5LRNA

Structure of mono-zinc mcr-1 in p21 space group
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
325
structure length
324
Chain Sequence
GPTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylethanolamine transferase Mcr-1
publication title Insights into the Mechanistic Basis of Plasmid-Mediated Colistin Resistance from Crystal Structures of the Catalytic Domain of MCR-1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 123
structure length 324
sequence length 325
chains with identical sequence B
ec nomenclature ec 2.7.-.-:
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 5lrnA00
1KHLA 5INHA 2RH6A 1KHNA 4FDIA 1URBA 2GLQA 4KJDA 2W5VA 3UO0A 1K7HA 1AJCA 1N2LA 1ZEDA 1ELZA 2XR9A 3BDGA 1Y7AA 1ZEBA 3NKQA 4GTYA 2XRGA 4LR7A 4LRBA 5AJ9A 3WAYA 5LIAA 1EJJA 4LRDA 2IUCB 5HRTA 3T02A 1EQJA 3TX0A 2ANHA 3NKRA 4UPLA 2W8DA 4MHXA 3IGZB 3A52A 4GTXA 2D1GA 1HJKA 1AJBA 3LXQA 1ELXA 5L0KA 1ALHA 1ALKA 4KM4A 2X98A 3M8YA 4LRFA 1KH4A 4NWXA 1URAA 1P49A 3DYCA 5K4PA 3OT9A 4LREA 5DLVA 1EW8A 1EW9A 5KXAA 1KH5A 3NKOA 4CYRA 3MK2A 3M8ZA 1ANIA 3BDFA 2QZUA 1SHNA 3NKNA 4LQYA 3SZYA 3WAXA 5LQQA 1O98A 4LRAA 1E33P 4N7TA 4ZG9A 4ZG7A 1ANJA 4UPKA 4CYSA 3UNYA 3DPCA 4LRCA 5TJ3A 2IFYA 2IUCA 1N2KA 3WAWA 1E1ZP 3NKPA 1ALJA 3NKMA 3MK1A 1E2SP 2GSUA 4UORA 5LRMA 4FDJA 3ED4A 3T01A 1EW2A 5IJSA 1ELYA 5EGHA 4KAVA 3UN5A 1EI6A 2W8SA 1E3CP 3IGYB 5LRNA 3WAVA 3IDDA 1HQAA 3TG0A 4YR1A 4KAYA 2W5TA 5DLTA 5C66A 2W5QA 3M8WA 4LR9A 4MIVA 4KJGA 3CMRA 1KHKA 1KH9A 5GRRA 4GTWA 1KHJA 3BDGB 1KH7A 2W5SA 5DLWA 5GOVA 4LR2A 3TWZA 3B5QA 5L0BA 4UOPA 1FSUA 3T00A 1SHQA 3MK0A 4LR8A 4UOOA 4CXSA 4NWJA 3WBHA 4B56A 2W5WA 2VQRA 4MY4A 1Y6VA 2G9YA 4UPIA 2GSOA 3UN3A 4ZG6A 1AJDA 3E2DA 4CXUA 2W5XA 1ZEFA 1ALIA 3KD8A 3Q3QA 4GTZA 1ED9A 3NVLA 1HDHA 5EGEA 2GSNA 1AJAA 1AUKA 4CXKA 4ZGAA 3BDHA 3SZZA 2ZKTA 4TN0A 3M7VA 4QAXA 1O99A 4UPHA 1ED8A 2W5RA 3UN2A 5IJQA 2GA3A 5L0EA 1B8JA
chains in the Genus database with same CATH superfamily
1KHLA 5INHA 2RH6A 1KHNA 4FDIA 1URBA 2GLQA 4KJDA 2W5VA 3UO0A 1K7HA 1AJCA 1N2LA 1ZEDA 1ELZA 2XR9A 3BDGA 1Y7AA 1ZEBA 3NKQA 4GTYA 2XRGA 4LR7A 4LRBA 5AJ9A 3WAYA 5LIAA 1EJJA 4LRDA 2IUCB 5HRTA 3T02A 1EQJA 3TX0A 2ANHA 3NKRA 4UPLA 2W8DA 4MHXA 3IGZB 3A52A 4GTXA 2D1GA 1HJKA 1AJBA 3LXQA 1ELXA 5L0KA 1ALHA 1ALKA 4KM4A 2X98A 3M8YA 4LRFA 1KH4A 4NWXA 1URAA 1P49A 3DYCA 5K4PA 3OT9A 4LREA 5DLVA 1EW8A 1EW9A 5KXAA 1KH5A 3NKOA 4CYRA 3MK2A 3M8ZA 1ANIA 3BDFA 2QZUA 1SHNA 3NKNA 4LQYA 3SZYA 3WAXA 5LQQA 1O98A 4LRAA 1E33P 4N7TA 4ZG9A 4ZG7A 1ANJA 4UPKA 4CYSA 3UNYA 3DPCA 4LRCA 5TJ3A 2IFYA 2IUCA 1N2KA 3WAWA 1E1ZP 3NKPA 1ALJA 3NKMA 3MK1A 1E2SP 2GSUA 4UORA 5LRMA 4FDJA 3ED4A 3T01A 1EW2A 5IJSA 1ELYA 5EGHA 4KAVA 3UN5A 1EI6A 2W8SA 1E3CP 3IGYB 5LRNA 3WAVA 3IDDA 1HQAA 3TG0A 4YR1A 4KAYA 2W5TA 5DLTA 5C66A 2W5QA 3M8WA 4LR9A 4MIVA 4KJGA 3CMRA 1KHKA 1KH9A 5GRRA 4GTWA 1KHJA 3BDGB 1KH7A 2W5SA 5DLWA 5GOVA 4LR2A 3TWZA 3B5QA 5L0BA 4UOPA 1FSUA 3T00A 1SHQA 3MK0A 4LR8A 4UOOA 4CXSA 4NWJA 3WBHA 4B56A 2W5WA 2VQRA 4MY4A 1Y6VA 2G9YA 4UPIA 2GSOA 3UN3A 4ZG6A 1AJDA 3E2DA 4CXUA 2W5XA 1ZEFA 1ALIA 3KD8A 3Q3QA 4GTZA 1ED9A 3NVLA 1HDHA 5EGEA 2GSNA 1AJAA 1AUKA 4CXKA 4ZGAA 3BDHA 3SZZA 2ZKTA 4TN0A 3M7VA 4QAXA 1O99A 4UPHA 1ED8A 2W5RA 3UN2A 5IJQA 2GA3A 5L0EA 1B8JA
chains in the Genus database with same CATH topology
1KHLA 5INHA 2RH6A 1KHNA 4FDIA 1URBA 2GLQA 4KJDA 2W5VA 3UO0A 1K7HA 1AJCA 1N2LA 1ZEDA 1ELZA 2XR9A 3BDGA 1Y7AA 1ZEBA 3NKQA 4GTYA 2XRGA 4LR7A 4LRBA 5AJ9A 3WAYA 5LIAA 1EJJA 4LRDA 2IUCB 5HRTA 3T02A 1EQJA 3TX0A 2ANHA 3NKRA 4UPLA 2W8DA 4MHXA 3IGZB 3A52A 4GTXA 2D1GA 1HJKA 1AJBA 3LXQA 1ELXA 5L0KA 1ALHA 1ALKA 4KM4A 2X98A 3M8YA 4LRFA 1KH4A 4NWXA 1URAA 1P49A 3DYCA 5K4PA 3OT9A 4LREA 5DLVA 1EW8A 1EW9A 5KXAA 1KH5A 3NKOA 4CYRA 3MK2A 3M8ZA 1ANIA 3BDFA 2QZUA 1SHNA 3NKNA 4LQYA 3SZYA 3WAXA 5LQQA 1O98A 4LRAA 1E33P 4N7TA 4ZG9A 4ZG7A 1ANJA 4UPKA 4CYSA 3UNYA 3DPCA 4LRCA 5TJ3A 2IFYA 2IUCA 1N2KA 3WAWA 1E1ZP 3NKPA 1ALJA 3NKMA 3MK1A 1E2SP 2GSUA 4UORA 5LRMA 4FDJA 3ED4A 3T01A 1EW2A 5IJSA 1ELYA 5EGHA 4KAVA 3UN5A 1EI6A 2W8SA 1E3CP 3IGYB 5LRNA 3WAVA 3IDDA 1HQAA 3TG0A 4YR1A 4KAYA 2W5TA 5DLTA 5C66A 2W5QA 3M8WA 4LR9A 4MIVA 4KJGA 3CMRA 1KHKA 1KH9A 5GRRA 4GTWA 1KHJA 3BDGB 1KH7A 2W5SA 5DLWA 5GOVA 4LR2A 3TWZA 3B5QA 5L0BA 4UOPA 1FSUA 3T00A 1SHQA 3MK0A 4LR8A 4UOOA 4CXSA 4NWJA 3WBHA 4B56A 2W5WA 2VQRA 4MY4A 1Y6VA 2G9YA 4UPIA 2GSOA 3UN3A 4ZG6A 1AJDA 3E2DA 4CXUA 2W5XA 1ZEFA 1ALIA 3KD8A 3Q3QA 4GTZA 1ED9A 3NVLA 1HDHA 5EGEA 2GSNA 1AJAA 1AUKA 4CXKA 4ZGAA 3BDHA 3SZZA 2ZKTA 4TN0A 3M7VA 4QAXA 1O99A 4UPHA 1ED8A 2W5RA 3UN2A 5IJQA 2GA3A 5L0EA 1B8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHL A;  5INH A;  2RH6 A;  1KHN A;  4FDI A;  1URB A;  2GLQ A;  4KJD A;  2W5V A;  3UO0 A;  1K7H A;  1AJC A;  1N2L A;  1ZED A;  1ELZ A;  2XR9 A;  3BDG A;  1Y7A A;  1ZEB A;  3NKQ A;  4GTY A;  2XRG A;  4LR7 A;  4LRB A;  5AJ9 A;  3WAY A;  5LIA A;  1EJJ A;  4LRD A;  2IUC B;  5HRT A;  3T02 A;  1EQJ A;  3TX0 A;  2ANH A;  3NKR A;  4UPL A;  2W8D A;  4MHX A;  3IGZ B;  3A52 A;  4GTX A;  2D1G A;  1HJK A;  1AJB A;  3LXQ A;  1ELX A;  5L0K A;  1ALH A;  1ALK A;  4KM4 A;  2X98 A;  3M8Y A;  4LRF A;  1KH4 A;  4NWX A;  1URA A;  1P49 A;  3DYC A;  5K4P A;  3OT9 A;  4LRE A;  5DLV A;  1EW8 A;  1EW9 A;  5KXA A;  1KH5 A;  3NKO A;  4CYR A;  3MK2 A;  3M8Z A;  1ANI A;  3BDF A;  2QZU A;  1SHN A;  3NKN A;  4LQY A;  3SZY A;  3WAX A;  5LQQ A;  1O98 A;  4LRA A;  1E33 P;  4N7T A;  4ZG9 A;  4ZG7 A;  1ANJ A;  4UPK A;  4CYS A;  3UNY A;  3DPC A;  4LRC A;  5TJ3 A;  2IFY A;  2IUC A;  1N2K A;  3WAW A;  1E1Z P;  3NKP A;  1ALJ A;  3NKM A;  3MK1 A;  1E2S P;  2GSU A;  4UOR A;  5LRM A;  4FDJ A;  3ED4 A;  3T01 A;  1EW2 A;  5IJS A;  1ELY A;  5EGH A;  4KAV A;  3UN5 A;  1EI6 A;  2W8S A;  1E3C P;  3IGY B;  5LRN A;  3WAV A;  3IDD A;  1HQA A;  3TG0 A;  4YR1 A;  4KAY A;  2W5T A;  5DLT A;  5C66 A;  2W5Q A;  3M8W A;  4LR9 A;  4MIV A;  4KJG A;  3CMR A;  1KHK A;  1KH9 A;  5GRR A;  4GTW A;  1KHJ A;  3BDG B;  1KH7 A;  2W5S A;  5DLW A;  5GOV A;  4LR2 A;  3TWZ A;  3B5Q A;  5L0B A;  4UOP A;  1FSU A;  3T00 A;  1SHQ A;  3MK0 A;  4LR8 A;  4UOO A;  4CXS A;  4NWJ A;  3WBH A;  4B56 A;  2W5W A;  2VQR A;  4MY4 A;  1Y6V A;  2G9Y A;  4UPI A;  2GSO A;  3UN3 A;  4ZG6 A;  1AJD A;  3E2D A;  4CXU A;  2W5X A;  1ZEF A;  1ALI A;  3KD8 A;  3Q3Q A;  4GTZ A;  1ED9 A;  3NVL A;  1HDH A;  5EGE A;  2GSN A;  1AJA A;  1AUK A;  4CXK A;  4ZGA A;  3BDH A;  3SZZ A;  2ZKT A;  4TN0 A;  3M7V A;  4QAX A;  1O99 A;  4UPH A;  1ED8 A;  2W5R A;  3UN2 A;  5IJQ A;  2GA3 A;  5L0E A;  1B8J A; 
#chains in the Genus database with same CATH topology
 1KHL A;  5INH A;  2RH6 A;  1KHN A;  4FDI A;  1URB A;  2GLQ A;  4KJD A;  2W5V A;  3UO0 A;  1K7H A;  1AJC A;  1N2L A;  1ZED A;  1ELZ A;  2XR9 A;  3BDG A;  1Y7A A;  1ZEB A;  3NKQ A;  4GTY A;  2XRG A;  4LR7 A;  4LRB A;  5AJ9 A;  3WAY A;  5LIA A;  1EJJ A;  4LRD A;  2IUC B;  5HRT A;  3T02 A;  1EQJ A;  3TX0 A;  2ANH A;  3NKR A;  4UPL A;  2W8D A;  4MHX A;  3IGZ B;  3A52 A;  4GTX A;  2D1G A;  1HJK A;  1AJB A;  3LXQ A;  1ELX A;  5L0K A;  1ALH A;  1ALK A;  4KM4 A;  2X98 A;  3M8Y A;  4LRF A;  1KH4 A;  4NWX A;  1URA A;  1P49 A;  3DYC A;  5K4P A;  3OT9 A;  4LRE A;  5DLV A;  1EW8 A;  1EW9 A;  5KXA A;  1KH5 A;  3NKO A;  4CYR A;  3MK2 A;  3M8Z A;  1ANI A;  3BDF A;  2QZU A;  1SHN A;  3NKN A;  4LQY A;  3SZY A;  3WAX A;  5LQQ A;  1O98 A;  4LRA A;  1E33 P;  4N7T A;  4ZG9 A;  4ZG7 A;  1ANJ A;  4UPK A;  4CYS A;  3UNY A;  3DPC A;  4LRC A;  5TJ3 A;  2IFY A;  2IUC A;  1N2K A;  3WAW A;  1E1Z P;  3NKP A;  1ALJ A;  3NKM A;  3MK1 A;  1E2S P;  2GSU A;  4UOR A;  5LRM A;  4FDJ A;  3ED4 A;  3T01 A;  1EW2 A;  5IJS A;  1ELY A;  5EGH A;  4KAV A;  3UN5 A;  1EI6 A;  2W8S A;  1E3C P;  3IGY B;  5LRN A;  3WAV A;  3IDD A;  1HQA A;  3TG0 A;  4YR1 A;  4KAY A;  2W5T A;  5DLT A;  5C66 A;  2W5Q A;  3M8W A;  4LR9 A;  4MIV A;  4KJG A;  3CMR A;  1KHK A;  1KH9 A;  5GRR A;  4GTW A;  1KHJ A;  3BDG B;  1KH7 A;  2W5S A;  5DLW A;  5GOV A;  4LR2 A;  3TWZ A;  3B5Q A;  5L0B A;  4UOP A;  1FSU A;  3T00 A;  1SHQ A;  3MK0 A;  4LR8 A;  4UOO A;  4CXS A;  4NWJ A;  3WBH A;  4B56 A;  2W5W A;  2VQR A;  4MY4 A;  1Y6V A;  2G9Y A;  4UPI A;  2GSO A;  3UN3 A;  4ZG6 A;  1AJD A;  3E2D A;  4CXU A;  2W5X A;  1ZEF A;  1ALI A;  3KD8 A;  3Q3Q A;  4GTZ A;  1ED9 A;  3NVL A;  1HDH A;  5EGE A;  2GSN A;  1AJA A;  1AUK A;  4CXK A;  4ZGA A;  3BDH A;  3SZZ A;  2ZKT A;  4TN0 A;  3M7V A;  4QAX A;  1O99 A;  4UPH A;  1ED8 A;  2W5R A;  3UN2 A;  5IJQ A;  2GA3 A;  5L0E A;  1B8J A; 
#chains in the Genus database with same CATH homology
 1KHL A;  5INH A;  2RH6 A;  1KHN A;  4FDI A;  1URB A;  2GLQ A;  4KJD A;  2W5V A;  3UO0 A;  1K7H A;  1AJC A;  1N2L A;  1ZED A;  1ELZ A;  2XR9 A;  3BDG A;  1Y7A A;  1ZEB A;  3NKQ A;  4GTY A;  2XRG A;  4LR7 A;  4LRB A;  5AJ9 A;  3WAY A;  5LIA A;  1EJJ A;  4LRD A;  2IUC B;  5HRT A;  3T02 A;  1EQJ A;  3TX0 A;  2ANH A;  3NKR A;  4UPL A;  2W8D A;  4MHX A;  3IGZ B;  3A52 A;  4GTX A;  2D1G A;  1HJK A;  1AJB A;  3LXQ A;  1ELX A;  5L0K A;  1ALH A;  1ALK A;  4KM4 A;  2X98 A;  3M8Y A;  4LRF A;  1KH4 A;  4NWX A;  1URA A;  1P49 A;  3DYC A;  5K4P A;  3OT9 A;  4LRE A;  5DLV A;  1EW8 A;  1EW9 A;  5KXA A;  1KH5 A;  3NKO A;  4CYR A;  3MK2 A;  3M8Z A;  1ANI A;  3BDF A;  2QZU A;  1SHN A;  3NKN A;  4LQY A;  3SZY A;  3WAX A;  5LQQ A;  1O98 A;  4LRA A;  1E33 P;  4N7T A;  4ZG9 A;  4ZG7 A;  1ANJ A;  4UPK A;  4CYS A;  3UNY A;  3DPC A;  4LRC A;  5TJ3 A;  2IFY A;  2IUC A;  1N2K A;  3WAW A;  1E1Z P;  3NKP A;  1ALJ A;  3NKM A;  3MK1 A;  1E2S P;  2GSU A;  4UOR A;  5LRM A;  4FDJ A;  3ED4 A;  3T01 A;  1EW2 A;  5IJS A;  1ELY A;  5EGH A;  4KAV A;  3UN5 A;  1EI6 A;  2W8S A;  1E3C P;  3IGY B;  5LRN A;  3WAV A;  3IDD A;  1HQA A;  3TG0 A;  4YR1 A;  4KAY A;  2W5T A;  5DLT A;  5C66 A;  2W5Q A;  3M8W A;  4LR9 A;  4MIV A;  4KJG A;  3CMR A;  1KHK A;  1KH9 A;  5GRR A;  4GTW A;  1KHJ A;  3BDG B;  1KH7 A;  2W5S A;  5DLW A;  5GOV A;  4LR2 A;  3TWZ A;  3B5Q A;  5L0B A;  4UOP A;  1FSU A;  3T00 A;  1SHQ A;  3MK0 A;  4LR8 A;  4UOO A;  4CXS A;  4NWJ A;  3WBH A;  4B56 A;  2W5W A;  2VQR A;  4MY4 A;  1Y6V A;  2G9Y A;  4UPI A;  2GSO A;  3UN3 A;  4ZG6 A;  1AJD A;  3E2D A;  4CXU A;  2W5X A;  1ZEF A;  1ALI A;  3KD8 A;  3Q3Q A;  4GTZ A;  1ED9 A;  3NVL A;  1HDH A;  5EGE A;  2GSN A;  1AJA A;  1AUK A;  4CXK A;  4ZGA A;  3BDH A;  3SZZ A;  2ZKT A;  4TN0 A;  3M7V A;  4QAX A;  1O99 A;  4UPH A;  1ED8 A;  2W5R A;  3UN2 A;  5IJQ A;  2GA3 A;  5L0E A;  1B8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...