4LRCA

Phosphopentomutase v158l variant
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrcA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrcA01
1FSUA 2QZUA 1EW8A 1N2LA 3NKOA 2GSUA 2GSOA 1AJAA 1URAA 4NWXA 5AJ9A 3IGZB 3NKRA 1EI6A 3WAVA 1P49A 2VQRA 3E2DA 5LIAA 2W5VA 3TWZA 4CXUA 3BDHA 5GOVA 3LXQA 4LQYA 5EGEA 1ANIA 5TJ3A 4ZG7A 4UOOA 1Y7AA 4CYSA 4LRAA 4LRBA 3UN3A 2XR9A 3BDGB 1URBA 4GTWA 1ALHA 3ED4A 4UPKA 3T02A 4ZG9A 1E2SP 1AUKA 2W5TA 4UOPA 4UPLA 3BDGA 5C66A 2X98A 3WAWA 3CMRA 1EW2A 5DLTA 4LRDA 3UNYA 3A52A 3UN5A 5LQQA 1EW9A 1ZEFA 4MHXA 3DPCA 3IDDA 1ALKA 3T00A 4KJDA 1E1ZP 1ELYA 5L0EA 3B5QA 3SZYA 3M8WA 5IJQA 4MIVA 1Y6VA 5INHA 4UORA 1O99A 4LR7A 4LRCA 3NKNA 2W5SA 4CXSA 1SHNA 5LRMA 1KH5A 2D1GA 4FDJA 2IFYA 4KM4A 2W8DA 3WAYA 3T01A 1ELZA 3M8ZA 5L0BA 1KHKA 5KXAA 4LR2A 3MK2A 1KH7A 1KHNA 2XRGA 5K4PA 4ZGAA 4KAYA 4MY4A 1AJBA 3NVLA 1EJJA 3WBHA 5DLWA 1ANJA 2IUCB 5GRRA 1KHJA 2W8SA 4LREA 3KD8A 3NKPA 1KH4A 3BDFA 4GTXA 2GA3A 2IUCA 1KHLA 4FDIA 1K7HA 2G9YA 4ZG6A 1ED8A 1AJDA 2W5QA 5DLVA 1HDHA 4LR8A 1HQAA 4GTYA 4NWJA 1SHQA 1E33P 3SZZA 4UPHA 5L0KA 1ALJA 3UN2A 4QAXA 5HRTA 1N2KA 3DYCA 3NKMA 3UO0A 4B56A 4GTZA 1EQJA 2GSNA 1ZEDA 3NKQA 3WAXA 1ED9A 1E3CP 1HJKA 2W5XA 3IGYB 4UPIA 1AJCA 3Q3QA 3MK0A 1O98A 1ALIA 4LRFA 1ZEBA 2RH6A 3TG0A 4LR9A 4TN0A 2GLQA 2W5RA 5IJSA 1B8JA 3MK1A 4CXKA 4KAVA 3OT9A 4CYRA 4KJGA 2ANHA 3M7VA 1KH9A 4YR1A 3TX0A 3M8YA 5EGHA 5LRNA 2W5WA 4N7TA 1ELXA 2ZKTA
chains in the Genus database with same CATH superfamily
1URAA 3NAHA 3ZTSA 4OZ0A 1HWJA 4QZVB 1NK8A 3J81U 2VICA 4XK8C 2Q6BA 4YOEA 2XY5A 3H5SA 4KE5A 1XIQA 1UMJA 1RT3A 4NEZA 3RU0A 4MIWA 2XMMA 1DZ5A 2HW3A 4J7CA 2LKZA 4LFBJ 2ZD1A 1JLGB 4IFVA 3OXLA 2OLWA 1T03B 2XTJP 3I0SB 1CS4B 3PW2A 4M95A 4ZG6A 3GFYA 1RAFB 2YQ1A 4C9DA 2P2CB 4AQYF 2VC0A 1VLYA 4DV1J 1J5OA 1TELA 2KT5A 3T5KA 2XB2D 2OPPA 4I67A 1WEZA 4YR1A 3SSSA 3GYNA 3OTBA 4K4TA 2FZKB 4J9QA 4BHQA 1I94J 3BZQA 4E2FB 4RO0A 3W9HA 1DBDA 4F3QA 4RW6B 3CD0A 5AJ3J 3HHKA 5C42B 5DDOC 2HFNA 4DL0C 5D6GA 2PC6A 3BDGA 2IVFB 1NXIA 5D4PA 2CNNB 2I5JA 2CQ4A 1ACMB 1U47A 4OLOA 1RWPB 1XJWB 5C2CA 2JLFA 2J6UA 5LRMA 2XZTB 3PR4A 1RHQB 1S97A 3WQPA 1HNIA 3E01A 5KFZA 2X51A 1UL3A 3KD8A 1MMNA 1OY8A 3RTVA 4LR8A 5F8JA 1VK8A 5F8IA 2W9CA 2EKNA 1O8BA 1ZEDA 4HR2A 4U8YA 2KZMA 1B0VA 2ZDOA 2KH9A 2QT7A 4XIUA 2JOQA 1WG5A 4DL7A 5GMKa 2XZWA 4DR3J 1MROB 4ECQA 3EMTA 4JI0J 3MMBB 1JLQB 2V69A 3QO9A 2ZH1A 4I7FB 2R2UA 2YNGA 5BXIA 4ITSA 1FCAA 3FRYA 1QE1A 4AT1B 1NPKA 2DNZA 2F8MA 4LSNA 4TN2A 2D9PA 1FEEA 5LJ5Y 2DNNA 3BPDA 2OPSB 4I6AA 3AD7C 3KJVB 4OMFG 3ENQA 1NDCA 4RR5A 4WTOB 4DV6F 1TKTB 3PKYA 2IM3A 2ADCA 1BLUA 2BJDA 2UUBF 1HA1A 2C22A 5EHHA 1HQ2A 4B9LA 2RQCA 2ZEJA 4WF9Q 4A8SA 5JJBA 4NLPA 4CI0B 4KHPF 2O67A 1I51B 2KHDA 4TQRA 3IR5B 4N77A 1JJ2R 1NDLA 2XG8A 1IQZA 2FJAB 4K4UA 1FVSA 3A12A 1C2PA 1HBNB 1NPPA 2MEWA 4B9NA 3I5CA 5KT3A 2DD8S 1VHIA 1ZM2A 1KTQA 1JXVA 4KY3A 4TNOA 2VOPA 2OI2A 3DM2B 3NOGA 1HL6A 1SIWB 4B9TA 1UW4A 1UVKA 2GNKA 2LDYA 4RWXA 1VBXA 3CCVS 4UOOA 2B0GA 5B0FA 2R7TA 1NH8A 3Q22A 1V6HA 4U6PA 4ECVA 4PXDA 3G6YA 1F5BA 2Z2YB 1TK5A 5KFHA 3OFHA 5ETNA 5KG4A 2E7WA 1JXEA 2IM0A 2JFKA 4I2QB 1UVMA 1UEKA 3BN7A 2WRMA 2QMUB 5A0YB 4HDGA 1FRHA 2MZSA 2DO4A 2IC3A 1GEHA 1QSLA 2V34A 4DUZJ 2CADA 4L74A 1IBLF 3FSIA 4WFAQ 4H4KC 4HEA9 1LNQA 2DR6A 4IRCA 3CB4A 6FDRA 2OHDA 2AMCB 4B56A 3UD3P 1QTMA 2QA1A 2WB4A 4USKA 1SJ4P 2HHHJ 4RUAA 5CYQB 3NEKA 2OEKA 2NUHA 4BC9A 1YHQS 2UUAJ 2F8HA 2ZJQQ 3KJQB 2EEYA 1M1HA 1N32J 1QTNB 2HNDA 2XLIA 1VC6A 2V6AA 2FHKA 1JLEB 2DH9A 3ETMA 1CSJA 4ZG7A 1UAWA 1FK9B 3D67A 5E3RA 2G1DA 2HIQA 3PDNA 4M5MA 3M32A 3RYLA 1RK8A 1YGYA 4CYUB 1ITPA 1UA1A 4KIAA 3D54A 4QWEA 1ELYA 4MIAA 3H7HB 5INHA 4G1PA 5KT6A 1S1WB 1MMDA 3JS9A 2V4JA 5A8RB 4WFBQ 1RCOB 2MQLA 3N5FA 3KHGA 2F9JA 4F4ZA 3TQ1A 3RB3A 4ZLJA 2FZGB 1DQ8A 4FS1A 3IG1B 2CXEA 4ZCIA 4WP3A 5HO4A 2IRXA 4IQXA 1NK4A 4XAKA 4WTYA 4X4PA 3KLVA 2V68A 3ZFVA 2GIFA 2CQ2A 5DM7Q 3MM7B 2F4VF 1KQSR 2IBOA 4IR9A 3PTWA 4LBIA 3HSZA 3NS7B 4NRUA 3TVKA 1SH2A 2BKOA 4AXIA 2AF6A 1RHMB 3CC7S 2RKIA 4B3MF 4F4KA 2ZJRQ 2MQPA 3I9ZA 2WONB 2QZUA 3QSIA 1R6YA 1HW9A 1PAEX 1WEXA 4DV7F 4ICLA 3TWZA 2UU9J 1IBCB 2AEMA 4G6VB 1Y7PA 4ID5B 2VQEJ 5A8WB 2DIUA 2RF2B 3U7JA 3R27A 4JV1A 2DNLA 3X3UA 3PO5A 3GSIA 2C2RA 5GMEA 3LH2S 2GMLA 2Y3YA 1S1VA 2QLBB 2DRBA 4IH6A 2C2KB 4RX6A 1VMBA 3PW7A 1VBYA 3ITHA 1Y11A 1UJ4A 3G6VA 3L7PA 3P5TL 1VRUB 3DLJA 1SV5B 3KK2B 1G4CA 1UVJA 1QSYA 3EDRB 4MKAA 2KRRA 2XY6A 4HYKA 1K9MT 5J2NB 3MMAA 5JVGQ 3CD5A 2WVCA 3L7OA 3AH6A 2K3IA 5DS7A 5IJSA 4H4OB 2FJWA 1NBEB 2E5LJ 4OI4A 3AAWB 2PGCA 4DPWA 3D3BJ 2HKEA 5CZVA 1H3DA 1UEVA 3ZTRA 4OYZA 2K1RA 1WDTA 1ANIA 2YWWA 5B0EA 3JYTB 3VGUA 2F8EX 2QMXA 1T11A 5DLGA 1HNXF 4KJDA 3W2VB 5IJQA 3EWGA 1GXUA 3RAXA 4OX9F 4QPXA 2CJXB 1X5PA 5D77A 2NXNA 4KGZB 2QLFB 1UP1A 2C3UA 3A4TA 1KOHA 1DURA 2MHEA 3ISNC 2RS8A 4J9SA 4NLGA 3L3CA 2W2OP 3BBFA 4ZJOA 5DQIA 2FY8A 2R7RA 4IDKB 1DQAA 1HJKA 3TZWA 3CF5Q 1CC7A 3RBZA 2QL5B 2XS2A 1T03A 3I0SA 4Z37A 1CS4A 2UXDF 3A3OB 2HQFA 1E6VB 2RDIA 4ER8A 5C24B 3K17A 2AU0A 4TKTA 3HHNB 3GB0A 3EE3A 2VFRA 9ATCB 3FKBA 5B0AA 4NLRA 2BJ7A 3EUNA 2ZNYA 3JSMB 3W1YC 3CCRS 5CAAA 3LWLA 2CPYA 4P52A 2R8IA 2R9LA 4HACB 2BX6A 1FXRA 3MPUB 4RW6A 2HBYB 3LAKA 1KHKA 3SFUA 2CDQA 5HATA 2YBVA 5C42A 4ZGAA 4CLWA 1AW0A 4R5PB 1Y10A 2LU2A 2IJNA 1FRJA 5HMWA 5C2GA 1HW8A 1T3OA 2PT0A 4P7VA 2OELA 1SJFA 4X66J 1B0TA 4ZJQA 5SZTA 4B3OB 4K4XA 1C0UB 5IZHA 2CQPA 5C25B 5DQHA 2JEJA 4LF8F 1EQJA 3UWTA 1FEHA 4C3KA 2CPJA 2A0FB 2X7IA 4JUZA 2UVWA 1EAYC 4NA3A 3PO4A 2GV1A 3G9CA 1VQYA 2PN6A 5IC4B 3W8GA 2EFGA 4Y0FA 2QLJB 3I55S 2Q66A 1EW8A 2FY1A 2MKYA 3WAVA 2MLYA 3DN9A 3PVXA 2V8PA 1S0VA 4FNIA 4CT8A 5GOVA 2EKYA 1R8HA 2ZFHA 4V1Ak 3MM5A 2XMVA 3W8PA 3VZHA 3QBCA 4UZCA 1O5JA 4B9UA 2Y1LB 3PX6A 4FF3A 2E9TA 3CD6S 3GIIA 3MMBA 1JLQA 2ALYB 2G2OA 1BQNB 1FT8A 1QY7A 5F8GA 4I7FA 1FJEB 2WCXA 4A8MP 2V9WA 8AT1B 3M1VB 5LL6d 4CLLA 2VBYA 4J9RA 3DLKB 4YHHF 1UA0A 1ZAWA 4DSFA 1LWXA 2B4PA 3LOUA 1KHLA 4WFNQ 1S99A 5THWA 1JLBA 1I5OB 3PEJA 2E29A 3TZYA 2W5QA 5GMDA 2OP5A 5HP1B 3KJVA 1WOSA 3M8RA 4CO0A 4WBFA 1TKTA 3I4PA 2QJ3A 1Z1ZA 1F3FA 4ECYA 3A8KA 5KFSA 1BQXA 4G1QB 2MY7A 2YX1A 4DXLA 2XMUA 3OL7A 3UD5A 1Q8BA 3DI6A 2I0XA 5J2QB 4I6WA 1K0VA 1HBNA 4C0BA 1ALKA 3BBCA 2DGXA 4FYDA 2EG1A 3M6UA 2KXHA 3DM2A 4OZNA 4C8YA 1FWKA 4YN3B 4WYWA 5ETLA 3ZO7A 4DSKA 4ELUA 1RYRA 4WIIA 1NM2A 1KH7A 1PG5B 3ET6B 4DPYA 1A0OB 3AD8C 3PXGa 3KLGB 3HVWA 5D3GB 1X4AA 2ABYA 1TKDA 3BDFA 4FDIA 2VJVA 2W7PA 4FBTA 4FKXA 4LF1A 4CLKA 1MNEA 1IXKA 4ZPDA 2ZOGA 3M8PB 3FSYA 5DM6Q 1DQ9A 3EX7B 5A0YA 1OYEA 4W92B 3GFHA 2DGUA 5GAHU 2EFOA 1VJWA 2HVHA 4JI8J 3KLEB 1WC3A 1Q82T 3KUEA 2HZAA 2FJDB 4NE9C 4JI4F 5HI7A 4C7QA 4RUHA 1ZM4A 2ZBPA 3Q8VA 1REVB 3PIOQ 2DNQA 1JJCB 4F3MA 5CYQA 3C16A 2ASLA 3HP6A 1YJNS 3R7BB 4MFBA 4CLFA 5IS2A 2HQIA 1HHQA 3M2RB 1TL4A 4EFAC 5EUHA 4JI6J 2N3OA 1LFPA 2QYGA 3IRWP 1JLEA 4XTTA 2YQ0A 3MM9B 4F2RA 2FVCA 2ATLA 3MI7X 2FZCB 2LA4A 2XNQA 1WACA 2W9BB 2IUCB 2LCWA 4CYUA 3M8QB 3BGLA 4UY8T 5GADU 3GONA 1YK9A 3IWNC 4FS2A 3VGTA 4RZRA 1Q5VA 4K4YA 3Q8UA 2ZITA 2YPZA 4TN0A 3JSYA 2ZNZA 3IG1A 2BJEA 3HHLD 4X4SA 1HBOB 1KN6A 2R8KA 2ZZMA 3MM7A 2E1MC 1GTHA 3KLFB 1Y9OA 3NGDA 4PG4A 1GX6A 2QC3A 1E6YB 2JX2A 5H1SV 2WONA 4MK7A 2P9EA 1RCXB 1X9MA 5D8HB 1T3NA 4F3OA 2WSEC 1HI8A 3QMQA 1MN7A 3M8ZA 5ETRA 3MK2A 2CPFA 1X8DA 4JOUA 2KYXA 4ID5A 3Q83A 4ATNA 2VF3A 5A8WA 3OVAA 3RAMA 3FNNA 5IOLA 2UP1A 3SCKE 1H74A 4RW4A 1M5PC 2DXDA 3G6XA 1RBOB 3S01A 2E5HA 1D9FA 3KTQA 5IWAF 3R1LA 2M8DB 2IYGA 3OTEA 2B8QA 3RB0A 2M3DA 2VH7A 3VAJA 2EI5A 1VRUA 1SV5A 3BSOA 1ZA1B 3KK2A 2BE7D 3LTOA 4F25A 2FLOA 3T1AA 5J2NA 1UCNA 2DGQA 3M2UB 2W01A 2ASYA 3QGPA 4C2MA 3B82A 2AJQA 2VKRA 1RAIB 4B3TF 4LRAA 1OPIA 1T9XA 4W90B 1KNZA 5K14B 4QBUA 4H4OA 2UVUA 2AEFA 1V3RA 2UV8G 4LF7F 1RWVB 3P3DA 2RUGA 1SKWA 1VRQC 1AZSB 4GVLA 1W25A 4MIVA 3DXBA 1HWIA 2KM8C 2BKPA 3JYTA 3CJTA 4QCLA 4W4MA 5KG1A 4ENOA 1TUGB 2VUGA 3BYRA 1O6XA 4QIWD 1IUJA 2DEIA 1NKBA 1Y5NB 4JBCA 2XYPB 3W2VA 3M8SA 4ZCMA 1RWNB 1YG0A 2HNYB 2P9CA 4AE5A 3MFIA 2GSNA 2CPEA 1Q81T 3KK1A 2O01C 4ZCLA 2RRBA 2ZH2A 3P5BP 1IR1A 5IM0B 5J1EB 2NQPA 5BR8F 2HS0A 5IFMA 1NKEA 1RHUB 4OZ5A 1TZ0A 4FXDA 2GHPA 1F9HA 4IDKA 1P49A 1HD0A 1VC5A 4MTPA 3HCXA 1TFWA 3HT3A 1QUPA 4KT0C 4LFCF 3MEEA 1OIAA 2ZWOA 2HMIB 5FDLB 1DTTA 4DR1F 5C24A 3CCUS 2VDIA 1M5KC 2D1GA 3T01A 2UUWA 4I1TA 2CWKA 1CG2A 2D9OA 1UVLA 3G87A 4CNZA 3JSMA 2OAUA 2YKPA 1CJUB 1GMWA 1K0TA 4F36A 1LFWA 5HAOA 4HH0A 2PD1A 2RE1A 4GKKF 4HACA 3SYZA 3FEXB 1NNDA 4PQAA 2XC9A 4P10A 4JV5F 1Y0HA 3GIKA 4R5PA 3BGRA 1B4SA 2B3TB 3IAM9 4B3OA 1C0UA 2MGZB 2RDJA 5C25A 1R7IA 4NPOA 5HJXA 1VRTB 2C2ZB 3GR1A 3Q8YA 4U8VA 3C15A 3SDEB 4USTA 4D3GA 7FDRA 4URSA 2CNLB 2MDAA 3PG9A 4YUDA 4DV4F 3SXLA 2O66A 5HVFA 3A52A 1AFJA 5KFWA 1YRUA 2R8JA 2R7QA 5E3PA 3KYLA 3BO4A 1Z2ZA 1KOOA 5F41A 2V8GA 5CQGA 4L76A 1YJTA 4KKOB 2X1AA 3NMRA 4FDJA 4KM4A 5FLXU 4TY8A 4DR2J 1S6OA 1S12A 1S7IA 3N6LA 2CPZA 8ATCB 3ILIA 3EYZA 2E5GA 4FYWB 3W5ZA 1UW9A 2BW2A 2KO1A 3IGNA 1BQNA 4FN5A 1VYAA 1S6QB 3IM8A 4CLZA 4RNHA 3M1VA 3G86A 1R89A 4CLPA 1WTFA 4ANEA 4JI2F 4D3HA 3VWSA 4CH0S 3RJMB 1WEYA 3CJQA 2HHUA 2QX0A 3G82B 3HD2A 5HP1A 3NWRA 1NJYA 3Q86A 4ED2A 1N48A 5HMZA 3MTJA 2VQFF 1U24A 1RAHB 2HHTA 3PW4A 4PG7A 2AWZA 4G1QA 1WUUA 3B5QA 1J27A 2KL8A 1IWGA 4NXNF 1Q16B 3CDBA 5J2QA 3HT0A 5L0BA 5C7PA 4AD6A 1S5ZA 5DJBA 1T94A 2KI2A 2WZ1A 4O4RA 4GTXA 2HIYA 2XMKA 4ZDNA 5A6WA 1FO1A 3OTCA 2GQQA 4GKJF 2NUUG 4C8LA 4Y28C 1U26A 3ET6A 1FXLA 4WU3A 3KLGA 4DS5A 3PFEA 1YWXA 5D3GA 3MF5A 3N4WA 2J8SA 4Z2XA 1GQEA 1WC0A 5AE3A 1VQLS 3TX0A 5DZ6A 2FPHX 5KG2A 3M8PA 3CCJS 1LWEB 3KMQA 5ETVA 1LXJA 1FE0A 3WAWA 2HS4A 2V0NA 3OUYB 1GMVA 2F1FA 2FLPA 1JK9B 5G4DA 4C0OC 3JQMA 5KFFA 2N4DA 1REVA 2XHCA 3MZIA 2VHGA 2IFYA 5CXTA 4I6YA 2FHOB 3SCLE 2CJYB 5F9NA 2CPHA 4LFBF 4DZDA 4DBQA 3FVYA 1VIOA 1EKRA 2DY9A 3BKUA 5FLXY 5L1IA 3GFZA 4OJHA 2EK1A 1RU1A 1HKAA 4A8WA 5LOQA 4LFAJ 3SZZA 4GTYA 3T5LA 4UPHA 5C5JA 3T41A 3MM9A 2MZRA 4DV1F 4ZA1A 4U7UK 3JQKA 3GYXB 2AKWB 1VLOA 1LK7A 2ZH5A 3ZZ0A 1NPRA 2H54B 4NLSA 1S57A 2W9BA 3M8QA 2V9KA 3TOQA 2YWFA 4PG6A 3RW6A 2PEHA 4IO1A 1DLOB 2DHAA 3TVZA 3RBEA 1EIYB 1N36J 2LEPA 3ENVA 1IBKJ 3RB6A 5AJ3F 3R7SB 4J37A 1IJFB 4AXJA 3PW5A 3DYAB 5B09A 1J2VA 1YI2S 3T1HJ 3S6EA 3ED4A 1WF1A 4UOHA 2O5DA 4CM0A 3CE8A 2YKNB 1M5SA 2VA3A 3ZZOA 4LUBA 2RQMA 1RWMB 4RU2A 3PYEA 1HBOA 3JSRA 2AX0A 3IWXA 4IQMA 1YKWA 2IY5B 2XCAA 3CVKA 1JNZB 1S9GB 2CRLA 2VU5A 2IDLA 2AYMA 3CDAA 3M9NB 2ASJA 4KGVB 4P6QA 1RISA 2NR0A 1N0VC 4OYOA 1BWVA 1E6YA 3UD4P 3NKPA 4RUBA 3OVSA 3TR5A 2M8HA 1D9DA 1WF0A 3DGPB 1GT8A 4J9OA 3J81j 1KR4A 2V2QA 1A9NB 2RSQA 1FRMA 4LSZB 1RTIB 2RDDA 3W65A 4YR0A 4DUYJ 2R2TA 2KVIA 1VCTA 1HNWJ 1YTYA 3MCOA 1FJCA 3CJ5A 3QLHB 4ZPBA 5MLCV 1KH9A 4DR3F 1FDAA 4J9MA 1CLFA 3IRXA 1IVZA 2HPUA 1FSUA 1JX4A 4JI0F 2GSUA 3LAMA 1EB0A 1S6PB 4PXEA 2GHVC 2J5AA 1SH0A 2CZ9A 4CZCA 2E1RA 4TYBA 3CDWA 2IJRA 1U0SA 2M88A 2ZWPA 2DNMA 5KG3A 5CYMA 2AIRB 3DRPA 1Q78A 3LP0B 1H73A 4P2XA 4Q2MA 4C98A 3CCES 2WOMB 4BS2A 1UPMB 4MH8A 1RAOA 3FBCA 4EU0A 4WJBA 4Y2MA 1SL1A 1NJWA 1LV5A 2LEBA 1PBUA 5FD1A 3LF0A 3G4SS 5FIIA 1K7HA 1AZSA 5LMNJ 3W60A 2Z2LA 3H8YA 3WC0A 4NLYA 4KYZA 2UUCJ 3M4XA 4ZK7M 1YJVA 2N7YA 4YDXA 2FHJA 1RI7A 2LQ8A 1TKZB 2P5VA 3BB5A 2EPIA 4N41A 3UR3C 1ALIA 5LSOA 5A6PA 3FMWA 3BBBA 1EP4B 3KUGA 2HGMA 1IKVB 2FC8A 5MAOA 3JTOA 2HNYA 1TKXB 4B02A 2Y8YA 5D0GA 3BDHA 2QG9B 5IM0A 1QAJA 1ZPVA 5J1EA 2HQDA 3AB4B 3CJ0A 3HXMA 4L3NA 4FF2A 1Y6VA 5LMUJ 1R31A 2DIVA 5EGYA 3W9IA 1BE4A 1YITS 4RUCA 3HJFA 4JV0A 4OI3A 1V9OA 3F0NA 1F5CA 1WC5A 4LF9J 2KDOA 2IPOB 4DUZF 4OJGA 4Q5VA 4CIOA 1WORA 2B56A 2HMIA 5FDLA 1NK7A 2C2DA 4JB8B 5E3AA 1SIZA 5I4MA 2HHHF 3WIVA 1URNA 3V6HA 4A46A 1F0XA 1R8AA 4HVZA 3M2VB 2Z2MA 3OTOJ 1CJUA 2UUAF 1FESA 4WU2A 3K0JA 2ZE2B 1N32F 2HFVA 2V50A 4HL9A 2UXBJ 1S48A 4NWXA 2BACA 3NKRA 3HZGA 5H9EJ 3W63A 3K59A 4OFZA 1MMLA 3UN3A 2DR7A 3RR8A 4OJ1A 3CJ4A 5CCLA 1X4CA 3DDIA 3UCUP 4O3NA 2XMWA 1U2RA 1YRXA 4OHVA 4RKUC 1ZYQA 1YBTA 2NS1B 4ID8A 1M90T 1ZAXA 2RIJA 4ED4A 1MLAA 4DPUA 2DNRA 1DRZA 1P8GA 3SDEA 5D15A 4J9LA 3EJMA 4DMZA 4DLGA 2EK6A 1FDBA 5T41A 3NKYA 1G2EA 2D3OR 2XGQA 2W2QP 2A1BA 4KKOA 3H42A 4BDPA 4OYMA 2E9ZA 4QYZJ 2E5JA 4F4AA 4UPIA 1VHFA 4ZIWA 2CQCA 2E1PA 2BJ3A 3T6BA 1T05B 5DG8A 4YMEA 3TZZA 5ETPA 4M94A 3QJJA 1S6QA 2UU9F 4ZIVA 2CQIA 3EXCX 1R8BA 1TL7B 3QNWB 2IM1A 3IGVA 4QWAA 3EGNA 2VQEF 2MY8A 4XDDA 1SBRA 3HDSA 4ES1A 4JV2A 3FC9A 4WYLA 2QSFA 3G82A 5KOXA 3AOBA 4IOCQ 3AD9C 1HNVB 1R3NA 2NXEA 1FA0A 3SV4A 1N5QA 1JNRB 2ILZA 2M7SA 1RTDB 4DV0F 4YB7A 2Y8WA 1NHVA 1IKYA 4C3LA 4DS4A 1N5YA 1L3VA 2DTJA 1N4LA 1V5IB 2J7UA 1GFWB 1SC3B 5L9NA 1SHQA 3EVWA 3CCQS 2ASDA 3V4MA 3POTA 4RPFA 4DZ6A 4DF4A 2DR9A 4O3RA 3NKMA 2DJWA 3NY0A 3NXZA 3CJSA 5DO2A 2YXLA 3CJKB 1NRKA 4CO1A 4QYZK 2E5LF 1Q8KA 1M1GA 1LEOA 1FKAF 2ZUGA 2MHNA 1H0HB 2RB7A 4PCQA 2HVZA 2PI5A 4KO0B 2ZZNA 1FD2A 1SJQA 3BQ2A 1D9AA 1N33J 3TAMB 2D3UA 2W7OA 3THTA 3IR6B 3AXMA 2WSFC 3B6BA 2PSZA 2HHPA 4EEYA 5HL7Q 3A8IA 3NRBA 2FTRA 3NWGA 2K06A 2MZJA 3MCSA 4OYIA 1JLCB 1LWEA 2NPIA 1GAOA 1H72C 5B0DA 1K1SA 3PYGA 4L75A 2JEGA 3OUYA 4J9PA 4DR6J 1RE1B 2WVBA 3DOKB 3GJTB 3PRBA 1Q0NA 3T5HA 3B4DA 1X7VA 1PC5A 3IO1A 1I1GA 5EDWA 1CBKA 1ZH5A 4DPTA 5GAEU 4ED8A 2V8HA 1RACB 5HANA 4P73A 5ETTA 4ELVA 3Q3QA 1XN9A 4TXSA 5K8NA 4CYRA 4B3SJ 4DU7A 3AHPA 2ZJPQ 2EG2A 3AJ2A 3J7AN 3DC2A 1JQGA 2BM1A 3AA8A 3UW1A 5EWEA 4K2JA 2IHR1 3I56S 4QIEA 2GMHA 4Y2IA 1JLFB 1MU2B 3Q8QB 4C8KA 2VKZG 5D78A 3TEHB 1RWUA 5BYSA 1KLNA 2MLZA 4B3RJ 3UN5A 1DLOA 1NK5A 3NGRA 4OZLA 1V3ZA 2IVMA 2A6MA 1T9VA 2IMWP 4F4WA 3HVAA 4J9KA 2CJKA 2A18A 4K0KJ 4LJMA 5GAGI 1OS5A 3EM1A 4WP8A 2EFQA 2EVZA 4L73A 3MURP 4CO4A 1EJJA 3I82A 1T9WA 2YKNA 4K2XA 3HHLB 2U1AA 4OL8A 1GX5A 4X66F 4HT5A 4C8ZA 1RWOB 4YFUA 1WC4A 5AE1A 1QM9A 3VALA 1FERA 1S9GA 2AP6A 4QW9A 5DZ7A 4P75A 4CP5A 2YNFA 1WF2A 2ADBA 1GMUA 2WVEA 2LDIA 4MKVA 2DVIA 2DYAA 4A8OA 4HHJA 4KHPJ 3DGPA 2HHWA 4LF5J 1RKJA 2OMOA 2VBZA 2Q79A 3HFVA 1VQ6S 4OYWA 3DLEA 2XQCA 1U0HB 3QLHA 2HFUA 4QOTA 1YRTA 4PZVA 2HVEA 3VCDA 2JH3A 4WKYA 1OJ4A 4ZVRB 4OYXA 3J7A1 3IS9A 1YJ7A 2ZDPA 2ERRA 1Z4UA 3A8JA 1Y4ZB 3OD2A 1SQEA 2VPYB 5F8NA 1N52B 1RAGB 2JRSA 3DNCA 2GA7A 3MWBA 4MY4A 1G6BA 4LF2A 2OJ3A 1RHJB 2F5GA 3SFGA 2BZ2A 3LP0A 4K7QA 2WOMA 1D1UA 4BWMA 4I0WA 2W4DA 2FVPA 1CPZA 4QWDA 3CIMA 2GCFA 3CEDA 4NLTA 2VFVA 1TMJA 3WAXA 4HLBA 5BYQA 3KUHA 2MZQA 1RT2B 4DWIA 4DCJB 3HO1A 3M8YA 2W25A 2OSQA 2HHQA 3QRQA 1SJ1A 3GG0A 3PHTA 3DOMB 3JTNA 1HD1A 1YBAA 1UWBB 3A1YG 5KG0A 1KFSA 4KC5A 1LWCB 1TKZA 1WC6A 1WSVA 1XR5A 9RUBA 3R8YA 4TVAB 3CMQA 1X9WA 2DH8A 1EP4A 5KG6A 3R97A 3C46A 1WELA 2I6WA 1T8EA 4DOZA 2GGPB 1IKVA 1WHYA 1TKXA 1R0BG 1SHNA 2YWGA 3CC2S 3C6UB 2VONA 4CO5A 3RUBL 3CCWA 4QWCA 5LM7E 1ZOTA 5L8RC 5DLWA 3DRYA 4Q7AA 2RQKA 5AXNA 3RBXA 1OY6A 1N88A 1VS3A 1JLAB 2BANB 2B4UA 2RUSA 2V8VA 3VQTA 1UZHA 3MMCB 3FBEA 2Z58B 2BQRA 3UVJB 1XTZA 3RRGA 4JI8F 2W5RA 1HQEB 3VVTA 1YX2A 1DY3A 1WC1A 2CWXA 1UJ5A 1YDLA 5B7WA 5K5MA 1HWLA 4OYPA 1HHTP 2YH1A 5KFNA 3UFCX 2W5VA 1PYOB 4NEYA 4LQ3A 1U4BA 4QYRA 3M2VA 1KHVA 4PUOB 2H1YA 3CMRA 4R0EA 2F40A 2G0CA 1UWAA 1F2GA 2WBMA 3OXGA 5D0HA 3MTKA 3EXYA 3BEGB 4L72B 5CD4A 1C1CB 2W24A 3Q24A 2AEJA 1RTZA 5HVGA 2UXCF 1KH4A 2QTWA 1CQMA 1S1UB 5DETA 2VFUA 5DGAA 1TUWA 4B9SA 2AGQA 1N5TA 1VQ9S 1HPZB 2AJFE 3N28A 3QWPA 2FJVA 2ZZTA 4PQUB 4LR9A 4DR4F 3MK1A 2CZ4A 4OX7A 4CTAB 2ANHA 4ECWA 5I3UB 2GS8A 3CMES 2IJFA 4PR6A 3N01A 3EVOA 5JVHQ 3KHRA 2AJ2A 4C8OA 2W4CA 3CPWR 1CEZA 2HRTA 1WKJA 4RJVA 4NI2B 2HK2A 1RWWB 1P27B 2BV3A 1WHWA 2X98A 2J7KA 1T05A 3O5TB 2J9CA 2PMHA 4RBTA 4YDDB 5DG9A 3QAEA 4MHXA 4KGMA 2A6OA 3AB2B 2HBRB 1HIYA 1Q95G 4EBEA 1TVRB 2R8GA 1RQ0A 1RBAA 3ZZZA 1TL7A 3H20A 3DU6A 3WBHA 1DTQB 2EFPA 5K20B 1P9YA 4WFZA 3TJ9A 4QQBA 1QLNA 2HK3A 5AE2A 1HNVA 4F7VA 5HLFB 1OY9A 4R25A 1IKXB 1AA1B 1W2IA 4OX9J 6FD1A 4HI2A 5U47A 1ZZFA 2XS5A 2AYEA 2ZBCA 2G4BA 3QGHA 2JWNA 4IH5A 2Z0GA 2KFYA 2VV5A 1A7GE 1T9TA 1Q8LA 2Z30B 1X4EA 1B64A 1EI6A 2QEXS 4J90A 3NCRA 3Q2SC 3CJKA 2DNGA 2R7SA 2UXDJ 2BUNA 3N6NA 3OVBA 3UNYA 3P8BB 1IM6A 2POKA 5EWGA 2QA2A 4KO0A 3D0HE 1Q8IA 1X60A 4PAAA 3TAMA 3FMBA 1NO8A 3I31A 1MWQA 1FKPA 1F1BB 1WD6A 3THPA 2XMJA 1PIEA 4KHMA 1WI6A 4ZP7A 2D41A 2DNYA 2NREA 1WHXA 1AJDA 5IXUA 3KHHA 4U7UD 1JLCA 3R7NB 1M5OC 1ROFA 2MZTA 4EO8A 2ZH9A 2LQJA 3ZZYA 1Z2LA 1Q53A 4DV3J 3TG0A 3DOKA 3PHEA 2W5WA 4YR2A 4PKDB 1U1QA 4URQU 1P9QC 3J81Y 2HSEB 1NCLA 3KLIB 3K5MA 5AXLA 1VK3A 3UDVA 4M5JA 1M0SA 2LLZA 2KTQA 2WTFA 1X0FA 3MM6B 4DL5A 5HMXA 2JC0A 2CG8A 2I38A 1S72S 1ZEFA 3FJ2A 2BE9B 1HI1A 5GAEI 4OQJA 1IM4A 2BABA 1Y5LB 1YIJS 3N79A 4X62J 1SC1B 3NGSA 3MUVP 1JLFA 3HHLC 3UE2A 2W8DA 3W5YA 1MU2A 1KQKA 1KHNA 5IT4A 4H4MB 2ROGA 4ETZA 1XERA 1FWPA 2CJBA 1U6ZA 3HJVA 2R7WA 2MZ1A 4DR5J 3PJWA 1VQ7S 3ZTPA 3LW5C 5ETOA 5DDPC 1NJIT 1PGZA 1ED9A 1QUVA 1NHKL 1R8CA 2FGOA 3KK3B 3H4DA 1AJCA 4ZCKA 1OQ3A 5CYJA 2B43A 4YHHJ 3HHLA 3TO8A 1X4DA 2V4QA 5A2QU 1HMVB 2E5IA 3DLGB 3QIDA 3HSJA 4NMXA 4KAVA 2I8EA 2OFHX 5ETSA 2B6AB 3DLLQ 2ZKTA 4EGLA 4L3KA 3CNQP 1IBMJ 3S8SA 2XY7A 1D3WA 1RLDA 4UOFA 1XNRJ 3CIZA 2AJ0A 4DFJA 2F7VA 2HLUA 3MEDB 1FRKA 3O2IA 1Q5YA 4YP3A 4DV2J 1E2SP 2OD4A 5D0RA 4LSLB 2HAIA 1CJVB 3VQSA 1VQKS 2CQGA 1U6FA 3D3CJ 3H5UA 3T9ZA 4EO6A 4Y34A 1YZ7A 3R6LB 4DR2F 1KLMB 4ZVGA 4I4BA 4HT7A 4R8UA 1RKIA 3D7SB 4YS2A 3TQEA 1U0HA 1LW2A 2IFXA 2KVQE 1BQMB 3KOAA 2W8SA 1WJ9A 1S10A 5E33A 1KKHA 3I0RB 1WG4A 3FCVA 3ZNUA 1L3TA 2ZH3A 4I69A 1LWFB 1MG7A 4ZLLA 3OSPA 3NNHA 3PCOB 1KC8T 4GMKA 4H4KA 2DK2A 2MQQA 3MECB 2V2KA 2OPRB 4MYTA 2C1EB 3CCZA 3OT9A 3MR6A 4WZMA 3BREA 4OZ3A 3IGZB 1U1OA 3H2UB 4WKRA 2OIHA 2EBGA 3FGVA 3T02A 2D3O1 3OPKA 3OFEA 1WTBA 1XNQF 4USVA 1HFEL 3W2WB 5CZXA 4A47A 4TU9A 2YQ3A 4QW8A 2Z8QA 3FEYB 3M9OB 2ZVIA 2RAQA 3SMZA 3I6PA 2HHXA 1LWCA 2EFNA 4JI5J 2MKHA 3LALA 2C28A 2J0XA 3V5RA 2NXJA 4ECXA 2NZ4A 1HQUB 2CQHA 1AJBA 2IDEA 4IFVB 1ANJA 3KJNB 3FCHA 4NCGB 3ZZPA 2DITA 2HFSA 3VGVA 3BGUA 2GGPA 4OLPA 3J7Z5 3MD1A 1YQHA 2DR8A 3QRRA 4KSEB 3DDNA 1VQ8S 3O8WA 3C6UA 4UF4A 4NLDA 2HHSA 2W5XA 2D69A 4NCBA 1H7XA 5D4OA 4WXOA 3RG6A 3TA0A 4CXKA 2C3PA 3CJ8A 4O44B 3DDKA 4K4ZA 2NYIA 3PFOA 1BMQB 5DLFA 5A2QY 4G65A 1FDNA 1RYSA 2CUYA 1JLAA 5KT4A 2WB1D 5J1PA 3MMCA 3J80U 1C0TB 4JYAJ 2D7SA 2MLXA 3GE9A 2DH7A 3UVJA 2GIQA 3D1OA 2X1BA 4M63A 3BDGB 1H2VZ 3BO2A 1HQEA 1U2CA 2A2CA 3MGJA 1RTJB 2CNKB 4DR7J 1FF2A 4NLWA 3PIPQ 2GQCA 4UQTA 4LR7A 4CLSA 4F26A 3PKMA 4RW9B 2RH3A 2ZH8A 4PUOA 3OL9A 1AT1B 4EZ6A 4OIXA 3GV8B 4I68A 4ZJLA 4LFAF 4U9RA 4N8NA 3ZTOA 1FVQA 4NWJA 1N34J 4ERDA 2R2SA 5ETQA 3PY8A 3QZ8A 1C1CA 2VIHA 1QVFR 4LIWA 5HROB 3T1YJ 2GW8A 2W9AA 1VJQA 1Y00A 4I56A 3OHAA 1S1UA 1VQSA 2NCKL 4DFMA 3FRZA 3D68A 2C2NA 1WOPA 1QJHA 4M5HA 5IWAJ 2DEJA 2MQMA 1IBKF 4FPRA 2AX1A 3DMJB 1UVIA 1HPZA 2N7CA 4U7CA 4NMLA 4CXUA 3T1HF 2AQ4A 2LQ5A 4PWWA 1TP7A 4PQUA 2YNIB 5HN0A 4HKQA 3R1HA 1RLCL 1R43A 5I3UA 2HWIA 2KM8B 3WX8A 1PC4A 3HVTB 2BOAA 4DSEA 3DCAA 1X31C 2CQDA 1AROP 4B9MA 3DRXA 2MJUA 4HI1A 1IWAA 4P7TA 1TV6B 2ZM6J 1RAAB 2N82B 3D5MA 2P9GA 4NI2A 3V2UC 4ZP9A 4DQRA 2IA0A 4EUVA 3M6VA 1EHWA 2B4VA 1LXNA 4CM2A 1UETA 1JLGA 1AUSL 1W7WA 2Z4PA 2FVQA 4Y3CA 3QYYA 1RTHB 3TA2A 2OTLS 2VDHA 5FJ4A 1TVRA 2KZZA 5HRTA 2KJVA 1EZZB 3SV3A 2H48B 1HNWF 1DTQA 2XGPA 2JNJA 5F0UA 2LU1A 2KXNB 2L48A 1RA7A 2DNHA 3BM7A 4O23A 4Z7YA 2LVWA 1TU0B 3BJYA 4USUA 5HLFA 4OV6A 1K44A 5EX3A 5KFRA 2DHGA 1IKXA 2GQ2A 4CLYA 1U1PA 1QSSA 3ZZUA 3GMGA 4CYSA 3F44A 1JKHB 2MMYA 2PA8D 2B9WA 2HAFA 5KFJA 1X4BA 4QR2A 1FTRA 1VDHA 4HDHA 4ED6A 4TU8A 1WOOA 4A8FA 3UDCA 2BR0A 3NVLA 8RUCA 3CCTA 4IKAA 5GVQA 4KPCA 1TK0A 2QGFB 4TY9A 4FXWA 5LMNF 1RBLA 4DR1J 1B3TA 1ICEB 2COLA 4DX5A 4A8YA 2UUCF 2HQCA 4PEOA 3FFIB 3UN2A 3W7BA 1ALJA 3I32A 3KHLA 4K5RA 3AA9A 1V3SA 3R3TA 4B9VA 2HVDA 3J7ZT 1XBWA 2A3JA 3CD7A 2FHMA 1B99A 4MKYA 3N5BA 3KDNA 1PBAA 3BF4A 3MM8B 2JVRA 5EGHA 2CQ1A 4OHWA 3RGIA 1IQTA 4KH0B 4J9VA 4TU7A 1MROA 3WZ0A 3DU5A 1U49A 2HFOA 1RT7B 3IM9A 5F3ZA 4Y2CA 4IOAQ 4KR0B 4O3PA 3M32B 4ZVOB 4EK2A 1FHTA 4CH7A 1XMOF 3TUZC 1KFDA 1TQLA 1MWYA 3GYGA 5E0OA 3QRPA 4R0JA 4U67Q 3KLIA 2H9ZA 2V4JB 2DGSA 2OPSA 3NP5A 4NZ0A 3C66A 2ACYA 4LF9F 4ED7A 1D8YA 5L38A 3MM6A 2XLKA 5B0GA 4KQZA 4ED1A 3U1MA 1SL0A 3OBIA 1RJJA 2EFVA 1UPPA 1K8AT 4ALZA 4RNMA 4Y00A 5KFDA 4F0HA 4Q43A 3UO0A 3HSDA 3Q89A 4H4MA 5KFBA 3OTOF 2LXFA 2J9EA 4NYPA 2C2EA 2P8IA 3QATA 2UXBF 2MJNA 2DNPA 4ED3A 4JI3J 2OGUA 3H4BA 2ZOMA 2YKOA 3CWJA 3MUMP 3C8YA 3BYPA 3G96A 1GNKA 3KK3A 2DCLA 5TJ3A 1AFIA 4DV5J 3ISZA 1OSDA 3GCXP 1FX2A 2FQQB 2J7WA 3DLGA 5JMNA 2Q1LA 1EX8A 2MB0B 4CO2A 2B6AA 1VISA 2BVZA 1S1VB 4PXBA 3AFGA 4YB6A 3OSNA 3DGVA 3LGMA 4LF6F 1OWXA 3ILLA 4QIGA 4X65J 3H0PA 5KFYA 4I2QA 3MEDA 1VQOS 3ELHA 3ITHB 4K5SA 2B51A 1DJ0A 3K7RA 2XSJB 3DRSB 4LSLA 4YB1P 1HI0P 4LREA 2HGLA 2GAGC 2LXUA 4KAIA 5E7OB 3TW0A 3OJSA 2XSFA 4USIA 4K4SA 2JZ5A 1KLMA 2XO6A 4M5GA 5A8KB 4ECSA 1NMEB 1NUEA 4ECZA 1YJWS 1BQMA 5T7LB 3JB9k 1M5VC 3NGKA 1U6BA 2C42A 4P9SA 5F8HA 5ETKA 1TL3B 2K1RB 3ONQA 2G0JA 2PEBA 4C4WA 1XMBA 5LIAA 4O3QA 1S1XB 3PV8A 4LQYA 3MECA 2OPRA 4LRBA 2RD5C 1FK9A 2ATCB 4FPIA 3WC2A 5A76A 5KG5A 4ZITA 4NCAA 2JLEA 3ILJA 4YY3J 1S1WA 4QWBA 2ZOFA 3TUJC 5A8RA 4X4RA 2U2FA 3ENWA 5KFEA 2DBBA 2HQGA 2V8DA 3W2WA 2IBKA 4UW2A 4PABA 4M1KA 3PR5B 5DDQC 3HPOA 2B7CB 2VOOA 5HQ8A 2QMWA 4Q45A 4CDIA 2M0GB 3JAMU 3MOJB 5HVHA 1ELOA 1HQUA 4QU7A 5HK4A 5BJRA 4WIQA 1SVDA 5F0WA 2RH6A 4NCGA 2LQ9A 2H4YB 1S7HA 5KTQA 1HYSB 4OHYA 4LMZA 1XK8A 3OXFA 4MJKA 2Q3PA 1A6LA 4J91A 3TYTA 2MXYA 3JXOA 2HG4A 4DU8A 2GSOA 4FNHA 1CQNA 3MMJA 1RA6A 2EW9A 1KTVA 1BXNA 3CTRA 4NXMJ 2I2YA 1N33F 2F65A 2IYIA 4GTWA 1BGXT 2RU9A 4Y2AA 4UOPA 1EKSA 3W64A 4DI6A 4O44A 1IKWB 3R5DA 2RF2A 3BGOP 3QJPA 5K9FA 3BSNA 4GRSA 1C0TA 3DKDA 3S7RA 5B0CA 2M52A 1RT5B 5E3CA 3EVMA 4DR6F 3I96A 1RTJA 4E0DA 1U2FA 1BY9A 5LSRA 3OQ2A 3D1HA 3AQOA 3HI9A 4ECTA 2IM2A 2L08A 3TA1A 5KFMA 1RT6B 4FZVA 1ZBTA 4OYBA 4YR3A 4RW9A 2GJFA 2B4OA 1SH3A 1U1RA 1O98A 2YWKA 3M6WA 4B3SF 1H7WA 1RT1B 4RW7B 3EPIA 1JXLA 4RNOA 2LP4A 2RRAA 2OUGA 3GP9A 4ZVSB 5HROA 1TAQA 3T6JA 3BGFA 4UOGA 3C14B 3MM5B 1X5OA 1I6JA 4B3RF 2NSBA 3VF0B 2C2OB 2WVDA 3MPYA 2M2BA 4K0KF 4ECUA 2K7JA 1S76D 3DMJA 3AOCA 2C3OA 3HLUA 4CXSA 3R5BA 2OEJA 1VFJA 5D0EA 5AXMA 5KXAA 3GR0A 4DPXA 2YNIA 5J2PB 4ES2A 1JLBB 1R0AB 3HVTA 3OLBA 2JVOA 2QA4S 1FNOA 1TV6A 3D4JA 2LFVA 2RRNA 1VGYA 3JAMY 4NZ6A 4N5SA 4ZVFA 3A8EA 3L7UA 2XMAA 2HYIB 1VQ4S 3VAGA 3FCWA 3HMJG 2DKOB 3BQ1A 4OJ3A 3NNAA 1RTHA 4LF5F 1AXQA 5HQMA 4DLEA 1SQGA 1E6VA 4GC7A 3DI6B 3K5PA 4TYAA 3KKFA 4NX9A 3BDEA 5EGEA 1Y7AA 3CMAS 3GQCA 2OMLA 3LPEA 2DGOA 3MR2A 3KNAA 4X4TA 3R6GB 2VL1A 1XWLA 1UKUA 3CCLS 1HLWA 1KH5A 4U95A 3OFFA 5K4PA 1JKHA 2M4MA 3LUYA 2MTLA 4PG8A 4QPTA 1KEKA 5LSLA 3L4BC 2XBPA 5LXRA 4DQQA 3W9JA 4KJIA 2RILA 1U8WA 4ECRA 2M70A 2PFFB 1SCJB 2F3JA 4ZPAA 3DYCA 1G1XA 1NLKL 4GTZA 1KVKA 4GO5X 3D1QA 3GWCA 1JMTA 3HFKA 2DPIA 3TVYA 2MQNA 4EBDA 4M5LA 5D4LA 1ZZNA 1CULB 4ZPTR 2CPXA 3HM9A 4GO7X 2MKJA 4GC6A 1PYSB 3FFIA 4F4XA 2QE5A 3QQCD 1Y5IB 4C3MA 2ILYA 4V19J 3C16B 3CO9A 1V5VA 4MAKA 4MFBB 4CLTA 1EW2A 3GJRB 3ZC4A 3MM8A 1EW9A 3AODA 2BRLA 3M8WA 2J9DA 3NOCA 3SSQA 3TJAA 1PJ7A 1RT7A 2Q6CA 4IG0B 3MUTP 3U1NA 1PILA 4PRFA 4LBPA 3W61A 4DQSA 3TZXA 2CPDA 2DB1A 2QV6A 3DLKA 4XPCA 1D09B 2PIIA 2MKSA 4J9UE 5AT1B 4CWBA 4LIRA 3K89A 1TL5A 1IN0A 1REGX 2JC1A 1KDNA 4A8XA 1HR0J 2V4RA 1RAEB 4C0HA 2KG1A 3PZPA 4RW8B 3BH7B 1B7FA 3OJUA 5CCMA 2XHWA 3K8WA 5LRNA 1KBRA 3FEZA 3L09A 3VGSA 3HKZD 3AJDA 4ZVUB 1D0EA 3M30B 3PM9A 2EWHA 2H5IB 4DCPB 1RXOB 1UFLA 5KAKA 2L9NA 1UJ6A 5L9XA 3RAQA 4RBVA 2QZ8A 2BYCA 1VR6A 1T7PA 3OTDA 3H5YA 3WX4A 2HWTA 3NAIA 1PO6A 2X1FA 3IC1A 4KGXB 3R5JB 2VBWA 4FYYB 2HRYA 1FRIA 3ZXWA 4RW4B 2ROPA 4C8MA 5KFTA 2OH2A 2OEMA 2MKIA 2HHVA 4DV0J 3D6MB 3H90A 5RUBA 3PRVA 2XSJA 3DRSA 3W5XA 2HBZB 2Z57B 3DRRB 2QL7B 3SSRA 2JL9A 2CQBA 4ZPWR 3T3FA 1OYDA 3KLEA 1OPZA 2CAJA 2FIUA 2IMOA 3H40A 2AD9A 4E98A 4RBUA 2E1CA 5A8KA 2KRBA 5GAHI 2OSRA 2FJEB 1FRLA 5T7LA 3MD3A 1FD8A 2GX8A 5KFLA 4ZS6A 1H98A 3E2EA 4K59A 4O0NA 3M2RA 2D3ZA 1TL3A 4J5OA 2L41A 1RB0A 1C1BB 1S1XA 1YVFA 3PACA 1TL1B 5LJ3Y 4EMDA 4J9NA 1OQ6A 1FKOB 2BRKA 3SCJE 4K50A 2IUCA 2E66A 2R7VA 2ZHAA 2EXUA 3RRHA 1I94F 3KK1B 2JEIA 3G8TA 3AY0A 2BBEA 1HBMB 5KFOA 3Q23A 4ILMA 2CDRB 4P2SA 3S1TA 1S6UA 5GADI 3SZ2A 2QO3A 2FB0A 3KG1A 4K4WA 1GTEA 3B8HA 3I5AA 4EYHB 5B08A 1NU4A 3HKWA 3VV2B 1OSCA 3KWMA 1VQ5S 4ZPVR 2VQRA 3E2DA 1HHSA 4C6AA 1XMQJ 2OO4A 2HEKA 3N9UC 2ZKUA 4NYOA 1U8SA 1S0OA 3ZNJ1 4P2FA 4HTIA 3KLFA 4BBYA 2FUG9 3RRKA 3MEEB 1HYSA 2Q43A 1DTTB 2HQ3A 3DPCA 4OX8A 3PRDA 3LANA 1MN9A 5KFAA 2W5SA 2KFZA 3THVA 3D0GE 2DGTA 3TAQA 5ADZA 2D74B 5DG7A 3NGTA 5DRKA 4X64J 4OHXA 1GH8A 3OR1B 2CQ3A 1IKWA 2FDNA 4B08A 3VAMA 3MEGB 2VG7B 3UCZP 2W7AA 2HFZA 1HBUB 4UY85 5K8PA 1YZ6A 2B7BB 2DXEA 1KQFB 1EETB 5HMYA 1ZTWA 3PJXA 5L1KA 2HRUA 4CNYA 3UCGA 1B7YB 4DV3F 1RT5A 4XDCA 5BYRA 3Q2TC 2DY1A 3GLJA 4ANCA 3FZ2A 1NB7A 3BGRB 3AT1B 5HJYA 2GVDB 3WBZA 3MAHA 1S0NA 3HX9A 3TARA 1T9YA 1RUSA 2WBRA 1WHVA 3NGUA 1RT6A 1U02A 3CUNA 4LF4J 3M2UA 2ZC3A 3C15B 2NYHA 5HSPA 4CCHA 3QT8A 2BQUA 1RT1A 2NSCA 4JI1J 3RW7A 6AT1B 5K14A 7FD1A 4RW7A 3T00A 1Q7LB 3V6KA 4X62F 2R4FA 3H98A 3OL8A 4Q0BB 3G2XA 4TY8B 3C14A 1RT4B 2A2DA 4IG3B 1S77D 2MYFA 3TX8A 4TQSA 4DR5F 4ED5A 3F41A 3IN5A 1NZ8A 4S0MA 3MAQA 3V4IB 2DT9A 4RLEA 2CPIA 2V94A 3TEGA 4ZVEA 3PX4A 3RR7A 3I4HX 3DOLB 4G3IA 1IR2A 5J2PA 4DF8A 3DHWC 1R0AA 1IBMF 1S59A 2K2PA 1S0MA 1XNRF 4CRJA 1KVIA 1CJTB 2XNRA 2XZDB 2DGWA 2CFXA 3QFWA 4DQIA 1ZAVA 2Y1JA 1F9EB 4LT6A 4DV2F 2P6SA 2UZAA 3QIPB 3IR7B 4PG5A 1FJGJ 1BWEA 1DHMA 2ZH7A 1RSCA 2WAQD 2L9WA 4NYZA 2QSWA 4F2SA 2NPFA 3NKNA 3ZZTA 2YKMB 1H6KX 5F3TA 3H5XA 1GXLA 4USJC 1NZAA 4PPZA 3CO0P 3W66A 1NJXA 3KDOA 4KH1B 1FNMA 3FSXA 2UV8A 3EPGA 5E41A 4KRWA 4NA2A 3QWUA 2GFFA 1T95A 2FGCA 4FBUA 2IAJB 5J2MB 5KT7A 3NNCA 3QT5A 1J5EJ 1ZPWX 5L46A 3E51A 2VA2A 2QYCA 2XMTA 5L39A 1X4HA 1WI8A 4P2MA 1R6VA 4OZ1A 3O44A 1NDKA 4FYVB 3BDPA 2MGZA 1G7CB 1PKUA 1VRTA 3FQKA 3PW0A 1WSRA 3W62A 4IFYB 3G8QA 2AW0A 2MPUA 1AUKA 4X4NA 1CULA 1CVJA 2WHOA 3IDDA 1H2UX 5IV3A 1FNXH 5IC6B 4JI7J 4LVNP 4JI5F 3ZTQA 1CJKB 1U7LA 2IRUA 2RU3A 4WWSA 1FDDA 4ZOSA 2DPJA 2XRGA 2DHXA 2O3DA 3GSDA 4AL7A 1HNZJ 2CNOB 2XLJA 2E7VA 2XS7A 1RAJA 1ED8A 4M5DB 1RHRB 4WFYA 1O51A 3M6XA 2WW4A 4IG0A 3B78A 2LA6A 2YPYA 2IRYA 1YLXA 2DHHA 4Y6IA 2ROEA 2UXCJ 3HVRA 2M5YA 1VC0A 3I87A 7AT1B 5KOWA 1SB6A 4I64A 1ELXA 4JYAF 2OD6A 2W1BA 4FXVA 4DFPA 5IQ6A 1PJ5A 3IBFB 1IJEB 3LQVA 3D6TB 5IT0A 4DR4J 2H65B 4RW8A 4X4OA 3TUIC 3HD1A 4JP8A 4DR7F 4PWDB 4X4UA 2H51B 4PYAA 4DL3A 5HQLA 5LT5A 3MPWA 1EQ0A 3NS5A 3AQPA 3M30A 3HHDA 4NLVA 4ZLPA 3L95X 1Q86T 2FC9A 2GA3A 1VQMS 4NLUA 2OKQA 2MQ8A 2QRRA 1N34F 3K58A 4F0KA 2I9SA 1RADB 5ETMA 2GJ2A 3GPAA 3QZ7A 3KFWX 4AQYJ 3T1YF 2PDAA 3UNGC 2H5JB 1BHNA 2BXJA 2VPWB 2XCPA 2GLQA 1U1KA 1URRA 1LW0B 3BR8A 3HSGA 2GVZB 3IRXB 5J1NA 2QA4G 1UTAA 2B5JB 4ZHRB 3NG8A 1MWZA 3M05A 4O3SA 1AYEA 2APOA 4WK1A 4IRDA 5CYMB 3DRRA 4WP9A 4PXCA 5I42B 3DRPB 4RL1A 4DG1B 3HK2A 1KS2A 3NLCA 5KFXA 2KU7A 4UOCA 3VVUA 1EARA 3DHXA 2ZM6F 1K73T 4FF4A 2GO8A 5SUHA 1U45A 3WAYA 2KN4A 2LYVA 2DCUB 3TUPA 1P1LA 1F9FA 3NBPB 2LXIA 2VD3A 3SCIE 3CSKA 2GIRA 3ZZRA 1NK0A 2A10A 4HH1A 4AFFA 1ZETA 3T9NA 1H2TZ 2G0IA 1F6TA 1W2BR 1C1BA 2KHCA 1TL1A 4KB7A 4A8KA 1E3CP 2YX7A 3AXKA 1Q1KA 2R2RA 4ZN1A 1LOUA 2PI4A 1S79A 3M9MB 1D8ZA 3VZIA 4DN0A 1FKOA 1PCAA 2VG6B 4WK3A 4UUWA 3K5NA 2CG4A 4DL6A 1NHUA 2J0QD 2ZC4A 2PMWA 4DL2A 3HFZB 2ZH4A 1HBMA 3DYAA 2AZ3A 1IR0A 2Y0SD 1SL2A 3LP2B 5DLTA 1S1TB 2VPXB 3MAAB 1WKKA 1YBUA 1KSPA 4ZP8A 1RWXB 3LGHA 3SEOA 3JSBA 4KHRA 1NAQA 1O99A 4LRCA 2J76E 2KFNA 3A3PB 3NMAA 3LP1B 2J8AA 4DPOA 5JXSA 3HHEA 4DV6J 1KHJA 1R8PA 2UUBJ 4MT1A 1FWLA 1HQAA 2MKCA 5KFUA 2XI2A 4HHUA 4OZ2A 5CABA 3BS9A 2AYBA 5G0RB 3E3XA 3TAPA 4M5IA 1RTIA 2Y9HA 1N0UA 2WSCC 4LRFA 3OR1A 3IWLA 2E9RX 4I2PB 3MEGA 2VG7A 2EC0A 1KQGB 2ZH6A 1HBUA 2C2MB 2QFIA 3IAS9 2FLNA 1EETA 5CHCB 1JJ4A 2FD2A 5LXYA 1S6PA 2W8KA 4ED0A 2PFDA 4LQ9A 1EJ7L 3P45B 1S9EB 2GVDA 2VC1A 4ZMMA 3SIPB 3CDEA 1ZM9A 1E1ZP 4QU6A 2PA3A 3SQOP 3EICA 4O4GB 3GCWP 3UDEA 3LWMA 4USHA 1XR7A 5CD4H 3WDOA 1UVNA 5GRRA 2V2VA 2G1HA 5HBMB 1IBLJ 3N0VA 4Q8EA 3V6DB 4F50A 4Q0BA 3MPVA 1RGVA 3FDSA 2FVSA 5T14A 4WE1B 5E3QA 1K1QA 1RT4A 3IGYB 4IG3A 4F04B 2BQ3A 1N5SA 4NL5A 3OLAA 2XWXA 3F56A 1HWKA 3EGZA 4JI3F 3V4IA 2HZCA 4IYQA 3D66A 3Q8SB 2BW7A 1TK8A 3KNGA 3DOLA 3NL0A 2QN6B 1QAXA 4DJBA 4DV5F 3FK4A 1CC8A 1ALHA 2AHOB 4DL4A 4UPLA 3ISND 3GILA 2AGOA 1QAYA 4KPYA 4FDFA 4L6V3 3R5CA 4M5KA 2WK4A 4X65F 1CJTA 2X1GA 4NLOA 3VAKA 4DX8H 4LR2A 3QIPA 2B9YA 1IKYB 1N6QB 1N5YB 1XNQJ 3UI3A 4BLGA 4W98A 2HWHA 2AGPA 1KRPA 1JB0C 3E8OA 1BC6A 2E1AA 4Y2KA 2V67A 3LO3A 2HNZB 2EC2A 3D9BA 3POTB 1RP5A 2RT3A 1NKCA 2YKMA 3TANA 2PMZD 4M8LA 2DNKA 3PNIA 4FF1A 4UQGA 3IBWA 1F3VA 2HVIA 2F4VJ 2I1RA 2JHEA 3HZEA 1RZMA 2DRAA 2IAJA 3C3LA 5J2MA 1AUDA 2ZE2A 3MFHA 4B3MJ 4JI6F 1N8RT 1VOMA 2RJZA 2B9EA 1F5AA 3P49B 2N4CA 1OO0B 4DV7J 4OZJA 1QAIA 2BEFA 2WVFA 5DDRC 5KFGA 2G2ZA 2BA9A 1YJ9S 2VBXA 2ZHOA 2OFGX 2XULA 1SKUB 5EX0A 2LQBA 2L3MA 3V81B 3LA0A 1NSKL 2CJQA 4YY3F 4X2BA 2PO4A 1ELZA 4P74A 1X5TA 4IFYA 1UZDA 4NA1A 3C19A 3TP2A 5KFCA 4URGA 2G9YA 3GTYX 4LVOP 1R27B 1KVJA 3PJ9A 1CJKA 2DRDA 3Q0AA 2HLTA 1C4AA 2P6TA 3OR2B 3PX0A 3PEHA 2HZVA 2R8HA 3T5JA 3C2PA 1L3KA 2OPQB 1L3SA 3O3LA 4Y65A 2BJ9A 4M5DA 3KJFB 1VBKA 1F2HA 2JDJA 3MCNA 3FBFA 3MCMA 3US5A 4NXMF 2IA6A 1NK9A 1NDPA 3KXDA 5F9LA 1AB8A 1JIHA 5GAGU 2J9DE 3QGIA 1O0PA 1RDRA 2RMLA 4K8RA 2QLXA 1LQ9A 3C6TB 2VASA 4YEAA 3VTIA 1QD1A 4EBCA 1HNXJ 2BE2B 1N56A 3CC4S 5IT9U 1YJRA 4RNNA 4A8QA 5EWFA 1NEEA 3K8VA 2Y1IA 2R42A 3U02A 1X4FA 1RTDA 3RB4A 3WHIA 2MKKA 2H4WB 3EGWB 3TRGA 3CJ3A 2ZVSA 4NASA 1B0PA 3KLHB 4PWDA 4Q8FA 4CT9A 2UVRA 3QPIA 2YNFB 3KG4A 1B70B 4B17A 2BM0A 4NRTA 4ETXA 5M2UA 4A4JA 5D4NA 4ANDA 1YJUA 5ITHA 4O3OA 3UR0A 1FXDA 4KJGA 1ZA2B 2H3EB 2RVJA 5I3PA 5KFVA 3DFEA 1Q7YT 1FFSB 3NKOA 1AJAA 4KV8B 1RU2A 4ZKAA 3O6QA 3UPFA 2KT3A 5KFKA 3T19A 4H54A 4ZN3A 2ZUAA 4O0IA 4F8RA 4BWJA 3DLEB 2KJWA 5K8MA 4USWA 1URBA 2KYZA 2R7UA 2CQ0A 5CH7B 3Q8RB 1LW0A 5C66A 4FP9A 2GVZA 4WXWA 4WPAA 4BCAA 2B5JA 4ZHRA 3MDFA 3IS9B 3SQGB 4DSJA 5DGBA 2GJIA 3BO3A 2XO7A 1FTCA 2Y1RI 2VFTA 4AYBD 2YY3A 2HURA 2AYGA 5I42A 4DG1A 1FX4A 1HARA 1S49A 2PE8A 2KKHA 4IH7A 1G3OA 1TTHB 5E5NA 2SXLA 2F4FA 1E33P 1MSWD 4QAXA 2CA9A 4WFXA 4E8UA 3VHQA 2DISA 3GV7B 1TUVA 3QFHA 4TLRA 4LF8J 3NBPA 3J7YU 3UQSA 1SUQB 3QGGA 4RWWA 1UEUA 3D6HB 1U09A 3CGIA 4DUTA 1RHKB 3BR9A 2RNEA 1M5HA 3IBCB 4FVCA 2CVEA 4N56A 2X3DA 4XO0A 2C3MA 3ILOA 4KFBB 2XM3A 4AUKA 2YNHB 4U96A 3TI0A 1X4GA 3TNVA 4IRKA 2VG5B 3I5BA 2K7KA 2CVIA 1MW7A 2NXUA 2VG6A 1XEZA 4IO9Q 4XPEA 1U1NA 2V63A 2X3GA 3H25A 1NK6A 5KT5A 2G9OA 3FQLA 5IT9Y 1FFGB 1SI9A 1NSAA 1PSDA 1XMOJ 1FJ7A 2N3LA 3LP2A 1S1TA 1Q4RA 2K8GA 2R7OA 4C48A 3MAAA 2ZBRA 2QFJA 2KT2A 2B9XA 3MR7A 2M9KA 5KFIA 1WNEA 4OYAA 1WG1A 4F0MA 2CJ9A 3OL6A 3CJRA 3VAIA 3LP1A 1SQFA 2J6SA 2XEXA 2DGVA 3R9LA 4A48A 4Z7CA 1M1KT 2IVYA 3H2VE 5M2PA 4GVBB 3P96A 5G0RA 1UFKA 3GU0A 3LXQA 2CKWA 2XR9A 2KG0A 5KFPA 1RABB 4I2PA 2W5TA 1U1MA 3IP0A 4CQ1A 4ZVQB 4C11B 2QLWA 2MSTA 3EZ5A 4C97A 5M2RA 2DR5A 1NJZA 3BH6B 2O1PA 3QAUA 3K57A 3QJLA 3EZOA 3ENAA 4MMOA 1S9EA 3BQ0A 4F67A 2YWHA 1QDUB 4N76A 1BD6A 2YTCA 3QSYB 4LF6J 4NLXA 5CA5A 5DLVA 4O4GA 1R0CB 1SPBP 1DARA 1WDDA 4QIVA 4ZPCA 4ILRA 1HR0F 1LKZA 2AZ1A 2GHWA 3JQJA 2VZ9A 1ZTTA 5HBMA 1RT2A 3V6DA 4CLUA 2V2ZA 4DN9A 3Q8PB 1ZS6A 3DLBA 2NXCA 2CYYA 5AJ9A 4JI4J 2R3VA 4WE1A 3DOMA 1RT3B 1UWBA 1DFDA 4ELTA 2CJAA 1TFYA 4ZG9A 4G1IA 2VFSA 2ZD1B 2W4PA 5LQQA 1GXTA 3MEKA 4KTQA 2CZVC 3AOAA 2EBEA 2FLLA 2AJ1A 1KONA 3G6ES 4RU9A 3L9ZA 3CCMS 4EZ9A 5H9EK 1J5OB 2BKNA 3G71S 1H38A 3V6JA 1F60B 4YB5A 4N47A 2OPPB 2GZOA 2J0SD 1VIXA 3D28A 4OI1A 5H9FJ 3JTPA 1SC4B 1KD1T 1U1LA 4QR0A 1KP6A 4QR1A 2JJ4D 3ADAC 3VR1A 2LMIA 1NSQA 4OHZA 1GMWD 2W8LA 2BANA 4YQWA 1Y3JA 1N6QA 3DXSX 2YX4A 3UDLA 1SXLA 3R5AA 1N5VA 4F02A 3BPSP 3OHBA 2Z56B 1YSJA 2ZBQA 2HNZA 2I5JB 3GG1A 3LPYA 5F8LA 3MR5A 4EI2A 2AJ4A 2UVVA 2QIFA 4NOHA 5IQQA 3EDQB 2RS2A 3X1LB 4WZQA 1XQIA 1HNIB 2GAHC 4DX7A 3E01B 4MKBA 5DQGA 3BN4A 2Z2ZA 4LRDA 3GZ7A 1LK5A 2MQOA 1XC9A 2E7XA 4DDFA 4PPDA 1X5SA 2W9CB 5KT2A 3BSCA 3GJQB 3IA0A 4KAYA 1N54B 4ZVTB 1FKPB 4NWBA 1NSPA 3PYFA 4CH1A 3AJ1A 1T9UA 1XR6A 3I9V9 4UZBA 2XI3A 3V81A 1NB2A 2GO9A 3CJ2A 4PYDA 5KG7A 1N36F 4NZ7A 5H9FK 5JUMA 3QO9B 3CXCR 1WKLA 2G13A 4ZVPB 3MOZA 4DSLA 2YNGB 4FVMA 3F73A 4EWTA 1SKRA 1VBZA 3IXQA 1QE1B 2BMBA 4LSNB 4CTAA 2MSSA 1SKSA 5E2QA 4PWUA 1N2LA 3D6FB 3HULA 4UUXA 1XMQF 3U27A 1P6TA 3OR2A 2ZHBA 2J0WA 1GK8A 2GMJA 2F63A 4UPKA 4B3TJ 4MIBA 2F9DA 2OPQA 1OMSA 4WCEQ 4AL5A 2XYGB 3H59A 4ZVHA 4OV1A 4LF7J 1S4FA 3SZYA 4RNFA 4DEZA 1W26A 4KGKA 4K4VA 2YVSA 2H5EA 3FBBA 2JLGA 1WWHA 3GIJA 3IMQJ 5K8OA 4FYXB 4X64F 2V5HG 4DUYF 4DFKA 3C6TA 2DNOA 3U1LA 3K5OA 1SC6A 3D2WA 2BE2A 1ZM3A 3OFGA 2Y0BB 1PYTA 3GIMA 2UUTA 4N8OA 5B0BA 2WW8A 4DQPA 2HS3A 5L1LA 4FKYA 3CW2C 3EGVA 2B8PA 4M5NA 4ZP6A 3KG0A 2HBQB 3NKQA 1T02A 2VJUA 2IIHA 4IR1A 3NCQA 3MHYA 3VAHA 2OTJS 3J80Y 2AV5A 3KLHA 1BUXA 1X0PA 3M7VA 4USMA 5BR8J 2XWYA 3A13A 2D1CA 2FVRA 1S9FA 2HGNA 4LF4F 2J6TA 3TJ8A 3KMSA 1NH7A 3GFXA 1ULRA 5I3QA 4EYIB 3O1LA 3FUYA 3N6MA 4JI1F 3OW2R 4DSIA 2IC3B 4MK9A 3D0IE 1C4CA 2CIMA 4LFCJ 3VAFA 3H2LA 4OX6A 1JJHA 2DO0A 5L0EA 4KV8A 1P1TA 2VB6A 3SBMA 2BDPA 3K2YA 3OV7A 1JWWA 4QJVA 4R8UB 4V19X 2E44A 2RQ4A 1LW2B 1TMMA 3GJSB 2G2YA 2YWEA 5KFQA 1Y3KA 2GC8A 1U48A 3SQGA 3MR3A 1I3OB 5IV4A 4HHHA 1HDHA 1DAXA 5EN1A 4GKKJ 2HNDB 2VODA 1L5UA 3R5GA 3RBDA 4X4VA 2W2NP 3B54A 3EZUA 4JV5J 3MK0A 4HTJA 1ZEBA 1PAUB 2RHSB 2ALZA 1X9SA 1B8JA 4TLQA 4ES3A 4Q2LA 3BKTA 4OI0A 3W3SA 2DHSA 4N7TA 3ICLA 2ACMA 3R2CJ 1U25A 3BKFA 3P4UB 1TAUA 5LMUF 4IOBA 4LBHA 3CDUA 4QIFA 1SUQA 1FJGF 1EQMA 2K3KA 1L3UA 3WIUA 4OI6A 3FZBA 2VPZB 4DV4J 3LGNA 5AXKA 2DXFA 2KXFA 2YKQA 1VI7A 1SJRA 3G8SA 3R2DJ 4BC7A 3GIRA 4KFBA 3J7YI 2YNHA 4F4YA 4DCOB 1S4EA 1RWKB 2VG5A 2YKAA 2ZBIA 1QVGR 2LEAA 5L1JA 2RKIB 2JEFA 1J5EF 2W2MP 2C3YA 2LECA 1N2KA 1PJ6A 3CCSS 1FRXA 3NS6A 3PYDA 4ICLB 4MK8A 4Q44A 1K47A 1T0TV 1FE4A 4IUFA 4DX6A 4JI2J 1KHWA 1HMVA 3QT6A 2NLWA 3SI8A 4NLQA 1VQPS 1FFWB 3CULA 1APSA 2R7XA 2KB2A 2FJXA 4ILLA 3NCPA 3BSAA 3BV8A 3A3NB 2VQFJ 2L9DA 4KBIA 3ULHA 1FI4A 4JI7F 3GV5B 1CJVA 1SJ3P 4OI2A 4X4QA 2W2PP 4UORA 4AL6A 4GVBA 4MYUA 2BJ8A 3MMAB 4NXNJ 3RZAA 1HNZF 2NZCA 1VQNS 1UFWA 3MPDA 2BOPA 2BJ1A 3MXHP 4C11A 4C8NA 3DLHA 3CT9A 4DHVA 3I0RA 3B4MA 2QL9B 4P72A 5F8MA 4GKJJ 5L0KA 3QT7A 1LWFA 4CO3A 4UTGA 1TR0A 3K5LA 1HWUA 3ETOA 4P71A 2AT1B 4UT4A 3P6YC 2RHQB 1Q79A 2XYHB 2FYXA 2FHJD 2JFDA 2YH0A 4ZLNA 2JSXA 3IFEA 3HF5A 4X84A 2FJBB 1KWMA
chains in the Genus database with same CATH topology
1FSUA 2QZUA 1EW8A 1N2LA 3NKOA 2GSUA 2GSOA 1AJAA 1URAA 4NWXA 5AJ9A 3IGZB 3NKRA 1EI6A 3WAVA 1P49A 2VQRA 3E2DA 5LIAA 2W5VA 3TWZA 4CXUA 3BDHA 5GOVA 3LXQA 4LQYA 5EGEA 1ANIA 5TJ3A 4ZG7A 4UOOA 1Y7AA 4CYSA 4LRAA 4LRBA 3UN3A 2XR9A 3BDGB 1URBA 4GTWA 1ALHA 3ED4A 4UPKA 3T02A 4ZG9A 1E2SP 1AUKA 2W5TA 4UOPA 4UPLA 3BDGA 5C66A 2X98A 3WAWA 3CMRA 1EW2A 5DLTA 4LRDA 3UNYA 3A52A 3UN5A 5LQQA 1EW9A 1ZEFA 4MHXA 3DPCA 3IDDA 1ALKA 3T00A 4KJDA 1E1ZP 1ELYA 5L0EA 3B5QA 3SZYA 3M8WA 5IJQA 4MIVA 1Y6VA 5INHA 4UORA 1O99A 4LR7A 4LRCA 3NKNA 2W5SA 4CXSA 1SHNA 5LRMA 1KH5A 2D1GA 4FDJA 2IFYA 4KM4A 2W8DA 3WAYA 3T01A 1ELZA 3M8ZA 5L0BA 1KHKA 5KXAA 4LR2A 3MK2A 1KH7A 1KHNA 2XRGA 5K4PA 4ZGAA 4KAYA 4MY4A 1AJBA 3NVLA 1EJJA 3WBHA 5DLWA 1ANJA 2IUCB 5GRRA 1KHJA 2W8SA 4LREA 3KD8A 3NKPA 1KH4A 3BDFA 4GTXA 2GA3A 2IUCA 1KHLA 4FDIA 1K7HA 2G9YA 4ZG6A 1ED8A 1AJDA 2W5QA 5DLVA 1HDHA 4LR8A 1HQAA 4GTYA 4NWJA 1SHQA 1E33P 3SZZA 4UPHA 5L0KA 1ALJA 3UN2A 4QAXA 5HRTA 1N2KA 3DYCA 3NKMA 3UO0A 4B56A 4GTZA 1EQJA 2GSNA 1ZEDA 3NKQA 3WAXA 1ED9A 1E3CP 1HJKA 2W5XA 3IGYB 4UPIA 1AJCA 3Q3QA 3MK0A 1O98A 1ALIA 4LRFA 1ZEBA 2RH6A 3TG0A 4LR9A 4TN0A 2GLQA 2W5RA 5IJSA 1B8JA 3MK1A 4CXKA 4KAVA 3OT9A 4CYRA 4KJGA 2ANHA 3M7VA 1KH9A 4YR1A 3TX0A 3M8YA 5EGHA 5LRNA 2W5WA 4N7TA 1ELXA 2ZKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSU A;  2QZU A;  1EW8 A;  1N2L A;  3NKO A;  2GSU A;  2GSO A;  1AJA A;  1URA A;  4NWX A;  5AJ9 A;  3IGZ B;  3NKR A;  1EI6 A;  3WAV A;  1P49 A;  2VQR A;  3E2D A;  5LIA A;  2W5V A;  3TWZ A;  4CXU A;  3BDH A;  5GOV A;  3LXQ A;  4LQY A;  5EGE A;  1ANI A;  5TJ3 A;  4ZG7 A;  4UOO A;  1Y7A A;  4CYS A;  4LRA A;  4LRB A;  3UN3 A;  2XR9 A;  3BDG B;  1URB A;  4GTW A;  1ALH A;  3ED4 A;  4UPK A;  3T02 A;  4ZG9 A;  1E2S P;  1AUK A;  2W5T A;  4UOP A;  4UPL A;  3BDG A;  5C66 A;  2X98 A;  3WAW A;  3CMR A;  1EW2 A;  5DLT A;  4LRD A;  3UNY A;  3A52 A;  3UN5 A;  5LQQ A;  1EW9 A;  1ZEF A;  4MHX A;  3DPC A;  3IDD A;  1ALK A;  3T00 A;  4KJD A;  1E1Z P;  1ELY A;  5L0E A;  3B5Q A;  3SZY A;  3M8W A;  5IJQ A;  4MIV A;  1Y6V A;  5INH A;  4UOR A;  1O99 A;  4LR7 A;  4LRC A;  3NKN A;  2W5S A;  4CXS A;  1SHN A;  5LRM A;  1KH5 A;  2D1G A;  4FDJ A;  2IFY A;  4KM4 A;  2W8D A;  3WAY A;  3T01 A;  1ELZ A;  3M8Z A;  5L0B A;  1KHK A;  5KXA A;  4LR2 A;  3MK2 A;  1KH7 A;  1KHN A;  2XRG A;  5K4P A;  4ZGA A;  4KAY A;  4MY4 A;  1AJB A;  3NVL A;  1EJJ A;  3WBH A;  5DLW A;  1ANJ A;  2IUC B;  5GRR A;  1KHJ A;  2W8S A;  4LRE A;  3KD8 A;  3NKP A;  1KH4 A;  3BDF A;  4GTX A;  2GA3 A;  2IUC A;  1KHL A;  4FDI A;  1K7H A;  2G9Y A;  4ZG6 A;  1ED8 A;  1AJD A;  2W5Q A;  5DLV A;  1HDH A;  4LR8 A;  1HQA A;  4GTY A;  4NWJ A;  1SHQ A;  1E33 P;  3SZZ A;  4UPH A;  5L0K A;  1ALJ A;  3UN2 A;  4QAX A;  5HRT A;  1N2K A;  3DYC A;  3NKM A;  3UO0 A;  4B56 A;  4GTZ A;  1EQJ A;  2GSN A;  1ZED A;  3NKQ A;  3WAX A;  1ED9 A;  1E3C P;  1HJK A;  2W5X A;  3IGY B;  4UPI A;  1AJC A;  3Q3Q A;  3MK0 A;  1O98 A;  1ALI A;  4LRF A;  1ZEB A;  2RH6 A;  3TG0 A;  4LR9 A;  4TN0 A;  2GLQ A;  2W5R A;  5IJS A;  1B8J A;  3MK1 A;  4CXK A;  4KAV A;  3OT9 A;  4CYR A;  4KJG A;  2ANH A;  3M7V A;  1KH9 A;  4YR1 A;  3TX0 A;  3M8Y A;  5EGH A;  5LRN A;  2W5W A;  4N7T A;  1ELX A;  2ZKT A; 
#chains in the Genus database with same CATH topology
 1URA A;  3NAH A;  3ZTS A;  4OZ0 A;  1HWJ A;  4QZV B;  1NK8 A;  3J81 U;  2VIC A;  4XK8 C;  2Q6B A;  4YOE A;  2XY5 A;  3H5S A;  4KE5 A;  1XIQ A;  1UMJ A;  1RT3 A;  4NEZ A;  3RU0 A;  4MIW A;  2XMM A;  1DZ5 A;  2HW3 A;  4J7C A;  2LKZ A;  4LFB J;  2ZD1 A;  1JLG B;  4IFV A;  3OXL A;  2OLW A;  1T03 B;  2XTJ P;  3I0S B;  1CS4 B;  3PW2 A;  4M95 A;  4ZG6 A;  3GFY A;  1RAF B;  2YQ1 A;  4C9D A;  2P2C B;  4AQY F;  2VC0 A;  1VLY A;  4DV1 J;  1J5O A;  1TEL A;  2KT5 A;  3T5K A;  2XB2 D;  2OPP A;  4I67 A;  1WEZ A;  4YR1 A;  3SSS A;  3GYN A;  3OTB A;  4K4T A;  2FZK B;  4J9Q A;  4BHQ A;  1I94 J;  3BZQ A;  4E2F B;  4RO0 A;  3W9H A;  1DBD A;  4F3Q A;  4RW6 B;  3CD0 A;  5AJ3 J;  3HHK A;  5C42 B;  5DDO C;  2HFN A;  4DL0 C;  5D6G A;  2PC6 A;  3BDG A;  2IVF B;  1NXI A;  5D4P A;  2CNN B;  2I5J A;  2CQ4 A;  1ACM B;  1U47 A;  4OLO A;  1RWP B;  1XJW B;  5C2C A;  2JLF A;  2J6U A;  5LRM A;  2XZT B;  3PR4 A;  1RHQ B;  1S97 A;  3WQP A;  1HNI A;  3E01 A;  5KFZ A;  2X51 A;  1UL3 A;  3KD8 A;  1MMN A;  1OY8 A;  3RTV A;  4LR8 A;  5F8J A;  1VK8 A;  5F8I A;  2W9C A;  2EKN A;  1O8B A;  1ZED A;  4HR2 A;  4U8Y A;  2KZM A;  1B0V A;  2ZDO A;  2KH9 A;  2QT7 A;  4XIU A;  2JOQ A;  1WG5 A;  4DL7 A;  5GMK a;  2XZW A;  4DR3 J;  1MRO B;  4ECQ A;  3EMT A;  4JI0 J;  3MMB B;  1JLQ B;  2V69 A;  3QO9 A;  2ZH1 A;  4I7F B;  2R2U A;  2YNG A;  5BXI A;  4ITS A;  1FCA A;  3FRY A;  1QE1 A;  4AT1 B;  1NPK A;  2DNZ A;  2F8M A;  4LSN A;  4TN2 A;  2D9P A;  1FEE A;  5LJ5 Y;  2DNN A;  3BPD A;  2OPS B;  4I6A A;  3AD7 C;  3KJV B;  4OMF G;  3ENQ A;  1NDC A;  4RR5 A;  4WTO B;  4DV6 F;  1TKT B;  3PKY A;  2IM3 A;  2ADC A;  1BLU A;  2BJD A;  2UUB F;  1HA1 A;  2C22 A;  5EHH A;  1HQ2 A;  4B9L A;  2RQC A;  2ZEJ A;  4WF9 Q;  4A8S A;  5JJB A;  4NLP A;  4CI0 B;  4KHP F;  2O67 A;  1I51 B;  2KHD A;  4TQR A;  3IR5 B;  4N77 A;  1JJ2 R;  1NDL A;  2XG8 A;  1IQZ A;  2FJA B;  4K4U A;  1FVS A;  3A12 A;  1C2P A;  1HBN B;  1NPP A;  2MEW A;  4B9N A;  3I5C A;  5KT3 A;  2DD8 S;  1VHI A;  1ZM2 A;  1KTQ A;  1JXV A;  4KY3 A;  4TNO A;  2VOP A;  2OI2 A;  3DM2 B;  3NOG A;  1HL6 A;  1SIW B;  4B9T A;  1UW4 A;  1UVK A;  2GNK A;  2LDY A;  4RWX A;  1VBX A;  3CCV S;  4UOO A;  2B0G A;  5B0F A;  2R7T A;  1NH8 A;  3Q22 A;  1V6H A;  4U6P A;  4ECV A;  4PXD A;  3G6Y A;  1F5B A;  2Z2Y B;  1TK5 A;  5KFH A;  3OFH A;  5ETN A;  5KG4 A;  2E7W A;  1JXE A;  2IM0 A;  2JFK A;  4I2Q B;  1UVM A;  1UEK A;  3BN7 A;  2WRM A;  2QMU B;  5A0Y B;  4HDG A;  1FRH A;  2MZS A;  2DO4 A;  2IC3 A;  1GEH A;  1QSL A;  2V34 A;  4DUZ J;  2CAD A;  4L74 A;  1IBL F;  3FSI A;  4WFA Q;  4H4K C;  4HEA 9;  1LNQ A;  2DR6 A;  4IRC A;  3CB4 A;  6FDR A;  2OHD A;  2AMC B;  4B56 A;  3UD3 P;  1QTM A;  2QA1 A;  2WB4 A;  4USK A;  1SJ4 P;  2HHH J;  4RUA A;  5CYQ B;  3NEK A;  2OEK A;  2NUH A;  4BC9 A;  1YHQ S;  2UUA J;  2F8H A;  2ZJQ Q;  3KJQ B;  2EEY A;  1M1H A;  1N32 J;  1QTN B;  2HND A;  2XLI A;  1VC6 A;  2V6A A;  2FHK A;  1JLE B;  2DH9 A;  3ETM A;  1CSJ A;  4ZG7 A;  1UAW A;  1FK9 B;  3D67 A;  5E3R A;  2G1D A;  2HIQ A;  3PDN A;  4M5M A;  3M32 A;  3RYL A;  1RK8 A;  1YGY A;  4CYU B;  1ITP A;  1UA1 A;  4KIA A;  3D54 A;  4QWE A;  1ELY A;  4MIA A;  3H7H B;  5INH A;  4G1P A;  5KT6 A;  1S1W B;  1MMD A;  3JS9 A;  2V4J A;  5A8R B;  4WFB Q;  1RCO B;  2MQL A;  3N5F A;  3KHG A;  2F9J A;  4F4Z A;  3TQ1 A;  3RB3 A;  4ZLJ A;  2FZG B;  1DQ8 A;  4FS1 A;  3IG1 B;  2CXE A;  4ZCI A;  4WP3 A;  5HO4 A;  2IRX A;  4IQX A;  1NK4 A;  4XAK A;  4WTY A;  4X4P A;  3KLV A;  2V68 A;  3ZFV A;  2GIF A;  2CQ2 A;  5DM7 Q;  3MM7 B;  2F4V F;  1KQS R;  2IBO A;  4IR9 A;  3PTW A;  4LBI A;  3HSZ A;  3NS7 B;  4NRU A;  3TVK A;  1SH2 A;  2BKO A;  4AXI A;  2AF6 A;  1RHM B;  3CC7 S;  2RKI A;  4B3M F;  4F4K A;  2ZJR Q;  2MQP A;  3I9Z A;  2WON B;  2QZU A;  3QSI A;  1R6Y A;  1HW9 A;  1PAE X;  1WEX A;  4DV7 F;  4ICL A;  3TWZ A;  2UU9 J;  1IBC B;  2AEM A;  4G6V B;  1Y7P A;  4ID5 B;  2VQE J;  5A8W B;  2DIU A;  2RF2 B;  3U7J A;  3R27 A;  4JV1 A;  2DNL A;  3X3U A;  3PO5 A;  3GSI A;  2C2R A;  5GME A;  3LH2 S;  2GML A;  2Y3Y A;  1S1V A;  2QLB B;  2DRB A;  4IH6 A;  2C2K B;  4RX6 A;  1VMB A;  3PW7 A;  1VBY A;  3ITH A;  1Y11 A;  1UJ4 A;  3G6V A;  3L7P A;  3P5T L;  1VRU B;  3DLJ A;  1SV5 B;  3KK2 B;  1G4C A;  1UVJ A;  1QSY A;  3EDR B;  4MKA A;  2KRR A;  2XY6 A;  4HYK A;  1K9M T;  5J2N B;  3MMA A;  5JVG Q;  3CD5 A;  2WVC A;  3L7O A;  3AH6 A;  2K3I A;  5DS7 A;  5IJS A;  4H4O B;  2FJW A;  1NBE B;  2E5L J;  4OI4 A;  3AAW B;  2PGC A;  4DPW A;  3D3B J;  2HKE A;  5CZV A;  1H3D A;  1UEV A;  3ZTR A;  4OYZ A;  2K1R A;  1WDT A;  1ANI A;  2YWW A;  5B0E A;  3JYT B;  3VGU A;  2F8E X;  2QMX A;  1T11 A;  5DLG A;  1HNX F;  4KJD A;  3W2V B;  5IJQ A;  3EWG A;  1GXU A;  3RAX A;  4OX9 F;  4QPX A;  2CJX B;  1X5P A;  5D77 A;  2NXN A;  4KGZ B;  2QLF B;  1UP1 A;  2C3U A;  3A4T A;  1KOH A;  1DUR A;  2MHE A;  3ISN C;  2RS8 A;  4J9S A;  4NLG A;  3L3C A;  2W2O P;  3BBF A;  4ZJO A;  5DQI A;  2FY8 A;  2R7R A;  4IDK B;  1DQA A;  1HJK A;  3TZW A;  3CF5 Q;  1CC7 A;  3RBZ A;  2QL5 B;  2XS2 A;  1T03 A;  3I0S A;  4Z37 A;  1CS4 A;  2UXD F;  3A3O B;  2HQF A;  1E6V B;  2RDI A;  4ER8 A;  5C24 B;  3K17 A;  2AU0 A;  4TKT A;  3HHN B;  3GB0 A;  3EE3 A;  2VFR A;  9ATC B;  3FKB A;  5B0A A;  4NLR A;  2BJ7 A;  3EUN A;  2ZNY A;  3JSM B;  3W1Y C;  3CCR S;  5CAA A;  3LWL A;  2CPY A;  4P52 A;  2R8I A;  2R9L A;  4HAC B;  2BX6 A;  1FXR A;  3MPU B;  4RW6 A;  2HBY B;  3LAK A;  1KHK A;  3SFU A;  2CDQ A;  5HAT A;  2YBV A;  5C42 A;  4ZGA A;  4CLW A;  1AW0 A;  4R5P B;  1Y10 A;  2LU2 A;  2IJN A;  1FRJ A;  5HMW A;  5C2G A;  1HW8 A;  1T3O A;  2PT0 A;  4P7V A;  2OEL A;  1SJF A;  4X66 J;  1B0T A;  4ZJQ A;  5SZT A;  4B3O B;  4K4X A;  1C0U B;  5IZH A;  2CQP A;  5C25 B;  5DQH A;  2JEJ A;  4LF8 F;  1EQJ A;  3UWT A;  1FEH A;  4C3K A;  2CPJ A;  2A0F B;  2X7I A;  4JUZ A;  2UVW A;  1EAY C;  4NA3 A;  3PO4 A;  2GV1 A;  3G9C A;  1VQY A;  2PN6 A;  5IC4 B;  3W8G A;  2EFG A;  4Y0F A;  2QLJ B;  3I55 S;  2Q66 A;  1EW8 A;  2FY1 A;  2MKY A;  3WAV A;  2MLY A;  3DN9 A;  3PVX A;  2V8P A;  1S0V A;  4FNI A;  4CT8 A;  5GOV A;  2EKY A;  1R8H A;  2ZFH A;  4V1A k;  3MM5 A;  2XMV A;  3W8P A;  3VZH A;  3QBC A;  4UZC A;  1O5J A;  4B9U A;  2Y1L B;  3PX6 A;  4FF3 A;  2E9T A;  3CD6 S;  3GII A;  3MMB A;  1JLQ A;  2ALY B;  2G2O A;  1BQN B;  1FT8 A;  1QY7 A;  5F8G A;  4I7F A;  1FJE B;  2WCX A;  4A8M P;  2V9W A;  8AT1 B;  3M1V B;  5LL6 d;  4CLL A;  2VBY A;  4J9R A;  3DLK B;  4YHH F;  1UA0 A;  1ZAW A;  4DSF A;  1LWX A;  2B4P A;  3LOU A;  1KHL A;  4WFN Q;  1S99 A;  5THW A;  1JLB A;  1I5O B;  3PEJ A;  2E29 A;  3TZY A;  2W5Q A;  5GMD A;  2OP5 A;  5HP1 B;  3KJV A;  1WOS A;  3M8R A;  4CO0 A;  4WBF A;  1TKT A;  3I4P A;  2QJ3 A;  1Z1Z A;  1F3F A;  4ECY A;  3A8K A;  5KFS A;  1BQX A;  4G1Q B;  2MY7 A;  2YX1 A;  4DXL A;  2XMU A;  3OL7 A;  3UD5 A;  1Q8B A;  3DI6 A;  2I0X A;  5J2Q B;  4I6W A;  1K0V A;  1HBN A;  4C0B A;  1ALK A;  3BBC A;  2DGX A;  4FYD A;  2EG1 A;  3M6U A;  2KXH A;  3DM2 A;  4OZN A;  4C8Y A;  1FWK A;  4YN3 B;  4WYW A;  5ETL A;  3ZO7 A;  4DSK A;  4ELU A;  1RYR A;  4WII A;  1NM2 A;  1KH7 A;  1PG5 B;  3ET6 B;  4DPY A;  1A0O B;  3AD8 C;  3PXG a;  3KLG B;  3HVW A;  5D3G B;  1X4A A;  2ABY A;  1TKD A;  3BDF A;  4FDI A;  2VJV A;  2W7P A;  4FBT A;  4FKX A;  4LF1 A;  4CLK A;  1MNE A;  1IXK A;  4ZPD A;  2ZOG A;  3M8P B;  3FSY A;  5DM6 Q;  1DQ9 A;  3EX7 B;  5A0Y A;  1OYE A;  4W92 B;  3GFH A;  2DGU A;  5GAH U;  2EFO A;  1VJW A;  2HVH A;  4JI8 J;  3KLE B;  1WC3 A;  1Q82 T;  3KUE A;  2HZA A;  2FJD B;  4NE9 C;  4JI4 F;  5HI7 A;  4C7Q A;  4RUH A;  1ZM4 A;  2ZBP A;  3Q8V A;  1REV B;  3PIO Q;  2DNQ A;  1JJC B;  4F3M A;  5CYQ A;  3C16 A;  2ASL A;  3HP6 A;  1YJN S;  3R7B B;  4MFB A;  4CLF A;  5IS2 A;  2HQI A;  1HHQ A;  3M2R B;  1TL4 A;  4EFA C;  5EUH A;  4JI6 J;  2N3O A;  1LFP A;  2QYG A;  3IRW P;  1JLE A;  4XTT A;  2YQ0 A;  3MM9 B;  4F2R A;  2FVC A;  2ATL A;  3MI7 X;  2FZC B;  2LA4 A;  2XNQ A;  1WAC A;  2W9B B;  2IUC B;  2LCW A;  4CYU A;  3M8Q B;  3BGL A;  4UY8 T;  5GAD U;  3GON A;  1YK9 A;  3IWN C;  4FS2 A;  3VGT A;  4RZR A;  1Q5V A;  4K4Y A;  3Q8U A;  2ZIT A;  2YPZ A;  4TN0 A;  3JSY A;  2ZNZ A;  3IG1 A;  2BJE A;  3HHL D;  4X4S A;  1HBO B;  1KN6 A;  2R8K A;  2ZZM A;  3MM7 A;  2E1M C;  1GTH A;  3KLF B;  1Y9O A;  3NGD A;  4PG4 A;  1GX6 A;  2QC3 A;  1E6Y B;  2JX2 A;  5H1S V;  2WON A;  4MK7 A;  2P9E A;  1RCX B;  1X9M A;  5D8H B;  1T3N A;  4F3O A;  2WSE C;  1HI8 A;  3QMQ A;  1MN7 A;  3M8Z A;  5ETR A;  3MK2 A;  2CPF A;  1X8D A;  4JOU A;  2KYX A;  4ID5 A;  3Q83 A;  4ATN A;  2VF3 A;  5A8W A;  3OVA A;  3RAM A;  3FNN A;  5IOL A;  2UP1 A;  3SCK E;  1H74 A;  4RW4 A;  1M5P C;  2DXD A;  3G6X A;  1RBO B;  3S01 A;  2E5H A;  1D9F A;  3KTQ A;  5IWA F;  3R1L A;  2M8D B;  2IYG A;  3OTE A;  2B8Q A;  3RB0 A;  2M3D A;  2VH7 A;  3VAJ A;  2EI5 A;  1VRU A;  1SV5 A;  3BSO A;  1ZA1 B;  3KK2 A;  2BE7 D;  3LTO A;  4F25 A;  2FLO A;  3T1A A;  5J2N A;  1UCN A;  2DGQ A;  3M2U B;  2W01 A;  2ASY A;  3QGP A;  4C2M A;  3B82 A;  2AJQ A;  2VKR A;  1RAI B;  4B3T F;  4LRA A;  1OPI A;  1T9X A;  4W90 B;  1KNZ A;  5K14 B;  4QBU A;  4H4O A;  2UVU A;  2AEF A;  1V3R A;  2UV8 G;  4LF7 F;  1RWV B;  3P3D A;  2RUG A;  1SKW A;  1VRQ C;  1AZS B;  4GVL A;  1W25 A;  4MIV A;  3DXB A;  1HWI A;  2KM8 C;  2BKP A;  3JYT A;  3CJT A;  4QCL A;  4W4M A;  5KG1 A;  4ENO A;  1TUG B;  2VUG A;  3BYR A;  1O6X A;  4QIW D;  1IUJ A;  2DEI A;  1NKB A;  1Y5N B;  4JBC A;  2XYP B;  3W2V A;  3M8S A;  4ZCM A;  1RWN B;  1YG0 A;  2HNY B;  2P9C A;  4AE5 A;  3MFI A;  2GSN A;  2CPE A;  1Q81 T;  3KK1 A;  2O01 C;  4ZCL A;  2RRB A;  2ZH2 A;  3P5B P;  1IR1 A;  5IM0 B;  5J1E B;  2NQP A;  5BR8 F;  2HS0 A;  5IFM A;  1NKE A;  1RHU B;  4OZ5 A;  1TZ0 A;  4FXD A;  2GHP A;  1F9H A;  4IDK A;  1P49 A;  1HD0 A;  1VC5 A;  4MTP A;  3HCX A;  1TFW A;  3HT3 A;  1QUP A;  4KT0 C;  4LFC F;  3MEE A;  1OIA A;  2ZWO A;  2HMI B;  5FDL B;  1DTT A;  4DR1 F;  5C24 A;  3CCU S;  2VDI A;  1M5K C;  2D1G A;  3T01 A;  2UUW A;  4I1T A;  2CWK A;  1CG2 A;  2D9O A;  1UVL A;  3G87 A;  4CNZ A;  3JSM A;  2OAU A;  2YKP A;  1CJU B;  1GMW A;  1K0T A;  4F36 A;  1LFW A;  5HAO A;  4HH0 A;  2PD1 A;  2RE1 A;  4GKK F;  4HAC A;  3SYZ A;  3FEX B;  1NND A;  4PQA A;  2XC9 A;  4P10 A;  4JV5 F;  1Y0H A;  3GIK A;  4R5P A;  3BGR A;  1B4S A;  2B3T B;  3IAM 9;  4B3O A;  1C0U A;  2MGZ B;  2RDJ A;  5C25 A;  1R7I A;  4NPO A;  5HJX A;  1VRT B;  2C2Z B;  3GR1 A;  3Q8Y A;  4U8V A;  3C15 A;  3SDE B;  4UST A;  4D3G A;  7FDR A;  4URS A;  2CNL B;  2MDA A;  3PG9 A;  4YUD A;  4DV4 F;  3SXL A;  2O66 A;  5HVF A;  3A52 A;  1AFJ A;  5KFW A;  1YRU A;  2R8J A;  2R7Q A;  5E3P A;  3KYL A;  3BO4 A;  1Z2Z A;  1KOO A;  5F41 A;  2V8G A;  5CQG A;  4L76 A;  1YJT A;  4KKO B;  2X1A A;  3NMR A;  4FDJ A;  4KM4 A;  5FLX U;  4TY8 A;  4DR2 J;  1S6O A;  1S12 A;  1S7I A;  3N6L A;  2CPZ A;  8ATC B;  3ILI A;  3EYZ A;  2E5G A;  4FYW B;  3W5Z A;  1UW9 A;  2BW2 A;  2KO1 A;  3IGN A;  1BQN A;  4FN5 A;  1VYA A;  1S6Q B;  3IM8 A;  4CLZ A;  4RNH A;  3M1V A;  3G86 A;  1R89 A;  4CLP A;  1WTF A;  4ANE A;  4JI2 F;  4D3H A;  3VWS A;  4CH0 S;  3RJM B;  1WEY A;  3CJQ A;  2HHU A;  2QX0 A;  3G82 B;  3HD2 A;  5HP1 A;  3NWR A;  1NJY A;  3Q86 A;  4ED2 A;  1N48 A;  5HMZ A;  3MTJ A;  2VQF F;  1U24 A;  1RAH B;  2HHT A;  3PW4 A;  4PG7 A;  2AWZ A;  4G1Q A;  1WUU A;  3B5Q A;  1J27 A;  2KL8 A;  1IWG A;  4NXN F;  1Q16 B;  3CDB A;  5J2Q A;  3HT0 A;  5L0B A;  5C7P A;  4AD6 A;  1S5Z A;  5DJB A;  1T94 A;  2KI2 A;  2WZ1 A;  4O4R A;  4GTX A;  2HIY A;  2XMK A;  4ZDN A;  5A6W A;  1FO1 A;  3OTC A;  2GQQ A;  4GKJ F;  2NUU G;  4C8L A;  4Y28 C;  1U26 A;  3ET6 A;  1FXL A;  4WU3 A;  3KLG A;  4DS5 A;  3PFE A;  1YWX A;  5D3G A;  3MF5 A;  3N4W A;  2J8S A;  4Z2X A;  1GQE A;  1WC0 A;  5AE3 A;  1VQL S;  3TX0 A;  5DZ6 A;  2FPH X;  5KG2 A;  3M8P A;  3CCJ S;  1LWE B;  3KMQ A;  5ETV A;  1LXJ A;  1FE0 A;  3WAW A;  2HS4 A;  2V0N A;  3OUY B;  1GMV A;  2F1F A;  2FLP A;  1JK9 B;  5G4D A;  4C0O C;  3JQM A;  5KFF A;  2N4D A;  1REV A;  2XHC A;  3MZI A;  2VHG A;  2IFY A;  5CXT A;  4I6Y A;  2FHO B;  3SCL E;  2CJY B;  5F9N A;  2CPH A;  4LFB F;  4DZD A;  4DBQ A;  3FVY A;  1VIO A;  1EKR A;  2DY9 A;  3BKU A;  5FLX Y;  5L1I A;  3GFZ A;  4OJH A;  2EK1 A;  1RU1 A;  1HKA A;  4A8W A;  5LOQ A;  4LFA J;  3SZZ A;  4GTY A;  3T5L A;  4UPH A;  5C5J A;  3T41 A;  3MM9 A;  2MZR A;  4DV1 F;  4ZA1 A;  4U7U K;  3JQK A;  3GYX B;  2AKW B;  1VLO A;  1LK7 A;  2ZH5 A;  3ZZ0 A;  1NPR A;  2H54 B;  4NLS A;  1S57 A;  2W9B A;  3M8Q A;  2V9K A;  3TOQ A;  2YWF A;  4PG6 A;  3RW6 A;  2PEH A;  4IO1 A;  1DLO B;  2DHA A;  3TVZ A;  3RBE A;  1EIY B;  1N36 J;  2LEP A;  3ENV A;  1IBK J;  3RB6 A;  5AJ3 F;  3R7S B;  4J37 A;  1IJF B;  4AXJ A;  3PW5 A;  3DYA B;  5B09 A;  1J2V A;  1YI2 S;  3T1H J;  3S6E A;  3ED4 A;  1WF1 A;  4UOH A;  2O5D A;  4CM0 A;  3CE8 A;  2YKN B;  1M5S A;  2VA3 A;  3ZZO A;  4LUB A;  2RQM A;  1RWM B;  4RU2 A;  3PYE A;  1HBO A;  3JSR A;  2AX0 A;  3IWX A;  4IQM A;  1YKW A;  2IY5 B;  2XCA A;  3CVK A;  1JNZ B;  1S9G B;  2CRL A;  2VU5 A;  2IDL A;  2AYM A;  3CDA A;  3M9N B;  2ASJ A;  4KGV B;  4P6Q A;  1RIS A;  2NR0 A;  1N0V C;  4OYO A;  1BWV A;  1E6Y A;  3UD4 P;  3NKP A;  4RUB A;  3OVS A;  3TR5 A;  2M8H A;  1D9D A;  1WF0 A;  3DGP B;  1GT8 A;  4J9O A;  3J81 j;  1KR4 A;  2V2Q A;  1A9N B;  2RSQ A;  1FRM A;  4LSZ B;  1RTI B;  2RDD A;  3W65 A;  4YR0 A;  4DUY J;  2R2T A;  2KVI A;  1VCT A;  1HNW J;  1YTY A;  3MCO A;  1FJC A;  3CJ5 A;  3QLH B;  4ZPB A;  5MLC V;  1KH9 A;  4DR3 F;  1FDA A;  4J9M A;  1CLF A;  3IRX A;  1IVZ A;  2HPU A;  1FSU A;  1JX4 A;  4JI0 F;  2GSU A;  3LAM A;  1EB0 A;  1S6P B;  4PXE A;  2GHV C;  2J5A A;  1SH0 A;  2CZ9 A;  4CZC A;  2E1R A;  4TYB A;  3CDW A;  2IJR A;  1U0S A;  2M88 A;  2ZWP A;  2DNM A;  5KG3 A;  5CYM A;  2AIR B;  3DRP A;  1Q78 A;  3LP0 B;  1H73 A;  4P2X A;  4Q2M A;  4C98 A;  3CCE S;  2WOM B;  4BS2 A;  1UPM B;  4MH8 A;  1RAO A;  3FBC A;  4EU0 A;  4WJB A;  4Y2M A;  1SL1 A;  1NJW A;  1LV5 A;  2LEB A;  1PBU A;  5FD1 A;  3LF0 A;  3G4S S;  5FII A;  1K7H A;  1AZS A;  5LMN J;  3W60 A;  2Z2L A;  3H8Y A;  3WC0 A;  4NLY A;  4KYZ A;  2UUC J;  3M4X A;  4ZK7 M;  1YJV A;  2N7Y A;  4YDX A;  2FHJ A;  1RI7 A;  2LQ8 A;  1TKZ B;  2P5V A;  3BB5 A;  2EPI A;  4N41 A;  3UR3 C;  1ALI A;  5LSO A;  5A6P A;  3FMW A;  3BBB A;  1EP4 B;  3KUG A;  2HGM A;  1IKV B;  2FC8 A;  5MAO A;  3JTO A;  2HNY A;  1TKX B;  4B02 A;  2Y8Y A;  5D0G A;  3BDH A;  2QG9 B;  5IM0 A;  1QAJ A;  1ZPV A;  5J1E A;  2HQD A;  3AB4 B;  3CJ0 A;  3HXM A;  4L3N A;  4FF2 A;  1Y6V A;  5LMU J;  1R31 A;  2DIV A;  5EGY A;  3W9I A;  1BE4 A;  1YIT S;  4RUC A;  3HJF A;  4JV0 A;  4OI3 A;  1V9O A;  3F0N A;  1F5C A;  1WC5 A;  4LF9 J;  2KDO A;  2IPO B;  4DUZ F;  4OJG A;  4Q5V A;  4CIO A;  1WOR A;  2B56 A;  2HMI A;  5FDL A;  1NK7 A;  2C2D A;  4JB8 B;  5E3A A;  1SIZ A;  5I4M A;  2HHH F;  3WIV A;  1URN A;  3V6H A;  4A46 A;  1F0X A;  1R8A A;  4HVZ A;  3M2V B;  2Z2M A;  3OTO J;  1CJU A;  2UUA F;  1FES A;  4WU2 A;  3K0J A;  2ZE2 B;  1N32 F;  2HFV A;  2V50 A;  4HL9 A;  2UXB J;  1S48 A;  4NWX A;  2BAC A;  3NKR A;  3HZG A;  5H9E J;  3W63 A;  3K59 A;  4OFZ A;  1MML A;  3UN3 A;  2DR7 A;  3RR8 A;  4OJ1 A;  3CJ4 A;  5CCL A;  1X4C A;  3DDI A;  3UCU P;  4O3N A;  2XMW A;  1U2R A;  1YRX A;  4OHV A;  4RKU C;  1ZYQ A;  1YBT A;  2NS1 B;  4ID8 A;  1M90 T;  1ZAX A;  2RIJ A;  4ED4 A;  1MLA A;  4DPU A;  2DNR A;  1DRZ A;  1P8G A;  3SDE A;  5D15 A;  4J9L A;  3EJM A;  4DMZ A;  4DLG A;  2EK6 A;  1FDB A;  5T41 A;  3NKY A;  1G2E A;  2D3O R;  2XGQ A;  2W2Q P;  2A1B A;  4KKO A;  3H42 A;  4BDP A;  4OYM A;  2E9Z A;  4QYZ J;  2E5J A;  4F4A A;  4UPI A;  1VHF A;  4ZIW A;  2CQC A;  2E1P A;  2BJ3 A;  3T6B A;  1T05 B;  5DG8 A;  4YME A;  3TZZ A;  5ETP A;  4M94 A;  3QJJ A;  1S6Q A;  2UU9 F;  4ZIV A;  2CQI A;  3EXC X;  1R8B A;  1TL7 B;  3QNW B;  2IM1 A;  3IGV A;  4QWA A;  3EGN A;  2VQE F;  2MY8 A;  4XDD A;  1SBR A;  3HDS A;  4ES1 A;  4JV2 A;  3FC9 A;  4WYL A;  2QSF A;  3G82 A;  5KOX A;  3AOB A;  4IOC Q;  3AD9 C;  1HNV B;  1R3N A;  2NXE A;  1FA0 A;  3SV4 A;  1N5Q A;  1JNR B;  2ILZ A;  2M7S A;  1RTD B;  4DV0 F;  4YB7 A;  2Y8W A;  1NHV A;  1IKY A;  4C3L A;  4DS4 A;  1N5Y A;  1L3V A;  2DTJ A;  1N4L A;  1V5I B;  2J7U A;  1GFW B;  1SC3 B;  5L9N A;  1SHQ A;  3EVW A;  3CCQ S;  2ASD A;  3V4M A;  3POT A;  4RPF A;  4DZ6 A;  4DF4 A;  2DR9 A;  4O3R A;  3NKM A;  2DJW A;  3NY0 A;  3NXZ A;  3CJS A;  5DO2 A;  2YXL A;  3CJK B;  1NRK A;  4CO1 A;  4QYZ K;  2E5L F;  1Q8K A;  1M1G A;  1LEO A;  1FKA F;  2ZUG A;  2MHN A;  1H0H B;  2RB7 A;  4PCQ A;  2HVZ A;  2PI5 A;  4KO0 B;  2ZZN A;  1FD2 A;  1SJQ A;  3BQ2 A;  1D9A A;  1N33 J;  3TAM B;  2D3U A;  2W7O A;  3THT A;  3IR6 B;  3AXM A;  2WSF C;  3B6B A;  2PSZ A;  2HHP A;  4EEY A;  5HL7 Q;  3A8I A;  3NRB A;  2FTR A;  3NWG A;  2K06 A;  2MZJ A;  3MCS A;  4OYI A;  1JLC B;  1LWE A;  2NPI A;  1GAO A;  1H72 C;  5B0D A;  1K1S A;  3PYG A;  4L75 A;  2JEG A;  3OUY A;  4J9P A;  4DR6 J;  1RE1 B;  2WVB A;  3DOK B;  3GJT B;  3PRB A;  1Q0N A;  3T5H A;  3B4D A;  1X7V A;  1PC5 A;  3IO1 A;  1I1G A;  5EDW A;  1CBK A;  1ZH5 A;  4DPT A;  5GAE U;  4ED8 A;  2V8H A;  1RAC B;  5HAN A;  4P73 A;  5ETT A;  4ELV A;  3Q3Q A;  1XN9 A;  4TXS A;  5K8N A;  4CYR A;  4B3S J;  4DU7 A;  3AHP A;  2ZJP Q;  2EG2 A;  3AJ2 A;  3J7A N;  3DC2 A;  1JQG A;  2BM1 A;  3AA8 A;  3UW1 A;  5EWE A;  4K2J A;  2IHR 1;  3I56 S;  4QIE A;  2GMH A;  4Y2I A;  1JLF B;  1MU2 B;  3Q8Q B;  4C8K A;  2VKZ G;  5D78 A;  3TEH B;  1RWU A;  5BYS A;  1KLN A;  2MLZ A;  4B3R J;  3UN5 A;  1DLO A;  1NK5 A;  3NGR A;  4OZL A;  1V3Z A;  2IVM A;  2A6M A;  1T9V A;  2IMW P;  4F4W A;  3HVA A;  4J9K A;  2CJK A;  2A18 A;  4K0K J;  4LJM A;  5GAG I;  1OS5 A;  3EM1 A;  4WP8 A;  2EFQ A;  2EVZ A;  4L73 A;  3MUR P;  4CO4 A;  1EJJ A;  3I82 A;  1T9W A;  2YKN A;  4K2X A;  3HHL B;  2U1A A;  4OL8 A;  1GX5 A;  4X66 F;  4HT5 A;  4C8Z A;  1RWO B;  4YFU A;  1WC4 A;  5AE1 A;  1QM9 A;  3VAL A;  1FER A;  1S9G A;  2AP6 A;  4QW9 A;  5DZ7 A;  4P75 A;  4CP5 A;  2YNF A;  1WF2 A;  2ADB A;  1GMU A;  2WVE A;  2LDI A;  4MKV A;  2DVI A;  2DYA A;  4A8O A;  4HHJ A;  4KHP J;  3DGP A;  2HHW A;  4LF5 J;  1RKJ A;  2OMO A;  2VBZ A;  2Q79 A;  3HFV A;  1VQ6 S;  4OYW A;  3DLE A;  2XQC A;  1U0H B;  3QLH A;  2HFU A;  4QOT A;  1YRT A;  4PZV A;  2HVE A;  3VCD A;  2JH3 A;  4WKY A;  1OJ4 A;  4ZVR B;  4OYX A;  3J7A 1;  3IS9 A;  1YJ7 A;  2ZDP A;  2ERR A;  1Z4U A;  3A8J A;  1Y4Z B;  3OD2 A;  1SQE A;  2VPY B;  5F8N A;  1N52 B;  1RAG B;  2JRS A;  3DNC A;  2GA7 A;  3MWB A;  4MY4 A;  1G6B A;  4LF2 A;  2OJ3 A;  1RHJ B;  2F5G A;  3SFG A;  2BZ2 A;  3LP0 A;  4K7Q A;  2WOM A;  1D1U A;  4BWM A;  4I0W A;  2W4D A;  2FVP A;  1CPZ A;  4QWD A;  3CIM A;  2GCF A;  3CED A;  4NLT A;  2VFV A;  1TMJ A;  3WAX A;  4HLB A;  5BYQ A;  3KUH A;  2MZQ A;  1RT2 B;  4DWI A;  4DCJ B;  3HO1 A;  3M8Y A;  2W25 A;  2OSQ A;  2HHQ A;  3QRQ A;  1SJ1 A;  3GG0 A;  3PHT A;  3DOM B;  3JTN A;  1HD1 A;  1YBA A;  1UWB B;  3A1Y G;  5KG0 A;  1KFS A;  4KC5 A;  1LWC B;  1TKZ A;  1WC6 A;  1WSV A;  1XR5 A;  9RUB A;  3R8Y A;  4TVA B;  3CMQ A;  1X9W A;  2DH8 A;  1EP4 A;  5KG6 A;  3R97 A;  3C46 A;  1WEL A;  2I6W A;  1T8E A;  4DOZ A;  2GGP B;  1IKV A;  1WHY A;  1TKX A;  1R0B G;  1SHN A;  2YWG A;  3CC2 S;  3C6U B;  2VON A;  4CO5 A;  3RUB L;  3CCW A;  4QWC A;  5LM7 E;  1ZOT A;  5L8R C;  5DLW A;  3DRY A;  4Q7A A;  2RQK A;  5AXN A;  3RBX A;  1OY6 A;  1N88 A;  1VS3 A;  1JLA B;  2BAN B;  2B4U A;  2RUS A;  2V8V A;  3VQT A;  1UZH A;  3MMC B;  3FBE A;  2Z58 B;  2BQR A;  3UVJ B;  1XTZ A;  3RRG A;  4JI8 F;  2W5R A;  1HQE B;  3VVT A;  1YX2 A;  1DY3 A;  1WC1 A;  2CWX A;  1UJ5 A;  1YDL A;  5B7W A;  5K5M A;  1HWL A;  4OYP A;  1HHT P;  2YH1 A;  5KFN A;  3UFC X;  2W5V A;  1PYO B;  4NEY A;  4LQ3 A;  1U4B A;  4QYR A;  3M2V A;  1KHV A;  4PUO B;  2H1Y A;  3CMR A;  4R0E A;  2F40 A;  2G0C A;  1UWA A;  1F2G A;  2WBM A;  3OXG A;  5D0H A;  3MTK A;  3EXY A;  3BEG B;  4L72 B;  5CD4 A;  1C1C B;  2W24 A;  3Q24 A;  2AEJ A;  1RTZ A;  5HVG A;  2UXC F;  1KH4 A;  2QTW A;  1CQM A;  1S1U B;  5DET A;  2VFU A;  5DGA A;  1TUW A;  4B9S A;  2AGQ A;  1N5T A;  1VQ9 S;  1HPZ B;  2AJF E;  3N28 A;  3QWP A;  2FJV A;  2ZZT A;  4PQU B;  4LR9 A;  4DR4 F;  3MK1 A;  2CZ4 A;  4OX7 A;  4CTA B;  2ANH A;  4ECW A;  5I3U B;  2GS8 A;  3CME S;  2IJF A;  4PR6 A;  3N01 A;  3EVO A;  5JVH Q;  3KHR A;  2AJ2 A;  4C8O A;  2W4C A;  3CPW R;  1CEZ A;  2HRT A;  1WKJ A;  4RJV A;  4NI2 B;  2HK2 A;  1RWW B;  1P27 B;  2BV3 A;  1WHW A;  2X98 A;  2J7K A;  1T05 A;  3O5T B;  2J9C A;  2PMH A;  4RBT A;  4YDD B;  5DG9 A;  3QAE A;  4MHX A;  4KGM A;  2A6O A;  3AB2 B;  2HBR B;  1HIY A;  1Q95 G;  4EBE A;  1TVR B;  2R8G A;  1RQ0 A;  1RBA A;  3ZZZ A;  1TL7 A;  3H20 A;  3DU6 A;  3WBH A;  1DTQ B;  2EFP A;  5K20 B;  1P9Y A;  4WFZ A;  3TJ9 A;  4QQB A;  1QLN A;  2HK3 A;  5AE2 A;  1HNV A;  4F7V A;  5HLF B;  1OY9 A;  4R25 A;  1IKX B;  1AA1 B;  1W2I A;  4OX9 J;  6FD1 A;  4HI2 A;  5U47 A;  1ZZF A;  2XS5 A;  2AYE A;  2ZBC A;  2G4B A;  3QGH A;  2JWN A;  4IH5 A;  2Z0G A;  2KFY A;  2VV5 A;  1A7G E;  1T9T A;  1Q8L A;  2Z30 B;  1X4E A;  1B64 A;  1EI6 A;  2QEX S;  4J90 A;  3NCR A;  3Q2S C;  3CJK A;  2DNG A;  2R7S A;  2UXD J;  2BUN A;  3N6N A;  3OVB A;  3UNY A;  3P8B B;  1IM6 A;  2POK A;  5EWG A;  2QA2 A;  4KO0 A;  3D0H E;  1Q8I A;  1X60 A;  4PAA A;  3TAM A;  3FMB A;  1NO8 A;  3I31 A;  1MWQ A;  1FKP A;  1F1B B;  1WD6 A;  3THP A;  2XMJ A;  1PIE A;  4KHM A;  1WI6 A;  4ZP7 A;  2D41 A;  2DNY A;  2NRE A;  1WHX A;  1AJD A;  5IXU A;  3KHH A;  4U7U D;  1JLC A;  3R7N B;  1M5O C;  1ROF A;  2MZT A;  4EO8 A;  2ZH9 A;  2LQJ A;  3ZZY A;  1Z2L A;  1Q53 A;  4DV3 J;  3TG0 A;  3DOK A;  3PHE A;  2W5W A;  4YR2 A;  4PKD B;  1U1Q A;  4URQ U;  1P9Q C;  3J81 Y;  2HSE B;  1NCL A;  3KLI B;  3K5M A;  5AXL A;  1VK3 A;  3UDV A;  4M5J A;  1M0S A;  2LLZ A;  2KTQ A;  2WTF A;  1X0F A;  3MM6 B;  4DL5 A;  5HMX A;  2JC0 A;  2CG8 A;  2I38 A;  1S72 S;  1ZEF A;  3FJ2 A;  2BE9 B;  1HI1 A;  5GAE I;  4OQJ A;  1IM4 A;  2BAB A;  1Y5L B;  1YIJ S;  3N79 A;  4X62 J;  1SC1 B;  3NGS A;  3MUV P;  1JLF A;  3HHL C;  3UE2 A;  2W8D A;  3W5Y A;  1MU2 A;  1KQK A;  1KHN A;  5IT4 A;  4H4M B;  2ROG A;  4ETZ A;  1XER A;  1FWP A;  2CJB A;  1U6Z A;  3HJV A;  2R7W A;  2MZ1 A;  4DR5 J;  3PJW A;  1VQ7 S;  3ZTP A;  3LW5 C;  5ETO A;  5DDP C;  1NJI T;  1PGZ A;  1ED9 A;  1QUV A;  1NHK L;  1R8C A;  2FGO A;  3KK3 B;  3H4D A;  1AJC A;  4ZCK A;  1OQ3 A;  5CYJ A;  2B43 A;  4YHH J;  3HHL A;  3TO8 A;  1X4D A;  2V4Q A;  5A2Q U;  1HMV B;  2E5I A;  3DLG B;  3QID A;  3HSJ A;  4NMX A;  4KAV A;  2I8E A;  2OFH X;  5ETS A;  2B6A B;  3DLL Q;  2ZKT A;  4EGL A;  4L3K A;  3CNQ P;  1IBM J;  3S8S A;  2XY7 A;  1D3W A;  1RLD A;  4UOF A;  1XNR J;  3CIZ A;  2AJ0 A;  4DFJ A;  2F7V A;  2HLU A;  3MED B;  1FRK A;  3O2I A;  1Q5Y A;  4YP3 A;  4DV2 J;  1E2S P;  2OD4 A;  5D0R A;  4LSL B;  2HAI A;  1CJV B;  3VQS A;  1VQK S;  2CQG A;  1U6F A;  3D3C J;  3H5U A;  3T9Z A;  4EO6 A;  4Y34 A;  1YZ7 A;  3R6L B;  4DR2 F;  1KLM B;  4ZVG A;  4I4B A;  4HT7 A;  4R8U A;  1RKI A;  3D7S B;  4YS2 A;  3TQE A;  1U0H A;  1LW2 A;  2IFX A;  2KVQ E;  1BQM B;  3KOA A;  2W8S A;  1WJ9 A;  1S10 A;  5E33 A;  1KKH A;  3I0R B;  1WG4 A;  3FCV A;  3ZNU A;  1L3T A;  2ZH3 A;  4I69 A;  1LWF B;  1MG7 A;  4ZLL A;  3OSP A;  3NNH A;  3PCO B;  1KC8 T;  4GMK A;  4H4K A;  2DK2 A;  2MQQ A;  3MEC B;  2V2K A;  2OPR B;  4MYT A;  2C1E B;  3CCZ A;  3OT9 A;  3MR6 A;  4WZM A;  3BRE A;  4OZ3 A;  3IGZ B;  1U1O A;  3H2U B;  4WKR A;  2OIH A;  2EBG A;  3FGV A;  3T02 A;  2D3O 1;  3OPK A;  3OFE A;  1WTB A;  1XNQ F;  4USV A;  1HFE L;  3W2W B;  5CZX A;  4A47 A;  4TU9 A;  2YQ3 A;  4QW8 A;  2Z8Q A;  3FEY B;  3M9O B;  2ZVI A;  2RAQ A;  3SMZ A;  3I6P A;  2HHX A;  1LWC A;  2EFN A;  4JI5 J;  2MKH A;  3LAL A;  2C28 A;  2J0X A;  3V5R A;  2NXJ A;  4ECX A;  2NZ4 A;  1HQU B;  2CQH A;  1AJB A;  2IDE A;  4IFV B;  1ANJ A;  3KJN B;  3FCH A;  4NCG B;  3ZZP A;  2DIT A;  2HFS A;  3VGV A;  3BGU A;  2GGP A;  4OLP A;  3J7Z 5;  3MD1 A;  1YQH A;  2DR8 A;  3QRR A;  4KSE B;  3DDN A;  1VQ8 S;  3O8W A;  3C6U A;  4UF4 A;  4NLD A;  2HHS A;  2W5X A;  2D69 A;  4NCB A;  1H7X A;  5D4O A;  4WXO A;  3RG6 A;  3TA0 A;  4CXK A;  2C3P A;  3CJ8 A;  4O44 B;  3DDK A;  4K4Z A;  2NYI A;  3PFO A;  1BMQ B;  5DLF A;  5A2Q Y;  4G65 A;  1FDN A;  1RYS A;  2CUY A;  1JLA A;  5KT4 A;  2WB1 D;  5J1P A;  3MMC A;  3J80 U;  1C0T B;  4JYA J;  2D7S A;  2MLX A;  3GE9 A;  2DH7 A;  3UVJ A;  2GIQ A;  3D1O A;  2X1B A;  4M63 A;  3BDG B;  1H2V Z;  3BO2 A;  1HQE A;  1U2C A;  2A2C A;  3MGJ A;  1RTJ B;  2CNK B;  4DR7 J;  1FF2 A;  4NLW A;  3PIP Q;  2GQC A;  4UQT A;  4LR7 A;  4CLS A;  4F26 A;  3PKM A;  4RW9 B;  2RH3 A;  2ZH8 A;  4PUO A;  3OL9 A;  1AT1 B;  4EZ6 A;  4OIX A;  3GV8 B;  4I68 A;  4ZJL A;  4LFA F;  4U9R A;  4N8N A;  3ZTO A;  1FVQ A;  4NWJ A;  1N34 J;  4ERD A;  2R2S A;  5ETQ A;  3PY8 A;  3QZ8 A;  1C1C A;  2VIH A;  1QVF R;  4LIW A;  5HRO B;  3T1Y J;  2GW8 A;  2W9A A;  1VJQ A;  1Y00 A;  4I56 A;  3OHA A;  1S1U A;  1VQS A;  2NCK L;  4DFM A;  3FRZ A;  3D68 A;  2C2N A;  1WOP A;  1QJH A;  4M5H A;  5IWA J;  2DEJ A;  2MQM A;  1IBK F;  4FPR A;  2AX1 A;  3DMJ B;  1UVI A;  1HPZ A;  2N7C A;  4U7C A;  4NML A;  4CXU A;  3T1H F;  2AQ4 A;  2LQ5 A;  4PWW A;  1TP7 A;  4PQU A;  2YNI B;  5HN0 A;  4HKQ A;  3R1H A;  1RLC L;  1R43 A;  5I3U A;  2HWI A;  2KM8 B;  3WX8 A;  1PC4 A;  3HVT B;  2BOA A;  4DSE A;  3DCA A;  1X31 C;  2CQD A;  1ARO P;  4B9M A;  3DRX A;  2MJU A;  4HI1 A;  1IWA A;  4P7T A;  1TV6 B;  2ZM6 J;  1RAA B;  2N82 B;  3D5M A;  2P9G A;  4NI2 A;  3V2U C;  4ZP9 A;  4DQR A;  2IA0 A;  4EUV A;  3M6V A;  1EHW A;  2B4V A;  1LXN A;  4CM2 A;  1UET A;  1JLG A;  1AUS L;  1W7W A;  2Z4P A;  2FVQ A;  4Y3C A;  3QYY A;  1RTH B;  3TA2 A;  2OTL S;  2VDH A;  5FJ4 A;  1TVR A;  2KZZ A;  5HRT A;  2KJV A;  1EZZ B;  3SV3 A;  2H48 B;  1HNW F;  1DTQ A;  2XGP A;  2JNJ A;  5F0U A;  2LU1 A;  2KXN B;  2L48 A;  1RA7 A;  2DNH A;  3BM7 A;  4O23 A;  4Z7Y A;  2LVW A;  1TU0 B;  3BJY A;  4USU A;  5HLF A;  4OV6 A;  1K44 A;  5EX3 A;  5KFR A;  2DHG A;  1IKX A;  2GQ2 A;  4CLY A;  1U1P A;  1QSS A;  3ZZU A;  3GMG A;  4CYS A;  3F44 A;  1JKH B;  2MMY A;  2PA8 D;  2B9W A;  2HAF A;  5KFJ A;  1X4B A;  4QR2 A;  1FTR A;  1VDH A;  4HDH A;  4ED6 A;  4TU8 A;  1WOO A;  4A8F A;  3UDC A;  2BR0 A;  3NVL A;  8RUC A;  3CCT A;  4IKA A;  5GVQ A;  4KPC A;  1TK0 A;  2QGF B;  4TY9 A;  4FXW A;  5LMN F;  1RBL A;  4DR1 J;  1B3T A;  1ICE B;  2COL A;  4DX5 A;  4A8Y A;  2UUC F;  2HQC A;  4PEO A;  3FFI B;  3UN2 A;  3W7B A;  1ALJ A;  3I32 A;  3KHL A;  4K5R A;  3AA9 A;  1V3S A;  3R3T A;  4B9V A;  2HVD A;  3J7Z T;  1XBW A;  2A3J A;  3CD7 A;  2FHM A;  1B99 A;  4MKY A;  3N5B A;  3KDN A;  1PBA A;  3BF4 A;  3MM8 B;  2JVR A;  5EGH A;  2CQ1 A;  4OHW A;  3RGI A;  1IQT A;  4KH0 B;  4J9V A;  4TU7 A;  1MRO A;  3WZ0 A;  3DU5 A;  1U49 A;  2HFO A;  1RT7 B;  3IM9 A;  5F3Z A;  4Y2C A;  4IOA Q;  4KR0 B;  4O3P A;  3M32 B;  4ZVO B;  4EK2 A;  1FHT A;  4CH7 A;  1XMO F;  3TUZ C;  1KFD A;  1TQL A;  1MWY A;  3GYG A;  5E0O A;  3QRP A;  4R0J A;  4U67 Q;  3KLI A;  2H9Z A;  2V4J B;  2DGS A;  2OPS A;  3NP5 A;  4NZ0 A;  3C66 A;  2ACY A;  4LF9 F;  4ED7 A;  1D8Y A;  5L38 A;  3MM6 A;  2XLK A;  5B0G A;  4KQZ A;  4ED1 A;  3U1M A;  1SL0 A;  3OBI A;  1RJJ A;  2EFV A;  1UPP A;  1K8A T;  4ALZ A;  4RNM A;  4Y00 A;  5KFD A;  4F0H A;  4Q43 A;  3UO0 A;  3HSD A;  3Q89 A;  4H4M A;  5KFB A;  3OTO F;  2LXF A;  2J9E A;  4NYP A;  2C2E A;  2P8I A;  3QAT A;  2UXB F;  2MJN A;  2DNP A;  4ED3 A;  4JI3 J;  2OGU A;  3H4B A;  2ZOM A;  2YKO A;  3CWJ A;  3MUM P;  3C8Y A;  3BYP A;  3G96 A;  1GNK A;  3KK3 A;  2DCL A;  5TJ3 A;  1AFI A;  4DV5 J;  3ISZ A;  1OSD A;  3GCX P;  1FX2 A;  2FQQ B;  2J7W A;  3DLG A;  5JMN A;  2Q1L A;  1EX8 A;  2MB0 B;  4CO2 A;  2B6A A;  1VIS A;  2BVZ A;  1S1V B;  4PXB A;  3AFG A;  4YB6 A;  3OSN A;  3DGV A;  3LGM A;  4LF6 F;  1OWX A;  3ILL A;  4QIG A;  4X65 J;  3H0P A;  5KFY A;  4I2Q A;  3MED A;  1VQO S;  3ELH A;  3ITH B;  4K5S A;  2B51 A;  1DJ0 A;  3K7R A;  2XSJ B;  3DRS B;  4LSL A;  4YB1 P;  1HI0 P;  4LRE A;  2HGL A;  2GAG C;  2LXU A;  4KAI A;  5E7O B;  3TW0 A;  3OJS A;  2XSF A;  4USI A;  4K4S A;  2JZ5 A;  1KLM A;  2XO6 A;  4M5G A;  5A8K B;  4ECS A;  1NME B;  1NUE A;  4ECZ A;  1YJW S;  1BQM A;  5T7L B;  3JB9 k;  1M5V C;  3NGK A;  1U6B A;  2C42 A;  4P9S A;  5F8H A;  5ETK A;  1TL3 B;  2K1R B;  3ONQ A;  2G0J A;  2PEB A;  4C4W A;  1XMB A;  5LIA A;  4O3Q A;  1S1X B;  3PV8 A;  4LQY A;  3MEC A;  2OPR A;  4LRB A;  2RD5 C;  1FK9 A;  2ATC B;  4FPI A;  3WC2 A;  5A76 A;  5KG5 A;  4ZIT A;  4NCA A;  2JLE A;  3ILJ A;  4YY3 J;  1S1W A;  4QWB A;  2ZOF A;  3TUJ C;  5A8R A;  4X4R A;  2U2F A;  3ENW A;  5KFE A;  2DBB A;  2HQG A;  2V8D A;  3W2W A;  2IBK A;  4UW2 A;  4PAB A;  4M1K A;  3PR5 B;  5DDQ C;  3HPO A;  2B7C B;  2VOO A;  5HQ8 A;  2QMW A;  4Q45 A;  4CDI A;  2M0G B;  3JAM U;  3MOJ B;  5HVH A;  1ELO A;  1HQU A;  4QU7 A;  5HK4 A;  5BJR A;  4WIQ A;  1SVD A;  5F0W A;  2RH6 A;  4NCG A;  2LQ9 A;  2H4Y B;  1S7H A;  5KTQ A;  1HYS B;  4OHY A;  4LMZ A;  1XK8 A;  3OXF A;  4MJK A;  2Q3P A;  1A6L A;  4J91 A;  3TYT A;  2MXY A;  3JXO A;  2HG4 A;  4DU8 A;  2GSO A;  4FNH A;  1CQN A;  3MMJ A;  1RA6 A;  2EW9 A;  1KTV A;  1BXN A;  3CTR A;  4NXM J;  2I2Y A;  1N33 F;  2F65 A;  2IYI A;  4GTW A;  1BGX T;  2RU9 A;  4Y2A A;  4UOP A;  1EKS A;  3W64 A;  4DI6 A;  4O44 A;  1IKW B;  3R5D A;  2RF2 A;  3BGO P;  3QJP A;  5K9F A;  3BSN A;  4GRS A;  1C0T A;  3DKD A;  3S7R A;  5B0C A;  2M52 A;  1RT5 B;  5E3C A;  3EVM A;  4DR6 F;  3I96 A;  1RTJ A;  4E0D A;  1U2F A;  1BY9 A;  5LSR A;  3OQ2 A;  3D1H A;  3AQO A;  3HI9 A;  4ECT A;  2IM2 A;  2L08 A;  3TA1 A;  5KFM A;  1RT6 B;  4FZV A;  1ZBT A;  4OYB A;  4YR3 A;  4RW9 A;  2GJF A;  2B4O A;  1SH3 A;  1U1R A;  1O98 A;  2YWK A;  3M6W A;  4B3S F;  1H7W A;  1RT1 B;  4RW7 B;  3EPI A;  1JXL A;  4RNO A;  2LP4 A;  2RRA A;  2OUG A;  3GP9 A;  4ZVS B;  5HRO A;  1TAQ A;  3T6J A;  3BGF A;  4UOG A;  3C14 B;  3MM5 B;  1X5O A;  1I6J A;  4B3R F;  2NSB A;  3VF0 B;  2C2O B;  2WVD A;  3MPY A;  2M2B A;  4K0K F;  4ECU A;  2K7J A;  1S76 D;  3DMJ A;  3AOC A;  2C3O A;  3HLU A;  4CXS A;  3R5B A;  2OEJ A;  1VFJ A;  5D0E A;  5AXM A;  5KXA A;  3GR0 A;  4DPX A;  2YNI A;  5J2P B;  4ES2 A;  1JLB B;  1R0A B;  3HVT A;  3OLB A;  2JVO A;  2QA4 S;  1FNO A;  1TV6 A;  3D4J A;  2LFV A;  2RRN A;  1VGY A;  3JAM Y;  4NZ6 A;  4N5S A;  4ZVF A;  3A8E A;  3L7U A;  2XMA A;  2HYI B;  1VQ4 S;  3VAG A;  3FCW A;  3HMJ G;  2DKO B;  3BQ1 A;  4OJ3 A;  3NNA A;  1RTH A;  4LF5 F;  1AXQ A;  5HQM A;  4DLE A;  1SQG A;  1E6V A;  4GC7 A;  3DI6 B;  3K5P A;  4TYA A;  3KKF A;  4NX9 A;  3BDE A;  5EGE A;  1Y7A A;  3CMA S;  3GQC A;  2OML A;  3LPE A;  2DGO A;  3MR2 A;  3KNA A;  4X4T A;  3R6G B;  2VL1 A;  1XWL A;  1UKU A;  3CCL S;  1HLW A;  1KH5 A;  4U95 A;  3OFF A;  5K4P A;  1JKH A;  2M4M A;  3LUY A;  2MTL A;  4PG8 A;  4QPT A;  1KEK A;  5LSL A;  3L4B C;  2XBP A;  5LXR A;  4DQQ A;  3W9J A;  4KJI A;  2RIL A;  1U8W A;  4ECR A;  2M70 A;  2PFF B;  1SCJ B;  2F3J A;  4ZPA A;  3DYC A;  1G1X A;  1NLK L;  4GTZ A;  1KVK A;  4GO5 X;  3D1Q A;  3GWC A;  1JMT A;  3HFK A;  2DPI A;  3TVY A;  2MQN A;  4EBD A;  4M5L A;  5D4L A;  1ZZN A;  1CUL B;  4ZPT R;  2CPX A;  3HM9 A;  4GO7 X;  2MKJ A;  4GC6 A;  1PYS B;  3FFI A;  4F4X A;  2QE5 A;  3QQC D;  1Y5I B;  4C3M A;  2ILY A;  4V19 J;  3C16 B;  3CO9 A;  1V5V A;  4MAK A;  4MFB B;  4CLT A;  1EW2 A;  3GJR B;  3ZC4 A;  3MM8 A;  1EW9 A;  3AOD A;  2BRL A;  3M8W A;  2J9D A;  3NOC A;  3SSQ A;  3TJA A;  1PJ7 A;  1RT7 A;  2Q6C A;  4IG0 B;  3MUT P;  3U1N A;  1PIL A;  4PRF A;  4LBP A;  3W61 A;  4DQS A;  3TZX A;  2CPD A;  2DB1 A;  2QV6 A;  3DLK A;  4XPC A;  1D09 B;  2PII A;  2MKS A;  4J9U E;  5AT1 B;  4CWB A;  4LIR A;  3K89 A;  1TL5 A;  1IN0 A;  1REG X;  2JC1 A;  1KDN A;  4A8X A;  1HR0 J;  2V4R A;  1RAE B;  4C0H A;  2KG1 A;  3PZP A;  4RW8 B;  3BH7 B;  1B7F A;  3OJU A;  5CCM A;  2XHW A;  3K8W A;  5LRN A;  1KBR A;  3FEZ A;  3L09 A;  3VGS A;  3HKZ D;  3AJD A;  4ZVU B;  1D0E A;  3M30 B;  3PM9 A;  2EWH A;  2H5I B;  4DCP B;  1RXO B;  1UFL A;  5KAK A;  2L9N A;  1UJ6 A;  5L9X A;  3RAQ A;  4RBV A;  2QZ8 A;  2BYC A;  1VR6 A;  1T7P A;  3OTD A;  3H5Y A;  3WX4 A;  2HWT A;  3NAI A;  1PO6 A;  2X1F A;  3IC1 A;  4KGX B;  3R5J B;  2VBW A;  4FYY B;  2HRY A;  1FRI A;  3ZXW A;  4RW4 B;  2ROP A;  4C8M A;  5KFT A;  2OH2 A;  2OEM A;  2MKI A;  2HHV A;  4DV0 J;  3D6M B;  3H90 A;  5RUB A;  3PRV A;  2XSJ A;  3DRS A;  3W5X A;  2HBZ B;  2Z57 B;  3DRR B;  2QL7 B;  3SSR A;  2JL9 A;  2CQB A;  4ZPW R;  3T3F A;  1OYD A;  3KLE A;  1OPZ A;  2CAJ A;  2FIU A;  2IMO A;  3H40 A;  2AD9 A;  4E98 A;  4RBU A;  2E1C A;  5A8K A;  2KRB A;  5GAH I;  2OSR A;  2FJE B;  1FRL A;  5T7L A;  3MD3 A;  1FD8 A;  2GX8 A;  5KFL A;  4ZS6 A;  1H98 A;  3E2E A;  4K59 A;  4O0N A;  3M2R A;  2D3Z A;  1TL3 A;  4J5O A;  2L41 A;  1RB0 A;  1C1B B;  1S1X A;  1YVF A;  3PAC A;  1TL1 B;  5LJ3 Y;  4EMD A;  4J9N A;  1OQ6 A;  1FKO B;  2BRK A;  3SCJ E;  4K50 A;  2IUC A;  2E66 A;  2R7V A;  2ZHA A;  2EXU A;  3RRH A;  1I94 F;  3KK1 B;  2JEI A;  3G8T A;  3AY0 A;  2BBE A;  1HBM B;  5KFO A;  3Q23 A;  4ILM A;  2CDR B;  4P2S A;  3S1T A;  1S6U A;  5GAD I;  3SZ2 A;  2QO3 A;  2FB0 A;  3KG1 A;  4K4W A;  1GTE A;  3B8H A;  3I5A A;  4EYH B;  5B08 A;  1NU4 A;  3HKW A;  3VV2 B;  1OSC A;  3KWM A;  1VQ5 S;  4ZPV R;  2VQR A;  3E2D A;  1HHS A;  4C6A A;  1XMQ J;  2OO4 A;  2HEK A;  3N9U C;  2ZKU A;  4NYO A;  1U8S A;  1S0O A;  3ZNJ 1;  4P2F A;  4HTI A;  3KLF A;  4BBY A;  2FUG 9;  3RRK A;  3MEE B;  1HYS A;  2Q43 A;  1DTT B;  2HQ3 A;  3DPC A;  4OX8 A;  3PRD A;  3LAN A;  1MN9 A;  5KFA A;  2W5S A;  2KFZ A;  3THV A;  3D0G E;  2DGT A;  3TAQ A;  5ADZ A;  2D74 B;  5DG7 A;  3NGT A;  5DRK A;  4X64 J;  4OHX A;  1GH8 A;  3OR1 B;  2CQ3 A;  1IKW A;  2FDN A;  4B08 A;  3VAM A;  3MEG B;  2VG7 B;  3UCZ P;  2W7A A;  2HFZ A;  1HBU B;  4UY8 5;  5K8P A;  1YZ6 A;  2B7B B;  2DXE A;  1KQF B;  1EET B;  5HMY A;  1ZTW A;  3PJX A;  5L1K A;  2HRU A;  4CNY A;  3UCG A;  1B7Y B;  4DV3 F;  1RT5 A;  4XDC A;  5BYR A;  3Q2T C;  2DY1 A;  3GLJ A;  4ANC A;  3FZ2 A;  1NB7 A;  3BGR B;  3AT1 B;  5HJY A;  2GVD B;  3WBZ A;  3MAH A;  1S0N A;  3HX9 A;  3TAR A;  1T9Y A;  1RUS A;  2WBR A;  1WHV A;  3NGU A;  1RT6 A;  1U02 A;  3CUN A;  4LF4 J;  3M2U A;  2ZC3 A;  3C15 B;  2NYH A;  5HSP A;  4CCH A;  3QT8 A;  2BQU A;  1RT1 A;  2NSC A;  4JI1 J;  3RW7 A;  6AT1 B;  5K14 A;  7FD1 A;  4RW7 A;  3T00 A;  1Q7L B;  3V6K A;  4X62 F;  2R4F A;  3H98 A;  3OL8 A;  4Q0B B;  3G2X A;  4TY8 B;  3C14 A;  1RT4 B;  2A2D A;  4IG3 B;  1S77 D;  2MYF A;  3TX8 A;  4TQS A;  4DR5 F;  4ED5 A;  3F41 A;  3IN5 A;  1NZ8 A;  4S0M A;  3MAQ A;  3V4I B;  2DT9 A;  4RLE A;  2CPI A;  2V94 A;  3TEG A;  4ZVE A;  3PX4 A;  3RR7 A;  3I4H X;  3DOL B;  4G3I A;  1IR2 A;  5J2P A;  4DF8 A;  3DHW C;  1R0A A;  1IBM F;  1S59 A;  2K2P A;  1S0M A;  1XNR F;  4CRJ A;  1KVI A;  1CJT B;  2XNR A;  2XZD B;  2DGW A;  2CFX A;  3QFW A;  4DQI A;  1ZAV A;  2Y1J A;  1F9E B;  4LT6 A;  4DV2 F;  2P6S A;  2UZA A;  3QIP B;  3IR7 B;  4PG5 A;  1FJG J;  1BWE A;  1DHM A;  2ZH7 A;  1RSC A;  2WAQ D;  2L9W A;  4NYZ A;  2QSW A;  4F2S A;  2NPF A;  3NKN A;  3ZZT A;  2YKM B;  1H6K X;  5F3T A;  3H5X A;  1GXL A;  4USJ C;  1NZA A;  4PPZ A;  3CO0 P;  3W66 A;  1NJX A;  3KDO A;  4KH1 B;  1FNM A;  3FSX A;  2UV8 A;  3EPG A;  5E41 A;  4KRW A;  4NA2 A;  3QWU A;  2GFF A;  1T95 A;  2FGC A;  4FBU A;  2IAJ B;  5J2M B;  5KT7 A;  3NNC A;  3QT5 A;  1J5E J;  1ZPW X;  5L46 A;  3E51 A;  2VA2 A;  2QYC A;  2XMT A;  5L39 A;  1X4H A;  1WI8 A;  4P2M A;  1R6V A;  4OZ1 A;  3O44 A;  1NDK A;  4FYV B;  3BDP A;  2MGZ A;  1G7C B;  1PKU A;  1VRT A;  3FQK A;  3PW0 A;  1WSR A;  3W62 A;  4IFY B;  3G8Q A;  2AW0 A;  2MPU A;  1AUK A;  4X4N A;  1CUL A;  1CVJ A;  2WHO A;  3IDD A;  1H2U X;  5IV3 A;  1FNX H;  5IC6 B;  4JI7 J;  4LVN P;  4JI5 F;  3ZTQ A;  1CJK B;  1U7L A;  2IRU A;  2RU3 A;  4WWS A;  1FDD A;  4ZOS A;  2DPJ A;  2XRG A;  2DHX A;  2O3D A;  3GSD A;  4AL7 A;  1HNZ J;  2CNO B;  2XLJ A;  2E7V A;  2XS7 A;  1RAJ A;  1ED8 A;  4M5D B;  1RHR B;  4WFY A;  1O51 A;  3M6X A;  2WW4 A;  4IG0 A;  3B78 A;  2LA6 A;  2YPY A;  2IRY A;  1YLX A;  2DHH A;  4Y6I A;  2ROE A;  2UXC J;  3HVR A;  2M5Y A;  1VC0 A;  3I87 A;  7AT1 B;  5KOW A;  1SB6 A;  4I64 A;  1ELX A;  4JYA F;  2OD6 A;  2W1B A;  4FXV A;  4DFP A;  5IQ6 A;  1PJ5 A;  3IBF B;  1IJE B;  3LQV A;  3D6T B;  5IT0 A;  4DR4 J;  2H65 B;  4RW8 A;  4X4O A;  3TUI C;  3HD1 A;  4JP8 A;  4DR7 F;  4PWD B;  4X4U A;  2H51 B;  4PYA A;  4DL3 A;  5HQL A;  5LT5 A;  3MPW A;  1EQ0 A;  3NS5 A;  3AQP A;  3M30 A;  3HHD A;  4NLV A;  4ZLP A;  3L95 X;  1Q86 T;  2FC9 A;  2GA3 A;  1VQM S;  4NLU A;  2OKQ A;  2MQ8 A;  2QRR A;  1N34 F;  3K58 A;  4F0K A;  2I9S A;  1RAD B;  5ETM A;  2GJ2 A;  3GPA A;  3QZ7 A;  3KFW X;  4AQY J;  3T1Y F;  2PDA A;  3UNG C;  2H5J B;  1BHN A;  2BXJ A;  2VPW B;  2XCP A;  2GLQ A;  1U1K A;  1URR A;  1LW0 B;  3BR8 A;  3HSG A;  2GVZ B;  3IRX B;  5J1N A;  2QA4 G;  1UTA A;  2B5J B;  4ZHR B;  3NG8 A;  1MWZ A;  3M05 A;  4O3S A;  1AYE A;  2APO A;  4WK1 A;  4IRD A;  5CYM B;  3DRR A;  4WP9 A;  4PXC A;  5I42 B;  3DRP B;  4RL1 A;  4DG1 B;  3HK2 A;  1KS2 A;  3NLC A;  5KFX A;  2KU7 A;  4UOC A;  3VVU A;  1EAR A;  3DHX A;  2ZM6 F;  1K73 T;  4FF4 A;  2GO8 A;  5SUH A;  1U45 A;  3WAY A;  2KN4 A;  2LYV A;  2DCU B;  3TUP A;  1P1L A;  1F9F A;  3NBP B;  2LXI A;  2VD3 A;  3SCI E;  3CSK A;  2GIR A;  3ZZR A;  1NK0 A;  2A10 A;  4HH1 A;  4AFF A;  1ZET A;  3T9N A;  1H2T Z;  2G0I A;  1F6T A;  1W2B R;  1C1B A;  2KHC A;  1TL1 A;  4KB7 A;  4A8K A;  1E3C P;  2YX7 A;  3AXK A;  1Q1K A;  2R2R A;  4ZN1 A;  1LOU A;  2PI4 A;  1S79 A;  3M9M B;  1D8Z A;  3VZI A;  4DN0 A;  1FKO A;  1PCA A;  2VG6 B;  4WK3 A;  4UUW A;  3K5N A;  2CG4 A;  4DL6 A;  1NHU A;  2J0Q D;  2ZC4 A;  2PMW A;  4DL2 A;  3HFZ B;  2ZH4 A;  1HBM A;  3DYA A;  2AZ3 A;  1IR0 A;  2Y0S D;  1SL2 A;  3LP2 B;  5DLT A;  1S1T B;  2VPX B;  3MAA B;  1WKK A;  1YBU A;  1KSP A;  4ZP8 A;  1RWX B;  3LGH A;  3SEO A;  3JSB A;  4KHR A;  1NAQ A;  1O99 A;  4LRC A;  2J76 E;  2KFN A;  3A3P B;  3NMA A;  3LP1 B;  2J8A A;  4DPO A;  5JXS A;  3HHE A;  4DV6 J;  1KHJ A;  1R8P A;  2UUB J;  4MT1 A;  1FWL A;  1HQA A;  2MKC A;  5KFU A;  2XI2 A;  4HHU A;  4OZ2 A;  5CAB A;  3BS9 A;  2AYB A;  5G0R B;  3E3X A;  3TAP A;  4M5I A;  1RTI A;  2Y9H A;  1N0U A;  2WSC C;  4LRF A;  3OR1 A;  3IWL A;  2E9R X;  4I2P B;  3MEG A;  2VG7 A;  2EC0 A;  1KQG B;  2ZH6 A;  1HBU A;  2C2M B;  2QFI A;  3IAS 9;  2FLN A;  1EET A;  5CHC B;  1JJ4 A;  2FD2 A;  5LXY A;  1S6P A;  2W8K A;  4ED0 A;  2PFD A;  4LQ9 A;  1EJ7 L;  3P45 B;  1S9E B;  2GVD A;  2VC1 A;  4ZMM A;  3SIP B;  3CDE A;  1ZM9 A;  1E1Z P;  4QU6 A;  2PA3 A;  3SQO P;  3EIC A;  4O4G B;  3GCW P;  3UDE A;  3LWM A;  4USH A;  1XR7 A;  5CD4 H;  3WDO A;  1UVN A;  5GRR A;  2V2V A;  2G1H A;  5HBM B;  1IBL J;  3N0V A;  4Q8E A;  3V6D B;  4F50 A;  4Q0B A;  3MPV A;  1RGV A;  3FDS A;  2FVS A;  5T14 A;  4WE1 B;  5E3Q A;  1K1Q A;  1RT4 A;  3IGY B;  4IG3 A;  4F04 B;  2BQ3 A;  1N5S A;  4NL5 A;  3OLA A;  2XWX A;  3F56 A;  1HWK A;  3EGZ A;  4JI3 F;  3V4I A;  2HZC A;  4IYQ A;  3D66 A;  3Q8S B;  2BW7 A;  1TK8 A;  3KNG A;  3DOL A;  3NL0 A;  2QN6 B;  1QAX A;  4DJB A;  4DV5 F;  3FK4 A;  1CC8 A;  1ALH A;  2AHO B;  4DL4 A;  4UPL A;  3ISN D;  3GIL A;  2AGO A;  1QAY A;  4KPY A;  4FDF A;  4L6V 3;  3R5C A;  4M5K A;  2WK4 A;  4X65 F;  1CJT A;  2X1G A;  4NLO A;  3VAK A;  4DX8 H;  4LR2 A;  3QIP A;  2B9Y A;  1IKY B;  1N6Q B;  1N5Y B;  1XNQ J;  3UI3 A;  4BLG A;  4W98 A;  2HWH A;  2AGP A;  1KRP A;  1JB0 C;  3E8O A;  1BC6 A;  2E1A A;  4Y2K A;  2V67 A;  3LO3 A;  2HNZ B;  2EC2 A;  3D9B A;  3POT B;  1RP5 A;  2RT3 A;  1NKC A;  2YKM A;  3TAN A;  2PMZ D;  4M8L A;  2DNK A;  3PNI A;  4FF1 A;  4UQG A;  3IBW A;  1F3V A;  2HVI A;  2F4V J;  2I1R A;  2JHE A;  3HZE A;  1RZM A;  2DRA A;  2IAJ A;  3C3L A;  5J2M A;  1AUD A;  2ZE2 A;  3MFH A;  4B3M J;  4JI6 F;  1N8R T;  1VOM A;  2RJZ A;  2B9E A;  1F5A A;  3P49 B;  2N4C A;  1OO0 B;  4DV7 J;  4OZJ A;  1QAI A;  2BEF A;  2WVF A;  5DDR C;  5KFG A;  2G2Z A;  2BA9 A;  1YJ9 S;  2VBX A;  2ZHO A;  2OFG X;  2XUL A;  1SKU B;  5EX0 A;  2LQB A;  2L3M A;  3V81 B;  3LA0 A;  1NSK L;  2CJQ A;  4YY3 F;  4X2B A;  2PO4 A;  1ELZ A;  4P74 A;  1X5T A;  4IFY A;  1UZD A;  4NA1 A;  3C19 A;  3TP2 A;  5KFC A;  4URG A;  2G9Y A;  3GTY X;  4LVO P;  1R27 B;  1KVJ A;  3PJ9 A;  1CJK A;  2DRD A;  3Q0A A;  2HLT A;  1C4A A;  2P6T A;  3OR2 B;  3PX0 A;  3PEH A;  2HZV A;  2R8H A;  3T5J A;  3C2P A;  1L3K A;  2OPQ B;  1L3S A;  3O3L A;  4Y65 A;  2BJ9 A;  4M5D A;  3KJF B;  1VBK A;  1F2H A;  2JDJ A;  3MCN A;  3FBF A;  3MCM A;  3US5 A;  4NXM F;  2IA6 A;  1NK9 A;  1NDP A;  3KXD A;  5F9L A;  1AB8 A;  1JIH A;  5GAG U;  2J9D E;  3QGI A;  1O0P A;  1RDR A;  2RML A;  4K8R A;  2QLX A;  1LQ9 A;  3C6T B;  2VAS A;  4YEA A;  3VTI A;  1QD1 A;  4EBC A;  1HNX J;  2BE2 B;  1N56 A;  3CC4 S;  5IT9 U;  1YJR A;  4RNN A;  4A8Q A;  5EWF A;  1NEE A;  3K8V A;  2Y1I A;  2R42 A;  3U02 A;  1X4F A;  1RTD A;  3RB4 A;  3WHI A;  2MKK A;  2H4W B;  3EGW B;  3TRG A;  3CJ3 A;  2ZVS A;  4NAS A;  1B0P A;  3KLH B;  4PWD A;  4Q8F A;  4CT9 A;  2UVR A;  3QPI A;  2YNF B;  3KG4 A;  1B70 B;  4B17 A;  2BM0 A;  4NRT A;  4ETX A;  5M2U A;  4A4J A;  5D4N A;  4AND A;  1YJU A;  5ITH A;  4O3O A;  3UR0 A;  1FXD A;  4KJG A;  1ZA2 B;  2H3E B;  2RVJ A;  5I3P A;  5KFV A;  3DFE A;  1Q7Y T;  1FFS B;  3NKO A;  1AJA A;  4KV8 B;  1RU2 A;  4ZKA A;  3O6Q A;  3UPF A;  2KT3 A;  5KFK A;  3T19 A;  4H54 A;  4ZN3 A;  2ZUA A;  4O0I A;  4F8R A;  4BWJ A;  3DLE B;  2KJW A;  5K8M A;  4USW A;  1URB A;  2KYZ A;  2R7U A;  2CQ0 A;  5CH7 B;  3Q8R B;  1LW0 A;  5C66 A;  4FP9 A;  2GVZ A;  4WXW A;  4WPA A;  4BCA A;  2B5J A;  4ZHR A;  3MDF A;  3IS9 B;  3SQG B;  4DSJ A;  5DGB A;  2GJI A;  3BO3 A;  2XO7 A;  1FTC A;  2Y1R I;  2VFT A;  4AYB D;  2YY3 A;  2HUR A;  2AYG A;  5I42 A;  4DG1 A;  1FX4 A;  1HAR A;  1S49 A;  2PE8 A;  2KKH A;  4IH7 A;  1G3O A;  1TTH B;  5E5N A;  2SXL A;  2F4F A;  1E33 P;  1MSW D;  4QAX A;  2CA9 A;  4WFX A;  4E8U A;  3VHQ A;  2DIS A;  3GV7 B;  1TUV A;  3QFH A;  4TLR A;  4LF8 J;  3NBP A;  3J7Y U;  3UQS A;  1SUQ B;  3QGG A;  4RWW A;  1UEU A;  3D6H B;  1U09 A;  3CGI A;  4DUT A;  1RHK B;  3BR9 A;  2RNE A;  1M5H A;  3IBC B;  4FVC A;  2CVE A;  4N56 A;  2X3D A;  4XO0 A;  2C3M A;  3ILO A;  4KFB B;  2XM3 A;  4AUK A;  2YNH B;  4U96 A;  3TI0 A;  1X4G A;  3TNV A;  4IRK A;  2VG5 B;  3I5B A;  2K7K A;  2CVI A;  1MW7 A;  2NXU A;  2VG6 A;  1XEZ A;  4IO9 Q;  4XPE A;  1U1N A;  2V63 A;  2X3G A;  3H25 A;  1NK6 A;  5KT5 A;  2G9O A;  3FQL A;  5IT9 Y;  1FFG B;  1SI9 A;  1NSA A;  1PSD A;  1XMO J;  1FJ7 A;  2N3L A;  3LP2 A;  1S1T A;  1Q4R A;  2K8G A;  2R7O A;  4C48 A;  3MAA A;  2ZBR A;  2QFJ A;  2KT2 A;  2B9X A;  3MR7 A;  2M9K A;  5KFI A;  1WNE A;  4OYA A;  1WG1 A;  4F0M A;  2CJ9 A;  3OL6 A;  3CJR A;  3VAI A;  3LP1 A;  1SQF A;  2J6S A;  2XEX A;  2DGV A;  3R9L A;  4A48 A;  4Z7C A;  1M1K T;  2IVY A;  3H2V E;  5M2P A;  4GVB B;  3P96 A;  5G0R A;  1UFK A;  3GU0 A;  3LXQ A;  2CKW A;  2XR9 A;  2KG0 A;  5KFP A;  1RAB B;  4I2P A;  2W5T A;  1U1M A;  3IP0 A;  4CQ1 A;  4ZVQ B;  4C11 B;  2QLW A;  2MST A;  3EZ5 A;  4C97 A;  5M2R A;  2DR5 A;  1NJZ A;  3BH6 B;  2O1P A;  3QAU A;  3K57 A;  3QJL A;  3EZO A;  3ENA A;  4MMO A;  1S9E A;  3BQ0 A;  4F67 A;  2YWH A;  1QDU B;  4N76 A;  1BD6 A;  2YTC A;  3QSY B;  4LF6 J;  4NLX A;  5CA5 A;  5DLV A;  4O4G A;  1R0C B;  1SPB P;  1DAR A;  1WDD A;  4QIV A;  4ZPC A;  4ILR A;  1HR0 F;  1LKZ A;  2AZ1 A;  2GHW A;  3JQJ A;  2VZ9 A;  1ZTT A;  5HBM A;  1RT2 A;  3V6D A;  4CLU A;  2V2Z A;  4DN9 A;  3Q8P B;  1ZS6 A;  3DLB A;  2NXC A;  2CYY A;  5AJ9 A;  4JI4 J;  2R3V A;  4WE1 A;  3DOM A;  1RT3 B;  1UWB A;  1DFD A;  4ELT A;  2CJA A;  1TFY A;  4ZG9 A;  4G1I A;  2VFS A;  2ZD1 B;  2W4P A;  5LQQ A;  1GXT A;  3MEK A;  4KTQ A;  2CZV C;  3AOA A;  2EBE A;  2FLL A;  2AJ1 A;  1KON A;  3G6E S;  4RU9 A;  3L9Z A;  3CCM S;  4EZ9 A;  5H9E K;  1J5O B;  2BKN A;  3G71 S;  1H38 A;  3V6J A;  1F60 B;  4YB5 A;  4N47 A;  2OPP B;  2GZO A;  2J0S D;  1VIX A;  3D28 A;  4OI1 A;  5H9F J;  3JTP A;  1SC4 B;  1KD1 T;  1U1L A;  4QR0 A;  1KP6 A;  4QR1 A;  2JJ4 D;  3ADA C;  3VR1 A;  2LMI A;  1NSQ A;  4OHZ A;  1GMW D;  2W8L A;  2BAN A;  4YQW A;  1Y3J A;  1N6Q A;  3DXS X;  2YX4 A;  3UDL A;  1SXL A;  3R5A A;  1N5V A;  4F02 A;  3BPS P;  3OHB A;  2Z56 B;  1YSJ A;  2ZBQ A;  2HNZ A;  2I5J B;  3GG1 A;  3LPY A;  5F8L A;  3MR5 A;  4EI2 A;  2AJ4 A;  2UVV A;  2QIF A;  4NOH A;  5IQQ A;  3EDQ B;  2RS2 A;  3X1L B;  4WZQ A;  1XQI A;  1HNI B;  2GAH C;  4DX7 A;  3E01 B;  4MKB A;  5DQG A;  3BN4 A;  2Z2Z A;  4LRD A;  3GZ7 A;  1LK5 A;  2MQO A;  1XC9 A;  2E7X A;  4DDF A;  4PPD A;  1X5S A;  2W9C B;  5KT2 A;  3BSC A;  3GJQ B;  3IA0 A;  4KAY A;  1N54 B;  4ZVT B;  1FKP B;  4NWB A;  1NSP A;  3PYF A;  4CH1 A;  3AJ1 A;  1T9U A;  1XR6 A;  3I9V 9;  4UZB A;  2XI3 A;  3V81 A;  1NB2 A;  2GO9 A;  3CJ2 A;  4PYD A;  5KG7 A;  1N36 F;  4NZ7 A;  5H9F K;  5JUM A;  3QO9 B;  3CXC R;  1WKL A;  2G13 A;  4ZVP B;  3MOZ A;  4DSL A;  2YNG B;  4FVM A;  3F73 A;  4EWT A;  1SKR A;  1VBZ A;  3IXQ A;  1QE1 B;  2BMB A;  4LSN B;  4CTA A;  2MSS A;  1SKS A;  5E2Q A;  4PWU A;  1N2L A;  3D6F B;  3HUL A;  4UUX A;  1XMQ F;  3U27 A;  1P6T A;  3OR2 A;  2ZHB A;  2J0W A;  1GK8 A;  2GMJ A;  2F63 A;  4UPK A;  4B3T J;  4MIB A;  2F9D A;  2OPQ A;  1OMS A;  4WCE Q;  4AL5 A;  2XYG B;  3H59 A;  4ZVH A;  4OV1 A;  4LF7 J;  1S4F A;  3SZY A;  4RNF A;  4DEZ A;  1W26 A;  4KGK A;  4K4V A;  2YVS A;  2H5E A;  3FBB A;  2JLG A;  1WWH A;  3GIJ A;  3IMQ J;  5K8O A;  4FYX B;  4X64 F;  2V5H G;  4DUY F;  4DFK A;  3C6T A;  2DNO A;  3U1L A;  3K5O A;  1SC6 A;  3D2W A;  2BE2 A;  1ZM3 A;  3OFG A;  2Y0B B;  1PYT A;  3GIM A;  2UUT A;  4N8O A;  5B0B A;  2WW8 A;  4DQP A;  2HS3 A;  5L1L A;  4FKY A;  3CW2 C;  3EGV A;  2B8P A;  4M5N A;  4ZP6 A;  3KG0 A;  2HBQ B;  3NKQ A;  1T02 A;  2VJU A;  2IIH A;  4IR1 A;  3NCQ A;  3MHY A;  3VAH A;  2OTJ S;  3J80 Y;  2AV5 A;  3KLH A;  1BUX A;  1X0P A;  3M7V A;  4USM A;  5BR8 J;  2XWY A;  3A13 A;  2D1C A;  2FVR A;  1S9F A;  2HGN A;  4LF4 F;  2J6T A;  3TJ8 A;  3KMS A;  1NH7 A;  3GFX A;  1ULR A;  5I3Q A;  4EYI B;  3O1L A;  3FUY A;  3N6M A;  4JI1 F;  3OW2 R;  4DSI A;  2IC3 B;  4MK9 A;  3D0I E;  1C4C A;  2CIM A;  4LFC J;  3VAF A;  3H2L A;  4OX6 A;  1JJH A;  2DO0 A;  5L0E A;  4KV8 A;  1P1T A;  2VB6 A;  3SBM A;  2BDP A;  3K2Y A;  3OV7 A;  1JWW A;  4QJV A;  4R8U B;  4V19 X;  2E44 A;  2RQ4 A;  1LW2 B;  1TMM A;  3GJS B;  2G2Y A;  2YWE A;  5KFQ A;  1Y3K A;  2GC8 A;  1U48 A;  3SQG A;  3MR3 A;  1I3O B;  5IV4 A;  4HHH A;  1HDH A;  1DAX A;  5EN1 A;  4GKK J;  2HND B;  2VOD A;  1L5U A;  3R5G A;  3RBD A;  4X4V A;  2W2N P;  3B54 A;  3EZU A;  4JV5 J;  3MK0 A;  4HTJ A;  1ZEB A;  1PAU B;  2RHS B;  2ALZ A;  1X9S A;  1B8J A;  4TLQ A;  4ES3 A;  4Q2L A;  3BKT A;  4OI0 A;  3W3S A;  2DHS A;  4N7T A;  3ICL A;  2ACM A;  3R2C J;  1U25 A;  3BKF A;  3P4U B;  1TAU A;  5LMU F;  4IOB A;  4LBH A;  3CDU A;  4QIF A;  1SUQ A;  1FJG F;  1EQM A;  2K3K A;  1L3U A;  3WIU A;  4OI6 A;  3FZB A;  2VPZ B;  4DV4 J;  3LGN A;  5AXK A;  2DXF A;  2KXF A;  2YKQ A;  1VI7 A;  1SJR A;  3G8S A;  3R2D J;  4BC7 A;  3GIR A;  4KFB A;  3J7Y I;  2YNH A;  4F4Y A;  4DCO B;  1S4E A;  1RWK B;  2VG5 A;  2YKA A;  2ZBI A;  1QVG R;  2LEA A;  5L1J A;  2RKI B;  2JEF A;  1J5E F;  2W2M P;  2C3Y A;  2LEC A;  1N2K A;  1PJ6 A;  3CCS S;  1FRX A;  3NS6 A;  3PYD A;  4ICL B;  4MK8 A;  4Q44 A;  1K47 A;  1T0T V;  1FE4 A;  4IUF A;  4DX6 A;  4JI2 J;  1KHW A;  1HMV A;  3QT6 A;  2NLW A;  3SI8 A;  4NLQ A;  1VQP S;  1FFW B;  3CUL A;  1APS A;  2R7X A;  2KB2 A;  2FJX A;  4ILL A;  3NCP A;  3BSA A;  3BV8 A;  3A3N B;  2VQF J;  2L9D A;  4KBI A;  3ULH A;  1FI4 A;  4JI7 F;  3GV5 B;  1CJV A;  1SJ3 P;  4OI2 A;  4X4Q A;  2W2P P;  4UOR A;  4AL6 A;  4GVB A;  4MYU A;  2BJ8 A;  3MMA B;  4NXN J;  3RZA A;  1HNZ F;  2NZC A;  1VQN S;  1UFW A;  3MPD A;  2BOP A;  2BJ1 A;  3MXH P;  4C11 A;  4C8N A;  3DLH A;  3CT9 A;  4DHV A;  3I0R A;  3B4M A;  2QL9 B;  4P72 A;  5F8M A;  4GKJ J;  5L0K A;  3QT7 A;  1LWF A;  4CO3 A;  4UTG A;  1TR0 A;  3K5L A;  1HWU A;  3ETO A;  4P71 A;  2AT1 B;  4UT4 A;  3P6Y C;  2RHQ B;  1Q79 A;  2XYH B;  2FYX A;  2FHJ D;  2JFD A;  2YH0 A;  4ZLN A;  2JSX A;  3IFE A;  3HF5 A;  4X84 A;  2FJB B;  1KWM A; 
#chains in the Genus database with same CATH homology
 1FSU A;  2QZU A;  1EW8 A;  1N2L A;  3NKO A;  2GSU A;  2GSO A;  1AJA A;  1URA A;  4NWX A;  5AJ9 A;  3IGZ B;  3NKR A;  1EI6 A;  3WAV A;  1P49 A;  2VQR A;  3E2D A;  5LIA A;  2W5V A;  3TWZ A;  4CXU A;  3BDH A;  5GOV A;  3LXQ A;  4LQY A;  5EGE A;  1ANI A;  5TJ3 A;  4ZG7 A;  4UOO A;  1Y7A A;  4CYS A;  4LRA A;  4LRB A;  3UN3 A;  2XR9 A;  3BDG B;  1URB A;  4GTW A;  1ALH A;  3ED4 A;  4UPK A;  3T02 A;  4ZG9 A;  1E2S P;  1AUK A;  2W5T A;  4UOP A;  4UPL A;  3BDG A;  5C66 A;  2X98 A;  3WAW A;  3CMR A;  1EW2 A;  5DLT A;  4LRD A;  3UNY A;  3A52 A;  3UN5 A;  5LQQ A;  1EW9 A;  1ZEF A;  4MHX A;  3DPC A;  3IDD A;  1ALK A;  3T00 A;  4KJD A;  1E1Z P;  1ELY A;  5L0E A;  3B5Q A;  3SZY A;  3M8W A;  5IJQ A;  4MIV A;  1Y6V A;  5INH A;  4UOR A;  1O99 A;  4LR7 A;  4LRC A;  3NKN A;  2W5S A;  4CXS A;  1SHN A;  5LRM A;  1KH5 A;  2D1G A;  4FDJ A;  2IFY A;  4KM4 A;  2W8D A;  3WAY A;  3T01 A;  1ELZ A;  3M8Z A;  5L0B A;  1KHK A;  5KXA A;  4LR2 A;  3MK2 A;  1KH7 A;  1KHN A;  2XRG A;  5K4P A;  4ZGA A;  4KAY A;  4MY4 A;  1AJB A;  3NVL A;  1EJJ A;  3WBH A;  5DLW A;  1ANJ A;  2IUC B;  5GRR A;  1KHJ A;  2W8S A;  4LRE A;  3KD8 A;  3NKP A;  1KH4 A;  3BDF A;  4GTX A;  2GA3 A;  2IUC A;  1KHL A;  4FDI A;  1K7H A;  2G9Y A;  4ZG6 A;  1ED8 A;  1AJD A;  2W5Q A;  5DLV A;  1HDH A;  4LR8 A;  1HQA A;  4GTY A;  4NWJ A;  1SHQ A;  1E33 P;  3SZZ A;  4UPH A;  5L0K A;  1ALJ A;  3UN2 A;  4QAX A;  5HRT A;  1N2K A;  3DYC A;  3NKM A;  3UO0 A;  4B56 A;  4GTZ A;  1EQJ A;  2GSN A;  1ZED A;  3NKQ A;  3WAX A;  1ED9 A;  1E3C P;  1HJK A;  2W5X A;  3IGY B;  4UPI A;  1AJC A;  3Q3Q A;  3MK0 A;  1O98 A;  1ALI A;  4LRF A;  1ZEB A;  2RH6 A;  3TG0 A;  4LR9 A;  4TN0 A;  2GLQ A;  2W5R A;  5IJS A;  1B8J A;  3MK1 A;  4CXK A;  4KAV A;  3OT9 A;  4CYR A;  4KJG A;  2ANH A;  3M7V A;  1KH9 A;  4YR1 A;  3TX0 A;  3M8Y A;  5EGH A;  5LRN A;  2W5W A;  4N7T A;  1ELX A;  2ZKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...