWX A;  4OYI A;  3ILL A;  4RW8 B;  4DEZ A;  1LWF B;  4UOC A;  1YJV A;  4F67 A;  3BGU A;  5DJB A;  3A8E A;  2DIS A;  4M63 A;  5LL6 d;  3T1H F;  3PYD A;  2VC1 A;  1YBA A;  4B3O A;  1T8E A;  2LEP A;  2V2K A;  1KNZ A;  3IG1 B;  5J1N A;  4UQG A;  2QL9 B;  2FDN A;  2IJN A;  2AMC B;  1TV6 B;  3MMB B;  3H8Y A;  2HAF A;  5LMN J;  2ZC3 A;  3GIR A;  4EFA C;  3V81 A;  4IUF A;  1FER A;  3HSG A;  1LW2 B;  4LMZ A;  4WWS A;  4I67 A;  3GII A;  3CXC R;  3RB0 A;  4A8Y A;  1PC4 A;  1U2C A;  2CQ2 A;  3BGR A;  3UDC A;  2PDA A;  1S1T A;  1VJW A;  1S1V B;  3OFH A;  2QTW A;  3AAW B;  2P9C A;  3HHK A;  4F2R A;  4YR2 A;  2CNL B;  3WAV A;  3IBW A;  3UD5 A;  2KJW A;  2UP1 A;  3NKQ A;  1FEH A;  4OX8 A;  3J81 U;  3OR1 A;  4IH7 A;  4C3L A;  1SV5 A;  2ILZ A;  2W24 A;  1HIY A;  3HHL B;  2PD1 A;  2GGP A;  1JNZ B;  2Q1L A;  1ZS6 A;  2N4D A;  4JI8 F;  2V6A A;  1YZ7 A;  4YB6 A;  2M0G B;  4KAI A;  4DUY J;  4IO9 Q;  4DL6 A;  4I4B A;  3WBZ A;  1N48 A;  2C3O A;  1C4A A;  4JI0 F;  1UMJ A;  3C6T A;  4EUV A;  5EN1 A;  1RAD B;  1TP7 A;  4H4K C;  4C8N A;  5HLF B;  2X3G A;  1K9M T;  1VBX A;  2VBW A;  1M5V C;  4CLW A;  1RTI A;  4CO2 A;  5D0G A;  1JLE B;  3BRE A;  2VC0 A;  4IFV A;  4BCA A;  4DG1 B;  4GKK F;  2P8I A;  3DLE B;  2RS8 A;  5K8N A;  5L39 A;  5EWG A;  1F60 B;  1L5U A;  2IMW P;  3T5H A;  3HP6 A;  4OHV A;  4EI2 A;  1D3W A;  2C2K B;  3HZG A;  2XI3 A;  2CQB A;  3ISN C;  2B5J B;  2GMJ A;  2DNO A;  2CPE A;  5F9L A;  2MZR A;  3CCL S;  1RAE B;  2HIQ A;  1P27 B;  1X9M A;  4JI7 F;  2FLN A;  1RA7 A;  3IGZ B;  1KDN A;  4PXC A;  2V50 A;  3A3O B;  5F8L A;  3LGH A;  2ZBC A;  2FZC B;  4H4M B;  2GW8 A;  1G7C B;  3V4I B;  1BWV A;  4F2S A;  1SJ4 P;  2DHG A;  1U1L A;  5HRO B;  5F3Z A;  4ECW A;  2MZS A;  2PN6 A;  2LLZ A;  3Q8P B;  3QSY B;  2ZZM A;  2PT0 A;  1VYA A;  3NOG A;  4FF4 A;  5DO2 A;  3CJS A;  2PEB A;  1N5Y A;  2PE8 A;  2G2O A;  4DR6 J;  3BKT A;  2W5X A;  2HQC A;  3BN4 A;  4IR9 A;  5LMU F;  4U67 Q;  3TAP A;  4OZ5 A;  2BQR A;  1OY9 A;  2Y1J A;  4ANC A;  4F4A A;  2QL7 B;  2A3J A;  4Y2M A;  1CG2 A;  4R0J A;  2UU9 F;  3UR0 A;  1U1N A;  4KH1 B;  1W26 A;  2XLJ A;  1NO8 A;  3L9Z A;  2W7O A;  1HBN A;  4DN9 A;  4WZM A;  4YUD A;  2EFO A;  4CO3 A;  3GR0 A;  2UUC J;  2OSQ A;  4WK1 A;  2XNR A;  3GSD A;  2OEK A;  3A3P B;  2I5J B;  2OEJ A;  1ARO P;  2QLX A;  1J5O B;  2XYG B;  2RVJ A;  5B0D A;  5E41 A;  4R25 A;  2FVR A;  5C25 B;  2MDA A;  3BGF A;  3NGK A;  5IT4 A;  4ZGA A;  1XTZ A;  4DV6 J;  2DXE A;  2P5V A;  1JLC A;  1M1H A;  3NVL A;  4RNN A;  4M5L A;  1PIL A;  4FXD A;  2VG5 B;  3HSD A;  2ZEJ A;  3PJ9 A;  3GU0 A;  4RWX A;  3TJ9 A;  1RGV A;  4MJK A;  2AJ1 A;  4LFA J;  4A46 A;  5B0C A;  3UN2 A;  1TUG B;  2HQF A;  4ED1 A;  2EKN A;  1APS A;  3DOL A;  4DPO A;  1XEZ A;  2CQD A;  2EFP A;  3ILO A;  5JXS A;  2ZM6 J;  3G6X A;  5CZV A;  1C0T A;  3ZZP A;  4JUZ A;  4A47 A;  1NM2 A;  4DX6 A;  3HHL D;  2AYE A;  3O2I A;  1T9X A;  2YNI B;  1JLF B;  4GVL A;  5LSL A;  1HHT P;  5L46 A;  4YFU A;  4KM4 A;  1NK6 A;  3UN5 A;  2K7K A;  2EBE A;  1HBM A;  1JX4 A;  1N2L A;  9ATC B;  3W9H A;  1S79 A;  3CJ8 A;  1TFW A;  3R9L A;  3JAM Y;  3WAY A;  3I5B A;  4G1P A;  1S4E A;  3ZZ0 A;  5ETV A;  2W5T A;  4NLX A;  4PXD A;  4JI4 F;  1KC8 T;  1DZ5 A;  1TVR A;  4NXN J;  5K8M A;  2RDD A;  3B5Q A;  3K59 A;  4ZPB A;  3BN7 A;  4P74 A;  2PGC A;  4AFF A;  4QR2 A;  4RW9 A;  2JSX A;  2NR0 A;  1CC8 A;  5DET A;  3G82 A;  4ZMM A;  1X4G A;  2J9C A;  2EW9 A;  2GHP A;  3NAI A;  4PQU A;  5J2M A;  4ZJQ A;  2BKP A;  1U1M A;  4PXB A;  3DOM A;  4DWI A;  4MK9 A;  1Y0H A;  3FEY B;  4ZIW A;  1EKR A;  2M5Y A;  1U6B A;  3BR9 A;  2DIU A;  1RAI B;  2R8I A;  4J9M A;  4TY9 A;  2B9Y A;  2Q79 A;  2BJ3 A;  2CQ3 A;  2OP5 A;  5KFK A;  1S0M A;  5D0R A;  2BE7 D;  5B0B A;  5B09 A;  1EQ0 A;  1FDD A;  3TX0 A;  1BLU A;  1NAQ A;  4YDD B;  1RBL A;  3ZO7 A;  3ZTP A;  1G1X A;  2DNL A;  4ECV A;  4F4W A;  4KTQ A;  2OPR A;  2UXB J;  3KTQ A;  3NMR A;  1MWZ A;  1X8D A;  2G0I A;  1RWU A;  1F1B B;  3OUY A;  2QZ8 A;  3WDO A;  1UVM A;  1RT7 B;  2DHH A;  1SC3 B;  2MJN A;  3OL8 A;  2F9D A;  1BQN A;  1OYD A;  2OTJ S;  3GV5 B;  3VGT A;  4KT0 C;  1SQG A;  2EG2 A;  1AXQ A;  1TL7 A;  3M8Q B;  1YK9 A;  3ZTQ A;  4IQM A;  3HVW A;  3KJN B;  1RWW B;  1U8S A;  3THP A;  2DEI A;  2RQC A;  3EVW A;  4BBY A;  2BAN B;  1L3K A;  3OTE A;  4AD6 A;  2QMX A;  3CJ2 A;  5E3Q A;  3KLG A;  3CCE S;  2VPY B;  4DPY A;  4J9P A;  5CD4 A;  1FEE A;  5A8K A;  4ZVH A;  2UUB F;  8AT1 B;  3AJ2 A;  3K2Y A;  2APO A;  2B51 A;  4MYU A;  4B3T J;  5A2Q U;  3PW5 A;  3OL9 A;  2OI2 A;  4C98 A;  2EPI A;  2O66 A;  5T14 A;  1S0O A;  3OJS A;  4N7T A;  2QLF B;  3FVY A;  5KFQ A;  4NZ7 A;  1NME B;  3LAL A;  4GVB A;  2ROP A;  1NPR A;  3D6F B;  3Q2T C;  1WKL A;  3IS9 B;  5ETS A;  5J2Q B;  4FXW A;  4LVO P;  1TL5 A;  3FFI B;  5L8R C;  3AQP A;  3R5A A;  4LFC J;  1HR0 F;  4I2Q A;  3TQ1 A;  3OQ2 A;  3J7Y U;  4B9N A;  1Y7P A;  1N0U A;  5F8J A;  4ED4 A;  1RTH A;  3QT7 A;  2KVQ E;  3RGI A;  2K1R B;  3OXF A;  3IO1 A;  2JC0 A;  1FFG B;  5KT5 A;  1ELO A;  1TK5 A;  4WK3 A;  2ANH A;  1NSA A;  2IFY A;  3MXH P;  2VV5 A;  4KB7 A;  1SBR A;  2J0W A;  3G6V A;  4IRC A;  1NJI T;  2HVD A;  2HEK A;  3EWG A;  1C2P A;  3KK1 A;  2CVI A;  1RHK B;  3L3C A;  2C2E A;  3T1Y J;  2CIM A;  3DLL Q;  2FVP A;  1QAI A;  3VF0 B;  1PG5 B;  3IA0 A;  2CAJ A;  3NXZ A;  3HO1 A;  4J9V A;  2V69 A;  1YRT A;  1IBM J;  1N88 A;  2YNF A;  3PY8 A;  3FSY A;  3QAE A;  1S7H A;  3MFI A;  3FC9 A;  1CJU B;  1YVF A;  4B3R J;  2RUS A;  2O67 A;  4O44 A;  3KHG A;  1VRU B;  2H5J B;  1W2I A;  2V9K A;  4CT9 A;  1YJ7 A;  2XZT B;  2E1P A;  4F36 A;  5K4P A;  2OPP A;  4DV2 F;  3RB6 A;  2XGP A;  3G87 A;  2LEC A;  5HVG A;  1HYS B;  3CTR A;  3EGV A;  3GG1 A;  2DRA A;  3G6E S;  3GIJ A;  3GLJ A;  2IRX A;  4PKD B;  2VKR A;  1WEY A;  1S0N A;  4UPI A;  1X5O A;  4LBH A;  2Y3Y A;  4ZJL A;  4A8W A;  2AD9 A;  4QPT A;  2WBM A;  4RBU A;  1K7H A;  5A6P A;  1TKT B;  1X60 A;  2GVZ A;  3T9N A;  2IIH A;  3R1L A;  4NRT A;  2HHW A;  1LXJ A;  3BJY A;  2RUG A;  5CCM A;  1IM4 A;  4KJG A;  3NKY A;  3I0R A;  2B3T B;  5F8M A;  2J5A A;  4OZ1 A;  1SIZ A;  5F9N A;  4B3S J;  4ZPV R;  4K7Q A;  3WZ0 A;  4B9M A;  2V8D A;  4J90 A;  5IJQ A;  2HNZ A;  4XIU A;  3QSI A;  2YNG A;  3HSJ A;  4LF6 J;  1SL1 A;  1TL3 B;  5GAG U;  1TQL A;  2CQ4 A;  4TU7 A;  2QLW A;  4WZQ A;  4I7F A;  2ZBI A;  4X4P A;  3KLH B;  1SKW A;  1ZPV A;  3QO9 B;  4MKY A;  2CDR B;  3J7Y I;  1PC5 A;  4A4J A;  4ICL B;  3QLH A;  4F0M A;  1I94 F;  1IKY A;  3AT1 B;  4PUO B;  3SV3 A;  1CJT B;  2FHM A;  2Y1R I;  4X65 J;  5HRT A;  3W8P A;  4RUC A;  4G1Q A;  2KXF A;  3BKF A;  2NLW A;  4ZHR A;  2RRN A;  1IR1 A;  1HQE A;  4MH8 A;  4NZ6 A;  2QFI A;  4QZV B;  2C28 A;  1JLB A;  3T9Z A;  4P75 A;  1F5B A;  1JLA A;  1ROF A;  3ZNU A;  1A9N B;  4ZA1 A;  1TL1 A;  3I5C A;  2YX4 A;  4I56 A;  2R3V A;  5C42 A;  2MHN A;  1Y6V A;  2MQO A;  3EZ5 A;  2JEG A;  1SJ1 A;  1RT3 B;  3DMJ A;  4NLW A;  1ZM3 A;  2DO0 A;  4K4S A;  1WOR A;  2A1B A;  1P6T A;  3W65 A;  5HQL A;  3PYE A;  3QMQ A;  3ZNJ 1;  1VQ7 S;  4DL2 A;  3VAJ A;  1HNV A;  3M8W A;  1ALI A;  2M52 A;  2IMO A;  2N3O A;  2J7K A;  4C11 B;  5F8G A;  1FO1 A;  1B99 A;  2FJE B;  3AQO A;  3K7R A;  3KLI B;  3BDH A;  1DFD A;  4BS2 A;  3DHW C;  2RKI A;  3OFF A;  1EX8 A;  2FB0 A;  4RNO A;  2V4J A;  2CJY B;  3LPE A;  4J5O A;  2HBR B;  3LWM A;  3SZZ A;  4P52 A;  3IAS 9;  3I4P A;  4JYA J;  4IRD A;  1X5P A;  4LQ3 A;  1NK5 A;  3D9B A;  3V6D B;  7FD1 A;  2XSJ A;  5IT0 A;  1J5E F;  2C2D A;  4ES1 A;  2CG4 A;  2IAJ B;  3DN9 A;  2VQF J;  4FDJ A;  4H54 A;  1VOM A;  5D78 A;  3W63 A;  3G8S A;  1SJ3 P;  3GYG A;  3BKU A;  4KAV A;  1AUD A;  5GAG I;  1RWN B;  2F63 A;  3QIP B;  2QE5 A;  3MM9 B;  4WE1 B;  3AOD A;  3DLK A;  4DV3 J;  3RRK A;  2VA2 A;  3DGP B;  1S6P A;  3MI7 X;  1BWE A;  2R7Q A;  1K0T A;  3RU0 A;  2CZ9 A;  1HWJ A;  3KLE B;  4FPR A;  3EZU A;  1C0U A;  2CFX A;  4P2M A;  3CCV S;  2J7U A;  1NHK L;  2NYH A;  5K9F A;  4OFZ A;  3D0I E;  1HJK A;  3QFW A;  3E01 B;  1U0H A;  2VJV A;  2XO6 A;  3T00 A;  4OJ3 A;  3U1L A;  2A6O A;  1SUQ B;  5H9E J;  2JEI A;  5DZ6 A;  5M2P A;  1GX5 A;  3A4T A;  1S59 A;  3AD8 C;  4ZVE A;  3SSS A;  4FN5 A;  1U1K A;  2Q66 A;  4XPC A;  4P7T A;  3AOB A;  3KJV B;  2XMU A;  1KLN A;  2GA7 A;  1FRJ A;  3A8I A;  4FYV B;  3I4H X;  3H0P A;  3D6H B;  3QWU A;  1KOO A;  1SHQ A;  4NA3 A;  2WSF C;  2E1R A;  4PPD A;  1NK8 A;  2E7W A;  4ELV A;  1GQE A;  1EHW A;  1S1X A;  3I0S A;  3MK0 A;  3IR6 B;  5HQM A;  3AXM A;  5KFD A;  2FIU A;  3ITH A;  2GHV C;  4OI1 A;  1FRL A;  1HPZ A;  2WON B;  3OT9 A;  1J2V A;  2J9E A;  4NOH A;  3K17 A;  1TUW A;  3M32 B;  4J9L A;  3T1H J;  4ECX A;  4OZ0 A;  1VDH A;  5H1S V;  4WFY A;  3MEC B;  5IWA F;  3DDN A;  1R0A A;  1KN6 A;  2YKN A;  3KOA A;  4ZCL A;  4Q7A A;  1Y5N B;  4OYW A;  3E3X A;  1T03 A;  2DNN A;  2M9K A;  4KBI A;  4OZ2 A;  1RE1 B;  4M5I A;  3PDN A;  2CNO B;  3NKP A;  3M6X A;  1Q81 T;  3J7A N;  4DR1 F;  1M5K C;  4C3M A;  1AJB A;  2FLO A;  5JUM A;  1NSP A;  1CJV B;  1NKC A;  2BRK A;  4ETZ A;  4CTA A;  3H90 A;  3BH7 B;  1RTD B;  3KUE A;  1LNQ A;  5HVF A;  4OV6 A;  3BS9 A;  5L1K A;  4DFJ A;  4CH0 S;  1GMW D;  2ABY A;  2MQP A;  2V67 A;  2W2Q P;  2HHV A;  3PW4 A;  4DBQ A;  2AYG A;  4PAB A;  1XMO J;  2ZE2 A;  1JKH B;  3PRB A;  3Q8U A;  2X1G A;  2N4C A;  3MR5 A;  3D1O A;  4IQX A;  1PYT A;  3L7O A;  3MK1 A;  1FJG F;  1FXL A;  3MM7 B;  2UXC F;  1YX2 A;  4N5S A;  4ZVS B;  2B4P A;  1R31 A;  4QWC A;  2W25 A;  3EYZ A;  3OR2 A;  3TVZ A;  4ZN3 A;  4I0W A;  4ZLL A;  2D3Z A;  4NX9 A;  2HLT A;  4JI0 J;  4DQR A;  1EJ7 L;  3CB4 A;  3MTK A;  4F4Z A;  1T11 A;  3H7H B;  4L6V 3;  2GML A;  4NA2 A;  4J9S A;  1EW2 A;  2AW0 A;  1U1P A;  2K3I A;  3N6M A;  5HBM B;  4KGX B;  2QO3 A;  2KXH A;  3CO0 P;  5AXM A;  4AXJ A;  2XMK A;  4DR2 F;  4FXV A;  4ID8 A;  4ED0 A;  1KHL A;  1V5I B;  1MU2 A;  2L9W A;  3MAQ A;  4UZB A;  1ALJ A;  3MR3 A;  4QU6 A;  1BUX A;  2HFV A;  4MKB A;  2F9J A;  5A8W B;  4GKK J;  3CCQ S;  1TU0 B;  2IRU A;  5D3G A;  4CH1 A;  1Q16 B;  2JOQ A;  4Z2X A;  3SCL E;  2AKW B;  2GMH A;  3PJX A;  2MXY A;  4JI5 J;  2PFF B;  5B0E A;  3M9N B;  4J9O A;  2DNZ A;  3T19 A;  4ECQ A;  4YHH J;  4JV1 A;  1ELZ A;  2ZKU A;  1KHV A;  1JLG B;  2KRB A;  3OXL A;  1FVS A;  1U2R A;  1HLW A;  1S9G A;  2HWH A;  1KHN A;  3MPW A;  5E5N A;  4GC6 A;  2Q3P A;  1HBO B;  2MQN A;  2ILY A;  3MM6 B;  2ZDO A;  1YJT A;  2E7V A;  1S1W A;  2DR8 A;  2UVW A;  1XMQ J;  3HD1 A;  2RHS B;  1DBD A;  1TAQ A;  4Y3C A;  3K89 A;  4E0D A;  3LOU A;  2JWN A;  4OYB A;  3FBC A;  1Q82 T;  3HF5 A;  4ID5 A;  5LMU J;  5L0E A;  1NND A;  1O8B A;  2DPI A;  2DH9 A;  3AXK A;  1TKX B;  4FZV A;  2WZ1 A;  2I2Y A;  2IBK A;  1O6X A;  4MKV A;  3VHQ A;  5A8R A;  4ZP7 A;  2F1F A;  1RT6 A;  2MQ8 A;  3Q83 A;  3UQS A;  3CJK A;  2YNH B;  2IVF B;  2OH2 A;  2K8G A;  2WVD A;  3UCZ P;  4TLQ A;  1U49 A;  1N32 J;  3QT6 A;  1YJR A;  3MHY A;  4OIX A;  1Y9O A;  1S76 D;  2KM8 C;  4ECZ A;  2V5H G;  2NXC A;  3JSM A;  1HMV A;  1NXI A;  1VCT A;  3W61 A;  5KFS A;  4NML A;  3SV4 A;  4IR1 A;  4DR4 J;  2HRT A;  2F4V F;  1FHT A;  5KG5 A;  4KO0 A;  5AJ3 F;  4QYZ J;  2K3K A;  1KHW A;  4M5D A;  2ACM A;  2ERR A;  2HHU A;  1S4F A;  1Y4Z B;  4F0H A;  6FDR A;  3QZ8 A;  1LWC A;  3M2R A;  1CJK B;  1T05 B;  1FKP B;  1OY8 A;  1PYS B;  4LR2 A;  3P96 A;  3BPS P;  2IVM A;  5KFM A;  4ED7 A;  2E5L F;  5ETP A;  1KVI A;  1NJZ A;  3VAG A;  3PO4 A;  1WD6 A;  2XSF A;  2IM1 A;  3V6K A;  3I32 A;  3OHA A;  3JQM A;  3OVA A;  4DCO B;  4IDK B;  2QLJ B;  4DU7 A;  5LMN F;  2BJD A;  4P71 A;  1VRT A;  3H59 A;  1JNR B;  3JTO A;  3BH6 B;  2HFN A;  4JI1 F;  2KFN A;  2MHE A;  1B7F A;  5DS7 A;  1HI1 A;  1OWX A;  3CJQ A;  4ED6 A;  2GAH C;  5I42 A;  5CYQ B;  3UVJ B;  1L3U A;  1EB0 A;  5K14 A;  4GTW A;  3QWP A;  4N8O A;  4ELT A;  1EQJ A;  4NI2 A;  5IQ6 A;  5D0H A;  1VBZ A;  1VIO A;  5A76 A;  2J76 E;  1J27 A;  3B8H A;  3KMQ A;  3M8P B;  5CXT A;  3NGU A;  5KFP A;  2R4F A;  1NBE B;  1XNR J;  3PX4 A;  3JYT B;  4QW8 A;  2B43 A;  2XY7 A;  1RHU B;  1S6Q B;  5HJY A;  1JK9 B;  3TVK A;  5MLC V;  5LRM A;  1YQH A;  2HRU A;  3OJU A;  2DGS A;  2KB2 A;  5C24 B;  2JX2 A;  3HT0 A;  3T3F A;  4PAA A;  3ZC4 A;  4TXS A;  4Y00 A;  1IKX A;  1OIA A;  1EAY C;  2VQE J;  2ZHA A;  3EIC A;  1QD1 A;  2OPS B;  5I3U B;  1CUL B;  4WF9 Q;  2MKS A;  3QAU A;  2QC3 A;  1NZA A;  3ELH A;  4R8U B;  3TRG A;  2XMT A;  2FJW A;  1NUE A;  3ET6 B;  4AE5 A;  3C6U A;  3KG4 A;  2Z0G A;  1VK3 A;  5G4D A;  2OGU A;  3DLB A;  4UPL A;  5KFI A;  2FVS A;  1TKZ B;  3BYP A;  4R0E A;  3TEG A;  5EGH A;  5D4L A;  2C3M A;  3L7U A;  5E3A A;  1MRO B;  4CLK A;  3KYL A;  2J6T A;  5EGE A;  3TAM A;  3CPW R;  4DL7 A;  4LIW A;  4B3O B;  1BC6 A;  1T0T V;  3D0H E;  2VA3 A;  4NAS A;  5L1J A;  2RF2 A;  1R3N A;  1VIS A;  4B17 A;  2K06 A;  3N79 A;  4X4U A;  3H5U A;  3HVT B;  3H5X A;  5EX0 A;  3B6B A;  5L38 A;  3NBP A;  3DRS B;  3V81 B;  1X7V A;  2MKY A;  1V6H A;  1IQZ A;  4J9R A;  2DKO B;  2R7O A;  2NZ4 A;  2VON A;  3PCO B;  1WHV A;  3IC1 A;  2E5J A;  1HBU A;  2CPH A;  3MM8 A;  2DIT A;  2PII A;  2B9X A;  1S1T B;  4NLQ A;  4P72 A;  2ALZ A;  3CC2 S;  1WI8 A;  3OFG A;  1LWX A;  3MCM A;  3D7S B;  1BD6 A;  1PCA A;  4GKJ F;  3G96 A;  3PW2 A;  2WW8 A;  4LSL A;  1FNM A;  4OI4 A;  4P10 A;  3OR1 B;  4AT1 B;  1SV5 B;  5L0B A;  5HMX A;  3UDL A;  2NXE A;  3NAH A;  1RBO B;  3TR5 A;  5KOW A;  5IV3 A;  2Z58 B;  4LR8 A;  3SMZ A;  3NEK A;  4RUH A;  3F73 A;  4U7U D;  2WVB A;  2X1A A;  4FVM A;  4X66 J;  1IKV B;  2GQ2 A;  2BR0 A;  1B70 B;  2MZQ A;  1UW9 A;  2GA3 A;  4RNF A;  2W8S A;  3G8Q A;  1UWB A;  4JV2 A;  1HQA A;  3LP0 B;  2HQD A;  1WEZ A;  1U02 A;  4PWW A;  4IYQ A;  3BGL A;  2UUC F;  3PAC A;  3ISN D;  1PAE X;  3N28 A;  1FJ7 A;  1VI7 A;  4RW6 A;  2UVR A;  2EFG A;  4X84 A;  1SCJ B;  4TLR A;  4DDF A;  1QLN A;  3GFH A;  1HD1 A;  4QIV A;  3CME S;  1KEK A;  1MWQ A;  1VR6 A;  3UCG A;  3I55 S;  4DV6 F;  3PIP Q;  3CC4 S;  3MR2 A;  5C2G A;  4LF4 J;  2W5W A;  2E7X A;  1AT1 B;  1VHF A;  1EI6 A;  3HD2 A;  1MMN A;  3OBI A;  2B0G A;  4ZG6 A;  4EU0 A;  1SPB P;  3BDG A;  1OS5 A;  4LFA F;  3KJF B;  2VBZ A;  3VGU A;  1WUU A;  2CWX A;  3C14 B;  3WBH A;  5FLX Y;  4HL9 A;  4QAX A;  2VKZ G;  4YP3 A;  1X9W A;  1IQT A;  1URN A;  1K1S A;  2XLK A;  4F04 B;  1ZAV A;  4YEA A;  2ZM6 F;  4K4V A;  3MK2 A;  5ITH A;  3MED B;  1SL2 A;  3JS9 A;  1WOS A;  3MR6 A;  4O3O A;  2QMW A;  2O5D A;  2KYZ A;  2ZVS A;  2R9L A;  3D0G E;  1GTH A;  4NLD A;  1S6O A;  1H74 A;  2QIF A;  4HDG A;  1F2H A;  3JQK A;  3R5B A;  1HW9 A;  2W4D A;  3IMQ J;  2QA2 A;  2WB1 D;  1SKU B;  1RKJ A;  4AL5 A;  3HX9 A;  4RW7 B;  2YBV A;  4Y2A A;  3KLV A;  3R5J B;  2PC6 A;  1UAW A;  1N5Y B;  2ZOG A;  2WTF A;  3KK2 A;  2R7R A;  1TAU A;  1U4B A;  1KQK A;  2AJQ A;  1IWG A;  4L3N A;  1EKS A;  4NXN F;  5T7L A;  4UOF A;  1U48 A;  3MR7 A;  3R6G B;  4TYB A;  2FJD B;  2GNK A;  2G1D A;  1RP5 A;  2HS0 A;  3M1V B;  3N0V A;  4RU2 A;  2XTJ P;  2R8K A;  2HHT A;  2FJV A;  1KON A;  3D6M B;  1NCL A;  2CJX B;  2PI4 A;  2P9E A;  2VBY A;  2XY6 A;  5DZ7 A;  1AZS A;  2ZIT A;  4OMF G;  1RTJ A;  1UJ5 A;  2HQ3 A;  1FD2 A;  1SH0 A;  5I4M A;  4A8Q A;  2ATL A;  2DR7 A;  1HBN B;  3CCJ S;  3SI8 A;  1TL4 A;  3K5P A;  5F8I A;  4HKQ A;  1OQ3 A;  2W7A A;  3KG0 A;  2CPF A;  1RBA A;  2CZV C;  3PG9 A;  2LU1 A;  1VQP S;  1JLQ A;  3HT3 A;  1WSV A;  3BF4 A;  2VZ9 A;  3DYA A;  4GO7 X;  3PR4 A;  1AJA A;  1D9D A;  1ZED A;  2X98 A;  4X4Q A;  2HGM A;  2VFU A;  2F3J A;  1F3V A;  4ZP9 A;  4URG A;  2LA6 A;  4L3K A;  3W2V A;  3HJF A;  1X4H A;  4KPY A;  1XK8 A;  1KS2 A;  3TZY A;  5KG4 A;  1FTR A;  3U7J A;  1Q86 T;  1YLX A;  1DQA A;  1PO6 A;  1Z4U A;  4KKO B;  3KHR A;  3UD3 P;  8RUC A;  2DNK A;  5THW A;  3CO9 A;  2OML A;  1R6Y A;  4PQA A;  2XS7 A;  2BUN A;  5EGY A;  4G65 A;  4LUB A;  3DOL B;  1H7W A;  5L1I A;  2H4W B;  1DRZ A;  3IWX A;  3OTO J;  3WX8 A;  4ETX A;  2DGV A;  4DR5 F;  1C0T B;  2P6S A;  3EUN A;  3D3C J;  3PV8 A;  2F8M A;  2IYI A;  2X7I A;  4PWD A;  4RZR A;  4LF8 F;  2DGW A;  3NCP A;  3FSX A;  2MKK A;  1M5O C;  3AB2 B;  3DRP B;  2AV5 A;  2NYI A;  1XR6 A;  1HBM B;  2M8D B;  4DL0 C;  5GAH I;  4K4Y A;  1RSC A;  5HMY A;  4IG3 B;  2P2C B;  1EP4 A;  2AQ4 A;  1HHS A;  2H5I B;  4LF5 J;  3GTY X;  3N5F A;  1TVR B;  3KHL A;  1KLM A;  2VF3 A;  4WP9 A;  1FI4 A;  1NKE A;  1R8B A;  2C1E B;  3H2V E;  4BLG A;  2PA8 D;  4PQU B;  3ISZ A;  1WTB A;  4TVA B;  4DFK A;  3DOM B;  1PBA A;  2ZD1 B;  1ZA1 B;  1J5E J;  2IFX A;  4HEA 9;  1ELX A;  3QT5 A;  5FJ4 A;  2BM0 A;  2ZJR Q;  5KFG A;  3DDK A;  3MPU B;  3CGI A;  2BQ3 A;  4B9V A;  2ZUA A;  4ZVT B;  3TWZ A;  2YKP A;  1VQ8 S;  5HK4 A;  3MDF A;  2F4F A;  3QPI A;  1MW7 A;  5I3P A;  2B5J A;  3NS7 B;  4BDP A;  2OPR B;  4MFB B;  1S9E A;  2XHW A;  1N34 F;  1D9A A;  3NL0 A;  3V2U C;  1VRQ C;  3OUY B;  2BOA A;  4UOR A;  4H4M A;  4LF1 A;  4CM0 A;  1DAR A;  3V4I A;  1UPP A;  1UFW A;  4OX9 J;  5DLG A;  4NMX A;  4QIW D;  1CVJ A;  2EG1 A;  5HRO A;  2QSW A;  1JJ2 R;  1DTQ A;  1BQN B;  3HZE A;  1IBM F;  4CLS A;  4ZP6 A;  4WFB Q;  1ZET A;  3J7A 1;  1GMV A;  5I3Q A;  3ZTO A;  1TL7 B;  2NS1 B;  2IUC B;  4F3O A;  3LP2 B;  4QR0 A;  4B3R F;  2IY5 B;  2JZ5 A;  3IBF B;  1KBR A;  3LTO A;  1FDN A;  3KLG B;  3LQV A;  2JJ4 D;  4ER8 A;  4MMO A;  5A8K B;  1ZEB A;  4KFB B;  4G1I A;  2UUW A;  3CJT A;  4DQQ A;  3T5L A;  4M5H A;  1RT1 A;  2FC8 A;  3H2U B;  1NHV A;  2G9Y A;  4USJ C;  1XR5 A;  1U0S A;  3S6E A;  3BB5 A;  3JAM U;  1QSS A;  1SQF A;  1WHW A;  2GO9 A;  1S48 A;  4RUA A;  4F4X A;  5J1E A;  4H4O A;  1VQO S;  2BE2 B;  1YWX A;  3I31 A;  5IWA J;  4ZVQ B;  4GVB B;  3T5J A;  2HWI A;  3ZZZ A;  2D1C A;  2CPZ A;  3X1L B;  1KH7 A;  1X9S A;  4XK8 C;  4B3S F;  4PG4 A;  1NPK A;  3QRR A;  1D09 B;  2P6T A;  3PNI A;  3KLF A;  3CMQ A;  1T3O A;  4DR1 J;  4LF6 F;  3CCT A;  3UE2 A;  1FT8 A;  2V2V A;  2GLQ A;  1SL0 A;  3A52 A;  4I2Q B;  1B0V A;  4I2P B;  3C46 A;  4RX6 A;  2GIF A;  3PRV A;  3FUY A;  4DXL A;  4PR6 A;  4P6Q A;  1RTH B;  5DQH A;  4C8O A;  1VK8 A;  3M7V A;  3W2W A;  1GMU A;  2GJ2 A;  2KZM A;  5D6G A;  2ZH7 A;  3GWC A;  4X65 F;  3KNG A;  2D69 A;  3CD6 S;  3DLG A;  4DU8 A;  1FJG J;  1WF1 A;  4A8M P;  3CDW A;  4YS2 A;  4YR1 A;  2FLP A;  2W2N P;  1O51 A;  1VQK S;  3KK1 B;  3GFX A;  5DLV A;  4M8L A;  4OYO A;  1VHI A;  2FGO A;  3TA2 A;  3SFU A;  2LYV A;  2BEF A;  1S7I A;  4DX7 A;  1OSC A;  4OHY A;  3FEZ A;  2R8H A;  2DNR A;  2YNF B;  3MCO A;  3BPD A;  3C15 A;  4DS5 A;  3HDS A;  1SXL A;  4D3H A;  4DZD A;  2I8E A;  1U09 A;  4G6V B;  4DR2 J;  4F3Q A;  1W25 A;  1RI7 A;  1P8G A;  3C16 B;  1NJW A;  3NGT A;  3H5Y A;  4CXS A;  4F4Y A;  1FF2 A;  2OPP B;  3D1Q A;  2GV1 A;  3S8S A;  1N33 J;  5KFC A;  4CNY A;  2KN4 A;  1L3S A;  4DF8 A;  4NRU A;  1HQU A;  4DV4 J;  3K5N A;  2LQJ A;  1NB7 A;  1H2T Z;  1FTC A;  3PYG A;  2N7Y A;  2ZWP A;  1WHX A;  4KGV B;  4GC7 A;  5J2P A;  2CKW A;  2D3O R;  1Q4R A;  4LF7 J;  4LQ9 A;  4HT7 A;  2RT3 A;  1V3Z A;  4TY8 B;  5DLT A;  4EZ6 A;  3CDA A;  2OKQ A;  4UST A;  2M7S A;  2GVZ B;  3RZA A;  5B7W A;  4GRS A;  4OJ1 A;  1W7W A;  1FJC A;  1R8H A;  4YOE A;  4JYA F;  2XB2 D;  2P9G A;  2GJF A;  1NDL A;  4OI0 A;  4MIA A;  1LKZ A;  2EFV A;  2VQF F;  4Y2K A;  3CCU S;  4FPI A;  4OYM A;  2X1B A;  4A48 A;  1YBT A;  5CAB A;  3CD7 A;  3EXC X;  2G0C A;  5C7P A;  2C42 A;  3G71 S;  4O23 A;  2BW7 A;  3KG1 A;  4DFM A;  4DV3 F;  1XJW B;  4RLE A;  2I38 A;  2VUG A;  3SCI E;  3TA0 A;  4ILR A;  3QLH B;  4O3N A;  1IKY B;  2OD6 A;  2BJ9 A;  2HG4 A;  4G1Q B;  2KFZ A;  4AQY F;  2DK2 A;  4ZHR B;  3M8Q A;  4JI2 J;  1KTV A;  5K8P A;  1RWK B;  1JJC B;  1HQE B;  1B0P A;  1UKU A;  2XCA A;  2E9T A;  1VC5 A;  2C3U A;  2ZJP Q;  4Q43 A;  3AFG A;  1Q78 A;  2ZC4 A;  4ZDN A;  1MLA A;  3GV7 B;  3QJL A;  1KFD A;  2E44 A;  2ZOM A;  2MGZ A;  2FD2 A;  4YB7 A;  2RDI A;  4DOZ A;  5C42 B;  3CSK A;  4WBF A;  3B4M A;  3W5Z A;  2KVI A;  5U47 A;  3DMJ B;  2KHD A;  3KJQ B;  1XR7 A;  2C22 A;  4CO5 A;  1VMB A;  2FC9 A;  4TQR A;  4OL8 A;  4IFY B;  4TQS A;  4URQ U;  3R97 A;  1N8R T;  1WEX A;  4I6A A;  2ZZT A;  3LPY A;  1XER A;  5ADZ A;  2LQ5 A;  3M8Y A;  3W9J A;  3L09 A;  3MOJ B;  4BHQ A;  3TZX A;  1KP6 A;  2NCK L;  4O3Q A;  5BYS A;  2V94 A;  2CJK A;  2E5L J;  5B0F A;  1RDR A;  1TTH B;  3L4B C;  2RKI B;  4B02 A;  1P9Q C;  1F5A A;  2KH9 A;  2CJB A;  1H72 C;  4MY4 A;  2BVZ A;  1FRK A;  1X0P A;  1UVI A;  3ENW A;  2LXF A;  1Q8B A;  2K1R A;  3MF5 A;  1WC4 A;  4R5P B;  4EBC A;  2FJA B;  3TP2 A;  4K50 A;  3NY0 A;  4NEY A;  3B54 A;  4OLO A;  2XSJ B;  4JI1 J;  3VVT A;  3SFG A;  3FDS A;  4DQS A;  1Y10 A;  1A0O B;  4ILM A;  2D1G A;  2W8D A;  2DBB A;  2HNY A;  3BDE A;  5K5M A;  2F8H A;  1JB0 C;  3EM1 A;  1XMO F;  3DLK B;  4C8L A;  2YPY A;  3IR5 B;  2JRS A;  3M2V A;  2JH3 A;  3MCN A;  2HFZ A;  3B78 A;  4DR7 F;  5KFX A;  3C66 A;  2DD8 S;  2IC3 A;  5KG2 A;  4DMZ A;  4ILL A;  3ZTS A;  2NUU G;  1B4S A;  2K2P A;  1RTZ A;  2HWT A;  1SH2 A;  3IGN A;  1C0U B;  3EX7 B;  5K20 B;  5KXA A;  1CJU A;  2LEB A;  3OW2 R;  2IM3 A;  3HFK A;  1UPM B;  5JMN A;  2KM8 B;  3PRD A;  2D7S A;  4BWM A;  1AFI A;  3QGG A;  2BBE A;  1H2U X;  1IKW B;  1S6U A;  3BZQ A;  2KYX A;  4L74 A;  2DCU B;  1NRK A;  4L72 B;  4KR0 B;  2C3P A;  2KT3 A;  2U1A A;  4WYL A;  1Q79 A;  4F8R A;  4YR0 A;  3SIP B;  1QUP A;  2C2R A;  4KJD A;  2MZJ A;  3PTW A;  1M5H A;  4ZVG A;  2PMZ D;  2M8H A;  7FDR A;  5KFE A;  3RRG A;  5HAT A;  2YKM B;  1NK0 A;  4M5N A;  3Q23 A;  3QID A;  3I0S B;  4WKR A;  2VG6 A;  2Y1L B;  1VC0 A;  2M4M A;  3ITH B;  2FHJ A;  3OVS A;  2D3U A;  5D4P A;  4UPK A;  1HPZ B;  1S1U B;  2R7X A;  3OTD A;  3R27 A;  1LV5 A;  4QIG A;  4ED8 A;  4JI5 F;  4RBV A;  4LFB J;  5JVH Q;  3QRQ A;  4YHH F;  3IN5 A;  1FKA F;  3CC7 S;  5BYR A;  2XO7 A;  3DYC A;  3ZZU A;  2B4U A;  5DG8 A;  1YRU A;  4L73 A;  1T03 B;  3UO0 A;  5GOV A;  1S99 A;  3IM9 A;  1VQL S;  4QJV A;  2RH3 A;  4EYI B;  1KH9 A;  4N56 A;  1LK7 A;  2EWH A;  1ZTW A;  2VOD A;  4DI6 A;  2FVQ A;  1OMS A;  3A12 A;  5GAE U;  4ENO A;  5M2R A;  1RK8 A;  1CJT A;  3U02 A;  5CYM A;  5DGB A;  4HI1 A;  3V6H A;  2FY1 A;  2I1R A;  1VQN S;  1ED9 A;  2W5Q A;  1XMQ F;  2VFV A;  3DXS X;  4CTA B;  4FYY B;  2R7V A;  3EVO A;  5HP1 A;  1QUV A;  1KQS R;  5CYJ A;  2QG9 B;  1R8A A;  5HQ8 A;  4IH6 A;  4DJB A;  4GKJ J;  2ZE2 B;  4RBT A;  1FRM A;  4UQT A;  3CUN A;  1WHY A;  3QYY A;  4CLZ A;  1Q53 A;  1GMW A;  3UDV A;  3OPK A;  1AUK A;  3QZ7 A;  4AL6 A;  4UUW A;  2HAI A;  3ZXW A;  1PSD A;  4U9R A;  3EGN A;  4CRJ A;  3HXM A;  3O3L A;  2BJ1 A;  1RT3 A;  2CQC A;  3OR2 B;  1N32 F;  2SXL A;  3H4D A;  2Z4P A;  1SI9 A;  3N01 A;  3HI9 A;  1IJE B;  2IVY A;  5ETR A;  1VQ4 S;  4FKX A;  1ZYQ A;  1WF0 A;  4M5G A;  3VZH A;  4DR4 F;  3VV2 B;  2LCW A;  3LAK A;  3HUL A;  4NCA A;  4MIB A;  4K4U A;  3KLI A;  1YTY A;  2WHO A;  2HQG A;  1JJ4 A;  1VFJ A;  3M30 B;  4A8S A;  3ZZY A;  1NEE A;  2VH7 A;  1N6Q B;  3AJ1 A;  2AIR B;  5DRK A;  2V2Z A;  3MAA B;  2W5R A;  3DM2 A;  2W2M P;  5D3G B;  5ETO A;  2CDQ A;  2X51 A;  1HNZ F;  4B9U A;  1XIQ A;  2HK3 A;  1WC0 A;  1SJF A;  3FJ2 A;  5H9F K;  3UNY A;  2XMA A;  1TMJ A;  2DJW A;  1EAR A;  1R0B G;  3RR7 A;  1NSQ A;  3QBC A;  2ZNY A;  1Y5L B;  1XC9 A;  2VDH A;  3GON A;  2VDI A;  4HAC B;  5HO4 A;  1ANI A;  3MM9 A;  4WE1 A;  1N0V C;  1S9G B;  3BR8 A;  3VQS A;  2RS2 A;  3MAH A;  1HFE L;  1CLF A;  3DGP A;  3DRR A;  1AW0 A;  3MOZ A;  1E6V A;  1S77 D;  5EUH A;  5GAE I;  3ENA A;  3MEG A;  1E33 P;  2IDL A;  2CPI A;  4DS4 A;  3QGI A;  3P3D A;  5GRR A;  2FJB B;  5ETK A;  4C8Y A;  5F3T A;  5KG3 A;  2E1A A;  1GAO A;  2VPZ B;  1IJF B;  1XNR F;  3NKR A;  1FDA A;  2MZ1 A;  3W5X A;  4ID5 B;  2CPX A;  4NLV A;  3CCR S;  1F6T A;  1SUQ A;  2ZH5 A;  3PR5 B;  4KHM A;  4ZVF A;  3FZ2 A;  1IM6 A;  1FVQ A;  3VR1 A;  2NXN A;  5EHH A;  1A7G E;  2AEJ A;  1U45 A;  5A8R B;  1I5O B;  4KHR A;  3OTB A;  3CJK B;  3S01 A;  1D8Y A;  4MK8 A;  1FCA A;  4NYP A;  3O6Q A;  1UZH A;  2ZHB A;  3E2D A;  3W5Y A;  4OYP A;  1AJC A;  2VQE F;  2F5G A;  2DT9 A;  4X64 F;  4CIO A;  1HMV B;  2COL A;  1H2V Z;  5SUH A;  2I9S A;  2EFN A;  3EE3 A;  4NXM F;  3CD5 A;  5AXL A;  4DV1 J;  3VQT A;  1M5S A;  4BC9 A;  2AGQ A;  1HHQ A;  4KO0 B;  3M32 A;  2GO8 A;  2CJ9 A;  2KG1 A;  3Q3Q A;  4M5D B;  2JL9 A;  3GV8 B;  3FCW A;  1U26 A;  1OQ6 A;  2V9W A;  2DHX A;  2ZH4 A;  1LWC B;  3M2R B;  3T01 A;  2B9E A;  2W9A A;  2MLZ A;  4ZVP B;  3LP1 B;  5DM6 Q;  4DPW A;  2LVW A;  2RAQ A;  1UEU A;  2W9C B;  2JDJ A;  4CCH A;  4O4G B;  1NB2 A;  5IQQ A;  1CQN A;  1RKI A;  2JEJ A;  1BQM A;  4PG6 A;  4DR5 J;  1RTD A;  2AX0 A;  2AJ2 A;  3PO5 A;  2BA9 A;  3CWJ A;  2AF6 A;  2XMJ A;  4LF8 J;  4LSN A;  1N5Q A;  1JKH A;  3BM7 A;  4YB1 P;  4OX6 A;  2AZ3 A;  3NCQ A;  3DU6 A;  1B0T A;  3BSO A;  4LRB A;  3CE8 A;  3VZI A;  5I42 B;  1SH3 A;  2GC8 A;  4LF2 A;  3UCU P;  5K14 B;  1JMT A;  2A6M A;  5GVQ A;  2RRA A;  1RAH B;  4WYW A;  4EGL A;  4PCQ A;  1WC5 A;  3CJ4 A;  3D4J A;  1GXL A;  3T6B A;  1QE1 B;  3P5B P;  4NLU A;  2DH8 A;  4DZ6 A;  3RR8 A;  3NWG A;  1JJH A;  2OFG X;  4USU A;  4F3M A;  3W66 A;  2VAS A;  3ZZT A;  2IM2 A;  4ITS A;  1KR4 A;  4JP8 A;  1KHK A;  4QWD A;  2HVZ A;  1FFW B;  1P9Y A;  3QQC D;  2JFD A;  4X66 F;  2D74 B;  2FVC A;  3EZO A;  4A8O A;  2VL1 A;  2ALY B;  1LFW A;  2DHS A;  3DDI A;  5IT9 Y;  1MML A;  3JSY A;  4HTJ A;  3NCR A;  4M1K A;  2W4C A;  3M9M B;  3POT A;  2XLI A;  4YDX A;  1LOU A;  1RLC L;  1RT2 A;  2LU2 A;  3BQ1 A;  3MPY A;  4WP8 A;  3GP9 A;  4K2X A;  2RIL A;  4LF4 F;  4QPX A;  4QIF A;  5HAN A;  5CAA A;  3AD9 C;  3VAH A;  2RU3 A;  3QFH A;  3AJD A;  2HPU A;  4CO0 A;  4O3R A;  1N34 J;  2AWZ A;  4Q8F A;  4ECS A;  3RBD A;  5LJ5 Y;  2KHC A;  3TI0 A;  1N5V A;  1QTM A;  3NMA A;  1H3D A;  3PW0 A;  1QAY A;  1IBL F;  1SQE A;  3GG0 A;  2H65 B;  1X4D A;  1ULR A;  3BBB A;  2ZBP A;  2BQU A;  1HWL A;  5LSR A;  5DM7 Q;  2LP4 A;  5IS2 A;  5D77 A;  5E2Q A;  4RU9 A;  3I5A A;  4N77 A;  4CYU A;  2M70 A;  1FXD A;  4RL1 A;  3QNW B;  4L76 A;  1Q95 G;  1SHN A;  1IWA A;  1H73 A;  1HBU B;  3MM8 B;  1VLO A;  5BXI A;  2MPU A;  2G0J A;  1TKX A;  3GCW P;  1NZ8 A;  5K8O A;  1HWI A;  1YJU A;  2LQB A;  1TK0 A;  2LA4 A;  3C3L A;  1Q8L A;  2YNH A;  4CP5 A;  3AHP A;  5MAO A;  4K0K F;  2V4R A;  2HMI A;  2CQI A;  2RDJ A;  4LT6 A;  2GQQ A;  5BJR A;  4H4K A;  2VFT A;  3TUP A;  2BAC A;  2MQQ A;  1N52 B;  3KMS A;  5KG7 A;  4YY3 J;  3NRB A;  4ZOS A;  4PYD A;  2XUL A;  2PO4 A;  3H25 A;  1G4C A;  3FMB A;  1UWB B;  2HBZ B;  3M2U A;  2HZA A;  3P4U B;  2RRB A;  3AOA A;  2ZUG A;  5TJ3 A;  4PG8 A;  4RW6 B;  1JXV A;  1CJK A;  2H3E B;  1T05 A;  1E6Y A;  2QLB B;  3I56 S;  1PAU B;  2MJU A;  1HD0 A;  2WK4 A;  2AJ4 A;  1V3R A;  1MG7 A;  1IR2 A;  3ONQ A;  3VCD A;  2YH1 A;  1WSR A;  2R2S A;  4OJG A;  4WPA A;  2PI5 A;  2QRR A;  4FVC A;  4CLT A;  1O98 A;  4NLS A;  3TZW A;  2E5H A;  5F8N A;  3KD8 A;  1NDC A;  1B64 A;  4OYZ A;  1RIS A;  2DB1 A;  3CW2 C;  2G4B A;  3MUM P;  3BSN A;  4L75 A;  5A0Y A;  5ETM A;  2ZH3 A;  1RU1 A;  2DGU A;  4K5S A;  3HMJ G;  3H20 A;  3HHN B;  3LXQ A;  2I6W A;  4CDI A;  2WOM B;  5E3P A;  1X0F A;  4C8M A;  3OTO F;  5F41 A;  2FGC A;  2ZH6 A;  1GXT A;  1HWU A;  4FS1 A;  5EWF A;  4FF1 A;  1RU2 A;  2DNH A;  3K57 A;  3M8P A;  2J7W A;  7AT1 B;  5A6W A;  2CQG A;  3WQP A;  3WHI A;  2YX1 A;  1FNO A;  2OD4 A;  2OSR A;  4B3M J;  3G86 A;  3E2E A;  1HKA A;  3CCZ A;  2R2R A;  2GVD B;  2NQP A;  2Y8W A;  1WOP A;  4ZIV A;  4NLT A;  4TNO A;  2HS4 A;  3NKN A;  3JQJ A;  4FDI A;  5AT1 B;  3KK2 B;  4NLO A;  4LF5 F;  1O99 A;  5T7L B;  2YH0 A;  2ROG A;  2VD3 A;  2WBR A;  2AJ0 A;  3MMC B;  1RT4 A;  5JJB A;  3VAM A;  1F9E B;  5IZH A;  3FBE A;  2XS5 A;  3IAM 9;  2G1H A;  5DLF A;  1KRP A;  2HK2 A;  1TUV A;  2EFQ A;  2H48 B;  1LEO A;  3MMA A;  1CUL A;  1YRX A;  4ZN1 A;  3DOK A;  4OI3 A;  1TZ0 A;  1AZS B;  2ROE A;  3ET6 A;  1V9O A;  3BEG B;  3UDE A;  2IM0 A;  4HH0 A;  3P8B B;  1RTJ B;  3G8T A;  1FK9 B;  1CQM A;  1UFL A;  5HL7 Q;  1TKZ A;  4FS2 A;  2ATC B;  1S12 A;  4DCJ B;  1MRO A;  2HFS A;  1JLQ B;  5D4N A;  2PSZ A;  3DYA B;  3IM8 A;  4WJB A;  4ZVR B;  1VQM S;  1RT5 A;  4B9S A;  3GJT B;  3DI6 A;  4WFX A;  4AQY J;  3SDE A;  4F50 A;  4M95 A;  3PFE A;  2FQQ B;  2Q43 A;  4KYZ A;  3K58 A;  3J80 Y;  5L9N A;  3W2V B;  4FBT A;  1XBW A;  2R7S A;  2IA6 A;  3HVT A;  4NL5 A;  3DRS A;  3CDE A;  4OX9 F;  4DPU A;  4NCG B;  4AYB D;  2IA0 A;  3RAQ A;  1JXE A;  1ALH A;  4FNH A;  2FUG 9;  4PEO A;  4WFN Q;  3LO3 A;  5FLX U;  1QAX A;  3KUG A;  2YQ0 A;  2XYP B;  3T02 A;  1DTT A;  3A3N B;  2LDY A;  1X5S A;  4PWD B;  2BDP A;  1GEH A;  3EJM A;  4Q5V A;  1HNI A;  2GSU A;  1ELY A;  5D15 A;  5D4O A;  2CWK A;  4NPO A;  5E0O A;  3M8S A;  4AUK A;  4V19 X;  3N4W A;  4Q0B A;  2DR9 A;  3NKO A;  3F41 A;  3TUI C;  4I1T A;  2DO4 A;  2BJ7 A;  4KQZ A;  3W60 A;  4F4K A;  3P49 B;  1HNX J;  2JVR A;  3KHH A;  3ZZR A;  2V8G A;  1IKV A;  1EP4 B;  2C2M B;  3H4B A;  2IHR 1;  1AFJ A;  2ZWO A;  3LP0 A;  1KLM B;  4KY3 A;  2YY3 A;  1YDL A;  3B4D A;  5LQQ A;  1QSY A;  1FRX A;  2W7P A;  4LSZ B;  5GAD I;  3IRX A;  2ASL A;  4ECT A;  1HQ2 A;  2QZU A;  3CJR A;  2R8G A;  4IG0 A;  2HFO A;  5L0K A;  4U7C A;  4QW9 A;  1EZZ B;  5KFJ A;  1IN0 A;  3MD1 A;  2G13 A;  2ZNZ A;  4FNI A;  2HSE B;  2WVF A;  3N9U C;  4J9U E;  1U8W A;  2BKN A;  4XO0 A;  1NLK L;  3CJ5 A;  1RHQ B;  2GQC A;  3H42 A;  4DLG A;  2HVE A;  3GFZ A;  2ZH8 A;  2XCP A;  4QBU A;  3FSI A;  5AE3 A;  2NSB A;  3C14 A;  4FDF A;  5G0R A;  4DX8 H;  3KFW X;  2MKI A;  3OSP A;  3TEH B;  4HDH A;  4DR7 J;  5D8H B;  2HZC A;  2H54 B;  1BXN A;  3BDP A;  1VQ9 S;  1N2K A;  2HFU A;  1S9E B;  4MTP A;  5LRN A;  3DLJ A;  3MED A;  2RD5 C;  2IPO B;  4ZVU B;  2AYB A;  3DC2 A;  4LJM A;  2XS2 A;  4Y2I A;  1ZEF A;  3WAW A;  5J2N A;  1LK5 A;  4DV0 J;  1YJN S;  4S0M A;  1X31 C;  3NGD A;  4USM A;  3F44 A;  1DTQ B;  4HYK A;  2CVE A;  2FHO B;  1C1B A;  1G6B A;  2NXJ A;  4RW7 A;  5KFF A;  1M1K T;  4NYO A;  2KFY A;  5D0E A;  5GME A;  5LXR A;  1PJ7 A;  3SBM A;  2PA3 A;  3TW0 A;  3GIL A;  4CM2 A;  4WFZ A;  4YR3 A;  4QWA A;  2KXN B;  2H9Z A;  5FDL B;  3G2X A;  3CT9 A;  2OJ3 A;  1Q5V A;  3PJW A;  1N33 F;  5KT7 A;  4DV4 F;  1CS4 B;  1RT1 B;  2BX6 A;  3Q89 A;  1HI0 P;  4P2X A;  3M1V A;  6AT1 B;  5HMW A;  1PYO B;  4C0B A;  5B0A A;  4LF7 F;  4OJH A;  5EX3 A;  4EMD A;  3BO2 A;  4JV5 F;  2CQH A;  5C66 A;  2AJF E;  1NPP A;  1URB A;  4U7U K;  2O01 C;  3KK3 A;  5BR8 F;  5J1E B;  4H4O B;  2EKY A;  3Q8Y A;  1D1U A;  2DR6 A;  2HHP A;  2R7T A;  2HVI A;  5CCL A;  2B4V A;  4E2F B;  5DDO C;  1RAB B;  4YN3 B;  4DSK A;  3AA8 A;  2NPI A;  4ECY A;  4USH A;  2IYG A;  2Y9H A;  3KLF B;  1XQI A;  2V34 A;  2OFH X;  2IJF A;  4F02 A;  2HYI B;  4Y34 A;  4Z37 A;  4JI3 J;  1R0C B; 
#chains in the Genus database with same CATH homology
 3WAX A;  5L0K A;  1E2S P;  4KAY A;  1ALH A;  1EW9 A;  4CXK A;  4GTW A;  1KHN A;  3DYC A;  3DPC A;  5HRT A;  5KXA A;  4GTX A;  3BDH A;  3M7V A;  1EQJ A;  1KH5 A;  3LXQ A;  4LRE A;  1ELX A;  1HJK A;  3IDD A;  3WBH A;  4TN0 A;  5L0B A;  4QAX A;  4LRD A;  2VQR A;  1KH4 A;  1AJD A;  4LQY A;  5INH A;  3UO0 A;  1EW2 A;  2GSO A;  5GOV A;  3T00 A;  1ZEB A;  4UPL A;  3IGY B;  4GTY A;  5AJ9 A;  3T02 A;  2IUC A;  2ANH A;  3Q3Q A;  1KH9 A;  4MY4 A;  5EGH A;  2IFY A;  4LR8 A;  3NKP A;  2GSU A;  1ELY A;  1E33 P;  4UPI A;  3SZZ A;  3MK2 A;  4ZG9 A;  1P49 A;  1AJB A;  5GRR A;  3TWZ A;  2XRG A;  4KM4 A;  1K7H A;  1E1Z P;  1KHK A;  5EGE A;  3IGZ B;  3UN5 A;  5DLT A;  4YR1 A;  3T01 A;  2G9Y A;  2W5Q A;  1ED9 A;  1KHL A;  2GA3 A;  1N2L A;  4LR2 A;  4N7T A;  3TX0 A;  2W8S A;  3NKR A;  5LRM A;  4KJD A;  1ALJ A;  3NKO A;  5DLV A;  3UN3 A;  1HQA A;  5L0E A;  3WAY A;  4NWJ A;  5DLW A;  5LIA A;  4KJG A;  1N2K A;  5C66 A;  1URB A;  2W5T A;  4FDJ A;  1ANJ A;  4LRC A;  5LRN A;  2W5R A;  1Y6V A;  2W5V A;  1ED8 A;  5TJ3 A;  1HDH A;  1SHQ A;  1ZED A;  1AJA A;  4ZGA A;  3M8Z A;  2W8D A;  2D1G A;  2X98 A;  4LRF A;  1FSU A;  4UOP A;  4UOR A;  4KAV A;  1ZEF A;  4CYS A;  5IJQ A;  3WAW A;  4LR7 A;  3SZY A;  3NVL A;  1KH7 A;  1AUK A;  2ZKT A;  3UNY A;  3B5Q A;  3MK1 A;  3MK0 A;  1SHN A;  4LR9 A;  3BDG B;  4MHX A;  4LRA A;  3NKN A;  1ALK A;  4FDI A;  5LQQ A;  4MIV A;  4UOO A;  4CXU A;  3E2D A;  3TG0 A;  3CMR A;  5IJS A;  3BDF A;  2W5W A;  2W5X A;  1O98 A;  4UPK A;  1ELZ A;  4GTZ A;  1AJC A;  3OT9 A;  1Y7A A;  1O99 A;  3NKM A;  2XR9 A;  3KD8 A;  1EI6 A;  3M8W A;  1KHJ A;  1ALI A;  3WAV A;  1EJJ A;  1ANI A;  2GLQ A;  1E3C P;  3UN2 A;  1B8J A;  2GSN A;  2QZU A;  2RH6 A;  2W5S A;  3A52 A;  2IUC B;  4CYR A;  4ZG6 A;  4B56 A;  1EW8 A;  4NWX A;  1URA A;  4UPH A;  5K4P A;  4ZG7 A;  4CXS A;  3M8Y A;  4LRB A;  3BDG A;  3ED4 A;  3NKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...