3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 127
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
3OT9A 1ED9A 5KXAA 4KAYA 4LRAA 3IGZB 3E2DA 3SZZA 3NVLA 4N7TA 3WAYA 3WAWA 4KJGA 2XRGA 1ED8A 5DLTA 1KHNA 1KH5A 3M8WA 4GTWA 2W5SA 3DPCA 3MK2A 4ZG6A 2GSUA 5INHA 1AJBA 1EJJA 4UPKA 5GRRA 1ALKA 2W8SA 2W5TA 4LRBA 2GA3A 2W5QA 5LRNA 1O98A 4LR7A 4LR8A 1ALIA 2X98A 4KJDA 2D1GA 5LQQA 4CXSA 1AUKA 1KHLA 4MHXA 3NKQA 4UPIA 5IJQA 3MK0A 2W5WA 1E2SP 4FDIA 3UN2A 1Y6VA 5C66A 3WBHA 2G9YA 1EW9A 3MK1A 1URBA 2GSOA 1ELXA 1EW8A 3M7VA 3WAXA 1KHJA 4TN0A 3UO0A 4UOPA 1FSUA 3M8ZA 3TX0A 1KH9A 3NKPA 4CXKA 3Q3QA 4LREA 1P49A 3BDGB 4B56A 4MIVA 4CYSA 5DLWA 4ZG9A 1HQAA 1AJDA 1ZEDA 2ANHA 4KAVA 3T02A 3CMRA 1ZEFA 4QAXA 1N2KA 4LRDA 3ED4A 1AJCA 1HJKA 3M8YA 4LR9A 4CYRA 3BDGA 5HRTA 4FDJA 2W8DA 1KH4A 3A52A 1EI6A 2ZKTA 5L0BA 5GOVA 2VQRA 4GTYA 4KM4A 1KHKA 3BDHA 5AJ9A 5LIAA 4GTZA 2GLQA 1HDHA 2W5RA 4ZG7A 1E1ZP 5K4PA 1SHNA 1Y7AA 3TWZA 3DYCA 4GTXA 4LRFA 3NKRA 5IJSA 4NWJA 1B8JA 1K7HA 4NWXA 1ALJA 1ZEBA 4YR1A 4UOOA 4UPHA 2IFYA 1O99A 3NKOA 2W5VA 2IUCB 4LRCA 1EW2A 1E33P 3T01A 1KH7A 5L0EA 3IGYB 4CXUA 5EGHA 3BDFA 4LQYA 4UPLA 5DLVA 3SZYA 5LRMA 3WAVA 3TG0A 3UN3A 3NKNA 1ALHA 1E3CP 3IDDA 5L0KA 2IUCA 3B5QA 4UORA 4MY4A 2QZUA 1ANJA 2GSNA 3NKMA 2XR9A 4LR2A 1ANIA 1AJAA 4ZGAA 1SHQA 1ELZA 1URAA 2RH6A 3LXQA 3KD8A 3T00A 5TJ3A 1EQJA 3UNYA 1ELYA 5EGEA 1N2LA 3UN5A 2W5XA
chains in the Genus database with same CATH superfamily
3OT9A 4GTCA 4FZBA 3K7AC 3M4OC 4C45A 3IGZB 3SZZA 3CQZA 4KARA 1TWAK 2R93K 2EBBA 3H0GA 5IYBK 2P8TA 3WAWA 3GTJA 1JVIA 1I50C 4GTWA 3GTGC 3MK2A 4GTEA 2PHCB 1EJJA 1BJTA 1TWCA 4A3EC 2P5MA 5TMFA 4KASA 3GTLA 3GEHA 1PJ7A 4QJVB 4WJ4A 1O28A 2X98A 5C3EK 4A3JC 1WQHA 4BBSK 1K83C 4KDDA 4Q4ZA 2W5WA 2CFAA 3CQZK 2E2HC 1F9NA 3HOWK 1ZYRA 3H0GK 1GE9A 3GTJK 3ADAC 2G9YA 1EW9A 3GTMC 2A69A 1URBA 2A68A 5E68A 1ELXA 1J6WA 3S0XA 3N3YA 4LK0A 4C2MC 2YU9A 4JK1A 1TWCK 2NVXC 2NVTC 1KHJA 2BE5A 3GTLK 3IPJA 1TWHA 4CXKA 3Q3QA 1ZBSA 1P49A 4A3LC 4A3DK 1AJDA 1WOPA 2E2IK 5M5YK 3BUEA 1IW7A 3GTKC 4KB4A 4Y7NC 5CJ9A 2RGRA 1AJCA 2FQTA 4C3HC 3GDZA 1WCMC 1IL2A 3GTQC 3FKIA 3FHZA 1KH4A 4MQ9A 1RU0A 5GOVA 3PO3C 3S17C 1G51A 2VQRA 5JVOA 4GTYA 2YU9K 1KHKA 3BDHA 5AJ9A 4MEYA 2NVQK 2GLQA 4KATA 5K4PA 3S16C 1SHNA 1TWHK 4GT9A 4GTDA 3DXJA 4GTXA 4LRFA 5IJSA 3HOXK 1YCLA 4QIWD 1K7HA 1AB4A 4MEXA 4G7ZA 2ZUEA 4BY7C 1EK8A 4UPHA 2IFYA 5HL8A 1EW2A 2PMZD 1E33P 5L0EA 3GSIA 3FKIK 5C44C 3BDFA 4UPLA 3SZYA 2E2JC 3WAVA 3NKNA 3MMLB 3S14K 1E3CP 3GTOC 4A3IC 4BXXC 5L0KA 3L4KA 3B5QA 4UORA 2QZUA 3S1QC 1ANJA 1PJ5A 2WB1L 1WORA 3NKMA 2XR9A 1ANIA 3S1MC 5FLMK 4ZGAA 4G0WA 5IYDC 4OIRA 3N0BA 1INNA 3TTGA 3AH5A 2XCRB 1URAA 1EQRA 1O29A 4GTBA 1R9TC 3S15C 5TMCA 2JA8K 1JOEA 3HXAA 3TFHA 4X6AC 1O27A 3RZOK 5M3FK 3CAGA 4FM9A 2B63C 4A3GC 4KMDA 2XRGA 5DLTA 4P9SA 4YFNA 5JFEA 1KHNA 3HOVK 3HOZK 2W5SA 4ZG6A 2GSUA 3FOEA 5FJ8K 2O5IA 3GTGA 4A3MK 3GTPC 1DD5A 3I4MK 4A93C 2W5TA 2GA3A 2W5QA 4C3JK 1O24A 1WQFA 4GTAA 1O98A 1PJ6A 1VLOA 4LR7A 4LR8A 3A8IA 5LQQA 1I3QA 5M5XK 3ERED 1I6HC 3MK0A 1B4AA 3HOYC 3M4OK 2Y0SL 1E2SP 3UN2A 1YNJA 1Y6VA 4KMUA 2WB1D 5C66A 4G0UA 1F7UA 2GSOA 1SFOC 2CW0A 3AQPA 1L0WA 2R92C 3GIRA 3GTGK 3UO0A 3WAXA 1FSUA 5IP7K 3TX0A 3NKPA 2NVXA 1XXCA 4XLPA 4LREA 3BDGB 4B56A 3S1NC 3FOFA 1HQAA 4ZG9A 2ANHA 1I3QK 1XZQB 3T02A 3CMRA 2WAQD 2E2IA 2O5JA 4A3JK 3ED4A 3LAJA 1HI9A 4YFXA 4A3CC 1TWAC 1WOSA 1K83K 1HJKA 3M8YA 5HRTA 1UV7A 2W8DA 1O2AA 1J6VA 2ZKTA 5L0BA 1WCMA 1WQGA 1F93A 4BBRC 3OREA 4C2MK 1VRQC 1F7VA 2NVXK 1WOOA 1YNNA 3PO2C 3DYCA 2FQOA 5C3EC 4G7HA 1WSRA 4A3LK 1XZPA 4KM8A 1ALJA 4A3KC 4DDQA 4YR1A 3I4NK 2PA8L 2ZUFA 4YFKA 2IUCB 4LRCA 4OIOA 3H3VL 3A8KA 2NVYA 4Y7NK 5EGHA 3BP8C 4BLBA 5LRMA 1DCPA 3TG0A 1WCMK 1Y1WC 4OIQA 4XSXA 2R7ZC 1WSVA 1ALHA 3S17K 4LLGA 3GTLC 4PABA 1ZXOA 1AJAA 4XLNA 5M5WK 1ELZA 4GTFA 3S16K 1O2FB 4AYBL 2RH6A 3KD8A 3T00A 1EQJA 3VA7A 1ELYA 5EGEA 2JA6C 1N2LA 4XCHA 2VUMC 3M7VA 1ED9A 3AQOA 1USMA 1R9TA 4BY7K 4LRAA 2NVYK 4G7OA 1VJEA 4N7TA 2JA7A 4WILA 4AH6A 5C44K 4LOWA 2E2JK 4KN4A 1ED8A 3L4JA 2D6FC 1IS1A 4KMAA 1TWFC 1TWHC 1TWGC 4BXXK 3DPCA 1IQ0A 5IOQA 2JH3A 3S1QK 1AJBA 4UPKA 3HOXC 3S1MK 5D4DA 4C3IC 5IYCC 1ALKA 2CFAB 2JA5C 2PA8D 4A3FC 3S1RC 4LRBA 5IOTA 5C4XC 3GEIA 3GTPA 3S2HC 1R9TK 3S15K 4KJDA 2XCQA 1AUKA 1KHLA 4MHXA 3A8JA 4UPIA 5IJQA 3LPXA 2ZFZA 2JA7K 4X6AK 1JQWA 2KWAA 3M3YC 3JSTA 4QJVA 3S14C 2V6SA 4LK1A 3WBHA 4OIPA 2W7VA 3MK1A 2B63K 4A3GK 3S2DC 1KQ4A 4RMFA 1EW8A 4KM9A 4TN0A 4UOPA 2A6HA 1I50A 3HOUK 1SFOA 2R92A 4BKWA 5C4JC 3GTPK 4MIVA 1Y1VC 3RZOC 1USOA 1N2KA 4LRDA 3K7AK 2Y3PA 1I6HK 4CYRA 1IBAA 1EFWA 4BY1C 3HOYK 1XXAA 1VH2A 4FDJA 4NOIA 1K83A 4Y52C 3TFJA 3HOZC 2E2HA 3RZDC 4KN7A 4A3BC 1HDHA 4A3MC 2W5RA 1I6VA 4M1XA 3EQLA 3GTMA 1E1ZP 1I50K 1Y7AA 1SFOK 3I4MC 4ZG7A 2R92K 2PPBA 4A3EK 4KAWX 2V6UA 5IP9C 1X31C 3BP3A 4KB2A 3G4CA 3S1NK 4WJ3M 1ZEBA 4UOOA 1O99A 2W5VA 1BS2A 1KH7A 1XXBA 4CXUA 4A3CK 2R93C 3GTKA 4KMHA 5IYBC 5DLVA 1BDFA 2E2HK 1ZVUA 3G4AA 3HKZL 3GTQA 1Y1WA 4MY4A 1YX2A 2R7ZA 5IP7C 3GTMK 2GSNA 4LR2A 1SHQA 1BGWA 4BBRK 2NVTK 1I3QC 4O2DA 3PO2K 4Q5SA 2A6EA 3UN5A 1DCOA 4BBSC 1C0AA 2Y0SD 2JA6A 5KXAA 1HQMA 4A3KK 4QIWL 3CQZC 1O2BA 4YG2A 2VUMA 4KAYA 3AD9C 3E2DA 3GTKK 3HOWC 3H0GC 3NVLA 3GTJC 4C3HK 2PMZL 3WAYA 1IE0A 4KJGA 1Y1WK 3GTQK 2R7ZK 1TWCC 1EH1A 1KH5A 3M8WA 3PO3K 5INHA 1TWFA 3GTOA 5GRRA 1TWGA 5M3MK 4BLAA 2W8SA 4A3DC 1O25A 5LRNA 1ISEA 2E2IC 3I4NC 2JA5A 1ALIA 2JA6K 2D1GA 2VUMK 4CXSA 4ZH4A 4ILDA 3WODA 3NKQA 4GTLA 4G0VA 3HKZD 4FDIA 4P5BA 4OINA 3TFIA 2YU9C 2NVQC 1J6XA 5CHPA 2B63A 1TWFK 3GTOK 4A3IK 1TWGK 1XPPA 3GEEA 3M8ZA 1KH9A 4J3NA 4LJZA 4PAAA 5IYDK 3AD8C 3OPFA 4C3IK 5IYCK 2JA5K 4A3FK 4CYSA 3S1RK 5DLWA 1ZEDA 2NVYC 5C4XK 3H3VD 4KAVA 1SMYA 5L46A 3S2HK 1ZEFA 4QAXA 1Y1VA 4KC6A 3FKIC 4LR9A 3BDGA 3M3YK 1O26A 1XZQA 1EI6A 3A52A 3LAPA 3QX3A 2XCOA 2GAHC 4KM4A 4GZYA 2GAGC 5LIAA 4AYBD 5FLMC 4GTZA 1XZPB 3S2DK 1DCHA 1V5VA 3TWZA 1B4BA 1ZQ1C 3NKRA 1WIHA 4NWJA 1B8JA 3OEPA 4NWXA 5IOSA 2V6TA 5C4JK 2JA8C 4A93K 1Y1VK 2JA7C 4XSZA 3NKOA 5IORA 3T01A 3IGYB 3AD7C 1VGXA 4GFQA 2WAQL 4LQYA 4P5AA 4BY1K 3UN3A 1TWAA 2R93A 3HOVC 4Y52K 3IDDA 3RZDK 2IUCA 4A3BK 1J98A 3NUHA 3HOUC 3N0CA 3LXQA 4C3JC 5TJ3A 3UNYA 3V4GA 2W5XA 5IP9K
chains in the Genus database with same CATH topology
3OT9A 1ED9A 5KXAA 4KAYA 4LRAA 3IGZB 3E2DA 3SZZA 3NVLA 4N7TA 3WAYA 3WAWA 4KJGA 2XRGA 1ED8A 5DLTA 1KHNA 1KH5A 3M8WA 4GTWA 2W5SA 3DPCA 3MK2A 4ZG6A 2GSUA 5INHA 1AJBA 1EJJA 4UPKA 5GRRA 1ALKA 2W8SA 2W5TA 4LRBA 2GA3A 2W5QA 5LRNA 1O98A 4LR7A 4LR8A 1ALIA 2X98A 4KJDA 2D1GA 5LQQA 4CXSA 1AUKA 1KHLA 4MHXA 3NKQA 4UPIA 5IJQA 3MK0A 2W5WA 1E2SP 4FDIA 3UN2A 1Y6VA 5C66A 3WBHA 2G9YA 1EW9A 3MK1A 1URBA 2GSOA 1ELXA 1EW8A 3M7VA 3WAXA 1KHJA 4TN0A 3UO0A 4UOPA 1FSUA 3M8ZA 3TX0A 1KH9A 3NKPA 4CXKA 3Q3QA 4LREA 1P49A 3BDGB 4B56A 4MIVA 4CYSA 5DLWA 4ZG9A 1HQAA 1AJDA 1ZEDA 2ANHA 4KAVA 3T02A 3CMRA 1ZEFA 4QAXA 1N2KA 4LRDA 3ED4A 1AJCA 1HJKA 3M8YA 4LR9A 4CYRA 3BDGA 5HRTA 4FDJA 2W8DA 1KH4A 3A52A 1EI6A 2ZKTA 5L0BA 5GOVA 2VQRA 4GTYA 4KM4A 1KHKA 3BDHA 5AJ9A 5LIAA 4GTZA 2GLQA 1HDHA 2W5RA 4ZG7A 1E1ZP 5K4PA 1SHNA 1Y7AA 3TWZA 3DYCA 4GTXA 4LRFA 3NKRA 5IJSA 4NWJA 1B8JA 1K7HA 4NWXA 1ALJA 1ZEBA 4YR1A 4UOOA 4UPHA 2IFYA 1O99A 3NKOA 2W5VA 2IUCB 4LRCA 1EW2A 1E33P 3T01A 1KH7A 5L0EA 3IGYB 4CXUA 5EGHA 3BDFA 4LQYA 4UPLA 5DLVA 3SZYA 5LRMA 3WAVA 3TG0A 3UN3A 3NKNA 1ALHA 1E3CP 3IDDA 5L0KA 2IUCA 3B5QA 4UORA 4MY4A 2QZUA 1ANJA 2GSNA 3NKMA 2XR9A 4LR2A 1ANIA 1AJAA 4ZGAA 1SHQA 1ELZA 1URAA 2RH6A 3LXQA 3KD8A 3T00A 5TJ3A 1EQJA 3UNYA 1ELYA 5EGEA 1N2LA 3UN5A 2W5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT9 A;  1ED9 A;  5KXA A;  4KAY A;  4LRA A;  3IGZ B;  3E2D A;  3SZZ A;  3NVL A;  4N7T A;  3WAY A;  3WAW A;  4KJG A;  2XRG A;  1ED8 A;  5DLT A;  1KHN A;  1KH5 A;  3M8W A;  4GTW A;  2W5S A;  3DPC A;  3MK2 A;  4ZG6 A;  2GSU A;  5INH A;  1AJB A;  1EJJ A;  4UPK A;  5GRR A;  1ALK A;  2W8S A;  2W5T A;  4LRB A;  2GA3 A;  2W5Q A;  5LRN A;  1O98 A;  4LR7 A;  4LR8 A;  1ALI A;  2X98 A;  4KJD A;  2D1G A;  5LQQ A;  4CXS A;  1AUK A;  1KHL A;  4MHX A;  3NKQ A;  4UPI A;  5IJQ A;  3MK0 A;  2W5W A;  1E2S P;  4FDI A;  3UN2 A;  1Y6V A;  5C66 A;  3WBH A;  2G9Y A;  1EW9 A;  3MK1 A;  1URB A;  2GSO A;  1ELX A;  1EW8 A;  3M7V A;  3WAX A;  1KHJ A;  4TN0 A;  3UO0 A;  4UOP A;  1FSU A;  3M8Z A;  3TX0 A;  1KH9 A;  3NKP A;  4CXK A;  3Q3Q A;  4LRE A;  1P49 A;  3BDG B;  4B56 A;  4MIV A;  4CYS A;  5DLW A;  4ZG9 A;  1HQA A;  1AJD A;  1ZED A;  2ANH A;  4KAV A;  3T02 A;  3CMR A;  1ZEF A;  4QAX A;  1N2K A;  4LRD A;  3ED4 A;  1AJC A;  1HJK A;  3M8Y A;  4LR9 A;  4CYR A;  3BDG A;  5HRT A;  4FDJ A;  2W8D A;  1KH4 A;  3A52 A;  1EI6 A;  2ZKT A;  5L0B A;  5GOV A;  2VQR A;  4GTY A;  4KM4 A;  1KHK A;  3BDH A;  5AJ9 A;  5LIA A;  4GTZ A;  2GLQ A;  1HDH A;  2W5R A;  4ZG7 A;  1E1Z P;  5K4P A;  1SHN A;  1Y7A A;  3TWZ A;  3DYC A;  4GTX A;  4LRF A;  3NKR A;  5IJS A;  4NWJ A;  1B8J A;  1K7H A;  4NWX A;  1ALJ A;  1ZEB A;  4YR1 A;  4UOO A;  4UPH A;  2IFY A;  1O99 A;  3NKO A;  2W5V A;  2IUC B;  4LRC A;  1EW2 A;  1E33 P;  3T01 A;  1KH7 A;  5L0E A;  3IGY B;  4CXU A;  5EGH A;  3BDF A;  4LQY A;  4UPL A;  5DLV A;  3SZY A;  5LRM A;  3WAV A;  3TG0 A;  3UN3 A;  3NKN A;  1ALH A;  1E3C P;  3IDD A;  5L0K A;  2IUC A;  3B5Q A;  4UOR A;  4MY4 A;  2QZU A;  1ANJ A;  2GSN A;  3NKM A;  2XR9 A;  4LR2 A;  1ANI A;  1AJA A;  4ZGA A;  1SHQ A;  1ELZ A;  1URA A;  2RH6 A;  3LXQ A;  3KD8 A;  3T00 A;  5TJ3 A;  1EQJ A;  3UNY A;  1ELY A;  5EGE A;  1N2L A;  3UN5 A;  2W5X A; 
#chains in the Genus database with same CATH topology
 3OT9 A;  4GTC A;  4FZB A;  3K7A C;  3M4O C;  4C45 A;  3IGZ B;  3SZZ A;  3CQZ A;  4KAR A;  1TWA K;  2R93 K;  2EBB A;  3H0G A;  5IYB K;  2P8T A;  3WAW A;  3GTJ A;  1JVI A;  1I50 C;  4GTW A;  3GTG C;  3MK2 A;  4GTE A;  2PHC B;  1EJJ A;  1BJT A;  1TWC A;  4A3E C;  2P5M A;  5TMF A;  4KAS A;  3GTL A;  3GEH A;  1PJ7 A;  4QJV B;  4WJ4 A;  1O28 A;  2X98 A;  5C3E K;  4A3J C;  1WQH A;  4BBS K;  1K83 C;  4KDD A;  4Q4Z A;  2W5W A;  2CFA A;  3CQZ K;  2E2H C;  1F9N A;  3HOW K;  1ZYR A;  3H0G K;  1GE9 A;  3GTJ K;  3ADA C;  2G9Y A;  1EW9 A;  3GTM C;  2A69 A;  1URB A;  2A68 A;  5E68 A;  1ELX A;  1J6W A;  3S0X A;  3N3Y A;  4LK0 A;  4C2M C;  2YU9 A;  4JK1 A;  1TWC K;  2NVX C;  2NVT C;  1KHJ A;  2BE5 A;  3GTL K;  3IPJ A;  1TWH A;  4CXK A;  3Q3Q A;  1ZBS A;  1P49 A;  4A3L C;  4A3D K;  1AJD A;  1WOP A;  2E2I K;  5M5Y K;  3BUE A;  1IW7 A;  3GTK C;  4KB4 A;  4Y7N C;  5CJ9 A;  2RGR A;  1AJC A;  2FQT A;  4C3H C;  3GDZ A;  1WCM C;  1IL2 A;  3GTQ C;  3FKI A;  3FHZ A;  1KH4 A;  4MQ9 A;  1RU0 A;  5GOV A;  3PO3 C;  3S17 C;  1G51 A;  2VQR A;  5JVO A;  4GTY A;  2YU9 K;  1KHK A;  3BDH A;  5AJ9 A;  4MEY A;  2NVQ K;  2GLQ A;  4KAT A;  5K4P A;  3S16 C;  1SHN A;  1TWH K;  4GT9 A;  4GTD A;  3DXJ A;  4GTX A;  4LRF A;  5IJS A;  3HOX K;  1YCL A;  4QIW D;  1K7H A;  1AB4 A;  4MEX A;  4G7Z A;  2ZUE A;  4BY7 C;  1EK8 A;  4UPH A;  2IFY A;  5HL8 A;  1EW2 A;  2PMZ D;  1E33 P;  5L0E A;  3GSI A;  3FKI K;  5C44 C;  3BDF A;  4UPL A;  3SZY A;  2E2J C;  3WAV A;  3NKN A;  3MML B;  3S14 K;  1E3C P;  3GTO C;  4A3I C;  4BXX C;  5L0K A;  3L4K A;  3B5Q A;  4UOR A;  2QZU A;  3S1Q C;  1ANJ A;  1PJ5 A;  2WB1 L;  1WOR A;  3NKM A;  2XR9 A;  1ANI A;  3S1M C;  5FLM K;  4ZGA A;  4G0W A;  5IYD C;  4OIR A;  3N0B A;  1INN A;  3TTG A;  3AH5 A;  2XCR B;  1URA A;  1EQR A;  1O29 A;  4GTB A;  1R9T C;  3S15 C;  5TMC A;  2JA8 K;  1JOE A;  3HXA A;  3TFH A;  4X6A C;  1O27 A;  3RZO K;  5M3F K;  3CAG A;  4FM9 A;  2B63 C;  4A3G C;  4KMD A;  2XRG A;  5DLT A;  4P9S A;  4YFN A;  5JFE A;  1KHN A;  3HOV K;  3HOZ K;  2W5S A;  4ZG6 A;  2GSU A;  3FOE A;  5FJ8 K;  2O5I A;  3GTG A;  4A3M K;  3GTP C;  1DD5 A;  3I4M K;  4A93 C;  2W5T A;  2GA3 A;  2W5Q A;  4C3J K;  1O24 A;  1WQF A;  4GTA A;  1O98 A;  1PJ6 A;  1VLO A;  4LR7 A;  4LR8 A;  3A8I A;  5LQQ A;  1I3Q A;  5M5X K;  3ERE D;  1I6H C;  3MK0 A;  1B4A A;  3HOY C;  3M4O K;  2Y0S L;  1E2S P;  3UN2 A;  1YNJ A;  1Y6V A;  4KMU A;  2WB1 D;  5C66 A;  4G0U A;  1F7U A;  2GSO A;  1SFO C;  2CW0 A;  3AQP A;  1L0W A;  2R92 C;  3GIR A;  3GTG K;  3UO0 A;  3WAX A;  1FSU A;  5IP7 K;  3TX0 A;  3NKP A;  2NVX A;  1XXC A;  4XLP A;  4LRE A;  3BDG B;  4B56 A;  3S1N C;  3FOF A;  1HQA A;  4ZG9 A;  2ANH A;  1I3Q K;  1XZQ B;  3T02 A;  3CMR A;  2WAQ D;  2E2I A;  2O5J A;  4A3J K;  3ED4 A;  3LAJ A;  1HI9 A;  4YFX A;  4A3C C;  1TWA C;  1WOS A;  1K83 K;  1HJK A;  3M8Y A;  5HRT A;  1UV7 A;  2W8D A;  1O2A A;  1J6V A;  2ZKT A;  5L0B A;  1WCM A;  1WQG A;  1F93 A;  4BBR C;  3ORE A;  4C2M K;  1VRQ C;  1F7V A;  2NVX K;  1WOO A;  1YNN A;  3PO2 C;  3DYC A;  2FQO A;  5C3E C;  4G7H A;  1WSR A;  4A3L K;  1XZP A;  4KM8 A;  1ALJ A;  4A3K C;  4DDQ A;  4YR1 A;  3I4N K;  2PA8 L;  2ZUF A;  4YFK A;  2IUC B;  4LRC A;  4OIO A;  3H3V L;  3A8K A;  2NVY A;  4Y7N K;  5EGH A;  3BP8 C;  4BLB A;  5LRM A;  1DCP A;  3TG0 A;  1WCM K;  1Y1W C;  4OIQ A;  4XSX A;  2R7Z C;  1WSV A;  1ALH A;  3S17 K;  4LLG A;  3GTL C;  4PAB A;  1ZXO A;  1AJA A;  4XLN A;  5M5W K;  1ELZ A;  4GTF A;  3S16 K;  1O2F B;  4AYB L;  2RH6 A;  3KD8 A;  3T00 A;  1EQJ A;  3VA7 A;  1ELY A;  5EGE A;  2JA6 C;  1N2L A;  4XCH A;  2VUM C;  3M7V A;  1ED9 A;  3AQO A;  1USM A;  1R9T A;  4BY7 K;  4LRA A;  2NVY K;  4G7O A;  1VJE A;  4N7T A;  2JA7 A;  4WIL A;  4AH6 A;  5C44 K;  4LOW A;  2E2J K;  4KN4 A;  1ED8 A;  3L4J A;  2D6F C;  1IS1 A;  4KMA A;  1TWF C;  1TWH C;  1TWG C;  4BXX K;  3DPC A;  1IQ0 A;  5IOQ A;  2JH3 A;  3S1Q K;  1AJB A;  4UPK A;  3HOX C;  3S1M K;  5D4D A;  4C3I C;  5IYC C;  1ALK A;  2CFA B;  2JA5 C;  2PA8 D;  4A3F C;  3S1R C;  4LRB A;  5IOT A;  5C4X C;  3GEI A;  3GTP A;  3S2H C;  1R9T K;  3S15 K;  4KJD A;  2XCQ A;  1AUK A;  1KHL A;  4MHX A;  3A8J A;  4UPI A;  5IJQ A;  3LPX A;  2ZFZ A;  2JA7 K;  4X6A K;  1JQW A;  2KWA A;  3M3Y C;  3JST A;  4QJV A;  3S14 C;  2V6S A;  4LK1 A;  3WBH A;  4OIP A;  2W7V A;  3MK1 A;  2B63 K;  4A3G K;  3S2D C;  1KQ4 A;  4RMF A;  1EW8 A;  4KM9 A;  4TN0 A;  4UOP A;  2A6H A;  1I50 A;  3HOU K;  1SFO A;  2R92 A;  4BKW A;  5C4J C;  3GTP K;  4MIV A;  1Y1V C;  3RZO C;  1USO A;  1N2K A;  4LRD A;  3K7A K;  2Y3P A;  1I6H K;  4CYR A;  1IBA A;  1EFW A;  4BY1 C;  3HOY K;  1XXA A;  1VH2 A;  4FDJ A;  4NOI A;  1K83 A;  4Y52 C;  3TFJ A;  3HOZ C;  2E2H A;  3RZD C;  4KN7 A;  4A3B C;  1HDH A;  4A3M C;  2W5R A;  1I6V A;  4M1X A;  3EQL A;  3GTM A;  1E1Z P;  1I50 K;  1Y7A A;  1SFO K;  3I4M C;  4ZG7 A;  2R92 K;  2PPB A;  4A3E K;  4KAW X;  2V6U A;  5IP9 C;  1X31 C;  3BP3 A;  4KB2 A;  3G4C A;  3S1N K;  4WJ3 M;  1ZEB A;  4UOO A;  1O99 A;  2W5V A;  1BS2 A;  1KH7 A;  1XXB A;  4CXU A;  4A3C K;  2R93 C;  3GTK A;  4KMH A;  5IYB C;  5DLV A;  1BDF A;  2E2H K;  1ZVU A;  3G4A A;  3HKZ L;  3GTQ A;  1Y1W A;  4MY4 A;  1YX2 A;  2R7Z A;  5IP7 C;  3GTM K;  2GSN A;  4LR2 A;  1SHQ A;  1BGW A;  4BBR K;  2NVT K;  1I3Q C;  4O2D A;  3PO2 K;  4Q5S A;  2A6E A;  3UN5 A;  1DCO A;  4BBS C;  1C0A A;  2Y0S D;  2JA6 A;  5KXA A;  1HQM A;  4A3K K;  4QIW L;  3CQZ C;  1O2B A;  4YG2 A;  2VUM A;  4KAY A;  3AD9 C;  3E2D A;  3GTK K;  3HOW C;  3H0G C;  3NVL A;  3GTJ C;  4C3H K;  2PMZ L;  3WAY A;  1IE0 A;  4KJG A;  1Y1W K;  3GTQ K;  2R7Z K;  1TWC C;  1EH1 A;  1KH5 A;  3M8W A;  3PO3 K;  5INH A;  1TWF A;  3GTO A;  5GRR A;  1TWG A;  5M3M K;  4BLA A;  2W8S A;  4A3D C;  1O25 A;  5LRN A;  1ISE A;  2E2I C;  3I4N C;  2JA5 A;  1ALI A;  2JA6 K;  2D1G A;  2VUM K;  4CXS A;  4ZH4 A;  4ILD A;  3WOD A;  3NKQ A;  4GTL A;  4G0V A;  3HKZ D;  4FDI A;  4P5B A;  4OIN A;  3TFI A;  2YU9 C;  2NVQ C;  1J6X A;  5CHP A;  2B63 A;  1TWF K;  3GTO K;  4A3I K;  1TWG K;  1XPP A;  3GEE A;  3M8Z A;  1KH9 A;  4J3N A;  4LJZ A;  4PAA A;  5IYD K;  3AD8 C;  3OPF A;  4C3I K;  5IYC K;  2JA5 K;  4A3F K;  4CYS A;  3S1R K;  5DLW A;  1ZED A;  2NVY C;  5C4X K;  3H3V D;  4KAV A;  1SMY A;  5L46 A;  3S2H K;  1ZEF A;  4QAX A;  1Y1V A;  4KC6 A;  3FKI C;  4LR9 A;  3BDG A;  3M3Y K;  1O26 A;  1XZQ A;  1EI6 A;  3A52 A;  3LAP A;  3QX3 A;  2XCO A;  2GAH C;  4KM4 A;  4GZY A;  2GAG C;  5LIA A;  4AYB D;  5FLM C;  4GTZ A;  1XZP B;  3S2D K;  1DCH A;  1V5V A;  3TWZ A;  1B4B A;  1ZQ1 C;  3NKR A;  1WIH A;  4NWJ A;  1B8J A;  3OEP A;  4NWX A;  5IOS A;  2V6T A;  5C4J K;  2JA8 C;  4A93 K;  1Y1V K;  2JA7 C;  4XSZ A;  3NKO A;  5IOR A;  3T01 A;  3IGY B;  3AD7 C;  1VGX A;  4GFQ A;  2WAQ L;  4LQY A;  4P5A A;  4BY1 K;  3UN3 A;  1TWA A;  2R93 A;  3HOV C;  4Y52 K;  3IDD A;  3RZD K;  2IUC A;  4A3B K;  1J98 A;  3NUH A;  3HOU C;  3N0C A;  3LXQ A;  4C3J C;  5TJ3 A;  3UNY A;  3V4G A;  2W5X A;  5IP9 K; 
#chains in the Genus database with same CATH homology
 3OT9 A;  1ED9 A;  5KXA A;  4KAY A;  4LRA A;  3IGZ B;  3E2D A;  3SZZ A;  3NVL A;  4N7T A;  3WAY A;  3WAW A;  4KJG A;  2XRG A;  1ED8 A;  5DLT A;  1KHN A;  1KH5 A;  3M8W A;  4GTW A;  2W5S A;  3DPC A;  3MK2 A;  4ZG6 A;  2GSU A;  5INH A;  1AJB A;  1EJJ A;  4UPK A;  5GRR A;  1ALK A;  2W8S A;  2W5T A;  4LRB A;  2GA3 A;  2W5Q A;  5LRN A;  1O98 A;  4LR7 A;  4LR8 A;  1ALI A;  2X98 A;  4KJD A;  2D1G A;  5LQQ A;  4CXS A;  1AUK A;  1KHL A;  4MHX A;  3NKQ A;  4UPI A;  5IJQ A;  3MK0 A;  2W5W A;  1E2S P;  4FDI A;  3UN2 A;  1Y6V A;  5C66 A;  3WBH A;  2G9Y A;  1EW9 A;  3MK1 A;  1URB A;  2GSO A;  1ELX A;  1EW8 A;  3M7V A;  3WAX A;  1KHJ A;  4TN0 A;  3UO0 A;  4UOP A;  1FSU A;  3M8Z A;  3TX0 A;  1KH9 A;  3NKP A;  4CXK A;  3Q3Q A;  4LRE A;  1P49 A;  3BDG B;  4B56 A;  4MIV A;  4CYS A;  5DLW A;  4ZG9 A;  1HQA A;  1AJD A;  1ZED A;  2ANH A;  4KAV A;  3T02 A;  3CMR A;  1ZEF A;  4QAX A;  1N2K A;  4LRD A;  3ED4 A;  1AJC A;  1HJK A;  3M8Y A;  4LR9 A;  4CYR A;  3BDG A;  5HRT A;  4FDJ A;  2W8D A;  1KH4 A;  3A52 A;  1EI6 A;  2ZKT A;  5L0B A;  5GOV A;  2VQR A;  4GTY A;  4KM4 A;  1KHK A;  3BDH A;  5AJ9 A;  5LIA A;  4GTZ A;  2GLQ A;  1HDH A;  2W5R A;  4ZG7 A;  1E1Z P;  5K4P A;  1SHN A;  1Y7A A;  3TWZ A;  3DYC A;  4GTX A;  4LRF A;  3NKR A;  5IJS A;  4NWJ A;  1B8J A;  1K7H A;  4NWX A;  1ALJ A;  1ZEB A;  4YR1 A;  4UOO A;  4UPH A;  2IFY A;  1O99 A;  3NKO A;  2W5V A;  2IUC B;  4LRC A;  1EW2 A;  1E33 P;  3T01 A;  1KH7 A;  5L0E A;  3IGY B;  4CXU A;  5EGH A;  3BDF A;  4LQY A;  4UPL A;  5DLV A;  3SZY A;  5LRM A;  3WAV A;  3TG0 A;  3UN3 A;  3NKN A;  1ALH A;  1E3C P;  3IDD A;  5L0K A;  2IUC A;  3B5Q A;  4UOR A;  4MY4 A;  2QZU A;  1ANJ A;  2GSN A;  3NKM A;  2XR9 A;  4LR2 A;  1ANI A;  1AJA A;  4ZGA A;  1SHQ A;  1ELZ A;  1URA A;  2RH6 A;  3LXQ A;  3KD8 A;  3T00 A;  5TJ3 A;  1EQJ A;  3UNY A;  1ELY A;  5EGE A;  1N2L A;  3UN5 A;  2W5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...