3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 127
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
1AJCA 3WAYA 4KAYA 1KH9A 3BDGA 3UNYA 1ELYA 1ZEBA 3B5QA 3BDHA 4KJGA 3E2DA 3M8ZA 5IJQA 4NWJA 4KM4A 1ALKA 2W5WA 3NVLA 5L0EA 4TN0A 4CXUA 3UO0A 1KHNA 4GTZA 3DYCA 3T02A 1ZEDA 3A52A 2W5SA 1SHNA 4N7TA 2GA3A 3LXQA 4LRCA 4UPKA 5TJ3A 3IGZB 1ALJA 1ANJA 2IUCA 5HRTA 3M7VA 2W5QA 4CXKA 4GTWA 2G9YA 3MK2A 5EGEA 1ANIA 1KHLA 3BDGB 3NKOA 1KHKA 3DPCA 1Y6VA 3UN3A 2X98A 2GSOA 1P49A 1FSUA 3OT9A 4LR7A 3WAXA 5IJSA 4MIVA 2RH6A 5LIAA 4QAXA 5L0KA 4FDIA 3WAVA 4LRFA 3ED4A 4UORA 2GSNA 3CMRA 2IFYA 1EI6A 2QZUA 3Q3QA 2IUCB 4FDJA 4KJDA 4LRBA 1KH4A 3WBHA 4KAVA 4UPHA 1B8JA 1O99A 2ZKTA 1HDHA 4CYRA 1SHQA 4LQYA 1ALIA 4LRDA 5KXAA 1AJAA 5EGHA 1E2SP 3SZZA 5GOVA 2ANHA 4UOPA 2XRGA 3NKMA 3WAWA 3M8YA 4ZG6A 4LR2A 4LR9A 2W5VA 3NKQA 4UOOA 3M8WA 3IGYB 1AJDA 2W5RA 3UN2A 4UPIA 2XR9A 4ZG7A 1KH7A 5K4PA 4GTXA 4YR1A 1E3CP 5GRRA 4LR8A 3TG0A 1EW9A 2GLQA 4MHXA 1E1ZP 4B56A 5L0BA 3TWZA 3T01A 1K7HA 3IDDA 3NKPA 1ED9A 1ED8A 2GSUA 5DLWA 4ZG9A 3TX0A 3SZYA 2W8DA 2W8SA 3MK0A 3NKNA 4LREA 4NWXA 1EJJA 1URBA 1HQAA 4GTYA 1ALHA 4MY4A 1AJBA 1ELXA 1EQJA 5LQQA 1HJKA 5INHA 5LRMA 5AJ9A 5DLTA 3NKRA 3MK1A 1ELZA 1N2KA 1Y7AA 4CXSA 1N2LA 4LRAA 4ZGAA 1E33P 2D1GA 1ZEFA 1AUKA 1EW8A 4UPLA 1EW2A 5DLVA 5LRNA 2W5TA 3KD8A 2W5XA 2VQRA 1O98A 3T00A 4CYSA 1KH5A 3BDFA 5C66A 3UN5A 1KHJA 1URAA
chains in the Genus database with same CATH superfamily
4LK1A 4QIWD 3G4CA 1L0WA 4KAYA 1KH9A 3BDGA 1ELYA 3I4MC 2R7ZA 3B5QA 1O2AA 3FHZA 4KJGA 3E2DA 5IJQA 2JH3A 4NWJA 1YCLA 1ALKA 2W5WA 2YU9K 3GTOC 3S1MK 3DYCA 3T02A 4BY1C 3GTPA 3K7AK 1R9TA 3TFJA 5C3EK 2JA7K 2JA6K 2W5SA 4M1XA 4KB4A 1TWHK 3LXQA 1WSVA 1ANJA 5M5WK 2BE5A 4FM9A 1O2BA 3HOUC 3H3VD 3NKOA 3BUEA 4A3FK 1BDFA 3DPCA 2RGRA 1BGWA 3N0CA 3UN3A 1J6XA 2GSOA 4GTEA 3OT9A 3WAXA 5IJSA 4KDDA 2RH6A 3FOEA 4QAXA 5M3MK 5M5XK 1JQWA 3H0GK 2IUCB 4ILDA 4KAVA 1BS2A 1TWGA 4KATA 2YU9C 1HDHA 4A3CK 1SHQA 1V5VA 3S1MC 1VRQC 3K7AC 3SZZA 5C4JK 5GOVA 4UOPA 4G7OA 5C3EC 3NKMA 2JA7C 2JA6C 4GFQA 1TWHC 5IP7K 2ZFZA 3M8YA 1SFOK 3RZDK 4A3LC 5M3FK 4GTAA 3CQZA 3JSTA 3S17K 4XLPA 3S2DK 3M8WA 3UN2A 4UPIA 3HOVK 2A68A 4GZYA 1B4BA 4ZG7A 1VLOA 4BBRK 3LAPA 4XLNA 5GRRA 2A69A 4A3KK 1TWCK 1TWAA 4BY7K 2GLQA 4KB2A 3TWZA 5CHPA 5C44C 4OIQA 3H0GC 2CW0A 4A3MK 1O28A 1Y1WK 4GTFA 1WQGA 5L46A 4ZG9A 3TX0A 2GAHC 3SZYA 4OIRA 1PJ6A 3GTJK 3S14K 4LREA 5C4JC 1EJJA 4WJ4A 2D6FC 2V6UA 3A8KA 2PPBA 5IP7C 5D4DA 4PABA 1EQJA 1F9NA 1I50K 5INHA 3GDZA 5CJ9A 1SFOC 3RZDC 3NKRA 1K83K 4X6AK 5FJ8K 1ELZA 5IYDK 3S17C 1Y7AA 3S2DC 3GIRA 1I3QK 4KAWX 1N2LA 4ZGAA 3HOVC 2D1GA 4KMUA 3PO3K 4BBRC 3N3YA 2R7ZK 1EW8A 5LRNA 2W5TA 3KD8A 4A3KC 2W5XA 2B63K 4ZH4A 3M3YK 4Q4ZA 4CYSA 3HXAA 1KH5A 3ERED 2WAQD 1GE9A 4A3MC 1Y1WC 1R9TK 3I4MK 3WAYA 1YNNA 1EK8A 1INNA 2R93K 3UNYA 3GTOK 4C3IK 1YNJA 3M8ZA 2FQOA 4KM4A 1WOOA 3NVLA 4TN0A 4CXUA 3FKIA 1KHNA 1I50C 3GTLC 5FLMK 1K83C 3OEPA 4C45A 4N7TA 3HOUK 1HQMA 2O5JA 4RMFA 5TJ3A 2E2HK 5IYDC 2JA5A 4FZBA 2IUCA 3IGZB 2WB1D 1IQ0A 1I3QC 4GTWA 1ANIA 3RZOK 1KHLA 1KHKA 3PO3C 2R7ZC 2VUMK 4G0UA 2B63C 4A93K 2X98A 3M3YC 1FSUA 3S1QK 3GTPC 1WIHA 5LIAA 1R9TC 3WAVA 1IW7A 4LLGA 1ZBSA 2R93C 1XPPA 4C3IC 3A8IA 4FDJA 4YFKA 4LRBA 2R92A 3BP8C 1DCHA 4LQYA 1O26A 5KXAA 2KWAA 2CFAB 2PHCB 4MQ9A 1E2SP 4AH6A 5FLMC 5TMCA 2NVYK 4A3LK 1ZVUA 2PA8L 1WCMA 2E2HC 4ZG6A 3S1NK 3GTQA 1F93A 4LR2A 2FQTA 1WOPA 3RZOC 2W5VA 1USMA 3NKQA 2A6HA 4Q5SA 4KMDA 2VUMC 3IGYB 4A93C 1AJDA 1IBAA 2XCQA 3S1QC 4GTXA 4YR1A 4MEYA 1O27A 1E3CP 1Y1VK 3ADAC 4LR8A 1AB4A 4P5AA 3AD8C 5C44K 1F7VA 3TG0A 4B56A 1IL2A 2V6TA 3GTMA 1I6VA 3HOYK 3TTGA 5IOSA 1WQFA 1TWFK 3BP3A 3S15K 1J6WA 2E2JK 3NKNA 3M4OC 2PA8D 3HOWK 1DCPA 2NVYC 4GTDA 5C4XC 4MY4A 3GTGA 1ELXA 2P8TA 3S1NC 1HJKA 1ZQ1C 3AH5A 2NVXA 5DLTA 2E2IK 3MK1A 1N2KA 4LRAA 1XXCA 1E33P 4QJVB 3NUHA 3HOXK 1Y1VC 5IYBK 4A3DC 2VQRA 2YU9A 4KASA 3FKIK 4JK1A 2WAQL 5JVOA 2XCOA 3S0XA 3UN5A 3HOYC 4KC6A 1AJCA 1TWFC 1KQ4A 1TWHA 2JA5K 3S15C 1JVIA 2E2JC 3BDHA 4PAAA 5M5YK 3GTLK 3HOWC 5L0EA 1O24A 3WODA 1I6HK 3A8JA 2ZUFA 1WORA 4GTCA 2XCRB 3A52A 1SHNA 5IP9K 2E2IC 2GA3A 4UPKA 5HRTA 1XXAA 2WB1L 3GEEA 3PO2K 2W5QA 1VGXA 2G9YA 3MK2A 4Y7NK 3H0GA 3HOXC 2CFAA 5IYBC 4AYBL 3GTKA 4BLAA 3GTPK 1Y6VA 1USOA 2V6SA 3FKIC 4BXXK 4LR7A 4A3EK 4J3NA 5L0KA 4KMAA 2Y0SL 1JOEA 4FDIA 1IE0A 4LRFA 3ED4A 4KN7A 3I4NK 1WSRA 5TMFA 1PJ7A 2A6EA 2JA5C 1WCMK 2IFYA 1EI6A 3Q3QA 2QZUA 4KJDA 1SFOA 1C0AA 1KH4A 3WBHA 2O5IA 4UPHA 4YFNA 4P5BA 1B8JA 1O99A 1I6HC 4LRDA 1AJAA 3MMLB 2ANHA 2XRGA 5IP9C 3WAWA 3PO2C 1TWCA 5IORA 3EQLA 3L4KA 1TWGK 1WQHA 4AYBD 4Y7NC 4LR9A 3GTMK 3CAGA 2JA8K 1Y1WA 3TFIA 4UOOA 1XZPB 1F7UA 1IS1A 2XR9A 2Y0SD 4OIOA 4XSZA 2EBBA 4BXXC 3GTJA 4A3EC 1KH7A 5K4PA 3OPFA 4C3HK 3I4NC 1XZQA 3CQZK 4O2DA 3GTGK 1WCMC 1J98A 4WILA 3T01A 1K7HA 1I50A 4LK0A 3GTQC 3IDDA 2NVQK 1ED9A 2NVXK 1ED8A 2GSUA 5E68A 1EFWA 3M4OK 1X31C 5C4XK 2W8DA 4QJVA 4A3BK 1I3QA 2NVTK 1HQAA 1TWAK 3G4AA 4WJ3M 1ALHA 1AJBA 5LQQA 2B63A 5LRMA 4Y52K 3S1RK 1TWGC 1VH2A 4C3JC 3GTMC 2JA8C 3L4JA 2PMZL 3LPXA 4CXSA 4A3DK 2R93A 4GTBA 4C2MK 3GTOA 1AUKA 4UPLA 1EW2A 1ZXOA 3FOFA 1O25A 5HL8A 4C3HC 1O98A 5IYCK 2P5MA 3V4GA 3CQZC 3GSIA 3N0BA 3GTGC 3BDFA 5C66A 1RU0A 1URAA 2NVQC 5IOTA 2NVXC 3S2HK 4G7HA 1EH1A 2E2HA 4OINA 4A3BC 1ZEBA 2NVTC 3HKZL 4NOIA 1TWAC 3AD9C 5JFEA 3UO0A 4GTZA 1XZQB 3GTKK 2VUMA 4A3GK 1ZEDA 4Y52C 4LOWA 3TFHA 3S1RC 2PMZD 1B4AA 4BBSK 2ZUEA 4LRCA 4A3IK 1ALJA 3M7VA 1DD5A 4CXKA 5EGEA 4C2MC 3BDGB 3LAJA 5IYCC 1P49A 2JA7A 2JA6A 4A3FC 1ISEA 4G7ZA 4MIVA 3AQPA 2NVYA 4UORA 2GSNA 3S2HC 3GEIA 3HKZD 3CMRA 1XZPA 4G0WA 2ZKTA 4MEXA 4CYRA 1ALIA 3GTKC 4OIPA 4A3GC 5EGHA 1BJTA 1O2FB 1EQRA 4A3CC 2Y3PA 4GT9A 4BBSC 3DXJA 1Y1VA 4A3IC 1HI9A 1WOSA 3OREA 1ZYRA 2R92K 4KN4A 1VJEA 1TWFA 5IOQA 2W5RA 4KM9A 4A3JK 4KMHA 4XCHA 3S16K 2W7VA 4KM8A 1O29A 3GTQK 1XXBA 1EW9A 3GEHA 3HOZK 4MHXA 1E1ZP 5L0BA 4P9SA 3QX3A 1TWCC 1YX2A 4BY7C 3NKPA 4YG2A 2E2IA 5DLWA 4GTLA 4QIWL 2W8SA 4BLBA 3VA7A 3MK0A 4NWXA 1DCOA 1URBA 2GAGC 4LJZA 4GTYA 3GTJC 3S14C 4C3JK 4KARA 1G51A 4BY1K 1PJ5A 1UV7A 5AJ9A 4DDQA 2R92C 4X6AC 4A3JC 3S16C 3IPJA 4YFXA 1ZEFA 3AD7C 5DLVA 3AQOA 4BKWA 3H3VL 3GTLA 1SMYA 4G0VA 3HOZC 1K83A 3T00A 1J6VA 1KHJA 4XSXA
chains in the Genus database with same CATH topology
1AJCA 3WAYA 4KAYA 1KH9A 3BDGA 3UNYA 1ELYA 1ZEBA 3B5QA 3BDHA 4KJGA 3E2DA 3M8ZA 5IJQA 4NWJA 4KM4A 1ALKA 2W5WA 3NVLA 5L0EA 4TN0A 4CXUA 3UO0A 1KHNA 4GTZA 3DYCA 3T02A 1ZEDA 3A52A 2W5SA 1SHNA 4N7TA 2GA3A 3LXQA 4LRCA 4UPKA 5TJ3A 3IGZB 1ALJA 1ANJA 2IUCA 5HRTA 3M7VA 2W5QA 4CXKA 4GTWA 2G9YA 3MK2A 5EGEA 1ANIA 1KHLA 3BDGB 3NKOA 1KHKA 3DPCA 1Y6VA 3UN3A 2X98A 2GSOA 1P49A 1FSUA 3OT9A 4LR7A 3WAXA 5IJSA 4MIVA 2RH6A 5LIAA 4QAXA 5L0KA 4FDIA 3WAVA 4LRFA 3ED4A 4UORA 2GSNA 3CMRA 2IFYA 1EI6A 2QZUA 3Q3QA 2IUCB 4FDJA 4KJDA 4LRBA 1KH4A 3WBHA 4KAVA 4UPHA 1B8JA 1O99A 2ZKTA 1HDHA 4CYRA 1SHQA 4LQYA 1ALIA 4LRDA 5KXAA 1AJAA 5EGHA 1E2SP 3SZZA 5GOVA 2ANHA 4UOPA 2XRGA 3NKMA 3WAWA 3M8YA 4ZG6A 4LR2A 4LR9A 2W5VA 3NKQA 4UOOA 3M8WA 3IGYB 1AJDA 2W5RA 3UN2A 4UPIA 2XR9A 4ZG7A 1KH7A 5K4PA 4GTXA 4YR1A 1E3CP 5GRRA 4LR8A 3TG0A 1EW9A 2GLQA 4MHXA 1E1ZP 4B56A 5L0BA 3TWZA 3T01A 1K7HA 3IDDA 3NKPA 1ED9A 1ED8A 2GSUA 5DLWA 4ZG9A 3TX0A 3SZYA 2W8DA 2W8SA 3MK0A 3NKNA 4LREA 4NWXA 1EJJA 1URBA 1HQAA 4GTYA 1ALHA 4MY4A 1AJBA 1ELXA 1EQJA 5LQQA 1HJKA 5INHA 5LRMA 5AJ9A 5DLTA 3NKRA 3MK1A 1ELZA 1N2KA 1Y7AA 4CXSA 1N2LA 4LRAA 4ZGAA 1E33P 2D1GA 1ZEFA 1AUKA 1EW8A 4UPLA 1EW2A 5DLVA 5LRNA 2W5TA 3KD8A 2W5XA 2VQRA 1O98A 3T00A 4CYSA 1KH5A 3BDFA 5C66A 3UN5A 1KHJA 1URAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJC A;  3WAY A;  4KAY A;  1KH9 A;  3BDG A;  3UNY A;  1ELY A;  1ZEB A;  3B5Q A;  3BDH A;  4KJG A;  3E2D A;  3M8Z A;  5IJQ A;  4NWJ A;  4KM4 A;  1ALK A;  2W5W A;  3NVL A;  5L0E A;  4TN0 A;  4CXU A;  3UO0 A;  1KHN A;  4GTZ A;  3DYC A;  3T02 A;  1ZED A;  3A52 A;  2W5S A;  1SHN A;  4N7T A;  2GA3 A;  3LXQ A;  4LRC A;  4UPK A;  5TJ3 A;  3IGZ B;  1ALJ A;  1ANJ A;  2IUC A;  5HRT A;  3M7V A;  2W5Q A;  4CXK A;  4GTW A;  2G9Y A;  3MK2 A;  5EGE A;  1ANI A;  1KHL A;  3BDG B;  3NKO A;  1KHK A;  3DPC A;  1Y6V A;  3UN3 A;  2X98 A;  2GSO A;  1P49 A;  1FSU A;  3OT9 A;  4LR7 A;  3WAX A;  5IJS A;  4MIV A;  2RH6 A;  5LIA A;  4QAX A;  5L0K A;  4FDI A;  3WAV A;  4LRF A;  3ED4 A;  4UOR A;  2GSN A;  3CMR A;  2IFY A;  1EI6 A;  2QZU A;  3Q3Q A;  2IUC B;  4FDJ A;  4KJD A;  4LRB A;  1KH4 A;  3WBH A;  4KAV A;  4UPH A;  1B8J A;  1O99 A;  2ZKT A;  1HDH A;  4CYR A;  1SHQ A;  4LQY A;  1ALI A;  4LRD A;  5KXA A;  1AJA A;  5EGH A;  1E2S P;  3SZZ A;  5GOV A;  2ANH A;  4UOP A;  2XRG A;  3NKM A;  3WAW A;  3M8Y A;  4ZG6 A;  4LR2 A;  4LR9 A;  2W5V A;  3NKQ A;  4UOO A;  3M8W A;  3IGY B;  1AJD A;  2W5R A;  3UN2 A;  4UPI A;  2XR9 A;  4ZG7 A;  1KH7 A;  5K4P A;  4GTX A;  4YR1 A;  1E3C P;  5GRR A;  4LR8 A;  3TG0 A;  1EW9 A;  2GLQ A;  4MHX A;  1E1Z P;  4B56 A;  5L0B A;  3TWZ A;  3T01 A;  1K7H A;  3IDD A;  3NKP A;  1ED9 A;  1ED8 A;  2GSU A;  5DLW A;  4ZG9 A;  3TX0 A;  3SZY A;  2W8D A;  2W8S A;  3MK0 A;  3NKN A;  4LRE A;  4NWX A;  1EJJ A;  1URB A;  1HQA A;  4GTY A;  1ALH A;  4MY4 A;  1AJB A;  1ELX A;  1EQJ A;  5LQQ A;  1HJK A;  5INH A;  5LRM A;  5AJ9 A;  5DLT A;  3NKR A;  3MK1 A;  1ELZ A;  1N2K A;  1Y7A A;  4CXS A;  1N2L A;  4LRA A;  4ZGA A;  1E33 P;  2D1G A;  1ZEF A;  1AUK A;  1EW8 A;  4UPL A;  1EW2 A;  5DLV A;  5LRN A;  2W5T A;  3KD8 A;  2W5X A;  2VQR A;  1O98 A;  3T00 A;  4CYS A;  1KH5 A;  3BDF A;  5C66 A;  3UN5 A;  1KHJ A;  1URA A; 
#chains in the Genus database with same CATH topology
 4LK1 A;  4QIW D;  3G4C A;  1L0W A;  4KAY A;  1KH9 A;  3BDG A;  1ELY A;  3I4M C;  2R7Z A;  3B5Q A;  1O2A A;  3FHZ A;  4KJG A;  3E2D A;  5IJQ A;  2JH3 A;  4NWJ A;  1YCL A;  1ALK A;  2W5W A;  2YU9 K;  3GTO C;  3S1M K;  3DYC A;  3T02 A;  4BY1 C;  3GTP A;  3K7A K;  1R9T A;  3TFJ A;  5C3E K;  2JA7 K;  2JA6 K;  2W5S A;  4M1X A;  4KB4 A;  1TWH K;  3LXQ A;  1WSV A;  1ANJ A;  5M5W K;  2BE5 A;  4FM9 A;  1O2B A;  3HOU C;  3H3V D;  3NKO A;  3BUE A;  4A3F K;  1BDF A;  3DPC A;  2RGR A;  1BGW A;  3N0C A;  3UN3 A;  1J6X A;  2GSO A;  4GTE A;  3OT9 A;  3WAX A;  5IJS A;  4KDD A;  2RH6 A;  3FOE A;  4QAX A;  5M3M K;  5M5X K;  1JQW A;  3H0G K;  2IUC B;  4ILD A;  4KAV A;  1BS2 A;  1TWG A;  4KAT A;  2YU9 C;  1HDH A;  4A3C K;  1SHQ A;  1V5V A;  3S1M C;  1VRQ C;  3K7A C;  3SZZ A;  5C4J K;  5GOV A;  4UOP A;  4G7O A;  5C3E C;  3NKM A;  2JA7 C;  2JA6 C;  4GFQ A;  1TWH C;  5IP7 K;  2ZFZ A;  3M8Y A;  1SFO K;  3RZD K;  4A3L C;  5M3F K;  4GTA A;  3CQZ A;  3JST A;  3S17 K;  4XLP A;  3S2D K;  3M8W A;  3UN2 A;  4UPI A;  3HOV K;  2A68 A;  4GZY A;  1B4B A;  4ZG7 A;  1VLO A;  4BBR K;  3LAP A;  4XLN A;  5GRR A;  2A69 A;  4A3K K;  1TWC K;  1TWA A;  4BY7 K;  2GLQ A;  4KB2 A;  3TWZ A;  5CHP A;  5C44 C;  4OIQ A;  3H0G C;  2CW0 A;  4A3M K;  1O28 A;  1Y1W K;  4GTF A;  1WQG A;  5L46 A;  4ZG9 A;  3TX0 A;  2GAH C;  3SZY A;  4OIR A;  1PJ6 A;  3GTJ K;  3S14 K;  4LRE A;  5C4J C;  1EJJ A;  4WJ4 A;  2D6F C;  2V6U A;  3A8K A;  2PPB A;  5IP7 C;  5D4D A;  4PAB A;  1EQJ A;  1F9N A;  1I50 K;  5INH A;  3GDZ A;  5CJ9 A;  1SFO C;  3RZD C;  3NKR A;  1K83 K;  4X6A K;  5FJ8 K;  1ELZ A;  5IYD K;  3S17 C;  1Y7A A;  3S2D C;  3GIR A;  1I3Q K;  4KAW X;  1N2L A;  4ZGA A;  3HOV C;  2D1G A;  4KMU A;  3PO3 K;  4BBR C;  3N3Y A;  2R7Z K;  1EW8 A;  5LRN A;  2W5T A;  3KD8 A;  4A3K C;  2W5X A;  2B63 K;  4ZH4 A;  3M3Y K;  4Q4Z A;  4CYS A;  3HXA A;  1KH5 A;  3ERE D;  2WAQ D;  1GE9 A;  4A3M C;  1Y1W C;  1R9T K;  3I4M K;  3WAY A;  1YNN A;  1EK8 A;  1INN A;  2R93 K;  3UNY A;  3GTO K;  4C3I K;  1YNJ A;  3M8Z A;  2FQO A;  4KM4 A;  1WOO A;  3NVL A;  4TN0 A;  4CXU A;  3FKI A;  1KHN A;  1I50 C;  3GTL C;  5FLM K;  1K83 C;  3OEP A;  4C45 A;  4N7T A;  3HOU K;  1HQM A;  2O5J A;  4RMF A;  5TJ3 A;  2E2H K;  5IYD C;  2JA5 A;  4FZB A;  2IUC A;  3IGZ B;  2WB1 D;  1IQ0 A;  1I3Q C;  4GTW A;  1ANI A;  3RZO K;  1KHL A;  1KHK A;  3PO3 C;  2R7Z C;  2VUM K;  4G0U A;  2B63 C;  4A93 K;  2X98 A;  3M3Y C;  1FSU A;  3S1Q K;  3GTP C;  1WIH A;  5LIA A;  1R9T C;  3WAV A;  1IW7 A;  4LLG A;  1ZBS A;  2R93 C;  1XPP A;  4C3I C;  3A8I A;  4FDJ A;  4YFK A;  4LRB A;  2R92 A;  3BP8 C;  1DCH A;  4LQY A;  1O26 A;  5KXA A;  2KWA A;  2CFA B;  2PHC B;  4MQ9 A;  1E2S P;  4AH6 A;  5FLM C;  5TMC A;  2NVY K;  4A3L K;  1ZVU A;  2PA8 L;  1WCM A;  2E2H C;  4ZG6 A;  3S1N K;  3GTQ A;  1F93 A;  4LR2 A;  2FQT A;  1WOP A;  3RZO C;  2W5V A;  1USM A;  3NKQ A;  2A6H A;  4Q5S A;  4KMD A;  2VUM C;  3IGY B;  4A93 C;  1AJD A;  1IBA A;  2XCQ A;  3S1Q C;  4GTX A;  4YR1 A;  4MEY A;  1O27 A;  1E3C P;  1Y1V K;  3ADA C;  4LR8 A;  1AB4 A;  4P5A A;  3AD8 C;  5C44 K;  1F7V A;  3TG0 A;  4B56 A;  1IL2 A;  2V6T A;  3GTM A;  1I6V A;  3HOY K;  3TTG A;  5IOS A;  1WQF A;  1TWF K;  3BP3 A;  3S15 K;  1J6W A;  2E2J K;  3NKN A;  3M4O C;  2PA8 D;  3HOW K;  1DCP A;  2NVY C;  4GTD A;  5C4X C;  4MY4 A;  3GTG A;  1ELX A;  2P8T A;  3S1N C;  1HJK A;  1ZQ1 C;  3AH5 A;  2NVX A;  5DLT A;  2E2I K;  3MK1 A;  1N2K A;  4LRA A;  1XXC A;  1E33 P;  4QJV B;  3NUH A;  3HOX K;  1Y1V C;  5IYB K;  4A3D C;  2VQR A;  2YU9 A;  4KAS A;  3FKI K;  4JK1 A;  2WAQ L;  5JVO A;  2XCO A;  3S0X A;  3UN5 A;  3HOY C;  4KC6 A;  1AJC A;  1TWF C;  1KQ4 A;  1TWH A;  2JA5 K;  3S15 C;  1JVI A;  2E2J C;  3BDH A;  4PAA A;  5M5Y K;  3GTL K;  3HOW C;  5L0E A;  1O24 A;  3WOD A;  1I6H K;  3A8J A;  2ZUF A;  1WOR A;  4GTC A;  2XCR B;  3A52 A;  1SHN A;  5IP9 K;  2E2I C;  2GA3 A;  4UPK A;  5HRT A;  1XXA A;  2WB1 L;  3GEE A;  3PO2 K;  2W5Q A;  1VGX A;  2G9Y A;  3MK2 A;  4Y7N K;  3H0G A;  3HOX C;  2CFA A;  5IYB C;  4AYB L;  3GTK A;  4BLA A;  3GTP K;  1Y6V A;  1USO A;  2V6S A;  3FKI C;  4BXX K;  4LR7 A;  4A3E K;  4J3N A;  5L0K A;  4KMA A;  2Y0S L;  1JOE A;  4FDI A;  1IE0 A;  4LRF A;  3ED4 A;  4KN7 A;  3I4N K;  1WSR A;  5TMF A;  1PJ7 A;  2A6E A;  2JA5 C;  1WCM K;  2IFY A;  1EI6 A;  3Q3Q A;  2QZU A;  4KJD A;  1SFO A;  1C0A A;  1KH4 A;  3WBH A;  2O5I A;  4UPH A;  4YFN A;  4P5B A;  1B8J A;  1O99 A;  1I6H C;  4LRD A;  1AJA A;  3MML B;  2ANH A;  2XRG A;  5IP9 C;  3WAW A;  3PO2 C;  1TWC A;  5IOR A;  3EQL A;  3L4K A;  1TWG K;  1WQH A;  4AYB D;  4Y7N C;  4LR9 A;  3GTM K;  3CAG A;  2JA8 K;  1Y1W A;  3TFI A;  4UOO A;  1XZP B;  1F7U A;  1IS1 A;  2XR9 A;  2Y0S D;  4OIO A;  4XSZ A;  2EBB A;  4BXX C;  3GTJ A;  4A3E C;  1KH7 A;  5K4P A;  3OPF A;  4C3H K;  3I4N C;  1XZQ A;  3CQZ K;  4O2D A;  3GTG K;  1WCM C;  1J98 A;  4WIL A;  3T01 A;  1K7H A;  1I50 A;  4LK0 A;  3GTQ C;  3IDD A;  2NVQ K;  1ED9 A;  2NVX K;  1ED8 A;  2GSU A;  5E68 A;  1EFW A;  3M4O K;  1X31 C;  5C4X K;  2W8D A;  4QJV A;  4A3B K;  1I3Q A;  2NVT K;  1HQA A;  1TWA K;  3G4A A;  4WJ3 M;  1ALH A;  1AJB A;  5LQQ A;  2B63 A;  5LRM A;  4Y52 K;  3S1R K;  1TWG C;  1VH2 A;  4C3J C;  3GTM C;  2JA8 C;  3L4J A;  2PMZ L;  3LPX A;  4CXS A;  4A3D K;  2R93 A;  4GTB A;  4C2M K;  3GTO A;  1AUK A;  4UPL A;  1EW2 A;  1ZXO A;  3FOF A;  1O25 A;  5HL8 A;  4C3H C;  1O98 A;  5IYC K;  2P5M A;  3V4G A;  3CQZ C;  3GSI A;  3N0B A;  3GTG C;  3BDF A;  5C66 A;  1RU0 A;  1URA A;  2NVQ C;  5IOT A;  2NVX C;  3S2H K;  4G7H A;  1EH1 A;  2E2H A;  4OIN A;  4A3B C;  1ZEB A;  2NVT C;  3HKZ L;  4NOI A;  1TWA C;  3AD9 C;  5JFE A;  3UO0 A;  4GTZ A;  1XZQ B;  3GTK K;  2VUM A;  4A3G K;  1ZED A;  4Y52 C;  4LOW A;  3TFH A;  3S1R C;  2PMZ D;  1B4A A;  4BBS K;  2ZUE A;  4LRC A;  4A3I K;  1ALJ A;  3M7V A;  1DD5 A;  4CXK A;  5EGE A;  4C2M C;  3BDG B;  3LAJ A;  5IYC C;  1P49 A;  2JA7 A;  2JA6 A;  4A3F C;  1ISE A;  4G7Z A;  4MIV A;  3AQP A;  2NVY A;  4UOR A;  2GSN A;  3S2H C;  3GEI A;  3HKZ D;  3CMR A;  1XZP A;  4G0W A;  2ZKT A;  4MEX A;  4CYR A;  1ALI A;  3GTK C;  4OIP A;  4A3G C;  5EGH A;  1BJT A;  1O2F B;  1EQR A;  4A3C C;  2Y3P A;  4GT9 A;  4BBS C;  3DXJ A;  1Y1V A;  4A3I C;  1HI9 A;  1WOS A;  3ORE A;  1ZYR A;  2R92 K;  4KN4 A;  1VJE A;  1TWF A;  5IOQ A;  2W5R A;  4KM9 A;  4A3J K;  4KMH A;  4XCH A;  3S16 K;  2W7V A;  4KM8 A;  1O29 A;  3GTQ K;  1XXB A;  1EW9 A;  3GEH A;  3HOZ K;  4MHX A;  1E1Z P;  5L0B A;  4P9S A;  3QX3 A;  1TWC C;  1YX2 A;  4BY7 C;  3NKP A;  4YG2 A;  2E2I A;  5DLW A;  4GTL A;  4QIW L;  2W8S A;  4BLB A;  3VA7 A;  3MK0 A;  4NWX A;  1DCO A;  1URB A;  2GAG C;  4LJZ A;  4GTY A;  3GTJ C;  3S14 C;  4C3J K;  4KAR A;  1G51 A;  4BY1 K;  1PJ5 A;  1UV7 A;  5AJ9 A;  4DDQ A;  2R92 C;  4X6A C;  4A3J C;  3S16 C;  3IPJ A;  4YFX A;  1ZEF A;  3AD7 C;  5DLV A;  3AQO A;  4BKW A;  3H3V L;  3GTL A;  1SMY A;  4G0V A;  3HOZ C;  1K83 A;  3T00 A;  1J6V A;  1KHJ A;  4XSX A; 
#chains in the Genus database with same CATH homology
 1AJC A;  3WAY A;  4KAY A;  1KH9 A;  3BDG A;  3UNY A;  1ELY A;  1ZEB A;  3B5Q A;  3BDH A;  4KJG A;  3E2D A;  3M8Z A;  5IJQ A;  4NWJ A;  4KM4 A;  1ALK A;  2W5W A;  3NVL A;  5L0E A;  4TN0 A;  4CXU A;  3UO0 A;  1KHN A;  4GTZ A;  3DYC A;  3T02 A;  1ZED A;  3A52 A;  2W5S A;  1SHN A;  4N7T A;  2GA3 A;  3LXQ A;  4LRC A;  4UPK A;  5TJ3 A;  3IGZ B;  1ALJ A;  1ANJ A;  2IUC A;  5HRT A;  3M7V A;  2W5Q A;  4CXK A;  4GTW A;  2G9Y A;  3MK2 A;  5EGE A;  1ANI A;  1KHL A;  3BDG B;  3NKO A;  1KHK A;  3DPC A;  1Y6V A;  3UN3 A;  2X98 A;  2GSO A;  1P49 A;  1FSU A;  3OT9 A;  4LR7 A;  3WAX A;  5IJS A;  4MIV A;  2RH6 A;  5LIA A;  4QAX A;  5L0K A;  4FDI A;  3WAV A;  4LRF A;  3ED4 A;  4UOR A;  2GSN A;  3CMR A;  2IFY A;  1EI6 A;  2QZU A;  3Q3Q A;  2IUC B;  4FDJ A;  4KJD A;  4LRB A;  1KH4 A;  3WBH A;  4KAV A;  4UPH A;  1B8J A;  1O99 A;  2ZKT A;  1HDH A;  4CYR A;  1SHQ A;  4LQY A;  1ALI A;  4LRD A;  5KXA A;  1AJA A;  5EGH A;  1E2S P;  3SZZ A;  5GOV A;  2ANH A;  4UOP A;  2XRG A;  3NKM A;  3WAW A;  3M8Y A;  4ZG6 A;  4LR2 A;  4LR9 A;  2W5V A;  3NKQ A;  4UOO A;  3M8W A;  3IGY B;  1AJD A;  2W5R A;  3UN2 A;  4UPI A;  2XR9 A;  4ZG7 A;  1KH7 A;  5K4P A;  4GTX A;  4YR1 A;  1E3C P;  5GRR A;  4LR8 A;  3TG0 A;  1EW9 A;  2GLQ A;  4MHX A;  1E1Z P;  4B56 A;  5L0B A;  3TWZ A;  3T01 A;  1K7H A;  3IDD A;  3NKP A;  1ED9 A;  1ED8 A;  2GSU A;  5DLW A;  4ZG9 A;  3TX0 A;  3SZY A;  2W8D A;  2W8S A;  3MK0 A;  3NKN A;  4LRE A;  4NWX A;  1EJJ A;  1URB A;  1HQA A;  4GTY A;  1ALH A;  4MY4 A;  1AJB A;  1ELX A;  1EQJ A;  5LQQ A;  1HJK A;  5INH A;  5LRM A;  5AJ9 A;  5DLT A;  3NKR A;  3MK1 A;  1ELZ A;  1N2K A;  1Y7A A;  4CXS A;  1N2L A;  4LRA A;  4ZGA A;  1E33 P;  2D1G A;  1ZEF A;  1AUK A;  1EW8 A;  4UPL A;  1EW2 A;  5DLV A;  5LRN A;  2W5T A;  3KD8 A;  2W5X A;  2VQR A;  1O98 A;  3T00 A;  4CYS A;  1KH5 A;  3BDF A;  5C66 A;  3UN5 A;  1KHJ A;  1URA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...