3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 127
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
3OT9A 4FDIA 1N2KA 1Y6VA 3DYCA 3TWZA 1SHQA 1AJAA 4ZG7A 1AUKA 3T02A 1ELYA 1ANIA 1URAA 5DLVA 2ANHA 2ZKTA 1HQAA 1ALIA 4FDJA 5HRTA 1SHNA 4QAXA 5L0EA 1EQJA 1FSUA 4LR2A 4UPHA 4ZG9A 3SZZA 5DLWA 3BDFA 3CMRA 5LRMA 3IGYB 2VQRA 1AJCA 5TJ3A 1AJBA 5L0BA 1KHKA 1EW9A 2W5SA 4UOPA 2W5RA 3NKRA 3DPCA 3T00A 3M8YA 1ALKA 5LRNA 4UPKA 4LREA 1ALJA 1ED9A 1B8JA 4N7TA 3NKNA 1N2LA 2IUCB 1EJJA 3NKMA 3NKQA 3ED4A 4KAYA 5DLTA 4CYRA 4GTXA 1KHLA 4UPLA 1EW2A 3UN3A 2GLQA 2IFYA 3UNYA 3UN2A 1KHJA 1ED8A 4LR9A 3UN5A 3BDGA 1HDHA 2XRGA 3WAYA 4UORA 4CXUA 1HJKA 4KAVA 3M8ZA 2GSNA 2W5VA 2QZUA 1O98A 1EI6A 1O99A 1KH9A 3WBHA 3A52A 1K7HA 4GTZA 4TN0A 3TX0A 2GA3A 5L0KA 2GSOA 4KM4A 5GOVA 3LXQA 3Q3QA 4LRAA 5EGEA 4LRDA 2IUCA 5LQQA 1URBA 4GTYA 2W5QA 3BDGB 3NVLA 4YR1A 4ZG6A 1ELZA 1ZEFA 5K4PA 4B56A 5GRRA 4UPIA 3SZYA 4LR7A 2G9YA 4UOOA 1E33P 4MHXA 3MK0A 2X98A 5INHA 2D1GA 4GTWA 1E1ZP 1Y7AA 2RH6A 3E2DA 4LRBA 1KHNA 2W5TA 2W8DA 1ANJA 4KJDA 3UO0A 5C66A 1ELXA 3MK1A 1ZEDA 2GSUA 1P49A 3NKPA 4MY4A 3KD8A 2W5XA 4CXKA 2XR9A 4NWXA 4ZGAA 3MK2A 4LRCA 3BDHA 3M7VA 1KH7A 5KXAA 3T01A 5EGHA 3IDDA 5AJ9A 2W8SA 3M8WA 4LRFA 4CXSA 4LR8A 4NWJA 2W5WA 5IJQA 1EW8A 3WAXA 4MIVA 1E3CP 1KH4A 3B5QA 3WAWA 3WAVA 1ALHA 4LQYA 3TG0A 5IJSA 1AJDA 3NKOA 4CYSA 3IGZB 5LIAA 1E2SP 4KJGA 1KH5A 1ZEBA
chains in the Genus database with same CATH superfamily
1BGWA 4C3IC 3GTLC 2R7ZK 2E2HK 1SHQA 1BS2A 3NUHA 2JA8C 1AUKA 2B63K 1ELYA 3L4KA 1R9TC 5DLVA 1J6XA 4ILDA 2ZKTA 3A8IA 4X6AC 4BY7K 2B63A 2WB1D 3AD8C 1SHNA 1EQJA 4QAXA 3FOFA 3HOZK 3GTMK 1FSUA 2WAQL 4LR2A 1L0WA 3TTGA 3GTGK 5IOTA 2E2JK 3I4MC 3BDFA 1ZQ1C 1O29A 3S2DK 1AJCA 1TWFK 2XCQA 2CFAA 5L0BA 1WOOA 1BJTA 5IP9K 3S17K 5C4XC 3RZOC 2E2HA 3TFJA 2W5RA 3T00A 3M8YA 4G7HA 3S1MC 5LRNA 4UPKA 1ED9A 3HXAA 1B8JA 4C3JC 4AYBD 1I6HC 1XZPA 5FJ8K 5C4JK 3GTPC 1EJJA 4A3CC 1DD5A 5DLTA 5IP9C 1J6VA 4OIRA 1TWCK 2V6SA 2JA6K 2XRGA 5CHPA 3GDZA 4CXUA 2E2JC 3I4MK 1SMYA 4A3DC 1HJKA 1JQWA 2QZUA 1EI6A 1I3QA 3L4JA 2NVTK 4GTDA 4KMHA 4GTZA 3TX0A 1YX2A 2GA3A 5C44K 3H3VD 5EGEA 4LRDA 2JA8K 2E2HC 3JSTA 2JH3A 3BP8C 4O2DA 3HOVC 1PJ6A 3HOXC 1ELZA 1XZQA 4A3DK 1I50A 5TMFA 4UOOA 4MHXA 4BLBA 1C0AA 4XSZA 5FLMK 1EQRA 4KC6A 1ANJA 3UO0A 3MK1A 1UV7A 4A3MC 1JOEA 1O27A 2RGRA 3NKPA 3H3VL 4WJ4A 3TFHA 3I4NK 1WQHA 2NVXC 1F9NA 1R9TA 3H0GK 4CXKA 1K83A 2YU9A 1EK8A 3BDHA 3M7VA 4KATA 1I50C 5C4XK 3S17C 2WB1L 3IDDA 3GTOC 1PJ5A 4LRFA 4LR8A 1ZXOA 2O5JA 1TWFC 2P5MA 1VGXA 3MMLB 3WAWA 1TWHK 1ALHA 1B4AA 1AJDA 5IYDC 2R92C 2Y0SD 1TWCC 1WOSA 2P8TA 2NVXA 3HKZL 4KJGA 1VH2A 3FKIC 4A3BC 1XZQB 1DCOA 5C4JC 3GTPK 3TWZA 2PA8L 1WCMK 4A3JK 3S1RC 1USOA 4A3EK 3GTLK 1XXCA 4ZG7A 2GAHC 4A3FC 1HQAA 2R93C 2NVQK 2XCRB 1TWGA 3RZOK 4WILA 1J6WA 3GTMA 1AB4A 3S16C 5DLWA 4MQ9A 2ZUEA 3LAPA 5LRMA 3IGYB 2VQRA 4LLGA 1AJBA 3BUEA 4Y7NK 4Y52K 2NVXK 3AQPA 1KHKA 4PABA 4UOPA 3M4OC 3S2HK 3CQZA 4GZYA 1WQGA 1O2AA 3K7AK 3ERED 2W7VA 3CAGA 1I3QK 3AQOA 4YG2A 5C3EC 2B63C 3S2DC 4WJ3M 3FKIA 4M1XA 4A3GK 1N2LA 2IUCB 4KMDA 3HOXK 4KAYA 2A69A 4GTXA 2XCOA 1KHLA 1HI9A 1YNNA 3AD7C 4KDDA 3GTQC 3HOWK 2JA6C 2IFYA 3RZDC 3UN3A 3N0CA 5C3EK 3UN2A 3UN5A 2E2IA 4BLAA 3BDGA 1O26A 5C44C 3WAYA 1Y1WA 3FHZA 1WQFA 4QIWD 2NVTC 3M4OK 1WSVA 2GSNA 3S2HC 3PO3C 3S15C 3A52A 3V4GA 4TN0A 5M3MK 2GSOA 4BXXK 2IUCA 3S1RK 4A3JC 3NVLA 4GTAA 4YR1A 4ZG6A 1WIHA 4KAWX 5K4PA 2JA6A 4B56A 1F7VA 3GEIA 4P5BA 3PO2C 3GEHA 3MK0A 4FM9A 1E1ZP 1SFOC 3E2DA 3GTGC 4LK0A 1YNJA 4KJDA 1ELXA 2GSUA 5IP7C 1Y1VA 4C3HC 5D4DA 3HOZC 4J3NA 1TWHC 3CQZC 3PO2K 3KD8A 2W5XA 3GTOK 4G7ZA 1ISEA 3GTJC 2YU9K 4RMFA 5JFEA 2XR9A 4A3IC 4NWXA 1I50K 3GEEA 3HKZD 4NOIA 3T01A 5IORA 5AJ9A 2W8SA 1IE0A 3GTJA 4NWJA 1YCLA 5IJQA 1X31C 4MIVA 1IW7A 2VUMK 1E3CP 1TWGC 2JA7K 1TWHA 3G4CA 3A8KA 3OREA 2FQOA 2JA5C 2R93A 4CYSA 4GTCA 1F93A 3IGZB 5LIAA 3H0GC 4YFKA 2R93K 1E2SP 3BP3A 1KH5A 1ZEBA 1WORA 5L46A 1ZYRA 3S1MK 3OT9A 4FDIA 1N2KA 1Y6VA 3DYCA 1O2FB 3OPFA 1AJAA 3T02A 3OEPA 4GTWA 3GTJK 1B4BA 2VUMC 5IOQA 5IOSA 3A8JA 4UPHA 3SZZA 1EFWA 4GTFA 3M3YC 4DDQA 5TJ3A 4BY7C 3HOUK 5M5XK 2E2IC 3GTKA 3K7AC 3GTQA 1K83C 4BKWA 4G0VA 2JA7A 1GE9A 3DPCA 3DXJA 4C45A 1V5VA 4N7TA 3S1QC 3QX3A 5IYCK 3GIRA 3NKNA 1IS1A 4A3MK 3NKMA 4QJVA 4CYRA 1J98A 1K83K 1G51A 4UPLA 2NVYC 2R7ZA 1INNA 3LAJA 1KQ4A 1VJEA 3HOUC 1KHJA 1ED8A 3UNYA 4LR9A 4C3JK 1HDHA 5M5WK 3GTQK 2O5IA 2VUMA 4MEYA 4KAVA 3M8ZA 3GTMC 2W5VA 3S14K 4A93K 1KH9A 5M3FK 3WBHA 4BBRC 5L0KA 4BY1K 4KM4A 5GOVA 3TFIA 4LRAA 3H0GA 3RZDK 5LQQA 1URBA 2Y0SL 4A3LC 3BDGB 2FQTA 2V6UA 4AYBL 1ZEFA 4Q5SA 4UPIA 1O25A 2CW0A 3SZYA 4LR7A 4FZBA 1E33P 5INHA 3HOYK 2D1GA 1Y7AA 2A6EA 2W5TA 2W8DA 4GTLA 2PMZL 4G0UA 5C66A 1ZEDA 4LK1A 5FLMC 1VRQC 1P49A 1DCPA 4MY4A 4OIPA 4C3IK 4KMAA 4G0WA 5JVOA 3VA7A 1PJ7A 3GTOA 4QJVB 3S15K 4LRCA 4A3LK 1HQMA 3S16K 4ZH4A 5EGHA 4A3IK 4KN7A 2E2IK 2D6FC 2PMZD 5IYBC 3CQZK 4C2MK 1KH4A 2A68A 3WAVA 3LPXA 3TG0A 3NKOA 1WCMC 4A3GC 4A3KC 1TWAK 4XLNA 3FKIK 1BDFA 4BBRK 2NVYK 1TWAA 1XPPA 5TMCA 3ADAC 3AD9C 4A3KK 2NVYA 2R7ZC 1I6HK 1ANIA 1URAA 1IL2A 2ANHA 3S1NK 1O24A 4P9SA 1ALIA 1Y1WC 4FDJA 5IYBK 4QIWL 5HRTA 3N3YA 1Y1VC 5L0EA 4KARA 1USMA 1XXBA 4ZG9A 4YFNA 1TWGK 2Y3PA 1ZVUA 2JA7C 3S1QK 3CMRA 2A6HA 2NVQC 1IBAA 4BXXC 3M3YK 2PPBA 3I4NC 2EBBA 4PAAA 4MEXA 3GTKC 1EW9A 2W5SA 4AH6A 1WSRA 4KN4A 3GTPA 3AH5A 3NKRA 1ALKA 4LREA 1ALJA 2PHCB 3N0BA 4YFXA 3HOYC 1TWAC 5IP7K 3NKQA 3ED4A 1WOPA 4GTBA 3EQLA 1SFOK 2PA8D 4KASA 1EW2A 2GLQA 1WCMA 2WAQD 1I3QC 1IQ0A 4LOWA 4X6AK 4BY1C 4OIQA 4UORA 5CJ9A 1VLOA 4A3CK 3S14C 4A93C 1O98A 3WODA 5IYCC 1I6VA 1O99A 2JA5A 1K7HA 2BE5A 3S1NC 4Y52C 4Y7NC 4A3FK 3LXQA 4LJZA 3Q3QA 4KB4A 4BBSK 4GTYA 1ZBSA 2W5QA 3FOEA 1JVIA 5GRRA 3GTLA 1F7UA 2G9YA 4XLPA 4KM9A 4GFQA 2X98A 4KM8A 3S0XA 2GAGC 4JK1A 2R92K 2ZFZA 5IYDK 3HOWC 5M5YK 2RH6A 4GT9A 4C3HK 1KHNA 1EH1A 4LRBA 5E68A 3HOVK 4A3EC 2KWAA 1XXAA 2ZUFA 3GSIA 4A3BK 2YU9C 3GTGA 1SFOA 1R9TK 4ZGAA 3MK2A 4BBSC 4GTEA 1KH7A 5KXAA 1O2BA 4G7OA 3GTKK 1Y1WK 3M8WA 4CXSA 4C2MC 4OIOA 1TWCA 1EW8A 2W5WA 2V6TA 4OINA 3WAXA 2R92A 5HL8A 3B5QA 3PO3K 4LQYA 2JA5K 4KMUA 3IPJA 5IJSA 1DCHA 4XSXA 3G4AA 1XZPB 1Y1VK 1O28A 1TWFA 1RU0A 4XCHA 4P5AA 4Q4ZA 4KB2A 2CFAB
chains in the Genus database with same CATH topology
3OT9A 4FDIA 1N2KA 1Y6VA 3DYCA 3TWZA 1SHQA 1AJAA 4ZG7A 1AUKA 3T02A 1ELYA 1ANIA 1URAA 5DLVA 2ANHA 2ZKTA 1HQAA 1ALIA 4FDJA 5HRTA 1SHNA 4QAXA 5L0EA 1EQJA 1FSUA 4LR2A 4UPHA 4ZG9A 3SZZA 5DLWA 3BDFA 3CMRA 5LRMA 3IGYB 2VQRA 1AJCA 5TJ3A 1AJBA 5L0BA 1KHKA 1EW9A 2W5SA 4UOPA 2W5RA 3NKRA 3DPCA 3T00A 3M8YA 1ALKA 5LRNA 4UPKA 4LREA 1ALJA 1ED9A 1B8JA 4N7TA 3NKNA 1N2LA 2IUCB 1EJJA 3NKMA 3NKQA 3ED4A 4KAYA 5DLTA 4CYRA 4GTXA 1KHLA 4UPLA 1EW2A 3UN3A 2GLQA 2IFYA 3UNYA 3UN2A 1KHJA 1ED8A 4LR9A 3UN5A 3BDGA 1HDHA 2XRGA 3WAYA 4UORA 4CXUA 1HJKA 4KAVA 3M8ZA 2GSNA 2W5VA 2QZUA 1O98A 1EI6A 1O99A 1KH9A 3WBHA 3A52A 1K7HA 4GTZA 4TN0A 3TX0A 2GA3A 5L0KA 2GSOA 4KM4A 5GOVA 3LXQA 3Q3QA 4LRAA 5EGEA 4LRDA 2IUCA 5LQQA 1URBA 4GTYA 2W5QA 3BDGB 3NVLA 4YR1A 4ZG6A 1ELZA 1ZEFA 5K4PA 4B56A 5GRRA 4UPIA 3SZYA 4LR7A 2G9YA 4UOOA 1E33P 4MHXA 3MK0A 2X98A 5INHA 2D1GA 4GTWA 1E1ZP 1Y7AA 2RH6A 3E2DA 4LRBA 1KHNA 2W5TA 2W8DA 1ANJA 4KJDA 3UO0A 5C66A 1ELXA 3MK1A 1ZEDA 2GSUA 1P49A 3NKPA 4MY4A 3KD8A 2W5XA 4CXKA 2XR9A 4NWXA 4ZGAA 3MK2A 4LRCA 3BDHA 3M7VA 1KH7A 5KXAA 3T01A 5EGHA 3IDDA 5AJ9A 2W8SA 3M8WA 4LRFA 4CXSA 4LR8A 4NWJA 2W5WA 5IJQA 1EW8A 3WAXA 4MIVA 1E3CP 1KH4A 3B5QA 3WAWA 3WAVA 1ALHA 4LQYA 3TG0A 5IJSA 1AJDA 3NKOA 4CYSA 3IGZB 5LIAA 1E2SP 4KJGA 1KH5A 1ZEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT9 A;  4FDI A;  1N2K A;  1Y6V A;  3DYC A;  3TWZ A;  1SHQ A;  1AJA A;  4ZG7 A;  1AUK A;  3T02 A;  1ELY A;  1ANI A;  1URA A;  5DLV A;  2ANH A;  2ZKT A;  1HQA A;  1ALI A;  4FDJ A;  5HRT A;  1SHN A;  4QAX A;  5L0E A;  1EQJ A;  1FSU A;  4LR2 A;  4UPH A;  4ZG9 A;  3SZZ A;  5DLW A;  3BDF A;  3CMR A;  5LRM A;  3IGY B;  2VQR A;  1AJC A;  5TJ3 A;  1AJB A;  5L0B A;  1KHK A;  1EW9 A;  2W5S A;  4UOP A;  2W5R A;  3NKR A;  3DPC A;  3T00 A;  3M8Y A;  1ALK A;  5LRN A;  4UPK A;  4LRE A;  1ALJ A;  1ED9 A;  1B8J A;  4N7T A;  3NKN A;  1N2L A;  2IUC B;  1EJJ A;  3NKM A;  3NKQ A;  3ED4 A;  4KAY A;  5DLT A;  4CYR A;  4GTX A;  1KHL A;  4UPL A;  1EW2 A;  3UN3 A;  2GLQ A;  2IFY A;  3UNY A;  3UN2 A;  1KHJ A;  1ED8 A;  4LR9 A;  3UN5 A;  3BDG A;  1HDH A;  2XRG A;  3WAY A;  4UOR A;  4CXU A;  1HJK A;  4KAV A;  3M8Z A;  2GSN A;  2W5V A;  2QZU A;  1O98 A;  1EI6 A;  1O99 A;  1KH9 A;  3WBH A;  3A52 A;  1K7H A;  4GTZ A;  4TN0 A;  3TX0 A;  2GA3 A;  5L0K A;  2GSO A;  4KM4 A;  5GOV A;  3LXQ A;  3Q3Q A;  4LRA A;  5EGE A;  4LRD A;  2IUC A;  5LQQ A;  1URB A;  4GTY A;  2W5Q A;  3BDG B;  3NVL A;  4YR1 A;  4ZG6 A;  1ELZ A;  1ZEF A;  5K4P A;  4B56 A;  5GRR A;  4UPI A;  3SZY A;  4LR7 A;  2G9Y A;  4UOO A;  1E33 P;  4MHX A;  3MK0 A;  2X98 A;  5INH A;  2D1G A;  4GTW A;  1E1Z P;  1Y7A A;  2RH6 A;  3E2D A;  4LRB A;  1KHN A;  2W5T A;  2W8D A;  1ANJ A;  4KJD A;  3UO0 A;  5C66 A;  1ELX A;  3MK1 A;  1ZED A;  2GSU A;  1P49 A;  3NKP A;  4MY4 A;  3KD8 A;  2W5X A;  4CXK A;  2XR9 A;  4NWX A;  4ZGA A;  3MK2 A;  4LRC A;  3BDH A;  3M7V A;  1KH7 A;  5KXA A;  3T01 A;  5EGH A;  3IDD A;  5AJ9 A;  2W8S A;  3M8W A;  4LRF A;  4CXS A;  4LR8 A;  4NWJ A;  2W5W A;  5IJQ A;  1EW8 A;  3WAX A;  4MIV A;  1E3C P;  1KH4 A;  3B5Q A;  3WAW A;  3WAV A;  1ALH A;  4LQY A;  3TG0 A;  5IJS A;  1AJD A;  3NKO A;  4CYS A;  3IGZ B;  5LIA A;  1E2S P;  4KJG A;  1KH5 A;  1ZEB A; 
#chains in the Genus database with same CATH topology
 1BGW A;  4C3I C;  3GTL C;  2R7Z K;  2E2H K;  1SHQ A;  1BS2 A;  3NUH A;  2JA8 C;  1AUK A;  2B63 K;  1ELY A;  3L4K A;  1R9T C;  5DLV A;  1J6X A;  4ILD A;  2ZKT A;  3A8I A;  4X6A C;  4BY7 K;  2B63 A;  2WB1 D;  3AD8 C;  1SHN A;  1EQJ A;  4QAX A;  3FOF A;  3HOZ K;  3GTM K;  1FSU A;  2WAQ L;  4LR2 A;  1L0W A;  3TTG A;  3GTG K;  5IOT A;  2E2J K;  3I4M C;  3BDF A;  1ZQ1 C;  1O29 A;  3S2D K;  1AJC A;  1TWF K;  2XCQ A;  2CFA A;  5L0B A;  1WOO A;  1BJT A;  5IP9 K;  3S17 K;  5C4X C;  3RZO C;  2E2H A;  3TFJ A;  2W5R A;  3T00 A;  3M8Y A;  4G7H A;  3S1M C;  5LRN A;  4UPK A;  1ED9 A;  3HXA A;  1B8J A;  4C3J C;  4AYB D;  1I6H C;  1XZP A;  5FJ8 K;  5C4J K;  3GTP C;  1EJJ A;  4A3C C;  1DD5 A;  5DLT A;  5IP9 C;  1J6V A;  4OIR A;  1TWC K;  2V6S A;  2JA6 K;  2XRG A;  5CHP A;  3GDZ A;  4CXU A;  2E2J C;  3I4M K;  1SMY A;  4A3D C;  1HJK A;  1JQW A;  2QZU A;  1EI6 A;  1I3Q A;  3L4J A;  2NVT K;  4GTD A;  4KMH A;  4GTZ A;  3TX0 A;  1YX2 A;  2GA3 A;  5C44 K;  3H3V D;  5EGE A;  4LRD A;  2JA8 K;  2E2H C;  3JST A;  2JH3 A;  3BP8 C;  4O2D A;  3HOV C;  1PJ6 A;  3HOX C;  1ELZ A;  1XZQ A;  4A3D K;  1I50 A;  5TMF A;  4UOO A;  4MHX A;  4BLB A;  1C0A A;  4XSZ A;  5FLM K;  1EQR A;  4KC6 A;  1ANJ A;  3UO0 A;  3MK1 A;  1UV7 A;  4A3M C;  1JOE A;  1O27 A;  2RGR A;  3NKP A;  3H3V L;  4WJ4 A;  3TFH A;  3I4N K;  1WQH A;  2NVX C;  1F9N A;  1R9T A;  3H0G K;  4CXK A;  1K83 A;  2YU9 A;  1EK8 A;  3BDH A;  3M7V A;  4KAT A;  1I50 C;  5C4X K;  3S17 C;  2WB1 L;  3IDD A;  3GTO C;  1PJ5 A;  4LRF A;  4LR8 A;  1ZXO A;  2O5J A;  1TWF C;  2P5M A;  1VGX A;  3MML B;  3WAW A;  1TWH K;  1ALH A;  1B4A A;  1AJD A;  5IYD C;  2R92 C;  2Y0S D;  1TWC C;  1WOS A;  2P8T A;  2NVX A;  3HKZ L;  4KJG A;  1VH2 A;  3FKI C;  4A3B C;  1XZQ B;  1DCO A;  5C4J C;  3GTP K;  3TWZ A;  2PA8 L;  1WCM K;  4A3J K;  3S1R C;  1USO A;  4A3E K;  3GTL K;  1XXC A;  4ZG7 A;  2GAH C;  4A3F C;  1HQA A;  2R93 C;  2NVQ K;  2XCR B;  1TWG A;  3RZO K;  4WIL A;  1J6W A;  3GTM A;  1AB4 A;  3S16 C;  5DLW A;  4MQ9 A;  2ZUE A;  3LAP A;  5LRM A;  3IGY B;  2VQR A;  4LLG A;  1AJB A;  3BUE A;  4Y7N K;  4Y52 K;  2NVX K;  3AQP A;  1KHK A;  4PAB A;  4UOP A;  3M4O C;  3S2H K;  3CQZ A;  4GZY A;  1WQG A;  1O2A A;  3K7A K;  3ERE D;  2W7V A;  3CAG A;  1I3Q K;  3AQO A;  4YG2 A;  5C3E C;  2B63 C;  3S2D C;  4WJ3 M;  3FKI A;  4M1X A;  4A3G K;  1N2L A;  2IUC B;  4KMD A;  3HOX K;  4KAY A;  2A69 A;  4GTX A;  2XCO A;  1KHL A;  1HI9 A;  1YNN A;  3AD7 C;  4KDD A;  3GTQ C;  3HOW K;  2JA6 C;  2IFY A;  3RZD C;  3UN3 A;  3N0C A;  5C3E K;  3UN2 A;  3UN5 A;  2E2I A;  4BLA A;  3BDG A;  1O26 A;  5C44 C;  3WAY A;  1Y1W A;  3FHZ A;  1WQF A;  4QIW D;  2NVT C;  3M4O K;  1WSV A;  2GSN A;  3S2H C;  3PO3 C;  3S15 C;  3A52 A;  3V4G A;  4TN0 A;  5M3M K;  2GSO A;  4BXX K;  2IUC A;  3S1R K;  4A3J C;  3NVL A;  4GTA A;  4YR1 A;  4ZG6 A;  1WIH A;  4KAW X;  5K4P A;  2JA6 A;  4B56 A;  1F7V A;  3GEI A;  4P5B A;  3PO2 C;  3GEH A;  3MK0 A;  4FM9 A;  1E1Z P;  1SFO C;  3E2D A;  3GTG C;  4LK0 A;  1YNJ A;  4KJD A;  1ELX A;  2GSU A;  5IP7 C;  1Y1V A;  4C3H C;  5D4D A;  3HOZ C;  4J3N A;  1TWH C;  3CQZ C;  3PO2 K;  3KD8 A;  2W5X A;  3GTO K;  4G7Z A;  1ISE A;  3GTJ C;  2YU9 K;  4RMF A;  5JFE A;  2XR9 A;  4A3I C;  4NWX A;  1I50 K;  3GEE A;  3HKZ D;  4NOI A;  3T01 A;  5IOR A;  5AJ9 A;  2W8S A;  1IE0 A;  3GTJ A;  4NWJ A;  1YCL A;  5IJQ A;  1X31 C;  4MIV A;  1IW7 A;  2VUM K;  1E3C P;  1TWG C;  2JA7 K;  1TWH A;  3G4C A;  3A8K A;  3ORE A;  2FQO A;  2JA5 C;  2R93 A;  4CYS A;  4GTC A;  1F93 A;  3IGZ B;  5LIA A;  3H0G C;  4YFK A;  2R93 K;  1E2S P;  3BP3 A;  1KH5 A;  1ZEB A;  1WOR A;  5L46 A;  1ZYR A;  3S1M K;  3OT9 A;  4FDI A;  1N2K A;  1Y6V A;  3DYC A;  1O2F B;  3OPF A;  1AJA A;  3T02 A;  3OEP A;  4GTW A;  3GTJ K;  1B4B A;  2VUM C;  5IOQ A;  5IOS A;  3A8J A;  4UPH A;  3SZZ A;  1EFW A;  4GTF A;  3M3Y C;  4DDQ A;  5TJ3 A;  4BY7 C;  3HOU K;  5M5X K;  2E2I C;  3GTK A;  3K7A C;  3GTQ A;  1K83 C;  4BKW A;  4G0V A;  2JA7 A;  1GE9 A;  3DPC A;  3DXJ A;  4C45 A;  1V5V A;  4N7T A;  3S1Q C;  3QX3 A;  5IYC K;  3GIR A;  3NKN A;  1IS1 A;  4A3M K;  3NKM A;  4QJV A;  4CYR A;  1J98 A;  1K83 K;  1G51 A;  4UPL A;  2NVY C;  2R7Z A;  1INN A;  3LAJ A;  1KQ4 A;  1VJE A;  3HOU C;  1KHJ A;  1ED8 A;  3UNY A;  4LR9 A;  4C3J K;  1HDH A;  5M5W K;  3GTQ K;  2O5I A;  2VUM A;  4MEY A;  4KAV A;  3M8Z A;  3GTM C;  2W5V A;  3S14 K;  4A93 K;  1KH9 A;  5M3F K;  3WBH A;  4BBR C;  5L0K A;  4BY1 K;  4KM4 A;  5GOV A;  3TFI A;  4LRA A;  3H0G A;  3RZD K;  5LQQ A;  1URB A;  2Y0S L;  4A3L C;  3BDG B;  2FQT A;  2V6U A;  4AYB L;  1ZEF A;  4Q5S A;  4UPI A;  1O25 A;  2CW0 A;  3SZY A;  4LR7 A;  4FZB A;  1E33 P;  5INH A;  3HOY K;  2D1G A;  1Y7A A;  2A6E A;  2W5T A;  2W8D A;  4GTL A;  2PMZ L;  4G0U A;  5C66 A;  1ZED A;  4LK1 A;  5FLM C;  1VRQ C;  1P49 A;  1DCP A;  4MY4 A;  4OIP A;  4C3I K;  4KMA A;  4G0W A;  5JVO A;  3VA7 A;  1PJ7 A;  3GTO A;  4QJV B;  3S15 K;  4LRC A;  4A3L K;  1HQM A;  3S16 K;  4ZH4 A;  5EGH A;  4A3I K;  4KN7 A;  2E2I K;  2D6F C;  2PMZ D;  5IYB C;  3CQZ K;  4C2M K;  1KH4 A;  2A68 A;  3WAV A;  3LPX A;  3TG0 A;  3NKO A;  1WCM C;  4A3G C;  4A3K C;  1TWA K;  4XLN A;  3FKI K;  1BDF A;  4BBR K;  2NVY K;  1TWA A;  1XPP A;  5TMC A;  3ADA C;  3AD9 C;  4A3K K;  2NVY A;  2R7Z C;  1I6H K;  1ANI A;  1URA A;  1IL2 A;  2ANH A;  3S1N K;  1O24 A;  4P9S A;  1ALI A;  1Y1W C;  4FDJ A;  5IYB K;  4QIW L;  5HRT A;  3N3Y A;  1Y1V C;  5L0E A;  4KAR A;  1USM A;  1XXB A;  4ZG9 A;  4YFN A;  1TWG K;  2Y3P A;  1ZVU A;  2JA7 C;  3S1Q K;  3CMR A;  2A6H A;  2NVQ C;  1IBA A;  4BXX C;  3M3Y K;  2PPB A;  3I4N C;  2EBB A;  4PAA A;  4MEX A;  3GTK C;  1EW9 A;  2W5S A;  4AH6 A;  1WSR A;  4KN4 A;  3GTP A;  3AH5 A;  3NKR A;  1ALK A;  4LRE A;  1ALJ A;  2PHC B;  3N0B A;  4YFX A;  3HOY C;  1TWA C;  5IP7 K;  3NKQ A;  3ED4 A;  1WOP A;  4GTB A;  3EQL A;  1SFO K;  2PA8 D;  4KAS A;  1EW2 A;  2GLQ A;  1WCM A;  2WAQ D;  1I3Q C;  1IQ0 A;  4LOW A;  4X6A K;  4BY1 C;  4OIQ A;  4UOR A;  5CJ9 A;  1VLO A;  4A3C K;  3S14 C;  4A93 C;  1O98 A;  3WOD A;  5IYC C;  1I6V A;  1O99 A;  2JA5 A;  1K7H A;  2BE5 A;  3S1N C;  4Y52 C;  4Y7N C;  4A3F K;  3LXQ A;  4LJZ A;  3Q3Q A;  4KB4 A;  4BBS K;  4GTY A;  1ZBS A;  2W5Q A;  3FOE A;  1JVI A;  5GRR A;  3GTL A;  1F7U A;  2G9Y A;  4XLP A;  4KM9 A;  4GFQ A;  2X98 A;  4KM8 A;  3S0X A;  2GAG C;  4JK1 A;  2R92 K;  2ZFZ A;  5IYD K;  3HOW C;  5M5Y K;  2RH6 A;  4GT9 A;  4C3H K;  1KHN A;  1EH1 A;  4LRB A;  5E68 A;  3HOV K;  4A3E C;  2KWA A;  1XXA A;  2ZUF A;  3GSI A;  4A3B K;  2YU9 C;  3GTG A;  1SFO A;  1R9T K;  4ZGA A;  3MK2 A;  4BBS C;  4GTE A;  1KH7 A;  5KXA A;  1O2B A;  4G7O A;  3GTK K;  1Y1W K;  3M8W A;  4CXS A;  4C2M C;  4OIO A;  1TWC A;  1EW8 A;  2W5W A;  2V6T A;  4OIN A;  3WAX A;  2R92 A;  5HL8 A;  3B5Q A;  3PO3 K;  4LQY A;  2JA5 K;  4KMU A;  3IPJ A;  5IJS A;  1DCH A;  4XSX A;  3G4A A;  1XZP B;  1Y1V K;  1O28 A;  1TWF A;  1RU0 A;  4XCH A;  4P5A A;  4Q4Z A;  4KB2 A;  2CFA B; 
#chains in the Genus database with same CATH homology
 3OT9 A;  4FDI A;  1N2K A;  1Y6V A;  3DYC A;  3TWZ A;  1SHQ A;  1AJA A;  4ZG7 A;  1AUK A;  3T02 A;  1ELY A;  1ANI A;  1URA A;  5DLV A;  2ANH A;  2ZKT A;  1HQA A;  1ALI A;  4FDJ A;  5HRT A;  1SHN A;  4QAX A;  5L0E A;  1EQJ A;  1FSU A;  4LR2 A;  4UPH A;  4ZG9 A;  3SZZ A;  5DLW A;  3BDF A;  3CMR A;  5LRM A;  3IGY B;  2VQR A;  1AJC A;  5TJ3 A;  1AJB A;  5L0B A;  1KHK A;  1EW9 A;  2W5S A;  4UOP A;  2W5R A;  3NKR A;  3DPC A;  3T00 A;  3M8Y A;  1ALK A;  5LRN A;  4UPK A;  4LRE A;  1ALJ A;  1ED9 A;  1B8J A;  4N7T A;  3NKN A;  1N2L A;  2IUC B;  1EJJ A;  3NKM A;  3NKQ A;  3ED4 A;  4KAY A;  5DLT A;  4CYR A;  4GTX A;  1KHL A;  4UPL A;  1EW2 A;  3UN3 A;  2GLQ A;  2IFY A;  3UNY A;  3UN2 A;  1KHJ A;  1ED8 A;  4LR9 A;  3UN5 A;  3BDG A;  1HDH A;  2XRG A;  3WAY A;  4UOR A;  4CXU A;  1HJK A;  4KAV A;  3M8Z A;  2GSN A;  2W5V A;  2QZU A;  1O98 A;  1EI6 A;  1O99 A;  1KH9 A;  3WBH A;  3A52 A;  1K7H A;  4GTZ A;  4TN0 A;  3TX0 A;  2GA3 A;  5L0K A;  2GSO A;  4KM4 A;  5GOV A;  3LXQ A;  3Q3Q A;  4LRA A;  5EGE A;  4LRD A;  2IUC A;  5LQQ A;  1URB A;  4GTY A;  2W5Q A;  3BDG B;  3NVL A;  4YR1 A;  4ZG6 A;  1ELZ A;  1ZEF A;  5K4P A;  4B56 A;  5GRR A;  4UPI A;  3SZY A;  4LR7 A;  2G9Y A;  4UOO A;  1E33 P;  4MHX A;  3MK0 A;  2X98 A;  5INH A;  2D1G A;  4GTW A;  1E1Z P;  1Y7A A;  2RH6 A;  3E2D A;  4LRB A;  1KHN A;  2W5T A;  2W8D A;  1ANJ A;  4KJD A;  3UO0 A;  5C66 A;  1ELX A;  3MK1 A;  1ZED A;  2GSU A;  1P49 A;  3NKP A;  4MY4 A;  3KD8 A;  2W5X A;  4CXK A;  2XR9 A;  4NWX A;  4ZGA A;  3MK2 A;  4LRC A;  3BDH A;  3M7V A;  1KH7 A;  5KXA A;  3T01 A;  5EGH A;  3IDD A;  5AJ9 A;  2W8S A;  3M8W A;  4LRF A;  4CXS A;  4LR8 A;  4NWJ A;  2W5W A;  5IJQ A;  1EW8 A;  3WAX A;  4MIV A;  1E3C P;  1KH4 A;  3B5Q A;  3WAW A;  3WAV A;  1ALH A;  4LQY A;  3TG0 A;  5IJS A;  1AJD A;  3NKO A;  4CYS A;  3IGZ B;  5LIA A;  1E2S P;  4KJG A;  1KH5 A;  1ZEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...