4LRCA

Phosphopentomutase v158l variant
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrcA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrcA01
1ELZA 4LQYA 4UPKA 3OT9A 4CXSA 1ALKA 2W5TA 5GOVA 3T02A 5L0EA 2G9YA 4NWJA 2W8SA 2IFYA 1AJDA 4LR8A 1N2KA 4MHXA 3NKMA 4MIVA 5LQQA 1E3CP 1EI6A 4UPLA 1N2LA 3LXQA 4GTZA 1ELXA 5GRRA 2W5VA 3M8WA 1KHKA 1ZEBA 5LIAA 3M8ZA 1EQJA 2W5XA 2ANHA 5LRMA 3UO0A 3B5QA 3Q3QA 1KH9A 5TJ3A 4UOOA 4B56A 3NKNA 4KJGA 3UN2A 3WAVA 4LREA 1P49A 4LRBA 4UPHA 4LR7A 4LRCA 1AJAA 1ZEFA 3MK1A 3TWZA 1KH7A 2D1GA 3DPCA 5EGEA 5LRNA 1SHNA 4UOPA 4CYRA 4ZG6A 4FDJA 3WAXA 4CYSA 3IGYB 3BDHA 4QAXA 1ED8A 1K7HA 4NWXA 1ALHA 1URBA 3UN3A 3WAYA 3WAWA 4ZG9A 1FSUA 1URAA 2GLQA 4LRDA 3IDDA 3NKRA 4LR2A 4KM4A 3NKOA 3UNYA 1EW9A 2W5WA 2W8DA 3A52A 4CXKA 3MK2A 5K4PA 4MY4A 1Y6VA 5L0KA 1ALIA 4GTYA 1AJCA 1KH5A 5EGHA 3UN5A 4N7TA 3TX0A 2QZUA 2W5RA 4GTWA 1ANIA 2X98A 5IJSA 2W5QA 1E1ZP 3DYCA 4LR9A 2W5SA 3ED4A 3NKQA 1EW8A 4LRAA 4ZGAA 1AJBA 3SZYA 2GSNA 1SHQA 3M7VA 5IJQA 2XRGA 1ELYA 4KAVA 4UPIA 3MK0A 1HJKA 1O99A 4YR1A 1KHLA 3M8YA 2VQRA 1Y7AA 3BDGB 1HDHA 3TG0A 3NVLA 2RH6A 5KXAA 2GSUA 3CMRA 5L0BA 1EW2A 2GA3A 3NKPA 3WBHA 4LRFA 5C66A 2GSOA 5DLTA 4GTXA 5DLWA 3E2DA 1E33P 3T00A 5INHA 2IUCB 1EJJA 3KD8A 1ED9A 2IUCA 4KAYA 5HRTA 4ZG7A 1KHNA 4FDIA 4TN0A 1KHJA 3BDFA 1ALJA 1ZEDA 4CXUA 1HQAA 5AJ9A 1KH4A 2XR9A 2ZKTA 1ANJA 1O98A 1B8JA 3T01A 3IGZB 5DLVA 3SZZA 3BDGA 1E2SP 1AUKA 4UORA 4KJDA
chains in the Genus database with same CATH superfamily
2C28A 3PKMA 1GMUA 3I0SB 3W9IA 4GVBA 4O0NA 4USTA 2XY5A 2B4OA 1JJCB 4DV4J 2DCLA 2JLFA 3BSCA 3W64A 4KFBA 3KLVA 2GX8A 3MTKA 1ZEFA 1UPPA 2YKAA 3DPCA 3DCAA 4CYRA 3KLEB 1VBKA 1HQEA 5HQ8A 2LEBA 2VG5B 2HK3A 2K7KA 1KQKA 1CPZA 1HMVB 3PY8A 2JRSA 2VODA 1T7PA 1ALIA 2DGWA 3GJSB 4HYKA 3D1QA 4OV1A 4HT7A 4E98A 5C25A 1VISA 2DEJA 1WG1A 2BXJA 3AB2B 5B08A 2DB1A 1RADB 1G6BA 2O66A 1HHQA 3KJVB 1K1QA 3TG0A 4TQSA 2PEBA 4JOUA 3PZPA 3C16B 1HBMB 1Y5LB 3T00A 2OPQA 4NLGA 3HHDA 3JQKA 1C2PA 2RRBA 3QGIA 2VH7A 1JLGA 3W8GA 2ZDOA 5AE2A 3ET6B 3QIPB 4NCGB 1AT1B 3QGHA 1U2FA 2ZZNA 4GRSA 1X4AA 2DKOB 5K20B 2QLWA 3IO1A 2VQEJ 4MHXA 3GYGA 3B5QA 2V50A 4LFCJ 4K5SA 3GONA 4U7CA 4DG1B 2F8EX 5T41A 1F9EB 4U9RA 1S0MA 1B99A 4ETZA 1B0PA 4ZPDA 2AYGA 2YNFA 3LQVA 2AD9A 3VAKA 4M5DA 4LIRA 2FVCA 1UFKA 2CQDA 3MPYA 2XLKA 4V1Ak 2JDJA 2BQ3A 3ZZZA 3ILJA 2LCWA 3MPDA 3HPOA 4DSEA 1R8BA 5GADU 3QAUA 4ETXA 2H65B 2YNGB 2R8JA 3HULA 2DGVA 3DDNA 5KG6A 1NJWA 4I1TA 5DS7A 1NH7A 3TJ9A 2ZM6F 2GFFA 4DCJB 3M6UA 3F0NA 5KT6A 4B3TJ 5IS2A 3CJ2A 2HNDA 3ZTPA 1ZPVA 1SV5A 4QWDA 2IPOB 3LAMA 4ZN3A 4KHPF 3GIMA 4JI5J 5F8JA 1DQ9A 2DR9A 1RTDB 1PBAA 2F8MA 4CZCA 4IG0B 1HW9A 1I1GA 1BUXA 4IYQA 5KFAA 2CQ3A 2XS7A 2U1AA 1OSCA 3TJ8A 3DLGA 5DDPC 2F3JA 2C2DA 4O3SA 1UA0A 3BGRB 2MKJA 2HHHJ 3NLCA 3IRXB 4M5JA 4A8OA 1MLAA 1NDKA 1AROP 4X66F 4L74A 2KM8C 2E5HA 4YR0A 3EE3A 2VICA 1VQ7S 4A4JA 4Y00A 9ATCB 5EWEA 1KTVA 3KWMA 4DZDA 5K8OA 2A18A 3M30B 3AD7C 1UWAA 2DNYA 1X7VA 2MZJA 3UD3P 2KKHA 1H2UX 2B4VA 3EGWB 4IO1A 4OHYA 4DR1J 4FKYA 1RZMA 4PQUB 1VOMA 4LJMA 2FTRA 2CDRB 1T05B 3KLGB 3M2UB 3GIKA 1XBWA 4CLFA 3TOQA 5KAKA 4UQTA 4YY3J 1QUPA 3V6DB 1KLMA 3THPA 3MMBA 4IUFA 4KV8B 4ANCA 2JNJA 2GLQA 5KT4A 1ZYQA 3UDLA 1HBOA 3T9NA 3DKDA 4NE9C 2DNHA 4Y28C 2Y3YA 5LMUF 2ACYA 2HYIB 3L7OA 2I2YA 2AYEA 1S1VA 4GVLA 3MK0A 3PRDA 1Q86T 2PMWA 2HBZB 3PIPQ 1IVZA 1DFDA 2QT7A 3TUZC 3RZAA 2RU3A 5KT7A 3NCQA 1FTRA 3IS9A 1TFYA 1TKDA 4FN5A 2X1FA 1WEYA 1RTIB 3CB4A 1SQEA 3Q2TC 1JKHB 1T03A 1HARA 4DR6F 2EBEA 1WSRA 3THVA 3K2YA 3OUYA 1HYSB 2MHEA 4M95A 3KLFA 1M5VC 4GO5X 1KS2A 3CIZA 5D8HB 1EAYC 1OS5A 2E1CA 1PC5A 1S6PB 1HKAA 4IO9Q 1CJTA 2C2OB 3PCOB 3W61A 2V69A 3LP2A 4H4MB 4PWDA 4LRBA 1CJUB 3WIUA 3TWZA 1NH8A 4MK8A 2MQMA 3TO8A 4FXDA 3A12A 3HF5A 3K17A 1Q4RA 1NZ8A 2ZHOA 2ZH9A 1YTYA 3KNGA 1FRHA 4JV2A 4ZHRA 1FRIA 2PIIA 1UA1A 3WX8A 2G0CA 1MN9A 2KM8B 2FIUA 4OYBA 3M1VA 2GJIA 2OFHX 4O4GB 1U4BA 3NVLA 4OLPA 1KHWA 5DLFA 5KFVA 1FRJA 4A8YA 4CIOA 3CULA 4DZ6A 1E33P 3H40A 1X9SA 4LF9J 3PV8A 2X51A 2D9OA 1VIOA 2UVVA 1G1XA 4I4BA 4GKKF 1JLEB 1KOOA 5G0RB 2J7UA 2CJKA 2FJAB 1TFWA 2OTLS 2HGLA 3JTPA 2BEFA 5EDWA 4CCHA 3IBFB 1QLNA 3TX8A 2YKMA 3NMRA 1I3OB 3VAJA 2IFYA 3AT1B 2HRUA 1N36F 4XDDA 3PRBA 2I38A 1X0FA 5I42B 2V8HA 4UUXA 2BYCA 2ZBRA 2KB2A 3IAS9 1SQFA 4HHUA 5KFKA 2C2KB 3W1YC 4ZCLA 2CYYA 5J1EA 3ETOA 4EEYA 2HS3A 3DMJA 1RKJA 5KFUA 2OEJA 4OX9F 4C8MA 2B7BB 2VZ9A 3NL0A 3FCHA 1RKIA 3CJ3A 3K0JA 3L3CA 4BS2A 5A8KA 1JNRB 3SCKE 4J9SA 5E0OA 4EBDA 2XSFA 5AXNA 3NWGA 1YJVA 2KFYA 4X62J 2W9CA 2ZNYA 1X0PA 2J0WA 1BQMB 4UOCA 5CH7B 3MM8B 1WHVA 3MFIA 3RAQA 2BANB 1HBMA 3HP6A 1RT6B 4RW6A 1JX4A 1OY9A 5KFIA 4F67A 4JI0J 1EQJA 2POKA 4TXSA 1AFJA 3MGJA 2BACA 3CDBA 2N3LA 4NCGA 2OSQA 3MHYA 4OI0A 1SHNA 1WC1A 3T41A 3H25A 3AFGA 4P9SA 1JXLA 4PG4A 3T1HJ 2KXHA 4IH5A 5HQMA 1Q79A 3U7JA 2JSXA 4HT5A 2DNQA 1BLUA 4B02A 1UP1A 3QJPA 3D7SB 1ULRA 4O23A 2H5JB 4P74A 3EGVA 4JV1A 2E5LF 4M94A 1RT4B 2XMJA 1A0OB 4KBIA 1YJ9S 1FK9A 1D0EA 2XCPA 1NHUA 3MPUB 4PCQA 4NX9A 2HRTA 3P8BB 2ILZA 2V9WA 4ZLPA 4NLSA 4FS2A 4TU9A 2F7VA 2E5JA 1RAFB 3RR8A 2GGPB 1ELZA 3LW5C 5GOVA 5A8WA 3JSRA 4RBVA 1MROB 2CNOB 4PXBA 4JV5J 2XULA 3KKFA 2NPFA 1TR0A 3IR5B 1KR4A 2HMIA 2YTCA 1F5AA 4B17A 4LT6A 4LREA 2B56A 1FKPA 2JLEA 2XHCA 2HW3A 3PFOA 1NJXA 4OI1A 3F56A 3D4JA 5HVGA 5KFRA 2PSZA 1F6TA 3VCDA 1O6XA 3W5YA 2WB4A 1MU2A 2I9SA 1SHQA 3DDKA 3QO9B 1RGVA 6AT1B 3BKFA 2QYCA 4O3OA 3P45B 1P9YA 1RA6A 3HX9A 4B9VA 1YZ7A 1URNA 3FNNA 1HNVB 1VC5A 4OZ0A 3M8SA 5K5MA 2WVCA 4R0JA 1CG2A 2ERRA 3IRXA 2A6OA 3QJLA 5MAOA 1DTQA 2E29A 4CNYA 4DV2J 4YB7A 2BKPA 3GR0A 3PYDA 4OHVA 2WVFA 3MM7A 1TKTA 3MAAB 1RT2B 3CCZA 3C3LA 4M8LA 3NNAA 3GZ7A 3M4XA 1X4BA 3H90A 3M30A 2LDIA 3NEKA 2C2NA 1LEOA 2YNIB 3EWGA 1RWVB 2E9TA 3PEJA 2FLOA 2QFIA 1QAYA 2XYGB 4K7QA 2GMHA 4UQGA 4PQUA 1WF0A 1X5PA 1ZAXA 5HBMB 1T05A 4UOGA 2MQPA 3CJQA 1ZZNA 2JEIA 1DJ0A 2BBEA 4AYBD 4KV8A 5ITHA 2FJXA 1FXDA 3AAWB 2GIFA 3OFHA 1PCAA 2OELA 3D5MA 3SSRA 3ZFVA 1RTJA 3GG1A 4N47A 2XMAA 1VBXA 3I56S 5GMEA 5H1SV 2IMWP 2RQKA 3D9BA 2IC3B 4KY3A 1B7YB 2ZH1A 4QW8A 1VFJA 2A0FB 1B64A 4J9QA 4DF4A 4KKOA 2M9KA 1U26A 1RTIA 2FJEB 4Y2KA 4CP5A 5KG2A 3TQ1A 3ADAC 1RAJA 1E6YA 2R7SA 3SEOA 2FB0A 1URBA 5CCMA 1NPKA 4WXOA 3BKTA 3DLKB 5GMKa 1FVQA 3BO2A 3A1YG 1M5SA 3PYFA 3ITHB 2HHTA 2LQ8A 4ERDA 3NAHA 5DG7A 3OD2A 4HL9A 4PXEA 2AU0A 2DTJA 2LQBA 2KL8A 3QBCA 2MKIA 1FRKA 3CO9A 3O2IA 4I6WA 1WELA 4NZ6A 2RQ4A 4YQWA 2RMLA 3M8QB 1N5YA 4RUBA 1MWZA 1JLAB 3V5RA 5IT4A 2VG6B 2ZJQQ 5IT0A 1M5PC 5IC6B 3HD1A 3BO3A 3OV7A 2RJZA 3ELHA 5LRMA 1NB2A 4DV5J 2R2TA 5TJ3A 2D9PA 4QPTA 1K44A 1TU0B 3MK1A 5HMXA 1D9FA 2MY8A 3C46A 1AXQA 2YY3A 3W5XA 2ZKUA 2YWWA 2PE8A 5G4DA 3RUBL 4URSA 1RBOB 2LQJA 3E01A 4ICLB 4DFJA 3VR1A 4MFBB 2D3ZA 2LMIA 2GC8A 4ED3A 1PO6A 5I42A 4LRAA 1U8SA 5J2MB 1IBKJ 4YN3B 2NZ4A 4IR9A 1M1GA 1VCTA 5DETA 1LW2B 2AYBA 1RWWB 5F9NA 4DSFA 3OTOF 1PKUA 1IKXB 3G4SS 5JXSA 3R5AA 4MK9A 4WYLA 2N82B 3V6JA 3QZ7A 4OX6A 4TN0A 2DGUA 3EGNA 3MCMA 3MUMP 2MB0B 1J5OA 4DV0F 3E51A 1FJ7A 3MFHA 3Q23A 4CH0S 2FHJA 5KFMA 3RU0A 3P49B 4CM0A 3CCWA 5EWFA 5ETMA 5KFWA 1HI0P 4RLEA 1LWFB 4DR3J 3I4PA 2FJBB 2W9BA 2QSFA 1C1CB 5JMNA 2ATCB 4MH8A 3NKOA 3D3BJ 5KFHA 4X65J 1I6JA 3THTA 4JI3F 4AT1B 3GCWP 1N5VA 3I4HX 3BBCA 3QGGA 4C98A 4B08A 2FYXA 2DNKA 1DRZA 2Y1RI 4U8VA 2MLXA 5IM0B 3BDGB 2SXLA 3CNQP 5DLTA 1H3DA 2YPYA 4Q8EA 1D8YA 1Y5IB 5D0GA 2NS1B 1O8BA 1XTZA 3PW4A 1S9EB 1OQ3A 4W4MA 2UUAF 3RBEA 3UNGC 4Q44A 4CYUB 1S7IA 4QIWD 2ALZA 4KH1B 4X4UA 3HSJA 2ASYA 4ZLLA 3CC2S 2HWHA 3K7RA 2JFDA 3M8WA 1WWHA 3HCXA 5J2NA 1SH2A 2M4MA 5KFBA 3KK3A 2QA2A 2Q66A 2UUWA 3GWCA 2YNHB 2GGPA 4N76A 3I0RB 1GH8A 3B54A 2DBBA 1MROA 4J91A 2ZWPA 4WFAQ 1J2VA 3UI3A 1FRLA 1URRA 1T02A 5L0KA 3BR8A 1DURA 3CF5Q 1NM2A 2XMMA 2QMWA 4C0OC 1WC5A 4G3IA 4QIEA 3ICLA 3RGIA 4KH0B 1U1KA 4ED1A 2YKNB 4C7QA 5HMYA 2ZVSA 2GZOA 3GFHA 4TQRA 5INHA 4ZA1A 4ZPVR 3JSYA 2OUGA 4Q0BA 4NLDA 2J6SA 4G1IA 4RL1A 1HNXF 1ANJA 2RF2B 3B4DA 1VHIA 2VFVA 4BWMA 4ZK7M 2W1BA 4WFBQ 5D0HA 1XEZA 1O51A 1K8AT 2CNLB 1NXIA 2YX4A 3BB5A 1RE1B 2FJVA 3PO4A 3MR5A 1APSA 5D4PA 3PG9A 2RQCA 1YRTA 4DV4F 1R31A 1YRXA 2BJ7A 4LR7A 3ISND 2YPZA 3QYYA 2BOAA 4ZIWA 2XNRA 5CD4A 2OPSB 1SCJB 3G8SA 3P96A 1OY8A 2HHXA 1PBUA 3MCNA 4FS1A 1S12A 4GTYA 4HACA 2J7KA 1CJKB 3NGDA 3CPWR 5KG3A 5IJQA 1U1LA 3PFEA 3TP2A 4NLXA 5J1NA 3W65A 1WTBA 5K8NA 5IT9U 2KG1A 1SXLA 2CZ9A 4QWAA 2MLYA 2IDLA 2W01A 3S01A 2UZAA 5DO2A 1ED9A 2QSWA 1YJ7A 2ZC4A 3KJFB 3CDEA 3H59A 2XS5A 1IXKA 4CT9A 1EIYB 4UY8T 1NPPA 5HATA 1ZPWX 2J9DA 4HDGA 3RG6A 3Q89A 3D0HE 3R5DA 1BQNB 4YHHJ 3C14B 3VAMA 2DXDA 2VV5A 1VQSA 1UVJA 2VQEF 3U1MA 3P5BP 3ZC4A 2C2ZB 3W3SA 3HHLA 2R42A 1SC6A 1M1KT 4AL7A 5BYQA 4LFCF 5JUMA 1CBKA 3G2XA 1Y10A 3KOAA 3D0IE 4ES3A 4RUCA 2AGPA 2FJDB 4L6V3 2RHSB 3CO0P 3CXCR 3D6FB 1UTAA 5LSRA 1P9QC 1WOSA 2VJVA 3UD4P 3ILIA 4FVMA 3FZ2A 5HJXA 4I6AA 3HVWA 2ZBQA 4TYBA 2MTLA 2VBWA 5HJYA 4RJVA 3RJMB 4UZCA 3OVAA 4DI6A 2IUCB 4X4SA 4WJBA 3ETMA 2UVRA 3BDFA 1KTQA 3FCVA 1RWUA 2ZH2A 3ITHA 5T7LB 1S9GB 2KT5A 2HFUA 2CJYB 3C66A 1S5ZA 4B3TF 1ALKA 5C42B 5L1IA 3CJ4A 3JYTA 4DR7J 4ZVGA 3RW7A 4IDKA 3H7HB 4IQMA 3BYPA 3AA9A 3LXQA 3M8QA 1IQZA 3TAPA 2M7SA 3VGVA 2VPYB 3DRSA 4RNNA 4JI5F 3TVZA 2K7JA 3ISZA 2FVRA 3R6GB 5HI7A 4QU6A 2R2RA 4J9RA 1RAIB 1R89A 5C2GA 4Y6IA 4PKDB 1K0TA 3BEGB 3WBZA 4DPWA 3M6VA 3CUNA 2J6UA 2HVHA 2HHPA 1GTHA 1AA1B 3C8YA 4J9UE 4QYRA 2RILA 4OIXA 3UPFA 3CCJS 3C15B 1C1BB 4DDFA 4UW2A 2W7AA 2BMBA 3ZZPA 4B3MJ 2DXFA 3SBMA 2HHHF 2B4PA 3WZ0A 2GA3A 1G2EA 3LO3A 2GVZB 4OYMA 1WKJA 2IJNA 1NAQA 5K14A 1YZ6A 3CDUA 1HW8A 3CJRA 4PUOB 1NUEA 1T9YA 3K5OA 2W8KA 4P7TA 3FQLA 4FF2A 1LW2A 2Z2YB 3UR3C 4ZVTB 3DLEB 3PVXA 4NMXA 3DRPB 2DITA 2W8SA 3LAKA 4O3RA 3QPIA 3ZO7A 1MMNA 1KLNA 3V4IB 3WQPA 4BC9A 2GO8A 2CQHA 3NGUA 3KLIB 1QAIA 4DR1F 3B6BA 2WRMA 3CCMS 4KJGA 2Z2ZA 1LK7A 1HPZA 3GTYX 3W63A 3K8WA 2KH9A 4C4WA 1U49A 2CPDA 3LF0A 1N56A 2BM0A 5KG0A 2R8HA 2AV5A 3RB3A 5B0GA 1S1WB 4CTAB 4LR2A 4YY3F 3JTOA 1SL2A 3RRKA 1L3VA 1Y6VA 2XI2A 1NMEB 1OSDA 4K0KJ 1YJUA 3DN9A 1UJ6A 4UOFA 1U1RA 3UDVA 3TVKA 4DWIA 2DR8A 3NKQA 4KO0A 1LWFA 5F41A 1I51B 4DPOA 3GG0A 2NYIA 4FNIA 3HO1A 2CQBA 1FX4A 1GMWA 4M5NA 2AJFE 4ZVSB 2C2RA 4L75A 3QFWA 1U0HB 2IA6A 3IMQJ 5CHCB 3DOLB 2CZ4A 1W7WA 3RBZA 2G2YA 3G87A 3QIDA 5E5NA 1Y9OA 2YWHA 4F4ZA 1XMOJ 1HQAA 1TV6B 4DL2A 4TY9A 5EX0A 2XMKA 3BDGA 1ICEB 3K5LA 4B3RF 2B6AB 2M52A 3IFEA 1ZM9A 4IRKA 1HWLA 4JI6J 5LT5A 3R1LA 4L3KA 4F50A 1S9EA 1YVFA 5DDRC 2D3UA 3S6EA 5CYMB 3A4TA 3WDOA 5I3UA 2RDDA 1Q5YA 2WONB 4QU7A 3KK2B 5AE3A 2HQIA 3TA1A 3C6TB 1RK8A 3U1LA 4J9PA 3MAQA 1A9NB 4FXWA 1WACA 1WG4A 2MZ1A 4XO0A 4L72B 3LA0A 1F3FA 2GSNA 2QTWA 1GT8A 3MM6B 1HI8A 2RNEA 4IH6A 4ZPCA 4YR1A 3DXBA 2JZ5A 3PTWA 1S0OA 2DD8S 2F63A 4X4PA 3POTA 5A2QU 1CQNA 4OYIA 2NYHA 2C3PA 5J2QA 3IP0A 3MF5A 5BXIA 3UCUP 4RO0A 3MURP 4LF9F 5ETOA 3E2EA 4OLOA 2N4CA 3SCLE 1W26A 5A0YA 2P9CA 4LF6J 4P2SA 2CG8A 2QN6B 1AJDA 2FGCA 3W2WA 1NU4A 2LP4A 4DFPA 1XMQJ 2HVIA 4Z7CA 5D0RA 1T11A 4PYAA 4CLPA 3Q0AA 3MMAB 2BABA 4FP9A 1DTTB 2E1RA 2L9DA 5IC4B 4Z37A 4A8WA 2OP5A 4DV6F 1M0SA 2YKPA 1RT5A 4CLWA 3MR2A 1KFSA 1RT3B 2XEXA 4J37A 3UD5A 4NZ7A 3N28A 4DX6A 1RYSA 1HL6A 4CLZA 2V63A 2KO1A 1IM6A 3DHXA 2Z2LA 5KG4A 2AEFA 4NXMJ 2W9AA 1OPIA 1XN9A 3KK1B 2V4JB 2PGCA 4ZIVA 3A8KA 1EW2A 1WNEA 3HMJG 2PC6A 4GTXA 4YB1P 2XMTA 4P72A 4S0MA 1EETB 2EI5A 1ZM4A 1ZTTA 5DM7Q 1S1XB 1VRTB 1FDDA 1CQMA 2HFNA 4X62F 4LF5J 4WU2A 3I31A 2UUCJ 3GV5B 2FY1A 3IM9A 4G1PA 5B7WA 3WHIA 1S0NA 2RKIB 4GKJJ 4ILRA 3LWMA 2ZE2B 5LSLA 3IG1A 4CRJA 2VC0A 1S9FA 4JI0F 1RI7A 3FFIA 2NSCA 4OYOA 2CNNB 4RU9A 2BRLA 2CJXB 3SZ2A 1M5HA 3ONQA 1QSYA 4YDXA 2M8DB 4M5KA 2XZWA 3T1HF 2UV8G 2MZSA 1NSAA 4O3NA 4NMLA 1VQYA 1BWVA 4IFVA 2K3KA 2HRYA 3GU0A 2VQFJ 4F3MA 4ZN1A 3WC0A 1U1NA 4EK2A 4C8YA 4FF1A 4ED5A 4K4YA 1GFWB 3RB6A 1QTMA 2PFDA 3SXLA 2AIRB 4USVA 5HAOA 3CCQS 3TUIC 3W9JA 1FE4A 4LSNB 4EBCA 2MZQA 3H20A 3C2PA 4TVAB 3D1OA 4IG3B 2FD2A 2OFGX 4JV5F 1EB0A 2DNGA 1S7HA 1TAUA 2OPPA 2LU2A 4LRDA 4X2BA 4Q8FA 2ZD1A 4C8OA 2R7QA 1LWCB 1RLCL 4P6QA 4USUA 3GJQB 4PRFA 2P5VA 5K8MA 2C42A 2BJ3A 1JQGA 3CIMA 4KAVA 2ASLA 4DLEA 5ADZA 1JXEA 2XMWA 2WW4A 2O01C 1QTNB 2IHR1 2W4CA 5GAGI 3WBHA 4WPAA 2BE7D 2MSTA 1VGYA 4ES2A 1KHJA 2IRUA 1C1BA 2VFSA 4F0KA 3VAGA 3JAMU 1X4EA 2YQ1A 1FRXA 2GMLA 1AUKA 2B7CB 3HI9A 2NCKL 2V68A 2GNKA 3M6XA 3TUPA 4TNOA 1N2KA 4DV2F 1NDPA 3BGUA 4BDPA 4CO4A 3C6UB 3V81B 4PUOA 2HNZB 1LWEA 2KN4A 5F3TA 3OTDA 5F0UA 2LVWA 1VQ9S 1HBUB 3MMJA 4B9LA 3A3NB 2A10A 5A8RB 1Q5VA 2RAQA 4K4TA 2W5QA 2E7VA 5E3AA 3OR1A 4CO0A 1E6VA 3IGVA 1BHNA 1Y11A 1G7CB 3DLBA 4LF2A 1KC8T 4B9UA 2HHUA 2K1RA 2JX2A 3SV3A 2A1BA 1KVKA 1FD8A 2QLJB 1S59A 4F25A 5E41A 4YOEA 3MR6A 1FKAF 3O1LA 2U2FA 4LSLB 4ECUA 1FDNA 2QC3A 1U0HA 5E7OB 2FUG9 3OT9A 5C24B 1ZOTA 2J8SA 1HQUA 1KNZA 4URQU 4USKA 1T8EA 1BWEA 1XNRJ 3H5UA 4DBQA 4C3MA 1ELXA 3ENQA 2ZBIA 2D74B 4ZLJA 1D9AA 3JB9k 2MQLA 1NB7A 2QA1A 4B3OB 2ZNZA 1EKSA 1XK8A 1SJRA 4F4AA 3R7NB 3MEGA 1F2HA 2I5JB 1SKUB 3N4WA 4W98A 2WOMA 1F60B 1YI2S 5KG7A 4DL7A 1HBNA 2HHSA 4F2SA 4OZ2A 3IWNC 1S97A 2ZDPA 3TZZA 1VIXA 5A6WA 2JVRA 3CD6S 4RW9A 3NKPA 3EMTA 3CEDA 1N34J 4QJVA 3G6YA 1BMQB 3TEGA 3A3OB 4P73A 4C3KA 2RVJA 2ZH3A 2EC0A 4WYWA 2ZC3A 3UCZP 3KHRA 1NJYA 4DL4A 1B70B 4P10A 4FXVA 2CJ9A 4OMFG 2PMHA 5D3GA 2AKWB 2GVDA 2R4FA 3K5PA 3I6PA 3LP0B 2AGOA 1FX2A 1RT1A 2O5DA 5J2PB 3EZUA 4HH0A 4C8ZA 4ECZA 1BGXT 3TAQA 4MKVA 1CSJA 4DV5F 2AT1B 2QO3A 2VKZG 3TEHB 2V5HG 4C9DA 5SUHA 1N0VC 2HS0A 1RA7A 3GPAA 3ZTRA 4CI0B 1VMBA 3CD5A 3HZGA 3G6VA 5GAGU 5MLCV 3DYCA 3AXKA 4A46A 3BDEA 1BD6A 2R7RA 3FEYB 4UZBA 1RWNB 2EG2A 2E1PA 1YLXA 5E3CA 2AZ1A 2KHDA 2GQQA 1IBKF 3T6BA 3PHTA 1JLBB 3M32B 1J5EF 4E2FB 2P9GA 3FK4A 2OPRA 3MM5A 5HMWA 5E3RA 3GFXA 3OXFA 4XPEA 2IY5B 1W25A 2Y1LB 4ID5A 3CJKB 1SJFA 1UVIA 4IRCA 4YP3A 1WJ9A 1XR7A 4M5HA 4JI2J 4R8UA 2NUHA 2DNOA 2BOPA 5J1PA 4FZVA 2BW2A 1SBRA 4Y3CA 3GCXP 3WIVA 2DK2A 2IRXA 2W2PP 2B8PA 1VRTA 4LBPA 1P49A 2BKNA 5DQHA 4V19X 4ZG6A 2EFGA 3WAXA 3ENWA 1K9MT 1IQTA 3HFVA 1LQ9A 2B9WA 3NAIA 1FSUA 4LVOP 3PIOQ 4C2MA 2MKSA 5HMZA 4DN9A 4DR3F 4EMDA 3CC7S 2RKIA 4ECTA 1KH5A 3MTJA 3MUVP 4OQJA 1CJVB 4GC6A 4X65F 5HK4A 4N5SA 1KFDA 4USWA 4DV0J 4MIBA 4DPTA 2CVEA 3BPDA 1YRUA 3DM2B 3LGHA 2RUSA 4NLYA 2NQPA 2ZBCA 4AFFA 2GSOA 5C66A 1M5OC 2UVWA 3KMQA 2LA6A 2COLA 2IA0A 1C0UB 4TY8A 3R97A 2ZZMA 5SZTA 4AXJA 2JEGA 1XC9A 2OIHA 2FZKB 2NXCA 4ED7A 4YS2A 2BVZA 3TAMB 3SQGA 3BQ2A 3UCGA 1IKYB 1TL7B 2XCAA 1S1UB 3K59A 5F8NA 5FDLA 5HP1B 1U09A 2HS4A 1W2IA 4ZJQA 3W8PA 4IFYB 2B4UA 3DYAA 4N8OA 2V4RA 2AJ0A 3CCLS 1YGYA 1Y3JA 2VA2A 4WP3A 3N9UC 1U6FA 1S6OA 3NGRA 3V6HA 2F40A 1KQSR 2CIMA 3UVJA 4UUWA 4ECRA 4R0EA 2X3DA 1DLOA 4G1QB 4OHWA 2OMOA 2LYVA 1JLFB 1R8AA 1R27B 4U96A 2FQQB 5EGHA 4EBEA 1B4SA 3IAM9 5FJ4A 3MCOA 4PZVA 3IBCB 2IVYA 2EEYA 4USIA 1OY6A 2JWNA 3T1YJ 1X4CA 1JMTA 1O5JA 4NLTA 5DQGA 2W8LA 2FZCB 1TK5A 5CA5A 2IM0A 3HFZB 3Q24A 3OFFA 1HD1A 1R7IA 1IJFB 1RT7B 5L1JA 2Q1LA 3W9HA 2GW8A 4DV1J 3G86A 2XHWA 5ETPA 3A8JA 1MSWD 1L3TA 4UPKA 3MEDB 5HO4A 3QGPA 3NNCA 5CAAA 4ZJLA 2FY8A 2DJWA 4O4RA 4J9NA 2BM1A 4MT1A 1MG7A 3KG4A 2LQ9A 3QFHA 3P3DA 2UV8A 1H7WA 2VFUA 2NXEA 1XWLA 4JI8J 3HD2A 3PJWA 2HZVA 2QRRA 1VDHA 1T9XA 4MTPA 2M70A 1HWIA 2W2NP 2PO4A 1NBEB 4KB7A 3KXDA 2DH8A 5A8RA 2MKKA 1S77D 3PNIA 5L0BA 1NPRA 3LANA 4DL5A 4WIQA 4P75A 6FDRA 4F4YA 3J80Y 2MQQA 1X4FA 2DNLA 4WZQA 4OYAA 1L3KA 4R25A 2VG7B 4ITSA 4R5PA 3NY0A 2CG4A 5D4OA 1VLOA 3D66A 3M8ZA 4A8XA 1HR0J 1FF2A 4YHHF 1LNQA 4UY85 1YQHA 3OXLA 1U0SA 3MD1A 5LRNA 3N01A 2DNMA 5AE1A 1X9WA 2LEAA 1OYDA 4DOZA 2ZOFA 3NKRA 4F3OA 2W5WA 1R3NA 1YBUA 2HGNA 2W25A 3VWSA 3ZZRA 3TYTA 2APOA 3HDSA 1SUQB 1RQ0A 1UWBB 4AD6A 1DHMA 4DPXA 1FJGJ 2P9EA 2CUYA 3PW0A 1D3WA 2I5JA 2HZCA 2PDAA 2VPZB 2EWHA 3JSMA 2X1BA 2VPXB 2HQDA 4QYZJ 1N5TA 1IBMJ 4U8YA 2DH9A 3M05A 4PXCA 2MYFA 3VAIA 1JLQB 3MMCB 4ECQA 4HI1A 2I6WA 1O98A 2HQGA 1NJIT 5E33A 1TKZA 5IV4A 1H74A 1XNQF 2I8EA 4NWJA 1UW4A 1YG0A 1D09B 4NI2B 3R5BA 4DR7F 1CC7A 4I7FB 2D3OR 5KFOA 4A8QA 4HTIA 4CQ1A 4OYWA 1RAEB 3VQSA 5L39A 3Q8UA 4ZPAA 2JFKA 3DOKA 1TVRB 4BBYA 3G71S 2AX0A 8AT1B 2BJEA 3M9NB 2BJDA 2HQCA 5EX3A 1G4CA 3MD3A 4CDIA 3CD0A 2B5JB 1ACMB 4LF7J 3I55S 1RWKB 2KRBA 2HQFA 4Q2LA 1SKWA 3I87A 4K4UA 4NOHA 3M2RA 1GMWD 2KI2A 4OJHA 1SVDA 2JC1A 2XWYA 3EM1A 1CS4A 4NYOA 2MJNA 4B3MF 4QR1A 3CCVS 3BKUA 3K5NA 2L9NA 3R2DJ 4C48A 5ETQA 3NMAA 5DZ6A 3W66A 4B9MA 1JK9B 3GSDA 3LP1A 2AJ1A 3W2VB 3SZZA 5DQIA 3FQKA 2L41A 3M32A 3HVTB 3M2VB 1V9OA 3EZ5A 3NRBA 1EI6A 3M8PB 1M5KC 2H54B 1MN7A 4RW8B 3KDNA 4M5LA 4Z7YA 2ZH6A 2CAJA 2IM1A 1RAOA 4LFAJ 1FDBA 3DGVA 1U25A 4RNOA 2QJ3A 2J9EA 1QE1B 3GE9A 1TUWA 1AJCA 1S1TA 4JI7J 3EXCX 4WKYA 3TA0A 3HT3A 4PXDA 3N5FA 5KT2A 2YX7A 1QSSA 1XR5A 3MM9A 2XYHB 4K0KF 1WDTA 5EN1A 1P1TA 4MAKA 2F8HA 1MNEA 4O3QA 2HLTA 5C5JA 4JI1J 1H72C 3HFKA 3PX0A 3RAXA 1WOPA 1H2TZ 4OI4A 1ZA2B 3TANA 5F8MA 1R0AB 2KZMA 4J9VA 2YWEA 3OFEA 4CWBA 1U6ZA 2RIJA 1XMOF 4PG8A 5L0EA 4P52A 1VQLS 1N6QB 4GTZA 2V2QA 3ZXWA 2EK1A 4NWBA 5KFSA 2B9EA 4IRDA 2LXIA 2BKOA 2HWTA 2LQ5A 3TAMA 2FC9A 1IKYA 1TL7A 2B9XA 3V2UC 4JI6F 2IM2A 2ALYB 3UR0A 3AD9C 5LL6d 1ELOA 4IOBA 3N6LA 1IKVA 5HVFA 1Y5NB 3I5AA 3OLBA 1VJWA 1NDLA 3VVTA 4XAKA 4I2PB 1AW0A 2ZH4A 1N54B 3TA2A 5CYQA 3Q22A 2BX6A 4B3RJ 4G1QA 1RHKB 1RCXB 1FHTA 3EVMA 2XWXA 5KFNA 4CLKA 5HLFA 4C11B 5F8LA 2MGZB 3HZEA 2VD3A 4GC7A 3DOMA 2CWXA 4C97A 2CPIA 4Q45A 4GO7X 2I1RA 4OYZA 2P8IA 4UORA 1TMJA 3BREA 4ZVEA 3TZXA 3GYNA 3BQ1A 4Q7AA 5T14A 2G4BA 4LFBJ 4CM2A 1UFLA 3IRWP 4LF6F 3KHGA 2E7WA 3MECB 1CEZA 2QEXS 3UQSA 2NREA 4QW9A 1HNIA 1XMQF 4B9NA 2BRKA 4PG6A 1RWPB 1U1QA 2QGFB 4DCOB 1VI7A 4UTGA 5I3PA 4ZPTR 2L08A 4FBUA 3UNYA 2HSEB 1S6QB 3G82A 4NLUA 4RNMA 1Q0NA 3EVWA 4ANDA 2OGUA 2CQGA 1YX2A 2V2KA 1D1UA 4DQSA 1S48A 1N33J 2ROGA 1ELYA 1O0PA 2M8HA 2IAJB 3W5ZA 5KT3A 2GHVC 4M5MA 2BE2B 2HNYB 1NK9A 4NXMF 5IFMA 4Y65A 4WE1B 2O3DA 3JXOA 4H4OB 2DHHA 4Y2CA 3DRRA 1MMLA 1YWXA 1RP5A 2NXJA 1VRUB 4CO2A 5DRKA 2H5IB 4L76A 2R9LA 2NSBA 3F73A 2UP1A 1NHKL 4DFKA 3GJTB 4LQYA 4DV6J 4KGXB 2CJQA 5BR8J 3OTBA 4GVBB 1OMSA 1OWXA 3I0SA 3HXMA 2PA8D 3UWTA 2XM3A 1MWYA 4ZCKA 4LF5F 4UPLA 2R7WA 1FCAA 2UUCF 1X4GA 5B09A 4KFBB 3PR4A 3D6HB 2J0XA 3ZTSA 3UN2A 1V5VA 1YITS 2MLZA 1T9WA 3OXGA 5KFCA 2CJBA 3CTRA 4C6AA 4GKJF 1HQEB 1XJWB 3HKZD 3IN5A 2OAUA 3KLEA 3R7SB 3L4BC 2ZH5A 2VG5A 2FPHX 2BQRA 1HMVA 3MCSA 2MQ8A 4V19J 5L9NA 4O0IA 5C25B 3RAMA 3PM9A 1S57A 2YWFA 1VBYA 3FRYA 3HT0A 4PWUA 2W7OA 1ZETA 2HKEA 3AOAA 3KJVA 3BF4A 4KE5A 4CO1A 3SFUA 4LUBA 3C16A 2C3YA 2OPQB 2HGMA 4KIAA 2PFFB 2Y0SD 2ABYA 1IKWB 2VQFF 4KAYA 1JLGB 3HK2A 2DNRA 2DGXA 2EK6A 3UFCX 2ZKTA 5ETKA 1AYEA 3ET6A 1FRMA 3QIPA 2Y1IA 3H5XA 3Q8YA 3D67A 4K4VA 3R5CA 4DN0A 4JV0A 5KFFA 1IWGA 4MMOA 5L9XA 4MJKA 5AXLA 3J80U 3MMCA 3BH6B 2QLFB 4MIWA 5EHHA 3DI6B 1P1LA 2P6SA 1F9HA 1FT8A 1FESA 4HI2A 4DG1A 2RUGA 4RX6A 4MY4A 1SL0A 4M5DB 4NI2A 3RW6A 3PW2A 2EFVA 1SC4B 2IYGA 4I7FA 3AA8A 1UAWA 2HWIA 4ZVQB 1X5TA 3M7VA 3MWBA 4UPIA 4LQ3A 3NS5A 4KHMA 3Q8SB 2KHCA 2IBOA 2YNGA 3CMRA 4I6YA 4K2JA 1OIAA 5DGBA 4ZOSA 1REVB 2BV3A 1ALJA 5M2RA 4RWXA 2HNDB 4YR3A 1TK0A 3IGZB 1SV5B 2GV1A 2RRNA 1GX5A 1EQMA 2BE9B 3VV2B 1BE4A 4OL8A 2J9DE 4G65A 2DRAA 4DXLA 1RAHB 2RH3A 4JI4J 1PYTA 2HBQB 1RB0A 4LRCA 1R43A 1RTDA 2JJ4D 4OI3A 4DL6A 4IG0A 2DGTA 1T0TV 3HHEA 7FD1A 4KTQA 3IDDA 3CMES 5DG8A 3SYZA 4AL5A 5K4PA 4HKQA 3DLGB 1Z4UA 4FBTA 3O8WA 1TZ0A 4DX7A 2E5GA 2DPIA 2WAQD 1F5BA 4I0WA 2RE1A 3BGRA 4HR2A 3U1NA 2C2MB 4FYDA 4TU7A 4K4XA 4RPFA 1EHWA 2IDEA 1QE1A 2PT0A 3I9ZA 2LU1A 3GYXB 2G0JA 1WOOA 3VVUA 1UJ4A 4DFMA 2LXFA 4DV3J 2G2OA 3TVYA 3Q2SC 2XR9A 4BHQA 1ZTWA 2GS8A 3AXMA 3GJRB 1GEHA 2YKQA 1HIYA 3PDNA 1IWAA 2J9CA 2E9RX 3NKMA 1NNDA 2V8PA 2ADBA 3A8EA 1HQ2A 3C19A 5CZVA 1XNRF 1TMMA 5AJ3J 1SB6A 3M2UA 3KLGA 2IJFA 3L7PA 2XG8A 1KLMB 3MMBB 2VDHA 3V6DA 2C2EA 1L3UA 1KKHA 3UN3A 4HHHA 1VBZA 2XGQA 3OTEA 4ZITA 2I0XA 3VAHA 3M6WA 4EO6A 2EBGA 3PHEA 4ES1A 1YJWS 1EW8A 3MAHA 3CMQA 3NKYA 1RHJB 1S1VB 2V34A 2RDIA 3FBFA 2DNPA 2XQCA 3PW7A 2K2PA 2VQRA 1C0TB 3OHBA 1NJZA 2UXBJ 4JYAJ 5KFQA 3RTVA 3IS9B 3AOCA 1TUGB 4I2PA 1T03B 1JKHA 5K9FA 1N34F 1FJEB 1KSPA 3OUYB 4I2QB 1RXOB 1I5OB 1HYSA 2MKHA 4ECYA 3KLFB 2CDQA 5E2QA 1E3CP 2X7IA 2YX1A 4TYAA 4KQZA 2MGZA 3ILLA 1RHQB 4RBUA 3Q3QA 3RB0A 2AEMA 1S6PA 3KG0A 5KFGA 2LA4A 3LP2B 4PWDB 4QIGA 3QWPA 4UPHA 4H4MA 1CJUA 3IGNA 1IN0A 4DQIA 4NLWA 3OL8A 3GV7B 2VA3A 1N32J 5B0FA 2XS2A 3JS9A 3CJTA 2UUTA 4EUVA 3V6KA 3DGPB 2W8DA 3BPSP 3MXHP 5THWA 1BY9A 4DR4J 4ZHRB 4IQXA 3QNWB 1GAOA 1LV5A 2R7XA 2DY1A 4P2XA 3BN4A 3T5KA 2GHPA 3SMZA 4J5OA 3LGNA 1VC6A 1V6HA 3M1VB 3QWUA 1HJKA 4O4GA 1XQIA 4USMA 2BR0A 4J9OA 1XMBA 3KFWX 3X3UA 1FA0A 2HIYA 5HVHA 1NK7A 2J5AA 1JJ2R 2AW0A 1VQKS 3CE8A 2CA9A 3J81Y 5HRTA 1RAGB 5F8GA 3N6NA 1PJ6A 1Q8BA 1JLEA 2QG9B 5G0RA 2CQ2A 1BQXA 2QV6A 4KRWA 3Q8RB 2YKMB 3W7BA 2Q79A 1Y4ZB 1FFGB 4NA3A 4JI2F 1YJNS 1UETA 2ATLA 2XY7A 2ZH7A 1AZSB 5CYJA 5KFLA 4ATNA 1U7LA 4A8MP 2R3VA 1J5EJ 2R8GA 5H9FK 4DU8A 4IOCQ 4YEAA 4QWBA 2VB6A 1FDAA 2B43A 1FERA 2QLXA 5J1EB 4FYYB 1U2RA 3MR3A 1X5SA 2KXFA 3DMJB 1RAAB 1TK8A 2MSSA 3R3TA 2A2CA 2PD1A 1T94A 2QL5B 2Y0BB 2EVZA 1WDDA 2DO4A 4NZ0A 2CQ4A 5A8KB 2VBYA 1V5IB 2QL9B 4XK8C 1TELA 2HLUA 4NPOA 2DISA 3MZIA 4E0DA 1T9TA 1FNOA 3RB4A 2J7WA 3FSXA 2W9CB 4FDIA 2GQ2A 4DR5J 1KQGB 3P5TL 1FXLA 1BQMA 5CQGA 2UVUA 1P6TA 3MM8A 2M5YA 2GAHC 2Q3PA 4EYHB 2CPJA 4RW6B 4WP9A 2BANA 2IVFB 2V94A 3OW2R 1RT6A 1IKWA 2ROPA 2XLIA 1X4DA 5HANA 3KMSA 2XZTB 4O3PA 2XO7A 2UU9F 1JJHA 2RRAA 4CO5A 5D6GA 2H5EA 2UXCJ 2XO6A 3MR7A 3K57A 1R6YA 1K7HA 2M2BA 4I69A 2XC9A 1NKBA 3NGTA 4HLBA 2F9DA 1DQAA 2ZJRQ 3FCWA 1PAUB 3GIJA 2AJ4A 1DY3A 2RHQB 1P8GA 2XRGA 3DI6A 3TZWA 2ZOGA 1AFIA 5GAEI 4DHVA 1FK9B 1RT4A 3EJMA 4ZVUB 3T1YF 2GSUA 1ZBTA 3FMWA 3H4DA 3E2DA 4WWSA 4LF8J 4P2MA 2RQMA 1QD1A 1HFEL 4LF1A 4J7CA 3M9MB 5KFEA 3BBFA 2XGPA 3SFGA 4PPZA 5BYRA 5A8WB 2M3DA 2M0GB 1H0HB 2FJWA 4DV1F 2B0GA 1LKZA 2R7UA 2KXNB 1LXNA 4PPDA 1REVA 3VHQA 3H4BA 2HMIB 4U95A 1QDUB 3AJDA 3KDOA 5K8PA 2WSEC 3MPVA 1FKPB 1TQLA 5JVHQ 1KVIA 2DNZA 2N7YA 3TI0A 1ALHA 3T1AA 3WAWA 2Q43A 4X4RA 1K0VA 4XTTA 4QQBA 1GMVA 3GV8B 2JC0A 3RBDA 1MU2B 4UF4A 2QZUA 4GTWA 5CCLA 3EICA 4JI8F 1RSCA 3M8RA 3QO9A 4B9SA 4C8LA 3B8HA 3JQMA 2P6TA 5I4MA 1HNVA 2HFOA 2A2DA 2EFQA 2C3UA 4CO3A 4YMEA 4OJGA 2D1CA 1S0VA 2DCUB 1DTQB 2P2CB 3NOCA 4DX5A 2YWGA 4EZ9A 1B0VA 5LMNJ 3MM7B 1TKTB 3OLAA 2GJFA 2R2UA 2HK2A 3G6XA 3MAAA 1RT2A 4N77A 2YNIA 2F4VJ 5KFZA 4OI6A 2Z56B 1KH7A 4RKUC 3G9CA 5A6PA 2KYZA 4MKAA 1HR0F 4CYSA 4QWEA 3DC2A 4F04B 2BZ2A 4PAAA 4BLGA 4LBHA 2KRRA 2UXDJ 2E7XA 4MKBA 4PEOA 1S4FA 1FEEA 4NXNJ 5HBMA 4X4NA 4DQPA 3O44A 1VYAA 2JL9A 4OV6A 4RW4B 2HBRB 3L9ZA 2HURA 2V0NA 1FJGF 2AF6A 1RTJB 4YR2A 4LRFA 5ETTA 1SJ3P 2BJ8A 2KU7A 2OEMA 3SI8A 1RCOB 3KNAA 4DUYF 2F4FA 1B0TA 1IBMF 4RW7B 1C0TA 1WC6A 2ZFHA 2YQ0A 5KTQA 2IC3A 4I68A 2G9YA 1GTEA 2ZOMA 4KKOB 5F8IA 1NSKL 5BYSA 3F41A 4H4KC 2VPWB 3DDIA 1ZEBA 2W4DA 1E6YB 3BDPA 3QSIA 4Y2MA 1N5SA 3OR2B 4A48A 2RSQA 2EKYA 4I2QA 4UOPA 3G8TA 5IV3A 4OHXA 2DHSA 3OSNA 3BDHA 5ETLA 2FDNA 4HH1A 2N4DA 4PWWA 5B0AA 3FUYA 3N6MA 4NA2A 5GAEU 1ZA1B 3E8OA 3NGKA 3LUYA 1RHUB 3R5JB 3UN5A 5DDQC 3GB0A 3SDEB 3DLKA 2W2MP 1JIHA 1GXLA 3MDFA 2XBPA 3NG8A 5DGAA 1O99A 2FLPA 1KHLA 3R1HA 4WFYA 1XNQJ 4LF7F 3S1TA 1SQGA 5HSPA 5HROB 3DGPA 3BSNA 1RWXB 1U6BA 2OJ3A 2L48A 3MOZA 4DR2J 4EZ6A 1N5YB 3LTOA 1SI9A 3BZQA 3ZZ0A 3AJ1A 1CC8A 4CXUA 5IQ6A 4KAIA 4AL6A 3T01A 5DLVA 1JLAA 1WORA 5L1LA 2LFVA 4J9LA 2VG6A 1FWPA 4AXIA 1PILA 4LR8A 2DXEA 4IH7A 3I32A 2HVDA 5IOLA 2DHXA 1KWMA 1WTFA 4DQQA 3H2VE 4QZVB 1JJ4A 4ANEA 1HI1A 2V2VA 3G6ES 3E01B 4DF8A 2MXYA 3ENVA 4LFAF 3B78A 4ICLA 2V67A 4D3GA 4MFBA 4I67A 4OZ1A 3VF0B 2QMUB 2VL1A 1Y0HA 4X4VA 2DR7A 1AZSA 3CD7A 1C4CA 2WCXA 1VLYA 3SZYA 4DX8H 5LXRA 4JI7F 5J2MA 1RHMB 1DAXA 4QIVA 2GQCA 3QSYB 4DSIA 1Z2LA 2XI3A 1H7XA 2E66A 4C3LA 1Q82T 4OFZA 3SSSA 3BJYA 2DR5A 1IKXA 4G6VB 4LIWA 4QIFA 5D78A 2R8KA 2H51B 4JI1F 3DU5A 3CCRS 2HFSA 3W60A 2NUUG 4WU3A 1J5OB 1SPBP 7FDRA 3H5YA 4RZRA 4NCAA 1N0UA 4X4TA 3LPYA 2Z30B 3NGSA 3DLJA 4AE5A 1R8HA 3J81U 3GR1A 2IVMA 1TKXB 4DS5A 3K89A 2ANHA 2Z0GA 4A8FA 4YFUA 3VZIA 2X3GA 1GQEA 4KHRA 2LLZA 4FDJA 3PXGa 2W9BB 2KVIA 2G9OA 2EFNA 2GIQA 2VBXA 1C1CA 5DDOC 3Q8PB 3BQ0A 3J7ZT 4WCEQ 5F3ZA 3OPKA 3CJ8A 3PO5A 1LFWA 1N8RT 2OMLA 3BGOP 4KPYA 1RDRA 1AUDA 2MQNA 3HHKA 3D54A 3HSDA 2DVIA 5IM0A 3QRQA 5KXAA 5AT1B 4A8SA 1HWJA 1IBLJ 2VONA 3KD8A 2AGQA 3FBCA 3KHHA 1EZZB 4MK7A 4CYUA 5H9FJ 3R5GA 4DUTA 2NXNA 2AHOB 2WHOA 4K50A 1CLFA 5FLXY 3AOBA 5B0BA 1UKUA 5J2NB 4XPCA 1SKRA 3KK3B 3TQEA 4K4ZA 3MUTP 3H0PA 1Q8KA 4QPXA 4F4KA 4LFBF 5L38A 3FEXB 1V3RA 4QBUA 2YNHA 3L09A 3I0RA 1V3SA 1UZDA 3HHLC 1WD6A 2XLJA 1ED8A 4QAXA 4O44B 4BWJA 1TL5A 1Q8LA 2NLWA 1FKOB 1YBTA 4X4QA 4OX8A 3VGUA 3NXZA 5LJ5Y 4AQYJ 1UVLA 4ZKAA 1EP4B 3DU6A 1HWUA 1JNZB 1Y7PA 1UZHA 2RD5C 4A8KA 3AB4B 4UOHA 5IT9Y 2DNNA 1N33F 2YKNA 1UW9A 4Q0BB 4EI2A 4OJ3A 1KH4A 2IFXA 2GAGC 1VQ4S 4DLGA 1NCLA 4FVCA 3B82A 4K2XA 2RF2A 2OD4A 1VRQC 1UJ5A 2EC2A 1UFWA 1U45A 2H4WB 1QAJA 1KD1T 2HHQA 5BR8F 3BR9A 3QT7A 1HNZJ 5ETRA 1F2GA 3ENAA 1IR0A 2YXLA 1HA1A 2IRYA 2FVQA 4EU0A 3A13A 4HVZA 3SCJE 3N0VA 2OPSA 2WBMA 2AZ3A 3FBEA 3FKBA 2DPJA 4HACB 3GLJA 2CQPA 3AQPA 2G1DA 5H9EK 4JP8A 1CJKA 1SIWB 2R7OA 1PSDA 2G1HA 1L3SA 1KONA 2OH2A 3X1LB 4WFZA 1CULB 2YWKA 3QT6A 3FVYA 4OX7A 3AH6A 1RU1A 1PJ5A 1FD2A 1KQFB 2AWZA 1KP6A 1Z2ZA 3QRRA 3H2UB 3PW5A 4RW4A 4HEA9 2V8VA 2UUBJ 3P6YC 1RTZA 2MJUA 3GP9A 5KFDA 5KG5A 2OLWA 1FJCA 2J76E 3S8SA 1BQNA 2MPUA 3C14A 4FDFA 1KHKA 4DUZJ 3BGLA 4F8RA 4NLRA 4N41A 3SQOP 1TL3B 3HHLB 4RW7A 1LW0B 5EGEA 4MYTA 3ZNJ1 5KFYA 3CT9A 3K8VA 3OSPA 5ETNA 3ZNUA 4Q5VA 4K4SA 3J7YI 1NK0A 2D7SA 1L5UA 1LWXA 1PGZA 1GK8A 1ANIA 3OR2A 1HLWA 2XSJB 2J0SD 1DARA 3UDEA 2VOOA 1X8DA 4AUKA 1F3VA 4IKAA 1LOUA 4LF4J 2W2OP 2MMYA 2XB2D 3SDEA 2IUCA 3FJ2A 5CD4H 2CZVC 1OYEA 4U7UK 5HROA 2Z4PA 5T7LA 2NR0A 4KJDA 1S9GA 4CXSA 3JYTB 1WI8A 4IDKB 4DV7J 3U27A 1BXNA 5C42A 4DS4A 2H48B 4ELUA 3GMGA 4XIUA 2VC1A 1T3OA 2C22A 4PG5A 1XERA 2MKYA 3CMAS 3CVKA 3WAVA 2DHAA 1WC3A 4ZVFA 2EXUA 3DRSB 1PG5B 3KJQB 4P2FA 5CABA 4JI4F 5GMDA 1F5CA 1GX6A 3RBXA 1U2CA 1GXUA 1URAA 2YVSA 4NL5A 2O1PA 5B0DA 1UCNA 4Y2IA 1FNMA 3TARA 2CVIA 5CXTA 2CPZA 1QAXA 8RUCA 1AJBA 3PYEA 2OKQA 1NHVA 4ZCMA 4M5GA 3C15A 1EARA 2JEFA 2MY7A 3QJJA 2MZTA 2HBYB 1FFSB 2EPIA 3MEEB 4ZP8A 4W90B 1XR6A 2ASJA 4K4WA 3O3LA 4EFAC 4QOTA 4N56A 4WBFA 3ZZUA 1XIQA 2GVZA 1J27A 5K14B 5AXMA 4TLRA 4ELTA 3TJAA 2JHEA 4DPYA 2X1AA 2HFZA 4X64J 1WI6A 4DV3F 2DIUA 4OZ3A 1TTHB 3NWRA 3BO4A 2R2SA 3DLEA 3EDRB 3DRPA 3D6MB 1HD0A 4ED0A 4C8NA 2DH7A 2FLNA 3V4IA 4CH1A 1R0BG 3KLIA 4CT8A 1ROFA 1HPZB 3P4UB 2NZCA 1DQ8A 3CC4S 4P71A 2CFXA 2QMXA 4H4KA 3JTNA 4F36A 5AJ3F 4J90A 3OJUA 4M5IA 1UEKA 2NXUA 3EPGA 5IXUA 1S1WA 4CTAA 2KT3A 4DJBA 2HPUA 2KFNA 3A52A 1S4EA 1TKXA 2QFJA 1T9UA 1QM9A 4N7TA 4GMKA 2VHGA 4N8NA 3OVBA 3NP5A 4KO0B 1S10A 2NPIA 7AT1B 3QATA 2HHVA 2JLGA 2Z57B 2D41A 3FGVA 5IWAJ 2Y8YA 2WSFC 4WK1A 2ZHBA 2XNQA 4ZVPB 3K5MA 2B51A 3QT8A 3HJVA 2RT3A 1QSLA 1NLKL 1WHWA 2HAIA 2M88A 3DOLA 5A2QY 2V4QA 1YHQS 2UXBF 2KT2A 1T95A 3GIIA 4JYAF 2FVPA 4RNFA 1TV6A 1H6KX 3FEZA 3VAFA 2B6AA 1N4LA 1H98A 3GSIA 4B3SJ 3RR7A 1F0XA 3J7YU 5I3UB 1X9MA 1ZAWA 4UOOA 3CJ5A 3KJNB 4B56A 1Q1KA 2ASDA 5CYMA 4LBIA 2ILYA 1JWWA 2WONA 3LPEA 1ZM2A 3KK2A 3PJXA 4PQAA 2L9WA 3IBWA 3BGFA 1JLCB 3C6TA 2CPHA 1KEKA 1S49A 2CPXA 5L46A 1VK8A 1IUJA 1N32F 3CW2C 3I5CA 1RTHB 4F4WA 1OQ6A 1ZH5A 4DR4F 1A7GE 2YQ3A 4NLOA 2QX0A 4O44A 3AHPA 3MM6A 2CPFA 3NCRA 4Y34A 1I94J 3TZYA 1FKOA 2RH6A 1VQOS 3POTB 2WSCC 3RRGA 4FYXB 1WF1A 5J2QB 1PC4A 2KYXA 5DM6Q 1EP4A 2Q6CA 4USHA 2OTJS 4KPCA 1B8JA 5E3QA 2KJWA 5A0YB 3DLHA 4RNHA 2PI5A 1AB8A 2EW9A 4MIVA 3W2WB 4X84A 5GRRA 1IJEB 2W5VA 1FI4A 1WUUA 4ZCIA 2IJRA 4OYPA 4RWWA 1HHTP 3BH7B 3R8YA 1IBCB 2H4YB 3CDWA 3MMAA 5JJBA 2GMJA 5D4LA 5FLXU 1U48A 5KT5A 1DTTA 1R8CA 2Y1JA 1RT5B 2F9JA 1Q78A 4FF4A 3PACA 4CXKA 3EYZA 1RT3A 2FLLA 3NS7B 5IJSA 5D0EA 4LR9A 2VJUA 3SIPB 2V6AA 3SV4A 1NO8A 3BV8A 9RUBA 1VQNS 3KK1A 2V4JA 2Z8QA 2FGOA 5KFTA 4Y2AA 4WFNQ 4PABA 4ER8A 4ECVA 4WTYA 2JOQA 3G96A 1HNWJ 1EETA 3OFGA 4U6PA 1RABB 1S1XA 2CADA 1SC3B 1CULA 2HFVA 4DR5F 1TUVA 1KOHA 1YJTA 5IZHA 3I82A 4TLQA 5L8RC 3GIRA 1N2LA 2QA4G 3ILOA 2GHWA 3IG1B 2ZE2A 2DHGA 3FFIB 4DCPB 1Q8IA 1S76D 4NWXA 3WAYA 2UXCF 2V9KA 3MK2A 4NEZA 2X98A 1TL3A 4FPIA 2FZGB 2HG4A 4ZJOA 1LW0A 3ZTOA 4CH7A 4I56A 4ID8A 4IFVB 4LSZB 2RU9A 1LFPA 3V4MA 4ILMA 2CQCA 1NK8A 1T3NA 4F26A 4BCAA 2UU9J 1VC0A 2DO0A 2AJQA 2D69A 2PI4A 2XSJA 3JAMY 1UVMA 4URGA 4Q43A 4LF8F 4RUAA 2LKZA 3D68A 2ROEA 2DT9A 3R2CJ 3ZTQA 2XTJP 3L7UA 4LSNA 3HKWA 1UVNA 5H9EJ 2DY9A 3DXSX 3OHAA 3R27A 4IG3A 2IMOA 3IXQA 5HL7Q 3QLHB 3KUHA 3IR6B 2OPPB 1N48A 3S7RA 2YKOA 2ZD1B 3TW0A 4OJ1A 3OL6A 4FNHA 3U02A 5DJBA 1LWCA 3VZHA 1VJQA 1QVFR 2AX1A 3BS9A 3T5HA 3VALA 4ZGAA 2BJ9A 1Z1ZA 1ZZFA 4ED6A 4ZMMA 4DL0C 1M1HA 1WEXA 3IM8A 2WW8A 1FEHA 2ZM6J 1YIJS 4U67Q 4F0HA 2KJVA 1KVJA 1X60A 1U1MA 1H2VZ 2E1MC 1R0CB 1RUSA 1TL1B 4JB8B 3LH2S 2HVZA 3QAEA 1RWMB 2D3O1 2A6MA 3HLUA 2W7PA 3MEEA 5GVQA 4A47A 2VUGA 4DMZA 1PYOB 4BC7A 4KHPJ 1SH3A 4F0MA 2HQ3A 1ZS6A 2CQIA 5U47A 3I9V9 4QWCA 1VS3A 4C0BA 1TP7A 5LMNF 2OI2A 2EG1A 5E3PA 1NK5A 3C6UA 3V81A 1LWEB 2BQUA 3CJ0A 2PEHA 2G0IA 1TL4A 2HNZA 4ZS6A 1RYRA 3KG1A 2IYIA 2WVEA 3H42A 3H98A 1HBUA 4DQRA 2F4VF 4ZG9A 4NASA 1RLDA 3OL7A 1JXVA 4ED2A 1QUVA 3KUGA 1YBAA 3O5TB 2RB7A 2DGSA 5C2CA 2CWKA 4Q2MA 1E1ZP 3OVSA 2W5SA 3ED4A 1SJ1A 4X66J 2UXDF 3OR1B 1E6VB 4XDCA 1S72S 4NXNF 1SIZA 1MW7A 2K1RB 5HN0A 3SSQA 3PRVA 2R7VA 3FC9A 1EX8A 1FE0A 4OZ5A 3CDAA 2BJ1A 3OJSA 4DSLA 4DU7A 3NBPB 4YUDA 3AJ2A 4LSLA 2ZHAA 1HQUB 5M2PA 1G3OA 5C24A 2VKRA 3T19A 3UW1A 3KLHB 2AYMA 3R9LA 5LSOA 4L3NA 3IWLA 1X31C 1H38A 1NKEA 3US5A 4USJC 5LJ3Y 4B3OA 3ZZYA 1X5OA 4NA1A 2W4PA 4QR0A 2ZITA 3MEGB 2MDAA 3J7AN 5EGYA 5LMUJ 1DZ5A 2WOMB 2J6TA 4PYDA 1HBNB 2XY6A 4DUYJ 2WK4A 1BC6A 2W2QP 3FZBA 5B0CA 1JLCA 4EO8A 1Y7AA 1QY7A 1YK9A 4HTJA 3HVRA 3FBBA 4RW9B 4FYVB 2O67A 5DLWA 1RTHA 4KGKA 1F1BB 4DR6J 1EJJA 2H9ZA 4WP8A 4LMZA 2BUNA 4QCLA 1UVKA 2QA4S 3CCUS 4DR2F 4KGMA 1OO0B 3EX7B 4ZLNA 3HSGA 2KZZA 3M9OB 8ATCB 3ZZTA 5D3GB 2GVDB 2CQ1A 2PA3A 4ZPWR 3QMQA 1RT1B 4NLVA 2K8GA 3LP0A 2K3IA 4ECWA 5J2PA 1WHYA 3BN7A 5BJRA 2R8IA 2D1GA 2AP6A 3H2LA 3MOJB 2DRBA 5LOQA 4ALZA 4YDDB 3BSOA 1QJHA 1R8PA 1SL1A 5F9LA 2AEJA 4B9TA 2H3EB 4F4XA 3WC2A 2H1YA 2HIQA 2WVDA 4GKKJ 1JLBA 2EKNA 3LGMA 2OPRB 3IR7B 3MM5B 3HVAA 4OYXA 4WF9Q 1U1PA 4MIAA 2DRDA 4DEZA 4ID5B 2ZH8A 4WFXA 5AJ9A 3CJKA 4NLQA 2DGQA 2CPEA 4R8UB 4LQ9A 4RR5A 3BM7A 1N36J 4KR0B 3OQ2A 3HM9A 2B3TB 2XMUA 3F44A 3UE2A 4M63A 1D8ZA 4CLLA 1Y00A 5LXYA 2E1AA 2VOPA 3OBIA 3NNHA 4RUHA 4J9KA 3QT5A 2EFOA 2KVQE 2VASA 3D3CJ 3EUNA 1R6VA 1EQ0A 3PJ9A 4OX9J 5KOXA 3EDQB 3HSZA 4LVNP 2YH0A 3TX0A 1V3ZA 3L95X 4K8RA 3E3XA 1MWQA 2VBZA 2ZVIA 2DEIA 1CJVA 2VF3A 4NEYA 1VQPS 1AUSL 2HEKA 2ZEJA 3T6JA 3W62A 5ETVA 2Y8WA 2GO9A 2CPYA 2L3MA 2FHMA 4TN2A 1HDHA 3D1HA 4ZP9A 3DM2A 2ZBPA 3J7Z5 2XMVA 3CSKA 4TY8B 3TR5A 2WTFA 4EYIB 4FPRA 4OHZA 1NKCA 1C0UA 1UPMB 2C3OA 2R7TA 3PKYA 3SQGB 1ZM3A 2WZ1A 1IBLF 3TUJC 3RRHA 4K59A 3T5LA 1IR1A 5D4NA 1S1UA 3IC1A 5FDLB 3JSBA 3Q83A 1Q7YT 2CKWA 2QE5A 1T9VA 4PR6A 2W5TA 1FVSA 1ZAVA 5HP1A 3DYAB 4ENOA 3N79A 3EXYA 4MYUA 4IFYA 2V8DA 4CLYA 5LIAA 1FXRA 5L1KA 3QZ8A 4NRUA 5ETSA 5F0WA 3D0GE 4CNZA 4TKTA 3EGZA 2EFPA 2OD6A 3UVJB 1OPZA 4CLSA 2OHDA 3IGYB 2CNKB 1DLOB 3LOUA 1NK6A 1N5QA 4WKRA 1NEEA 2JH3A 5GAHI 1JLFA 3FSIA 1FWKA 5DLGA 2JEJA 1C4AA 4JUZA 2QL7B 2E5LJ 5DZ7A 3QLHA 3T5JA 5EWGA 2ADCA 2XZDB 4ECSA 1KHVA 1MMDA 4WK3A 4AQYF 2KDOA 4NRTA 1CVJA 1RISA 2YBVA 3MI7X 5B0EA 3Q86A 2N7CA 2OSRA 3T9ZA 4YB6A 1FTCA 4I64A 2WB1D 1U02A 3T3FA 4K5RA 4NYZA 2AQ4A 3BBBA 2HHWA 1RT7A 2OO4A 3EZOA 4ZP6A 2DR6A 2ZZTA 1M90T 2LEPA 3HJFA 3VQTA 1PAEX 4J9MA 1U47A 4RBTA 2A3JA 3MEDA 3PYGA 3ISNC 1TL1A 4ZVHA 1SKSA 3Q8QB 4DSJA 1K1SA 1FO1A 3GILA 3PX6A 2YH1A 1X4HA 1WC0A 1HNZF 4ED8A 5KFJA 2KG0A 4NCBA 1WSVA 3HHNB 3NOGA 4QYZK 4KGVB 2VFRA 3DNCA 3CCTA 2GIRA 3KTQA 2RS2A 2XYPB 1VQ8S 2PMZD 2PN6A 3QRPA 3DFEA 3CGIA 2HZAA 5FIIA 4TU8A 5KOWA 4KGZB 2CXEA 2JVOA 2MKCA 4DL3A 3DRYA 4D3HA 2QYGA 1TAQA 3N5BA 2DYAA 3R7BB 1U1OA 1UL3A 4PG7A 4ZVOB 1Y3KA 4EWTA 3PR5B 2VG7A 4R5PB 1SH0A 2F65A 1N52B 4OZJA 4YB5A 2UUBF 2CQ0A 3J7A1 4NLPA 3NKNA 3NBPA 2F1FA 1WEZA 3VTIA 4ZVRB 2ZUGA 4DUZF 2ZUAA 1WG5A 1PJ7A 5I3QA 3KLHA 1VK3A 4CLUA 2V2ZA 3J81j 3UDCA 2W5RA 1Q7LB 1RHRB 3RYLA 2GA7A 3PX4A 5F8HA 4WTOB 1SUQA 1UWBA 2GCFA 5M2UA 1N88A 1HWKA 3FDSA 1KBRA 2ZWOA 3JSMB 2LDYA 5DG9A 2B8QA 1LK5A 2FHOB 3KHLA 4LF4F 4ZG7A 1NSPA 4IR1A 1NDCA 3CCSS 1JLQA 3A8IA 1S6UA 2MQOA 2IM3A 1YKWA 1TKZB 1FWLA 3D2WA 2MHNA 4KT0C 1P27B 1NRKA 1HHSA 4DPUA 3TRGA 2RDJA 2YNFB 3O6QA 5D77A 4F7VA 1EJ7L 2VU5A 1RU2A 5GAHU 4DV7F 2IIHA 3MPWA 2BDPA 3NCPA 3DLLQ 5HQLA 4CLTA 3DOKB 2FHJD 3CCES 1VHFA 3GFYA 1TVRA 4KM4A 4HHJA 2X1GA 3DHWC 1ITPA 2Y9HA 2B5JA 4H54A 1WC4A 3ULHA 2AMCB 3M2RB 1DBDA 2CRLA 2QIFA 4HDHA 4C0HA 2E5IA 2GJ2A 6FD1A 1K47A 1CS4B 1RWOB 2G13A 2RS8A 1FNXH 1IR2A 5JVGQ 5C7PA 3H8YA 3LALA 3LP1B 1JB0C 1REGX 4RU2A 2K06A 1U8WA 3W2VA 3DRXA 3AD8C 4FKXA 4FF3A 4KJIA 2VFTA 3HVTA 1UEUA 2QLBB 3M2VA 4X64F 1B3TA 3OTCA 1RBLA 3M8PA 3D6TB 1RJJA 4UT4A 2W24A 2QZ8A 4RW8A 3VGTA 1KH9A 4DSKA 3B4MA 1KDNA 1AJAA 3GQCA 1VQ5S 1F9FA 4F02A 4P7VA 2AJ2A 3JQJA 1SJQA 1B7FA 3H5SA 4E8UA 4ZDNA 2F5GA 1EW9A 3OL9A 1S1TB 2ZJPQ 4KSEB 2KFZA 5KFPA 3LWLA 4WXWA 1SJ4P 1GNKA 3MM9B 1GXTA 3OTOJ 4OI2A 3I5BA 3M8YA 2FC8A 3Q8VA 1WKKA 1D9DA 2DGOA 5LM7E 3KUEA 3FMBA 1VQ6S 5IWAF 4Y0FA 2Q6BA 4M1KA 1KHNA 3FSYA 2CJAA 4C8KA 2HAFA 5AXKA 3KYLA 1R0AA 1VQMS 3AQOA 1Q95G 3T02A 3PEHA 4WIIA 2LXUA 2BA9A 1IM4A 2Z58B 1N6QA 1PIEA 1HBOB 1YJRA 2W5XA 1K73T 3UO0A 1U24A 1UEVA 1A6LA 5A76A 4B3SF 2J0QD 4W92B 1WF2A 4NYPA 1UMJA 4JI3J 1Q81T 1WHXA 1IKVB 1S99A 2WBRA 2OEKA 3EVOA 4F3QA 1W2BR 4ECXA 1NZAA 4OZLA 2E9ZA 4ED4A 4MKYA 1NK4A 2C1EB 1NSQA 5CYQB 2MEWA 4IOAQ 3G8QA 2FHKA 4KYZA 4ELVA 3AY0A 2ACMA 1WKLA 5CZXA 4QR2A 2LECA 2UUAJ 1I94F 5HLFB 1KN6A 2Z2MA 3EPIA 2C3MA 2VIHA 1S79A 1KRPA 1Q16B 3IWXA 4C11A 1ZEDA 3MEKA 3DOMB 5KFXA 1CJTB 4L73A 5GADI 4WZMA 5RUBA 3BSAA 3BYRA 1FFWB 5LQQA 2V8GA 3AODA 5IQQA 3ZZOA 3K58A 5EUHA 4ZP7A 3MECA 3TNVA 2BW7A 1HNIB 3SCIE 3IA0A 1PYSB 4FYWB 1EKRA 1H73A 3CJSA 2VDIA 3D28A 2N3OA 3NS6A 3VGSA 3WX4A 2FVSA 1RACB 3QQCD 4U7UD 3G82B 3GFZA 2E44A 4OZNA 4ILLA 4Z2XA 2B9YA 1RBAA 4X4OA 1S6QA 3HHLD 1YSJA 1YDLA 1LXJA 2HVEA 1OJ4A 3FRZA 2DIVA 2IAJA 4KC5A 2BE2A 2HNYA 2IBKA 2J8AA 1SC1B 2G2ZA 4EGLA 2KTQA 3DRRB 3I96A 1HNXJ 3A3PB 4WE1A 1QVGR 5D15A 4H4OA 3CWJA 5KG1A 5FD1A 4JBCA 1Q53A 1VRUA 4ZPBA 1VR6A 2WVBA 3R6LB 4F2RA 2MZRA 1E2SP 1HNWF
chains in the Genus database with same CATH topology
1ELZA 4LQYA 4UPKA 3OT9A 4CXSA 1ALKA 2W5TA 5GOVA 3T02A 5L0EA 2G9YA 4NWJA 2W8SA 2IFYA 1AJDA 4LR8A 1N2KA 4MHXA 3NKMA 4MIVA 5LQQA 1E3CP 1EI6A 4UPLA 1N2LA 3LXQA 4GTZA 1ELXA 5GRRA 2W5VA 3M8WA 1KHKA 1ZEBA 5LIAA 3M8ZA 1EQJA 2W5XA 2ANHA 5LRMA 3UO0A 3B5QA 3Q3QA 1KH9A 5TJ3A 4UOOA 4B56A 3NKNA 4KJGA 3UN2A 3WAVA 4LREA 1P49A 4LRBA 4UPHA 4LR7A 4LRCA 1AJAA 1ZEFA 3MK1A 3TWZA 1KH7A 2D1GA 3DPCA 5EGEA 5LRNA 1SHNA 4UOPA 4CYRA 4ZG6A 4FDJA 3WAXA 4CYSA 3IGYB 3BDHA 4QAXA 1ED8A 1K7HA 4NWXA 1ALHA 1URBA 3UN3A 3WAYA 3WAWA 4ZG9A 1FSUA 1URAA 2GLQA 4LRDA 3IDDA 3NKRA 4LR2A 4KM4A 3NKOA 3UNYA 1EW9A 2W5WA 2W8DA 3A52A 4CXKA 3MK2A 5K4PA 4MY4A 1Y6VA 5L0KA 1ALIA 4GTYA 1AJCA 1KH5A 5EGHA 3UN5A 4N7TA 3TX0A 2QZUA 2W5RA 4GTWA 1ANIA 2X98A 5IJSA 2W5QA 1E1ZP 3DYCA 4LR9A 2W5SA 3ED4A 3NKQA 1EW8A 4LRAA 4ZGAA 1AJBA 3SZYA 2GSNA 1SHQA 3M7VA 5IJQA 2XRGA 1ELYA 4KAVA 4UPIA 3MK0A 1HJKA 1O99A 4YR1A 1KHLA 3M8YA 2VQRA 1Y7AA 3BDGB 1HDHA 3TG0A 3NVLA 2RH6A 5KXAA 2GSUA 3CMRA 5L0BA 1EW2A 2GA3A 3NKPA 3WBHA 4LRFA 5C66A 2GSOA 5DLTA 4GTXA 5DLWA 3E2DA 1E33P 3T00A 5INHA 2IUCB 1EJJA 3KD8A 1ED9A 2IUCA 4KAYA 5HRTA 4ZG7A 1KHNA 4FDIA 4TN0A 1KHJA 3BDFA 1ALJA 1ZEDA 4CXUA 1HQAA 5AJ9A 1KH4A 2XR9A 2ZKTA 1ANJA 1O98A 1B8JA 3T01A 3IGZB 5DLVA 3SZZA 3BDGA 1E2SP 1AUKA 4UORA 4KJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELZ A;  4LQY A;  4UPK A;  3OT9 A;  4CXS A;  1ALK A;  2W5T A;  5GOV A;  3T02 A;  5L0E A;  2G9Y A;  4NWJ A;  2W8S A;  2IFY A;  1AJD A;  4LR8 A;  1N2K A;  4MHX A;  3NKM A;  4MIV A;  5LQQ A;  1E3C P;  1EI6 A;  4UPL A;  1N2L A;  3LXQ A;  4GTZ A;  1ELX A;  5GRR A;  2W5V A;  3M8W A;  1KHK A;  1ZEB A;  5LIA A;  3M8Z A;  1EQJ A;  2W5X A;  2ANH A;  5LRM A;  3UO0 A;  3B5Q A;  3Q3Q A;  1KH9 A;  5TJ3 A;  4UOO A;  4B56 A;  3NKN A;  4KJG A;  3UN2 A;  3WAV A;  4LRE A;  1P49 A;  4LRB A;  4UPH A;  4LR7 A;  4LRC A;  1AJA A;  1ZEF A;  3MK1 A;  3TWZ A;  1KH7 A;  2D1G A;  3DPC A;  5EGE A;  5LRN A;  1SHN A;  4UOP A;  4CYR A;  4ZG6 A;  4FDJ A;  3WAX A;  4CYS A;  3IGY B;  3BDH A;  4QAX A;  1ED8 A;  1K7H A;  4NWX A;  1ALH A;  1URB A;  3UN3 A;  3WAY A;  3WAW A;  4ZG9 A;  1FSU A;  1URA A;  2GLQ A;  4LRD A;  3IDD A;  3NKR A;  4LR2 A;  4KM4 A;  3NKO A;  3UNY A;  1EW9 A;  2W5W A;  2W8D A;  3A52 A;  4CXK A;  3MK2 A;  5K4P A;  4MY4 A;  1Y6V A;  5L0K A;  1ALI A;  4GTY A;  1AJC A;  1KH5 A;  5EGH A;  3UN5 A;  4N7T A;  3TX0 A;  2QZU A;  2W5R A;  4GTW A;  1ANI A;  2X98 A;  5IJS A;  2W5Q A;  1E1Z P;  3DYC A;  4LR9 A;  2W5S A;  3ED4 A;  3NKQ A;  1EW8 A;  4LRA A;  4ZGA A;  1AJB A;  3SZY A;  2GSN A;  1SHQ A;  3M7V A;  5IJQ A;  2XRG A;  1ELY A;  4KAV A;  4UPI A;  3MK0 A;  1HJK A;  1O99 A;  4YR1 A;  1KHL A;  3M8Y A;  2VQR A;  1Y7A A;  3BDG B;  1HDH A;  3TG0 A;  3NVL A;  2RH6 A;  5KXA A;  2GSU A;  3CMR A;  5L0B A;  1EW2 A;  2GA3 A;  3NKP A;  3WBH A;  4LRF A;  5C66 A;  2GSO A;  5DLT A;  4GTX A;  5DLW A;  3E2D A;  1E33 P;  3T00 A;  5INH A;  2IUC B;  1EJJ A;  3KD8 A;  1ED9 A;  2IUC A;  4KAY A;  5HRT A;  4ZG7 A;  1KHN A;  4FDI A;  4TN0 A;  1KHJ A;  3BDF A;  1ALJ A;  1ZED A;  4CXU A;  1HQA A;  5AJ9 A;  1KH4 A;  2XR9 A;  2ZKT A;  1ANJ A;  1O98 A;  1B8J A;  3T01 A;  3IGZ B;  5DLV A;  3SZZ A;  3BDG A;  1E2S P;  1AUK A;  4UOR A;  4KJD A; 
#chains in the Genus database with same CATH topology
 2C28 A;  3PKM A;  1GMU A;  3I0S B;  3W9I A;  4GVB A;  4O0N A;  4UST A;  2XY5 A;  2B4O A;  1JJC B;  4DV4 J;  2DCL A;  2JLF A;  3BSC A;  3W64 A;  4KFB A;  3KLV A;  2GX8 A;  3MTK A;  1ZEF A;  1UPP A;  2YKA A;  3DPC A;  3DCA A;  4CYR A;  3KLE B;  1VBK A;  1HQE A;  5HQ8 A;  2LEB A;  2VG5 B;  2HK3 A;  2K7K A;  1KQK A;  1CPZ A;  1HMV B;  3PY8 A;  2JRS A;  2VOD A;  1T7P A;  1ALI A;  2DGW A;  3GJS B;  4HYK A;  3D1Q A;  4OV1 A;  4HT7 A;  4E98 A;  5C25 A;  1VIS A;  2DEJ A;  1WG1 A;  2BXJ A;  3AB2 B;  5B08 A;  2DB1 A;  1RAD B;  1G6B A;  2O66 A;  1HHQ A;  3KJV B;  1K1Q A;  3TG0 A;  4TQS A;  2PEB A;  4JOU A;  3PZP A;  3C16 B;  1HBM B;  1Y5L B;  3T00 A;  2OPQ A;  4NLG A;  3HHD A;  3JQK A;  1C2P A;  2RRB A;  3QGI A;  2VH7 A;  1JLG A;  3W8G A;  2ZDO A;  5AE2 A;  3ET6 B;  3QIP B;  4NCG B;  1AT1 B;  3QGH A;  1U2F A;  2ZZN A;  4GRS A;  1X4A A;  2DKO B;  5K20 B;  2QLW A;  3IO1 A;  2VQE J;  4MHX A;  3GYG A;  3B5Q A;  2V50 A;  4LFC J;  4K5S A;  3GON A;  4U7C A;  4DG1 B;  2F8E X;  5T41 A;  1F9E B;  4U9R A;  1S0M A;  1B99 A;  4ETZ A;  1B0P A;  4ZPD A;  2AYG A;  2YNF A;  3LQV A;  2AD9 A;  3VAK A;  4M5D A;  4LIR A;  2FVC A;  1UFK A;  2CQD A;  3MPY A;  2XLK A;  4V1A k;  2JDJ A;  2BQ3 A;  3ZZZ A;  3ILJ A;  2LCW A;  3MPD A;  3HPO A;  4DSE A;  1R8B A;  5GAD U;  3QAU A;  4ETX A;  2H65 B;  2YNG B;  2R8J A;  3HUL A;  2DGV A;  3DDN A;  5KG6 A;  1NJW A;  4I1T A;  5DS7 A;  1NH7 A;  3TJ9 A;  2ZM6 F;  2GFF A;  4DCJ B;  3M6U A;  3F0N A;  5KT6 A;  4B3T J;  5IS2 A;  3CJ2 A;  2HND A;  3ZTP A;  1ZPV A;  1SV5 A;  4QWD A;  2IPO B;  3LAM A;  4ZN3 A;  4KHP F;  3GIM A;  4JI5 J;  5F8J A;  1DQ9 A;  2DR9 A;  1RTD B;  1PBA A;  2F8M A;  4CZC A;  4IG0 B;  1HW9 A;  1I1G A;  1BUX A;  4IYQ A;  5KFA A;  2CQ3 A;  2XS7 A;  2U1A A;  1OSC A;  3TJ8 A;  3DLG A;  5DDP C;  2F3J A;  2C2D A;  4O3S A;  1UA0 A;  3BGR B;  2MKJ A;  2HHH J;  3NLC A;  3IRX B;  4M5J A;  4A8O A;  1MLA A;  1NDK A;  1ARO P;  4X66 F;  4L74 A;  2KM8 C;  2E5H A;  4YR0 A;  3EE3 A;  2VIC A;  1VQ7 S;  4A4J A;  4Y00 A;  9ATC B;  5EWE A;  1KTV A;  3KWM A;  4DZD A;  5K8O A;  2A18 A;  3M30 B;  3AD7 C;  1UWA A;  2DNY A;  1X7V A;  2MZJ A;  3UD3 P;  2KKH A;  1H2U X;  2B4V A;  3EGW B;  4IO1 A;  4OHY A;  4DR1 J;  4FKY A;  1RZM A;  4PQU B;  1VOM A;  4LJM A;  2FTR A;  2CDR B;  1T05 B;  3KLG B;  3M2U B;  3GIK A;  1XBW A;  4CLF A;  3TOQ A;  5KAK A;  4UQT A;  4YY3 J;  1QUP A;  3V6D B;  1KLM A;  3THP A;  3MMB A;  4IUF A;  4KV8 B;  4ANC A;  2JNJ A;  2GLQ A;  5KT4 A;  1ZYQ A;  3UDL A;  1HBO A;  3T9N A;  3DKD A;  4NE9 C;  2DNH A;  4Y28 C;  2Y3Y A;  5LMU F;  2ACY A;  2HYI B;  3L7O A;  2I2Y A;  2AYE A;  1S1V A;  4GVL A;  3MK0 A;  3PRD A;  1Q86 T;  2PMW A;  2HBZ B;  3PIP Q;  1IVZ A;  1DFD A;  2QT7 A;  3TUZ C;  3RZA A;  2RU3 A;  5KT7 A;  3NCQ A;  1FTR A;  3IS9 A;  1TFY A;  1TKD A;  4FN5 A;  2X1F A;  1WEY A;  1RTI B;  3CB4 A;  1SQE A;  3Q2T C;  1JKH B;  1T03 A;  1HAR A;  4DR6 F;  2EBE A;  1WSR A;  3THV A;  3K2Y A;  3OUY A;  1HYS B;  2MHE A;  4M95 A;  3KLF A;  1M5V C;  4GO5 X;  1KS2 A;  3CIZ A;  5D8H B;  1EAY C;  1OS5 A;  2E1C A;  1PC5 A;  1S6P B;  1HKA A;  4IO9 Q;  1CJT A;  2C2O B;  3PCO B;  3W61 A;  2V69 A;  3LP2 A;  4H4M B;  4PWD A;  4LRB A;  1CJU B;  3WIU A;  3TWZ A;  1NH8 A;  4MK8 A;  2MQM A;  3TO8 A;  4FXD A;  3A12 A;  3HF5 A;  3K17 A;  1Q4R A;  1NZ8 A;  2ZHO A;  2ZH9 A;  1YTY A;  3KNG A;  1FRH A;  4JV2 A;  4ZHR A;  1FRI A;  2PII A;  1UA1 A;  3WX8 A;  2G0C A;  1MN9 A;  2KM8 B;  2FIU A;  4OYB A;  3M1V A;  2GJI A;  2OFH X;  4O4G B;  1U4B A;  3NVL A;  4OLP A;  1KHW A;  5DLF A;  5KFV A;  1FRJ A;  4A8Y A;  4CIO A;  3CUL A;  4DZ6 A;  1E33 P;  3H40 A;  1X9S A;  4LF9 J;  3PV8 A;  2X51 A;  2D9O A;  1VIO A;  2UVV A;  1G1X A;  4I4B A;  4GKK F;  1JLE B;  1KOO A;  5G0R B;  2J7U A;  2CJK A;  2FJA B;  1TFW A;  2OTL S;  2HGL A;  3JTP A;  2BEF A;  5EDW A;  4CCH A;  3IBF B;  1QLN A;  3TX8 A;  2YKM A;  3NMR A;  1I3O B;  3VAJ A;  2IFY A;  3AT1 B;  2HRU A;  1N36 F;  4XDD A;  3PRB A;  2I38 A;  1X0F A;  5I42 B;  2V8H A;  4UUX A;  2BYC A;  2ZBR A;  2KB2 A;  3IAS 9;  1SQF A;  4HHU A;  5KFK A;  2C2K B;  3W1Y C;  4ZCL A;  2CYY A;  5J1E A;  3ETO A;  4EEY A;  2HS3 A;  3DMJ A;  1RKJ A;  5KFU A;  2OEJ A;  4OX9 F;  4C8M A;  2B7B B;  2VZ9 A;  3NL0 A;  3FCH A;  1RKI A;  3CJ3 A;  3K0J A;  3L3C A;  4BS2 A;  5A8K A;  1JNR B;  3SCK E;  4J9S A;  5E0O A;  4EBD A;  2XSF A;  5AXN A;  3NWG A;  1YJV A;  2KFY A;  4X62 J;  2W9C A;  2ZNY A;  1X0P A;  2J0W A;  1BQM B;  4UOC A;  5CH7 B;  3MM8 B;  1WHV A;  3MFI A;  3RAQ A;  2BAN B;  1HBM A;  3HP6 A;  1RT6 B;  4RW6 A;  1JX4 A;  1OY9 A;  5KFI A;  4F67 A;  4JI0 J;  1EQJ A;  2POK A;  4TXS A;  1AFJ A;  3MGJ A;  2BAC A;  3CDB A;  2N3L A;  4NCG A;  2OSQ A;  3MHY A;  4OI0 A;  1SHN A;  1WC1 A;  3T41 A;  3H25 A;  3AFG A;  4P9S A;  1JXL A;  4PG4 A;  3T1H J;  2KXH A;  4IH5 A;  5HQM A;  1Q79 A;  3U7J A;  2JSX A;  4HT5 A;  2DNQ A;  1BLU A;  4B02 A;  1UP1 A;  3QJP A;  3D7S B;  1ULR A;  4O23 A;  2H5J B;  4P74 A;  3EGV A;  4JV1 A;  2E5L F;  4M94 A;  1RT4 B;  2XMJ A;  1A0O B;  4KBI A;  1YJ9 S;  1FK9 A;  1D0E A;  2XCP A;  1NHU A;  3MPU B;  4PCQ A;  4NX9 A;  2HRT A;  3P8B B;  2ILZ A;  2V9W A;  4ZLP A;  4NLS A;  4FS2 A;  4TU9 A;  2F7V A;  2E5J A;  1RAF B;  3RR8 A;  2GGP B;  1ELZ A;  3LW5 C;  5GOV A;  5A8W A;  3JSR A;  4RBV A;  1MRO B;  2CNO B;  4PXB A;  4JV5 J;  2XUL A;  3KKF A;  2NPF A;  1TR0 A;  3IR5 B;  1KR4 A;  2HMI A;  2YTC A;  1F5A A;  4B17 A;  4LT6 A;  4LRE A;  2B56 A;  1FKP A;  2JLE A;  2XHC A;  2HW3 A;  3PFO A;  1NJX A;  4OI1 A;  3F56 A;  3D4J A;  5HVG A;  5KFR A;  2PSZ A;  1F6T A;  3VCD A;  1O6X A;  3W5Y A;  2WB4 A;  1MU2 A;  2I9S A;  1SHQ A;  3DDK A;  3QO9 B;  1RGV A;  6AT1 B;  3BKF A;  2QYC A;  4O3O A;  3P45 B;  1P9Y A;  1RA6 A;  3HX9 A;  4B9V A;  1YZ7 A;  1URN A;  3FNN A;  1HNV B;  1VC5 A;  4OZ0 A;  3M8S A;  5K5M A;  2WVC A;  4R0J A;  1CG2 A;  2ERR A;  3IRX A;  2A6O A;  3QJL A;  5MAO A;  1DTQ A;  2E29 A;  4CNY A;  4DV2 J;  4YB7 A;  2BKP A;  3GR0 A;  3PYD A;  4OHV A;  2WVF A;  3MM7 A;  1TKT A;  3MAA B;  1RT2 B;  3CCZ A;  3C3L A;  4M8L A;  3NNA A;  3GZ7 A;  3M4X A;  1X4B A;  3H90 A;  3M30 A;  2LDI A;  3NEK A;  2C2N A;  1LEO A;  2YNI B;  3EWG A;  1RWV B;  2E9T A;  3PEJ A;  2FLO A;  2QFI A;  1QAY A;  2XYG B;  4K7Q A;  2GMH A;  4UQG A;  4PQU A;  1WF0 A;  1X5P A;  1ZAX A;  5HBM B;  1T05 A;  4UOG A;  2MQP A;  3CJQ A;  1ZZN A;  2JEI A;  1DJ0 A;  2BBE A;  4AYB D;  4KV8 A;  5ITH A;  2FJX A;  1FXD A;  3AAW B;  2GIF A;  3OFH A;  1PCA A;  2OEL A;  3D5M A;  3SSR A;  3ZFV A;  1RTJ A;  3GG1 A;  4N47 A;  2XMA A;  1VBX A;  3I56 S;  5GME A;  5H1S V;  2IMW P;  2RQK A;  3D9B A;  2IC3 B;  4KY3 A;  1B7Y B;  2ZH1 A;  4QW8 A;  1VFJ A;  2A0F B;  1B64 A;  4J9Q A;  4DF4 A;  4KKO A;  2M9K A;  1U26 A;  1RTI A;  2FJE B;  4Y2K A;  4CP5 A;  5KG2 A;  3TQ1 A;  3ADA C;  1RAJ A;  1E6Y A;  2R7S A;  3SEO A;  2FB0 A;  1URB A;  5CCM A;  1NPK A;  4WXO A;  3BKT A;  3DLK B;  5GMK a;  1FVQ A;  3BO2 A;  3A1Y G;  1M5S A;  3PYF A;  3ITH B;  2HHT A;  2LQ8 A;  4ERD A;  3NAH A;  5DG7 A;  3OD2 A;  4HL9 A;  4PXE A;  2AU0 A;  2DTJ A;  2LQB A;  2KL8 A;  3QBC A;  2MKI A;  1FRK A;  3CO9 A;  3O2I A;  4I6W A;  1WEL A;  4NZ6 A;  2RQ4 A;  4YQW A;  2RML A;  3M8Q B;  1N5Y A;  4RUB A;  1MWZ A;  1JLA B;  3V5R A;  5IT4 A;  2VG6 B;  2ZJQ Q;  5IT0 A;  1M5P C;  5IC6 B;  3HD1 A;  3BO3 A;  3OV7 A;  2RJZ A;  3ELH A;  5LRM A;  1NB2 A;  4DV5 J;  2R2T A;  5TJ3 A;  2D9P A;  4QPT A;  1K44 A;  1TU0 B;  3MK1 A;  5HMX A;  1D9F A;  2MY8 A;  3C46 A;  1AXQ A;  2YY3 A;  3W5X A;  2ZKU A;  2YWW A;  2PE8 A;  5G4D A;  3RUB L;  4URS A;  1RBO B;  2LQJ A;  3E01 A;  4ICL B;  4DFJ A;  3VR1 A;  4MFB B;  2D3Z A;  2LMI A;  2GC8 A;  4ED3 A;  1PO6 A;  5I42 A;  4LRA A;  1U8S A;  5J2M B;  1IBK J;  4YN3 B;  2NZ4 A;  4IR9 A;  1M1G A;  1VCT A;  5DET A;  1LW2 B;  2AYB A;  1RWW B;  5F9N A;  4DSF A;  3OTO F;  1PKU A;  1IKX B;  3G4S S;  5JXS A;  3R5A A;  4MK9 A;  4WYL A;  2N82 B;  3V6J A;  3QZ7 A;  4OX6 A;  4TN0 A;  2DGU A;  3EGN A;  3MCM A;  3MUM P;  2MB0 B;  1J5O A;  4DV0 F;  3E51 A;  1FJ7 A;  3MFH A;  3Q23 A;  4CH0 S;  2FHJ A;  5KFM A;  3RU0 A;  3P49 B;  4CM0 A;  3CCW A;  5EWF A;  5ETM A;  5KFW A;  1HI0 P;  4RLE A;  1LWF B;  4DR3 J;  3I4P A;  2FJB B;  2W9B A;  2QSF A;  1C1C B;  5JMN A;  2ATC B;  4MH8 A;  3NKO A;  3D3B J;  5KFH A;  4X65 J;  1I6J A;  3THT A;  4JI3 F;  4AT1 B;  3GCW P;  1N5V A;  3I4H X;  3BBC A;  3QGG A;  4C98 A;  4B08 A;  2FYX A;  2DNK A;  1DRZ A;  2Y1R I;  4U8V A;  2MLX A;  5IM0 B;  3BDG B;  2SXL A;  3CNQ P;  5DLT A;  1H3D A;  2YPY A;  4Q8E A;  1D8Y A;  1Y5I B;  5D0G A;  2NS1 B;  1O8B A;  1XTZ A;  3PW4 A;  1S9E B;  1OQ3 A;  4W4M A;  2UUA F;  3RBE A;  3UNG C;  4Q44 A;  4CYU B;  1S7I A;  4QIW D;  2ALZ A;  4KH1 B;  4X4U A;  3HSJ A;  2ASY A;  4ZLL A;  3CC2 S;  2HWH A;  3K7R A;  2JFD A;  3M8W A;  1WWH A;  3HCX A;  5J2N A;  1SH2 A;  2M4M A;  5KFB A;  3KK3 A;  2QA2 A;  2Q66 A;  2UUW A;  3GWC A;  2YNH B;  2GGP A;  4N76 A;  3I0R B;  1GH8 A;  3B54 A;  2DBB A;  1MRO A;  4J91 A;  2ZWP A;  4WFA Q;  1J2V A;  3UI3 A;  1FRL A;  1URR A;  1T02 A;  5L0K A;  3BR8 A;  1DUR A;  3CF5 Q;  1NM2 A;  2XMM A;  2QMW A;  4C0O C;  1WC5 A;  4G3I A;  4QIE A;  3ICL A;  3RGI A;  4KH0 B;  1U1K A;  4ED1 A;  2YKN B;  4C7Q A;  5HMY A;  2ZVS A;  2GZO A;  3GFH A;  4TQR A;  5INH A;  4ZA1 A;  4ZPV R;  3JSY A;  2OUG A;  4Q0B A;  4NLD A;  2J6S A;  4G1I A;  4RL1 A;  1HNX F;  1ANJ A;  2RF2 B;  3B4D A;  1VHI A;  2VFV A;  4BWM A;  4ZK7 M;  2W1B A;  4WFB Q;  5D0H A;  1XEZ A;  1O51 A;  1K8A T;  2CNL B;  1NXI A;  2YX4 A;  3BB5 A;  1RE1 B;  2FJV A;  3PO4 A;  3MR5 A;  1APS A;  5D4P A;  3PG9 A;  2RQC A;  1YRT A;  4DV4 F;  1R31 A;  1YRX A;  2BJ7 A;  4LR7 A;  3ISN D;  2YPZ A;  3QYY A;  2BOA A;  4ZIW A;  2XNR A;  5CD4 A;  2OPS B;  1SCJ B;  3G8S A;  3P96 A;  1OY8 A;  2HHX A;  1PBU A;  3MCN A;  4FS1 A;  1S12 A;  4GTY A;  4HAC A;  2J7K A;  1CJK B;  3NGD A;  3CPW R;  5KG3 A;  5IJQ A;  1U1L A;  3PFE A;  3TP2 A;  4NLX A;  5J1N A;  3W65 A;  1WTB A;  5K8N A;  5IT9 U;  2KG1 A;  1SXL A;  2CZ9 A;  4QWA A;  2MLY A;  2IDL A;  2W01 A;  3S01 A;  2UZA A;  5DO2 A;  1ED9 A;  2QSW A;  1YJ7 A;  2ZC4 A;  3KJF B;  3CDE A;  3H59 A;  2XS5 A;  1IXK A;  4CT9 A;  1EIY B;  4UY8 T;  1NPP A;  5HAT A;  1ZPW X;  2J9D A;  4HDG A;  3RG6 A;  3Q89 A;  3D0H E;  3R5D A;  1BQN B;  4YHH J;  3C14 B;  3VAM A;  2DXD A;  2VV5 A;  1VQS A;  1UVJ A;  2VQE F;  3U1M A;  3P5B P;  3ZC4 A;  2C2Z B;  3W3S A;  3HHL A;  2R42 A;  1SC6 A;  1M1K T;  4AL7 A;  5BYQ A;  4LFC F;  5JUM A;  1CBK A;  3G2X A;  1Y10 A;  3KOA A;  3D0I E;  4ES3 A;  4RUC A;  2AGP A;  2FJD B;  4L6V 3;  2RHS B;  3CO0 P;  3CXC R;  3D6F B;  1UTA A;  5LSR A;  1P9Q C;  1WOS A;  2VJV A;  3UD4 P;  3ILI A;  4FVM A;  3FZ2 A;  5HJX A;  4I6A A;  3HVW A;  2ZBQ A;  4TYB A;  2MTL A;  2VBW A;  5HJY A;  4RJV A;  3RJM B;  4UZC A;  3OVA A;  4DI6 A;  2IUC B;  4X4S A;  4WJB A;  3ETM A;  2UVR A;  3BDF A;  1KTQ A;  3FCV A;  1RWU A;  2ZH2 A;  3ITH A;  5T7L B;  1S9G B;  2KT5 A;  2HFU A;  2CJY B;  3C66 A;  1S5Z A;  4B3T F;  1ALK A;  5C42 B;  5L1I A;  3CJ4 A;  3JYT A;  4DR7 J;  4ZVG A;  3RW7 A;  4IDK A;  3H7H B;  4IQM A;  3BYP A;  3AA9 A;  3LXQ A;  3M8Q A;  1IQZ A;  3TAP A;  2M7S A;  3VGV A;  2VPY B;  3DRS A;  4RNN A;  4JI5 F;  3TVZ A;  2K7J A;  3ISZ A;  2FVR A;  3R6G B;  5HI7 A;  4QU6 A;  2R2R A;  4J9R A;  1RAI B;  1R89 A;  5C2G A;  4Y6I A;  4PKD B;  1K0T A;  3BEG B;  3WBZ A;  4DPW A;  3M6V A;  3CUN A;  2J6U A;  2HVH A;  2HHP A;  1GTH A;  1AA1 B;  3C8Y A;  4J9U E;  4QYR A;  2RIL A;  4OIX A;  3UPF A;  3CCJ S;  3C15 B;  1C1B B;  4DDF A;  4UW2 A;  2W7A A;  2BMB A;  3ZZP A;  4B3M J;  2DXF A;  3SBM A;  2HHH F;  2B4P A;  3WZ0 A;  2GA3 A;  1G2E A;  3LO3 A;  2GVZ B;  4OYM A;  1WKJ A;  2IJN A;  1NAQ A;  5K14 A;  1YZ6 A;  3CDU A;  1HW8 A;  3CJR A;  4PUO B;  1NUE A;  1T9Y A;  3K5O A;  2W8K A;  4P7T A;  3FQL A;  4FF2 A;  1LW2 A;  2Z2Y B;  3UR3 C;  4ZVT B;  3DLE B;  3PVX A;  4NMX A;  3DRP B;  2DIT A;  2W8S A;  3LAK A;  4O3R A;  3QPI A;  3ZO7 A;  1MMN A;  1KLN A;  3V4I B;  3WQP A;  4BC9 A;  2GO8 A;  2CQH A;  3NGU A;  3KLI B;  1QAI A;  4DR1 F;  3B6B A;  2WRM A;  3CCM S;  4KJG A;  2Z2Z A;  1LK7 A;  1HPZ A;  3GTY X;  3W63 A;  3K8W A;  2KH9 A;  4C4W A;  1U49 A;  2CPD A;  3LF0 A;  1N56 A;  2BM0 A;  5KG0 A;  2R8H A;  2AV5 A;  3RB3 A;  5B0G A;  1S1W B;  4CTA B;  4LR2 A;  4YY3 F;  3JTO A;  1SL2 A;  3RRK A;  1L3V A;  1Y6V A;  2XI2 A;  1NME B;  1OSD A;  4K0K J;  1YJU A;  3DN9 A;  1UJ6 A;  4UOF A;  1U1R A;  3UDV A;  3TVK A;  4DWI A;  2DR8 A;  3NKQ A;  4KO0 A;  1LWF A;  5F41 A;  1I51 B;  4DPO A;  3GG0 A;  2NYI A;  4FNI A;  3HO1 A;  2CQB A;  1FX4 A;  1GMW A;  4M5N A;  2AJF E;  4ZVS B;  2C2R A;  4L75 A;  3QFW A;  1U0H B;  2IA6 A;  3IMQ J;  5CHC B;  3DOL B;  2CZ4 A;  1W7W A;  3RBZ A;  2G2Y A;  3G87 A;  3QID A;  5E5N A;  1Y9O A;  2YWH A;  4F4Z A;  1XMO J;  1HQA A;  1TV6 B;  4DL2 A;  4TY9 A;  5EX0 A;  2XMK A;  3BDG A;  1ICE B;  3K5L A;  4B3R F;  2B6A B;  2M52 A;  3IFE A;  1ZM9 A;  4IRK A;  1HWL A;  4JI6 J;  5LT5 A;  3R1L A;  4L3K A;  4F50 A;  1S9E A;  1YVF A;  5DDR C;  2D3U A;  3S6E A;  5CYM B;  3A4T A;  3WDO A;  5I3U A;  2RDD A;  1Q5Y A;  2WON B;  4QU7 A;  3KK2 B;  5AE3 A;  2HQI A;  3TA1 A;  3C6T B;  1RK8 A;  3U1L A;  4J9P A;  3MAQ A;  1A9N B;  4FXW A;  1WAC A;  1WG4 A;  2MZ1 A;  4XO0 A;  4L72 B;  3LA0 A;  1F3F A;  2GSN A;  2QTW A;  1GT8 A;  3MM6 B;  1HI8 A;  2RNE A;  4IH6 A;  4ZPC A;  4YR1 A;  3DXB A;  2JZ5 A;  3PTW A;  1S0O A;  2DD8 S;  2F63 A;  4X4P A;  3POT A;  5A2Q U;  1CQN A;  4OYI A;  2NYH A;  2C3P A;  5J2Q A;  3IP0 A;  3MF5 A;  5BXI A;  3UCU P;  4RO0 A;  3MUR P;  4LF9 F;  5ETO A;  3E2E A;  4OLO A;  2N4C A;  3SCL E;  1W26 A;  5A0Y A;  2P9C A;  4LF6 J;  4P2S A;  2CG8 A;  2QN6 B;  1AJD A;  2FGC A;  3W2W A;  1NU4 A;  2LP4 A;  4DFP A;  1XMQ J;  2HVI A;  4Z7C A;  5D0R A;  1T11 A;  4PYA A;  4CLP A;  3Q0A A;  3MMA B;  2BAB A;  4FP9 A;  1DTT B;  2E1R A;  2L9D A;  5IC4 B;  4Z37 A;  4A8W A;  2OP5 A;  4DV6 F;  1M0S A;  2YKP A;  1RT5 A;  4CLW A;  3MR2 A;  1KFS A;  1RT3 B;  2XEX A;  4J37 A;  3UD5 A;  4NZ7 A;  3N28 A;  4DX6 A;  1RYS A;  1HL6 A;  4CLZ A;  2V63 A;  2KO1 A;  1IM6 A;  3DHX A;  2Z2L A;  5KG4 A;  2AEF A;  4NXM J;  2W9A A;  1OPI A;  1XN9 A;  3KK1 B;  2V4J B;  2PGC A;  4ZIV A;  3A8K A;  1EW2 A;  1WNE A;  3HMJ G;  2PC6 A;  4GTX A;  4YB1 P;  2XMT A;  4P72 A;  4S0M A;  1EET B;  2EI5 A;  1ZM4 A;  1ZTT A;  5DM7 Q;  1S1X B;  1VRT B;  1FDD A;  1CQM A;  2HFN A;  4X62 F;  4LF5 J;  4WU2 A;  3I31 A;  2UUC J;  3GV5 B;  2FY1 A;  3IM9 A;  4G1P A;  5B7W A;  3WHI A;  1S0N A;  2RKI B;  4GKJ J;  4ILR A;  3LWM A;  2ZE2 B;  5LSL A;  3IG1 A;  4CRJ A;  2VC0 A;  1S9F A;  4JI0 F;  1RI7 A;  3FFI A;  2NSC A;  4OYO A;  2CNN B;  4RU9 A;  2BRL A;  2CJX B;  3SZ2 A;  1M5H A;  3ONQ A;  1QSY A;  4YDX A;  2M8D B;  4M5K A;  2XZW A;  3T1H F;  2UV8 G;  2MZS A;  1NSA A;  4O3N A;  4NML A;  1VQY A;  1BWV A;  4IFV A;  2K3K A;  2HRY A;  3GU0 A;  2VQF J;  4F3M A;  4ZN1 A;  3WC0 A;  1U1N A;  4EK2 A;  4C8Y A;  4FF1 A;  4ED5 A;  4K4Y A;  1GFW B;  3RB6 A;  1QTM A;  2PFD A;  3SXL A;  2AIR B;  4USV A;  5HAO A;  3CCQ S;  3TUI C;  3W9J A;  1FE4 A;  4LSN B;  4EBC A;  2MZQ A;  3H20 A;  3C2P A;  4TVA B;  3D1O A;  4IG3 B;  2FD2 A;  2OFG X;  4JV5 F;  1EB0 A;  2DNG A;  1S7H A;  1TAU A;  2OPP A;  2LU2 A;  4LRD A;  4X2B A;  4Q8F A;  2ZD1 A;  4C8O A;  2R7Q A;  1LWC B;  1RLC L;  4P6Q A;  4USU A;  3GJQ B;  4PRF A;  2P5V A;  5K8M A;  2C42 A;  2BJ3 A;  1JQG A;  3CIM A;  4KAV A;  2ASL A;  4DLE A;  5ADZ A;  1JXE A;  2XMW A;  2WW4 A;  2O01 C;  1QTN B;  2IHR 1;  2W4C A;  5GAG I;  3WBH A;  4WPA A;  2BE7 D;  2MST A;  1VGY A;  4ES2 A;  1KHJ A;  2IRU A;  1C1B A;  2VFS A;  4F0K A;  3VAG A;  3JAM U;  1X4E A;  2YQ1 A;  1FRX A;  2GML A;  1AUK A;  2B7C B;  3HI9 A;  2NCK L;  2V68 A;  2GNK A;  3M6X A;  3TUP A;  4TNO A;  1N2K A;  4DV2 F;  1NDP A;  3BGU A;  4BDP A;  4CO4 A;  3C6U B;  3V81 B;  4PUO A;  2HNZ B;  1LWE A;  2KN4 A;  5F3T A;  3OTD A;  5F0U A;  2LVW A;  1VQ9 S;  1HBU B;  3MMJ A;  4B9L A;  3A3N B;  2A10 A;  5A8R B;  1Q5V A;  2RAQ A;  4K4T A;  2W5Q A;  2E7V A;  5E3A A;  3OR1 A;  4CO0 A;  1E6V A;  3IGV A;  1BHN A;  1Y11 A;  1G7C B;  3DLB A;  4LF2 A;  1KC8 T;  4B9U A;  2HHU A;  2K1R A;  2JX2 A;  3SV3 A;  2A1B A;  1KVK A;  1FD8 A;  2QLJ B;  1S59 A;  4F25 A;  5E41 A;  4YOE A;  3MR6 A;  1FKA F;  3O1L A;  2U2F A;  4LSL B;  4ECU A;  1FDN A;  2QC3 A;  1U0H A;  5E7O B;  2FUG 9;  3OT9 A;  5C24 B;  1ZOT A;  2J8S A;  1HQU A;  1KNZ A;  4URQ U;  4USK A;  1T8E A;  1BWE A;  1XNR J;  3H5U A;  4DBQ A;  4C3M A;  1ELX A;  3ENQ A;  2ZBI A;  2D74 B;  4ZLJ A;  1D9A A;  3JB9 k;  2MQL A;  1NB7 A;  2QA1 A;  4B3O B;  2ZNZ A;  1EKS A;  1XK8 A;  1SJR A;  4F4A A;  3R7N B;  3MEG A;  1F2H A;  2I5J B;  1SKU B;  3N4W A;  4W98 A;  2WOM A;  1F60 B;  1YI2 S;  5KG7 A;  4DL7 A;  1HBN A;  2HHS A;  4F2S A;  4OZ2 A;  3IWN C;  1S97 A;  2ZDP A;  3TZZ A;  1VIX A;  5A6W A;  2JVR A;  3CD6 S;  4RW9 A;  3NKP A;  3EMT A;  3CED A;  1N34 J;  4QJV A;  3G6Y A;  1BMQ B;  3TEG A;  3A3O B;  4P73 A;  4C3K A;  2RVJ A;  2ZH3 A;  2EC0 A;  4WYW A;  2ZC3 A;  3UCZ P;  3KHR A;  1NJY A;  4DL4 A;  1B70 B;  4P10 A;  4FXV A;  2CJ9 A;  4OMF G;  2PMH A;  5D3G A;  2AKW B;  2GVD A;  2R4F A;  3K5P A;  3I6P A;  3LP0 B;  2AGO A;  1FX2 A;  1RT1 A;  2O5D A;  5J2P B;  3EZU A;  4HH0 A;  4C8Z A;  4ECZ A;  1BGX T;  3TAQ A;  4MKV A;  1CSJ A;  4DV5 F;  2AT1 B;  2QO3 A;  2VKZ G;  3TEH B;  2V5H G;  4C9D A;  5SUH A;  1N0V C;  2HS0 A;  1RA7 A;  3GPA A;  3ZTR A;  4CI0 B;  1VMB A;  3CD5 A;  3HZG A;  3G6V A;  5GAG U;  5MLC V;  3DYC A;  3AXK A;  4A46 A;  3BDE A;  1BD6 A;  2R7R A;  3FEY B;  4UZB A;  1RWN B;  2EG2 A;  2E1P A;  1YLX A;  5E3C A;  2AZ1 A;  2KHD A;  2GQQ A;  1IBK F;  3T6B A;  3PHT A;  1JLB B;  3M32 B;  1J5E F;  4E2F B;  2P9G A;  3FK4 A;  2OPR A;  3MM5 A;  5HMW A;  5E3R A;  3GFX A;  3OXF A;  4XPE A;  2IY5 B;  1W25 A;  2Y1L B;  4ID5 A;  3CJK B;  1SJF A;  1UVI A;  4IRC A;  4YP3 A;  1WJ9 A;  1XR7 A;  4M5H A;  4JI2 J;  4R8U A;  2NUH A;  2DNO A;  2BOP A;  5J1P A;  4FZV A;  2BW2 A;  1SBR A;  4Y3C A;  3GCX P;  3WIV A;  2DK2 A;  2IRX A;  2W2P P;  2B8P A;  1VRT A;  4LBP A;  1P49 A;  2BKN A;  5DQH A;  4V19 X;  4ZG6 A;  2EFG A;  3WAX A;  3ENW A;  1K9M T;  1IQT A;  3HFV A;  1LQ9 A;  2B9W A;  3NAI A;  1FSU A;  4LVO P;  3PIO Q;  4C2M A;  2MKS A;  5HMZ A;  4DN9 A;  4DR3 F;  4EMD A;  3CC7 S;  2RKI A;  4ECT A;  1KH5 A;  3MTJ A;  3MUV P;  4OQJ A;  1CJV B;  4GC6 A;  4X65 F;  5HK4 A;  4N5S A;  1KFD A;  4USW A;  4DV0 J;  4MIB A;  4DPT A;  2CVE A;  3BPD A;  1YRU A;  3DM2 B;  3LGH A;  2RUS A;  4NLY A;  2NQP A;  2ZBC A;  4AFF A;  2GSO A;  5C66 A;  1M5O C;  2UVW A;  3KMQ A;  2LA6 A;  2COL A;  2IA0 A;  1C0U B;  4TY8 A;  3R97 A;  2ZZM A;  5SZT A;  4AXJ A;  2JEG A;  1XC9 A;  2OIH A;  2FZK B;  2NXC A;  4ED7 A;  4YS2 A;  2BVZ A;  3TAM B;  3SQG A;  3BQ2 A;  3UCG A;  1IKY B;  1TL7 B;  2XCA A;  1S1U B;  3K59 A;  5F8N A;  5FDL A;  5HP1 B;  1U09 A;  2HS4 A;  1W2I A;  4ZJQ A;  3W8P A;  4IFY B;  2B4U A;  3DYA A;  4N8O A;  2V4R A;  2AJ0 A;  3CCL S;  1YGY A;  1Y3J A;  2VA2 A;  4WP3 A;  3N9U C;  1U6F A;  1S6O A;  3NGR A;  3V6H A;  2F40 A;  1KQS R;  2CIM A;  3UVJ A;  4UUW A;  4ECR A;  4R0E A;  2X3D A;  1DLO A;  4G1Q B;  4OHW A;  2OMO A;  2LYV A;  1JLF B;  1R8A A;  1R27 B;  4U96 A;  2FQQ B;  5EGH A;  4EBE A;  1B4S A;  3IAM 9;  5FJ4 A;  3MCO A;  4PZV A;  3IBC B;  2IVY A;  2EEY A;  4USI A;  1OY6 A;  2JWN A;  3T1Y J;  1X4C A;  1JMT A;  1O5J A;  4NLT A;  5DQG A;  2W8L A;  2FZC B;  1TK5 A;  5CA5 A;  2IM0 A;  3HFZ B;  3Q24 A;  3OFF A;  1HD1 A;  1R7I A;  1IJF B;  1RT7 B;  5L1J A;  2Q1L A;  3W9H A;  2GW8 A;  4DV1 J;  3G86 A;  2XHW A;  5ETP A;  3A8J A;  1MSW D;  1L3T A;  4UPK A;  3MED B;  5HO4 A;  3QGP A;  3NNC A;  5CAA A;  4ZJL A;  2FY8 A;  2DJW A;  4O4R A;  4J9N A;  2BM1 A;  4MT1 A;  1MG7 A;  3KG4 A;  2LQ9 A;  3QFH A;  3P3D A;  2UV8 A;  1H7W A;  2VFU A;  2NXE A;  1XWL A;  4JI8 J;  3HD2 A;  3PJW A;  2HZV A;  2QRR A;  1VDH A;  1T9X A;  4MTP A;  2M70 A;  1HWI A;  2W2N P;  2PO4 A;  1NBE B;  4KB7 A;  3KXD A;  2DH8 A;  5A8R A;  2MKK A;  1S77 D;  3PNI A;  5L0B A;  1NPR A;  3LAN A;  4DL5 A;  4WIQ A;  4P75 A;  6FDR A;  4F4Y A;  3J80 Y;  2MQQ A;  1X4F A;  2DNL A;  4WZQ A;  4OYA A;  1L3K A;  4R25 A;  2VG7 B;  4ITS A;  4R5P A;  3NY0 A;  2CG4 A;  5D4O A;  1VLO A;  3D66 A;  3M8Z A;  4A8X A;  1HR0 J;  1FF2 A;  4YHH F;  1LNQ A;  4UY8 5;  1YQH A;  3OXL A;  1U0S A;  3MD1 A;  5LRN A;  3N01 A;  2DNM A;  5AE1 A;  1X9W A;  2LEA A;  1OYD A;  4DOZ A;  2ZOF A;  3NKR A;  4F3O A;  2W5W A;  1R3N A;  1YBU A;  2HGN A;  2W25 A;  3VWS A;  3ZZR A;  3TYT A;  2APO A;  3HDS A;  1SUQ B;  1RQ0 A;  1UWB B;  4AD6 A;  1DHM A;  4DPX A;  1FJG J;  2P9E A;  2CUY A;  3PW0 A;  1D3W A;  2I5J A;  2HZC A;  2PDA A;  2VPZ B;  2EWH A;  3JSM A;  2X1B A;  2VPX B;  2HQD A;  4QYZ J;  1N5T A;  1IBM J;  4U8Y A;  2DH9 A;  3M05 A;  4PXC A;  2MYF A;  3VAI A;  1JLQ B;  3MMC B;  4ECQ A;  4HI1 A;  2I6W A;  1O98 A;  2HQG A;  1NJI T;  5E33 A;  1TKZ A;  5IV4 A;  1H74 A;  1XNQ F;  2I8E A;  4NWJ A;  1UW4 A;  1YG0 A;  1D09 B;  4NI2 B;  3R5B A;  4DR7 F;  1CC7 A;  4I7F B;  2D3O R;  5KFO A;  4A8Q A;  4HTI A;  4CQ1 A;  4OYW A;  1RAE B;  3VQS A;  5L39 A;  3Q8U A;  4ZPA A;  2JFK A;  3DOK A;  1TVR B;  4BBY A;  3G71 S;  2AX0 A;  8AT1 B;  2BJE A;  3M9N B;  2BJD A;  2HQC A;  5EX3 A;  1G4C A;  3MD3 A;  4CDI A;  3CD0 A;  2B5J B;  1ACM B;  4LF7 J;  3I55 S;  1RWK B;  2KRB A;  2HQF A;  4Q2L A;  1SKW A;  3I87 A;  4K4U A;  4NOH A;  3M2R A;  1GMW D;  2KI2 A;  4OJH A;  1SVD A;  2JC1 A;  2XWY A;  3EM1 A;  1CS4 A;  4NYO A;  2MJN A;  4B3M F;  4QR1 A;  3CCV S;  3BKU A;  3K5N A;  2L9N A;  3R2D J;  4C48 A;  5ETQ A;  3NMA A;  5DZ6 A;  3W66 A;  4B9M A;  1JK9 B;  3GSD A;  3LP1 A;  2AJ1 A;  3W2V B;  3SZZ A;  5DQI A;  3FQK A;  2L41 A;  3M32 A;  3HVT B;  3M2V B;  1V9O A;  3EZ5 A;  3NRB A;  1EI6 A;  3M8P B;  1M5K C;  2H54 B;  1MN7 A;  4RW8 B;  3KDN A;  4M5L A;  4Z7Y A;  2ZH6 A;  2CAJ A;  2IM1 A;  1RAO A;  4LFA J;  1FDB A;  3DGV A;  1U25 A;  4RNO A;  2QJ3 A;  2J9E A;  1QE1 B;  3GE9 A;  1TUW A;  1AJC A;  1S1T A;  4JI7 J;  3EXC X;  4WKY A;  3TA0 A;  3HT3 A;  4PXD A;  3N5F A;  5KT2 A;  2YX7 A;  1QSS A;  1XR5 A;  3MM9 A;  2XYH B;  4K0K F;  1WDT A;  5EN1 A;  1P1T A;  4MAK A;  2F8H A;  1MNE A;  4O3Q A;  2HLT A;  5C5J A;  4JI1 J;  1H72 C;  3HFK A;  3PX0 A;  3RAX A;  1WOP A;  1H2T Z;  4OI4 A;  1ZA2 B;  3TAN A;  5F8M A;  1R0A B;  2KZM A;  4J9V A;  2YWE A;  3OFE A;  4CWB A;  1U6Z A;  2RIJ A;  1XMO F;  4PG8 A;  5L0E A;  4P52 A;  1VQL S;  1N6Q B;  4GTZ A;  2V2Q A;  3ZXW A;  2EK1 A;  4NWB A;  5KFS A;  2B9E A;  4IRD A;  2LXI A;  2BKO A;  2HWT A;  2LQ5 A;  3TAM A;  2FC9 A;  1IKY A;  1TL7 A;  2B9X A;  3V2U C;  4JI6 F;  2IM2 A;  2ALY B;  3UR0 A;  3AD9 C;  5LL6 d;  1ELO A;  4IOB A;  3N6L A;  1IKV A;  5HVF A;  1Y5N B;  3I5A A;  3OLB A;  1VJW A;  1NDL A;  3VVT A;  4XAK A;  4I2P B;  1AW0 A;  2ZH4 A;  1N54 B;  3TA2 A;  5CYQ A;  3Q22 A;  2BX6 A;  4B3R J;  4G1Q A;  1RHK B;  1RCX B;  1FHT A;  3EVM A;  2XWX A;  5KFN A;  4CLK A;  5HLF A;  4C11 B;  5F8L A;  2MGZ B;  3HZE A;  2VD3 A;  4GC7 A;  3DOM A;  2CWX A;  4C97 A;  2CPI A;  4Q45 A;  4GO7 X;  2I1R A;  4OYZ A;  2P8I A;  4UOR A;  1TMJ A;  3BRE A;  4ZVE A;  3TZX A;  3GYN A;  3BQ1 A;  4Q7A A;  5T14 A;  2G4B A;  4LFB J;  4CM2 A;  1UFL A;  3IRW P;  4LF6 F;  3KHG A;  2E7W A;  3MEC B;  1CEZ A;  2QEX S;  3UQS A;  2NRE A;  4QW9 A;  1HNI A;  1XMQ F;  4B9N A;  2BRK A;  4PG6 A;  1RWP B;  1U1Q A;  2QGF B;  4DCO B;  1VI7 A;  4UTG A;  5I3P A;  4ZPT R;  2L08 A;  4FBU A;  3UNY A;  2HSE B;  1S6Q B;  3G82 A;  4NLU A;  4RNM A;  1Q0N A;  3EVW A;  4AND A;  2OGU A;  2CQG A;  1YX2 A;  2V2K A;  1D1U A;  4DQS A;  1S48 A;  1N33 J;  2ROG A;  1ELY A;  1O0P A;  2M8H A;  2IAJ B;  3W5Z A;  5KT3 A;  2GHV C;  4M5M A;  2BE2 B;  2HNY B;  1NK9 A;  4NXM F;  5IFM A;  4Y65 A;  4WE1 B;  2O3D A;  3JXO A;  4H4O B;  2DHH A;  4Y2C A;  3DRR A;  1MML A;  1YWX A;  1RP5 A;  2NXJ A;  1VRU B;  4CO2 A;  5DRK A;  2H5I B;  4L76 A;  2R9L A;  2NSB A;  3F73 A;  2UP1 A;  1NHK L;  4DFK A;  3GJT B;  4LQY A;  4DV6 J;  4KGX B;  2CJQ A;  5BR8 J;  3OTB A;  4GVB B;  1OMS A;  1OWX A;  3I0S A;  3HXM A;  2PA8 D;  3UWT A;  2XM3 A;  1MWY A;  4ZCK A;  4LF5 F;  4UPL A;  2R7W A;  1FCA A;  2UUC F;  1X4G A;  5B09 A;  4KFB B;  3PR4 A;  3D6H B;  2J0X A;  3ZTS A;  3UN2 A;  1V5V A;  1YIT S;  2MLZ A;  1T9W A;  3OXG A;  5KFC A;  2CJB A;  3CTR A;  4C6A A;  4GKJ F;  1HQE B;  1XJW B;  3HKZ D;  3IN5 A;  2OAU A;  3KLE A;  3R7S B;  3L4B C;  2ZH5 A;  2VG5 A;  2FPH X;  2BQR A;  1HMV A;  3MCS A;  2MQ8 A;  4V19 J;  5L9N A;  4O0I A;  5C25 B;  3RAM A;  3PM9 A;  1S57 A;  2YWF A;  1VBY A;  3FRY A;  3HT0 A;  4PWU A;  2W7O A;  1ZET A;  2HKE A;  3AOA A;  3KJV A;  3BF4 A;  4KE5 A;  4CO1 A;  3SFU A;  4LUB A;  3C16 A;  2C3Y A;  2OPQ B;  2HGM A;  4KIA A;  2PFF B;  2Y0S D;  2ABY A;  1IKW B;  2VQF F;  4KAY A;  1JLG B;  3HK2 A;  2DNR A;  2DGX A;  2EK6 A;  3UFC X;  2ZKT A;  5ETK A;  1AYE A;  3ET6 A;  1FRM A;  3QIP A;  2Y1I A;  3H5X A;  3Q8Y A;  3D67 A;  4K4V A;  3R5C A;  4DN0 A;  4JV0 A;  5KFF A;  1IWG A;  4MMO A;  5L9X A;  4MJK A;  5AXL A;  3J80 U;  3MMC A;  3BH6 B;  2QLF B;  4MIW A;  5EHH A;  3DI6 B;  1P1L A;  2P6S A;  1F9H A;  1FT8 A;  1FES A;  4HI2 A;  4DG1 A;  2RUG A;  4RX6 A;  4MY4 A;  1SL0 A;  4M5D B;  4NI2 A;  3RW6 A;  3PW2 A;  2EFV A;  1SC4 B;  2IYG A;  4I7F A;  3AA8 A;  1UAW A;  2HWI A;  4ZVQ B;  1X5T A;  3M7V A;  3MWB A;  4UPI A;  4LQ3 A;  3NS5 A;  4KHM A;  3Q8S B;  2KHC A;  2IBO A;  2YNG A;  3CMR A;  4I6Y A;  4K2J A;  1OIA A;  5DGB A;  4ZOS A;  1REV B;  2BV3 A;  1ALJ A;  5M2R A;  4RWX A;  2HND B;  4YR3 A;  1TK0 A;  3IGZ B;  1SV5 B;  2GV1 A;  2RRN A;  1GX5 A;  1EQM A;  2BE9 B;  3VV2 B;  1BE4 A;  4OL8 A;  2J9D E;  4G65 A;  2DRA A;  4DXL A;  1RAH B;  2RH3 A;  4JI4 J;  1PYT A;  2HBQ B;  1RB0 A;  4LRC A;  1R43 A;  1RTD A;  2JJ4 D;  4OI3 A;  4DL6 A;  4IG0 A;  2DGT A;  1T0T V;  3HHE A;  7FD1 A;  4KTQ A;  3IDD A;  3CME S;  5DG8 A;  3SYZ A;  4AL5 A;  5K4P A;  4HKQ A;  3DLG B;  1Z4U A;  4FBT A;  3O8W A;  1TZ0 A;  4DX7 A;  2E5G A;  2DPI A;  2WAQ D;  1F5B A;  4I0W A;  2RE1 A;  3BGR A;  4HR2 A;  3U1N A;  2C2M B;  4FYD A;  4TU7 A;  4K4X A;  4RPF A;  1EHW A;  2IDE A;  1QE1 A;  2PT0 A;  3I9Z A;  2LU1 A;  3GYX B;  2G0J A;  1WOO A;  3VVU A;  1UJ4 A;  4DFM A;  2LXF A;  4DV3 J;  2G2O A;  3TVY A;  3Q2S C;  2XR9 A;  4BHQ A;  1ZTW A;  2GS8 A;  3AXM A;  3GJR B;  1GEH A;  2YKQ A;  1HIY A;  3PDN A;  1IWA A;  2J9C A;  2E9R X;  3NKM A;  1NND A;  2V8P A;  2ADB A;  3A8E A;  1HQ2 A;  3C19 A;  5CZV A;  1XNR F;  1TMM A;  5AJ3 J;  1SB6 A;  3M2U A;  3KLG A;  2IJF A;  3L7P A;  2XG8 A;  1KLM B;  3MMB B;  2VDH A;  3V6D A;  2C2E A;  1L3U A;  1KKH A;  3UN3 A;  4HHH A;  1VBZ A;  2XGQ A;  3OTE A;  4ZIT A;  2I0X A;  3VAH A;  3M6W A;  4EO6 A;  2EBG A;  3PHE A;  4ES1 A;  1YJW S;  1EW8 A;  3MAH A;  3CMQ A;  3NKY A;  1RHJ B;  1S1V B;  2V34 A;  2RDI A;  3FBF A;  2DNP A;  2XQC A;  3PW7 A;  2K2P A;  2VQR A;  1C0T B;  3OHB A;  1NJZ A;  2UXB J;  4JYA J;  5KFQ A;  3RTV A;  3IS9 B;  3AOC A;  1TUG B;  4I2P A;  1T03 B;  1JKH A;  5K9F A;  1N34 F;  1FJE B;  1KSP A;  3OUY B;  4I2Q B;  1RXO B;  1I5O B;  1HYS A;  2MKH A;  4ECY A;  3KLF B;  2CDQ A;  5E2Q A;  1E3C P;  2X7I A;  2YX1 A;  4TYA A;  4KQZ A;  2MGZ A;  3ILL A;  1RHQ B;  4RBU A;  3Q3Q A;  3RB0 A;  2AEM A;  1S6P A;  3KG0 A;  5KFG A;  2LA4 A;  3LP2 B;  4PWD B;  4QIG A;  3QWP A;  4UPH A;  4H4M A;  1CJU A;  3IGN A;  1IN0 A;  4DQI A;  4NLW A;  3OL8 A;  3GV7 B;  2VA3 A;  1N32 J;  5B0F A;  2XS2 A;  3JS9 A;  3CJT A;  2UUT A;  4EUV A;  3V6K A;  3DGP B;  2W8D A;  3BPS P;  3MXH P;  5THW A;  1BY9 A;  4DR4 J;  4ZHR B;  4IQX A;  3QNW B;  1GAO A;  1LV5 A;  2R7X A;  2DY1 A;  4P2X A;  3BN4 A;  3T5K A;  2GHP A;  3SMZ A;  4J5O A;  3LGN A;  1VC6 A;  1V6H A;  3M1V B;  3QWU A;  1HJK A;  4O4G A;  1XQI A;  4USM A;  2BR0 A;  4J9O A;  1XMB A;  3KFW X;  3X3U A;  1FA0 A;  2HIY A;  5HVH A;  1NK7 A;  2J5A A;  1JJ2 R;  2AW0 A;  1VQK S;  3CE8 A;  2CA9 A;  3J81 Y;  5HRT A;  1RAG B;  5F8G A;  3N6N A;  1PJ6 A;  1Q8B A;  1JLE A;  2QG9 B;  5G0R A;  2CQ2 A;  1BQX A;  2QV6 A;  4KRW A;  3Q8R B;  2YKM B;  3W7B A;  2Q79 A;  1Y4Z B;  1FFG B;  4NA3 A;  4JI2 F;  1YJN S;  1UET A;  2ATL A;  2XY7 A;  2ZH7 A;  1AZS B;  5CYJ A;  5KFL A;  4ATN A;  1U7L A;  4A8M P;  2R3V A;  1J5E J;  2R8G A;  5H9F K;  4DU8 A;  4IOC Q;  4YEA A;  4QWB A;  2VB6 A;  1FDA A;  2B43 A;  1FER A;  2QLX A;  5J1E B;  4FYY B;  1U2R A;  3MR3 A;  1X5S A;  2KXF A;  3DMJ B;  1RAA B;  1TK8 A;  2MSS A;  3R3T A;  2A2C A;  2PD1 A;  1T94 A;  2QL5 B;  2Y0B B;  2EVZ A;  1WDD A;  2DO4 A;  4NZ0 A;  2CQ4 A;  5A8K B;  2VBY A;  1V5I B;  2QL9 B;  4XK8 C;  1TEL A;  2HLU A;  4NPO A;  2DIS A;  3MZI A;  4E0D A;  1T9T A;  1FNO A;  3RB4 A;  2J7W A;  3FSX A;  2W9C B;  4FDI A;  2GQ2 A;  4DR5 J;  1KQG B;  3P5T L;  1FXL A;  1BQM A;  5CQG A;  2UVU A;  1P6T A;  3MM8 A;  2M5Y A;  2GAH C;  2Q3P A;  4EYH B;  2CPJ A;  4RW6 B;  4WP9 A;  2BAN A;  2IVF B;  2V94 A;  3OW2 R;  1RT6 A;  1IKW A;  2ROP A;  2XLI A;  1X4D A;  5HAN A;  3KMS A;  2XZT B;  4O3P A;  2XO7 A;  2UU9 F;  1JJH A;  2RRA A;  4CO5 A;  5D6G A;  2H5E A;  2UXC J;  2XO6 A;  3MR7 A;  3K57 A;  1R6Y A;  1K7H A;  2M2B A;  4I69 A;  2XC9 A;  1NKB A;  3NGT A;  4HLB A;  2F9D A;  1DQA A;  2ZJR Q;  3FCW A;  1PAU B;  3GIJ A;  2AJ4 A;  1DY3 A;  2RHQ B;  1P8G A;  2XRG A;  3DI6 A;  3TZW A;  2ZOG A;  1AFI A;  5GAE I;  4DHV A;  1FK9 B;  1RT4 A;  3EJM A;  4ZVU B;  3T1Y F;  2GSU A;  1ZBT A;  3FMW A;  3H4D A;  3E2D A;  4WWS A;  4LF8 J;  4P2M A;  2RQM A;  1QD1 A;  1HFE L;  4LF1 A;  4J7C A;  3M9M B;  5KFE A;  3BBF A;  2XGP A;  3SFG A;  4PPZ A;  5BYR A;  5A8W B;  2M3D A;  2M0G B;  1H0H B;  2FJW A;  4DV1 F;  2B0G A;  1LKZ A;  2R7U A;  2KXN B;  1LXN A;  4PPD A;  1REV A;  3VHQ A;  3H4B A;  2HMI B;  4U95 A;  1QDU B;  3AJD A;  3KDO A;  5K8P A;  2WSE C;  3MPV A;  1FKP B;  1TQL A;  5JVH Q;  1KVI A;  2DNZ A;  2N7Y A;  3TI0 A;  1ALH A;  3T1A A;  3WAW A;  2Q43 A;  4X4R A;  1K0V A;  4XTT A;  4QQB A;  1GMV A;  3GV8 B;  2JC0 A;  3RBD A;  1MU2 B;  4UF4 A;  2QZU A;  4GTW A;  5CCL A;  3EIC A;  4JI8 F;  1RSC A;  3M8R A;  3QO9 A;  4B9S A;  4C8L A;  3B8H A;  3JQM A;  2P6T A;  5I4M A;  1HNV A;  2HFO A;  2A2D A;  2EFQ A;  2C3U A;  4CO3 A;  4YME A;  4OJG A;  2D1C A;  1S0V A;  2DCU B;  1DTQ B;  2P2C B;  3NOC A;  4DX5 A;  2YWG A;  4EZ9 A;  1B0V A;  5LMN J;  3MM7 B;  1TKT B;  3OLA A;  2GJF A;  2R2U A;  2HK2 A;  3G6X A;  3MAA A;  1RT2 A;  4N77 A;  2YNI A;  2F4V J;  5KFZ A;  4OI6 A;  2Z56 B;  1KH7 A;  4RKU C;  3G9C A;  5A6P A;  2KYZ A;  4MKA A;  1HR0 F;  4CYS A;  4QWE A;  3DC2 A;  4F04 B;  2BZ2 A;  4PAA A;  4BLG A;  4LBH A;  2KRR A;  2UXD J;  2E7X A;  4MKB A;  4PEO A;  1S4F A;  1FEE A;  4NXN J;  5HBM A;  4X4N A;  4DQP A;  3O44 A;  1VYA A;  2JL9 A;  4OV6 A;  4RW4 B;  2HBR B;  3L9Z A;  2HUR A;  2V0N A;  1FJG F;  2AF6 A;  1RTJ B;  4YR2 A;  4LRF A;  5ETT A;  1SJ3 P;  2BJ8 A;  2KU7 A;  2OEM A;  3SI8 A;  1RCO B;  3KNA A;  4DUY F;  2F4F A;  1B0T A;  1IBM F;  4RW7 B;  1C0T A;  1WC6 A;  2ZFH A;  2YQ0 A;  5KTQ A;  2IC3 A;  4I68 A;  2G9Y A;  1GTE A;  2ZOM A;  4KKO B;  5F8I A;  1NSK L;  5BYS A;  3F41 A;  4H4K C;  2VPW B;  3DDI A;  1ZEB A;  2W4D A;  1E6Y B;  3BDP A;  3QSI A;  4Y2M A;  1N5S A;  3OR2 B;  4A48 A;  2RSQ A;  2EKY A;  4I2Q A;  4UOP A;  3G8T A;  5IV3 A;  4OHX A;  2DHS A;  3OSN A;  3BDH A;  5ETL A;  2FDN A;  4HH1 A;  2N4D A;  4PWW A;  5B0A A;  3FUY A;  3N6M A;  4NA2 A;  5GAE U;  1ZA1 B;  3E8O A;  3NGK A;  3LUY A;  1RHU B;  3R5J B;  3UN5 A;  5DDQ C;  3GB0 A;  3SDE B;  3DLK A;  2W2M P;  1JIH A;  1GXL A;  3MDF A;  2XBP A;  3NG8 A;  5DGA A;  1O99 A;  2FLP A;  1KHL A;  3R1H A;  4WFY A;  1XNQ J;  4LF7 F;  3S1T A;  1SQG A;  5HSP A;  5HRO B;  3DGP A;  3BSN A;  1RWX B;  1U6B A;  2OJ3 A;  2L48 A;  3MOZ A;  4DR2 J;  4EZ6 A;  1N5Y B;  3LTO A;  1SI9 A;  3BZQ A;  3ZZ0 A;  3AJ1 A;  1CC8 A;  4CXU A;  5IQ6 A;  4KAI A;  4AL6 A;  3T01 A;  5DLV A;  1JLA A;  1WOR A;  5L1L A;  2LFV A;  4J9L A;  2VG6 A;  1FWP A;  4AXI A;  1PIL A;  4LR8 A;  2DXE A;  4IH7 A;  3I32 A;  2HVD A;  5IOL A;  2DHX A;  1KWM A;  1WTF A;  4DQQ A;  3H2V E;  4QZV B;  1JJ4 A;  4ANE A;  1HI1 A;  2V2V A;  3G6E S;  3E01 B;  4DF8 A;  2MXY A;  3ENV A;  4LFA F;  3B78 A;  4ICL A;  2V67 A;  4D3G A;  4MFB A;  4I67 A;  4OZ1 A;  3VF0 B;  2QMU B;  2VL1 A;  1Y0H A;  4X4V A;  2DR7 A;  1AZS A;  3CD7 A;  1C4C A;  2WCX A;  1VLY A;  3SZY A;  4DX8 H;  5LXR A;  4JI7 F;  5J2M A;  1RHM B;  1DAX A;  4QIV A;  2GQC A;  3QSY B;  4DSI A;  1Z2L A;  2XI3 A;  1H7X A;  2E66 A;  4C3L A;  1Q82 T;  4OFZ A;  3SSS A;  3BJY A;  2DR5 A;  1IKX A;  4G6V B;  4LIW A;  4QIF A;  5D78 A;  2R8K A;  2H51 B;  4JI1 F;  3DU5 A;  3CCR S;  2HFS A;  3W60 A;  2NUU G;  4WU3 A;  1J5O B;  1SPB P;  7FDR A;  3H5Y A;  4RZR A;  4NCA A;  1N0U A;  4X4T A;  3LPY A;  2Z30 B;  3NGS A;  3DLJ A;  4AE5 A;  1R8H A;  3J81 U;  3GR1 A;  2IVM A;  1TKX B;  4DS5 A;  3K89 A;  2ANH A;  2Z0G A;  4A8F A;  4YFU A;  3VZI A;  2X3G A;  1GQE A;  4KHR A;  2LLZ A;  4FDJ A;  3PXG a;  2W9B B;  2KVI A;  2G9O A;  2EFN A;  2GIQ A;  2VBX A;  1C1C A;  5DDO C;  3Q8P B;  3BQ0 A;  3J7Z T;  4WCE Q;  5F3Z A;  3OPK A;  3CJ8 A;  3PO5 A;  1LFW A;  1N8R T;  2OML A;  3BGO P;  4KPY A;  1RDR A;  1AUD A;  2MQN A;  3HHK A;  3D54 A;  3HSD A;  2DVI A;  5IM0 A;  3QRQ A;  5KXA A;  5AT1 B;  4A8S A;  1HWJ A;  1IBL J;  2VON A;  3KD8 A;  2AGQ A;  3FBC A;  3KHH A;  1EZZ B;  4MK7 A;  4CYU A;  5H9F J;  3R5G A;  4DUT A;  2NXN A;  2AHO B;  2WHO A;  4K50 A;  1CLF A;  5FLX Y;  3AOB A;  5B0B A;  1UKU A;  5J2N B;  4XPC A;  1SKR A;  3KK3 B;  3TQE A;  4K4Z A;  3MUT P;  3H0P A;  1Q8K A;  4QPX A;  4F4K A;  4LFB F;  5L38 A;  3FEX B;  1V3R A;  4QBU A;  2YNH A;  3L09 A;  3I0R A;  1V3S A;  1UZD A;  3HHL C;  1WD6 A;  2XLJ A;  1ED8 A;  4QAX A;  4O44 B;  4BWJ A;  1TL5 A;  1Q8L A;  2NLW A;  1FKO B;  1YBT A;  4X4Q A;  4OX8 A;  3VGU A;  3NXZ A;  5LJ5 Y;  4AQY J;  1UVL A;  4ZKA A;  1EP4 B;  3DU6 A;  1HWU A;  1JNZ B;  1Y7P A;  1UZH A;  2RD5 C;  4A8K A;  3AB4 B;  4UOH A;  5IT9 Y;  2DNN A;  1N33 F;  2YKN A;  1UW9 A;  4Q0B B;  4EI2 A;  4OJ3 A;  1KH4 A;  2IFX A;  2GAG C;  1VQ4 S;  4DLG A;  1NCL A;  4FVC A;  3B82 A;  4K2X A;  2RF2 A;  2OD4 A;  1VRQ C;  1UJ5 A;  2EC2 A;  1UFW A;  1U45 A;  2H4W B;  1QAJ A;  1KD1 T;  2HHQ A;  5BR8 F;  3BR9 A;  3QT7 A;  1HNZ J;  5ETR A;  1F2G A;  3ENA A;  1IR0 A;  2YXL A;  1HA1 A;  2IRY A;  2FVQ A;  4EU0 A;  3A13 A;  4HVZ A;  3SCJ E;  3N0V A;  2OPS A;  2WBM A;  2AZ3 A;  3FBE A;  3FKB A;  2DPJ A;  4HAC B;  3GLJ A;  2CQP A;  3AQP A;  2G1D A;  5H9E K;  4JP8 A;  1CJK A;  1SIW B;  2R7O A;  1PSD A;  2G1H A;  1L3S A;  1KON A;  2OH2 A;  3X1L B;  4WFZ A;  1CUL B;  2YWK A;  3QT6 A;  3FVY A;  4OX7 A;  3AH6 A;  1RU1 A;  1PJ5 A;  1FD2 A;  1KQF B;  2AWZ A;  1KP6 A;  1Z2Z A;  3QRR A;  3H2U B;  3PW5 A;  4RW4 A;  4HEA 9;  2V8V A;  2UUB J;  3P6Y C;  1RTZ A;  2MJU A;  3GP9 A;  5KFD A;  5KG5 A;  2OLW A;  1FJC A;  2J76 E;  3S8S A;  1BQN A;  2MPU A;  3C14 A;  4FDF A;  1KHK A;  4DUZ J;  3BGL A;  4F8R A;  4NLR A;  4N41 A;  3SQO P;  1TL3 B;  3HHL B;  4RW7 A;  1LW0 B;  5EGE A;  4MYT A;  3ZNJ 1;  5KFY A;  3CT9 A;  3K8V A;  3OSP A;  5ETN A;  3ZNU A;  4Q5V A;  4K4S A;  3J7Y I;  1NK0 A;  2D7S A;  1L5U A;  1LWX A;  1PGZ A;  1GK8 A;  1ANI A;  3OR2 A;  1HLW A;  2XSJ B;  2J0S D;  1DAR A;  3UDE A;  2VOO A;  1X8D A;  4AUK A;  1F3V A;  4IKA A;  1LOU A;  4LF4 J;  2W2O P;  2MMY A;  2XB2 D;  3SDE A;  2IUC A;  3FJ2 A;  5CD4 H;  2CZV C;  1OYE A;  4U7U K;  5HRO A;  2Z4P A;  5T7L A;  2NR0 A;  4KJD A;  1S9G A;  4CXS A;  3JYT B;  1WI8 A;  4IDK B;  4DV7 J;  3U27 A;  1BXN A;  5C42 A;  4DS4 A;  2H48 B;  4ELU A;  3GMG A;  4XIU A;  2VC1 A;  1T3O A;  2C22 A;  4PG5 A;  1XER A;  2MKY A;  3CMA S;  3CVK A;  3WAV A;  2DHA A;  1WC3 A;  4ZVF A;  2EXU A;  3DRS B;  1PG5 B;  3KJQ B;  4P2F A;  5CAB A;  4JI4 F;  5GMD A;  1F5C A;  1GX6 A;  3RBX A;  1U2C A;  1GXU A;  1URA A;  2YVS A;  4NL5 A;  2O1P A;  5B0D A;  1UCN A;  4Y2I A;  1FNM A;  3TAR A;  2CVI A;  5CXT A;  2CPZ A;  1QAX A;  8RUC A;  1AJB A;  3PYE A;  2OKQ A;  1NHV A;  4ZCM A;  4M5G A;  3C15 A;  1EAR A;  2JEF A;  2MY7 A;  3QJJ A;  2MZT A;  2HBY B;  1FFS B;  2EPI A;  3MEE B;  4ZP8 A;  4W90 B;  1XR6 A;  2ASJ A;  4K4W A;  3O3L A;  4EFA C;  4QOT A;  4N56 A;  4WBF A;  3ZZU A;  1XIQ A;  2GVZ A;  1J27 A;  5K14 B;  5AXM A;  4TLR A;  4ELT A;  3TJA A;  2JHE A;  4DPY A;  2X1A A;  2HFZ A;  4X64 J;  1WI6 A;  4DV3 F;  2DIU A;  4OZ3 A;  1TTH B;  3NWR A;  3BO4 A;  2R2S A;  3DLE A;  3EDR B;  3DRP A;  3D6M B;  1HD0 A;  4ED0 A;  4C8N A;  2DH7 A;  2FLN A;  3V4I A;  4CH1 A;  1R0B G;  3KLI A;  4CT8 A;  1ROF A;  1HPZ B;  3P4U B;  2NZC A;  1DQ8 A;  3CC4 S;  4P71 A;  2CFX A;  2QMX A;  4H4K A;  3JTN A;  4F36 A;  5AJ3 F;  4J90 A;  3OJU A;  4M5I A;  1UEK A;  2NXU A;  3EPG A;  5IXU A;  1S1W A;  4CTA A;  2KT3 A;  4DJB A;  2HPU A;  2KFN A;  3A52 A;  1S4E A;  1TKX A;  2QFJ A;  1T9U A;  1QM9 A;  4N7T A;  4GMK A;  2VHG A;  4N8N A;  3OVB A;  3NP5 A;  4KO0 B;  1S10 A;  2NPI A;  7AT1 B;  3QAT A;  2HHV A;  2JLG A;  2Z57 B;  2D41 A;  3FGV A;  5IWA J;  2Y8Y A;  2WSF C;  4WK1 A;  2ZHB A;  2XNQ A;  4ZVP B;  3K5M A;  2B51 A;  3QT8 A;  3HJV A;  2RT3 A;  1QSL A;  1NLK L;  1WHW A;  2HAI A;  2M88 A;  3DOL A;  5A2Q Y;  2V4Q A;  1YHQ S;  2UXB F;  2KT2 A;  1T95 A;  3GII A;  4JYA F;  2FVP A;  4RNF A;  1TV6 A;  1H6K X;  3FEZ A;  3VAF A;  2B6A A;  1N4L A;  1H98 A;  3GSI A;  4B3S J;  3RR7 A;  1F0X A;  3J7Y U;  5I3U B;  1X9M A;  1ZAW A;  4UOO A;  3CJ5 A;  3KJN B;  4B56 A;  1Q1K A;  2ASD A;  5CYM A;  4LBI A;  2ILY A;  1JWW A;  2WON A;  3LPE A;  1ZM2 A;  3KK2 A;  3PJX A;  4PQA A;  2L9W A;  3IBW A;  3BGF A;  1JLC B;  3C6T A;  2CPH A;  1KEK A;  1S49 A;  2CPX A;  5L46 A;  1VK8 A;  1IUJ A;  1N32 F;  3CW2 C;  3I5C A;  1RTH B;  4F4W A;  1OQ6 A;  1ZH5 A;  4DR4 F;  1A7G E;  2YQ3 A;  4NLO A;  2QX0 A;  4O44 A;  3AHP A;  3MM6 A;  2CPF A;  3NCR A;  4Y34 A;  1I94 J;  3TZY A;  1FKO A;  2RH6 A;  1VQO S;  3POT B;  2WSC C;  3RRG A;  4FYX B;  1WF1 A;  5J2Q B;  1PC4 A;  2KYX A;  5DM6 Q;  1EP4 A;  2Q6C A;  4USH A;  2OTJ S;  4KPC A;  1B8J A;  5E3Q A;  2KJW A;  5A0Y B;  3DLH A;  4RNH A;  2PI5 A;  1AB8 A;  2EW9 A;  4MIV A;  3W2W B;  4X84 A;  5GRR A;  1IJE B;  2W5V A;  1FI4 A;  1WUU A;  4ZCI A;  2IJR A;  4OYP A;  4RWW A;  1HHT P;  3BH7 B;  3R8Y A;  1IBC B;  2H4Y B;  3CDW A;  3MMA A;  5JJB A;  2GMJ A;  5D4L A;  5FLX U;  1U48 A;  5KT5 A;  1DTT A;  1R8C A;  2Y1J A;  1RT5 B;  2F9J A;  1Q78 A;  4FF4 A;  3PAC A;  4CXK A;  3EYZ A;  1RT3 A;  2FLL A;  3NS7 B;  5IJS A;  5D0E A;  4LR9 A;  2VJU A;  3SIP B;  2V6A A;  3SV4 A;  1NO8 A;  3BV8 A;  9RUB A;  1VQN S;  3KK1 A;  2V4J A;  2Z8Q A;  2FGO A;  5KFT A;  4Y2A A;  4WFN Q;  4PAB A;  4ER8 A;  4ECV A;  4WTY A;  2JOQ A;  3G96 A;  1HNW J;  1EET A;  3OFG A;  4U6P A;  1RAB B;  1S1X A;  2CAD A;  1SC3 B;  1CUL A;  2HFV A;  4DR5 F;  1TUV A;  1KOH A;  1YJT A;  5IZH A;  3I82 A;  4TLQ A;  5L8R C;  3GIR A;  1N2L A;  2QA4 G;  3ILO A;  2GHW A;  3IG1 B;  2ZE2 A;  2DHG A;  3FFI B;  4DCP B;  1Q8I A;  1S76 D;  4NWX A;  3WAY A;  2UXC F;  2V9K A;  3MK2 A;  4NEZ A;  2X98 A;  1TL3 A;  4FPI A;  2FZG B;  2HG4 A;  4ZJO A;  1LW0 A;  3ZTO A;  4CH7 A;  4I56 A;  4ID8 A;  4IFV B;  4LSZ B;  2RU9 A;  1LFP A;  3V4M A;  4ILM A;  2CQC A;  1NK8 A;  1T3N A;  4F26 A;  4BCA A;  2UU9 J;  1VC0 A;  2DO0 A;  2AJQ A;  2D69 A;  2PI4 A;  2XSJ A;  3JAM Y;  1UVM A;  4URG A;  4Q43 A;  4LF8 F;  4RUA A;  2LKZ A;  3D68 A;  2ROE A;  2DT9 A;  3R2C J;  3ZTQ A;  2XTJ P;  3L7U A;  4LSN A;  3HKW A;  1UVN A;  5H9E J;  2DY9 A;  3DXS X;  3OHA A;  3R27 A;  4IG3 A;  2IMO A;  3IXQ A;  5HL7 Q;  3QLH B;  3KUH A;  3IR6 B;  2OPP B;  1N48 A;  3S7R A;  2YKO A;  2ZD1 B;  3TW0 A;  4OJ1 A;  3OL6 A;  4FNH A;  3U02 A;  5DJB A;  1LWC A;  3VZH A;  1VJQ A;  1QVF R;  2AX1 A;  3BS9 A;  3T5H A;  3VAL A;  4ZGA A;  2BJ9 A;  1Z1Z A;  1ZZF A;  4ED6 A;  4ZMM A;  4DL0 C;  1M1H A;  1WEX A;  3IM8 A;  2WW8 A;  1FEH A;  2ZM6 J;  1YIJ S;  4U67 Q;  4F0H A;  2KJV A;  1KVJ A;  1X60 A;  1U1M A;  1H2V Z;  2E1M C;  1R0C B;  1RUS A;  1TL1 B;  4JB8 B;  3LH2 S;  2HVZ A;  3QAE A;  1RWM B;  2D3O 1;  2A6M A;  3HLU A;  2W7P A;  3MEE A;  5GVQ A;  4A47 A;  2VUG A;  4DMZ A;  1PYO B;  4BC7 A;  4KHP J;  1SH3 A;  4F0M A;  2HQ3 A;  1ZS6 A;  2CQI A;  5U47 A;  3I9V 9;  4QWC A;  1VS3 A;  4C0B A;  1TP7 A;  5LMN F;  2OI2 A;  2EG1 A;  5E3P A;  1NK5 A;  3C6U A;  3V81 A;  1LWE B;  2BQU A;  3CJ0 A;  2PEH A;  2G0I A;  1TL4 A;  2HNZ A;  4ZS6 A;  1RYR A;  3KG1 A;  2IYI A;  2WVE A;  3H42 A;  3H98 A;  1HBU A;  4DQR A;  2F4V F;  4ZG9 A;  4NAS A;  1RLD A;  3OL7 A;  1JXV A;  4ED2 A;  1QUV A;  3KUG A;  1YBA A;  3O5T B;  2RB7 A;  2DGS A;  5C2C A;  2CWK A;  4Q2M A;  1E1Z P;  3OVS A;  2W5S A;  3ED4 A;  1SJ1 A;  4X66 J;  2UXD F;  3OR1 B;  1E6V B;  4XDC A;  1S72 S;  4NXN F;  1SIZ A;  1MW7 A;  2K1R B;  5HN0 A;  3SSQ A;  3PRV A;  2R7V A;  3FC9 A;  1EX8 A;  1FE0 A;  4OZ5 A;  3CDA A;  2BJ1 A;  3OJS A;  4DSL A;  4DU7 A;  3NBP B;  4YUD A;  3AJ2 A;  4LSL A;  2ZHA A;  1HQU B;  5M2P A;  1G3O A;  5C24 A;  2VKR A;  3T19 A;  3UW1 A;  3KLH B;  2AYM A;  3R9L A;  5LSO A;  4L3N A;  3IWL A;  1X31 C;  1H38 A;  1NKE A;  3US5 A;  4USJ C;  5LJ3 Y;  4B3O A;  3ZZY A;  1X5O A;  4NA1 A;  2W4P A;  4QR0 A;  2ZIT A;  3MEG B;  2MDA A;  3J7A N;  5EGY A;  5LMU J;  1DZ5 A;  2WOM B;  2J6T A;  4PYD A;  1HBN B;  2XY6 A;  4DUY J;  2WK4 A;  1BC6 A;  2W2Q P;  3FZB A;  5B0C A;  1JLC A;  4EO8 A;  1Y7A A;  1QY7 A;  1YK9 A;  4HTJ A;  3HVR A;  3FBB A;  4RW9 B;  4FYV B;  2O67 A;  5DLW A;  1RTH A;  4KGK A;  1F1B B;  4DR6 J;  1EJJ A;  2H9Z A;  4WP8 A;  4LMZ A;  2BUN A;  4QCL A;  1UVK A;  2QA4 S;  3CCU S;  4DR2 F;  4KGM A;  1OO0 B;  3EX7 B;  4ZLN A;  3HSG A;  2KZZ A;  3M9O B;  8ATC B;  3ZZT A;  5D3G B;  2GVD B;  2CQ1 A;  2PA3 A;  4ZPW R;  3QMQ A;  1RT1 B;  4NLV A;  2K8G A;  3LP0 A;  2K3I A;  4ECW A;  5J2P A;  1WHY A;  3BN7 A;  5BJR A;  2R8I A;  2D1G A;  2AP6 A;  3H2L A;  3MOJ B;  2DRB A;  5LOQ A;  4ALZ A;  4YDD B;  3BSO A;  1QJH A;  1R8P A;  1SL1 A;  5F9L A;  2AEJ A;  4B9T A;  2H3E B;  4F4X A;  3WC2 A;  2H1Y A;  2HIQ A;  2WVD A;  4GKK J;  1JLB A;  2EKN A;  3LGM A;  2OPR B;  3IR7 B;  3MM5 B;  3HVA A;  4OYX A;  4WF9 Q;  1U1P A;  4MIA A;  2DRD A;  4DEZ A;  4ID5 B;  2ZH8 A;  4WFX A;  5AJ9 A;  3CJK A;  4NLQ A;  2DGQ A;  2CPE A;  4R8U B;  4LQ9 A;  4RR5 A;  3BM7 A;  1N36 J;  4KR0 B;  3OQ2 A;  3HM9 A;  2B3T B;  2XMU A;  3F44 A;  3UE2 A;  4M63 A;  1D8Z A;  4CLL A;  1Y00 A;  5LXY A;  2E1A A;  2VOP A;  3OBI A;  3NNH A;  4RUH A;  4J9K A;  3QT5 A;  2EFO A;  2KVQ E;  2VAS A;  3D3C J;  3EUN A;  1R6V A;  1EQ0 A;  3PJ9 A;  4OX9 J;  5KOX A;  3EDQ B;  3HSZ A;  4LVN P;  2YH0 A;  3TX0 A;  1V3Z A;  3L95 X;  4K8R A;  3E3X A;  1MWQ A;  2VBZ A;  2ZVI A;  2DEI A;  1CJV A;  2VF3 A;  4NEY A;  1VQP S;  1AUS L;  2HEK A;  2ZEJ A;  3T6J A;  3W62 A;  5ETV A;  2Y8W A;  2GO9 A;  2CPY A;  2L3M A;  2FHM A;  4TN2 A;  1HDH A;  3D1H A;  4ZP9 A;  3DM2 A;  2ZBP A;  3J7Z 5;  2XMV A;  3CSK A;  4TY8 B;  3TR5 A;  2WTF A;  4EYI B;  4FPR A;  4OHZ A;  1NKC A;  1C0U A;  1UPM B;  2C3O A;  2R7T A;  3PKY A;  3SQG B;  1ZM3 A;  2WZ1 A;  1IBL F;  3TUJ C;  3RRH A;  4K59 A;  3T5L A;  1IR1 A;  5D4N A;  1S1U A;  3IC1 A;  5FDL B;  3JSB A;  3Q83 A;  1Q7Y T;  2CKW A;  2QE5 A;  1T9V A;  4PR6 A;  2W5T A;  1FVS A;  1ZAV A;  5HP1 A;  3DYA B;  4ENO A;  3N79 A;  3EXY A;  4MYU A;  4IFY A;  2V8D A;  4CLY A;  5LIA A;  1FXR A;  5L1K A;  3QZ8 A;  4NRU A;  5ETS A;  5F0W A;  3D0G E;  4CNZ A;  4TKT A;  3EGZ A;  2EFP A;  2OD6 A;  3UVJ B;  1OPZ A;  4CLS A;  2OHD A;  3IGY B;  2CNK B;  1DLO B;  3LOU A;  1NK6 A;  1N5Q A;  4WKR A;  1NEE A;  2JH3 A;  5GAH I;  1JLF A;  3FSI A;  1FWK A;  5DLG A;  2JEJ A;  1C4A A;  4JUZ A;  2QL7 B;  2E5L J;  5DZ7 A;  3QLH A;  3T5J A;  5EWG A;  2ADC A;  2XZD B;  4ECS A;  1KHV A;  1MMD A;  4WK3 A;  4AQY F;  2KDO A;  4NRT A;  1CVJ A;  1RIS A;  2YBV A;  3MI7 X;  5B0E A;  3Q86 A;  2N7C A;  2OSR A;  3T9Z A;  4YB6 A;  1FTC A;  4I64 A;  2WB1 D;  1U02 A;  3T3F A;  4K5R A;  4NYZ A;  2AQ4 A;  3BBB A;  2HHW A;  1RT7 A;  2OO4 A;  3EZO A;  4ZP6 A;  2DR6 A;  2ZZT A;  1M90 T;  2LEP A;  3HJF A;  3VQT A;  1PAE X;  4J9M A;  1U47 A;  4RBT A;  2A3J A;  3MED A;  3PYG A;  3ISN C;  1TL1 A;  4ZVH A;  1SKS A;  3Q8Q B;  4DSJ A;  1K1S A;  1FO1 A;  3GIL A;  3PX6 A;  2YH1 A;  1X4H A;  1WC0 A;  1HNZ F;  4ED8 A;  5KFJ A;  2KG0 A;  4NCB A;  1WSV A;  3HHN B;  3NOG A;  4QYZ K;  4KGV B;  2VFR A;  3DNC A;  3CCT A;  2GIR A;  3KTQ A;  2RS2 A;  2XYP B;  1VQ8 S;  2PMZ D;  2PN6 A;  3QRP A;  3DFE A;  3CGI A;  2HZA A;  5FII A;  4TU8 A;  5KOW A;  4KGZ B;  2CXE A;  2JVO A;  2MKC A;  4DL3 A;  3DRY A;  4D3H A;  2QYG A;  1TAQ A;  3N5B A;  2DYA A;  3R7B B;  1U1O A;  1UL3 A;  4PG7 A;  4ZVO B;  1Y3K A;  4EWT A;  3PR5 B;  2VG7 A;  4R5P B;  1SH0 A;  2F65 A;  1N52 B;  4OZJ A;  4YB5 A;  2UUB F;  2CQ0 A;  3J7A 1;  4NLP A;  3NKN A;  3NBP A;  2F1F A;  1WEZ A;  3VTI A;  4ZVR B;  2ZUG A;  4DUZ F;  2ZUA A;  1WG5 A;  1PJ7 A;  5I3Q A;  3KLH A;  1VK3 A;  4CLU A;  2V2Z A;  3J81 j;  3UDC A;  2W5R A;  1Q7L B;  1RHR B;  3RYL A;  2GA7 A;  3PX4 A;  5F8H A;  4WTO B;  1SUQ A;  1UWB A;  2GCF A;  5M2U A;  1N88 A;  1HWK A;  3FDS A;  1KBR A;  2ZWO A;  3JSM B;  2LDY A;  5DG9 A;  2B8Q A;  1LK5 A;  2FHO B;  3KHL A;  4LF4 F;  4ZG7 A;  1NSP A;  4IR1 A;  1NDC A;  3CCS S;  1JLQ A;  3A8I A;  1S6U A;  2MQO A;  2IM3 A;  1YKW A;  1TKZ B;  1FWL A;  3D2W A;  2MHN A;  4KT0 C;  1P27 B;  1NRK A;  1HHS A;  4DPU A;  3TRG A;  2RDJ A;  2YNF B;  3O6Q A;  5D77 A;  4F7V A;  1EJ7 L;  2VU5 A;  1RU2 A;  5GAH U;  4DV7 F;  2IIH A;  3MPW A;  2BDP A;  3NCP A;  3DLL Q;  5HQL A;  4CLT A;  3DOK B;  2FHJ D;  3CCE S;  1VHF A;  3GFY A;  1TVR A;  4KM4 A;  4HHJ A;  2X1G A;  3DHW C;  1ITP A;  2Y9H A;  2B5J A;  4H54 A;  1WC4 A;  3ULH A;  2AMC B;  3M2R B;  1DBD A;  2CRL A;  2QIF A;  4HDH A;  4C0H A;  2E5I A;  2GJ2 A;  6FD1 A;  1K47 A;  1CS4 B;  1RWO B;  2G13 A;  2RS8 A;  1FNX H;  1IR2 A;  5JVG Q;  5C7P A;  3H8Y A;  3LAL A;  3LP1 B;  1JB0 C;  1REG X;  4RU2 A;  2K06 A;  1U8W A;  3W2V A;  3DRX A;  3AD8 C;  4FKX A;  4FF3 A;  4KJI A;  2VFT A;  3HVT A;  1UEU A;  2QLB B;  3M2V A;  4X64 F;  1B3T A;  3OTC A;  1RBL A;  3M8P A;  3D6T B;  1RJJ A;  4UT4 A;  2W24 A;  2QZ8 A;  4RW8 A;  3VGT A;  1KH9 A;  4DSK A;  3B4M A;  1KDN A;  1AJA A;  3GQC A;  1VQ5 S;  1F9F A;  4F02 A;  4P7V A;  2AJ2 A;  3JQJ A;  1SJQ A;  1B7F A;  3H5S A;  4E8U A;  4ZDN A;  2F5G A;  1EW9 A;  3OL9 A;  1S1T B;  2ZJP Q;  4KSE B;  2KFZ A;  5KFP A;  3LWL A;  4WXW A;  1SJ4 P;  1GNK A;  3MM9 B;  1GXT A;  3OTO J;  4OI2 A;  3I5B A;  3M8Y A;  2FC8 A;  3Q8V A;  1WKK A;  1D9D A;  2DGO A;  5LM7 E;  3KUE A;  3FMB A;  1VQ6 S;  5IWA F;  4Y0F A;  2Q6B A;  4M1K A;  1KHN A;  3FSY A;  2CJA A;  4C8K A;  2HAF A;  5AXK A;  3KYL A;  1R0A A;  1VQM S;  3AQO A;  1Q95 G;  3T02 A;  3PEH A;  4WII A;  2LXU A;  2BA9 A;  1IM4 A;  2Z58 B;  1N6Q A;  1PIE A;  1HBO B;  1YJR A;  2W5X A;  1K73 T;  3UO0 A;  1U24 A;  1UEV A;  1A6L A;  5A76 A;  4B3S F;  2J0Q D;  4W92 B;  1WF2 A;  4NYP A;  1UMJ A;  4JI3 J;  1Q81 T;  1WHX A;  1IKV B;  1S99 A;  2WBR A;  2OEK A;  3EVO A;  4F3Q A;  1W2B R;  4ECX A;  1NZA A;  4OZL A;  2E9Z A;  4ED4 A;  4MKY A;  1NK4 A;  2C1E B;  1NSQ A;  5CYQ B;  2MEW A;  4IOA Q;  3G8Q A;  2FHK A;  4KYZ A;  4ELV A;  3AY0 A;  2ACM A;  1WKL A;  5CZX A;  4QR2 A;  2LEC A;  2UUA J;  1I94 F;  5HLF B;  1KN6 A;  2Z2M A;  3EPI A;  2C3M A;  2VIH A;  1S79 A;  1KRP A;  1Q16 B;  3IWX A;  4C11 A;  1ZED A;  3MEK A;  3DOM B;  5KFX A;  1CJT B;  4L73 A;  5GAD I;  4WZM A;  5RUB A;  3BSA A;  3BYR A;  1FFW B;  5LQQ A;  2V8G A;  3AOD A;  5IQQ A;  3ZZO A;  3K58 A;  5EUH A;  4ZP7 A;  3MEC A;  3TNV A;  2BW7 A;  1HNI B;  3SCI E;  3IA0 A;  1PYS B;  4FYW B;  1EKR A;  1H73 A;  3CJS A;  2VDI A;  3D28 A;  2N3O A;  3NS6 A;  3VGS A;  3WX4 A;  2FVS A;  1RAC B;  3QQC D;  4U7U D;  3G82 B;  3GFZ A;  2E44 A;  4OZN A;  4ILL A;  4Z2X A;  2B9Y A;  1RBA A;  4X4O A;  1S6Q A;  3HHL D;  1YSJ A;  1YDL A;  1LXJ A;  2HVE A;  1OJ4 A;  3FRZ A;  2DIV A;  2IAJ A;  4KC5 A;  2BE2 A;  2HNY A;  2IBK A;  2J8A A;  1SC1 B;  2G2Z A;  4EGL A;  2KTQ A;  3DRR B;  3I96 A;  1HNX J;  3A3P B;  4WE1 A;  1QVG R;  5D15 A;  4H4O A;  3CWJ A;  5KG1 A;  5FD1 A;  4JBC A;  1Q53 A;  1VRU A;  4ZPB A;  1VR6 A;  2WVB A;  3R6L B;  4F2R A;  2MZR A;  1E2S P;  1HNW F; 
#chains in the Genus database with same CATH homology
 1ELZ A;  4LQY A;  4UPK A;  3OT9 A;  4CXS A;  1ALK A;  2W5T A;  5GOV A;  3T02 A;  5L0E A;  2G9Y A;  4NWJ A;  2W8S A;  2IFY A;  1AJD A;  4LR8 A;  1N2K A;  4MHX A;  3NKM A;  4MIV A;  5LQQ A;  1E3C P;  1EI6 A;  4UPL A;  1N2L A;  3LXQ A;  4GTZ A;  1ELX A;  5GRR A;  2W5V A;  3M8W A;  1KHK A;  1ZEB A;  5LIA A;  3M8Z A;  1EQJ A;  2W5X A;  2ANH A;  5LRM A;  3UO0 A;  3B5Q A;  3Q3Q A;  1KH9 A;  5TJ3 A;  4UOO A;  4B56 A;  3NKN A;  4KJG A;  3UN2 A;  3WAV A;  4LRE A;  1P49 A;  4LRB A;  4UPH A;  4LR7 A;  4LRC A;  1AJA A;  1ZEF A;  3MK1 A;  3TWZ A;  1KH7 A;  2D1G A;  3DPC A;  5EGE A;  5LRN A;  1SHN A;  4UOP A;  4CYR A;  4ZG6 A;  4FDJ A;  3WAX A;  4CYS A;  3IGY B;  3BDH A;  4QAX A;  1ED8 A;  1K7H A;  4NWX A;  1ALH A;  1URB A;  3UN3 A;  3WAY A;  3WAW A;  4ZG9 A;  1FSU A;  1URA A;  2GLQ A;  4LRD A;  3IDD A;  3NKR A;  4LR2 A;  4KM4 A;  3NKO A;  3UNY A;  1EW9 A;  2W5W A;  2W8D A;  3A52 A;  4CXK A;  3MK2 A;  5K4P A;  4MY4 A;  1Y6V A;  5L0K A;  1ALI A;  4GTY A;  1AJC A;  1KH5 A;  5EGH A;  3UN5 A;  4N7T A;  3TX0 A;  2QZU A;  2W5R A;  4GTW A;  1ANI A;  2X98 A;  5IJS A;  2W5Q A;  1E1Z P;  3DYC A;  4LR9 A;  2W5S A;  3ED4 A;  3NKQ A;  1EW8 A;  4LRA A;  4ZGA A;  1AJB A;  3SZY A;  2GSN A;  1SHQ A;  3M7V A;  5IJQ A;  2XRG A;  1ELY A;  4KAV A;  4UPI A;  3MK0 A;  1HJK A;  1O99 A;  4YR1 A;  1KHL A;  3M8Y A;  2VQR A;  1Y7A A;  3BDG B;  1HDH A;  3TG0 A;  3NVL A;  2RH6 A;  5KXA A;  2GSU A;  3CMR A;  5L0B A;  1EW2 A;  2GA3 A;  3NKP A;  3WBH A;  4LRF A;  5C66 A;  2GSO A;  5DLT A;  4GTX A;  5DLW A;  3E2D A;  1E33 P;  3T00 A;  5INH A;  2IUC B;  1EJJ A;  3KD8 A;  1ED9 A;  2IUC A;  4KAY A;  5HRT A;  4ZG7 A;  1KHN A;  4FDI A;  4TN0 A;  1KHJ A;  3BDF A;  1ALJ A;  1ZED A;  4CXU A;  1HQA A;  5AJ9 A;  1KH4 A;  2XR9 A;  2ZKT A;  1ANJ A;  1O98 A;  1B8J A;  3T01 A;  3IGZ B;  5DLV A;  3SZZ A;  3BDG A;  1E2S P;  1AUK A;  4UOR A;  4KJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...