5LRNA

Structure of mono-zinc mcr-1 in p21 space group
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
325
structure length
324
Chain Sequence
GPTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphatidylethanolamine transferase Mcr-1
publication title Insights into the Mechanistic Basis of Plasmid-Mediated Colistin Resistance from Crystal Structures of the Catalytic Domain of MCR-1.
pubmed doi rcsb
source organism Escherichia coli
total genus 123
structure length 324
sequence length 325
chains with identical sequence B
ec nomenclature ec 2.7.-.-:
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 5lrnA00
1EW9A 1EW8A 3UN2A 2XR9A 1E3CP 3NKQA 1SHNA 3WBHA 3WAXA 1K7HA 2GSUA 2QZUA 1HDHA 3MK1A 5LQQA 3WAYA 2IUCB 3NKMA 1KH9A 3UNYA 4QAXA 5L0EA 1Y7AA 4UOPA 1ALHA 1SHQA 2W5SA 1HJKA 4LRAA 1ANIA 5EGEA 3SZZA 2IUCA 3IGZB 1E2SP 1E1ZP 4KAYA 4ZG7A 5GRRA 1O99A 5LIAA 1KHNA 1KHKA 4GTZA 5IJQA 5L0BA 1URBA 1FSUA 3CMRA 4LR7A 1HQAA 4ZGAA 1KHLA 4LREA 1EI6A 3TG0A 4UPHA 4KM4A 4LRFA 1URAA 1Y6VA 1P49A 4CYRA 3A52A 1ED9A 4MIVA 1N2LA 1EQJA 3NKPA 2W5WA 4NWXA 2X98A 5DLWA 3BDHA 4LR2A 3NKRA 2W8DA 3UN3A 3MK2A 4GTXA 4YR1A 2W5XA 3T01A 4GTYA 1B8JA 3BDFA 1AJBA 3M8ZA 1EJJA 3NVLA 3TWZA 2VQRA 4CXKA 3M7VA 4UPIA 4UPLA 4TN0A 5IJSA 3T02A 1AJDA 3T00A 1ALKA 2XRGA 3IDDA 3LXQA 3MK0A 4CXSA 2GA3A 5GOVA 1ELYA 5LRMA 1ANJA 4CYSA 3UN5A 1O98A 4LRBA 4FDIA 2GSNA 3NKOA 3WAVA 5KXAA 4UPKA 1KH7A 2W8SA 1AUKA 4N7TA 4MY4A 4ZG6A 2RH6A 4KJGA 4NWJA 2W5QA 4LQYA 5LRNA 2IFYA 3UO0A 1KHJA 1ZEDA 5HRTA 1N2KA 1ELXA 2D1GA 5K4PA 4LR8A 4ZG9A 4CXUA 3IGYB 4KJDA 1ALIA 1KH5A 4UOOA 3ED4A 2ANHA 1AJCA 4LRCA 1AJAA 3NKNA 4KAVA 3OT9A 5INHA 1E33P 2GLQA 3KD8A 3TX0A 3WAWA 2ZKTA 1EW2A 1KH4A 4FDJA 4LR9A 4MHXA 4UORA 1ELZA 4B56A 2W5VA 4LRDA 3DYCA 3BDGB 3B5QA 3Q3QA 3M8YA 2W5RA 1ED8A 3E2DA 5AJ9A 5DLTA 5EGHA 3SZYA 2W5TA 5TJ3A 5DLVA 2G9YA 1ALJA 5L0KA 3BDGA 2GSOA 3M8WA 1ZEFA 3DPCA 5C66A 4GTWA 1ZEBA
chains in the Genus database with same CATH superfamily
1EW9A 1EW8A 3UN2A 2XR9A 1E3CP 3NKQA 1SHNA 3WBHA 3WAXA 1K7HA 2GSUA 2QZUA 1HDHA 3MK1A 5LQQA 3WAYA 2IUCB 3NKMA 1KH9A 3UNYA 4QAXA 5L0EA 1Y7AA 4UOPA 1ALHA 1SHQA 2W5SA 1HJKA 4LRAA 1ANIA 5EGEA 3SZZA 2IUCA 3IGZB 1E2SP 1E1ZP 4KAYA 4ZG7A 5GRRA 1O99A 5LIAA 1KHNA 1KHKA 4GTZA 5IJQA 5L0BA 1URBA 1FSUA 3CMRA 4LR7A 1HQAA 4ZGAA 1KHLA 4LREA 1EI6A 3TG0A 4UPHA 4KM4A 4LRFA 1URAA 1Y6VA 1P49A 4CYRA 3A52A 1ED9A 4MIVA 1N2LA 1EQJA 3NKPA 2W5WA 4NWXA 2X98A 5DLWA 3BDHA 4LR2A 3NKRA 2W8DA 3UN3A 3MK2A 4GTXA 4YR1A 2W5XA 3T01A 4GTYA 1B8JA 3BDFA 1AJBA 3M8ZA 1EJJA 3NVLA 3TWZA 2VQRA 4CXKA 3M7VA 4UPIA 4UPLA 4TN0A 5IJSA 3T02A 1AJDA 3T00A 1ALKA 2XRGA 3IDDA 3LXQA 3MK0A 4CXSA 2GA3A 5GOVA 1ELYA 5LRMA 1ANJA 4CYSA 3UN5A 1O98A 4LRBA 4FDIA 2GSNA 3NKOA 3WAVA 5KXAA 4UPKA 1KH7A 2W8SA 1AUKA 4N7TA 4MY4A 4ZG6A 2RH6A 4KJGA 4NWJA 2W5QA 4LQYA 5LRNA 2IFYA 3UO0A 1KHJA 1ZEDA 5HRTA 1N2KA 1ELXA 2D1GA 5K4PA 4LR8A 4ZG9A 4CXUA 3IGYB 4KJDA 1ALIA 1KH5A 4UOOA 3ED4A 2ANHA 1AJCA 4LRCA 1AJAA 3NKNA 4KAVA 3OT9A 5INHA 1E33P 2GLQA 3KD8A 3TX0A 3WAWA 2ZKTA 1EW2A 1KH4A 4FDJA 4LR9A 4MHXA 4UORA 1ELZA 4B56A 2W5VA 4LRDA 3DYCA 3BDGB 3B5QA 3Q3QA 3M8YA 2W5RA 1ED8A 3E2DA 5AJ9A 5DLTA 5EGHA 3SZYA 2W5TA 5TJ3A 5DLVA 2G9YA 1ALJA 5L0KA 3BDGA 2GSOA 3M8WA 1ZEFA 3DPCA 5C66A 4GTWA 1ZEBA
chains in the Genus database with same CATH topology
1EW9A 1EW8A 3UN2A 2XR9A 1E3CP 3NKQA 1SHNA 3WBHA 3WAXA 1K7HA 2GSUA 2QZUA 1HDHA 3MK1A 5LQQA 3WAYA 2IUCB 3NKMA 1KH9A 3UNYA 4QAXA 5L0EA 1Y7AA 4UOPA 1ALHA 1SHQA 2W5SA 1HJKA 4LRAA 1ANIA 5EGEA 3SZZA 2IUCA 3IGZB 1E2SP 1E1ZP 4KAYA 4ZG7A 5GRRA 1O99A 5LIAA 1KHNA 1KHKA 4GTZA 5IJQA 5L0BA 1URBA 1FSUA 3CMRA 4LR7A 1HQAA 4ZGAA 1KHLA 4LREA 1EI6A 3TG0A 4UPHA 4KM4A 4LRFA 1URAA 1Y6VA 1P49A 4CYRA 3A52A 1ED9A 4MIVA 1N2LA 1EQJA 3NKPA 2W5WA 4NWXA 2X98A 5DLWA 3BDHA 4LR2A 3NKRA 2W8DA 3UN3A 3MK2A 4GTXA 4YR1A 2W5XA 3T01A 4GTYA 1B8JA 3BDFA 1AJBA 3M8ZA 1EJJA 3NVLA 3TWZA 2VQRA 4CXKA 3M7VA 4UPIA 4UPLA 4TN0A 5IJSA 3T02A 1AJDA 3T00A 1ALKA 2XRGA 3IDDA 3LXQA 3MK0A 4CXSA 2GA3A 5GOVA 1ELYA 5LRMA 1ANJA 4CYSA 3UN5A 1O98A 4LRBA 4FDIA 2GSNA 3NKOA 3WAVA 5KXAA 4UPKA 1KH7A 2W8SA 1AUKA 4N7TA 4MY4A 4ZG6A 2RH6A 4KJGA 4NWJA 2W5QA 4LQYA 5LRNA 2IFYA 3UO0A 1KHJA 1ZEDA 5HRTA 1N2KA 1ELXA 2D1GA 5K4PA 4LR8A 4ZG9A 4CXUA 3IGYB 4KJDA 1ALIA 1KH5A 4UOOA 3ED4A 2ANHA 1AJCA 4LRCA 1AJAA 3NKNA 4KAVA 3OT9A 5INHA 1E33P 2GLQA 3KD8A 3TX0A 3WAWA 2ZKTA 1EW2A 1KH4A 4FDJA 4LR9A 4MHXA 4UORA 1ELZA 4B56A 2W5VA 4LRDA 3DYCA 3BDGB 3B5QA 3Q3QA 3M8YA 2W5RA 1ED8A 3E2DA 5AJ9A 5DLTA 5EGHA 3SZYA 2W5TA 5TJ3A 5DLVA 2G9YA 1ALJA 5L0KA 3BDGA 2GSOA 3M8WA 1ZEFA 3DPCA 5C66A 4GTWA 1ZEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EW9 A;  1EW8 A;  3UN2 A;  2XR9 A;  1E3C P;  3NKQ A;  1SHN A;  3WBH A;  3WAX A;  1K7H A;  2GSU A;  2QZU A;  1HDH A;  3MK1 A;  5LQQ A;  3WAY A;  2IUC B;  3NKM A;  1KH9 A;  3UNY A;  4QAX A;  5L0E A;  1Y7A A;  4UOP A;  1ALH A;  1SHQ A;  2W5S A;  1HJK A;  4LRA A;  1ANI A;  5EGE A;  3SZZ A;  2IUC A;  3IGZ B;  1E2S P;  1E1Z P;  4KAY A;  4ZG7 A;  5GRR A;  1O99 A;  5LIA A;  1KHN A;  1KHK A;  4GTZ A;  5IJQ A;  5L0B A;  1URB A;  1FSU A;  3CMR A;  4LR7 A;  1HQA A;  4ZGA A;  1KHL A;  4LRE A;  1EI6 A;  3TG0 A;  4UPH A;  4KM4 A;  4LRF A;  1URA A;  1Y6V A;  1P49 A;  4CYR A;  3A52 A;  1ED9 A;  4MIV A;  1N2L A;  1EQJ A;  3NKP A;  2W5W A;  4NWX A;  2X98 A;  5DLW A;  3BDH A;  4LR2 A;  3NKR A;  2W8D A;  3UN3 A;  3MK2 A;  4GTX A;  4YR1 A;  2W5X A;  3T01 A;  4GTY A;  1B8J A;  3BDF A;  1AJB A;  3M8Z A;  1EJJ A;  3NVL A;  3TWZ A;  2VQR A;  4CXK A;  3M7V A;  4UPI A;  4UPL A;  4TN0 A;  5IJS A;  3T02 A;  1AJD A;  3T00 A;  1ALK A;  2XRG A;  3IDD A;  3LXQ A;  3MK0 A;  4CXS A;  2GA3 A;  5GOV A;  1ELY A;  5LRM A;  1ANJ A;  4CYS A;  3UN5 A;  1O98 A;  4LRB A;  4FDI A;  2GSN A;  3NKO A;  3WAV A;  5KXA A;  4UPK A;  1KH7 A;  2W8S A;  1AUK A;  4N7T A;  4MY4 A;  4ZG6 A;  2RH6 A;  4KJG A;  4NWJ A;  2W5Q A;  4LQY A;  5LRN A;  2IFY A;  3UO0 A;  1KHJ A;  1ZED A;  5HRT A;  1N2K A;  1ELX A;  2D1G A;  5K4P A;  4LR8 A;  4ZG9 A;  4CXU A;  3IGY B;  4KJD A;  1ALI A;  1KH5 A;  4UOO A;  3ED4 A;  2ANH A;  1AJC A;  4LRC A;  1AJA A;  3NKN A;  4KAV A;  3OT9 A;  5INH A;  1E33 P;  2GLQ A;  3KD8 A;  3TX0 A;  3WAW A;  2ZKT A;  1EW2 A;  1KH4 A;  4FDJ A;  4LR9 A;  4MHX A;  4UOR A;  1ELZ A;  4B56 A;  2W5V A;  4LRD A;  3DYC A;  3BDG B;  3B5Q A;  3Q3Q A;  3M8Y A;  2W5R A;  1ED8 A;  3E2D A;  5AJ9 A;  5DLT A;  5EGH A;  3SZY A;  2W5T A;  5TJ3 A;  5DLV A;  2G9Y A;  1ALJ A;  5L0K A;  3BDG A;  2GSO A;  3M8W A;  1ZEF A;  3DPC A;  5C66 A;  4GTW A;  1ZEB A; 
#chains in the Genus database with same CATH topology
 1EW9 A;  1EW8 A;  3UN2 A;  2XR9 A;  1E3C P;  3NKQ A;  1SHN A;  3WBH A;  3WAX A;  1K7H A;  2GSU A;  2QZU A;  1HDH A;  3MK1 A;  5LQQ A;  3WAY A;  2IUC B;  3NKM A;  1KH9 A;  3UNY A;  4QAX A;  5L0E A;  1Y7A A;  4UOP A;  1ALH A;  1SHQ A;  2W5S A;  1HJK A;  4LRA A;  1ANI A;  5EGE A;  3SZZ A;  2IUC A;  3IGZ B;  1E2S P;  1E1Z P;  4KAY A;  4ZG7 A;  5GRR A;  1O99 A;  5LIA A;  1KHN A;  1KHK A;  4GTZ A;  5IJQ A;  5L0B A;  1URB A;  1FSU A;  3CMR A;  4LR7 A;  1HQA A;  4ZGA A;  1KHL A;  4LRE A;  1EI6 A;  3TG0 A;  4UPH A;  4KM4 A;  4LRF A;  1URA A;  1Y6V A;  1P49 A;  4CYR A;  3A52 A;  1ED9 A;  4MIV A;  1N2L A;  1EQJ A;  3NKP A;  2W5W A;  4NWX A;  2X98 A;  5DLW A;  3BDH A;  4LR2 A;  3NKR A;  2W8D A;  3UN3 A;  3MK2 A;  4GTX A;  4YR1 A;  2W5X A;  3T01 A;  4GTY A;  1B8J A;  3BDF A;  1AJB A;  3M8Z A;  1EJJ A;  3NVL A;  3TWZ A;  2VQR A;  4CXK A;  3M7V A;  4UPI A;  4UPL A;  4TN0 A;  5IJS A;  3T02 A;  1AJD A;  3T00 A;  1ALK A;  2XRG A;  3IDD A;  3LXQ A;  3MK0 A;  4CXS A;  2GA3 A;  5GOV A;  1ELY A;  5LRM A;  1ANJ A;  4CYS A;  3UN5 A;  1O98 A;  4LRB A;  4FDI A;  2GSN A;  3NKO A;  3WAV A;  5KXA A;  4UPK A;  1KH7 A;  2W8S A;  1AUK A;  4N7T A;  4MY4 A;  4ZG6 A;  2RH6 A;  4KJG A;  4NWJ A;  2W5Q A;  4LQY A;  5LRN A;  2IFY A;  3UO0 A;  1KHJ A;  1ZED A;  5HRT A;  1N2K A;  1ELX A;  2D1G A;  5K4P A;  4LR8 A;  4ZG9 A;  4CXU A;  3IGY B;  4KJD A;  1ALI A;  1KH5 A;  4UOO A;  3ED4 A;  2ANH A;  1AJC A;  4LRC A;  1AJA A;  3NKN A;  4KAV A;  3OT9 A;  5INH A;  1E33 P;  2GLQ A;  3KD8 A;  3TX0 A;  3WAW A;  2ZKT A;  1EW2 A;  1KH4 A;  4FDJ A;  4LR9 A;  4MHX A;  4UOR A;  1ELZ A;  4B56 A;  2W5V A;  4LRD A;  3DYC A;  3BDG B;  3B5Q A;  3Q3Q A;  3M8Y A;  2W5R A;  1ED8 A;  3E2D A;  5AJ9 A;  5DLT A;  5EGH A;  3SZY A;  2W5T A;  5TJ3 A;  5DLV A;  2G9Y A;  1ALJ A;  5L0K A;  3BDG A;  2GSO A;  3M8W A;  1ZEF A;  3DPC A;  5C66 A;  4GTW A;  1ZEB A; 
#chains in the Genus database with same CATH homology
 1EW9 A;  1EW8 A;  3UN2 A;  2XR9 A;  1E3C P;  3NKQ A;  1SHN A;  3WBH A;  3WAX A;  1K7H A;  2GSU A;  2QZU A;  1HDH A;  3MK1 A;  5LQQ A;  3WAY A;  2IUC B;  3NKM A;  1KH9 A;  3UNY A;  4QAX A;  5L0E A;  1Y7A A;  4UOP A;  1ALH A;  1SHQ A;  2W5S A;  1HJK A;  4LRA A;  1ANI A;  5EGE A;  3SZZ A;  2IUC A;  3IGZ B;  1E2S P;  1E1Z P;  4KAY A;  4ZG7 A;  5GRR A;  1O99 A;  5LIA A;  1KHN A;  1KHK A;  4GTZ A;  5IJQ A;  5L0B A;  1URB A;  1FSU A;  3CMR A;  4LR7 A;  1HQA A;  4ZGA A;  1KHL A;  4LRE A;  1EI6 A;  3TG0 A;  4UPH A;  4KM4 A;  4LRF A;  1URA A;  1Y6V A;  1P49 A;  4CYR A;  3A52 A;  1ED9 A;  4MIV A;  1N2L A;  1EQJ A;  3NKP A;  2W5W A;  4NWX A;  2X98 A;  5DLW A;  3BDH A;  4LR2 A;  3NKR A;  2W8D A;  3UN3 A;  3MK2 A;  4GTX A;  4YR1 A;  2W5X A;  3T01 A;  4GTY A;  1B8J A;  3BDF A;  1AJB A;  3M8Z A;  1EJJ A;  3NVL A;  3TWZ A;  2VQR A;  4CXK A;  3M7V A;  4UPI A;  4UPL A;  4TN0 A;  5IJS A;  3T02 A;  1AJD A;  3T00 A;  1ALK A;  2XRG A;  3IDD A;  3LXQ A;  3MK0 A;  4CXS A;  2GA3 A;  5GOV A;  1ELY A;  5LRM A;  1ANJ A;  4CYS A;  3UN5 A;  1O98 A;  4LRB A;  4FDI A;  2GSN A;  3NKO A;  3WAV A;  5KXA A;  4UPK A;  1KH7 A;  2W8S A;  1AUK A;  4N7T A;  4MY4 A;  4ZG6 A;  2RH6 A;  4KJG A;  4NWJ A;  2W5Q A;  4LQY A;  5LRN A;  2IFY A;  3UO0 A;  1KHJ A;  1ZED A;  5HRT A;  1N2K A;  1ELX A;  2D1G A;  5K4P A;  4LR8 A;  4ZG9 A;  4CXU A;  3IGY B;  4KJD A;  1ALI A;  1KH5 A;  4UOO A;  3ED4 A;  2ANH A;  1AJC A;  4LRC A;  1AJA A;  3NKN A;  4KAV A;  3OT9 A;  5INH A;  1E33 P;  2GLQ A;  3KD8 A;  3TX0 A;  3WAW A;  2ZKT A;  1EW2 A;  1KH4 A;  4FDJ A;  4LR9 A;  4MHX A;  4UOR A;  1ELZ A;  4B56 A;  2W5V A;  4LRD A;  3DYC A;  3BDG B;  3B5Q A;  3Q3Q A;  3M8Y A;  2W5R A;  1ED8 A;  3E2D A;  5AJ9 A;  5DLT A;  5EGH A;  3SZY A;  2W5T A;  5TJ3 A;  5DLV A;  2G9Y A;  1ALJ A;  5L0K A;  3BDG A;  2GSO A;  3M8W A;  1ZEF A;  3DPC A;  5C66 A;  4GTW A;  1ZEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...