3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 127
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
3MK0A 1E3CP 5IJQA 1HJKA 4MY4A 5LQQA 4N7TA 1E2SP 3MK1A 1E1ZP 1ELZA 3CMRA 5GOVA 2VQRA 1AJDA 3UNYA 2W5QA 3NKPA 5AJ9A 1KHKA 3LXQA 4LQYA 5KXAA 1AJCA 3T02A 4LRDA 1KH4A 2W8SA 1ANJA 2IUCA 4ZG6A 2XR9A 2ZKTA 3NKMA 5LIAA 4NWXA 3T01A 4FDIA 4LR8A 1ANIA 3NKQA 4KAVA 2GSUA 1ZEDA 1HDHA 2W5VA 2GLQA 2W8DA 5K4PA 2W5SA 3WBHA 3NKOA 4UPLA 5L0EA 5EGEA 4ZG9A 4KJGA 1E33P 1KH7A 5C66A 2GSNA 4FDJA 5HRTA 2IUCB 4LREA 2G9YA 1AJBA 4GTXA 1N2KA 4LRAA 3WAVA 1URAA 3OT9A 1AJAA 3TX0A 4UOOA 1KH9A 2GSOA 4YR1A 1SHNA 1ELXA 3WAXA 1FSUA 2ANHA 4UPIA 4KAYA 4TN0A 1AUKA 1EW9A 3UN5A 5EGHA 3IGYB 3M7VA 4LR2A 3UN3A 2D1GA 2W5XA 3NKRA 4KJDA 5DLWA 3BDHA 2GA3A 1EJJA 3A52A 4LRCA 4MIVA 3IGZB 4B56A 4UORA 5L0BA 5LRNA 4LR7A 3TWZA 4NWJA 4UPHA 3WAWA 4ZG7A 2W5WA 3NKNA 4ZGAA 4CXSA 1O99A 1ALJA 1ALKA 3BDFA 1SHQA 1KHLA 4QAXA 5LRMA 5L0KA 1Y6VA 3ED4A 3E2DA 3M8YA 4CXKA 1K7HA 1O98A 4LRBA 1ALHA 2W5TA 3DPCA 3Q3QA 5TJ3A 1HQAA 1EW2A 1EI6A 4GTZA 4UOPA 3UO0A 4MHXA 4CXUA 1ED9A 5DLVA 3NVLA 3UN2A 3T00A 1B8JA 1ELYA 4UPKA 1EW8A 4LR9A 1KHNA 2W5RA 3IDDA 5DLTA 1KHJA 1P49A 4KM4A 4GTYA 1ALIA 1ZEBA 3M8ZA 5IJSA 2RH6A 3BDGA 3TG0A 3WAYA 3KD8A 3M8WA 2X98A 1EQJA 1ZEFA 1URBA 1ED8A 1Y7AA 5INHA 4GTWA 4LRFA 3DYCA 1N2LA 3SZZA 3SZYA 5GRRA 4CYRA 3MK2A 2QZUA 2IFYA 2XRGA 3BDGB 1KH5A 3B5QA 4CYSA
chains in the Genus database with same CATH superfamily
3MK0A 1ZQ1C 1O25A 4JK1A 1HJKA 4XLNA 1XZPA 4A93C 4QIWL 4N7TA 1RU0A 1E2SP 4KAWX 5M5XK 4BLAA 4KARA 3RZOK 3A8JA 2E2IA 3WODA 4KM8A 4MEYA 3LXQA 4C3IC 5KXAA 4BKWA 2B63C 4KM9A 4C45A 2CFAA 3GSIA 2PHCB 4LR8A 5TMFA 2NVYC 2PA8L 1SFOA 1ZEDA 4LLGA 1HDHA 2W5VA 2W8DA 2A69A 2O5IA 4P5AA 5EGEA 4A3KC 4A3BC 1O24A 1I3QK 1KH7A 2GSNA 3RZDK 2IUCB 4C3IK 3LPXA 2B63K 1WIHA 1BJTA 4J3NA 5C4XC 3TX0A 1TWCC 1SHNA 1VLOA 2WAQD 3GEEA 3HOXC 1WCMC 4KMHA 3HOWC 2NVYK 2ANHA 4UPIA 4KN4A 4C3JK 2XCQA 5IORA 1TWAC 4G7ZA 3H0GA 3GTMC 5M5YK 3L4JA 4A3BK 1WOSA 3GTLC 5TMCA 4KJDA 5DLWA 2GA3A 1J6VA 5C4XK 4UORA 5L0BA 3FKIC 1TWCK 3WAWA 5JVOA 4QJVB 4OIPA 4A3LC 2R93C 3HOXK 4X6AC 2W5WA 3BP8C 3GTOA 3BDFA 5LRMA 3HOWK 4QAXA 3N0BA 2JA8C 4KATA 1TWAK 1VRQC 1Y6VA 3GTMK 1TWHK 3E2DA 1WQHA 3GTLK 1I6HC 3S1NC 4FM9A 2W7VA 3DPCA 4GTZA 3S15K 1Y1VC 3FKIK 3I4MC 3UN2A 1HI9A 2Y0SD 4UPKA 4A3LK 2XCOA 3GDZA 2R93K 4LR9A 3FHZA 4YG2A 4GTBA 4C3HC 2JA8K 3G4AA 2PPBA 3ADAC 3BDGA 2WB1L 3TFIA 3GEIA 2V6UA 1I6HK 3S1NK 2KWAA 5C44K 2BE5A 2V6TA 1URBA 1EK8A 4GTWA 2E2JC 1KQ4A 1Y1VK 4A3FK 4Y7NC 1WOOA 1XXAA 2Y0SL 1DCOA 1IQ0A 3FOEA 3K7AK 4C3HK 4AYBL 5IJQA 3GIRA 2CW0A 1XPPA 1O2FB 4MY4A 3S0XA 1Y1WA 3GTKA 5L46A 5C3EC 1PJ5A 1ELZA 3CMRA 2D6FC 2JA6C 2JA7C 4Y7NK 3LAJA 1O29A 3S1RK 3GTGA 2W5QA 4GTAA 2PMZD 3TTGA 3VA7A 1AJCA 4GTCA 4KN7A 4LRDA 3S2HC 3A8KA 1G51A 4AH6A 4ZG6A 2XR9A 1WQGA 2ZKTA 5C3EK 2GAGC 4NWXA 4FDIA 1BDFA 3NKQA 4A3CC 2JA7K 2JA6K 3NKOA 4G0WA 4A3GK 5IYCC 1E33P 5C66A 5HRTA 1F93A 1I50C 2PMZL 1INNA 3HXAA 5IOQA 2JA5A 3V4GA 2PA8D 1WSRA 2XCRB 3S2HK 4GTXA 2YU9A 4BY1C 1ZYRA 4KC6A 1I3QC 1KH9A 4YR1A 1ELXA 4C2MC 3RZDC 3WAXA 4G0UA 1FSUA 3S2DK 4KAYA 3AQOA 4A3CK 3S17C 1EQRA 3M3YK 5IOSA 1TWGA 4P9SA 5IYCK 3IGYB 1I50K 3M7VA 4ILDA 5M3MK 2D1GA 2W5XA 3NKRA 3UN3A 4C3JC 1EJJA 4LRCA 4G7HA 1PJ6A 1ZBSA 4GTFA 3IGZB 4BY1K 4B56A 2P5MA 4LR7A 3NKNA 4C2MK 4ZGAA 2E2HC 1ALJA 1ALKA 3CQZA 2A6EA 3TFJA 5IP7C 4A3MC 1DCHA 3GTPA 3S17K 3H0GK 2R92A 4CXKA 4WJ4A 1USMA 1O98A 1K83C 1XZQB 4Y52C 1ALHA 3Q3QA 1EW2A 1EI6A 1HQAA 4MHXA 1TWHC 1F9NA 1ELYA 4MEXA 1SMYA 1EW8A 2E2HK 2W5RA 5IP7K 3GTOK 3S15C 1ALIA 4A3MK 3M8ZA 3G4CA 2RH6A 3TG0A 1TWFA 1K83K 4Y52K 4GTEA 5E68A 1ED8A 1J6XA 4XSXA 3OEPA 1N2LA 4KMDA 4GTDA 2A68A 2WB1D 4A3DC 4KDDA 5C44C 3B5QA 4CYSA 2NVYA 1E3CP 2NVXC 4A3FC 5D4DA 5HL8A 2GAHC 4LJZA 4BY7C 1Y1WC 3K7AC 1DD5A 3MK1A 4KMAA 4AYBD 1YNNA 3ERED 2VQRA 3S14C 1AJDA 3UNYA 1TWCA 4OIRA 4A3DK 1WCMA 3NKPA 3H3VD 1O26A 4LQYA 1KHKA 1XZPB 3GTQA 2NVXK 1TWAA 1JQWA 3GTMA 1ANJA 2IUCA 1DCPA 3GTLA 3S1RC 3GEHA 1Y1WK 4BY7K 1ISEA 1F7UA 3NKMA 5LIAA 3GTKK 3T01A 4GT9A 1ANIA 4G7OA 4KAVA 2GSUA 3GTJA 1C0AA 3DXJA 2GLQA 3S14K 2W5SA 5L0EA 5CJ9A 4ZG9A 4KJGA 3H3VL 4LREA 2G9YA 4A3EC 1VGXA 3L4KA 1IE0A 1AJBA 3HKZD 4LRAA 5IP9C 3WAVA 4UOOA 3OT9A 1AJAA 3OREA 2E2IC 2GSOA 4A3GC 4LK0A 4YFNA 1R9TA 5M3FK 4XLPA 5IYDC 2EBBA 2R7ZA 1Y1VA 4QJVA 1AUKA 1EW9A 3UN5A 1TWGC 5FJ8K 1O2BA 3AQPA 5M5WK 4A3EK 4G0VA 3S2DC 3HKZL 4Q4ZA 4OIQA 2JA5K 1SFOC 3M3YC 5IP9K 4MIVA 3N3YA 2E2IK 5LRNA 3S16C 3N0CA 3BUEA 4NWJA 4UPHA 4Q5SA 5IYDK 1O99A 3QX3A 1YX2A 3CQZC 2ZFZA 3PO3C 5L0KA 3GTPC 4WJ3M 1PJ7A 1TWGK 2VUMA 2JH3A 3M8YA 1VH2A 4M1XA 3HOUC 3UO0A 1IS1A 1SFOK 4UOPA 4CXUA 5DLVA 3A8IA 3NVLA 1VJEA 3H0GC 3S16K 3T00A 1B8JA 1O27A 3AD9C 4BLBA 1WQFA 3HOZK 1ZVUA 3M4OC 5DLTA 5C4JC 4KM4A 3CQZK 4GTYA 3JSTA 4GFQA 3PO3K 2JA7A 2JA6A 3GTPK 5IJSA 1EFWA 3WAYA 2R92K 3PO2C 1TWFC 5IOTA 5IYBC 1EQJA 1YNJA 3HOUK 3GTOC 1JOEA 1Y7AA 1J6WA 1B4BA 4LRFA 3DYCA 2FQTA 3SZYA 3MK2A 4OIOA 1WORA 3IPJA 1WOPA 4A93K 1F7VA 3BDGB 3M4OK 1KH5A 1I6VA 3NUHA 5C4JK 4O2DA 5JFEA 1WSVA 3I4NC 2FQOA 3MMLB 1GE9A 5LQQA 4P5BA 3PO2K 1I50A 4GZYA 1TWFK 3HOVC 5IYBK 4RMFA 4ZH4A 1E1ZP 5GOVA 1IBAA 3AD7C 1I3QA 2O5JA 5AJ9A 2B63A 3AD8C 4BBRC 3I4NK 3T02A 1HQMA 1KH4A 3CAGA 3GTQC 2W8SA 3EQLA 1BS2A 4OINA 2NVTC 4XCHA 4A3KK 4BBSC 3HOVK 3S1QC 4GTLA 5K4PA 1J98A 3GTJC 3WBHA 4UPLA 2NVQC 3HOYC 4LK1A 2WAQL 2E2HA 4FDJA 3GTKC 1XXCA 1WCMK 3TFHA 4BBRK 1ZXOA 1O28A 2A6HA 1B4AA 3GTQK 1N2KA 1URAA 4KB2A 3S1MC 2NVTK 5FLMC 2Y3PA 4BXXC 4BBSK 4YFXA 1O2AA 1K83A 2ZUEA 3S1QK 3GTGC 1BGWA 1R9TC 4XSZA 2R7ZC 4TN0A 1TWHA 1IL2A 3GTJK 3BP3A 4A3JC 2NVQK 3HOYK 5EGHA 4X6AK 4LR2A 4NOIA 2ZUFA 3BDHA 3A52A 1IW7A 3FKIA 1XZQA 4FZBA 2CFAB 3S1MK 1EH1A 5FLMK 2R93A 4BXXK 3TWZA 4ZG7A 3LAPA 4CXSA 4LOWA 4KMUA 4MQ9A 4KASA 3GTGK 1R9TK 1SHQA 1KHLA 2JA5C 2RGRA 2R7ZK 1JVIA 3OPFA 2YU9C 1YCLA 4A3JK 3ED4A 3I4MK 1XXBA 1K7HA 4YFKA 2VUMC 4LRBA 5TJ3A 2W5TA 2NVXA 1L0WA 1ED9A 3AH5A 4DDQA 4WILA 4A3IC 1KHNA 1AB4A 3IDDA 4KB4A 5CHPA 1USOA 1KHJA 1P49A 1UV7A 1ZEBA 2E2JK 2V6SA 2YU9K 1X31C 2P8TA 2VUMK 3HOZC 4PABA 4QIWD 3KD8A 3M8WA 2X98A 1ZEFA 1V5VA 5INHA 3SZZA 3RZOC 5GRRA 3FOFA 4CYRA 2QZUA 2IFYA 2XRGA 4A3IK 2R92C 4PAAA
chains in the Genus database with same CATH topology
3MK0A 1E3CP 5IJQA 1HJKA 4MY4A 5LQQA 4N7TA 1E2SP 3MK1A 1E1ZP 1ELZA 3CMRA 5GOVA 2VQRA 1AJDA 3UNYA 2W5QA 3NKPA 5AJ9A 1KHKA 3LXQA 4LQYA 5KXAA 1AJCA 3T02A 4LRDA 1KH4A 2W8SA 1ANJA 2IUCA 4ZG6A 2XR9A 2ZKTA 3NKMA 5LIAA 4NWXA 3T01A 4FDIA 4LR8A 1ANIA 3NKQA 4KAVA 2GSUA 1ZEDA 1HDHA 2W5VA 2GLQA 2W8DA 5K4PA 2W5SA 3WBHA 3NKOA 4UPLA 5L0EA 5EGEA 4ZG9A 4KJGA 1E33P 1KH7A 5C66A 2GSNA 4FDJA 5HRTA 2IUCB 4LREA 2G9YA 1AJBA 4GTXA 1N2KA 4LRAA 3WAVA 1URAA 3OT9A 1AJAA 3TX0A 4UOOA 1KH9A 2GSOA 4YR1A 1SHNA 1ELXA 3WAXA 1FSUA 2ANHA 4UPIA 4KAYA 4TN0A 1AUKA 1EW9A 3UN5A 5EGHA 3IGYB 3M7VA 4LR2A 3UN3A 2D1GA 2W5XA 3NKRA 4KJDA 5DLWA 3BDHA 2GA3A 1EJJA 3A52A 4LRCA 4MIVA 3IGZB 4B56A 4UORA 5L0BA 5LRNA 4LR7A 3TWZA 4NWJA 4UPHA 3WAWA 4ZG7A 2W5WA 3NKNA 4ZGAA 4CXSA 1O99A 1ALJA 1ALKA 3BDFA 1SHQA 1KHLA 4QAXA 5LRMA 5L0KA 1Y6VA 3ED4A 3E2DA 3M8YA 4CXKA 1K7HA 1O98A 4LRBA 1ALHA 2W5TA 3DPCA 3Q3QA 5TJ3A 1HQAA 1EW2A 1EI6A 4GTZA 4UOPA 3UO0A 4MHXA 4CXUA 1ED9A 5DLVA 3NVLA 3UN2A 3T00A 1B8JA 1ELYA 4UPKA 1EW8A 4LR9A 1KHNA 2W5RA 3IDDA 5DLTA 1KHJA 1P49A 4KM4A 4GTYA 1ALIA 1ZEBA 3M8ZA 5IJSA 2RH6A 3BDGA 3TG0A 3WAYA 3KD8A 3M8WA 2X98A 1EQJA 1ZEFA 1URBA 1ED8A 1Y7AA 5INHA 4GTWA 4LRFA 3DYCA 1N2LA 3SZZA 3SZYA 5GRRA 4CYRA 3MK2A 2QZUA 2IFYA 2XRGA 3BDGB 1KH5A 3B5QA 4CYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MK0 A;  1E3C P;  5IJQ A;  1HJK A;  4MY4 A;  5LQQ A;  4N7T A;  1E2S P;  3MK1 A;  1E1Z P;  1ELZ A;  3CMR A;  5GOV A;  2VQR A;  1AJD A;  3UNY A;  2W5Q A;  3NKP A;  5AJ9 A;  1KHK A;  3LXQ A;  4LQY A;  5KXA A;  1AJC A;  3T02 A;  4LRD A;  1KH4 A;  2W8S A;  1ANJ A;  2IUC A;  4ZG6 A;  2XR9 A;  2ZKT A;  3NKM A;  5LIA A;  4NWX A;  3T01 A;  4FDI A;  4LR8 A;  1ANI A;  3NKQ A;  4KAV A;  2GSU A;  1ZED A;  1HDH A;  2W5V A;  2GLQ A;  2W8D A;  5K4P A;  2W5S A;  3WBH A;  3NKO A;  4UPL A;  5L0E A;  5EGE A;  4ZG9 A;  4KJG A;  1E33 P;  1KH7 A;  5C66 A;  2GSN A;  4FDJ A;  5HRT A;  2IUC B;  4LRE A;  2G9Y A;  1AJB A;  4GTX A;  1N2K A;  4LRA A;  3WAV A;  1URA A;  3OT9 A;  1AJA A;  3TX0 A;  4UOO A;  1KH9 A;  2GSO A;  4YR1 A;  1SHN A;  1ELX A;  3WAX A;  1FSU A;  2ANH A;  4UPI A;  4KAY A;  4TN0 A;  1AUK A;  1EW9 A;  3UN5 A;  5EGH A;  3IGY B;  3M7V A;  4LR2 A;  3UN3 A;  2D1G A;  2W5X A;  3NKR A;  4KJD A;  5DLW A;  3BDH A;  2GA3 A;  1EJJ A;  3A52 A;  4LRC A;  4MIV A;  3IGZ B;  4B56 A;  4UOR A;  5L0B A;  5LRN A;  4LR7 A;  3TWZ A;  4NWJ A;  4UPH A;  3WAW A;  4ZG7 A;  2W5W A;  3NKN A;  4ZGA A;  4CXS A;  1O99 A;  1ALJ A;  1ALK A;  3BDF A;  1SHQ A;  1KHL A;  4QAX A;  5LRM A;  5L0K A;  1Y6V A;  3ED4 A;  3E2D A;  3M8Y A;  4CXK A;  1K7H A;  1O98 A;  4LRB A;  1ALH A;  2W5T A;  3DPC A;  3Q3Q A;  5TJ3 A;  1HQA A;  1EW2 A;  1EI6 A;  4GTZ A;  4UOP A;  3UO0 A;  4MHX A;  4CXU A;  1ED9 A;  5DLV A;  3NVL A;  3UN2 A;  3T00 A;  1B8J A;  1ELY A;  4UPK A;  1EW8 A;  4LR9 A;  1KHN A;  2W5R A;  3IDD A;  5DLT A;  1KHJ A;  1P49 A;  4KM4 A;  4GTY A;  1ALI A;  1ZEB A;  3M8Z A;  5IJS A;  2RH6 A;  3BDG A;  3TG0 A;  3WAY A;  3KD8 A;  3M8W A;  2X98 A;  1EQJ A;  1ZEF A;  1URB A;  1ED8 A;  1Y7A A;  5INH A;  4GTW A;  4LRF A;  3DYC A;  1N2L A;  3SZZ A;  3SZY A;  5GRR A;  4CYR A;  3MK2 A;  2QZU A;  2IFY A;  2XRG A;  3BDG B;  1KH5 A;  3B5Q A;  4CYS A; 
#chains in the Genus database with same CATH topology
 3MK0 A;  1ZQ1 C;  1O25 A;  4JK1 A;  1HJK A;  4XLN A;  1XZP A;  4A93 C;  4QIW L;  4N7T A;  1RU0 A;  1E2S P;  4KAW X;  5M5X K;  4BLA A;  4KAR A;  3RZO K;  3A8J A;  2E2I A;  3WOD A;  4KM8 A;  4MEY A;  3LXQ A;  4C3I C;  5KXA A;  4BKW A;  2B63 C;  4KM9 A;  4C45 A;  2CFA A;  3GSI A;  2PHC B;  4LR8 A;  5TMF A;  2NVY C;  2PA8 L;  1SFO A;  1ZED A;  4LLG A;  1HDH A;  2W5V A;  2W8D A;  2A69 A;  2O5I A;  4P5A A;  5EGE A;  4A3K C;  4A3B C;  1O24 A;  1I3Q K;  1KH7 A;  2GSN A;  3RZD K;  2IUC B;  4C3I K;  3LPX A;  2B63 K;  1WIH A;  1BJT A;  4J3N A;  5C4X C;  3TX0 A;  1TWC C;  1SHN A;  1VLO A;  2WAQ D;  3GEE A;  3HOX C;  1WCM C;  4KMH A;  3HOW C;  2NVY K;  2ANH A;  4UPI A;  4KN4 A;  4C3J K;  2XCQ A;  5IOR A;  1TWA C;  4G7Z A;  3H0G A;  3GTM C;  5M5Y K;  3L4J A;  4A3B K;  1WOS A;  3GTL C;  5TMC A;  4KJD A;  5DLW A;  2GA3 A;  1J6V A;  5C4X K;  4UOR A;  5L0B A;  3FKI C;  1TWC K;  3WAW A;  5JVO A;  4QJV B;  4OIP A;  4A3L C;  2R93 C;  3HOX K;  4X6A C;  2W5W A;  3BP8 C;  3GTO A;  3BDF A;  5LRM A;  3HOW K;  4QAX A;  3N0B A;  2JA8 C;  4KAT A;  1TWA K;  1VRQ C;  1Y6V A;  3GTM K;  1TWH K;  3E2D A;  1WQH A;  3GTL K;  1I6H C;  3S1N C;  4FM9 A;  2W7V A;  3DPC A;  4GTZ A;  3S15 K;  1Y1V C;  3FKI K;  3I4M C;  3UN2 A;  1HI9 A;  2Y0S D;  4UPK A;  4A3L K;  2XCO A;  3GDZ A;  2R93 K;  4LR9 A;  3FHZ A;  4YG2 A;  4GTB A;  4C3H C;  2JA8 K;  3G4A A;  2PPB A;  3ADA C;  3BDG A;  2WB1 L;  3TFI A;  3GEI A;  2V6U A;  1I6H K;  3S1N K;  2KWA A;  5C44 K;  2BE5 A;  2V6T A;  1URB A;  1EK8 A;  4GTW A;  2E2J C;  1KQ4 A;  1Y1V K;  4A3F K;  4Y7N C;  1WOO A;  1XXA A;  2Y0S L;  1DCO A;  1IQ0 A;  3FOE A;  3K7A K;  4C3H K;  4AYB L;  5IJQ A;  3GIR A;  2CW0 A;  1XPP A;  1O2F B;  4MY4 A;  3S0X A;  1Y1W A;  3GTK A;  5L46 A;  5C3E C;  1PJ5 A;  1ELZ A;  3CMR A;  2D6F C;  2JA6 C;  2JA7 C;  4Y7N K;  3LAJ A;  1O29 A;  3S1R K;  3GTG A;  2W5Q A;  4GTA A;  2PMZ D;  3TTG A;  3VA7 A;  1AJC A;  4GTC A;  4KN7 A;  4LRD A;  3S2H C;  3A8K A;  1G51 A;  4AH6 A;  4ZG6 A;  2XR9 A;  1WQG A;  2ZKT A;  5C3E K;  2GAG C;  4NWX A;  4FDI A;  1BDF A;  3NKQ A;  4A3C C;  2JA7 K;  2JA6 K;  3NKO A;  4G0W A;  4A3G K;  5IYC C;  1E33 P;  5C66 A;  5HRT A;  1F93 A;  1I50 C;  2PMZ L;  1INN A;  3HXA A;  5IOQ A;  2JA5 A;  3V4G A;  2PA8 D;  1WSR A;  2XCR B;  3S2H K;  4GTX A;  2YU9 A;  4BY1 C;  1ZYR A;  4KC6 A;  1I3Q C;  1KH9 A;  4YR1 A;  1ELX A;  4C2M C;  3RZD C;  3WAX A;  4G0U A;  1FSU A;  3S2D K;  4KAY A;  3AQO A;  4A3C K;  3S17 C;  1EQR A;  3M3Y K;  5IOS A;  1TWG A;  4P9S A;  5IYC K;  3IGY B;  1I50 K;  3M7V A;  4ILD A;  5M3M K;  2D1G A;  2W5X A;  3NKR A;  3UN3 A;  4C3J C;  1EJJ A;  4LRC A;  4G7H A;  1PJ6 A;  1ZBS A;  4GTF A;  3IGZ B;  4BY1 K;  4B56 A;  2P5M A;  4LR7 A;  3NKN A;  4C2M K;  4ZGA A;  2E2H C;  1ALJ A;  1ALK A;  3CQZ A;  2A6E A;  3TFJ A;  5IP7 C;  4A3M C;  1DCH A;  3GTP A;  3S17 K;  3H0G K;  2R92 A;  4CXK A;  4WJ4 A;  1USM A;  1O98 A;  1K83 C;  1XZQ B;  4Y52 C;  1ALH A;  3Q3Q A;  1EW2 A;  1EI6 A;  1HQA A;  4MHX A;  1TWH C;  1F9N A;  1ELY A;  4MEX A;  1SMY A;  1EW8 A;  2E2H K;  2W5R A;  5IP7 K;  3GTO K;  3S15 C;  1ALI A;  4A3M K;  3M8Z A;  3G4C A;  2RH6 A;  3TG0 A;  1TWF A;  1K83 K;  4Y52 K;  4GTE A;  5E68 A;  1ED8 A;  1J6X A;  4XSX A;  3OEP A;  1N2L A;  4KMD A;  4GTD A;  2A68 A;  2WB1 D;  4A3D C;  4KDD A;  5C44 C;  3B5Q A;  4CYS A;  2NVY A;  1E3C P;  2NVX C;  4A3F C;  5D4D A;  5HL8 A;  2GAH C;  4LJZ A;  4BY7 C;  1Y1W C;  3K7A C;  1DD5 A;  3MK1 A;  4KMA A;  4AYB D;  1YNN A;  3ERE D;  2VQR A;  3S14 C;  1AJD A;  3UNY A;  1TWC A;  4OIR A;  4A3D K;  1WCM A;  3NKP A;  3H3V D;  1O26 A;  4LQY A;  1KHK A;  1XZP B;  3GTQ A;  2NVX K;  1TWA A;  1JQW A;  3GTM A;  1ANJ A;  2IUC A;  1DCP A;  3GTL A;  3S1R C;  3GEH A;  1Y1W K;  4BY7 K;  1ISE A;  1F7U A;  3NKM A;  5LIA A;  3GTK K;  3T01 A;  4GT9 A;  1ANI A;  4G7O A;  4KAV A;  2GSU A;  3GTJ A;  1C0A A;  3DXJ A;  2GLQ A;  3S14 K;  2W5S A;  5L0E A;  5CJ9 A;  4ZG9 A;  4KJG A;  3H3V L;  4LRE A;  2G9Y A;  4A3E C;  1VGX A;  3L4K A;  1IE0 A;  1AJB A;  3HKZ D;  4LRA A;  5IP9 C;  3WAV A;  4UOO A;  3OT9 A;  1AJA A;  3ORE A;  2E2I C;  2GSO A;  4A3G C;  4LK0 A;  4YFN A;  1R9T A;  5M3F K;  4XLP A;  5IYD C;  2EBB A;  2R7Z A;  1Y1V A;  4QJV A;  1AUK A;  1EW9 A;  3UN5 A;  1TWG C;  5FJ8 K;  1O2B A;  3AQP A;  5M5W K;  4A3E K;  4G0V A;  3S2D C;  3HKZ L;  4Q4Z A;  4OIQ A;  2JA5 K;  1SFO C;  3M3Y C;  5IP9 K;  4MIV A;  3N3Y A;  2E2I K;  5LRN A;  3S16 C;  3N0C A;  3BUE A;  4NWJ A;  4UPH A;  4Q5S A;  5IYD K;  1O99 A;  3QX3 A;  1YX2 A;  3CQZ C;  2ZFZ A;  3PO3 C;  5L0K A;  3GTP C;  4WJ3 M;  1PJ7 A;  1TWG K;  2VUM A;  2JH3 A;  3M8Y A;  1VH2 A;  4M1X A;  3HOU C;  3UO0 A;  1IS1 A;  1SFO K;  4UOP A;  4CXU A;  5DLV A;  3A8I A;  3NVL A;  1VJE A;  3H0G C;  3S16 K;  3T00 A;  1B8J A;  1O27 A;  3AD9 C;  4BLB A;  1WQF A;  3HOZ K;  1ZVU A;  3M4O C;  5DLT A;  5C4J C;  4KM4 A;  3CQZ K;  4GTY A;  3JST A;  4GFQ A;  3PO3 K;  2JA7 A;  2JA6 A;  3GTP K;  5IJS A;  1EFW A;  3WAY A;  2R92 K;  3PO2 C;  1TWF C;  5IOT A;  5IYB C;  1EQJ A;  1YNJ A;  3HOU K;  3GTO C;  1JOE A;  1Y7A A;  1J6W A;  1B4B A;  4LRF A;  3DYC A;  2FQT A;  3SZY A;  3MK2 A;  4OIO A;  1WOR A;  3IPJ A;  1WOP A;  4A93 K;  1F7V A;  3BDG B;  3M4O K;  1KH5 A;  1I6V A;  3NUH A;  5C4J K;  4O2D A;  5JFE A;  1WSV A;  3I4N C;  2FQO A;  3MML B;  1GE9 A;  5LQQ A;  4P5B A;  3PO2 K;  1I50 A;  4GZY A;  1TWF K;  3HOV C;  5IYB K;  4RMF A;  4ZH4 A;  1E1Z P;  5GOV A;  1IBA A;  3AD7 C;  1I3Q A;  2O5J A;  5AJ9 A;  2B63 A;  3AD8 C;  4BBR C;  3I4N K;  3T02 A;  1HQM A;  1KH4 A;  3CAG A;  3GTQ C;  2W8S A;  3EQL A;  1BS2 A;  4OIN A;  2NVT C;  4XCH A;  4A3K K;  4BBS C;  3HOV K;  3S1Q C;  4GTL A;  5K4P A;  1J98 A;  3GTJ C;  3WBH A;  4UPL A;  2NVQ C;  3HOY C;  4LK1 A;  2WAQ L;  2E2H A;  4FDJ A;  3GTK C;  1XXC A;  1WCM K;  3TFH A;  4BBR K;  1ZXO A;  1O28 A;  2A6H A;  1B4A A;  3GTQ K;  1N2K A;  1URA A;  4KB2 A;  3S1M C;  2NVT K;  5FLM C;  2Y3P A;  4BXX C;  4BBS K;  4YFX A;  1O2A A;  1K83 A;  2ZUE A;  3S1Q K;  3GTG C;  1BGW A;  1R9T C;  4XSZ A;  2R7Z C;  4TN0 A;  1TWH A;  1IL2 A;  3GTJ K;  3BP3 A;  4A3J C;  2NVQ K;  3HOY K;  5EGH A;  4X6A K;  4LR2 A;  4NOI A;  2ZUF A;  3BDH A;  3A52 A;  1IW7 A;  3FKI A;  1XZQ A;  4FZB A;  2CFA B;  3S1M K;  1EH1 A;  5FLM K;  2R93 A;  4BXX K;  3TWZ A;  4ZG7 A;  3LAP A;  4CXS A;  4LOW A;  4KMU A;  4MQ9 A;  4KAS A;  3GTG K;  1R9T K;  1SHQ A;  1KHL A;  2JA5 C;  2RGR A;  2R7Z K;  1JVI A;  3OPF A;  2YU9 C;  1YCL A;  4A3J K;  3ED4 A;  3I4M K;  1XXB A;  1K7H A;  4YFK A;  2VUM C;  4LRB A;  5TJ3 A;  2W5T A;  2NVX A;  1L0W A;  1ED9 A;  3AH5 A;  4DDQ A;  4WIL A;  4A3I C;  1KHN A;  1AB4 A;  3IDD A;  4KB4 A;  5CHP A;  1USO A;  1KHJ A;  1P49 A;  1UV7 A;  1ZEB A;  2E2J K;  2V6S A;  2YU9 K;  1X31 C;  2P8T A;  2VUM K;  3HOZ C;  4PAB A;  4QIW D;  3KD8 A;  3M8W A;  2X98 A;  1ZEF A;  1V5V A;  5INH A;  3SZZ A;  3RZO C;  5GRR A;  3FOF A;  4CYR A;  2QZU A;  2IFY A;  2XRG A;  4A3I K;  2R92 C;  4PAA A; 
#chains in the Genus database with same CATH homology
 3MK0 A;  1E3C P;  5IJQ A;  1HJK A;  4MY4 A;  5LQQ A;  4N7T A;  1E2S P;  3MK1 A;  1E1Z P;  1ELZ A;  3CMR A;  5GOV A;  2VQR A;  1AJD A;  3UNY A;  2W5Q A;  3NKP A;  5AJ9 A;  1KHK A;  3LXQ A;  4LQY A;  5KXA A;  1AJC A;  3T02 A;  4LRD A;  1KH4 A;  2W8S A;  1ANJ A;  2IUC A;  4ZG6 A;  2XR9 A;  2ZKT A;  3NKM A;  5LIA A;  4NWX A;  3T01 A;  4FDI A;  4LR8 A;  1ANI A;  3NKQ A;  4KAV A;  2GSU A;  1ZED A;  1HDH A;  2W5V A;  2GLQ A;  2W8D A;  5K4P A;  2W5S A;  3WBH A;  3NKO A;  4UPL A;  5L0E A;  5EGE A;  4ZG9 A;  4KJG A;  1E33 P;  1KH7 A;  5C66 A;  2GSN A;  4FDJ A;  5HRT A;  2IUC B;  4LRE A;  2G9Y A;  1AJB A;  4GTX A;  1N2K A;  4LRA A;  3WAV A;  1URA A;  3OT9 A;  1AJA A;  3TX0 A;  4UOO A;  1KH9 A;  2GSO A;  4YR1 A;  1SHN A;  1ELX A;  3WAX A;  1FSU A;  2ANH A;  4UPI A;  4KAY A;  4TN0 A;  1AUK A;  1EW9 A;  3UN5 A;  5EGH A;  3IGY B;  3M7V A;  4LR2 A;  3UN3 A;  2D1G A;  2W5X A;  3NKR A;  4KJD A;  5DLW A;  3BDH A;  2GA3 A;  1EJJ A;  3A52 A;  4LRC A;  4MIV A;  3IGZ B;  4B56 A;  4UOR A;  5L0B A;  5LRN A;  4LR7 A;  3TWZ A;  4NWJ A;  4UPH A;  3WAW A;  4ZG7 A;  2W5W A;  3NKN A;  4ZGA A;  4CXS A;  1O99 A;  1ALJ A;  1ALK A;  3BDF A;  1SHQ A;  1KHL A;  4QAX A;  5LRM A;  5L0K A;  1Y6V A;  3ED4 A;  3E2D A;  3M8Y A;  4CXK A;  1K7H A;  1O98 A;  4LRB A;  1ALH A;  2W5T A;  3DPC A;  3Q3Q A;  5TJ3 A;  1HQA A;  1EW2 A;  1EI6 A;  4GTZ A;  4UOP A;  3UO0 A;  4MHX A;  4CXU A;  1ED9 A;  5DLV A;  3NVL A;  3UN2 A;  3T00 A;  1B8J A;  1ELY A;  4UPK A;  1EW8 A;  4LR9 A;  1KHN A;  2W5R A;  3IDD A;  5DLT A;  1KHJ A;  1P49 A;  4KM4 A;  4GTY A;  1ALI A;  1ZEB A;  3M8Z A;  5IJS A;  2RH6 A;  3BDG A;  3TG0 A;  3WAY A;  3KD8 A;  3M8W A;  2X98 A;  1EQJ A;  1ZEF A;  1URB A;  1ED8 A;  1Y7A A;  5INH A;  4GTW A;  4LRF A;  3DYC A;  1N2L A;  3SZZ A;  3SZY A;  5GRR A;  4CYR A;  3MK2 A;  2QZU A;  2IFY A;  2XRG A;  3BDG B;  1KH5 A;  3B5Q A;  4CYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...