4LRFA

Phosphopentomutase s154g variant soaked with ribose 5-phosphate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 137
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrfA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrfA01
4LRBA 5EGHA 4ZG7A 3TG0A 4LREA 1ELXA 3DYCA 5IJQA 1ANIA 1ED8A 3MK0A 1Y7AA 5HRTA 3KD8A 1K7HA 1KHJA 2ANHA 2D1GA 1P49A 4YR1A 5GRRA 1ELYA 2W5RA 3M8ZA 4MIVA 5AJ9A 2XRGA 1O98A 4UPIA 4KAVA 1SHQA 4LR8A 1AJBA 4UORA 3UN5A 4GTYA 4NWJA 1E1ZP 1EW9A 1Y6VA 1ZEFA 2IUCB 1HQAA 1E33P 1KH4A 3UO0A 1EI6A 3DPCA 3NKPA 2GSNA 1HDHA 4LRAA 4UPKA 5L0KA 3T00A 5LIAA 3M8YA 2GSUA 2GSOA 1EW8A 1URBA 4TN0A 2GLQA 4ZG6A 1ED9A 1ALKA 3T01A 1AJCA 2W5WA 2W5XA 1E3CP 1FSUA 2W5QA 5L0BA 4LRCA 3UN2A 4QAXA 1AUKA 5L0EA 1KHLA 3M7VA 1ELZA 3UNYA 4CXSA 3BDGB 3MK1A 3IDDA 4FDIA 4LQYA 1ZEBA 2W8SA 2W5VA 4GTXA 1ALIA 4GTZA 3WAYA 1KH9A 3OT9A 4ZGAA 1O99A 2IUCA 1KH7A 4KJGA 1ANJA 3NKQA 2W5SA 4MHXA 3NKOA 4CYSA 2W5TA 4N7TA 3NKRA 1EJJA 4CXUA 1AJDA 3A52A 3WAWA 3IGYB 1E2SP 3WAVA 2RH6A 5LQQA 4KJDA 5C66A 1ALJA 5DLTA 2G9YA 3Q3QA 4NWXA 5IJSA 5DLWA 3WBHA 2W8DA 3SZZA 4UOPA 2XR9A 1KH5A 1AJAA 3WAXA 4UOOA 3CMRA 4KAYA 1B8JA 2IFYA 4GTWA 5DLVA 1ZEDA 5GOVA 4ZG9A 3ED4A 4CYRA 5LRMA 3UN3A 5TJ3A 3B5QA 3NVLA 1EW2A 4LRDA 3T02A 1ALHA 1KHNA 2X98A 1N2LA 4LR9A 1EQJA 3M8WA 3SZYA 1HJKA 1N2KA 1SHNA 3E2DA 4B56A 1KHKA 4MY4A 3TX0A 3NKMA 5K4PA 2ZKTA 2GA3A 2QZUA 4LRFA 2VQRA 3MK2A 4UPLA 4CXKA 5KXAA 5INHA 1URAA 5EGEA 3IGZB 3BDGA 4LR7A 3LXQA 3NKNA 3BDFA 5LRNA 4KM4A 4FDJA 3TWZA 4UPHA 3BDHA 4LR2A
chains in the Genus database with same CATH superfamily
2BMBA 4FPIA 2XWXA 1Q8LA 1YG0A 3JQKA 3KFWX 3JTPA 3OJSA 2R8HA 2JRSA 2KM8B 2XZTB 1L3UA 2UU9F 2Q79A 3L3CA 3DYCA 3FEYB 2RKIA 5D4OA 2QL7B 4B08A 5EGYA 2WVBA 4ED7A 1S1XA 3PO4A 3HD1A 2DGSA 1S1UB 3W7BA 1U1LA 2F4VJ 3DLEB 5LT5A 3CJQA 3FRYA 4K4XA 3IM9A 5IQ6A 1X5PA 3HSDA 1F1BB 3LP2B 4DR5F 4ELUA 4NZ7A 5CCMA 4B3TJ 2Q43A 2QLJB 1NBEB 2AHOB 1WEYA 1ZTTA 4OZ1A 1T9VA 1U7LA 1C1BB 2RQMA 2EWHA 1P1LA 2ZM6J 1M5PC 1SXLA 4P10A 2K3KA 4KAVA 3SSQA 4USMA 2MPUA 4HH0A 3HP6A 3M9OB 1HBUB 2Z57B 1O6XA 1O8BA 3R5CA 4OZ0A 5I3UB 4DR1F 1SJRA 1N0VC 2XLJA 1ZEFA 1KOOA 2RRNA 4OX9F 2ZJPQ 1ZPVA 1URNA 5L0KA 4WXOA 4J9NA 2R7TA 1I51B 1SUQA 1VGYA 2Y0SD 3MM7B 4KYZA 4ZLPA 3CXCR 1ZAWA 3ENWA 1LWCB 5DDRC 5U47A 4R5PA 3PACA 4DEZA 2MLYA 1N5YB 1RKJA 3OFHA 4C8YA 4F25A 1RWWB 4YP3A 2HEKA 4WE1A 2PFDA 3PRVA 2CPYA 2V2KA 3TEGA 1H73A 2D1CA 4CLYA 1GQEA 4WIQA 4DU7A 3G9CA 4PWUA 2R2UA 1FEHA 3U7JA 1GXTA 5KFNA 3J81Y 1AUKA 3KNGA 2RE1A 3HHKA 2VG6B 3I5CA 4Y34A 2HHXA 3QIDA 3L7PA 1ACMB 3K89A 3THTA 2Y8WA 2W5VA 2Y3YA 4QYZJ 3UD4P 2J8AA 5E33A 1H98A 1XWLA 3HZEA 2FDNA 3DRPA 2NYHA 3GJSB 1B64A 2H51B 4Q7AA 5T7LA 4K4WA 2MSSA 2IUCA 2DYAA 4J9UE 3ZNUA 1U1PA 2UUBF 2DKOB 1QUPA 2FVQA 3G96A 2MXYA 1HWKA 3SCJE 4CXUA 1TKXA 1WUUA 4FXVA 3KK3A 3W62A 1H2UX 5C7PA 1RGVA 1ZA1B 5D3GA 2VOPA 2YTCA 4NLRA 3BN4A 3PIPQ 1J5EF 5IJSA 1RWKB 1VK8A 2YNHB 1AA1B 4F8RA 4XDDA 1WDDA 3K0JA 3OVBA 3SZZA 1IBCB 3DRXA 3MEGA 5AXLA 3QT8A 4DN0A 1MLAA 1VC0A 1OPZA 2XQCA 3CMRA 3C6UA 3MGJA 2CFXA 4NLWA 3OSPA 5HATA 1JIHA 2C3YA 2RF2B 2FUG9 2XO7A 3KMQA 4ZG9A 3CJ5A 4OZLA 3ED4A 1U6ZA 2HBYB 3MMJA 1M5SA 2GJFA 2XHWA 4TQRA 3KLEB 4USTA 4DL5A 1FXLA 4DR5J 3NVLA 2KXFA 3M8PB 3T1YJ 2FJAB 1X4HA 4Z2XA 1MN7A 3GFZA 4TLRA 3TYTA 1V6HA 4DV2J 2NQPA 3JSRA 5C2GA 4ECWA 2Z8QA 1HMVA 2JOQA 1TK0A 2XLKA 3J7YI 1JXEA 2QGFB 3MTKA 3PM9A 1RB0A 3MCSA 4ES3A 2ILZA 2JNJA 5K4PA 2YKNB 1S9FA 3CSKA 2I2YA 3ZZZA 3VALA 1SIZA 3PNIA 3W8GA 3WBZA 2RQ4A 2QLFB 2MQQA 4B3SJ 4Z7CA 3BSNA 4NL5A 4V19J 1U0HB 1LKZA 1LWEB 1Y5LB 2GQCA 1VRTB 4H4MB 1FXDA 2GFFA 2PT0A 1U47A 5LRNA 1CPZA 4FDJA 4X4VA 2D3UA 4HI2A 1EW2A 4WFXA 1ZAXA 5F41A 5FDLA 3EGNA 3F73A 1Y7PA 1HLWA 1YWXA 3M8SA 4DV1J 2NSCA 2I38A 4KFBA 2DHSA 3RAQA 2D69A 4OYPA 4LREA 1ELXA 2IAJB 3V4MA 4C0HA 1NDKA 2GGPB 2XULA 1TTHB 1NSKL 4EK2A 1R31A 3KD8A 1F2HA 2KXHA 4WIIA 3U1NA 3JYTA 2PMZD 2G2OA 1N6QA 3A12A 1YGYA 4ED4A 2DH8A 2W7PA 1IKVA 1K1QA 4MJKA 1JLQA 4MIVA 1ZZNA 2ZD1B 3KG1A 4JI6F 3TVKA 1D9DA 5BR8F 2FLNA 4IH5A 4DSFA 5CYMA 4WKYA 1I1GA 4OYZA 1S1WB 2KYZA 1FXRA 1ITPA 5HMXA 1WTFA 3QIPB 2XMTA 1S6PA 4OX7A 3R27A 2R7RA 4NWJA 2OH2A 4HTIA 5J2NB 5DGBA 3ZTRA 1KLNA 4ZPVR 4IQMA 1S99A 4Q44A 3SCLE 2DRDA 2HQCA 4UZCA 5HBMA 3W9JA 4OMFG 1QTMA 4ZS6A 4I2QB 4U9RA 5C5JA 1JLCA 2W1BA 3RAMA 3S6EA 1HFEL 4ZN1A 3KK1A 2FZGB 2QX0A 1QLNA 2IYIA 4QWCA 2B8QA 2DK2A 2WB1D 4RW9B 1PYOB 1YBUA 1IKYA 1R6YA 3OTOF 5D8HB 3QSYB 2QE5A 3BBBA 1ZS6A 5L0BA 4TKTA 3ELHA 3TI0A 2FVCA 3GR0A 3T1YF 1TAUA 3ZC4A 4KGKA 1JLFA 1TU0B 1R8BA 1R8PA 2BE9B 2ZH6A 2MLZA 3I0SA 5KFXA 3PO5A 1EQ0A 2YWKA 5D0RA 5HSPA 2NXCA 2R2RA 2GHWA 4ECQA 1XJWB 2DH7A 3W9IA 2JSXA 3TA2A 2XCAA 4MFBB 4NXNF 2B9WA 3DC2A 2DR9A 3CJSA 3QRRA 1N88A 3ISZA 2JEIA 5CABA 2V50A 3US5A 5CH7B 2ZBCA 4EZ9A 1C1CA 1SH2A 1S1XB 4MHXA 2AJ0A 1R8CA 1S1UA 3ITHB 4CDIA 7FDRA 3DLEA 3D7SB 5I3QA 4RU9A 3VVUA 2AQ4A 3WDOA 1E2SP 3LP2A 4NOHA 2XM3A 3J80Y 3TANA 1FTCA 3SDEB 1WORA 4TU8A 1U8SA 1SV5B 1C1BA 1AT1B 1IR2A 2CVEA 2LEBA 2DNHA 4KHPJ 1WC6A 3WAXA 2ZC4A 1CQNA 4HT7A 4XPEA 1KSPA 3RGIA 1SC3B 3FBFA 2NS1B 4YB7A 3PX6A 3NGSA 2F4FA 2OO4A 4LFBF 1JK9B 2KT3A 1VISA 3J7AN 3UDEA 3RBXA 1EQMA 2FJEB 4CH1A 2HFNA 1YHQS 2YX7A 2HK3A 4B9SA 2ZZNA 3NNHA 2VG5B 2QA4G 2HQFA 2QLWA 1N2LA 4MAKA 1B0PA 2LEAA 1VFJA 4USHA 3E2DA 1NZ8A 3DLJA 3HVWA 5DZ6A 1TV6A 3S01A 2IM2A 3CJTA 4ZVUB 4I7FA 2VV5A 1TUWA 3LWMA 4WCEQ 4RR5A 1E6YA 1YTYA 4UPLA 3N4WA 1MMDA 3KHLA 2IDLA 3GSDA 3IRXB 4PKDB 2Y8YA 2AJQA 2JWNA 5E7OB 5HQMA 4ZCMA 3DI6A 3QZ8A 3D68A 3G2XA 5M2PA 3IBCB 2MKSA 4KHMA 4PPZA 1RKIA 5IFMA 1WOOA 1DAXA 1WKJA 3GTYX 4CRJA 2DIVA 4DCPB 2LU2A 1KH4A 1X31C 2RS8A 4GRSA 4Y28C 2CPDA 2CPEA 4A8FA 4PG6A 4RW8A 5KFVA 2CG4A 4O44A 2XS7A 1IBMJ 4NLXA 2ATCB 3U27A 2AYEA 2K1RA 4DOZA 5DQIA 1TKXB 1WHWA 1ED8A 2MHEA 3NP5A 2J76E 5B0BA 1OSCA 5KG4A 4U7UK 4I6YA 3TQEA 3BR9A 4TU7A 3ZTSA 1I6JA 2DY9A 3D66A 4Y0FA 2EBGA 1PC5A 2AT1B 4RWXA 1AZSB 3KYLA 2HHQA 5E2QA 2W5RA 4DX8H 5AJ9A 2OAUA 1RE1B 4NMLA 4RW4A 2ASYA 3ZFVA 3JAMY 4Q43A 4XIUA 2FTRA 2JLEA 3K5MA 3N6MA 5F8LA 4CM0A 5L8RC 4JI1J 4YMEA 2QLBB 3QRPA 2YKQA 1PSDA 1QY7A 5HI7A 3M2UB 2LECA 3KLEA 4NEZA 1VQ4S 3VAMA 1Z4UA 3M8PA 4MK7A 2AEFA 2NSBA 3DNCA 4LRAA 1HQUB 3IM8A 3UVJA 5AE3A 4OI4A 2BJ9A 4LF2A 4NLDA 5CYQB 4JV0A 1WI6A 2YVSA 1R0AB 2H4YB 4C11B 1QSYA 4FS1A 1RWNB 3A3PB 1I94J 1F5AA 4M5DA 4KPYA 4X66J 2XSJB 2HNDA 4PQUA 3D9BA 2MDAA 4JI2F 1RADB 3MUVP 4B9TA 1G1XA 1YI2S 3BH6B 5ETQA 2LEPA 3DLLQ 1FWPA 5DDOC 4OI1A 4JV5J 2H4WB 4F2RA 1VJQA 4EBDA 4K4YA 3KNAA 3MM8A 4LVNP 3UI3A 1YJ7A 1H72C 1U45A 1S12A 1HL6A 2UXDF 2GMHA 5D0GA 4F04B 3IRWP 1BUXA 2W2PP 3RRHA 2X1GA 2Y1IA 1WC5A 3V81B 4CCHA 2OSRA 3MUMP 4OIXA 3OR1B 4RO0A 3G4SS 2UUAF 4ZGAA 2F1FA 3R6LB 3PRBA 5G0RB 1HWIA 2WSFC 3CVKA 2VJUA 1NH7A 2I1RA 4ECVA 3H40A 3ZTQA 3T6BA 3L9ZA 1TVRB 3CDAA 5C24A 2M3DA 2ZH5A 4DF8A 1MWZA 3GIIA 3ZTPA 2Q6BA 2QL9B 4X62J 1T9YA 5KFGA 5LQQA 1YJVA 2LQBA 1T9TA 3LP0A 2G9YA 3MFIA 1U2FA 1RISA 1UAWA 3VQTA 1X7VA 2C3PA 1RT5A 1FERA 2EK1A 4KBIA 1Y5NB 1YKWA 5AJ3J 4OX8A 2AZ1A 3D0GE 3TO8A 5B0CA 1FT8A 1SH3A 2B4OA 2I6WA 4H4KC 5DM7Q 5J2PB 2LQ5A 3BB5A 5J2NA 4NXMJ 2XZWA 4B3RF 4PG8A 2X3GA 2AW0A 4U96A 1UJ5A 2VBZA 3A8JA 4LRDA 3T5LA 5DDQC 2OSQA 1CC8A 3N79A 4IFVB 4U95A 2KI2A 4DUTA 4PXCA 5DO2A 2BM0A 2G0IA 1JLCB 5A6WA 3TP2A 5GAGU 4ZJOA 1TELA 4FF4A 1JLBB 3OR2A 3NXZA 4OFZA 3KK1B 1N2KA 1EJ7L 1TUVA 4NI2B 2CIMA 2CRLA 2M9KA 2RILA 3E01A 5FLXY 4CZCA 4JI2J 4FNIA 3DRSB 1WOPA 3CCES 4I1TA 3NMAA 1GX5A 1NPPA 2HWHA 5HK4A 1Y0HA 1MU2A 2BE2B 3NMRA 3O6QA 2K7JA 2MQNA 3H90A 2CQHA 3TUZC 2XI3A 2PN6A 3A8EA 3BM7A 3V2UC 1HBNA 3UE2A 3SYZA 2F4VF 4QU6A 1NJWA 1CJTA 2M4MA 2E5LJ 4K4SA 4O3PA 3M6VA 2QRRA 3HHLB 3LANA 2FLOA 5AT1B 1RT7B 3SCIE 3TWZA 5IT0A 2AV5A 3DHXA 2DHGA 2DITA 4LFCJ 1BC6A 2EKYA 4ZVPB 4DHVA 2W25A 4LQ3A 1A0OB 4N41A 4K5SA 5K14B 1C0TB 3H25A 1HPZB 3DLBA 1VQLS 5LJ3Y 3T1HJ 2GVZB 4NMXA 5J2MA 2DXDA 2R4FA 2A6OA 1T8EA 4IG3B 3NAHA 4EYIB 2I5JB 4DR6J 3C14B 1KHJA 1BWVA 2DHAA 3MM5A 4PXBA 1HWUA 4BC7A 1SV5A 2XGQA 1K0VA 3FBCA 4ED3A 1F5BA 1UFLA 1OMSA 3LPYA 4QIGA 3FBEA 3MM9A 3OVAA 1VJWA 4WFYA 2V4RA 4DLEA 2AGQA 4JI3F 1IQTA 2IRUA 1NK6A 1YLXA 2XMAA 5C42B 3M05A 4X65F 4DV6F 2Q3PA 2YWWA 3OW2R 3LGHA 2G2YA 5H9EJ 2HNYB 2WW8A 3WX4A 2V8PA 1VRUB 3A3OB 3LUYA 5HMWA 3HSGA 2H5IB 3MR5A 2LXUA 3D6HB 1MROB 4EYHB 2G0JA 2A0FB 3QSIA 4NLPA 3BDEA 1HKAA 3TNVA 3AXKA 3GP9A 3W8PA 5LIAA 4CT9A 3CJ3A 1H3DA 4OV6A 4RNNA 4QQBA 3T1HF 5KG0A 2HKEA 2BQ3A 1D9FA 4LF4F 1NU4A 1ZZFA 1NDPA 4CO2A 1F0XA 1S4FA 3GPAA 3DOKB 4DSJA 4NLTA 4Q8EA 4IQXA 4RJVA 2DNZA 1LEOA 3LAKA 2FJVA 2NZCA 2UVUA 4F0KA 4K8RA 2D74B 2QMWA 2JL9A 4P71A 6AT1B 4B3OA 3W60A 2JZ5A 3CCMS 2HHSA 1T3OA 3N28A 3M6WA 1K9MT 3PJ9A 3BDGB 1YJWS 1FJCA 1YQHA 4ES1A 1SJ4P 2P6SA 2HFSA 5FJ4A 4KC5A 3WC0A 4LQYA 2W8SA 4X4RA 1CSJA 3P49B 4C8NA 3D28A 4EO8A 5F8NA 4NYPA 3D0IE 4NLSA 5BR8J 3H4BA 2OMLA 2FVSA 1LWXA 1MW7A 1VYAA 1M5OC 2HLUA 1HW9A 1RZMA 2FQQB 2KG1A 2C2OB 4QYZK 4CNZA 3Q23A 2WVFA 3PYFA 1W2BR 1SKWA 3C19A 2Q6CA 3QATA 4ED5A 1SCJB 1UVKA 3KLFA 2CQCA 4H4KA 4HT5A 2GIQA 4OZ2A 4PYDA 3W2VB 4X4UA 4LSNB 1UEVA 4HLBA 2O5DA 1HQ2A 2FY8A 2J5AA 2MEWA 2YNIB 3LW5C 4TLQA 4CM2A 2EFGA 3CWJA 2YXLA 3M32A 4ZITA 1WKLA 2DGWA 1FVSA 1I5OB 2GZOA 4NA2A 5LOQA 3V6HA 2G9OA 5HJYA 3HPOA 2ZBQA 2ZH9A 2VIHA 1FK9B 1V3RA 5DLVA 2QA1A 2B9XA 2MJUA 4X64F 2ALZA 2J8SA 3K7RA 3SFUA 3WX8A 1R0AA 2PC6A 3SEOA 2ZUAA 3FRZA 4YUDA 3OUYB 2OI2A 1RYSA 2ADBA 5DRKA 1TL1A 3H4DA 3RJMB 4F67A 3Q22A 1P9QC 3THVA 4D3HA 4B56A 4J5OA 4C97A 4DWIA 4NA3A 4DXLA 1X9WA 2VZ9A 2BKOA 1UWBB 4CQ1A 2N82B 2NXEA 2R7UA 1QUVA 3FUYA 5GMDA 5K8MA 3MXHP 4URGA 3BYPA 5JJBA 2VH7A 4IH7A 4ZP7A 2COLA 1N48A 3BDFA 2MJNA 2IMWP 1KS2A 1LW2B 1FO1A 3N6NA 4DZDA 2IYGA 1HBMA 3JSMA 1XMOF 4Q2LA 9RUBA 1U4BA 1KR4A 1JNRB 2HRUA 2V34A 2PDAA 4IG0A 4J7CA 2CPZA 2W4CA 3OL8A 2C2DA 3W65A 3AQOA 4RPFA 4DN9A 3J7YU 2PMWA 2B51A 2E5GA 3KLGB 4OI6A 1WG5A 4I69A 3IWXA 1IM4A 1SIWB 1GEHA 3VAHA 1NKEA 2BJ3A 5ETLA 1XMBA 1URRA 1NJXA 2WONA 4YS2A 4EBEA 2VA3A 2EEYA 4ED0A 4HHUA 1RT5B 3I4HX 1HNXF 4MKAA 2GAHC 3ET6B 3KDOA 1YSJA 2KN4A 3IR5B 2UUCJ 1ZETA 4DFMA 1CJVB 1L3SA 3OFGA 1IKXB 4FNHA 1PJ5A 1NAQA 1Z1ZA 2OIHA 2EFQA 4BWMA 4MT1A 4GTYA 4Y6IA 2BJ8A 2IM0A 5IXUA 2FJBB 3SQOP 4QPTA 5LSLA 1EW9A 2Z30B 2CPIA 3P8BB 4TYBA 3O2IA 4BWJA 1S1VB 2NXNA 3I56S 4LBPA 3EWGA 1WELA 3P96A 3LAMA 1Q82T 2Y0BB 1CQMA 3PW4A 2XG8A 1EW8A 2NLWA 1DQ9A 3SMZA 3CGIA 2EK6A 3LGNA 1FKOA 1O5JA 1AJCA 2R8GA 4LF4J 1RHUB 4PG5A 3CC2S 4B3RJ 2LQJA 1KQKA 3ENVA 3Q8YA 1N33F 2CG8A 1TAQA 3ETOA 2CQ1A 2FHOB 4QPXA 1CJTB 2ZOFA 2D3OR 1N5QA 1RHRB 2RH3A 2M5YA 3B4DA 1T9WA 4P7TA 5GAHI 2VQFF 3PYEA 4AL6A 2BDPA 3M30A 2O01C 4J9VA 4L72B 2RHSB 2ZFHA 2LQ8A 4R0EA 1D1UA 1WJ9A 4JI1F 2AYGA 1KH9A 2VFTA 1ULRA 2P9GA 1JLAA 1BQMA 3EVMA 4IDKB 4BCAA 2GVZA 3TVZA 4U7CA 1IKWB 2OTLS 3AQPA 2NPFA 2RNEA 1JJHA 3M1VB 4JP8A 3SQGA 4KJGA 1RHQB 3R7BB 4X4QA 3P6YC 3O3LA 4RUHA 2M88A 1TKZA 2ZUGA 1UZHA 3BF4A 3I82A 4DQIA 1WNEA 2V5HG 4JOUA 2XS5A 2BRKA 1U2CA 2ERRA 1LWFA 3P5TL 2E9ZA 3GYGA 1KBRA 3JTNA 1NK7A 4UOPA 2RQCA 1YZ6A 2BJ7A 2DVIA 1YIJS 3BS9A 1WC3A 4ELVA 3HHLD 3MPYA 2AYMA 2VDHA 4PG4A 2VFSA 4PAAA 4QIVA 3HHEA 4C98A 1ZEDA 4LSZB 2J0WA 1RTIB 5I3UA 1VQMS 1ZOTA 3PEHA 1B99A 4OHXA 2DEJA 3R9LA 3V6DB 3AD8C 3KK2B 3UW1A 4CTAA 2DB1A 4LBHA 1ZA2B 4F4ZA 4URQU 3MM7A 4HR2A 4RUCA 1DURA 1OY8A 2B4PA 4PWDA 1NKBA 1LXNA 3HKWA 4ECTA 2ABYA 3TX0A 1XR5A 3BQ0A 1NHKL 5J2QB 3VQSA 2HHTA 4P75A 3FSIA 1VLOA 2V8VA 4GKJF 1QTNB 2WCXA 4WK3A 1N36F 2VUGA 5KXAA 1U25A 4DBQA 1B7FA 5INHA 5FD1A 4EUVA 2LVWA 5AXMA 2ATLA 1SH0A 3OFEA 3NNCA 2DR7A 1SC4B 1CJKA 2I8EA 4NA1A 3T41A 2W9CA 1NPKA 3VGSA 3PW5A 1VIXA 4YDDB 2IA0A 4W92B 4U67Q 1S7HA 1NDLA 2DXEA 4CT8A 1T11A 4LF7J 2BOAA 1UZDA 2MKYA 3TUPA 2HSEB 2CNOB 2I0XA 4OYXA 2AYBA 4M5GA 5EGHA 1FX2A 1VHIA 2RB7A 2CJAA 3ILOA 3OL7A 2VG7B 3S8SA 4JV2A 4RW6B 3IC1A 2O1PA 1NDCA 5IJQA 2UUBJ 2WBRA 1CBKA 4WE1B 4RW7A 2W8LA 2OP5A 2HNZB 1F9HA 1HQEB 1YK9A 3W2VA 4FBUA 1HNWF 1IJFB 2EG1A 2KFYA 4Y2CA 1U2RA 4CI0B 2CQ3A 3W2WA 5D6GA 1J5EJ 2XRGA 3PTWA 2XHCA 3BO3A 4NCAA 1YRUA 4LF9F 1YVFA 5LMNF 2DXFA 2AZ3A 1KDNA 3DRPB 1H7WA 4A8MP 1JJ4A 1NLKL 3ENAA 1F9FA 5CZXA 4F4AA 2CQGA 1QAIA 4FF2A 1FA0A 2ZE2B 2HBQB 1ALJA 4F3OA 2GO8A 3QLHA 4KH0B 3UO0A 3R7SB 5EWGA 3DPCA 3ENQA 2VONA 2CJBA 3JB9k 2GIFA 5L46A 2HPUA 1RTJA 3HVAA 3KK3B 1HHSA 2XMWA 2DNRA 2LKZA 5GADU 2X1AA 5KG7A 1VC6A 3R6GB 4HDGA 1N52B 3HO1A 2QO3A 1N5VA 3EDRB 4J9QA 2O67A 3O1LA 2YNHA 1WEZA 3GIKA 2P9EA 3DM2B 2MQOA 3UR0A 5A8KA 3I87A 3DLKA 1KHVA 4XAKA 1SL0A 2L41A 1X9SA 3V6KA 2BM1A 1HR0J 2WK4A 1RWUA 4Q0BB 3HT0A 3NS5A 2HS0A 1H74A 2F3JA 1U0HA 2VPWB 2ZWOA 2C2ZB 1VRTA 5L39A 4FYDA 3IDDA 1RWMB 8RUCA 4UOGA 4GTZA 1UFWA 2Q1LA 4OX6A 4Y3CA 4HACA 1CVJA 4JV5F 4ZPDA 1WD6A 3DGPA 3HD2A 2LP4A 5KT6A 4WFNQ 1DRZA 4PRFA 4DX5A 4G6VB 1NPRA 3MMBA 4Z37A 4QCLA 1Q8IA 3CEDA 1GXUA 3NCRA 1GXLA 3MAAA 3ZZUA 3WAWA 1UEKA 2XMKA 3DFEA 4LSLB 4E98A 1N5YA 2EFOA 1U48A 2V9WA 3WBHA 2HAFA 2AJ2A 1U09A 1JLQB 1AJAA 1GMUA 2KH9A 2WRMA 3MPWA 1IBLJ 1Q7YT 2MSTA 3BO4A 4JI5J 4ZVTB 1AB8A 1FKPA 2J7UA 4LF9J 2DO0A 5CYMB 5BJRA 3MFHA 1O51A 4Y00A 3BO2A 1DFDA 5T41A 4KFBB 3VR1A 2LFVA 5HN0A 5KFMA 3CMAS 3UN3A 1TFWA 1N56A 4DV5F 2VICA 1PC4A 4KIAA 2AKWB 2HS3A 1S48A 4ENOA 5KFFA 1XNQJ 4F02A 4WKRA 3IGNA 2KG0A 4DR2J 2XY6A 3NKYA 4KGZB 2F9DA 3VWSA 1HJKA 4OHWA 4DG1B 1SHNA 1U0SA 1FKOB 3UFCX 1RABB 1RA7A 2VFRA 2X7IA 5I3PA 2IBKA 2CPXA 3JSYA 4MKYA 5IQQA 3NKMA 2ZBRA 8ATCB 5LMUF 3W9HA 2FLLA 2WB4A 2HWTA 2QZUA 4OLOA 1G7CB 1K47A 1EIYB 2DTJA 2XMMA 1FE0A 2ROEA 1F6TA 1VQSA 5H1SV 1NHUA 1KKHA 3CIZA 5JUMA 3PZPA 2FY1A 1S6PB 4JI7F 1X60A 5EX0A 2F8HA 1NSAA 4DR7J 1FRJA 2B7CB 2H1YA 2RRBA 3W5XA 4JI8J 3B8HA 2G2ZA 5F3ZA 4FVCA 1BXNA 2ZC3A 3B82A 3D1QA 1HBOA 3F56A 3TA0A 5HBMB 3H5UA 3M2RA 1NJYA 1D9AA 2HZAA 2C42A 2J9CA 4NRTA 3TZYA 1OPIA 1GMVA 2UV8A 4M5HA 2DR5A 4OI0A 3G6YA 3E51A 4IO1A 1NJIT 2HRTA 3D6TB 4JI4J 3BR8A 3MAHA 4LIRA 2KJWA 4ZMMA 3KOAA 4AL5A 2E5LF 3KMSA 3PW7A 3M8QA 4IRDA 2YQ3A 4WFZA 1LOUA 1D0EA 1FRHA 2W7AA 4QIFA 5LMNJ 4ZVRB 2PIIA 1VMBA 3W64A 2R7XA 4V1Ak 2K2PA 4DPUA 3M9NB 2D1GA 2MYFA 1UJ6A 1FRMA 1NH8A 4HHJA 1S4EA 5E3RA 3Q2TC 5B08A 2VU5A 2DH9A 3PV8A 3SDEA 3PEJA 5L1JA 2CNNB 3PX4A 2PFFB 2POKA 2UXDJ 4DL6A 2AD9A 4Q8FA 1AJBA 4QW8A 3LH2S 2A18A 3TOQA 4C8KA 2HHVA 1UEUA 3HSJA 4DPWA 1M1HA 1LWEA 3I9V9 4JI8F 5DQGA 1VQ9S 2HURA 4XK8C 2VPXB 4P74A 1X5OA 2YNGA 2EFNA 3HDSA 4CIOA 2R8KA 2V0NA 4CLKA 3UDVA 5A2QU 1H7XA 3T00A 3D2WA 2M7SA 3M8RA 4G65A 1X0PA 4ZA1A 1URBA 2GC8A 1TL7A 5CQGA 4DUZF 3CMES 2XMVA 4JI5F 2XZDB 2IAJA 1SPBP 4I6AA 2GGPA 3TAMB 4OZNA 4CLFA 5EDWA 1HI0P 2BQUA 1R0CB 2VQEF 1AFIA 4YHHJ 3BPDA 4LFAJ 3BKTA 3IBFB 1T02A 4LQ9A 1IKVB 5KG1A 2ZH3A 2QA2A 5D0HA 4ZP9A 3UNYA 1X4DA 3MWBA 2RUSA 6FDRA 5EX3A 4AXIA 3D67A 1HNVA 3MK1A 4QBUA 3TZXA 1NMEB 3MZIA 2VFVA 3BV8A 4LF8J 3Q8UA 1G4CA 3QIPA 1DLOB 2VG7A 5D4PA 2DHHA 2QTWA 1FX4A 1WG1A 1QAXA 4K7QA 1JX4A 1O99A 1K0TA 1WEXA 3KTQA 1WACA 3KJQB 1YRTA 3DMJB 2VPZB 3MM6B 3H2LA 3K59A 4MH8A 1EETB 2D3ZA 2K1RB 2HNZA 2RT3A 3DU6A 2QMUB 4CH7A 4EWTA 4AUKA 3IRXA 5F0WA 3VGTA 4C3MA 2OUGA 2ZWPA 4KGXB 4QWBA 3ZZRA 3O8WA 2QC3A 5KG2A 2Y9HA 1FD8A 2QMXA 2XNQA 3CNQP 4ED2A 4RW9A 3QO9A 3AODA 4WU2A 1RTZA 2GQ2A 4WF9Q 1KVIA 2B5JA 1UTAA 5LSOA 1M1GA 4RW4B 4M8LA 1Q4RA 2P5VA 5KFOA 4EEYA 4K4TA 1IBLF 3VV2B 4QWAA 4GTWA 2HS4A 1C2PA 3Q8SB 2HZVA 1P8GA 1UPMB 1PJ6A 5TJ3A 5HVHA 1VK3A 3T02A 5KOWA 3D0HE 4M1KA 1HNZJ 4FS2A 1KHNA 1NRKA 1OQ3A 5BYQA 4C11A 3VAJA 2CQ2A 3GYXB 4EMDA 3HFKA 2VQFJ 4LMZA 3BPSP 1YJRA 4DR7F 3PVXA 3PCOB 1GTEA 3C66A 3H42A 3ITHA 3Q83A 3EICA 4Q2MA 4M5IA 5IV4A 2C1EB 3OVSA 3PYGA 1VQKS 2GA3A 3DLKB 1XBWA 2M0GB 1NUEA 2D7SA 4CXKA 2DISA 4HEA9 5ETSA 1R3NA 4E0DA 1U02A 2B0GA 3PJWA 1UKUA 2I9SA 3OPKA 4YB1P 2J6SA 1R43A 3E3XA 3RR7A 1WKKA 3H7HB 3QGIA 2KU7A 4NCGA 3C46A 4QWDA 2WSEC 2UXCF 5CYQA 5IM0B 5KT2A 3RBDA 4LR2A 2YQ0A 5IC6B 2IRXA 2MKHA 2Z2ZA 4ECYA 2OMOA 2OEKA 1ZAVA 5C2CA 3ZTOA 2ASDA 3TG0A 4O3RA 2JDJA 2HBRB 1B70B 4MYUA 4JB8B 1GFWB 1Q8KA 3DRRA 4WTYA 4PQUB 2GHVC 3D3BJ 4DSLA 2B4UA 1NCLA 4K59A 2KZZA 3TRGA 2E5JA 2R3VA 2MKIA 1D8YA 2QZ8A 2FGCA 1P49A 2V2VA 3I96A 3POTB 3KHGA 1TL3B 5KAKA 5KFJA 4X4OA 2DR8A 3CULA 2MGZB 3HK2A 5ETKA 2DNPA 3ILIA 4F0MA 1E6YB 4MK9A 2PD1A 2BZ2A 3B78A 4G1PA 2ZOGA 4UORA 2UVVA 3Q8PB 2DJWA 2AJFE 3DI6B 2JEFA 2ZH8A 4FVMA 3OXGA 1U6BA 1GTHA 4P7VA 3BKUA 3BYRA 4Y65A 1RAGB 2RDIA 4ZPWR 5G0RA 4BS2A 1TR0A 3H5XA 2RIJA 2YQ1A 4DS5A 3ISNC 3G8TA 4DFKA 2E9TA 1U1NA 3RB4A 4M94A 1SI9A 3CCVS 2ZEJA 4YB5A 2FC9A 4EZ6A 4FF1A 2OPSB 3VAFA 5J1EA 1KLMB 3CMQA 1RU2A 1KQGB 1R7IA 2VB6A 3FCHA 1RT1A 2DGTA 1ED9A 1S9GB 3T01A 2SXLA 3NAIA 4AL7A 1VQ7S 2KDOA 1NK4A 1OY6A 3E01B 3KLIA 4L76A 5F9NA 1S72S 1FKAF 3DRSA 4NXMF 5C25A 4XDCA 4NLVA 2HQGA 2KL8A 3CCZA 4LRCA 3IFEA 3UN2A 2JC1A 3E2EA 4QAXA 2M2BA 2PGCA 1UPPA 1PKUA 3H2UB 2HW3A 1BQNA 3QJPA 2DT9A 3UD3P 1BD6A 2JVRA 2ZITA 3SIPB 2R7SA 4DUYJ 1HBNB 4ZIVA 1VIOA 3OTCA 4OLPA 4OQJA 2E1AA 2ZH4A 4QZVB 4DL4A 3MMAB 1GH8A 5I42A 2N4CA 5HQLA 3L7UA 1Q5YA 1ZH5A 2K8GA 4LF6F 4L74A 3FSYA 2HWIA 4DR3F 3EZOA 2VHGA 1SJFA 2YX4A 3GILA 2MQMA 4NI2A 4KKOA 3UVJB 3M8QB 4CO4A 1C0TA 2JVOA 3GMGA 2G1HA 1HA1A 5HVFA 1TZ0A 5AE2A 2KJVA 1L5UA 1A6LA 2CJ9A 1PG5B 5LJ5Y 3AFGA 4FBTA 2M52A 4C6AA 3BGFA 3HM9A 2RSQA 4DUZJ 1OJ4A 2KHCA 3HJVA 1MU2B 2CQDA 2A2DA 1X4GA 2BE2A 4S0MA 3FQKA 5K8PA 3K5LA 4NWXA 2AIRB 3IP0A 3NOGA 3MM5B 4NPOA 1SVDA 4F7VA 2VPYB 5K20B 2LCWA 2HQ3A 3HHLA 4ZP6A 5KG6A 4C3LA 1WDTA 2HYIB 3FQLA 4O3OA 3VGVA 5KFSA 3QZ7A 4WFBQ 2DHXA 3R1HA 5IV3A 2JX2A 3OJUA 5MLCV 2CJYB 2KHDA 5GOVA 3DXBA 3EXYA 5K14A 1U26A 3RU0A 1ZM4A 4DR4J 1G2EA 2E66A 1TUGB 1U6FA 1TMMA 1YDLA 2HIQA 3C8YA 4PQAA 3M2VA 2N7CA 3HXMA 1ALHA 2GV1A 1BHNA 1SL2A 2HK2A 1XNRJ 1TL7B 1L3VA 2MKCA 2DRBA 4DSKA 4JBCA 1QSSA 4MY4A 5F8IA 5LXRA 4ZKAA 1R6VA 2FJXA 1DARA 2QLXA 3MM9B 4NZ0A 4X62F 2Z58B 4X4PA 2C22A 2DR6A 3M6XA 3AT1B 2KRRA 2Z4PA 5L38A 2R8IA 1PJ7A 1H6KX 2QA4S 4LF5J 3IGZB 4ZDNA 4J9KA 4YOEA 5E3AA 3C2PA 3WC2A 1S76D 3CJ2A 4JI0F 1EAYC 1HNVB 3QWUA 1ZTWA 2E29A 2ZOMA 3SZ2A 1Y4ZB 4P2FA 2DNOA 3FEXB 4L73A 1MROA 4GMKA 5ETRA 1MWQA 2LXIA 4EFAC 1DLOA 5F8HA 4U8VA 2VA2A 3AH6A 1F3VA 3NOCA 2F5GA 1E6VA 2FC8A 2J9EA 2JEJA 4ATNA 2AGPA 5DM6Q 2CNKB 1BWEA 1SQFA 3B6BA 1Z2LA 2DNQA 3A3NB 3HHNB 4J9LA 1CEZA 3DOKA 3GJTB 4CLWA 3HVTB 3DHWC 3VF0B 2XBPA 5HRTA 2HQDA 1UW9A 3ZZ0A 1KOHA 3CUNA 3IAM9 2DRAA 4DV5J 2LLZA 4AD6A 3CDBA 3PKMA 1XNQF 5KFIA 1QAYA 3GIJA 2XC9A 2L9DA 4LSNA 1RTDA 4ED1A 2DGQA 2N7YA 5E41A 4RZRA 3GE9A 3PR4A 2MZQA 3CCLS 2KFNA 5HANA 2RU3A 2V2QA 4WFAQ 1DTTA 5B0FA 3NGTA 1WC1A 2P8IA 2MTLA 3ILJA 4EO6A 4DR6F 1CC7A 1SJ1A 3HT3A 2UXCJ 1E1ZP 2A1BA 2MY8A 1E33P 1HQAA 1Q95G 5E5NA 3WZ0A 3MEKA 1B3TA 2BEFA 4A8SA 3V4IA 2RHQB 2LDIA 1WHVA 3G87A 2D9OA 4HHHA 2GNKA 1X4EA 1FFSB 4MMOA 3TEHB 3DU5A 1KQSR 4DPXA 3PY8A 1AROP 4OHVA 5BYSA 2LXFA 5ETVA 3J81U 1HPZA 2F8EX 2GJ2A 2DNYA 4OX9J 1NZAA 3ADAC 2R9LA 3Q0AA 4TNOA 3CC4S 2MZRA 3FKBA 2ZVIA 4ZP8A 4W90B 1FDNA 5B0DA 3C14A 1RP5A 3RBZA 2BOPA 2B6AA 2HHUA 4J90A 3PDNA 2J6TA 1CLFA 4K4ZA 1KHLA 1FK9A 5KG3A 2XI2A 1VBXA 4I2PA 4D3GA 2HZCA 2PI5A 3CCTA 3IG1B 3K2YA 2VKZG 3BQ2A 4GO7X 4TN2A 2OLWA 5KFYA 4IUFA 1B0VA 1S1TB 3GG1A 5ETMA 3OUYA 1UVJA 2KT2A 3OT9A 1K8AT 2HNYA 3CD5A 2HVEA 4B17A 5ETPA 2Z56B 4N77A 1N5TA 5CHCB 2MKKA 1CJUA 3NKOA 2RD5C 4Y2MA 2X1BA 2CPFA 3GYNA 3PJXA 3RW7A 3NKRA 3LGMA 2AX0A 3IR7B 1PIEA 3L4BC 1HNWJ 3CD6S 3G8QA 3QGHA 4G1QB 5EHHA 2HMIB 2MGZA 4G3IA 4KPCA 1DQ8A 1HHQA 1RAIB 1W26A 1W2IA 2FGOA 2MQLA 3N5FA 1LW0B 3I55S 3M9MB 3GIMA 3I5AA 4AT1B 1WF0A 4ZVFA 4MIWA 3H98A 3MOZA 5A8RB 5THWA 4WP9A 4R8UB 2OKQA 1REVB 2CQBA 2IFYA 2AJ1A 4K0KF 2GQQA 4DL2A 4DV7F 4HI1A 2AJ4A 3BSOA 1H2TZ 3S7RA 3QWPA 2D3O1 1VBZA 1KD1T 2ROPA 2K7KA 2G1DA 3ZZPA 3OHBA 3K58A 4I67A 4X4TA 2VBXA 5DGAA 2OPSA 1T03A 1YX2A 1K1SA 1FD2A 1WC4A 1J27A 1R8AA 4PYAA 2ZM6F 1EQJA 5GAHU 3CD7A 2EXUA 2R7QA 1EX8A 3G82B 4IFYB 3JTOA 1NK5A 1SJ3P 2GW8A 3CDUA 5C25B 5DQHA 2ZKTA 5AE1A 1BLUA 2CJXB 2UUWA 3GV7B 2FLPA 2VASA 4C7QA 4M5KA 1BQNB 4UOFA 4ZOSA 3D5MA 4M5JA 3AD9C 4RL1A 1VCTA 1ZM9A 2UU9J 2PI4A 5A8WB 3NKNA 1Q16B 4E2FB 2RAQA 5CCLA 2HBZB 3LQVA 3TUJC 1ZM2A 2VBWA 5E3QA 2V63A 3GQCA 4JI0J 5I42B 3BDHA 4R25A 1S1VA 4K5RA 5AXNA 1UFKA 3OBIA 4IYQA 3QNWB 2B56A 1CG2A 3DYAB 4YB6A 4U8YA 3BGUA 4IH6A 3T19A 4M5NA 1RBOB 3KUEA 1IKWA 2NXUA 3MTJA 2BR0A 3T3FA 2W24A 2DPIA 4DQQA 4ZLJA 1TKTA 2CQPA 1TKZB 2AWZA 3DLHA 1FDBA 6FD1A 1RT3B 4C48A 3RB0A 3RAXA 1YJNS 3NGUA 3TJAA 4BC9A 2VKRA 4UTGA 3TARA 1BE4A 1UWBA 1PILA 2ZJRQ 4DR3J 4OYMA 2EC0A 4UPIA 2UV8G 1YZ7A 3GG0A 3V6JA 2ZHOA 4LFBJ 5SUHA 2IVYA 3BKFA 5DJBA 2YBVA 2DNGA 1BQMB 3ISND 3CCWA 4ID5B 1ELOA 2FHJA 4MK8A 3LWLA 1VQNS 1C4CA 1QDUB 3W5ZA 3M2VB 3JSMB 2OD6A 5DG7A 4QIEA 1OY9A 4JI7J 4IG0B 1FRLA 2ZKUA 3KK2A 4ECXA 1SQGA 2KRBA 1K73T 1JLEB 1U24A 3IA0A 1NM2A 2OPPB 3G86A 1XN9A 3Q2SC 3QRQA 5LMUJ 1DBDA 1KH5A 2UVRA 1VQPS 2JFKA 2XMJA 2YWEA 2K3IA 2BE7D 5H9EK 4FXWA 2GAGC 2BRLA 2N3LA 5CA5A 3TAQA 2BQRA 4CWBA 3I4PA 2HHHJ 1RTHA 4NYZA 1DY3A 1NO8A 3TW0A 1Q0NA 3CJ0A 5CZVA 3CCRS 1FJGJ 1CJVA 1CJKB 1EKSA 4J37A 4RKUC 2L3MA 4CO0A 1IKXA 5A2QY 1JKHB 2W9CB 2U2FA 3V6DA 3MECA 4RNOA 1JJ2R 1M5KC 3NNAA 3EE3A 1C0UB 5A76A 4KH1B 1RWPB 1CS4B 2H9ZA 4HDHA 2J9DA 2MY7A 3MAQA 2FVRA 3SSRA 2W9BB 1R0BG 3OSNA 4F2SA 2M70A 3HVTA 4FYYB 2W5SA 1RLCL 4N7TA 4CYUA 3G6VA 4EBCA 1L3TA 1NSPA 3M6UA 5KFWA 3FVYA 3A13A 2C2RA 3A52A 3B4MA 4AE5A 5DDPC 3BSCA 4HKQA 3T1AA 2BANB 2BW2A 2E7WA 2OD4A 4TU9A 3KLHB 3FDSA 2IVMA 3NLCA 3AOCA 2HGLA 3VGUA 1RAHB 2DGUA 4DV1F 2Q66A 1HIYA 4AQYJ 1XEZA 3K5NA 1HW8A 1DTTB 1EB0A 2CYYA 2QT7A 3LP1A 2NYIA 3BEGB 7AT1B 1T94A 1S6QB 4I6WA 1FNOA 2HHWA 1IR0A 3GCWP 4JYAF 2WW4A 2NUHA 3EVOA 3NY0A 4OV1A 3NL0A 5KT5A 3V4IB 2MHNA 4RW6A 5KOXA 3UDCA 3FMWA 3DXSX 1RQ0A 1JB0C 1FRKA 4RBTA 4YFUA 2VBYA 3U02A 4NXNJ 4WU3A 1DTQB 4ZJQA 4B3MJ 3DOMB 3NRBA 4RW7B 3C16B 4O4RA 3UDLA 3BQ1A 4J9SA 1SKSA 1S9EB 2V8HA 1EP4A 1D09B 2IBOA 3AY0A 1RK8A 2ZHBA 2J6UA 4H54A 5HJXA 3SQGB 3BDPA 3M1VA 1SKUB 4AYBD 1T3NA 1WG4A 3W2WB 1Z2ZA 4X84A 1UMJA 4XTTA 2PMHA 1N34J 4LRFA 1P9YA 1RT6A 3DM2A 3R1LA 5L1IA 1T9UA 3K5PA 3KJNB 3MK2A 2WHOA 3FJ2A 3CE8A 4L75A 2P6TA 4AXJA 1LWFB 2YH0A 4LR7A 1T05B 1GNKA 1RXOB 2VODA 3LXQA 3IG1A 1IBMF 4QW9A 1LK7A 2CUYA 3T6JA 4Q0BA 3OHAA 4KM4A 3P5BP 1IUJA 2QSFA 5HLFA 2FIUA 5GAEU 1XTZA 3K57A 1SJQA 4HACB 3DGPB 1RTIA 1CJUB 3UCZP 2QIFA 1KQFB 3MMCB 1X0FA 1SC1B 1ZBTA 4KRWA 2RRAA 5LXYA 2FZCB 4WBFA 5D15A 2V9KA 3CC7S 3OLAA 3JAMU 2FD2A 1VRQC 4P73A 2ALYB 3G71S 1GX6A 2F9JA 3SV4A 3H0PA 3MAAB 5A8KB 2GHPA 5KT4A 1Q5VA 1L3KA 3C6TB 1PBUA 2CXEA 5IT4A 1F3FA 4J91A 4CLPA 2MB0B 2O3DA 1H2VZ 5J2QA 4PUOA 1Y5IB 1FFWB 1T95A 1S79A 4DFJA 2E9RX 4UUWA 4DPOA 5KFEA 2WOMB 3OV7A 1REVA 4LR8A 2OEJA 3WIUA 2KTQA 3RBEA 5F3TA 4OYAA 4O3QA 4ZG6A 1AW0A 3I9ZA 1M0SA 2UZAA 3VVTA 2CZ4A 2N4DA 5D78A 2E5HA 1B0TA 3I5BA 5KFZA 3G8SA 1WOSA 1CULA 2E1RA 2F40A 4O4GB 2AEMA 2ZBPA 5B09A 3FFIB 1NXIA 3R5BA 1D3WA 3M8YA 3THPA 1KRPA 2W2OP 4J9MA 4A8KA 4IFYA 4PR6A 5ETNA 3MUTP 2DY1A 2GVDA 2EI5A 3BZQA 4DG1A 4DX6A 4H4OB 1KVJA 1WSRA 1K44A 4A8YA 1SL1A 2PA8D 1V9OA 2XGPA 4FN5A 4DV4J 1RAEB 4DL7A 5HMYA 1HQEA 1N34F 3EGVA 4TVAB 5HAOA 3UCGA 4CLSA 1UA1A 2R2SA 3PR5B 3VZHA 1QSLA 4OYOA 2V8GA 2E1CA 4KGMA 3JS9A 3BGRA 3JXOA 3C15A 3MEDB 2HFVA 5HL7Q 3DLGB 3GV5B 2ZVSA 2J9DE 3AA9A 2C2NA 3HJFA 2BACA 1VOMA 1HBOB 3AB2B 1NK0A 3M2RB 3MURP 2DNMA 2HRYA 2ZE2A 1VR6A 3KWMA 3QLHB 3QT5A 3F0NA 3NG8A 4N8NA 4KT0C 5JXSA 5HP1B 3D6MB 4O23A 2HLTA 1N54B 3CDWA 3IS9A 2C3UA 3LA0A 1RTJB 4RUAA 2V69A 2VD3A 3MR6A 1RT3A 3A8IA 1BGXT 5GAEI 3HVRA 1S77D 2HVIA 3QGPA 2YNFB 4C8OA 1XMQJ 2W8DA 3QFHA 2XR9A 4LJMA 4MKVA 1HYSA 1U1RA 3K8WA 4DV6J 1RI7A 1KTVA 3HCXA 3QGGA 1FNXH 2KKHA 3QPIA 4OHZA 2R7VA 4XO0A 1G3OA 4ECSA 1QE1A 2LDYA 1IJEB 5DZ7A 5F0UA 3EGZA 1X8DA 3HHDA 4JYAJ 2AEJA 3GIRA 2QEXS 2JHEA 2PO4A 2YKPA 2IRYA 2YNGB 3D6FB 3HLUA 3UQSA 1H38A 4TYAA 2BABA 3OXFA 2VF3A 4FPRA 4C8MA 1VBYA 5ETOA 1X4FA 3MMBB 1FE4A 2F63A 2EKNA 2BVZA 4QR0A 4ZHRA 5E0OA 4DR4F 3PRDA 3CJ4A 4U6PA 1FRIA 3TAMA 1HNXJ 5M2UA 1YJTA 3R2CJ 4C0BA 3UR3C 2IM1A 4O0IA 4OL8A 4DQSA 4LSLA 3RTVA 4BLGA 4ALZA 3K5OA 4DS4A 1URAA 3FZBA 3RR8A 1S7IA 2CPJA 3GJRB 5JMNA 5RUBA 1YITS 2CWXA 2B9YA 1U1OA 4I56A 1JKHA 4LBIA 1FHTA 5B0EA 4PABA 3CDEA 1Q78A 2E5IA 1C0UA 1VDHA 1SUQB 1FKPB 2PEHA 2IFXA 4I64A 1UL3A 3PW2A 1RCXB 4WK1A 4ZPCA 3J81j 3QJLA 2W9BA 3NBPA 4CLTA 1FJ7A 4ZG7A 5KFHA 3MR7A 5A0YA 1M5VC 5FLXU 1P1TA 2VOOA 3EZ5A 2JLGA 4YDXA 2FVPA 2CVIA 1AXQA 1KFSA 4A4JA 1IWAA 3AJ2A 3DMJA 5HROB 3X1LB 1EETA 3UD5A 1TQLA 3GU0A 1AFJA 2D41A 2ZH2A 2OPQA 1HNIB 5A6PA 3KXDA 3W1YC 4C8ZA 4LT6A 2WZ1A 1MWYA 3FEZA 1WC0A 3M8ZA 4CO5A 4M63A 2NXJA 3KKFA 3BBCA 3SV3A 1W25A 1VQ6S 3MEEA 5I4MA 4B02A 1UVMA 4UZBA 5E3PA 1A9NB 5KG5A 4MIBA 3SXLA 1S0VA 2DGOA 1C4AA 2A6MA 1I94F 1S59A 4ZVOB 4CO3A 2OGUA 3BJYA 1IR1A 1Y6VA 2IUCB 1XR6A 2V4JB 1OS5A 2XYGB 3NKPA 4WTOB 2GSNA 3GFXA 2LA6A 1DTQA 2UUCF 2FHKA 3RRGA 4DSIA 2GMJA 4DQPA 4CNYA 4IRCA 5IT9Y 1S9EA 1IXKA 2YWFA 4X4SA 3FSXA 4UF4A 4K0KJ 2BKNA 3PYDA 1DHMA 1KWMA 4FZVA 1UA0A 2CJKA 3OL6A 2DBBA 2RKIB 4RUBA 4OYIA 3J7ZT 4J9OA 1RT6B 2VDIA 5J1NA 4ED6A 1N33J 1ICEB 2MZSA 4G1IA 3PG9A 1RT4B 2FHJD 2XMUA 2CADA 5IZHA 2RDJA 1PO6A 4GKKF 4DV4F 1T05A 3KUHA 4KHRA 3M7VA 2RF2A 1TMJA 4IOBA 1P6TA 3BSAA 4CXSA 4URSA 1XMOJ 4MIAA 3DCAA 2QG9B 3HMJG 2GIRA 1ZEBA 1FRXA 1JNZB 2DNKA 4K50A 5DETA 3MPUB 4WJBA 3KHRA 4PG7A 5B7WA 1FDDA 2ZH1A 3QMQA 3IXQA 1N32F 1UCNA 1YRXA 4X2BA 2D9PA 2KYXA 1KH7A 5KT3A 3M4XA 3HFZB 2EVZA 2W5TA 2R8JA 2O66A 5GMEA 4DQRA 3AOBA 4OJ1A 4N47A 1AJDA 4PEOA 1GAOA 2ZHAA 4DV0F 4OZ3A 2V8DA 3OD2A 1MN9A 4I68A 1S57A 1XERA 5EWFA 3TJ9A 3VAKA 3POTA 4ILRA 2W4DA 2JFDA 3FNNA 5CXTA 1S0NA 5DLWA 3CPWR 2WOMA 2C28A 3K8VA 3QAEA 1UJ4A 2CNLB 3D1OA 4ITSA 1VC5A 1HBUA 2HVDA 5K8NA 1T0TV 1QVFR 3RW6A 2ZH7A 3JSBA 1PYTA 4MYTA 4HTJA 3FZ2A 4ICLB 2HFUA 2HFZA 5LRMA 4OJHA 4USKA 2FYXA 3B5QA 2YY3A 2X3DA 3I0RB 4DCJB 3GFHA 4PWDB 3OL9A 2V4QA 1D8ZA 1LNQA 3CCSS 4RNHA 3T9ZA 3U1LA 4GVLA 4R5PB 4FYXB 2W2QP 4F26A 3EXCX 2EG2A 1EARA 3EZUA 3MM6A 1KLMA 1BQXA 3H59A 4PWWA 4DDFA 2EPIA 4TQSA 2ZD1A 3R2DJ 3NS6A 3CIMA 1U49A 4IO9Q 2AMCB 2J0SD 1XQIA 3KLIB 3KLVA 1DZ5A 1XNRF 2QSWA 4B9VA 2DNLA 2DNNA 4IKAA 4DL0C 3MCNA 3BGRB 3LTOA 3Q8VA 3C15B 2Z2LA 3CB4A 3QO9B 4QR2A 5KFBA 2AGOA 2H54B 3MEGB 2B5JB 4C8LA 1KVKA 1RSCA 2B43A 5M2RA 5DLFA 3C6UB 5GAGI 2A2CA 3MD1A 4WWSA 5KT7A 4N56A 5KFDA 4LRBA 3MMAA 4NLQA 2VL1A 4NRUA 3VCDA 5J1EB 2VQEJ 5HP1A 1LFWA 1RT1B 4J9PA 2E1PA 1S9GA 4JI3J 4A46A 3IS9B 2CQ4A 4O0NA 4ZVEA 2KZMA 2BKPA 4RNMA 1QVGR 1S5ZA 2W01A 2YPZA 1T9XA 3IMQJ 5D0EA 3RG6A 2XO6A 4M95A 1K7HA 1RWVB 3ZZOA 3EPGA 3A4TA 2DEIA 2DO4A 4C0OC 3D1HA 4GVBB 5J1PA 4ZJLA 1IN0A 1P27B 4FDFA 2XCPA 1HD1A 3R5GA 2HGNA 4A47A 2YKNA 2UXBJ 4P2MA 1N32J 1APSA 3D54A 2DIUA 2EC2A 4NX9A 4OZ5A 5H9FK 1LXJA 2XNRA 4K4UA 4MFBA 2APOA 4YR2A 4F0HA 4X65J 1OQ6A 1GK8A 3WQPA 5CAAA 5KFPA 1V5IB 4NCGB 4ZN3A 2Y1RI 2DGVA 3J80U 4NZ6A 1J2VA 1IQZA 2XSFA 5IM0A 2BYCA 4N8OA 3OTDA 3CCUS 4GKKJ 2HG4A 3C3LA 3P4UB 2IC3A 5GADI 3S1TA 4OJ3A 3DDKA 1QAJA 1JWWA 4X4NA 4TN0A 2J7KA 4ANEA 1Q79A 3N01A 4XPCA 3DRRB 4C3KA 2BX6A 4KO0A 2W9AA 3RB6A 4O3SA 1REGX 4DF4A 1S10A 4WYWA 2KVIA 3EPIA 3PFEA 5DG8A 2BW7A 3ONQA 2C3MA 3ZZYA 1OYDA 1N6QB 2ZBIA 1YBAA 5ITHA 1TL3A 3AB4B 1OO0B 4H4MA 1VQ8S 2DCLA 4YEAA 4CP5A 3H5YA 3QBCA 4MTPA 2A3JA 1FDAA 1HHTP 1RLDA 4ID8A 3IWLA 5FDLB 3VAIA 2HAIA 4OZJA 1X9MA 2VG5A 1M1KT 3NBPB 3LPEA 1VQ5S 2FB0A 1IWGA 4USIA 2GX8A 3L95X 2CKWA 3QT6A 1RBLA 4QYRA 2LMIA 1NNDA 2KVQE 3H5SA 4WPAA 2BJDA 4CO1A 3Q24A 1X5SA 2X98A 4P6QA 3F41A 3NKQA 2J7WA 5HROA 1PGZA 3R97A 3OFFA 2C2KB 4HVZA 1V3ZA 5DS7A 4ANCA 3JYTB 2QN6B 2R7OA 3ZNJ1 4I2QA 3OQ2A 4L6V3 9ATCB 3BGLA 4GKJJ 3WAVA 5SZTA 3AJDA 5DLTA 2HQIA 3MD3A 4LFCF 4IR1A 1RJJA 1RT2B 2V67A 1I3OB 1S0OA 3GZ7A 1KEKA 2R7WA 1NSQA 1RCOB 1RDRA 1TP7A 3ULHA 4RWWA 2E7XA 4EI2A 2EBEA 3O5TB 3RRKA 1FWLA 4DV2F 1F5CA 4KAYA 2X1FA 5HQ8A 1NHVA 4RW8B 4KSEB 2RDDA 3G6XA 4EU0A 1NKCA 4KV8B 4L3NA 3SFGA 2Y1JA 3FGVA 2WBMA 3D4JA 1YJUA 2IHR1 3GLJA 1PBAA 1N36J 4USJC 4FXDA 2ZNZA 3CCJS 2KO1A 3CJRA 4Y2IA 2XYHB 4KKOB 3PKYA 1FF2A 1C1CB 4YQWA 4DSEA 2WTFA 4UW2A 3FBBA 2UUAJ 4NLUA 3SBMA 5IT9U 2AU0A 2JJ4D 3T9NA 4HL9A 4ZVSB 1X5TA 3DGVA 4ZPBA 5EGEA 3KG4A 1R89A 1KTQA 4PPDA 4NLGA 1JLFB 4YR3A 1IBKF 1FJGF 3U1MA 3I0SB 4DPTA 4ECZA 3TUIC 4CLZA 5L9NA 5BYRA 4DX7A 2NR0A 1QD1A 3NWGA 4OYBA 1FESA 5EWEA 2C2MB 2H5EA 2GO9A 4V19X 5KFAA 4J9RA 2EFVA 4K2XA 1Q1KA 1QJHA 4NASA 3SSSA 1VHFA 1Y3KA 4ZVGA 2B6AB 1FWKA 5GRRA 3FCWA 1U1QA 1KONA 4A8WA 3WHIA 5K8OA 2HMIA 1H0HB 1MSWD 4ZVQB 4IR9A 4I2PB 4JI4F 4I7FB 1O98A 1LW0A 3H20A 4F4KA 3EVWA 3BGOP 5AXKA 4ERDA 4KQZA 1S1TA 2E44A 1VS3A 1SB6A 1X4CA 4R8UA 2NPIA 3UN5A 4B3OB 4ICLA 3PHEA 4KY3A 4GO5X 4LUBA 2NCKL 4WZQA 2MKJA 2CQ0A 2OFHX 3AXMA 1F60B 3I0RA 4DV7J 1NK8A 1EI6A 2W2MP 4UUXA 4UPKA 3GFYA 3HHLC 2HVZA 3BH7B 4IRKA 2IPOB 4X66F 1B7YB 7FD1A 2K06A 4WYLA 2IJNA 3IGVA 1TV6B 1E6VB 4DMZA 4ZCIA 3EYZA 3CF5Q 2GSOA 2U1AA 2R2TA 5DLGA 4Z7YA 5KFLA 3A8KA 2M8HA 4OI2A 4L3KA 2W7OA 1ALKA 2NZ4A 2ACYA 2J0XA 4OHYA 5F8JA 1E3CP 2KB2A 3EM1A 4A48A 1GMWD 2H65B 2ASJA 4KJIA 5K5MA 1IVZA 1FTRA 2W8KA 2HHPA 3CO9A 3JQMA 4Y2KA 3TVYA 4NWBA 4TY9A 4E8UA 1UVIA 1WSVA 2BJ1A 2P9CA 4ZLNA 3N6LA 4WZMA 2JLFA 1R8HA 2OPRA 1HI8A 2YKMA 3OTBA 2F8MA 2MQPA 1RTDB 5KTQA 3GONA 2UUTA 4DCOB 3TZZA 4A8QA 4IOCQ 3MPDA 2VC1A 1GMWA 2MQ8A 2OFGX 3QYYA 2ILYA 3UWTA 4O44B 4LFAF 2CWKA 1SC6A 1JLBA 1V5VA 3OR2B 3W63A 3DYAA 2ZZMA 2IJFA 1M5HA 1ANJA 3G82A 4PCQA 1LFPA 1RAOA 2Z2MA 3Q86A 3EGWB 1YBTA 1RACB 2YKAA 5IC4B 1IBKJ 3W66A 1AZSA 4M5DB 2KXNB 4LF8F 4BDPA 1Y10A 4GVBA 4KTQA 3VZIA 2HNDB 2V94A 3N5BA 3R7NB 2XY5A 1IM6A 3OTOJ 4FP9A 1RYRA 3H8YA 5CD4A 4LF7F 3HFVA 4UOOA 8AT1B 3IAS9 2FJDB 3MHYA 5LL6d 3UCUP 4JUZA 1Q81T 2B7BB 3M2UA 5KFRA 2QV6A 5KFCA 5LSRA 1RWXB 3HF5A 3VHQA 4P52A 3DDNA 2IDEA 2ZDOA 3TJ8A 5GMKa 3RUBL 4F36A 2KM8C 1HQUA 4F4XA 3J7Z5 2W5QA 3D3CJ 4NLOA 3V81A 3J7A1 2IC3B 2YKOA 1N5SA 1QM9A 3DOLA 2GS8A 3L7OA 3MF5A 2XSJA 4TXSA 4USVA 3TZWA 1Y11A 2QFIA 3ETMA 3M8WA 4LIWA 4LR9A 2C2EA 3GR1A 2DPJA 1JLEA 3SZYA 4KO0B 4A8OA 3AHPA 2OPPA 3CD0A 5HO4A 4ECUA 2IMOA 4B9NA 1JLGB 3ZXWA 3MM8B 4G1QA 1HNZF 4YN3B 3LP0B 3RZAA 4DZ6A 3TAPA 3MCOA 3AOAA 4C2MA 3PX0A 5D77A 2ZJQQ 4KHPF 2JH3A 1XK8A 4UOCA 1YJ9S 5A8RA 2DGXA 1DQAA 3OR1A 4OJGA 4QWEA 2C3OA 2YPYA 1OSDA 4TY8B 1NB2A 4P2XA 3K17A 2LU1A 4R0JA 5J2PA 2YWGA 3CO0P 4LF1A 1U1KA 1M90T 3P3DA 3HULA 3F44A 2OHDA 2R42A 4ANDA 5T14A 4JI6J 4F4WA 1TVRA 5C24B 3E8OA 1XR7A 2WVDA 4EGLA 2BUNA 2HHHF 3MK0A 2V6AA 4IFVA 1Y7AA 1T03B 4FYVB 2JC0A 2XWYA 4YR1A 2ANHA 5GVQA 1TK8A 1RT2A 3TX8A 2H48B 4NE9C 1ELYA 3EX7B 4KAIA 2PE8A 3HZGA 4UQTA 1EKRA 2KT5A 3ZO7A 3EJMA 3KLHA 2VJVA 1JQGA 1PYSB 2GMLA 4PZVA 2ASLA 3ICLA 3QFWA 3N9UC 3HSZA 1W7WA 3CJKB 1J5OA 4ELTA 1MMLA 2BBEA 1SHQA 4AQYF 4ER8A 5F8GA 2G4BA 2MMYA 1NEEA 4C4WA 2PEBA 1Q7LB 1FI4A 4B9LA 5A8WA 2IA6A 1JMTA 3VTIA 5L1LA 4QR1A 4KV8A 4UQGA 1VLYA 1RA6A 2MZTA 1HDHA 3KJVB 3AA8A 1S49A 3FC9A 2KFZA 1TL4A 4LF5F 1RWOB 1F9EB 3RYLA 1KFDA 3QQCD 1F2GA 4YHHF 1WF1A 1BY9A 1FEEA 2GSUA 4DR2F 4QOTA 4GC7A 2QJ3A 5IS2A 3EUNA 1MNEA 2H3EB 1FCAA 1S6OA 4GTXA 2ZZTA 4DU8A 3QJJA 4DFPA 2YNIA 4Y2AA 2XS2A 2W5XA 1TK5A 1UETA 2YX1A 3R5JB 3MI7X 2B3TB 1JXVA 2I5JA 4IG3A 2UVWA 1TKTB 4ILMA 4QIWD 3LP1B 4AFFA 1S6QA 5L0EA 2XEXA 1JJCB 3OLBA 2BA9A 4B9MA 4RU2A 1RHJB 1N4LA 1Y00A 1RT7A 3PIOQ 1UVNA 2RMLA 2LA4A 5C42A 2MZJA 3IWNC 4F3QA 1ALIA 3O44A 4OI3A 3DOMA 1EHWA 1KC8T 3C16A 5FIIA 4DV3F 1S97A 3I32A 3LO3A 1PAEX 1EP4B 3AJ1A 4ID5A 2QL5B 2GJIA 4P9SA 5J2MB 3IN5A 2UXBF 5EN1A 3KHHA 3CT9A 3Q89A 4DUYF 2V2ZA 3GCXP 1U8WA 3IGYB 4NEYA 3UPFA 1VQYA 4RBVA 3R5AA 2CPHA 5B0AA 5KFUA 4KJDA 1HWLA 2RJZA 4YY3J 5IWAF 2XLIA 5C66A 3W61A 2B8PA 3C6TA 1S0MA 2WVCA 1X4BA 4RBUA 4M5MA 2XTJP 3NS7B 2Y1LB 3PHTA 4FKXA 5HVGA 1PAUB 2E1MC 3GSIA 5JVHQ 5HLFB 1Q8BA 5G4DA 3KJFB 1RU1A 3ILLA 4ETXA 1WI8A 3QT7A 3BBFA 1RTHB 2F7VA 3HI9A 4CLLA 2IVFB 2N3OA 3DRYA 1MMNA 1VRUA 2RQKA 3GWCA 4DI6A 4F4YA 3DKDA 4Q45A 1XMQF 1SKRA 4JV1A 4I4BA 5L1KA 1Q86T 4HYKA 3QAUA 1LQ9A 4P2SA 4DPYA 3MECB 4ZCKA 4BBYA 1UWAA 5DG9A 2OJ3A 3GB0A 2HIYA 1CS4A 1VI7A 3NWRA 2L08A 1VBKA 2WAQD 4B3MF 3RB3A 3AAWB 1LWCA 2AX1A 1NB7A 1KHKA 2CZ9A 2W4PA 2OTJS 3IR6B 3MDFA 3MPVA 4PXDA 2P2CB 3HKZD 1ZPWX 4PUOB 1RBAA 4P72A 2FZKB 4CYUB 4LF6J 1G6BA 4H4OA 1KP6A 2XY7A 3LOUA 2PA3A 1ROFA 2HGMA 4YY3F 5IWAJ 2L48A 1OIAA 2W2NP 5IOLA 2OPRB 3KLFB 1KHWA 2YKMB 2BANA 4K4VA 3BDGA 2Z0GA 2M8DB 4NLYA 4W98A 1AYEA 3V5RA 4M5LA 5F9LA 4C9DA 3NCQA 2VG6A 3OXLA 3KG0A 3M32B 3TA1A 2HVHA 2OEMA 4UPHA 1CULB 4CH0S 2CZVC 4DJBA 2LQ9A 4UOHA 5LM7E 3X3UA 5CD4H 2FPHX 3W5YA 2DD8S 1Y3JA 5HMZA 2CDRB 5T7LB 3CCQS 1AUDA 2GVDB 1ANIA 4IOAQ 5ETTA 3MOJB 1V3SA 1N0UA 2L9NA 4DL3A 4ED8A 2NREA 4FF3A 1TL1B 2BJEA 1WWHA 3HX9A 4W4MA 1JXLA 2Z2YB 1FFGB 2WSCC 1N8RT 3LALA 4MKBA 4F50A 5D3GB 4FKYA 2G13A 2HFOA 3NCPA 4F3MA 4A8XA 3CW2C 5L9XA 4KR0B 4ZLLA 1B4SA 2XYPB 2QFJA 1WTBA 3MCMA 3NGKA 3DLGA 3R5DA 1HYSB 2CAJA 2BV3A 2OELA 1O0PA 2QYCA 3BREA 4DR1J 1RHMB 3R8YA 3H2VE 4YR0A 1VQOS 1RAAB 2MZ1A 2FJWA 1RUSA 5K9FA 1FVQA 3WIVA 3I31A 4IDKA 3MR2A 3NEKA 1QE1B 4USUA 3EDQB 3IBWA 3T5KA 1WF2A 2ROGA 4OYWA 3PXGa 3DOLB 3SCKE 1SQEA 2ADCA 1XC9A 4B3SF 4UT4A 2ZNYA 1FJEB 2GA7A 4ES2A 1KNZA 2B4VA 1HARA 3CTRA 3GJQB 3KUGA 5H9FJ 1LV5A 2J0QD 1R27B 3Q8QB 4DV0J 2YWHA 4WXWA 1TKDA 2GLQA 4QJVA 3MMCA 1HWJA 2YNFA 1HMVB 3KLGA 4B9UA 2ACMA 2L9WA 2W5WA 1JLGA 3P45B 4ZHRB 3W3SA 3G6ES 3CJ8A 4ILLA 1FSUA 2DCUB 4KGVB 2YH1A 1WHYA 2WONB 3T5HA 4DV3J 3TQ1A 2JEGA 5D4LA 1ELZA 4DLGA 4ECRA 3FCVA 2QYGA 1LW2A 3I6PA 4USWA 1UW4A 1HBMB 3BN7A 4X64J 1TL5A 1FNMA 1SBRA 4B3TF 1S6UA 4TY8A 4CTAB 1DJ0A 2UP1A 5KFTA 4N76A 2H5JB 4FDIA 1AUSL 1TFYA 3R3TA 3WAYA 5E3CA 4NYOA 4ZIWA 2AP6A 4PXEA 1BMQB 2CJQA 3ZZTA 3LF0A 2VFUA 2RS2A 1XIQA 3IO1A 4CYSA 2B9EA 3DN9A 4KE5A 4CLUA 2V68A 3EMTA 3VAGA 4O4GA 4KB7A 1ZM3A 3OTEA 3FFIA 1EJJA 3SI8A 2BXJA 1LK5A 2RH6A 2VC0A 2IM3A 4HH1A 2RVJA 3Q3QA 1OYEA 4UY8T 3ET6A 1OWXA 4QU7A 1HNIA 3T5JA 4N5SA 5ADZA 1UP1A 2NUUG 4ZPTR 2AF6A 4GC6A 4FYWB 3CJKA 4Q5VA 1NK9A 1J5OB 3MEEB 1EZZB 2IY5B 2XB2D 3FMBA 1S1WA 1B8JA 3PFOA 2GCFA 2X51A 2RU9A 4CYRA 5A0YB 3KJVA 2PSZA 3MEDA 3KDNA 4UY85 3JQJA 3TR5A 2EW9A 2V4JA 4RNFA 2G0CA 1HR0F 2FHMA 3N0VA 4RX6A 4WP3A 2ZDPA 2CDQA 3B54A 1RAJA 5EUHA 1MG7A 2LYVA 1JLAB 2OPQB 3NGDA 5CYJA 1HI1A 2MLXA 5BXIA 3Q8RB 2EFPA 4ZCLA 3GV8B 2CQIA 3AD7C 4ETZA 1KN6A 1Q53A 1NJZA 1Y9OA 3NGRA 1GT8A 4ZVHA 3MR3A 1ZYQA 2F65A 1WHXA 3A1YG 3FK4A 3PW0A 4NCBA 1X4AA 4ZK7M 1IKYB 4U7UD 2VQRA 1A7GE 4ZPAA 1RAFB 2RUGA 5F8MA 5KFQA 5JVGQ 1UVLA 1RT4A 2IJRA 5KFKA 1U1MA 5AJ3F 4O3NA 2WVEA 2IIHA 4LVOP 3M30B 4I0WA 4K2JA 5MAOA 3L09A 1PCAA 2E7VA 3DDIA 4RLEA 2CA9A 1T7PA 4BHQA 1HD0A 2A10A 4WP8A 1RHKB 3UNGC 5B0GA 5D4NA
chains in the Genus database with same CATH topology
4LRBA 5EGHA 4ZG7A 3TG0A 4LREA 1ELXA 3DYCA 5IJQA 1ANIA 1ED8A 3MK0A 1Y7AA 5HRTA 3KD8A 1K7HA 1KHJA 2ANHA 2D1GA 1P49A 4YR1A 5GRRA 1ELYA 2W5RA 3M8ZA 4MIVA 5AJ9A 2XRGA 1O98A 4UPIA 4KAVA 1SHQA 4LR8A 1AJBA 4UORA 3UN5A 4GTYA 4NWJA 1E1ZP 1EW9A 1Y6VA 1ZEFA 2IUCB 1HQAA 1E33P 1KH4A 3UO0A 1EI6A 3DPCA 3NKPA 2GSNA 1HDHA 4LRAA 4UPKA 5L0KA 3T00A 5LIAA 3M8YA 2GSUA 2GSOA 1EW8A 1URBA 4TN0A 2GLQA 4ZG6A 1ED9A 1ALKA 3T01A 1AJCA 2W5WA 2W5XA 1E3CP 1FSUA 2W5QA 5L0BA 4LRCA 3UN2A 4QAXA 1AUKA 5L0EA 1KHLA 3M7VA 1ELZA 3UNYA 4CXSA 3BDGB 3MK1A 3IDDA 4FDIA 4LQYA 1ZEBA 2W8SA 2W5VA 4GTXA 1ALIA 4GTZA 3WAYA 1KH9A 3OT9A 4ZGAA 1O99A 2IUCA 1KH7A 4KJGA 1ANJA 3NKQA 2W5SA 4MHXA 3NKOA 4CYSA 2W5TA 4N7TA 3NKRA 1EJJA 4CXUA 1AJDA 3A52A 3WAWA 3IGYB 1E2SP 3WAVA 2RH6A 5LQQA 4KJDA 5C66A 1ALJA 5DLTA 2G9YA 3Q3QA 4NWXA 5IJSA 5DLWA 3WBHA 2W8DA 3SZZA 4UOPA 2XR9A 1KH5A 1AJAA 3WAXA 4UOOA 3CMRA 4KAYA 1B8JA 2IFYA 4GTWA 5DLVA 1ZEDA 5GOVA 4ZG9A 3ED4A 4CYRA 5LRMA 3UN3A 5TJ3A 3B5QA 3NVLA 1EW2A 4LRDA 3T02A 1ALHA 1KHNA 2X98A 1N2LA 4LR9A 1EQJA 3M8WA 3SZYA 1HJKA 1N2KA 1SHNA 3E2DA 4B56A 1KHKA 4MY4A 3TX0A 3NKMA 5K4PA 2ZKTA 2GA3A 2QZUA 4LRFA 2VQRA 3MK2A 4UPLA 4CXKA 5KXAA 5INHA 1URAA 5EGEA 3IGZB 3BDGA 4LR7A 3LXQA 3NKNA 3BDFA 5LRNA 4KM4A 4FDJA 3TWZA 4UPHA 3BDHA 4LR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRB A;  5EGH A;  4ZG7 A;  3TG0 A;  4LRE A;  1ELX A;  3DYC A;  5IJQ A;  1ANI A;  1ED8 A;  3MK0 A;  1Y7A A;  5HRT A;  3KD8 A;  1K7H A;  1KHJ A;  2ANH A;  2D1G A;  1P49 A;  4YR1 A;  5GRR A;  1ELY A;  2W5R A;  3M8Z A;  4MIV A;  5AJ9 A;  2XRG A;  1O98 A;  4UPI A;  4KAV A;  1SHQ A;  4LR8 A;  1AJB A;  4UOR A;  3UN5 A;  4GTY A;  4NWJ A;  1E1Z P;  1EW9 A;  1Y6V A;  1ZEF A;  2IUC B;  1HQA A;  1E33 P;  1KH4 A;  3UO0 A;  1EI6 A;  3DPC A;  3NKP A;  2GSN A;  1HDH A;  4LRA A;  4UPK A;  5L0K A;  3T00 A;  5LIA A;  3M8Y A;  2GSU A;  2GSO A;  1EW8 A;  1URB A;  4TN0 A;  2GLQ A;  4ZG6 A;  1ED9 A;  1ALK A;  3T01 A;  1AJC A;  2W5W A;  2W5X A;  1E3C P;  1FSU A;  2W5Q A;  5L0B A;  4LRC A;  3UN2 A;  4QAX A;  1AUK A;  5L0E A;  1KHL A;  3M7V A;  1ELZ A;  3UNY A;  4CXS A;  3BDG B;  3MK1 A;  3IDD A;  4FDI A;  4LQY A;  1ZEB A;  2W8S A;  2W5V A;  4GTX A;  1ALI A;  4GTZ A;  3WAY A;  1KH9 A;  3OT9 A;  4ZGA A;  1O99 A;  2IUC A;  1KH7 A;  4KJG A;  1ANJ A;  3NKQ A;  2W5S A;  4MHX A;  3NKO A;  4CYS A;  2W5T A;  4N7T A;  3NKR A;  1EJJ A;  4CXU A;  1AJD A;  3A52 A;  3WAW A;  3IGY B;  1E2S P;  3WAV A;  2RH6 A;  5LQQ A;  4KJD A;  5C66 A;  1ALJ A;  5DLT A;  2G9Y A;  3Q3Q A;  4NWX A;  5IJS A;  5DLW A;  3WBH A;  2W8D A;  3SZZ A;  4UOP A;  2XR9 A;  1KH5 A;  1AJA A;  3WAX A;  4UOO A;  3CMR A;  4KAY A;  1B8J A;  2IFY A;  4GTW A;  5DLV A;  1ZED A;  5GOV A;  4ZG9 A;  3ED4 A;  4CYR A;  5LRM A;  3UN3 A;  5TJ3 A;  3B5Q A;  3NVL A;  1EW2 A;  4LRD A;  3T02 A;  1ALH A;  1KHN A;  2X98 A;  1N2L A;  4LR9 A;  1EQJ A;  3M8W A;  3SZY A;  1HJK A;  1N2K A;  1SHN A;  3E2D A;  4B56 A;  1KHK A;  4MY4 A;  3TX0 A;  3NKM A;  5K4P A;  2ZKT A;  2GA3 A;  2QZU A;  4LRF A;  2VQR A;  3MK2 A;  4UPL A;  4CXK A;  5KXA A;  5INH A;  1URA A;  5EGE A;  3IGZ B;  3BDG A;  4LR7 A;  3LXQ A;  3NKN A;  3BDF A;  5LRN A;  4KM4 A;  4FDJ A;  3TWZ A;  4UPH A;  3BDH A;  4LR2 A; 
#chains in the Genus database with same CATH topology
 2BMB A;  4FPI A;  2XWX A;  1Q8L A;  1YG0 A;  3JQK A;  3KFW X;  3JTP A;  3OJS A;  2R8H A;  2JRS A;  2KM8 B;  2XZT B;  1L3U A;  2UU9 F;  2Q79 A;  3L3C A;  3DYC A;  3FEY B;  2RKI A;  5D4O A;  2QL7 B;  4B08 A;  5EGY A;  2WVB A;  4ED7 A;  1S1X A;  3PO4 A;  3HD1 A;  2DGS A;  1S1U B;  3W7B A;  1U1L A;  2F4V J;  3DLE B;  5LT5 A;  3CJQ A;  3FRY A;  4K4X A;  3IM9 A;  5IQ6 A;  1X5P A;  3HSD A;  1F1B B;  3LP2 B;  4DR5 F;  4ELU A;  4NZ7 A;  5CCM A;  4B3T J;  2Q43 A;  2QLJ B;  1NBE B;  2AHO B;  1WEY A;  1ZTT A;  4OZ1 A;  1T9V A;  1U7L A;  1C1B B;  2RQM A;  2EWH A;  1P1L A;  2ZM6 J;  1M5P C;  1SXL A;  4P10 A;  2K3K A;  4KAV A;  3SSQ A;  4USM A;  2MPU A;  4HH0 A;  3HP6 A;  3M9O B;  1HBU B;  2Z57 B;  1O6X A;  1O8B A;  3R5C A;  4OZ0 A;  5I3U B;  4DR1 F;  1SJR A;  1N0V C;  2XLJ A;  1ZEF A;  1KOO A;  2RRN A;  4OX9 F;  2ZJP Q;  1ZPV A;  1URN A;  5L0K A;  4WXO A;  4J9N A;  2R7T A;  1I51 B;  1SUQ A;  1VGY A;  2Y0S D;  3MM7 B;  4KYZ A;  4ZLP A;  3CXC R;  1ZAW A;  3ENW A;  1LWC B;  5DDR C;  5U47 A;  4R5P A;  3PAC A;  4DEZ A;  2MLY A;  1N5Y B;  1RKJ A;  3OFH A;  4C8Y A;  4F25 A;  1RWW B;  4YP3 A;  2HEK A;  4WE1 A;  2PFD A;  3PRV A;  2CPY A;  2V2K A;  3TEG A;  1H73 A;  2D1C A;  4CLY A;  1GQE A;  4WIQ A;  4DU7 A;  3G9C A;  4PWU A;  2R2U A;  1FEH A;  3U7J A;  1GXT A;  5KFN A;  3J81 Y;  1AUK A;  3KNG A;  2RE1 A;  3HHK A;  2VG6 B;  3I5C A;  4Y34 A;  2HHX A;  3QID A;  3L7P A;  1ACM B;  3K89 A;  3THT A;  2Y8W A;  2W5V A;  2Y3Y A;  4QYZ J;  3UD4 P;  2J8A A;  5E33 A;  1H98 A;  1XWL A;  3HZE A;  2FDN A;  3DRP A;  2NYH A;  3GJS B;  1B64 A;  2H51 B;  4Q7A A;  5T7L A;  4K4W A;  2MSS A;  2IUC A;  2DYA A;  4J9U E;  3ZNU A;  1U1P A;  2UUB F;  2DKO B;  1QUP A;  2FVQ A;  3G96 A;  2MXY A;  1HWK A;  3SCJ E;  4CXU A;  1TKX A;  1WUU A;  4FXV A;  3KK3 A;  3W62 A;  1H2U X;  5C7P A;  1RGV A;  1ZA1 B;  5D3G A;  2VOP A;  2YTC A;  4NLR A;  3BN4 A;  3PIP Q;  1J5E F;  5IJS A;  1RWK B;  1VK8 A;  2YNH B;  1AA1 B;  4F8R A;  4XDD A;  1WDD A;  3K0J A;  3OVB A;  3SZZ A;  1IBC B;  3DRX A;  3MEG A;  5AXL A;  3QT8 A;  4DN0 A;  1MLA A;  1VC0 A;  1OPZ A;  2XQC A;  3CMR A;  3C6U A;  3MGJ A;  2CFX A;  4NLW A;  3OSP A;  5HAT A;  1JIH A;  2C3Y A;  2RF2 B;  2FUG 9;  2XO7 A;  3KMQ A;  4ZG9 A;  3CJ5 A;  4OZL A;  3ED4 A;  1U6Z A;  2HBY B;  3MMJ A;  1M5S A;  2GJF A;  2XHW A;  4TQR A;  3KLE B;  4UST A;  4DL5 A;  1FXL A;  4DR5 J;  3NVL A;  2KXF A;  3M8P B;  3T1Y J;  2FJA B;  1X4H A;  4Z2X A;  1MN7 A;  3GFZ A;  4TLR A;  3TYT A;  1V6H A;  4DV2 J;  2NQP A;  3JSR A;  5C2G A;  4ECW A;  2Z8Q A;  1HMV A;  2JOQ A;  1TK0 A;  2XLK A;  3J7Y I;  1JXE A;  2QGF B;  3MTK A;  3PM9 A;  1RB0 A;  3MCS A;  4ES3 A;  2ILZ A;  2JNJ A;  5K4P A;  2YKN B;  1S9F A;  3CSK A;  2I2Y A;  3ZZZ A;  3VAL A;  1SIZ A;  3PNI A;  3W8G A;  3WBZ A;  2RQ4 A;  2QLF B;  2MQQ A;  4B3S J;  4Z7C A;  3BSN A;  4NL5 A;  4V19 J;  1U0H B;  1LKZ A;  1LWE B;  1Y5L B;  2GQC A;  1VRT B;  4H4M B;  1FXD A;  2GFF A;  2PT0 A;  1U47 A;  5LRN A;  1CPZ A;  4FDJ A;  4X4V A;  2D3U A;  4HI2 A;  1EW2 A;  4WFX A;  1ZAX A;  5F41 A;  5FDL A;  3EGN A;  3F73 A;  1Y7P A;  1HLW A;  1YWX A;  3M8S A;  4DV1 J;  2NSC A;  2I38 A;  4KFB A;  2DHS A;  3RAQ A;  2D69 A;  4OYP A;  4LRE A;  1ELX A;  2IAJ B;  3V4M A;  4C0H A;  1NDK A;  2GGP B;  2XUL A;  1TTH B;  1NSK L;  4EK2 A;  1R31 A;  3KD8 A;  1F2H A;  2KXH A;  4WII A;  3U1N A;  3JYT A;  2PMZ D;  2G2O A;  1N6Q A;  3A12 A;  1YGY A;  4ED4 A;  2DH8 A;  2W7P A;  1IKV A;  1K1Q A;  4MJK A;  1JLQ A;  4MIV A;  1ZZN A;  2ZD1 B;  3KG1 A;  4JI6 F;  3TVK A;  1D9D A;  5BR8 F;  2FLN A;  4IH5 A;  4DSF A;  5CYM A;  4WKY A;  1I1G A;  4OYZ A;  1S1W B;  2KYZ A;  1FXR A;  1ITP A;  5HMX A;  1WTF A;  3QIP B;  2XMT A;  1S6P A;  4OX7 A;  3R27 A;  2R7R A;  4NWJ A;  2OH2 A;  4HTI A;  5J2N B;  5DGB A;  3ZTR A;  1KLN A;  4ZPV R;  4IQM A;  1S99 A;  4Q44 A;  3SCL E;  2DRD A;  2HQC A;  4UZC A;  5HBM A;  3W9J A;  4OMF G;  1QTM A;  4ZS6 A;  4I2Q B;  4U9R A;  5C5J A;  1JLC A;  2W1B A;  3RAM A;  3S6E A;  1HFE L;  4ZN1 A;  3KK1 A;  2FZG B;  2QX0 A;  1QLN A;  2IYI A;  4QWC A;  2B8Q A;  2DK2 A;  2WB1 D;  4RW9 B;  1PYO B;  1YBU A;  1IKY A;  1R6Y A;  3OTO F;  5D8H B;  3QSY B;  2QE5 A;  3BBB A;  1ZS6 A;  5L0B A;  4TKT A;  3ELH A;  3TI0 A;  2FVC A;  3GR0 A;  3T1Y F;  1TAU A;  3ZC4 A;  4KGK A;  1JLF A;  1TU0 B;  1R8B A;  1R8P A;  2BE9 B;  2ZH6 A;  2MLZ A;  3I0S A;  5KFX A;  3PO5 A;  1EQ0 A;  2YWK A;  5D0R A;  5HSP A;  2NXC A;  2R2R A;  2GHW A;  4ECQ A;  1XJW B;  2DH7 A;  3W9I A;  2JSX A;  3TA2 A;  2XCA A;  4MFB B;  4NXN F;  2B9W A;  3DC2 A;  2DR9 A;  3CJS A;  3QRR A;  1N88 A;  3ISZ A;  2JEI A;  5CAB A;  2V50 A;  3US5 A;  5CH7 B;  2ZBC A;  4EZ9 A;  1C1C A;  1SH2 A;  1S1X B;  4MHX A;  2AJ0 A;  1R8C A;  1S1U A;  3ITH B;  4CDI A;  7FDR A;  3DLE A;  3D7S B;  5I3Q A;  4RU9 A;  3VVU A;  2AQ4 A;  3WDO A;  1E2S P;  3LP2 A;  4NOH A;  2XM3 A;  3J80 Y;  3TAN A;  1FTC A;  3SDE B;  1WOR A;  4TU8 A;  1U8S A;  1SV5 B;  1C1B A;  1AT1 B;  1IR2 A;  2CVE A;  2LEB A;  2DNH A;  4KHP J;  1WC6 A;  3WAX A;  2ZC4 A;  1CQN A;  4HT7 A;  4XPE A;  1KSP A;  3RGI A;  1SC3 B;  3FBF A;  2NS1 B;  4YB7 A;  3PX6 A;  3NGS A;  2F4F A;  2OO4 A;  4LFB F;  1JK9 B;  2KT3 A;  1VIS A;  3J7A N;  3UDE A;  3RBX A;  1EQM A;  2FJE B;  4CH1 A;  2HFN A;  1YHQ S;  2YX7 A;  2HK3 A;  4B9S A;  2ZZN A;  3NNH A;  2VG5 B;  2QA4 G;  2HQF A;  2QLW A;  1N2L A;  4MAK A;  1B0P A;  2LEA A;  1VFJ A;  4USH A;  3E2D A;  1NZ8 A;  3DLJ A;  3HVW A;  5DZ6 A;  1TV6 A;  3S01 A;  2IM2 A;  3CJT A;  4ZVU B;  4I7F A;  2VV5 A;  1TUW A;  3LWM A;  4WCE Q;  4RR5 A;  1E6Y A;  1YTY A;  4UPL A;  3N4W A;  1MMD A;  3KHL A;  2IDL A;  3GSD A;  3IRX B;  4PKD B;  2Y8Y A;  2AJQ A;  2JWN A;  5E7O B;  5HQM A;  4ZCM A;  3DI6 A;  3QZ8 A;  3D68 A;  3G2X A;  5M2P A;  3IBC B;  2MKS A;  4KHM A;  4PPZ A;  1RKI A;  5IFM A;  1WOO A;  1DAX A;  1WKJ A;  3GTY X;  4CRJ A;  2DIV A;  4DCP B;  2LU2 A;  1KH4 A;  1X31 C;  2RS8 A;  4GRS A;  4Y28 C;  2CPD A;  2CPE A;  4A8F A;  4PG6 A;  4RW8 A;  5KFV A;  2CG4 A;  4O44 A;  2XS7 A;  1IBM J;  4NLX A;  2ATC B;  3U27 A;  2AYE A;  2K1R A;  4DOZ A;  5DQI A;  1TKX B;  1WHW A;  1ED8 A;  2MHE A;  3NP5 A;  2J76 E;  5B0B A;  1OSC A;  5KG4 A;  4U7U K;  4I6Y A;  3TQE A;  3BR9 A;  4TU7 A;  3ZTS A;  1I6J A;  2DY9 A;  3D66 A;  4Y0F A;  2EBG A;  1PC5 A;  2AT1 B;  4RWX A;  1AZS B;  3KYL A;  2HHQ A;  5E2Q A;  2W5R A;  4DX8 H;  5AJ9 A;  2OAU A;  1RE1 B;  4NML A;  4RW4 A;  2ASY A;  3ZFV A;  3JAM Y;  4Q43 A;  4XIU A;  2FTR A;  2JLE A;  3K5M A;  3N6M A;  5F8L A;  4CM0 A;  5L8R C;  4JI1 J;  4YME A;  2QLB B;  3QRP A;  2YKQ A;  1PSD A;  1QY7 A;  5HI7 A;  3M2U B;  2LEC A;  3KLE A;  4NEZ A;  1VQ4 S;  3VAM A;  1Z4U A;  3M8P A;  4MK7 A;  2AEF A;  2NSB A;  3DNC A;  4LRA A;  1HQU B;  3IM8 A;  3UVJ A;  5AE3 A;  4OI4 A;  2BJ9 A;  4LF2 A;  4NLD A;  5CYQ B;  4JV0 A;  1WI6 A;  2YVS A;  1R0A B;  2H4Y B;  4C11 B;  1QSY A;  4FS1 A;  1RWN B;  3A3P B;  1I94 J;  1F5A A;  4M5D A;  4KPY A;  4X66 J;  2XSJ B;  2HND A;  4PQU A;  3D9B A;  2MDA A;  4JI2 F;  1RAD B;  3MUV P;  4B9T A;  1G1X A;  1YI2 S;  3BH6 B;  5ETQ A;  2LEP A;  3DLL Q;  1FWP A;  5DDO C;  4OI1 A;  4JV5 J;  2H4W B;  4F2R A;  1VJQ A;  4EBD A;  4K4Y A;  3KNA A;  3MM8 A;  4LVN P;  3UI3 A;  1YJ7 A;  1H72 C;  1U45 A;  1S12 A;  1HL6 A;  2UXD F;  2GMH A;  5D0G A;  4F04 B;  3IRW P;  1BUX A;  2W2P P;  3RRH A;  2X1G A;  2Y1I A;  1WC5 A;  3V81 B;  4CCH A;  2OSR A;  3MUM P;  4OIX A;  3OR1 B;  4RO0 A;  3G4S S;  2UUA F;  4ZGA A;  2F1F A;  3R6L B;  3PRB A;  5G0R B;  1HWI A;  2WSF C;  3CVK A;  2VJU A;  1NH7 A;  2I1R A;  4ECV A;  3H40 A;  3ZTQ A;  3T6B A;  3L9Z A;  1TVR B;  3CDA A;  5C24 A;  2M3D A;  2ZH5 A;  4DF8 A;  1MWZ A;  3GII A;  3ZTP A;  2Q6B A;  2QL9 B;  4X62 J;  1T9Y A;  5KFG A;  5LQQ A;  1YJV A;  2LQB A;  1T9T A;  3LP0 A;  2G9Y A;  3MFI A;  1U2F A;  1RIS A;  1UAW A;  3VQT A;  1X7V A;  2C3P A;  1RT5 A;  1FER A;  2EK1 A;  4KBI A;  1Y5N B;  1YKW A;  5AJ3 J;  4OX8 A;  2AZ1 A;  3D0G E;  3TO8 A;  5B0C A;  1FT8 A;  1SH3 A;  2B4O A;  2I6W A;  4H4K C;  5DM7 Q;  5J2P B;  2LQ5 A;  3BB5 A;  5J2N A;  4NXM J;  2XZW A;  4B3R F;  4PG8 A;  2X3G A;  2AW0 A;  4U96 A;  1UJ5 A;  2VBZ A;  3A8J A;  4LRD A;  3T5L A;  5DDQ C;  2OSQ A;  1CC8 A;  3N79 A;  4IFV B;  4U95 A;  2KI2 A;  4DUT A;  4PXC A;  5DO2 A;  2BM0 A;  2G0I A;  1JLC B;  5A6W A;  3TP2 A;  5GAG U;  4ZJO A;  1TEL A;  4FF4 A;  1JLB B;  3OR2 A;  3NXZ A;  4OFZ A;  3KK1 B;  1N2K A;  1EJ7 L;  1TUV A;  4NI2 B;  2CIM A;  2CRL A;  2M9K A;  2RIL A;  3E01 A;  5FLX Y;  4CZC A;  4JI2 J;  4FNI A;  3DRS B;  1WOP A;  3CCE S;  4I1T A;  3NMA A;  1GX5 A;  1NPP A;  2HWH A;  5HK4 A;  1Y0H A;  1MU2 A;  2BE2 B;  3NMR A;  3O6Q A;  2K7J A;  2MQN A;  3H90 A;  2CQH A;  3TUZ C;  2XI3 A;  2PN6 A;  3A8E A;  3BM7 A;  3V2U C;  1HBN A;  3UE2 A;  3SYZ A;  2F4V F;  4QU6 A;  1NJW A;  1CJT A;  2M4M A;  2E5L J;  4K4S A;  4O3P A;  3M6V A;  2QRR A;  3HHL B;  3LAN A;  2FLO A;  5AT1 B;  1RT7 B;  3SCI E;  3TWZ A;  5IT0 A;  2AV5 A;  3DHX A;  2DHG A;  2DIT A;  4LFC J;  1BC6 A;  2EKY A;  4ZVP B;  4DHV A;  2W25 A;  4LQ3 A;  1A0O B;  4N41 A;  4K5S A;  5K14 B;  1C0T B;  3H25 A;  1HPZ B;  3DLB A;  1VQL S;  5LJ3 Y;  3T1H J;  2GVZ B;  4NMX A;  5J2M A;  2DXD A;  2R4F A;  2A6O A;  1T8E A;  4IG3 B;  3NAH A;  4EYI B;  2I5J B;  4DR6 J;  3C14 B;  1KHJ A;  1BWV A;  2DHA A;  3MM5 A;  4PXB A;  1HWU A;  4BC7 A;  1SV5 A;  2XGQ A;  1K0V A;  3FBC A;  4ED3 A;  1F5B A;  1UFL A;  1OMS A;  3LPY A;  4QIG A;  3FBE A;  3MM9 A;  3OVA A;  1VJW A;  4WFY A;  2V4R A;  4DLE A;  2AGQ A;  4JI3 F;  1IQT A;  2IRU A;  1NK6 A;  1YLX A;  2XMA A;  5C42 B;  3M05 A;  4X65 F;  4DV6 F;  2Q3P A;  2YWW A;  3OW2 R;  3LGH A;  2G2Y A;  5H9E J;  2HNY B;  2WW8 A;  3WX4 A;  2V8P A;  1VRU B;  3A3O B;  3LUY A;  5HMW A;  3HSG A;  2H5I B;  3MR5 A;  2LXU A;  3D6H B;  1MRO B;  4EYH B;  2G0J A;  2A0F B;  3QSI A;  4NLP A;  3BDE A;  1HKA A;  3TNV A;  3AXK A;  3GP9 A;  3W8P A;  5LIA A;  4CT9 A;  3CJ3 A;  1H3D A;  4OV6 A;  4RNN A;  4QQB A;  3T1H F;  5KG0 A;  2HKE A;  2BQ3 A;  1D9F A;  4LF4 F;  1NU4 A;  1ZZF A;  1NDP A;  4CO2 A;  1F0X A;  1S4F A;  3GPA A;  3DOK B;  4DSJ A;  4NLT A;  4Q8E A;  4IQX A;  4RJV A;  2DNZ A;  1LEO A;  3LAK A;  2FJV A;  2NZC A;  2UVU A;  4F0K A;  4K8R A;  2D74 B;  2QMW A;  2JL9 A;  4P71 A;  6AT1 B;  4B3O A;  3W60 A;  2JZ5 A;  3CCM S;  2HHS A;  1T3O A;  3N28 A;  3M6W A;  1K9M T;  3PJ9 A;  3BDG B;  1YJW S;  1FJC A;  1YQH A;  4ES1 A;  1SJ4 P;  2P6S A;  2HFS A;  5FJ4 A;  4KC5 A;  3WC0 A;  4LQY A;  2W8S A;  4X4R A;  1CSJ A;  3P49 B;  4C8N A;  3D28 A;  4EO8 A;  5F8N A;  4NYP A;  3D0I E;  4NLS A;  5BR8 J;  3H4B A;  2OML A;  2FVS A;  1LWX A;  1MW7 A;  1VYA A;  1M5O C;  2HLU A;  1HW9 A;  1RZM A;  2FQQ B;  2KG1 A;  2C2O B;  4QYZ K;  4CNZ A;  3Q23 A;  2WVF A;  3PYF A;  1W2B R;  1SKW A;  3C19 A;  2Q6C A;  3QAT A;  4ED5 A;  1SCJ B;  1UVK A;  3KLF A;  2CQC A;  4H4K A;  4HT5 A;  2GIQ A;  4OZ2 A;  4PYD A;  3W2V B;  4X4U A;  4LSN B;  1UEV A;  4HLB A;  2O5D A;  1HQ2 A;  2FY8 A;  2J5A A;  2MEW A;  2YNI B;  3LW5 C;  4TLQ A;  4CM2 A;  2EFG A;  3CWJ A;  2YXL A;  3M32 A;  4ZIT A;  1WKL A;  2DGW A;  1FVS A;  1I5O B;  2GZO A;  4NA2 A;  5LOQ A;  3V6H A;  2G9O A;  5HJY A;  3HPO A;  2ZBQ A;  2ZH9 A;  2VIH A;  1FK9 B;  1V3R A;  5DLV A;  2QA1 A;  2B9X A;  2MJU A;  4X64 F;  2ALZ A;  2J8S A;  3K7R A;  3SFU A;  3WX8 A;  1R0A A;  2PC6 A;  3SEO A;  2ZUA A;  3FRZ A;  4YUD A;  3OUY B;  2OI2 A;  1RYS A;  2ADB A;  5DRK A;  1TL1 A;  3H4D A;  3RJM B;  4F67 A;  3Q22 A;  1P9Q C;  3THV A;  4D3H A;  4B56 A;  4J5O A;  4C97 A;  4DWI A;  4NA3 A;  4DXL A;  1X9W A;  2VZ9 A;  2BKO A;  1UWB B;  4CQ1 A;  2N82 B;  2NXE A;  2R7U A;  1QUV A;  3FUY A;  5GMD A;  5K8M A;  3MXH P;  4URG A;  3BYP A;  5JJB A;  2VH7 A;  4IH7 A;  4ZP7 A;  2COL A;  1N48 A;  3BDF A;  2MJN A;  2IMW P;  1KS2 A;  1LW2 B;  1FO1 A;  3N6N A;  4DZD A;  2IYG A;  1HBM A;  3JSM A;  1XMO F;  4Q2L A;  9RUB A;  1U4B A;  1KR4 A;  1JNR B;  2HRU A;  2V34 A;  2PDA A;  4IG0 A;  4J7C A;  2CPZ A;  2W4C A;  3OL8 A;  2C2D A;  3W65 A;  3AQO A;  4RPF A;  4DN9 A;  3J7Y U;  2PMW A;  2B51 A;  2E5G A;  3KLG B;  4OI6 A;  1WG5 A;  4I69 A;  3IWX A;  1IM4 A;  1SIW B;  1GEH A;  3VAH A;  1NKE A;  2BJ3 A;  5ETL A;  1XMB A;  1URR A;  1NJX A;  2WON A;  4YS2 A;  4EBE A;  2VA3 A;  2EEY A;  4ED0 A;  4HHU A;  1RT5 B;  3I4H X;  1HNX F;  4MKA A;  2GAH C;  3ET6 B;  3KDO A;  1YSJ A;  2KN4 A;  3IR5 B;  2UUC J;  1ZET A;  4DFM A;  1CJV B;  1L3S A;  3OFG A;  1IKX B;  4FNH A;  1PJ5 A;  1NAQ A;  1Z1Z A;  2OIH A;  2EFQ A;  4BWM A;  4MT1 A;  4GTY A;  4Y6I A;  2BJ8 A;  2IM0 A;  5IXU A;  2FJB B;  3SQO P;  4QPT A;  5LSL A;  1EW9 A;  2Z30 B;  2CPI A;  3P8B B;  4TYB A;  3O2I A;  4BWJ A;  1S1V B;  2NXN A;  3I56 S;  4LBP A;  3EWG A;  1WEL A;  3P96 A;  3LAM A;  1Q82 T;  2Y0B B;  1CQM A;  3PW4 A;  2XG8 A;  1EW8 A;  2NLW A;  1DQ9 A;  3SMZ A;  3CGI A;  2EK6 A;  3LGN A;  1FKO A;  1O5J A;  1AJC A;  2R8G A;  4LF4 J;  1RHU B;  4PG5 A;  3CC2 S;  4B3R J;  2LQJ A;  1KQK A;  3ENV A;  3Q8Y A;  1N33 F;  2CG8 A;  1TAQ A;  3ETO A;  2CQ1 A;  2FHO B;  4QPX A;  1CJT B;  2ZOF A;  2D3O R;  1N5Q A;  1RHR B;  2RH3 A;  2M5Y A;  3B4D A;  1T9W A;  4P7T A;  5GAH I;  2VQF F;  3PYE A;  4AL6 A;  2BDP A;  3M30 A;  2O01 C;  4J9V A;  4L72 B;  2RHS B;  2ZFH A;  2LQ8 A;  4R0E A;  1D1U A;  1WJ9 A;  4JI1 F;  2AYG A;  1KH9 A;  2VFT A;  1ULR A;  2P9G A;  1JLA A;  1BQM A;  3EVM A;  4IDK B;  4BCA A;  2GVZ A;  3TVZ A;  4U7C A;  1IKW B;  2OTL S;  3AQP A;  2NPF A;  2RNE A;  1JJH A;  3M1V B;  4JP8 A;  3SQG A;  4KJG A;  1RHQ B;  3R7B B;  4X4Q A;  3P6Y C;  3O3L A;  4RUH A;  2M88 A;  1TKZ A;  2ZUG A;  1UZH A;  3BF4 A;  3I82 A;  4DQI A;  1WNE A;  2V5H G;  4JOU A;  2XS5 A;  2BRK A;  1U2C A;  2ERR A;  1LWF A;  3P5T L;  2E9Z A;  3GYG A;  1KBR A;  3JTN A;  1NK7 A;  4UOP A;  2RQC A;  1YZ6 A;  2BJ7 A;  2DVI A;  1YIJ S;  3BS9 A;  1WC3 A;  4ELV A;  3HHL D;  3MPY A;  2AYM A;  2VDH A;  4PG4 A;  2VFS A;  4PAA A;  4QIV A;  3HHE A;  4C98 A;  1ZED A;  4LSZ B;  2J0W A;  1RTI B;  5I3U A;  1VQM S;  1ZOT A;  3PEH A;  1B99 A;  4OHX A;  2DEJ A;  3R9L A;  3V6D B;  3AD8 C;  3KK2 B;  3UW1 A;  4CTA A;  2DB1 A;  4LBH A;  1ZA2 B;  4F4Z A;  4URQ U;  3MM7 A;  4HR2 A;  4RUC A;  1DUR A;  1OY8 A;  2B4P A;  4PWD A;  1NKB A;  1LXN A;  3HKW A;  4ECT A;  2ABY A;  3TX0 A;  1XR5 A;  3BQ0 A;  1NHK L;  5J2Q B;  3VQS A;  2HHT A;  4P75 A;  3FSI A;  1VLO A;  2V8V A;  4GKJ F;  1QTN B;  2WCX A;  4WK3 A;  1N36 F;  2VUG A;  5KXA A;  1U25 A;  4DBQ A;  1B7F A;  5INH A;  5FD1 A;  4EUV A;  2LVW A;  5AXM A;  2ATL A;  1SH0 A;  3OFE A;  3NNC A;  2DR7 A;  1SC4 B;  1CJK A;  2I8E A;  4NA1 A;  3T41 A;  2W9C A;  1NPK A;  3VGS A;  3PW5 A;  1VIX A;  4YDD B;  2IA0 A;  4W92 B;  4U67 Q;  1S7H A;  1NDL A;  2DXE A;  4CT8 A;  1T11 A;  4LF7 J;  2BOA A;  1UZD A;  2MKY A;  3TUP A;  2HSE B;  2CNO B;  2I0X A;  4OYX A;  2AYB A;  4M5G A;  5EGH A;  1FX2 A;  1VHI A;  2RB7 A;  2CJA A;  3ILO A;  3OL7 A;  2VG7 B;  3S8S A;  4JV2 A;  4RW6 B;  3IC1 A;  2O1P A;  1NDC A;  5IJQ A;  2UUB J;  2WBR A;  1CBK A;  4WE1 B;  4RW7 A;  2W8L A;  2OP5 A;  2HNZ B;  1F9H A;  1HQE B;  1YK9 A;  3W2V A;  4FBU A;  1HNW F;  1IJF B;  2EG1 A;  2KFY A;  4Y2C A;  1U2R A;  4CI0 B;  2CQ3 A;  3W2W A;  5D6G A;  1J5E J;  2XRG A;  3PTW A;  2XHC A;  3BO3 A;  4NCA A;  1YRU A;  4LF9 F;  1YVF A;  5LMN F;  2DXF A;  2AZ3 A;  1KDN A;  3DRP B;  1H7W A;  4A8M P;  1JJ4 A;  1NLK L;  3ENA A;  1F9F A;  5CZX A;  4F4A A;  2CQG A;  1QAI A;  4FF2 A;  1FA0 A;  2ZE2 B;  2HBQ B;  1ALJ A;  4F3O A;  2GO8 A;  3QLH A;  4KH0 B;  3UO0 A;  3R7S B;  5EWG A;  3DPC A;  3ENQ A;  2VON A;  2CJB A;  3JB9 k;  2GIF A;  5L46 A;  2HPU A;  1RTJ A;  3HVA A;  3KK3 B;  1HHS A;  2XMW A;  2DNR A;  2LKZ A;  5GAD U;  2X1A A;  5KG7 A;  1VC6 A;  3R6G B;  4HDG A;  1N52 B;  3HO1 A;  2QO3 A;  1N5V A;  3EDR B;  4J9Q A;  2O67 A;  3O1L A;  2YNH A;  1WEZ A;  3GIK A;  2P9E A;  3DM2 B;  2MQO A;  3UR0 A;  5A8K A;  3I87 A;  3DLK A;  1KHV A;  4XAK A;  1SL0 A;  2L41 A;  1X9S A;  3V6K A;  2BM1 A;  1HR0 J;  2WK4 A;  1RWU A;  4Q0B B;  3HT0 A;  3NS5 A;  2HS0 A;  1H74 A;  2F3J A;  1U0H A;  2VPW B;  2ZWO A;  2C2Z B;  1VRT A;  5L39 A;  4FYD A;  3IDD A;  1RWM B;  8RUC A;  4UOG A;  4GTZ A;  1UFW A;  2Q1L A;  4OX6 A;  4Y3C A;  4HAC A;  1CVJ A;  4JV5 F;  4ZPD A;  1WD6 A;  3DGP A;  3HD2 A;  2LP4 A;  5KT6 A;  4WFN Q;  1DRZ A;  4PRF A;  4DX5 A;  4G6V B;  1NPR A;  3MMB A;  4Z37 A;  4QCL A;  1Q8I A;  3CED A;  1GXU A;  3NCR A;  1GXL A;  3MAA A;  3ZZU A;  3WAW A;  1UEK A;  2XMK A;  3DFE A;  4LSL B;  4E98 A;  1N5Y A;  2EFO A;  1U48 A;  2V9W A;  3WBH A;  2HAF A;  2AJ2 A;  1U09 A;  1JLQ B;  1AJA A;  1GMU A;  2KH9 A;  2WRM A;  3MPW A;  1IBL J;  1Q7Y T;  2MST A;  3BO4 A;  4JI5 J;  4ZVT B;  1AB8 A;  1FKP A;  2J7U A;  4LF9 J;  2DO0 A;  5CYM B;  5BJR A;  3MFH A;  1O51 A;  4Y00 A;  3BO2 A;  1DFD A;  5T41 A;  4KFB B;  3VR1 A;  2LFV A;  5HN0 A;  5KFM A;  3CMA S;  3UN3 A;  1TFW A;  1N56 A;  4DV5 F;  2VIC A;  1PC4 A;  4KIA A;  2AKW B;  2HS3 A;  1S48 A;  4ENO A;  5KFF A;  1XNQ J;  4F02 A;  4WKR A;  3IGN A;  2KG0 A;  4DR2 J;  2XY6 A;  3NKY A;  4KGZ B;  2F9D A;  3VWS A;  1HJK A;  4OHW A;  4DG1 B;  1SHN A;  1U0S A;  1FKO B;  3UFC X;  1RAB B;  1RA7 A;  2VFR A;  2X7I A;  5I3P A;  2IBK A;  2CPX A;  3JSY A;  4MKY A;  5IQQ A;  3NKM A;  2ZBR A;  8ATC B;  5LMU F;  3W9H A;  2FLL A;  2WB4 A;  2HWT A;  2QZU A;  4OLO A;  1G7C B;  1K47 A;  1EIY B;  2DTJ A;  2XMM A;  1FE0 A;  2ROE A;  1F6T A;  1VQS A;  5H1S V;  1NHU A;  1KKH A;  3CIZ A;  5JUM A;  3PZP A;  2FY1 A;  1S6P B;  4JI7 F;  1X60 A;  5EX0 A;  2F8H A;  1NSA A;  4DR7 J;  1FRJ A;  2B7C B;  2H1Y A;  2RRB A;  3W5X A;  4JI8 J;  3B8H A;  2G2Z A;  5F3Z A;  4FVC A;  1BXN A;  2ZC3 A;  3B82 A;  3D1Q A;  1HBO A;  3F56 A;  3TA0 A;  5HBM B;  3H5U A;  3M2R A;  1NJY A;  1D9A A;  2HZA A;  2C42 A;  2J9C A;  4NRT A;  3TZY A;  1OPI A;  1GMV A;  2UV8 A;  4M5H A;  2DR5 A;  4OI0 A;  3G6Y A;  3E51 A;  4IO1 A;  1NJI T;  2HRT A;  3D6T B;  4JI4 J;  3BR8 A;  3MAH A;  4LIR A;  2KJW A;  4ZMM A;  3KOA A;  4AL5 A;  2E5L F;  3KMS A;  3PW7 A;  3M8Q A;  4IRD A;  2YQ3 A;  4WFZ A;  1LOU A;  1D0E A;  1FRH A;  2W7A A;  4QIF A;  5LMN J;  4ZVR B;  2PII A;  1VMB A;  3W64 A;  2R7X A;  4V1A k;  2K2P A;  4DPU A;  3M9N B;  2D1G A;  2MYF A;  1UJ6 A;  1FRM A;  1NH8 A;  4HHJ A;  1S4E A;  5E3R A;  3Q2T C;  5B08 A;  2VU5 A;  2DH9 A;  3PV8 A;  3SDE A;  3PEJ A;  5L1J A;  2CNN B;  3PX4 A;  2PFF B;  2POK A;  2UXD J;  4DL6 A;  2AD9 A;  4Q8F A;  1AJB A;  4QW8 A;  3LH2 S;  2A18 A;  3TOQ A;  4C8K A;  2HHV A;  1UEU A;  3HSJ A;  4DPW A;  1M1H A;  1LWE A;  3I9V 9;  4JI8 F;  5DQG A;  1VQ9 S;  2HUR A;  4XK8 C;  2VPX B;  4P74 A;  1X5O A;  2YNG A;  2EFN A;  3HDS A;  4CIO A;  2R8K A;  2V0N A;  4CLK A;  3UDV A;  5A2Q U;  1H7X A;  3T00 A;  3D2W A;  2M7S A;  3M8R A;  4G65 A;  1X0P A;  4ZA1 A;  1URB A;  2GC8 A;  1TL7 A;  5CQG A;  4DUZ F;  3CME S;  2XMV A;  4JI5 F;  2XZD B;  2IAJ A;  1SPB P;  4I6A A;  2GGP A;  3TAM B;  4OZN A;  4CLF A;  5EDW A;  1HI0 P;  2BQU A;  1R0C B;  2VQE F;  1AFI A;  4YHH J;  3BPD A;  4LFA J;  3BKT A;  3IBF B;  1T02 A;  4LQ9 A;  1IKV B;  5KG1 A;  2ZH3 A;  2QA2 A;  5D0H A;  4ZP9 A;  3UNY A;  1X4D A;  3MWB A;  2RUS A;  6FDR A;  5EX3 A;  4AXI A;  3D67 A;  1HNV A;  3MK1 A;  4QBU A;  3TZX A;  1NME B;  3MZI A;  2VFV A;  3BV8 A;  4LF8 J;  3Q8U A;  1G4C A;  3QIP A;  1DLO B;  2VG7 A;  5D4P A;  2DHH A;  2QTW A;  1FX4 A;  1WG1 A;  1QAX A;  4K7Q A;  1JX4 A;  1O99 A;  1K0T A;  1WEX A;  3KTQ A;  1WAC A;  3KJQ B;  1YRT A;  3DMJ B;  2VPZ B;  3MM6 B;  3H2L A;  3K59 A;  4MH8 A;  1EET B;  2D3Z A;  2K1R B;  2HNZ A;  2RT3 A;  3DU6 A;  2QMU B;  4CH7 A;  4EWT A;  4AUK A;  3IRX A;  5F0W A;  3VGT A;  4C3M A;  2OUG A;  2ZWP A;  4KGX B;  4QWB A;  3ZZR A;  3O8W A;  2QC3 A;  5KG2 A;  2Y9H A;  1FD8 A;  2QMX A;  2XNQ A;  3CNQ P;  4ED2 A;  4RW9 A;  3QO9 A;  3AOD A;  4WU2 A;  1RTZ A;  2GQ2 A;  4WF9 Q;  1KVI A;  2B5J A;  1UTA A;  5LSO A;  1M1G A;  4RW4 B;  4M8L A;  1Q4R A;  2P5V A;  5KFO A;  4EEY A;  4K4T A;  1IBL F;  3VV2 B;  4QWA A;  4GTW A;  2HS4 A;  1C2P A;  3Q8S B;  2HZV A;  1P8G A;  1UPM B;  1PJ6 A;  5TJ3 A;  5HVH A;  1VK3 A;  3T02 A;  5KOW A;  3D0H E;  4M1K A;  1HNZ J;  4FS2 A;  1KHN A;  1NRK A;  1OQ3 A;  5BYQ A;  4C11 A;  3VAJ A;  2CQ2 A;  3GYX B;  4EMD A;  3HFK A;  2VQF J;  4LMZ A;  3BPS P;  1YJR A;  4DR7 F;  3PVX A;  3PCO B;  1GTE A;  3C66 A;  3H42 A;  3ITH A;  3Q83 A;  3EIC A;  4Q2M A;  4M5I A;  5IV4 A;  2C1E B;  3OVS A;  3PYG A;  1VQK S;  2GA3 A;  3DLK B;  1XBW A;  2M0G B;  1NUE A;  2D7S A;  4CXK A;  2DIS A;  4HEA 9;  5ETS A;  1R3N A;  4E0D A;  1U02 A;  2B0G A;  3PJW A;  1UKU A;  2I9S A;  3OPK A;  4YB1 P;  2J6S A;  1R43 A;  3E3X A;  3RR7 A;  1WKK A;  3H7H B;  3QGI A;  2KU7 A;  4NCG A;  3C46 A;  4QWD A;  2WSE C;  2UXC F;  5CYQ A;  5IM0 B;  5KT2 A;  3RBD A;  4LR2 A;  2YQ0 A;  5IC6 B;  2IRX A;  2MKH A;  2Z2Z A;  4ECY A;  2OMO A;  2OEK A;  1ZAV A;  5C2C A;  3ZTO A;  2ASD A;  3TG0 A;  4O3R A;  2JDJ A;  2HBR B;  1B70 B;  4MYU A;  4JB8 B;  1GFW B;  1Q8K A;  3DRR A;  4WTY A;  4PQU B;  2GHV C;  3D3B J;  4DSL A;  2B4U A;  1NCL A;  4K59 A;  2KZZ A;  3TRG A;  2E5J A;  2R3V A;  2MKI A;  1D8Y A;  2QZ8 A;  2FGC A;  1P49 A;  2V2V A;  3I96 A;  3POT B;  3KHG A;  1TL3 B;  5KAK A;  5KFJ A;  4X4O A;  2DR8 A;  3CUL A;  2MGZ B;  3HK2 A;  5ETK A;  2DNP A;  3ILI A;  4F0M A;  1E6Y B;  4MK9 A;  2PD1 A;  2BZ2 A;  3B78 A;  4G1P A;  2ZOG A;  4UOR A;  2UVV A;  3Q8P B;  2DJW A;  2AJF E;  3DI6 B;  2JEF A;  2ZH8 A;  4FVM A;  3OXG A;  1U6B A;  1GTH A;  4P7V A;  3BKU A;  3BYR A;  4Y65 A;  1RAG B;  2RDI A;  4ZPW R;  5G0R A;  4BS2 A;  1TR0 A;  3H5X A;  2RIJ A;  2YQ1 A;  4DS5 A;  3ISN C;  3G8T A;  4DFK A;  2E9T A;  1U1N A;  3RB4 A;  4M94 A;  1SI9 A;  3CCV S;  2ZEJ A;  4YB5 A;  2FC9 A;  4EZ6 A;  4FF1 A;  2OPS B;  3VAF A;  5J1E A;  1KLM B;  3CMQ A;  1RU2 A;  1KQG B;  1R7I A;  2VB6 A;  3FCH A;  1RT1 A;  2DGT A;  1ED9 A;  1S9G B;  3T01 A;  2SXL A;  3NAI A;  4AL7 A;  1VQ7 S;  2KDO A;  1NK4 A;  1OY6 A;  3E01 B;  3KLI A;  4L76 A;  5F9N A;  1S72 S;  1FKA F;  3DRS A;  4NXM F;  5C25 A;  4XDC A;  4NLV A;  2HQG A;  2KL8 A;  3CCZ A;  4LRC A;  3IFE A;  3UN2 A;  2JC1 A;  3E2E A;  4QAX A;  2M2B A;  2PGC A;  1UPP A;  1PKU A;  3H2U B;  2HW3 A;  1BQN A;  3QJP A;  2DT9 A;  3UD3 P;  1BD6 A;  2JVR A;  2ZIT A;  3SIP B;  2R7S A;  4DUY J;  1HBN B;  4ZIV A;  1VIO A;  3OTC A;  4OLP A;  4OQJ A;  2E1A A;  2ZH4 A;  4QZV B;  4DL4 A;  3MMA B;  1GH8 A;  5I42 A;  2N4C A;  5HQL A;  3L7U A;  1Q5Y A;  1ZH5 A;  2K8G A;  4LF6 F;  4L74 A;  3FSY A;  2HWI A;  4DR3 F;  3EZO A;  2VHG A;  1SJF A;  2YX4 A;  3GIL A;  2MQM A;  4NI2 A;  4KKO A;  3UVJ B;  3M8Q B;  4CO4 A;  1C0T A;  2JVO A;  3GMG A;  2G1H A;  1HA1 A;  5HVF A;  1TZ0 A;  5AE2 A;  2KJV A;  1L5U A;  1A6L A;  2CJ9 A;  1PG5 B;  5LJ5 Y;  3AFG A;  4FBT A;  2M52 A;  4C6A A;  3BGF A;  3HM9 A;  2RSQ A;  4DUZ J;  1OJ4 A;  2KHC A;  3HJV A;  1MU2 B;  2CQD A;  2A2D A;  1X4G A;  2BE2 A;  4S0M A;  3FQK A;  5K8P A;  3K5L A;  4NWX A;  2AIR B;  3IP0 A;  3NOG A;  3MM5 B;  4NPO A;  1SVD A;  4F7V A;  2VPY B;  5K20 B;  2LCW A;  2HQ3 A;  3HHL A;  4ZP6 A;  5KG6 A;  4C3L A;  1WDT A;  2HYI B;  3FQL A;  4O3O A;  3VGV A;  5KFS A;  3QZ7 A;  4WFB Q;  2DHX A;  3R1H A;  5IV3 A;  2JX2 A;  3OJU A;  5MLC V;  2CJY B;  2KHD A;  5GOV A;  3DXB A;  3EXY A;  5K14 A;  1U26 A;  3RU0 A;  1ZM4 A;  4DR4 J;  1G2E A;  2E66 A;  1TUG B;  1U6F A;  1TMM A;  1YDL A;  2HIQ A;  3C8Y A;  4PQA A;  3M2V A;  2N7C A;  3HXM A;  1ALH A;  2GV1 A;  1BHN A;  1SL2 A;  2HK2 A;  1XNR J;  1TL7 B;  1L3V A;  2MKC A;  2DRB A;  4DSK A;  4JBC A;  1QSS A;  4MY4 A;  5F8I A;  5LXR A;  4ZKA A;  1R6V A;  2FJX A;  1DAR A;  2QLX A;  3MM9 B;  4NZ0 A;  4X62 F;  2Z58 B;  4X4P A;  2C22 A;  2DR6 A;  3M6X A;  3AT1 B;  2KRR A;  2Z4P A;  5L38 A;  2R8I A;  1PJ7 A;  1H6K X;  2QA4 S;  4LF5 J;  3IGZ B;  4ZDN A;  4J9K A;  4YOE A;  5E3A A;  3C2P A;  3WC2 A;  1S76 D;  3CJ2 A;  4JI0 F;  1EAY C;  1HNV B;  3QWU A;  1ZTW A;  2E29 A;  2ZOM A;  3SZ2 A;  1Y4Z B;  4P2F A;  2DNO A;  3FEX B;  4L73 A;  1MRO A;  4GMK A;  5ETR A;  1MWQ A;  2LXI A;  4EFA C;  1DLO A;  5F8H A;  4U8V A;  2VA2 A;  3AH6 A;  1F3V A;  3NOC A;  2F5G A;  1E6V A;  2FC8 A;  2J9E A;  2JEJ A;  4ATN A;  2AGP A;  5DM6 Q;  2CNK B;  1BWE A;  1SQF A;  3B6B A;  1Z2L A;  2DNQ A;  3A3N B;  3HHN B;  4J9L A;  1CEZ A;  3DOK A;  3GJT B;  4CLW A;  3HVT B;  3DHW C;  3VF0 B;  2XBP A;  5HRT A;  2HQD A;  1UW9 A;  3ZZ0 A;  1KOH A;  3CUN A;  3IAM 9;  2DRA A;  4DV5 J;  2LLZ A;  4AD6 A;  3CDB A;  3PKM A;  1XNQ F;  5KFI A;  1QAY A;  3GIJ A;  2XC9 A;  2L9D A;  4LSN A;  1RTD A;  4ED1 A;  2DGQ A;  2N7Y A;  5E41 A;  4RZR A;  3GE9 A;  3PR4 A;  2MZQ A;  3CCL S;  2KFN A;  5HAN A;  2RU3 A;  2V2Q A;  4WFA Q;  1DTT A;  5B0F A;  3NGT A;  1WC1 A;  2P8I A;  2MTL A;  3ILJ A;  4EO6 A;  4DR6 F;  1CC7 A;  1SJ1 A;  3HT3 A;  2UXC J;  1E1Z P;  2A1B A;  2MY8 A;  1E33 P;  1HQA A;  1Q95 G;  5E5N A;  3WZ0 A;  3MEK A;  1B3T A;  2BEF A;  4A8S A;  3V4I A;  2RHQ B;  2LDI A;  1WHV A;  3G87 A;  2D9O A;  4HHH A;  2GNK A;  1X4E A;  1FFS B;  4MMO A;  3TEH B;  3DU5 A;  1KQS R;  4DPX A;  3PY8 A;  1ARO P;  4OHV A;  5BYS A;  2LXF A;  5ETV A;  3J81 U;  1HPZ A;  2F8E X;  2GJ2 A;  2DNY A;  4OX9 J;  1NZA A;  3ADA C;  2R9L A;  3Q0A A;  4TNO A;  3CC4 S;  2MZR A;  3FKB A;  2ZVI A;  4ZP8 A;  4W90 B;  1FDN A;  5B0D A;  3C14 A;  1RP5 A;  3RBZ A;  2BOP A;  2B6A A;  2HHU A;  4J90 A;  3PDN A;  2J6T A;  1CLF A;  4K4Z A;  1KHL A;  1FK9 A;  5KG3 A;  2XI2 A;  1VBX A;  4I2P A;  4D3G A;  2HZC A;  2PI5 A;  3CCT A;  3IG1 B;  3K2Y A;  2VKZ G;  3BQ2 A;  4GO7 X;  4TN2 A;  2OLW A;  5KFY A;  4IUF A;  1B0V A;  1S1T B;  3GG1 A;  5ETM A;  3OUY A;  1UVJ A;  2KT2 A;  3OT9 A;  1K8A T;  2HNY A;  3CD5 A;  2HVE A;  4B17 A;  5ETP A;  2Z56 B;  4N77 A;  1N5T A;  5CHC B;  2MKK A;  1CJU A;  3NKO A;  2RD5 C;  4Y2M A;  2X1B A;  2CPF A;  3GYN A;  3PJX A;  3RW7 A;  3NKR A;  3LGM A;  2AX0 A;  3IR7 B;  1PIE A;  3L4B C;  1HNW J;  3CD6 S;  3G8Q A;  3QGH A;  4G1Q B;  5EHH A;  2HMI B;  2MGZ A;  4G3I A;  4KPC A;  1DQ8 A;  1HHQ A;  1RAI B;  1W26 A;  1W2I A;  2FGO A;  2MQL A;  3N5F A;  1LW0 B;  3I55 S;  3M9M B;  3GIM A;  3I5A A;  4AT1 B;  1WF0 A;  4ZVF A;  4MIW A;  3H98 A;  3MOZ A;  5A8R B;  5THW A;  4WP9 A;  4R8U B;  2OKQ A;  1REV B;  2CQB A;  2IFY A;  2AJ1 A;  4K0K F;  2GQQ A;  4DL2 A;  4DV7 F;  4HI1 A;  2AJ4 A;  3BSO A;  1H2T Z;  3S7R A;  3QWP A;  2D3O 1;  1VBZ A;  1KD1 T;  2ROP A;  2K7K A;  2G1D A;  3ZZP A;  3OHB A;  3K58 A;  4I67 A;  4X4T A;  2VBX A;  5DGA A;  2OPS A;  1T03 A;  1YX2 A;  1K1S A;  1FD2 A;  1WC4 A;  1J27 A;  1R8A A;  4PYA A;  2ZM6 F;  1EQJ A;  5GAH U;  3CD7 A;  2EXU A;  2R7Q A;  1EX8 A;  3G82 B;  4IFY B;  3JTO A;  1NK5 A;  1SJ3 P;  2GW8 A;  3CDU A;  5C25 B;  5DQH A;  2ZKT A;  5AE1 A;  1BLU A;  2CJX B;  2UUW A;  3GV7 B;  2FLP A;  2VAS A;  4C7Q A;  4M5K A;  1BQN B;  4UOF A;  4ZOS A;  3D5M A;  4M5J A;  3AD9 C;  4RL1 A;  1VCT A;  1ZM9 A;  2UU9 J;  2PI4 A;  5A8W B;  3NKN A;  1Q16 B;  4E2F B;  2RAQ A;  5CCL A;  2HBZ B;  3LQV A;  3TUJ C;  1ZM2 A;  2VBW A;  5E3Q A;  2V63 A;  3GQC A;  4JI0 J;  5I42 B;  3BDH A;  4R25 A;  1S1V A;  4K5R A;  5AXN A;  1UFK A;  3OBI A;  4IYQ A;  3QNW B;  2B56 A;  1CG2 A;  3DYA B;  4YB6 A;  4U8Y A;  3BGU A;  4IH6 A;  3T19 A;  4M5N A;  1RBO B;  3KUE A;  1IKW A;  2NXU A;  3MTJ A;  2BR0 A;  3T3F A;  2W24 A;  2DPI A;  4DQQ A;  4ZLJ A;  1TKT A;  2CQP A;  1TKZ B;  2AWZ A;  3DLH A;  1FDB A;  6FD1 A;  1RT3 B;  4C48 A;  3RB0 A;  3RAX A;  1YJN S;  3NGU A;  3TJA A;  4BC9 A;  2VKR A;  4UTG A;  3TAR A;  1BE4 A;  1UWB A;  1PIL A;  2ZJR Q;  4DR3 J;  4OYM A;  2EC0 A;  4UPI A;  2UV8 G;  1YZ7 A;  3GG0 A;  3V6J A;  2ZHO A;  4LFB J;  5SUH A;  2IVY A;  3BKF A;  5DJB A;  2YBV A;  2DNG A;  1BQM B;  3ISN D;  3CCW A;  4ID5 B;  1ELO A;  2FHJ A;  4MK8 A;  3LWL A;  1VQN S;  1C4C A;  1QDU B;  3W5Z A;  3M2V B;  3JSM B;  2OD6 A;  5DG7 A;  4QIE A;  1OY9 A;  4JI7 J;  4IG0 B;  1FRL A;  2ZKU A;  3KK2 A;  4ECX A;  1SQG A;  2KRB A;  1K73 T;  1JLE B;  1U24 A;  3IA0 A;  1NM2 A;  2OPP B;  3G86 A;  1XN9 A;  3Q2S C;  3QRQ A;  5LMU J;  1DBD A;  1KH5 A;  2UVR A;  1VQP S;  2JFK A;  2XMJ A;  2YWE A;  2K3I A;  2BE7 D;  5H9E K;  4FXW A;  2GAG C;  2BRL A;  2N3L A;  5CA5 A;  3TAQ A;  2BQR A;  4CWB A;  3I4P A;  2HHH J;  1RTH A;  4NYZ A;  1DY3 A;  1NO8 A;  3TW0 A;  1Q0N A;  3CJ0 A;  5CZV A;  3CCR S;  1FJG J;  1CJV A;  1CJK B;  1EKS A;  4J37 A;  4RKU C;  2L3M A;  4CO0 A;  1IKX A;  5A2Q Y;  1JKH B;  2W9C B;  2U2F A;  3V6D A;  3MEC A;  4RNO A;  1JJ2 R;  1M5K C;  3NNA A;  3EE3 A;  1C0U B;  5A76 A;  4KH1 B;  1RWP B;  1CS4 B;  2H9Z A;  4HDH A;  2J9D A;  2MY7 A;  3MAQ A;  2FVR A;  3SSR A;  2W9B B;  1R0B G;  3OSN A;  4F2S A;  2M70 A;  3HVT A;  4FYY B;  2W5S A;  1RLC L;  4N7T A;  4CYU A;  3G6V A;  4EBC A;  1L3T A;  1NSP A;  3M6U A;  5KFW A;  3FVY A;  3A13 A;  2C2R A;  3A52 A;  3B4M A;  4AE5 A;  5DDP C;  3BSC A;  4HKQ A;  3T1A A;  2BAN B;  2BW2 A;  2E7W A;  2OD4 A;  4TU9 A;  3KLH B;  3FDS A;  2IVM A;  3NLC A;  3AOC A;  2HGL A;  3VGU A;  1RAH B;  2DGU A;  4DV1 F;  2Q66 A;  1HIY A;  4AQY J;  1XEZ A;  3K5N A;  1HW8 A;  1DTT B;  1EB0 A;  2CYY A;  2QT7 A;  3LP1 A;  2NYI A;  3BEG B;  7AT1 B;  1T94 A;  1S6Q B;  4I6W A;  1FNO A;  2HHW A;  1IR0 A;  3GCW P;  4JYA F;  2WW4 A;  2NUH A;  3EVO A;  3NY0 A;  4OV1 A;  3NL0 A;  5KT5 A;  3V4I B;  2MHN A;  4RW6 A;  5KOX A;  3UDC A;  3FMW A;  3DXS X;  1RQ0 A;  1JB0 C;  1FRK A;  4RBT A;  4YFU A;  2VBY A;  3U02 A;  4NXN J;  4WU3 A;  1DTQ B;  4ZJQ A;  4B3M J;  3DOM B;  3NRB A;  4RW7 B;  3C16 B;  4O4R A;  3UDL A;  3BQ1 A;  4J9S A;  1SKS A;  1S9E B;  2V8H A;  1EP4 A;  1D09 B;  2IBO A;  3AY0 A;  1RK8 A;  2ZHB A;  2J6U A;  4H54 A;  5HJX A;  3SQG B;  3BDP A;  3M1V A;  1SKU B;  4AYB D;  1T3N A;  1WG4 A;  3W2W B;  1Z2Z A;  4X84 A;  1UMJ A;  4XTT A;  2PMH A;  1N34 J;  4LRF A;  1P9Y A;  1RT6 A;  3DM2 A;  3R1L A;  5L1I A;  1T9U A;  3K5P A;  3KJN B;  3MK2 A;  2WHO A;  3FJ2 A;  3CE8 A;  4L75 A;  2P6T A;  4AXJ A;  1LWF B;  2YH0 A;  4LR7 A;  1T05 B;  1GNK A;  1RXO B;  2VOD A;  3LXQ A;  3IG1 A;  1IBM F;  4QW9 A;  1LK7 A;  2CUY A;  3T6J A;  4Q0B A;  3OHA A;  4KM4 A;  3P5B P;  1IUJ A;  2QSF A;  5HLF A;  2FIU A;  5GAE U;  1XTZ A;  3K57 A;  1SJQ A;  4HAC B;  3DGP B;  1RTI A;  1CJU B;  3UCZ P;  2QIF A;  1KQF B;  3MMC B;  1X0F A;  1SC1 B;  1ZBT A;  4KRW A;  2RRA A;  5LXY A;  2FZC B;  4WBF A;  5D15 A;  2V9K A;  3CC7 S;  3OLA A;  3JAM U;  2FD2 A;  1VRQ C;  4P73 A;  2ALY B;  3G71 S;  1GX6 A;  2F9J A;  3SV4 A;  3H0P A;  3MAA B;  5A8K B;  2GHP A;  5KT4 A;  1Q5V A;  1L3K A;  3C6T B;  1PBU A;  2CXE A;  5IT4 A;  1F3F A;  4J91 A;  4CLP A;  2MB0 B;  2O3D A;  1H2V Z;  5J2Q A;  4PUO A;  1Y5I B;  1FFW B;  1T95 A;  1S79 A;  4DFJ A;  2E9R X;  4UUW A;  4DPO A;  5KFE A;  2WOM B;  3OV7 A;  1REV A;  4LR8 A;  2OEJ A;  3WIU A;  2KTQ A;  3RBE A;  5F3T A;  4OYA A;  4O3Q A;  4ZG6 A;  1AW0 A;  3I9Z A;  1M0S A;  2UZA A;  3VVT A;  2CZ4 A;  2N4D A;  5D78 A;  2E5H A;  1B0T A;  3I5B A;  5KFZ A;  3G8S A;  1WOS A;  1CUL A;  2E1R A;  2F40 A;  4O4G B;  2AEM A;  2ZBP A;  5B09 A;  3FFI B;  1NXI A;  3R5B A;  1D3W A;  3M8Y A;  3THP A;  1KRP A;  2W2O P;  4J9M A;  4A8K A;  4IFY A;  4PR6 A;  5ETN A;  3MUT P;  2DY1 A;  2GVD A;  2EI5 A;  3BZQ A;  4DG1 A;  4DX6 A;  4H4O B;  1KVJ A;  1WSR A;  1K44 A;  4A8Y A;  1SL1 A;  2PA8 D;  1V9O A;  2XGP A;  4FN5 A;  4DV4 J;  1RAE B;  4DL7 A;  5HMY A;  1HQE A;  1N34 F;  3EGV A;  4TVA B;  5HAO A;  3UCG A;  4CLS A;  1UA1 A;  2R2S A;  3PR5 B;  3VZH A;  1QSL A;  4OYO A;  2V8G A;  2E1C A;  4KGM A;  3JS9 A;  3BGR A;  3JXO A;  3C15 A;  3MED B;  2HFV A;  5HL7 Q;  3DLG B;  3GV5 B;  2ZVS A;  2J9D E;  3AA9 A;  2C2N A;  3HJF A;  2BAC A;  1VOM A;  1HBO B;  3AB2 B;  1NK0 A;  3M2R B;  3MUR P;  2DNM A;  2HRY A;  2ZE2 A;  1VR6 A;  3KWM A;  3QLH B;  3QT5 A;  3F0N A;  3NG8 A;  4N8N A;  4KT0 C;  5JXS A;  5HP1 B;  3D6M B;  4O23 A;  2HLT A;  1N54 B;  3CDW A;  3IS9 A;  2C3U A;  3LA0 A;  1RTJ B;  4RUA A;  2V69 A;  2VD3 A;  3MR6 A;  1RT3 A;  3A8I A;  1BGX T;  5GAE I;  3HVR A;  1S77 D;  2HVI A;  3QGP A;  2YNF B;  4C8O A;  1XMQ J;  2W8D A;  3QFH A;  2XR9 A;  4LJM A;  4MKV A;  1HYS A;  1U1R A;  3K8W A;  4DV6 J;  1RI7 A;  1KTV A;  3HCX A;  3QGG A;  1FNX H;  2KKH A;  3QPI A;  4OHZ A;  2R7V A;  4XO0 A;  1G3O A;  4ECS A;  1QE1 A;  2LDY A;  1IJE B;  5DZ7 A;  5F0U A;  3EGZ A;  1X8D A;  3HHD A;  4JYA J;  2AEJ A;  3GIR A;  2QEX S;  2JHE A;  2PO4 A;  2YKP A;  2IRY A;  2YNG B;  3D6F B;  3HLU A;  3UQS A;  1H38 A;  4TYA A;  2BAB A;  3OXF A;  2VF3 A;  4FPR A;  4C8M A;  1VBY A;  5ETO A;  1X4F A;  3MMB B;  1FE4 A;  2F63 A;  2EKN A;  2BVZ A;  4QR0 A;  4ZHR A;  5E0O A;  4DR4 F;  3PRD A;  3CJ4 A;  4U6P A;  1FRI A;  3TAM A;  1HNX J;  5M2U A;  1YJT A;  3R2C J;  4C0B A;  3UR3 C;  2IM1 A;  4O0I A;  4OL8 A;  4DQS A;  4LSL A;  3RTV A;  4BLG A;  4ALZ A;  3K5O A;  4DS4 A;  1URA A;  3FZB A;  3RR8 A;  1S7I A;  2CPJ A;  3GJR B;  5JMN A;  5RUB A;  1YIT S;  2CWX A;  2B9Y A;  1U1O A;  4I56 A;  1JKH A;  4LBI A;  1FHT A;  5B0E A;  4PAB A;  3CDE A;  1Q78 A;  2E5I A;  1C0U A;  1VDH A;  1SUQ B;  1FKP B;  2PEH A;  2IFX A;  4I64 A;  1UL3 A;  3PW2 A;  1RCX B;  4WK1 A;  4ZPC A;  3J81 j;  3QJL A;  2W9B A;  3NBP A;  4CLT A;  1FJ7 A;  4ZG7 A;  5KFH A;  3MR7 A;  5A0Y A;  1M5V C;  5FLX U;  1P1T A;  2VOO A;  3EZ5 A;  2JLG A;  4YDX A;  2FVP A;  2CVI A;  1AXQ A;  1KFS A;  4A4J A;  1IWA A;  3AJ2 A;  3DMJ A;  5HRO B;  3X1L B;  1EET A;  3UD5 A;  1TQL A;  3GU0 A;  1AFJ A;  2D41 A;  2ZH2 A;  2OPQ A;  1HNI B;  5A6P A;  3KXD A;  3W1Y C;  4C8Z A;  4LT6 A;  2WZ1 A;  1MWY A;  3FEZ A;  1WC0 A;  3M8Z A;  4CO5 A;  4M63 A;  2NXJ A;  3KKF A;  3BBC A;  3SV3 A;  1W25 A;  1VQ6 S;  3MEE A;  5I4M A;  4B02 A;  1UVM A;  4UZB A;  5E3P A;  1A9N B;  5KG5 A;  4MIB A;  3SXL A;  1S0V A;  2DGO A;  1C4A A;  2A6M A;  1I94 F;  1S59 A;  4ZVO B;  4CO3 A;  2OGU A;  3BJY A;  1IR1 A;  1Y6V A;  2IUC B;  1XR6 A;  2V4J B;  1OS5 A;  2XYG B;  3NKP A;  4WTO B;  2GSN A;  3GFX A;  2LA6 A;  1DTQ A;  2UUC F;  2FHK A;  3RRG A;  4DSI A;  2GMJ A;  4DQP A;  4CNY A;  4IRC A;  5IT9 Y;  1S9E A;  1IXK A;  2YWF A;  4X4S A;  3FSX A;  4UF4 A;  4K0K J;  2BKN A;  3PYD A;  1DHM A;  1KWM A;  4FZV A;  1UA0 A;  2CJK A;  3OL6 A;  2DBB A;  2RKI B;  4RUB A;  4OYI A;  3J7Z T;  4J9O A;  1RT6 B;  2VDI A;  5J1N A;  4ED6 A;  1N33 J;  1ICE B;  2MZS A;  4G1I A;  3PG9 A;  1RT4 B;  2FHJ D;  2XMU A;  2CAD A;  5IZH A;  2RDJ A;  1PO6 A;  4GKK F;  4DV4 F;  1T05 A;  3KUH A;  4KHR A;  3M7V A;  2RF2 A;  1TMJ A;  4IOB A;  1P6T A;  3BSA A;  4CXS A;  4URS A;  1XMO J;  4MIA A;  3DCA A;  2QG9 B;  3HMJ G;  2GIR A;  1ZEB A;  1FRX A;  1JNZ B;  2DNK A;  4K50 A;  5DET A;  3MPU B;  4WJB A;  3KHR A;  4PG7 A;  5B7W A;  1FDD A;  2ZH1 A;  3QMQ A;  3IXQ A;  1N32 F;  1UCN A;  1YRX A;  4X2B A;  2D9P A;  2KYX A;  1KH7 A;  5KT3 A;  3M4X A;  3HFZ B;  2EVZ A;  2W5T A;  2R8J A;  2O66 A;  5GME A;  4DQR A;  3AOB A;  4OJ1 A;  4N47 A;  1AJD A;  4PEO A;  1GAO A;  2ZHA A;  4DV0 F;  4OZ3 A;  2V8D A;  3OD2 A;  1MN9 A;  4I68 A;  1S57 A;  1XER A;  5EWF A;  3TJ9 A;  3VAK A;  3POT A;  4ILR A;  2W4D A;  2JFD A;  3FNN A;  5CXT A;  1S0N A;  5DLW A;  3CPW R;  2WOM A;  2C28 A;  3K8V A;  3QAE A;  1UJ4 A;  2CNL B;  3D1O A;  4ITS A;  1VC5 A;  1HBU A;  2HVD A;  5K8N A;  1T0T V;  1QVF R;  3RW6 A;  2ZH7 A;  3JSB A;  1PYT A;  4MYT A;  4HTJ A;  3FZ2 A;  4ICL B;  2HFU A;  2HFZ A;  5LRM A;  4OJH A;  4USK A;  2FYX A;  3B5Q A;  2YY3 A;  2X3D A;  3I0R B;  4DCJ B;  3GFH A;  4PWD B;  3OL9 A;  2V4Q A;  1D8Z A;  1LNQ A;  3CCS S;  4RNH A;  3T9Z A;  3U1L A;  4GVL A;  4R5P B;  4FYX B;  2W2Q P;  4F26 A;  3EXC X;  2EG2 A;  1EAR A;  3EZU A;  3MM6 A;  1KLM A;  1BQX A;  3H59 A;  4PWW A;  4DDF A;  2EPI A;  4TQS A;  2ZD1 A;  3R2D J;  3NS6 A;  3CIM A;  1U49 A;  4IO9 Q;  2AMC B;  2J0S D;  1XQI A;  3KLI B;  3KLV A;  1DZ5 A;  1XNR F;  2QSW A;  4B9V A;  2DNL A;  2DNN A;  4IKA A;  4DL0 C;  3MCN A;  3BGR B;  3LTO A;  3Q8V A;  3C15 B;  2Z2L A;  3CB4 A;  3QO9 B;  4QR2 A;  5KFB A;  2AGO A;  2H54 B;  3MEG B;  2B5J B;  4C8L A;  1KVK A;  1RSC A;  2B43 A;  5M2R A;  5DLF A;  3C6U B;  5GAG I;  2A2C A;  3MD1 A;  4WWS A;  5KT7 A;  4N56 A;  5KFD A;  4LRB A;  3MMA A;  4NLQ A;  2VL1 A;  4NRU A;  3VCD A;  5J1E B;  2VQE J;  5HP1 A;  1LFW A;  1RT1 B;  4J9P A;  2E1P A;  1S9G A;  4JI3 J;  4A46 A;  3IS9 B;  2CQ4 A;  4O0N A;  4ZVE A;  2KZM A;  2BKP A;  4RNM A;  1QVG R;  1S5Z A;  2W01 A;  2YPZ A;  1T9X A;  3IMQ J;  5D0E A;  3RG6 A;  2XO6 A;  4M95 A;  1K7H A;  1RWV B;  3ZZO A;  3EPG A;  3A4T A;  2DEI A;  2DO4 A;  4C0O C;  3D1H A;  4GVB B;  5J1P A;  4ZJL A;  1IN0 A;  1P27 B;  4FDF A;  2XCP A;  1HD1 A;  3R5G A;  2HGN A;  4A47 A;  2YKN A;  2UXB J;  4P2M A;  1N32 J;  1APS A;  3D54 A;  2DIU A;  2EC2 A;  4NX9 A;  4OZ5 A;  5H9F K;  1LXJ A;  2XNR A;  4K4U A;  4MFB A;  2APO A;  4YR2 A;  4F0H A;  4X65 J;  1OQ6 A;  1GK8 A;  3WQP A;  5CAA A;  5KFP A;  1V5I B;  4NCG B;  4ZN3 A;  2Y1R I;  2DGV A;  3J80 U;  4NZ6 A;  1J2V A;  1IQZ A;  2XSF A;  5IM0 A;  2BYC A;  4N8O A;  3OTD A;  3CCU S;  4GKK J;  2HG4 A;  3C3L A;  3P4U B;  2IC3 A;  5GAD I;  3S1T A;  4OJ3 A;  3DDK A;  1QAJ A;  1JWW A;  4X4N A;  4TN0 A;  2J7K A;  4ANE A;  1Q79 A;  3N01 A;  4XPC A;  3DRR B;  4C3K A;  2BX6 A;  4KO0 A;  2W9A A;  3RB6 A;  4O3S A;  1REG X;  4DF4 A;  1S10 A;  4WYW A;  2KVI A;  3EPI A;  3PFE A;  5DG8 A;  2BW7 A;  3ONQ A;  2C3M A;  3ZZY A;  1OYD A;  1N6Q B;  2ZBI A;  1YBA A;  5ITH A;  1TL3 A;  3AB4 B;  1OO0 B;  4H4M A;  1VQ8 S;  2DCL A;  4YEA A;  4CP5 A;  3H5Y A;  3QBC A;  4MTP A;  2A3J A;  1FDA A;  1HHT P;  1RLD A;  4ID8 A;  3IWL A;  5FDL B;  3VAI A;  2HAI A;  4OZJ A;  1X9M A;  2VG5 A;  1M1K T;  3NBP B;  3LPE A;  1VQ5 S;  2FB0 A;  1IWG A;  4USI A;  2GX8 A;  3L95 X;  2CKW A;  3QT6 A;  1RBL A;  4QYR A;  2LMI A;  1NND A;  2KVQ E;  3H5S A;  4WPA A;  2BJD A;  4CO1 A;  3Q24 A;  1X5S A;  2X98 A;  4P6Q A;  3F41 A;  3NKQ A;  2J7W A;  5HRO A;  1PGZ A;  3R97 A;  3OFF A;  2C2K B;  4HVZ A;  1V3Z A;  5DS7 A;  4ANC A;  3JYT B;  2QN6 B;  2R7O A;  3ZNJ 1;  4I2Q A;  3OQ2 A;  4L6V 3;  9ATC B;  3BGL A;  4GKJ J;  3WAV A;  5SZT A;  3AJD A;  5DLT A;  2HQI A;  3MD3 A;  4LFC F;  4IR1 A;  1RJJ A;  1RT2 B;  2V67 A;  1I3O B;  1S0O A;  3GZ7 A;  1KEK A;  2R7W A;  1NSQ A;  1RCO B;  1RDR A;  1TP7 A;  3ULH A;  4RWW A;  2E7X A;  4EI2 A;  2EBE A;  3O5T B;  3RRK A;  1FWL A;  4DV2 F;  1F5C A;  4KAY A;  2X1F A;  5HQ8 A;  1NHV A;  4RW8 B;  4KSE B;  2RDD A;  3G6X A;  4EU0 A;  1NKC A;  4KV8 B;  4L3N A;  3SFG A;  2Y1J A;  3FGV A;  2WBM A;  3D4J A;  1YJU A;  2IHR 1;  3GLJ A;  1PBA A;  1N36 J;  4USJ C;  4FXD A;  2ZNZ A;  3CCJ S;  2KO1 A;  3CJR A;  4Y2I A;  2XYH B;  4KKO B;  3PKY A;  1FF2 A;  1C1C B;  4YQW A;  4DSE A;  2WTF A;  4UW2 A;  3FBB A;  2UUA J;  4NLU A;  3SBM A;  5IT9 U;  2AU0 A;  2JJ4 D;  3T9N A;  4HL9 A;  4ZVS B;  1X5T A;  3DGV A;  4ZPB A;  5EGE A;  3KG4 A;  1R89 A;  1KTQ A;  4PPD A;  4NLG A;  1JLF B;  4YR3 A;  1IBK F;  1FJG F;  3U1M A;  3I0S B;  4DPT A;  4ECZ A;  3TUI C;  4CLZ A;  5L9N A;  5BYR A;  4DX7 A;  2NR0 A;  1QD1 A;  3NWG A;  4OYB A;  1FES A;  5EWE A;  2C2M B;  2H5E A;  2GO9 A;  4V19 X;  5KFA A;  4J9R A;  2EFV A;  4K2X A;  1Q1K A;  1QJH A;  4NAS A;  3SSS A;  1VHF A;  1Y3K A;  4ZVG A;  2B6A B;  1FWK A;  5GRR A;  3FCW A;  1U1Q A;  1KON A;  4A8W A;  3WHI A;  5K8O A;  2HMI A;  1H0H B;  1MSW D;  4ZVQ B;  4IR9 A;  4I2P B;  4JI4 F;  4I7F B;  1O98 A;  1LW0 A;  3H20 A;  4F4K A;  3EVW A;  3BGO P;  5AXK A;  4ERD A;  4KQZ A;  1S1T A;  2E44 A;  1VS3 A;  1SB6 A;  1X4C A;  4R8U A;  2NPI A;  3UN5 A;  4B3O B;  4ICL A;  3PHE A;  4KY3 A;  4GO5 X;  4LUB A;  2NCK L;  4WZQ A;  2MKJ A;  2CQ0 A;  2OFH X;  3AXM A;  1F60 B;  3I0R A;  4DV7 J;  1NK8 A;  1EI6 A;  2W2M P;  4UUX A;  4UPK A;  3GFY A;  3HHL C;  2HVZ A;  3BH7 B;  4IRK A;  2IPO B;  4X66 F;  1B7Y B;  7FD1 A;  2K06 A;  4WYL A;  2IJN A;  3IGV A;  1TV6 B;  1E6V B;  4DMZ A;  4ZCI A;  3EYZ A;  3CF5 Q;  2GSO A;  2U1A A;  2R2T A;  5DLG A;  4Z7Y A;  5KFL A;  3A8K A;  2M8H A;  4OI2 A;  4L3K A;  2W7O A;  1ALK A;  2NZ4 A;  2ACY A;  2J0X A;  4OHY A;  5F8J A;  1E3C P;  2KB2 A;  3EM1 A;  4A48 A;  1GMW D;  2H65 B;  2ASJ A;  4KJI A;  5K5M A;  1IVZ A;  1FTR A;  2W8K A;  2HHP A;  3CO9 A;  3JQM A;  4Y2K A;  3TVY A;  4NWB A;  4TY9 A;  4E8U A;  1UVI A;  1WSV A;  2BJ1 A;  2P9C A;  4ZLN A;  3N6L A;  4WZM A;  2JLF A;  1R8H A;  2OPR A;  1HI8 A;  2YKM A;  3OTB A;  2F8M A;  2MQP A;  1RTD B;  5KTQ A;  3GON A;  2UUT A;  4DCO B;  3TZZ A;  4A8Q A;  4IOC Q;  3MPD A;  2VC1 A;  1GMW A;  2MQ8 A;  2OFG X;  3QYY A;  2ILY A;  3UWT A;  4O44 B;  4LFA F;  2CWK A;  1SC6 A;  1JLB A;  1V5V A;  3OR2 B;  3W63 A;  3DYA A;  2ZZM A;  2IJF A;  1M5H A;  1ANJ A;  3G82 A;  4PCQ A;  1LFP A;  1RAO A;  2Z2M A;  3Q86 A;  3EGW B;  1YBT A;  1RAC B;  2YKA A;  5IC4 B;  1IBK J;  3W66 A;  1AZS A;  4M5D B;  2KXN B;  4LF8 F;  4BDP A;  1Y10 A;  4GVB A;  4KTQ A;  3VZI A;  2HND B;  2V94 A;  3N5B A;  3R7N B;  2XY5 A;  1IM6 A;  3OTO J;  4FP9 A;  1RYR A;  3H8Y A;  5CD4 A;  4LF7 F;  3HFV A;  4UOO A;  8AT1 B;  3IAS 9;  2FJD B;  3MHY A;  5LL6 d;  3UCU P;  4JUZ A;  1Q81 T;  2B7B B;  3M2U A;  5KFR A;  2QV6 A;  5KFC A;  5LSR A;  1RWX B;  3HF5 A;  3VHQ A;  4P52 A;  3DDN A;  2IDE A;  2ZDO A;  3TJ8 A;  5GMK a;  3RUB L;  4F36 A;  2KM8 C;  1HQU A;  4F4X A;  3J7Z 5;  2W5Q A;  3D3C J;  4NLO A;  3V81 A;  3J7A 1;  2IC3 B;  2YKO A;  1N5S A;  1QM9 A;  3DOL A;  2GS8 A;  3L7O A;  3MF5 A;  2XSJ A;  4TXS A;  4USV A;  3TZW A;  1Y11 A;  2QFI A;  3ETM A;  3M8W A;  4LIW A;  4LR9 A;  2C2E A;  3GR1 A;  2DPJ A;  1JLE A;  3SZY A;  4KO0 B;  4A8O A;  3AHP A;  2OPP A;  3CD0 A;  5HO4 A;  4ECU A;  2IMO A;  4B9N A;  1JLG B;  3ZXW A;  3MM8 B;  4G1Q A;  1HNZ F;  4YN3 B;  3LP0 B;  3RZA A;  4DZ6 A;  3TAP A;  3MCO A;  3AOA A;  4C2M A;  3PX0 A;  5D77 A;  2ZJQ Q;  4KHP F;  2JH3 A;  1XK8 A;  4UOC A;  1YJ9 S;  5A8R A;  2DGX A;  1DQA A;  3OR1 A;  4OJG A;  4QWE A;  2C3O A;  2YPY A;  1OSD A;  4TY8 B;  1NB2 A;  4P2X A;  3K17 A;  2LU1 A;  4R0J A;  5J2P A;  2YWG A;  3CO0 P;  4LF1 A;  1U1K A;  1M90 T;  3P3D A;  3HUL A;  3F44 A;  2OHD A;  2R42 A;  4AND A;  5T14 A;  4JI6 J;  4F4W A;  1TVR A;  5C24 B;  3E8O A;  1XR7 A;  2WVD A;  4EGL A;  2BUN A;  2HHH F;  3MK0 A;  2V6A A;  4IFV A;  1Y7A A;  1T03 B;  4FYV B;  2JC0 A;  2XWY A;  4YR1 A;  2ANH A;  5GVQ A;  1TK8 A;  1RT2 A;  3TX8 A;  2H48 B;  4NE9 C;  1ELY A;  3EX7 B;  4KAI A;  2PE8 A;  3HZG A;  4UQT A;  1EKR A;  2KT5 A;  3ZO7 A;  3EJM A;  3KLH A;  2VJV A;  1JQG A;  1PYS B;  2GML A;  4PZV A;  2ASL A;  3ICL A;  3QFW A;  3N9U C;  3HSZ A;  1W7W A;  3CJK B;  1J5O A;  4ELT A;  1MML A;  2BBE A;  1SHQ A;  4AQY F;  4ER8 A;  5F8G A;  2G4B A;  2MMY A;  1NEE A;  4C4W A;  2PEB A;  1Q7L B;  1FI4 A;  4B9L A;  5A8W A;  2IA6 A;  1JMT A;  3VTI A;  5L1L A;  4QR1 A;  4KV8 A;  4UQG A;  1VLY A;  1RA6 A;  2MZT A;  1HDH A;  3KJV B;  3AA8 A;  1S49 A;  3FC9 A;  2KFZ A;  1TL4 A;  4LF5 F;  1RWO B;  1F9E B;  3RYL A;  1KFD A;  3QQC D;  1F2G A;  4YHH F;  1WF1 A;  1BY9 A;  1FEE A;  2GSU A;  4DR2 F;  4QOT A;  4GC7 A;  2QJ3 A;  5IS2 A;  3EUN A;  1MNE A;  2H3E B;  1FCA A;  1S6O A;  4GTX A;  2ZZT A;  4DU8 A;  3QJJ A;  4DFP A;  2YNI A;  4Y2A A;  2XS2 A;  2W5X A;  1TK5 A;  1UET A;  2YX1 A;  3R5J B;  3MI7 X;  2B3T B;  1JXV A;  2I5J A;  4IG3 A;  2UVW A;  1TKT B;  4ILM A;  4QIW D;  3LP1 B;  4AFF A;  1S6Q A;  5L0E A;  2XEX A;  1JJC B;  3OLB A;  2BA9 A;  4B9M A;  4RU2 A;  1RHJ B;  1N4L A;  1Y00 A;  1RT7 A;  3PIO Q;  1UVN A;  2RML A;  2LA4 A;  5C42 A;  2MZJ A;  3IWN C;  4F3Q A;  1ALI A;  3O44 A;  4OI3 A;  3DOM A;  1EHW A;  1KC8 T;  3C16 A;  5FII A;  4DV3 F;  1S97 A;  3I32 A;  3LO3 A;  1PAE X;  1EP4 B;  3AJ1 A;  4ID5 A;  2QL5 B;  2GJI A;  4P9S A;  5J2M B;  3IN5 A;  2UXB F;  5EN1 A;  3KHH A;  3CT9 A;  3Q89 A;  4DUY F;  2V2Z A;  3GCX P;  1U8W A;  3IGY B;  4NEY A;  3UPF A;  1VQY A;  4RBV A;  3R5A A;  2CPH A;  5B0A A;  5KFU A;  4KJD A;  1HWL A;  2RJZ A;  4YY3 J;  5IWA F;  2XLI A;  5C66 A;  3W61 A;  2B8P A;  3C6T A;  1S0M A;  2WVC A;  1X4B A;  4RBU A;  4M5M A;  2XTJ P;  3NS7 B;  2Y1L B;  3PHT A;  4FKX A;  5HVG A;  1PAU B;  2E1M C;  3GSI A;  5JVH Q;  5HLF B;  1Q8B A;  5G4D A;  3KJF B;  1RU1 A;  3ILL A;  4ETX A;  1WI8 A;  3QT7 A;  3BBF A;  1RTH B;  2F7V A;  3HI9 A;  4CLL A;  2IVF B;  2N3O A;  3DRY A;  1MMN A;  1VRU A;  2RQK A;  3GWC A;  4DI6 A;  4F4Y A;  3DKD A;  4Q45 A;  1XMQ F;  1SKR A;  4JV1 A;  4I4B A;  5L1K A;  1Q86 T;  4HYK A;  3QAU A;  1LQ9 A;  4P2S A;  4DPY A;  3MEC B;  4ZCK A;  4BBY A;  1UWA A;  5DG9 A;  2OJ3 A;  3GB0 A;  2HIY A;  1CS4 A;  1VI7 A;  3NWR A;  2L08 A;  1VBK A;  2WAQ D;  4B3M F;  3RB3 A;  3AAW B;  1LWC A;  2AX1 A;  1NB7 A;  1KHK A;  2CZ9 A;  2W4P A;  2OTJ S;  3IR6 B;  3MDF A;  3MPV A;  4PXD A;  2P2C B;  3HKZ D;  1ZPW X;  4PUO B;  1RBA A;  4P72 A;  2FZK B;  4CYU B;  4LF6 J;  1G6B A;  4H4O A;  1KP6 A;  2XY7 A;  3LOU A;  2PA3 A;  1ROF A;  2HGM A;  4YY3 F;  5IWA J;  2L48 A;  1OIA A;  2W2N P;  5IOL A;  2OPR B;  3KLF B;  1KHW A;  2YKM B;  2BAN A;  4K4V A;  3BDG A;  2Z0G A;  2M8D B;  4NLY A;  4W98 A;  1AYE A;  3V5R A;  4M5L A;  5F9L A;  4C9D A;  3NCQ A;  2VG6 A;  3OXL A;  3KG0 A;  3M32 B;  3TA1 A;  2HVH A;  2OEM A;  4UPH A;  1CUL B;  4CH0 S;  2CZV C;  4DJB A;  2LQ9 A;  4UOH A;  5LM7 E;  3X3U A;  5CD4 H;  2FPH X;  3W5Y A;  2DD8 S;  1Y3J A;  5HMZ A;  2CDR B;  5T7L B;  3CCQ S;  1AUD A;  2GVD B;  1ANI A;  4IOA Q;  5ETT A;  3MOJ B;  1V3S A;  1N0U A;  2L9N A;  4DL3 A;  4ED8 A;  2NRE A;  4FF3 A;  1TL1 B;  2BJE A;  1WWH A;  3HX9 A;  4W4M A;  1JXL A;  2Z2Y B;  1FFG B;  2WSC C;  1N8R T;  3LAL A;  4MKB A;  4F50 A;  5D3G B;  4FKY A;  2G13 A;  2HFO A;  3NCP A;  4F3M A;  4A8X A;  3CW2 C;  5L9X A;  4KR0 B;  4ZLL A;  1B4S A;  2XYP B;  2QFJ A;  1WTB A;  3MCM A;  3NGK A;  3DLG A;  3R5D A;  1HYS B;  2CAJ A;  2BV3 A;  2OEL A;  1O0P A;  2QYC A;  3BRE A;  4DR1 J;  1RHM B;  3R8Y A;  3H2V E;  4YR0 A;  1VQO S;  1RAA B;  2MZ1 A;  2FJW A;  1RUS A;  5K9F A;  1FVQ A;  3WIV A;  3I31 A;  4IDK A;  3MR2 A;  3NEK A;  1QE1 B;  4USU A;  3EDQ B;  3IBW A;  3T5K A;  1WF2 A;  2ROG A;  4OYW A;  3PXG a;  3DOL B;  3SCK E;  1SQE A;  2ADC A;  1XC9 A;  4B3S F;  4UT4 A;  2ZNY A;  1FJE B;  2GA7 A;  4ES2 A;  1KNZ A;  2B4V A;  1HAR A;  3CTR A;  3GJQ B;  3KUG A;  5H9F J;  1LV5 A;  2J0Q D;  1R27 B;  3Q8Q B;  4DV0 J;  2YWH A;  4WXW A;  1TKD A;  2GLQ A;  4QJV A;  3MMC A;  1HWJ A;  2YNF A;  1HMV B;  3KLG A;  4B9U A;  2ACM A;  2L9W A;  2W5W A;  1JLG A;  3P45 B;  4ZHR B;  3W3S A;  3G6E S;  3CJ8 A;  4ILL A;  1FSU A;  2DCU B;  4KGV B;  2YH1 A;  1WHY A;  2WON B;  3T5H A;  4DV3 J;  3TQ1 A;  2JEG A;  5D4L A;  1ELZ A;  4DLG A;  4ECR A;  3FCV A;  2QYG A;  1LW2 A;  3I6P A;  4USW A;  1UW4 A;  1HBM B;  3BN7 A;  4X64 J;  1TL5 A;  1FNM A;  1SBR A;  4B3T F;  1S6U A;  4TY8 A;  4CTA B;  1DJ0 A;  2UP1 A;  5KFT A;  4N76 A;  2H5J B;  4FDI A;  1AUS L;  1TFY A;  3R3T A;  3WAY A;  5E3C A;  4NYO A;  4ZIW A;  2AP6 A;  4PXE A;  1BMQ B;  2CJQ A;  3ZZT A;  3LF0 A;  2VFU A;  2RS2 A;  1XIQ A;  3IO1 A;  4CYS A;  2B9E A;  3DN9 A;  4KE5 A;  4CLU A;  2V68 A;  3EMT A;  3VAG A;  4O4G A;  4KB7 A;  1ZM3 A;  3OTE A;  3FFI A;  1EJJ A;  3SI8 A;  2BXJ A;  1LK5 A;  2RH6 A;  2VC0 A;  2IM3 A;  4HH1 A;  2RVJ A;  3Q3Q A;  1OYE A;  4UY8 T;  3ET6 A;  1OWX A;  4QU7 A;  1HNI A;  3T5J A;  4N5S A;  5ADZ A;  1UP1 A;  2NUU G;  4ZPT R;  2AF6 A;  4GC6 A;  4FYW B;  3CJK A;  4Q5V A;  1NK9 A;  1J5O B;  3MEE B;  1EZZ B;  2IY5 B;  2XB2 D;  3FMB A;  1S1W A;  1B8J A;  3PFO A;  2GCF A;  2X51 A;  2RU9 A;  4CYR A;  5A0Y B;  3KJV A;  2PSZ A;  3MED A;  3KDN A;  4UY8 5;  3JQJ A;  3TR5 A;  2EW9 A;  2V4J A;  4RNF A;  2G0C A;  1HR0 F;  2FHM A;  3N0V A;  4RX6 A;  4WP3 A;  2ZDP A;  2CDQ A;  3B54 A;  1RAJ A;  5EUH A;  1MG7 A;  2LYV A;  1JLA B;  2OPQ B;  3NGD A;  5CYJ A;  1HI1 A;  2MLX A;  5BXI A;  3Q8R B;  2EFP A;  4ZCL A;  3GV8 B;  2CQI A;  3AD7 C;  4ETZ A;  1KN6 A;  1Q53 A;  1NJZ A;  1Y9O A;  3NGR A;  1GT8 A;  4ZVH A;  3MR3 A;  1ZYQ A;  2F65 A;  1WHX A;  3A1Y G;  3FK4 A;  3PW0 A;  4NCB A;  1X4A A;  4ZK7 M;  1IKY B;  4U7U D;  2VQR A;  1A7G E;  4ZPA A;  1RAF B;  2RUG A;  5F8M A;  5KFQ A;  5JVG Q;  1UVL A;  1RT4 A;  2IJR A;  5KFK A;  1U1M A;  5AJ3 F;  4O3N A;  2WVE A;  2IIH A;  4LVO P;  3M30 B;  4I0W A;  4K2J A;  5MAO A;  3L09 A;  1PCA A;  2E7V A;  3DDI A;  4RLE A;  2CA9 A;  1T7P A;  4BHQ A;  1HD0 A;  2A10 A;  4WP8 A;  1RHK B;  3UNG C;  5B0G A;  5D4N A; 
#chains in the Genus database with same CATH homology
 4LRB A;  5EGH A;  4ZG7 A;  3TG0 A;  4LRE A;  1ELX A;  3DYC A;  5IJQ A;  1ANI A;  1ED8 A;  3MK0 A;  1Y7A A;  5HRT A;  3KD8 A;  1K7H A;  1KHJ A;  2ANH A;  2D1G A;  1P49 A;  4YR1 A;  5GRR A;  1ELY A;  2W5R A;  3M8Z A;  4MIV A;  5AJ9 A;  2XRG A;  1O98 A;  4UPI A;  4KAV A;  1SHQ A;  4LR8 A;  1AJB A;  4UOR A;  3UN5 A;  4GTY A;  4NWJ A;  1E1Z P;  1EW9 A;  1Y6V A;  1ZEF A;  2IUC B;  1HQA A;  1E33 P;  1KH4 A;  3UO0 A;  1EI6 A;  3DPC A;  3NKP A;  2GSN A;  1HDH A;  4LRA A;  4UPK A;  5L0K A;  3T00 A;  5LIA A;  3M8Y A;  2GSU A;  2GSO A;  1EW8 A;  1URB A;  4TN0 A;  2GLQ A;  4ZG6 A;  1ED9 A;  1ALK A;  3T01 A;  1AJC A;  2W5W A;  2W5X A;  1E3C P;  1FSU A;  2W5Q A;  5L0B A;  4LRC A;  3UN2 A;  4QAX A;  1AUK A;  5L0E A;  1KHL A;  3M7V A;  1ELZ A;  3UNY A;  4CXS A;  3BDG B;  3MK1 A;  3IDD A;  4FDI A;  4LQY A;  1ZEB A;  2W8S A;  2W5V A;  4GTX A;  1ALI A;  4GTZ A;  3WAY A;  1KH9 A;  3OT9 A;  4ZGA A;  1O99 A;  2IUC A;  1KH7 A;  4KJG A;  1ANJ A;  3NKQ A;  2W5S A;  4MHX A;  3NKO A;  4CYS A;  2W5T A;  4N7T A;  3NKR A;  1EJJ A;  4CXU A;  1AJD A;  3A52 A;  3WAW A;  3IGY B;  1E2S P;  3WAV A;  2RH6 A;  5LQQ A;  4KJD A;  5C66 A;  1ALJ A;  5DLT A;  2G9Y A;  3Q3Q A;  4NWX A;  5IJS A;  5DLW A;  3WBH A;  2W8D A;  3SZZ A;  4UOP A;  2XR9 A;  1KH5 A;  1AJA A;  3WAX A;  4UOO A;  3CMR A;  4KAY A;  1B8J A;  2IFY A;  4GTW A;  5DLV A;  1ZED A;  5GOV A;  4ZG9 A;  3ED4 A;  4CYR A;  5LRM A;  3UN3 A;  5TJ3 A;  3B5Q A;  3NVL A;  1EW2 A;  4LRD A;  3T02 A;  1ALH A;  1KHN A;  2X98 A;  1N2L A;  4LR9 A;  1EQJ A;  3M8W A;  3SZY A;  1HJK A;  1N2K A;  1SHN A;  3E2D A;  4B56 A;  1KHK A;  4MY4 A;  3TX0 A;  3NKM A;  5K4P A;  2ZKT A;  2GA3 A;  2QZU A;  4LRF A;  2VQR A;  3MK2 A;  4UPL A;  4CXK A;  5KXA A;  5INH A;  1URA A;  5EGE A;  3IGZ B;  3BDG A;  4LR7 A;  3LXQ A;  3NKN A;  3BDF A;  5LRN A;  4KM4 A;  4FDJ A;  3TWZ A;  4UPH A;  3BDH A;  4LR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...