3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 127
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
2GSNA 3UN3A 4LRCA 5L0BA 1O98A 2G9YA 3WAVA 4UORA 4YR1A 4CXKA 4UOPA 2IUCA 4CYSA 3MK0A 5GRRA 1KHLA 1ZEFA 4FDJA 1KHKA 1EJJA 2GA3A 3T01A 3NKPA 5IJSA 5L0KA 1AJBA 3M8YA 4ZG7A 4CXSA 3NKNA 1KH5A 4MHXA 1ALIA 3B5QA 1E2SP 3BDFA 1SHQA 3KD8A 1B8JA 3BDGA 5KXAA 2W5SA 4QAXA 3CMRA 1ANJA 4UPLA 3E2DA 4KJDA 4FDIA 3M8WA 3WAXA 3BDHA 2XR9A 1ED9A 2IUCB 4LQYA 1EW2A 2ZKTA 4ZG9A 5HRTA 3DYCA 3M8ZA 2VQRA 4UPKA 1EQJA 4MIVA 4NWXA 5L0EA 4ZG6A 3BDGB 1AUKA 3SZZA 1ELZA 1HJKA 3Q3QA 1ED8A 3TX0A 3UO0A 2ANHA 4LREA 5K4PA 4UPHA 1Y7AA 2W5RA 3NVLA 3WBHA 2W8DA 1E33P 4LRFA 3NKRA 4LR7A 4LRBA 3UN2A 4LR8A 5LRMA 2IFYA 4GTZA 1P49A 3T00A 1EI6A 4GTWA 4LR2A 1K7HA 2W5QA 2GLQA 3UNYA 1ANIA 1ALKA 4CXUA 1URAA 3LXQA 4KM4A 5EGHA 2W8SA 5LRNA 1KH9A 1N2KA 1AJDA 5DLTA 5TJ3A 4UOOA 3IGZB 2W5TA 1N2LA 1EW9A 1HQAA 3IDDA 2GSUA 4TN0A 4UPIA 5DLWA 2W5WA 4ZGAA 1URBA 5LIAA 4LRDA 5INHA 1ALJA 1ALHA 1E1ZP 4KJGA 2W5VA 3UN5A 4LRAA 1ZEBA 1O99A 3MK1A 4GTYA 4N7TA 1KH4A 1KH7A 4B56A 1SHNA 2D1GA 3A52A 1Y6VA 3NKMA 3ED4A 1ZEDA 3NKQA 3NKOA 2XRGA 4CYRA 3SZYA 1KHNA 1AJCA 1E3CP 2GSOA 1FSUA 3WAYA 4NWJA 2RH6A 2W5XA 5LQQA 4LR9A 5IJQA 1KHJA 3TG0A 1ELXA 4KAVA 1EW8A 1ELYA 3M7VA 2QZUA 3OT9A 2X98A 3DPCA 3MK2A 1AJAA 1HDHA 3TWZA 4MY4A 3IGYB 3WAWA 3T02A 5AJ9A 5GOVA 4KAYA 5DLVA 5C66A 5EGEA 4GTXA
chains in the Genus database with same CATH superfamily
2GSNA 1KQ4A 4LRCA 5L0BA 4C3HC 4UOPA 3H3VL 2IUCA 4CYSA 5GRRA 4BKWA 1KHLA 4OIPA 1ZEFA 4FDJA 3S1NC 2R93K 1EJJA 4DDQA 4GTBA 2B63K 1O29A 1F9NA 3NKNA 3GTKA 4BY1K 4MEXA 1WSVA 1WQHA 1ALIA 4A93K 1O2AA 3HKZL 4A3JC 1EH1A 3A8IA 5IOTA 3S15K 4BXXK 3GTOK 1B8JA 3KD8A 1XXAA 4A3KK 1GE9A 4P5AA 3BDGA 4QAXA 4M1XA 4QIWL 4J3NA 3BDHA 4KC6A 1IW7A 1I3QC 2IUCB 4LQYA 4A3FK 3H0GC 3EQLA 1O25A 4KARA 4YFKA 3S1MC 1XPPA 3H0GK 4Q4ZA 4AH6A 1EFWA 2VQRA 1BS2A 1TWGC 3GTLA 4LJZA 5D4DA 1ELZA 3HOZK 3ERED 3UO0A 3H0GA 3GTMK 2ANHA 4Y7NC 2PMZD 1G51A 2FQOA 1V5VA 2E2JC 3S16K 3AQOA 3K7AK 1I50A 1XZPA 3NVLA 1R9TC 1TWGA 3WBHA 3GTGA 1F7VA 1Y1WA 4BY1C 4A3MK 4LR7A 3M3YC 3S17C 2CW0A 3UN2A 4KB2A 3LAJA 4GTDA 3HOUC 1BDFA 3UNYA 1K7HA 3RZDK 5M5WK 3LXQA 5EGHA 1SMYA 1ZQ1C 2W8SA 4A3DC 1VGXA 5TJ3A 4A3KC 2ZUFA 3HOVC 1EK8A 4XLNA 2GSUA 2VUMC 3HOYK 4ZGAA 1DCPA 3S2DC 3GTMA 1ALJA 2B63C 5C4JK 3S1NK 2JA6A 3UN5A 3GEEA 2RGRA 3GTQK 4Q5SA 4LOWA 1ISEA 1KH4A 1EQRA 4P9SA 1SHNA 4G0VA 2D1GA 1Y1VA 1USOA 1SFOK 4CYRA 3NKQA 4A3CK 1WCMK 3LAPA 5C4XC 1WOSA 2CFAA 3S1RK 4C3JK 1KHJA 3TG0A 4PAAA 4KAVA 4OIOA 5IP7K 2QZUA 5C44K 3OT9A 3PO3K 2P5MA 3T02A 5AJ9A 4ILDA 5EGEA 5C66A 3N0BA 1YCLA 3RZDC 3UN3A 4BY7K 2W7VA 2XCRB 3CAGA 3WAVA 1L0WA 1ZVUA 4YR1A 2WAQD 1YNNA 1IL2A 3V4GA 5L0KA 5IYCK 3NKPA 5IYDK 1AJBA 1TWFK 3M8YA 4A3EC 2E2IK 3FOEA 4CXSA 5M5XK 4BBSK 5M5YK 5JVOA 4MHXA 2E2HC 5IOQA 5TMCA 2V6TA 2NVYK 1I6HK 3AH5A 2XCQA 3BDFA 3HOXC 1SHQA 2JA6C 3GTKK 2W5SA 3CMRA 3L4KA 3GTPK 4WJ4A 3GEHA 3M8WA 2R7ZK 3WAXA 5HL8A 2XR9A 4A3LC 1JVIA 3TFHA 3DYCA 5HRTA 3M8ZA 3OEPA 4JK1A 2GAGC 2A69A 1EQJA 5L0EA 4A3LK 1VH2A 2R92A 1AUKA 3CQZC 3TX0A 4C45A 4BXXC 1TWHK 5C3EK 2Y3PA 3PO2K 4O2DA 5K4PA 4BLBA 1IS1A 2PHCB 1E33P 3S2HK 1TWAK 1VJEA 2D6FC 4BLAA 3NKRA 4GTEA 1B4BA 3G4CA 2A68A 1P49A 5IYDC 1ANIA 1O26A 4KMHA 1R9TA 2E2IA 3M3YK 5LRNA 1RU0A 1K83K 4KM8A 1F93A 1AJDA 5IOSA 5DLTA 4RMFA 3IGZB 4C3IC 5IYBK 1N2LA 3IDDA 3I4NC 4UPIA 5DLWA 4BBSC 4GTFA 2NVTK 1TWFC 2FQTA 4LRDA 5IYCC 4C2MC 5INHA 3S0XA 2GAHC 5CJ9A 2W5VA 1O99A 4C3IK 3MK1A 2NVXK 4GTYA 4N7TA 4KMAA 1X31C 3A52A 1TWCK 2V6UA 1Y1WC 3GTGC 2NVXA 1J6WA 3A8KA 2ZUEA 3ED4A 3S14K 1VRQC 3TTGA 1WCMA 3MMLB 1PJ6A 3WAYA 1TWFA 3PO3C 1TWCA 4XCHA 5LQQA 5IP7C 3N3YA 4KM9A 4GTAA 3FHZA 2O5IA 1WOOA 3S1RC 1EW8A 1PJ5A 1ZXOA 1VLOA 2WAQL 4WJ3M 3S2HC 2X98A 3GTQA 1SFOA 1WORA 3AQPA 4KDDA 3DPCA 1AJAA 3TFIA 2A6EA 4BBRC 2VUMK 3IGYB 5GOVA 4KAYA 1I3QA 1I6VA 5CHPA 4KMUA 4C3HK 4GTXA 4QJVA 4A3GC 2G9YA 1DCHA 4OIRA 4CXKA 4PABA 3QX3A 2R92C 4FZBA 1KHKA 3HOUK 2GA3A 4GZYA 4ZG7A 4MEYA 5L46A 1YX2A 4A3IK 4LLGA 4A3BK 4Y52K 1KH5A 3GTKC 3B5QA 1E2SP 1WQFA 3CQZA 5TMFA 2P8TA 2NVTC 2NVYC 4GTLA 1DCOA 3I4NK 1ANJA 4UPLA 4KMDA 3E2DA 4FDIA 1J98A 4A3EK 1ED9A 1K83A 2ZKTA 2YU9A 4ZG9A 3GSIA 3S17K 1TWGK 4UPKA 3S1MK 4MIVA 1XZQA 4NWXA 3L4JA 3Q3QA 3SZZA 1I3QK 1ED8A 2YU9C 4G7ZA 3H3VD 3GEIA 4LREA 3AD8C 4Y7NK 3GTMC 2W5RA 2EBBA 1O24A 1DD5A 2R7ZA 3HOZC 2W8DA 1TWHA 5E68A 4Y52C 3GDZA 4A3BC 4LRFA 4AYBD 5C3EC 4LRBA 4MQ9A 3CQZK 4YFNA 1BJTA 4GTZA 3OPFA 1XZQB 2ZFZA 4LR2A 3TFJA 4P5BA 2GLQA 1ALKA 4CXUA 1Y1VK 4KM4A 2JA5C 3I4MC 4YFXA 1N2KA 1O28A 3GTOC 2R7ZC 2W5TA 1IBAA 4A93C 1HQAA 4TN0A 1IQ0A 1HI9A 3BP8C 4BBRK 4FM9A 2R93A 2W5WA 1HQMA 1O2FB 3HOXK 2JA7A 1URBA 4A3IC 1I6HC 2KWAA 4YG2A 3S1QC 2E2HK 3S2DK 1ALHA 1E1ZP 3HOYC 4LK1A 2A6HA 2B63A 3M4OC 4QIWD 3WODA 1ZEBA 3HOVK 1JQWA 5IP9C 4G0UA 3ADAC 2VUMA 1KH7A 5FLMC 4B56A 3GTLC 1TWCC 3HKZD 5IP9K 4GFQA 1O27A 3NKMA 1ZEDA 2XRGA 3M4OK 1KHNA 1IE0A 2GSOA 2NVXC 1E3CP 1FSUA 1YNJA 1J6XA 2WB1L 2O5JA 4G0WA 4LR9A 5IJQA 4OIQA 1TWAA 1ELXA 2V6SA 1ELYA 1USMA 3M7VA 3BUEA 1ZBSA 4KB4A 5C44C 3HOWC 1HDHA 2PMZL 1ZYRA 3TWZA 2E2JK 2NVQK 4KATA 3S16C 3S14C 4MY4A 3WAWA 5DLVA 2JA5K 3I4MK 5C4XK 1Y1WK 3GTGK 1Y1VC 4KN7A 1C0AA 1WOPA 4XSZA 1O98A 4OINA 4UORA 1F7UA 2NVQC 3FKIC 3MK0A 2XCOA 4KAWX 3BP3A 4G7OA 3AD7C 3T01A 5IJSA 2PPBA 3GTQC 2PA8D 4C2MK 1XZPB 5C4JC 2Y0SD 5JFEA 1JOEA 3FKIA 3JSTA 5IYBC 4A3JK 1BGWA 2WB1D 4GT9A 3GIRA 2JH3A 4KJDA 3HXAA 5M3MK 3GTLK 4A3DK 1EW2A 3A8JA 2R93C 1B4AA 4G7HA 1AB4A 3NUHA 3S1QK 4ZG6A 3BDGB 1HJKA 1TWAC 2JA5A 4ZH4A 3GTPC 3GTOA 4A3MC 4XLPA 4X6AC 4UPHA 1I50K 1R9TK 3PO2C 1Y7AA 3VA7A 1TWHC 3K7AC 3IPJA 3RZOC 4KASA 2E2IC 2R92K 4LR8A 5LRMA 2IFYA 4GTCA 4QJVB 3GTJC 3T00A 1EI6A 4GTWA 2W5QA 3FKIK 1URAA 1KH9A 4BY7C 1INNA 2CFAB 4A3FC 3G4AA 2JA8K 2JA7C 1WSRA 3LPXA 4AYBL 4UOOA 2JA6K 1EW9A 3AD9C 3DXJA 3S15C 2NVYA 2YU9K 4XSXA 2BE5A 5LIAA 3OREA 4KJGA 4NOIA 3GTPA 4LRAA 1O2BA 1WCMC 5IORA 4A3CC 3FOFA 2JA7K 2JA8C 1Y6VA 1WIHA 2Y0SL 3NKOA 1WQGA 3SZYA 1AJCA 5FJ8K 3GTJK 5FLMK 1XXBA 3HOWK 1UV7A 4NWJA 2PA8L 1PJ7A 2RH6A 2W5XA 2E2HA 1J6VA 3GTJA 3RZOK 5M3FK 4WILA 4C3JC 1XXCA 3MK2A 4LK0A 1I50C 4X6AK 4KN4A 1K83C 1SFOC 5KXAA 4A3GK 3N0CA
chains in the Genus database with same CATH topology
2GSNA 3UN3A 4LRCA 5L0BA 1O98A 2G9YA 3WAVA 4UORA 4YR1A 4CXKA 4UOPA 2IUCA 4CYSA 3MK0A 5GRRA 1KHLA 1ZEFA 4FDJA 1KHKA 1EJJA 2GA3A 3T01A 3NKPA 5IJSA 5L0KA 1AJBA 3M8YA 4ZG7A 4CXSA 3NKNA 1KH5A 4MHXA 1ALIA 3B5QA 1E2SP 3BDFA 1SHQA 3KD8A 1B8JA 3BDGA 5KXAA 2W5SA 4QAXA 3CMRA 1ANJA 4UPLA 3E2DA 4KJDA 4FDIA 3M8WA 3WAXA 3BDHA 2XR9A 1ED9A 2IUCB 4LQYA 1EW2A 2ZKTA 4ZG9A 5HRTA 3DYCA 3M8ZA 2VQRA 4UPKA 1EQJA 4MIVA 4NWXA 5L0EA 4ZG6A 3BDGB 1AUKA 3SZZA 1ELZA 1HJKA 3Q3QA 1ED8A 3TX0A 3UO0A 2ANHA 4LREA 5K4PA 4UPHA 1Y7AA 2W5RA 3NVLA 3WBHA 2W8DA 1E33P 4LRFA 3NKRA 4LR7A 4LRBA 3UN2A 4LR8A 5LRMA 2IFYA 4GTZA 1P49A 3T00A 1EI6A 4GTWA 4LR2A 1K7HA 2W5QA 2GLQA 3UNYA 1ANIA 1ALKA 4CXUA 1URAA 3LXQA 4KM4A 5EGHA 2W8SA 5LRNA 1KH9A 1N2KA 1AJDA 5DLTA 5TJ3A 4UOOA 3IGZB 2W5TA 1N2LA 1EW9A 1HQAA 3IDDA 2GSUA 4TN0A 4UPIA 5DLWA 2W5WA 4ZGAA 1URBA 5LIAA 4LRDA 5INHA 1ALJA 1ALHA 1E1ZP 4KJGA 2W5VA 3UN5A 4LRAA 1ZEBA 1O99A 3MK1A 4GTYA 4N7TA 1KH4A 1KH7A 4B56A 1SHNA 2D1GA 3A52A 1Y6VA 3NKMA 3ED4A 1ZEDA 3NKQA 3NKOA 2XRGA 4CYRA 3SZYA 1KHNA 1AJCA 1E3CP 2GSOA 1FSUA 3WAYA 4NWJA 2RH6A 2W5XA 5LQQA 4LR9A 5IJQA 1KHJA 3TG0A 1ELXA 4KAVA 1EW8A 1ELYA 3M7VA 2QZUA 3OT9A 2X98A 3DPCA 3MK2A 1AJAA 1HDHA 3TWZA 4MY4A 3IGYB 3WAWA 3T02A 5AJ9A 5GOVA 4KAYA 5DLVA 5C66A 5EGEA 4GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSN A;  3UN3 A;  4LRC A;  5L0B A;  1O98 A;  2G9Y A;  3WAV A;  4UOR A;  4YR1 A;  4CXK A;  4UOP A;  2IUC A;  4CYS A;  3MK0 A;  5GRR A;  1KHL A;  1ZEF A;  4FDJ A;  1KHK A;  1EJJ A;  2GA3 A;  3T01 A;  3NKP A;  5IJS A;  5L0K A;  1AJB A;  3M8Y A;  4ZG7 A;  4CXS A;  3NKN A;  1KH5 A;  4MHX A;  1ALI A;  3B5Q A;  1E2S P;  3BDF A;  1SHQ A;  3KD8 A;  1B8J A;  3BDG A;  5KXA A;  2W5S A;  4QAX A;  3CMR A;  1ANJ A;  4UPL A;  3E2D A;  4KJD A;  4FDI A;  3M8W A;  3WAX A;  3BDH A;  2XR9 A;  1ED9 A;  2IUC B;  4LQY A;  1EW2 A;  2ZKT A;  4ZG9 A;  5HRT A;  3DYC A;  3M8Z A;  2VQR A;  4UPK A;  1EQJ A;  4MIV A;  4NWX A;  5L0E A;  4ZG6 A;  3BDG B;  1AUK A;  3SZZ A;  1ELZ A;  1HJK A;  3Q3Q A;  1ED8 A;  3TX0 A;  3UO0 A;  2ANH A;  4LRE A;  5K4P A;  4UPH A;  1Y7A A;  2W5R A;  3NVL A;  3WBH A;  2W8D A;  1E33 P;  4LRF A;  3NKR A;  4LR7 A;  4LRB A;  3UN2 A;  4LR8 A;  5LRM A;  2IFY A;  4GTZ A;  1P49 A;  3T00 A;  1EI6 A;  4GTW A;  4LR2 A;  1K7H A;  2W5Q A;  2GLQ A;  3UNY A;  1ANI A;  1ALK A;  4CXU A;  1URA A;  3LXQ A;  4KM4 A;  5EGH A;  2W8S A;  5LRN A;  1KH9 A;  1N2K A;  1AJD A;  5DLT A;  5TJ3 A;  4UOO A;  3IGZ B;  2W5T A;  1N2L A;  1EW9 A;  1HQA A;  3IDD A;  2GSU A;  4TN0 A;  4UPI A;  5DLW A;  2W5W A;  4ZGA A;  1URB A;  5LIA A;  4LRD A;  5INH A;  1ALJ A;  1ALH A;  1E1Z P;  4KJG A;  2W5V A;  3UN5 A;  4LRA A;  1ZEB A;  1O99 A;  3MK1 A;  4GTY A;  4N7T A;  1KH4 A;  1KH7 A;  4B56 A;  1SHN A;  2D1G A;  3A52 A;  1Y6V A;  3NKM A;  3ED4 A;  1ZED A;  3NKQ A;  3NKO A;  2XRG A;  4CYR A;  3SZY A;  1KHN A;  1AJC A;  1E3C P;  2GSO A;  1FSU A;  3WAY A;  4NWJ A;  2RH6 A;  2W5X A;  5LQQ A;  4LR9 A;  5IJQ A;  1KHJ A;  3TG0 A;  1ELX A;  4KAV A;  1EW8 A;  1ELY A;  3M7V A;  2QZU A;  3OT9 A;  2X98 A;  3DPC A;  3MK2 A;  1AJA A;  1HDH A;  3TWZ A;  4MY4 A;  3IGY B;  3WAW A;  3T02 A;  5AJ9 A;  5GOV A;  4KAY A;  5DLV A;  5C66 A;  5EGE A;  4GTX A; 
#chains in the Genus database with same CATH topology
 2GSN A;  1KQ4 A;  4LRC A;  5L0B A;  4C3H C;  4UOP A;  3H3V L;  2IUC A;  4CYS A;  5GRR A;  4BKW A;  1KHL A;  4OIP A;  1ZEF A;  4FDJ A;  3S1N C;  2R93 K;  1EJJ A;  4DDQ A;  4GTB A;  2B63 K;  1O29 A;  1F9N A;  3NKN A;  3GTK A;  4BY1 K;  4MEX A;  1WSV A;  1WQH A;  1ALI A;  4A93 K;  1O2A A;  3HKZ L;  4A3J C;  1EH1 A;  3A8I A;  5IOT A;  3S15 K;  4BXX K;  3GTO K;  1B8J A;  3KD8 A;  1XXA A;  4A3K K;  1GE9 A;  4P5A A;  3BDG A;  4QAX A;  4M1X A;  4QIW L;  4J3N A;  3BDH A;  4KC6 A;  1IW7 A;  1I3Q C;  2IUC B;  4LQY A;  4A3F K;  3H0G C;  3EQL A;  1O25 A;  4KAR A;  4YFK A;  3S1M C;  1XPP A;  3H0G K;  4Q4Z A;  4AH6 A;  1EFW A;  2VQR A;  1BS2 A;  1TWG C;  3GTL A;  4LJZ A;  5D4D A;  1ELZ A;  3HOZ K;  3ERE D;  3UO0 A;  3H0G A;  3GTM K;  2ANH A;  4Y7N C;  2PMZ D;  1G51 A;  2FQO A;  1V5V A;  2E2J C;  3S16 K;  3AQO A;  3K7A K;  1I50 A;  1XZP A;  3NVL A;  1R9T C;  1TWG A;  3WBH A;  3GTG A;  1F7V A;  1Y1W A;  4BY1 C;  4A3M K;  4LR7 A;  3M3Y C;  3S17 C;  2CW0 A;  3UN2 A;  4KB2 A;  3LAJ A;  4GTD A;  3HOU C;  1BDF A;  3UNY A;  1K7H A;  3RZD K;  5M5W K;  3LXQ A;  5EGH A;  1SMY A;  1ZQ1 C;  2W8S A;  4A3D C;  1VGX A;  5TJ3 A;  4A3K C;  2ZUF A;  3HOV C;  1EK8 A;  4XLN A;  2GSU A;  2VUM C;  3HOY K;  4ZGA A;  1DCP A;  3S2D C;  3GTM A;  1ALJ A;  2B63 C;  5C4J K;  3S1N K;  2JA6 A;  3UN5 A;  3GEE A;  2RGR A;  3GTQ K;  4Q5S A;  4LOW A;  1ISE A;  1KH4 A;  1EQR A;  4P9S A;  1SHN A;  4G0V A;  2D1G A;  1Y1V A;  1USO A;  1SFO K;  4CYR A;  3NKQ A;  4A3C K;  1WCM K;  3LAP A;  5C4X C;  1WOS A;  2CFA A;  3S1R K;  4C3J K;  1KHJ A;  3TG0 A;  4PAA A;  4KAV A;  4OIO A;  5IP7 K;  2QZU A;  5C44 K;  3OT9 A;  3PO3 K;  2P5M A;  3T02 A;  5AJ9 A;  4ILD A;  5EGE A;  5C66 A;  3N0B A;  1YCL A;  3RZD C;  3UN3 A;  4BY7 K;  2W7V A;  2XCR B;  3CAG A;  3WAV A;  1L0W A;  1ZVU A;  4YR1 A;  2WAQ D;  1YNN A;  1IL2 A;  3V4G A;  5L0K A;  5IYC K;  3NKP A;  5IYD K;  1AJB A;  1TWF K;  3M8Y A;  4A3E C;  2E2I K;  3FOE A;  4CXS A;  5M5X K;  4BBS K;  5M5Y K;  5JVO A;  4MHX A;  2E2H C;  5IOQ A;  5TMC A;  2V6T A;  2NVY K;  1I6H K;  3AH5 A;  2XCQ A;  3BDF A;  3HOX C;  1SHQ A;  2JA6 C;  3GTK K;  2W5S A;  3CMR A;  3L4K A;  3GTP K;  4WJ4 A;  3GEH A;  3M8W A;  2R7Z K;  3WAX A;  5HL8 A;  2XR9 A;  4A3L C;  1JVI A;  3TFH A;  3DYC A;  5HRT A;  3M8Z A;  3OEP A;  4JK1 A;  2GAG C;  2A69 A;  1EQJ A;  5L0E A;  4A3L K;  1VH2 A;  2R92 A;  1AUK A;  3CQZ C;  3TX0 A;  4C45 A;  4BXX C;  1TWH K;  5C3E K;  2Y3P A;  3PO2 K;  4O2D A;  5K4P A;  4BLB A;  1IS1 A;  2PHC B;  1E33 P;  3S2H K;  1TWA K;  1VJE A;  2D6F C;  4BLA A;  3NKR A;  4GTE A;  1B4B A;  3G4C A;  2A68 A;  1P49 A;  5IYD C;  1ANI A;  1O26 A;  4KMH A;  1R9T A;  2E2I A;  3M3Y K;  5LRN A;  1RU0 A;  1K83 K;  4KM8 A;  1F93 A;  1AJD A;  5IOS A;  5DLT A;  4RMF A;  3IGZ B;  4C3I C;  5IYB K;  1N2L A;  3IDD A;  3I4N C;  4UPI A;  5DLW A;  4BBS C;  4GTF A;  2NVT K;  1TWF C;  2FQT A;  4LRD A;  5IYC C;  4C2M C;  5INH A;  3S0X A;  2GAH C;  5CJ9 A;  2W5V A;  1O99 A;  4C3I K;  3MK1 A;  2NVX K;  4GTY A;  4N7T A;  4KMA A;  1X31 C;  3A52 A;  1TWC K;  2V6U A;  1Y1W C;  3GTG C;  2NVX A;  1J6W A;  3A8K A;  2ZUE A;  3ED4 A;  3S14 K;  1VRQ C;  3TTG A;  1WCM A;  3MML B;  1PJ6 A;  3WAY A;  1TWF A;  3PO3 C;  1TWC A;  4XCH A;  5LQQ A;  5IP7 C;  3N3Y A;  4KM9 A;  4GTA A;  3FHZ A;  2O5I A;  1WOO A;  3S1R C;  1EW8 A;  1PJ5 A;  1ZXO A;  1VLO A;  2WAQ L;  4WJ3 M;  3S2H C;  2X98 A;  3GTQ A;  1SFO A;  1WOR A;  3AQP A;  4KDD A;  3DPC A;  1AJA A;  3TFI A;  2A6E A;  4BBR C;  2VUM K;  3IGY B;  5GOV A;  4KAY A;  1I3Q A;  1I6V A;  5CHP A;  4KMU A;  4C3H K;  4GTX A;  4QJV A;  4A3G C;  2G9Y A;  1DCH A;  4OIR A;  4CXK A;  4PAB A;  3QX3 A;  2R92 C;  4FZB A;  1KHK A;  3HOU K;  2GA3 A;  4GZY A;  4ZG7 A;  4MEY A;  5L46 A;  1YX2 A;  4A3I K;  4LLG A;  4A3B K;  4Y52 K;  1KH5 A;  3GTK C;  3B5Q A;  1E2S P;  1WQF A;  3CQZ A;  5TMF A;  2P8T A;  2NVT C;  2NVY C;  4GTL A;  1DCO A;  3I4N K;  1ANJ A;  4UPL A;  4KMD A;  3E2D A;  4FDI A;  1J98 A;  4A3E K;  1ED9 A;  1K83 A;  2ZKT A;  2YU9 A;  4ZG9 A;  3GSI A;  3S17 K;  1TWG K;  4UPK A;  3S1M K;  4MIV A;  1XZQ A;  4NWX A;  3L4J A;  3Q3Q A;  3SZZ A;  1I3Q K;  1ED8 A;  2YU9 C;  4G7Z A;  3H3V D;  3GEI A;  4LRE A;  3AD8 C;  4Y7N K;  3GTM C;  2W5R A;  2EBB A;  1O24 A;  1DD5 A;  2R7Z A;  3HOZ C;  2W8D A;  1TWH A;  5E68 A;  4Y52 C;  3GDZ A;  4A3B C;  4LRF A;  4AYB D;  5C3E C;  4LRB A;  4MQ9 A;  3CQZ K;  4YFN A;  1BJT A;  4GTZ A;  3OPF A;  1XZQ B;  2ZFZ A;  4LR2 A;  3TFJ A;  4P5B A;  2GLQ A;  1ALK A;  4CXU A;  1Y1V K;  4KM4 A;  2JA5 C;  3I4M C;  4YFX A;  1N2K A;  1O28 A;  3GTO C;  2R7Z C;  2W5T A;  1IBA A;  4A93 C;  1HQA A;  4TN0 A;  1IQ0 A;  1HI9 A;  3BP8 C;  4BBR K;  4FM9 A;  2R93 A;  2W5W A;  1HQM A;  1O2F B;  3HOX K;  2JA7 A;  1URB A;  4A3I C;  1I6H C;  2KWA A;  4YG2 A;  3S1Q C;  2E2H K;  3S2D K;  1ALH A;  1E1Z P;  3HOY C;  4LK1 A;  2A6H A;  2B63 A;  3M4O C;  4QIW D;  3WOD A;  1ZEB A;  3HOV K;  1JQW A;  5IP9 C;  4G0U A;  3ADA C;  2VUM A;  1KH7 A;  5FLM C;  4B56 A;  3GTL C;  1TWC C;  3HKZ D;  5IP9 K;  4GFQ A;  1O27 A;  3NKM A;  1ZED A;  2XRG A;  3M4O K;  1KHN A;  1IE0 A;  2GSO A;  2NVX C;  1E3C P;  1FSU A;  1YNJ A;  1J6X A;  2WB1 L;  2O5J A;  4G0W A;  4LR9 A;  5IJQ A;  4OIQ A;  1TWA A;  1ELX A;  2V6S A;  1ELY A;  1USM A;  3M7V A;  3BUE A;  1ZBS A;  4KB4 A;  5C44 C;  3HOW C;  1HDH A;  2PMZ L;  1ZYR A;  3TWZ A;  2E2J K;  2NVQ K;  4KAT A;  3S16 C;  3S14 C;  4MY4 A;  3WAW A;  5DLV A;  2JA5 K;  3I4M K;  5C4X K;  1Y1W K;  3GTG K;  1Y1V C;  4KN7 A;  1C0A A;  1WOP A;  4XSZ A;  1O98 A;  4OIN A;  4UOR A;  1F7U A;  2NVQ C;  3FKI C;  3MK0 A;  2XCO A;  4KAW X;  3BP3 A;  4G7O A;  3AD7 C;  3T01 A;  5IJS A;  2PPB A;  3GTQ C;  2PA8 D;  4C2M K;  1XZP B;  5C4J C;  2Y0S D;  5JFE A;  1JOE A;  3FKI A;  3JST A;  5IYB C;  4A3J K;  1BGW A;  2WB1 D;  4GT9 A;  3GIR A;  2JH3 A;  4KJD A;  3HXA A;  5M3M K;  3GTL K;  4A3D K;  1EW2 A;  3A8J A;  2R93 C;  1B4A A;  4G7H A;  1AB4 A;  3NUH A;  3S1Q K;  4ZG6 A;  3BDG B;  1HJK A;  1TWA C;  2JA5 A;  4ZH4 A;  3GTP C;  3GTO A;  4A3M C;  4XLP A;  4X6A C;  4UPH A;  1I50 K;  1R9T K;  3PO2 C;  1Y7A A;  3VA7 A;  1TWH C;  3K7A C;  3IPJ A;  3RZO C;  4KAS A;  2E2I C;  2R92 K;  4LR8 A;  5LRM A;  2IFY A;  4GTC A;  4QJV B;  3GTJ C;  3T00 A;  1EI6 A;  4GTW A;  2W5Q A;  3FKI K;  1URA A;  1KH9 A;  4BY7 C;  1INN A;  2CFA B;  4A3F C;  3G4A A;  2JA8 K;  2JA7 C;  1WSR A;  3LPX A;  4AYB L;  4UOO A;  2JA6 K;  1EW9 A;  3AD9 C;  3DXJ A;  3S15 C;  2NVY A;  2YU9 K;  4XSX A;  2BE5 A;  5LIA A;  3ORE A;  4KJG A;  4NOI A;  3GTP A;  4LRA A;  1O2B A;  1WCM C;  5IOR A;  4A3C C;  3FOF A;  2JA7 K;  2JA8 C;  1Y6V A;  1WIH A;  2Y0S L;  3NKO A;  1WQG A;  3SZY A;  1AJC A;  5FJ8 K;  3GTJ K;  5FLM K;  1XXB A;  3HOW K;  1UV7 A;  4NWJ A;  2PA8 L;  1PJ7 A;  2RH6 A;  2W5X A;  2E2H A;  1J6V A;  3GTJ A;  3RZO K;  5M3F K;  4WIL A;  4C3J C;  1XXC A;  3MK2 A;  4LK0 A;  1I50 C;  4X6A K;  4KN4 A;  1K83 C;  1SFO C;  5KXA A;  4A3G K;  3N0C A; 
#chains in the Genus database with same CATH homology
 2GSN A;  3UN3 A;  4LRC A;  5L0B A;  1O98 A;  2G9Y A;  3WAV A;  4UOR A;  4YR1 A;  4CXK A;  4UOP A;  2IUC A;  4CYS A;  3MK0 A;  5GRR A;  1KHL A;  1ZEF A;  4FDJ A;  1KHK A;  1EJJ A;  2GA3 A;  3T01 A;  3NKP A;  5IJS A;  5L0K A;  1AJB A;  3M8Y A;  4ZG7 A;  4CXS A;  3NKN A;  1KH5 A;  4MHX A;  1ALI A;  3B5Q A;  1E2S P;  3BDF A;  1SHQ A;  3KD8 A;  1B8J A;  3BDG A;  5KXA A;  2W5S A;  4QAX A;  3CMR A;  1ANJ A;  4UPL A;  3E2D A;  4KJD A;  4FDI A;  3M8W A;  3WAX A;  3BDH A;  2XR9 A;  1ED9 A;  2IUC B;  4LQY A;  1EW2 A;  2ZKT A;  4ZG9 A;  5HRT A;  3DYC A;  3M8Z A;  2VQR A;  4UPK A;  1EQJ A;  4MIV A;  4NWX A;  5L0E A;  4ZG6 A;  3BDG B;  1AUK A;  3SZZ A;  1ELZ A;  1HJK A;  3Q3Q A;  1ED8 A;  3TX0 A;  3UO0 A;  2ANH A;  4LRE A;  5K4P A;  4UPH A;  1Y7A A;  2W5R A;  3NVL A;  3WBH A;  2W8D A;  1E33 P;  4LRF A;  3NKR A;  4LR7 A;  4LRB A;  3UN2 A;  4LR8 A;  5LRM A;  2IFY A;  4GTZ A;  1P49 A;  3T00 A;  1EI6 A;  4GTW A;  4LR2 A;  1K7H A;  2W5Q A;  2GLQ A;  3UNY A;  1ANI A;  1ALK A;  4CXU A;  1URA A;  3LXQ A;  4KM4 A;  5EGH A;  2W8S A;  5LRN A;  1KH9 A;  1N2K A;  1AJD A;  5DLT A;  5TJ3 A;  4UOO A;  3IGZ B;  2W5T A;  1N2L A;  1EW9 A;  1HQA A;  3IDD A;  2GSU A;  4TN0 A;  4UPI A;  5DLW A;  2W5W A;  4ZGA A;  1URB A;  5LIA A;  4LRD A;  5INH A;  1ALJ A;  1ALH A;  1E1Z P;  4KJG A;  2W5V A;  3UN5 A;  4LRA A;  1ZEB A;  1O99 A;  3MK1 A;  4GTY A;  4N7T A;  1KH4 A;  1KH7 A;  4B56 A;  1SHN A;  2D1G A;  3A52 A;  1Y6V A;  3NKM A;  3ED4 A;  1ZED A;  3NKQ A;  3NKO A;  2XRG A;  4CYR A;  3SZY A;  1KHN A;  1AJC A;  1E3C P;  2GSO A;  1FSU A;  3WAY A;  4NWJ A;  2RH6 A;  2W5X A;  5LQQ A;  4LR9 A;  5IJQ A;  1KHJ A;  3TG0 A;  1ELX A;  4KAV A;  1EW8 A;  1ELY A;  3M7V A;  2QZU A;  3OT9 A;  2X98 A;  3DPC A;  3MK2 A;  1AJA A;  1HDH A;  3TWZ A;  4MY4 A;  3IGY B;  3WAW A;  3T02 A;  5AJ9 A;  5GOV A;  4KAY A;  5DLV A;  5C66 A;  5EGE A;  4GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...