4LRFA

Phosphopentomutase s154g variant soaked with ribose 5-phosphate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 137
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrfA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrfA01
2GSNA 1KH4A 1ZEFA 1AUKA 4UOPA 1KHKA 2GA3A 5EGEA 3WAVA 1ALJA 2W8SA 4UOOA 3M8YA 3WAYA 1ANJA 3T00A 2IUCA 5LQQA 4MHXA 1ED8A 4KAYA 3NVLA 4LR9A 4FDIA 4UORA 5EGHA 2W5VA 5DLWA 4LRBA 4NWJA 2W5SA 3NKQA 3A52A 4CYSA 3IDDA 4N7TA 1SHQA 1EQJA 2XRGA 3UN5A 3MK1A 1HQAA 2W5XA 5AJ9A 1KH5A 2GSUA 3IGZB 4YR1A 1ELZA 1HDHA 4KAVA 5GOVA 1URBA 2W5RA 3UO0A 4GTXA 4NWXA 1K7HA 1KH9A 1EW2A 4LR2A 1P49A 5GRRA 3M7VA 5DLTA 3BDGB 1AJDA 1EJJA 4LRAA 2IUCB 3MK2A 1EI6A 1ALIA 3WBHA 5IJSA 2D1GA 3M8ZA 4ZG7A 1E2SP 4CXSA 1KHNA 1KH7A 2GLQA 3KD8A 3UNYA 5INHA 5IJQA 1EW9A 2XR9A 1ZEDA 1FSUA 2RH6A 2X98A 3IGYB 5K4PA 4ZG9A 2W5WA 3SZZA 1HJKA 2W5QA 4MY4A 1SHNA 1ALHA 3LXQA 1Y7AA 1ALKA 1O98A 3E2DA 3OT9A 1EW8A 3BDHA 1N2LA 4LQYA 1B8JA 3DYCA 2G9YA 3MK0A 3NKOA 5LRNA 4UPKA 2VQRA 3WAXA 3NKPA 1ZEBA 4UPIA 1ELXA 4B56A 4UPHA 3TX0A 1AJBA 3NKRA 3Q3QA 1E3CP 1E1ZP 4GTWA 3NKNA 5L0EA 2IFYA 5L0BA 4KM4A 1URAA 4LREA 2GSOA 1O99A 4GTZA 4MIVA 3WAWA 4TN0A 4ZG6A 5HRTA 5LIAA 4LRFA 1ANIA 3BDFA 2ANHA 3M8WA 4CYRA 4CXKA 1E33P 1AJAA 3ED4A 3T02A 2ZKTA 4ZGAA 5C66A 4LR8A 4KJDA 3DPCA 4FDJA 4QAXA 5KXAA 5TJ3A 1Y6VA 4LR7A 3BDGA 3UN3A 1KHLA 3B5QA 3SZYA 1ELYA 5LRMA 1ED9A 1N2KA 2W8DA 3TG0A 3UN2A 4KJGA 4CXUA 2W5TA 3CMRA 1KHJA 4UPLA 1AJCA 4LRCA 5DLVA 2QZUA 4LRDA 5L0KA 4GTYA 3TWZA 3T01A 3NKMA
chains in the Genus database with same CATH superfamily
4S0MA 1O51A 4ZIVA 4ZPAA 5C7PA 4K4WA 3RRHA 4KGXB 2IYIA 1AUKA 2I5JB 2CNNB 3F44A 2CJBA 5KFBA 3FNNA 1UKUA 4Y65A 3SQOP 1I6JA 5J1PA 5KFAA 4DR4F 2C1EB 1P8GA 1WC4A 1OQ6A 1F5CA 3SDEB 5EGYA 5L1LA 1N5SA 2H51B 1C0TA 5J1EB 2HHWA 2AJQA 3E01B 5K5MA 2GQCA 2OFHX 4Y3CA 3DRPB 2CQIA 1KRPA 3C16B 4P9SA 1KS2A 4J90A 1N5YB 1X5OA 4HVZA 4CO5A 3C6UA 4NX9A 4DSLA 3IBCB 3EPIA 1S1WA 3LP2B 2NSBA 1RWWB 2W2OP 4D3GA 2XZDB 2YNIA 4LF6F 1WHYA 2CA9A 2BYCA 3QBCA 2IRXA 4V19X 4K4ZA 2GHVC 4W92B 4ZLLA 1EQ0A 1X60A 2CQPA 4XDCA 4CYUB 2IDEA 3GZ7A 1JXLA 1BHNA 1RA6A 3W8PA 1NK8A 2YKMA 4KHMA 4LRAA 2IUCB 2NXCA 3J81Y 4O0NA 1O6XA 2XCPA 2O1PA 3LAMA 3FBCA 1RT2B 3KLFA 5HBMB 4B9VA 3R5BA 4DF4A 2MY8A 3G87A 4QCLA 1TV6A 1I1GA 2KYZA 2RMLA 1HPZA 3CCJS 3PRDA 3Q23A 4ECWA 4LMZA 3HVWA 1HBOA 1DBDA 4NLDA 2Y0SD 1T9XA 3I9ZA 1Y00A 4HL9A 3SIPB 3O2IA 4CRJA 4YQWA 3HJFA 1AB8A 1FWKA 2JVOA 1Q0NA 2RQCA 3OW2R 4L3KA 1G1XA 2BJ3A 1Y10A 3DYAB 5JXSA 1Y7AA 3JSMA 2QMXA 1S9EB 2OEMA 2HHSA 3D0IE 2XSJA 2DB1A 1BQXA 2CQCA 1HNIA 2HLTA 2NSCA 3E8OA 3QAEA 1PYOB 1Q8KA 1M1HA 1REVA 1MMNA 1EHWA 2AW0A 3MF5A 3N5BA 4NZ0A 4PXCA 4Z2XA 3MMCB 2KU7A 3UVJB 5F9NA 1HD1A 3BSOA 1N2LA 3QIDA 4CIOA 4LBHA 4LT6A 1KVIA 1D0EA 3DLKB 1JLQB 1GMWD 1HHSA 2ZC3A 3B8HA 3RYLA 4QJVA 2FY8A 4NLTA 3D66A 5J2MA 2BXJA 3M05A 4G1PA 2B5JA 4C2MA 6AT1B 5KOXA 3DLGA 2CPJA 1WC3A 1B0VA 2CDQA 4A8XA 1PILA 1AZSB 1ICEB 4DHVA 1U1KA 1BY9A 2GIRA 2O3DA 5CA5A 2ZH7A 1IBMJ 3L09A 1KNZA 2NYIA 3MZIA 3GYXB 1WHWA 5C25B 4U67Q 5KFVA 4BLGA 2ZH1A 4F0HA 2ZDOA 2DNHA 2FVRA 2MZRA 2YKMB 1JNZB 4N47A 3U1MA 1QVFR 1V9OA 3K8VA 5DDQC 3Q22A 3TA0A 1C1CB 3MPWA 4JI0J 2OPPA 1RK8A 4DPXA 1PBUA 2BW2A 3SCJE 2UVVA 4QIFA 5E3RA 2AWZA 2DXEA 3QQCD 5D4PA 2HHTA 5C66A 2ZJQQ 2G0JA 3CCSS 1OSDA 3P45B 2HAIA 2J0XA 2I2YA 2UUAJ 2C3YA 2GCFA 2MZSA 2MDAA 4TY8B 3CCRS 1DY3A 1KR4A 2VBWA 5DGAA 4I6AA 2DNMA 4MKVA 4ECUA 1IWAA 3FEYB 1N2KA 1IKVA 6FDRA 3AAWB 5I3QA 3VAJA 4DV4F 2VG5B 3TEGA 1KONA 3AJ1A 2OUGA 1FJGJ 4PYAA 1JMTA 4UPLA 1RAEB 1NDPA 2FQQB 3K7RA 4H4OB 2OAUA 2ZHOA 3BN4A 4CZCA 2J6TA 3TOQA 3DLHA 3GYNA 2QG9B 3RB6A 2GIFA 1RAAB 2BJ1A 2K7KA 2PO4A 6FD1A 5F9LA 3QLHB 1QAYA 3W5ZA 1S1VB 4IO9Q 4WF9Q 4DL2A 3NKMA 2ZEJA 2JNJA 4UOPA 5KFUA 4ZN3A 1WHXA 4Q0BA 2DBBA 2VG7B 3CT9A 4PUOB 2IM0A 4USKA 5HJYA 3CC2S 5D78A 4JV5J 4LFCJ 4AQYJ 1NB2A 1XNRF 2J7WA 1KHVA 2N4DA 2YNHA 1RTDA 1UVMA 2WAQD 2A1BA 3I0RB 2R2RA 2NREA 4YUDA 2EFPA 2ZKUA 1ZTTA 5CZXA 2HZVA 3R5CA 2CZVC 5AXKA 3N79A 5HMXA 2UUBF 3QO9B 5DLWA 1HMVA 4UW2A 1TMMA 2XY6A 3W61A 2PE8A 3C14B 1M1GA 2QLWA 3CDWA 3UW1A 3MK1A 2WSCC 2X7IA 4FDFA 3TUZC 4IQXA 4A46A 2GSUA 4ZS6A 3BGLA 3D1QA 1ELZA 5LJ5Y 2W5RA 4NYZA 4ZDNA 3UO0A 3Q8UA 2QLJB 1LV5A 4GTXA 3KLIB 1SL2A 3QLHA 3H2UB 2AEFA 3MM6A 5A8WB 3KJFB 4USHA 3AH6A 4I7FA 3GJSB 1RSCA 4J91A 3T1AA 4G1IA 1SI9A 2AJFE 4WKYA 3R1LA 2DR9A 2B9WA 4B3MF 1RT4B 3FSYA 3I5AA 4C7QA 2QMWA 2BKPA 4ATNA 1CS4B 1S9GA 3M6UA 4ZPWR 1FRIA 4DV7F 3SV4A 2M70A 4PXDA 5LMNJ 4EGLA 4N56A 3FEXB 1KQKA 1T05A 3TUPA 3ETOA 1PGZA 2ILYA 4OZ5A 4AE5A 2VBYA 4ES3A 3V6DA 3R1HA 2ROPA 1TELA 1WC5A 3H8YA 3ONQA 3CIZA 4RW8B 2Z2ZA 4AXIA 5K4PA 2ZH4A 1SC1B 5F8NA 3M6XA 4YS2A 2RQ4A 3EGWB 1S6PB 4LVNP 4DN9A 4J5OA 4KHPF 3G8SA 2GGPB 2VF3A 4QWBA 4CO1A 2MQMA 2Q6CA 1SC3B 2OELA 2XMUA 2LEPA 2Y1RI 1YJVA 3GE9A 3GR1A 3MEEA 3L9ZA 3W9HA 3T1YJ 2IM3A 2KXNB 2PMZD 2E44A 2HNYB 2J0QD 2POKA 2JHEA 2NUHA 3HKZD 3EXCX 4USTA 3U27A 4CTAB 3W2WB 5D0HA 3CCLS 4FF2A 4C4WA 1H2UX 4AT1B 1KBRA 1UFLA 2IVMA 2UV8A 3ENAA 5KFRA 4B3SJ 1AJBA 1CEZA 3NKRA 2HIYA 2A0FB 1Y7PA 4QWAA 5GMEA 3BEGB 3Q89A 1O99A 1NJWA 4C9DA 1FJCA 3AT1B 1P9QC 4ECYA 1JLCB 3QZ8A 2Q79A 1NJIT 1T3OA 2XMKA 2HNDB 3SZ2A 1X4DA 2BZ2A 1RWKB 3I5BA 3IBWA 2E5LJ 4B3MJ 3B78A 1T9YA 4DWIA 3KHHA 1AFJA 1R8HA 3HZEA 4ECSA 1XN9A 1R3NA 4IDKA 4ECTA 3DYAA 2VOOA 2XB2D 3D7SB 2DY1A 3NKYA 2XWXA 1D9DA 2ZH9A 2RAQA 3QRQA 3C14A 4YB1P 4CLUA 3DI6A 5HQLA 4LR7A 4RLEA 3UVJA 2B9YA 3FVYA 3CMAS 4M94A 4U7UD 4IO1A 1VLOA 3M8QB 4QIGA 3KG4A 2ZOMA 4RW6A 2A2DA 3KK3B 3HHKA 2OKQA 4RR5A 5L46A 1IXKA 2D1CA 2ASLA 1W26A 2G0CA 3GJTB 4NI2A 1LW0B 4JV0A 3BQ2A 1S10A 4GKKJ 4M1KA 4PXEA 1PC5A 1YX2A 3OFEA 4IH7A 3TVYA 4M5KA 5L38A 1HBOB 2VZ9A 1KWMA 1NH7A 2WCXA 3LPEA 1KFDA 4USWA 2M5YA 2DGVA 5L39A 1QE1B 2NZCA 1FE0A 2KB2A 4H4MA 3KJNB 4QW9A 2IUCA 2IIHA 3QSIA 4WPAA 3T41A 2G2YA 2IRYA 4CNYA 1ZM3A 5FDLB 5D77A 3SMZA 3EVWA 1S1VA 4G65A 2XZWA 4NLQA 4O44A 4ZVUB 2RUGA 3OQ2A 5HMWA 3ENQA 3OVAA 4JBCA 4DCJB 3PW0A 1S5ZA 4FPIA 4WFXA 5E5NA 3HP6A 1JLEA 4OMFG 4XIUA 2W9BA 5F41A 3K58A 4TQSA 2WOMA 2GO9A 4ZVOB 4OYBA 1F2GA 1H98A 3G8QA 1IKYB 2CADA 4QAXA 3V6DB 2XMJA 2XWYA 3UCZP 1EZZB 2DRDA 3OD2A 4GVLA 2HFZA 3DLEB 4DDFA 2F4VJ 1H38A 1UZHA 5F8GA 4ETXA 5A8RB 4DUYJ 2QLXA 2IBOA 1D1UA 4J9PA 1RADB 2DH7A 2H5IB 1N0UA 3HHLD 3KK1A 3J7A1 3Q8YA 2OSRA 1AYEA 3HULA 3UPFA 2HIQA 4HACA 2IJRA 1FK9B 2W4PA 3M8ZA 4WBFA 1DLOB 2UUTA 3D28A 4FKXA 4P2SA 2X1BA 2K1RB 5DDPC 2OPPB 2LXUA 2B5JB 1F9FA 4J9QA 3QT6A 5GADU 5CZVA 4ZA1A 5KT2A 4ECVA 2B0GA 2DITA 2V6AA 2ZE2B 4C8NA 1K9MT 1SJFA 2ZZMA 3IGYB 3ET6B 1SJ3P 5CYJA 2W5WA 1DHMA 3VV2B 5LMUF 3MCOA 2MQNA 1IBCB 3O44A 3GV7B 1ALHA 1X31C 3CTRA 3DCAA 4ZPVR 4UF4A 3R6GB 4CO0A 3O5TB 4R5PB 2VPYB 3B4MA 1DRZA 4QZVB 3CNQP 1TVRB 4YDXA 3DU5A 2V4RA 3MGJA 5BYRA 4OHVA 3C46A 4ZOSA 4ER8A 3SEOA 1HKAA 1XMOJ 1Y5IB 2C2NA 4PG4A 2E5LF 3VR1A 5KFHA 1QAIA 5T14A 3PKMA 2KHDA 2Q43A 2WBRA 4O4GA 1WKLA 1N54B 1UWBA 3TA1A 2M9KA 1RISA 3EDQB 1JLAA 4AL5A 4OYZA 2NQPA 3FCVA 1X4FA 4I1TA 3JQJA 4ZCMA 2B6AA 5DG8A 2DGQA 1URAA 2M88A 3EDRB 4M5DA 4IFYA 8RUCA 3PJXA 1X4AA 4ANEA 3C66A 1U26A 5ETVA 4A8OA 2VG5A 2ZVIA 4O3SA 5KTQA 4DR6F 1NB7A 2GAGC 1VJQA 2ANHA 1IR1A 4NZ6A 2J9DE 4CLWA 3P4UB 1R8CA 5HAOA 1RT5A 4A8YA 1NKBA 3MEDA 2HHPA 1EKRA 5K8PA 2V34A 1CQNA 3W2VB 2ZJPQ 3D4JA 2F3JA 3IM9A 4NRTA 2R4FA 3D6TB 3MM8B 4O4GB 2VONA 3R5JB 2BE7D 2IVYA 2HAFA 2VD3A 1DJ0A 3DOLB 3H5SA 4WE1B 4ZVFA 3O1LA 4CDIA 3TZZA 2BR0A 2P8IA 2RQMA 3MMBB 4M95A 5KG7A 1HWUA 1SV5B 1YBAA 2HWHA 2W8DA 3LP1B 4GKKF 5E3QA 4F4WA 5JVHQ 1WACA 1FX4A 4LIWA 2CPIA 2HRYA 5E3PA 5HK4A 4OHZA 3OJSA 4GKJJ 1FA0A 5CABA 2CQGA 2DHXA 4LRCA 5BXIA 3KLEB 3M2RA 4LRDA 3IRWP 3V6HA 4WYLA 4DFKA 4IG3A 8AT1B 4X4QA 4DU7A 5CAAA 5KG2A 4BCAA 1NM2A 3M9OB 2UUCF 5KT3A 2V9KA 2IRUA 1LWXA 2FGOA 1MMLA 2V4JB 3VZIA 1XNQJ 4KR0B 2K1RA 1S77D 3PV8A 2GA3A 3TZXA 2VHGA 4Y34A 3QZ7A 1GTHA 2GA7A 3DOKB 5CD4A 2GMHA 2XS5A 2YX7A 3KUEA 2C3PA 2AGOA 2HBZB 3T00A 4CI0B 1N52B 4CP5A 2R7XA 2L3MA 3AQOA 3CEDA 3DOMA 4NMXA 2BW7A 2OD6A 5KG5A 5C42B 2W5VA 3CCTA 3CPWR 3E2EA 3OR1B 4LRBA 4B08A 3TAQA 1X5PA 3S1TA 1H7XA 4JOUA 4B02A 3IAM9 3L7UA 2DCUB 4ALZA 3JSMB 1XMQJ 2WONB 2IA6A 1T03B 1HQAA 1HQUA 2YH1A 4G1QB 4MMOA 2R2SA 2ZDPA 3W2VA 3QO9A 2EKNA 3DDIA 4ID5A 5CCLA 3T1HJ 1WI6A 5E7OB 2VV5A 5EX0A 1HBMA 1HPZB 2BJEA 2L9NA 2RJZA 2F7VA 2V2ZA 4KT0C 1FRLA 2G2ZA 4Z7YA 5IXUA 4DSEA 3RRGA 3TQ1A 3PW4A 3VZHA 3KNAA 1SC4B 1VQKS 2HHQA 4UOCA 5B0FA 3PEHA 2R7UA 1C2PA 4ZLPA 4URGA 2PSZA 4FYXB 4DL4A 1SH0A 4USVA 4DS4A 1H72C 3TAPA 3WBHA 2B8QA 1RXOB 2ZFHA 4U8YA 4A8MP 5CYQB 3HVTB 1HQ2A 3W8GA 5GMKa 2FHOB 2PIIA 3GIRA 4X4SA 2KL8A 4A8FA 3DXBA 1FXDA 3EGVA 4G6VB 4CO2A 1EW9A 1RAIB 5HP1A 1FWPA 1HARA 1Q53A 2AMCB 3ILIA 4G1QA 4E98A 1Z2ZA 4ETZA 1RAGB 5EHHA 3T9ZA 2LEAA 1P1TA 1TL1B 3CCZA 3Q8PB 1WG5A 1DQ9A 3DRYA 1RWVB 2WTFA 1N5YA 1FRKA 4FYWB 5JJBA 3J7Z5 4EFAC 5H9EK 3OR2B 4I0WA 2B6AB 2BJ9A 4L72B 2W7AA 3FDSA 3D3BJ 2QLFB 2VBZA 3MD1A 2VJVA 1IBLJ 4JI8J 2E9ZA 4LUBA 1CJKB 1S76D 4LQYA 2DGXA 3DKDA 4PCQA 1N56A 4K5SA 2C2RA 3TANA 1FE4A 4E0DA 2BANA 1AUDA 2HZAA 1RGVA 4F02A 2DXFA 3NRBA 3NAIA 4CO4A 5KFNA 2A6MA 2QYGA 3HZGA 4OHWA 2WONA 5DQGA 2MKHA 1F60B 2X1AA 4C8YA 3HT0A 4EI2A 2W4DA 1UJ6A 2HK2A 2WSFC 1SXLA 3DRSA 3JXOA 3MMAB 2OPQA 1YRXA 3ELHA 4TYAA 4ZJQA 1GFWB 5C42A 5L0EA 2JC0A 5LSOA 2XYGB 3BN7A 1QTMA 3RW7A 4DXLA 3G6VA 1JXEA 2DIVA 1YJRA 3DMJA 3N0VA 3RZAA 5FLXY 3WAWA 3BH6B 5KT4A 1LK7A 1G6BA 3DOKA 4IR9A 2F40A 4KY3A 1UAWA 2DISA 2Z2YB 3KDOA 4OYOA 3W63A 1S9FA 1J27A 1P6TA 4NCGB 1H3DA 2IPOB 4EK2A 5K8NA 3Q8RB 2ZH5A 1UVJA 1CPZA 3I4HX 2QL5B 5IQQA 3ED4A 1UA0A 3I4PA 1VHFA 4P7TA 4QIVA 3KYLA 3T02A 1NPPA 1OWXA 3OTOJ 1JLBA 4PZVA 2W8LA 2XLJA 2FC8A 2AEJA 4ZVEA 3OSPA 4DX5A 4NLWA 1RWXB 1RT6B 3MMCA 1WC0A 3HT3A 5HLFA 1UA1A 1N34F 2FJXA 1VQYA 1Z1ZA 2AQ4A 1UVNA 3C6TA 1NHUA 3OR2A 2AGQA 4O44B 4KPCA 3O8WA 1U1LA 3MECA 2UVRA 3ISND 4DLEA 4WZQA 4J9KA 2B7CB 4CXUA 2I9SA 3KDNA 4HTIA 1NHVA 4RWWA 3MAHA 2EWHA 5KG1A 4DMZA 4F3QA 1Q16B 2DIUA 1WC6A 4ID8A 1JKHB 4WP8A 1LWCB 1KEKA 1JLEB 1JXVA 3L7PA 4RKUC 3TWZA 3ZO7A 2ZUGA 1MG7A 1S1TB 1WELA 1RTJB 1D8YA 4WYWA 5E0OA 3VAGA 2WRMA 4X66J 2JLEA 3GONA 1L3KA 4Y2KA 1OJ4A 2GQ2A 2R7OA 4DV2J 1WHVA 2W8SA 1FDBA 2BE2B 3HDSA 4DCPB 3M8YA 1T9TA 4FF1A 2OSQA 3T5JA 2B7BB 1XTZA 1N33J 3HVAA 5LQQA 1WF1A 5LL6d 3PX6A 3BREA 4I68A 1XMQF 4DZDA 1QAJA 2I6WA 2GS8A 4N41A 1BLUA 5ADZA 2AJ4A 3G4SS 3FMWA 5DRKA 5EN1A 1HYSB 4JI4F 3BGRB 1JJCB 1ZTWA 3LGNA 1KH5A 3N4WA 3IGZB 1RAFB 2GFFA 3OTEA 4W98A 1BWVA 5AXLA 5HMZA 4RU9A 1MWQA 3ISZA 1D9FA 1FFGB 4Y00A 3C16A 4DQRA 1DARA 3RB3A 1HNXF 4EBEA 1U6FA 4WK1A 2AGPA 2CKWA 1RTIB 4LSZB 3TUJC 4KBIA 1PSDA 2V69A 3AHPA 4HACB 1U49A 4Q8EA 1F9HA 3M2RB 3K89A 1X8DA 3MM7B 3UDVA 2LEBA 1N4LA 1WOSA 2UXCF 2L08A 1VQSA 4Q2LA 4DR5J 2KJVA 1HNZF 1S1XB 1TP7A 2IVFB 3KMQA 2GJFA 3H7HB 1LNQA 4UOGA 4LVOP 2EKYA 1WG4A 4MFBA 5ETNA 4F04B 4ZMMA 2XC9A 4M5GA 5GADI 3L95X 4TKTA 4KV8A 3W9IA 2V9WA 4F2RA 5IJQA 2MMYA 4HHHA 2C42A 4EWTA 2X98A 4HHUA 4WXWA 4DSJA 1GAOA 1OIAA 2H1YA 2IYGA 3DGVA 5F3ZA 2MQQA 4B3RF 1D8ZA 4TN2A 1FNMA 1XERA 5A76A 3V2UC 3CO0P 2HVEA 4LSLA 4M5JA 5J2NB 3V81A 3OL6A 1F5BA 1FKOB 3DLEA 4NLXA 5EWEA 3EPGA 2B4PA 3CJKB 4B3SF 3CC7S 3BDHA 4HTJA 4TY9A 3SSSA 3OTBA 1HBUB 2BJ8A 2KXHA 3MPYA 3IRXB 2GVDA 2KT5A 2E1MC 5DETA 3I87A 5LT5A 3MM8A 3BKFA 3CCQS 4C3MA 2VQRA 1RBOB 2X1FA 3A3PB 3MEDB 2FLNA 4ZVGA 1KOHA 1ZEBA 3DM2B 4J9LA 4ZLNA 5KFIA 1TKTB 5IV4A 3NWGA 4XPEA 4P74A 1UCNA 3BGFA 4F4YA 5IC6B 1U02A 2GGPA 1R8BA 1RWNB 1T05B 1VQ6S 1M5OC 1TK5A 4IG0B 1HA1A 1UVKA 1VRQC 1WOOA 3H98A 1SJ1A 1OSCA 1U09A 3K5PA 3N6LA 3P3DA 4M5DB 1B4SA 3PR4A 3DRXA 3MFHA 4OI2A 4K4SA 5HRTA 1IR2A 3NLCA 3PCOB 3MM7A 1NSAA 3JYTA 4ED1A 4P7VA 2FZKB 2NUUG 4DPTA 1Z4UA 3IO1A 2DGOA 5K8OA 2BQ3A 3IS9A 3BSAA 4CYRA 2Z2MA 2QO3A 3I0SA 5DDRC 3OL8A 3V4IB 3AB2B 1OMSA 4QR0A 3RBDA 4DR1J 1ZETA 2FJDB 2J0SD 4HH0A 1HQUB 2B8PA 3D1OA 5JUMA 4C97A 3VAKA 3PW2A 1LW0A 4FYDA 4KJDA 3DLKA 2XNRA 2HKEA 2LMIA 4QWEA 5FLXU 3TI0A 4B9UA 4QYZJ 9RUBA 1SC6A 5KFXA 1KHLA 2VG6B 4ITSA 5D6GA 5LRMA 2A10A 1WKKA 3WDOA 3DOMB 2OEKA 4KJGA 2CRLA 2Y1JA 2MZQA 2Z2LA 4NLVA 4KFBA 1FXLA 3JAMU 3D6HB 1XJWB 4LF5J 2QZUA 3PDNA 1GMWA 1OY6A 1CVJA 2D74B 3OXFA 2BKNA 3EZUA 2YKQA 2DPIA 3IS9B 2QFIA 2VOPA 3NWRA 4L76A 1VLYA 4O23A 4TU8A 3LWLA 4CT8A 4X4RA 3K57A 1VBXA 1KHKA 2V8DA 1U0SA 4QWCA 2EFGA 3HHEA 3N01A 2MB0B 3GILA 4OI6A 4Y6IA 1RLDA 4HLBA 3W9JA 5C5JA 2X1GA 4KGZB 4ILRA 1F9EB 4UTGA 4C0HA 2F1FA 3BO3A 4CYUA 4FBTA 1RTHA 3HHLA 1U2CA 3GPAA 1WNEA 2FLOA 3MAAB 1U1RA 2XI2A 2MHEA 4ZVRB 3AJDA 2ZOFA 1KTQA 1PJ7A 3CCMS 2N7YA 3CCVS 2XRGA 4QW8A 1GX5A 1B0TA 2YY3A 1HDHA 4UUWA 3W1YC 1K1SA 2DRAA 3NNHA 1U8WA 2JX2A 1S0VA 3CJ8A 5HATA 1ZA1B 1F1BB 1FO1A 2CPEA 1YJUA 3B54A 3HFVA 3HJVA 2N3LA 1B99A 1BGXT 3GIKA 2N82B 4DFMA 4L75A 1GH8A 3VWSA 3F0NA 1VRTB 3MOJB 4KKOB 3FJ2A 1EJJA 1RT4A 2QC3A 4LSLB 3NP5A 3BS9A 5J2NA 1FI4A 2BOAA 4KFBB 4ZVHA 2KZZA 5SUHA 5B0BA 4KH0B 4DL3A 3QJJA 5EWFA 2QFJA 2H48B 4FP9A 1FXRA 4I7FB 2P9GA 4YP3A 1HWIA 2I5JA 1E2SP 1HD0A 1SH2A 4NMLA 1F3FA 1NDCA 3ZNJ1 4CH0S 1N36J 4IKAA 4IOAQ 2CZ9A 3DNCA 3PFEA 5IOLA 2MZ1A 4LF5F 5AXNA 5E33A 3RRKA 1O8BA 2ASJA 5CYMB 1SVDA 3SXLA 1EKSA 2R8HA 2WZ1A 2W9CB 4JI5F 5IM0A 2C3OA 4JV2A 2Q1LA 4OJGA 4K50A 2MTLA 5GMDA 1Q1KA 2RUSA 1CJTB 1FDDA 1MWZA 1T9VA 3OT9A 1SQGA 2J0WA 3FBFA 4NXNJ 4LQ9A 5IT9Y 4DX8H 3HVRA 5KG4A 1M0SA 3G82B 3T6BA 3UCGA 4IR1A 1S4EA 5U47A 1YSJA 1GQEA 3DRRB 2RQKA 2FHJD 1CSJA 4OQJA 5JMNA 4FZVA 4ECXA 2UZAA 1APSA 4IH6A 1BMQB 3DU6A 5L1IA 4OX7A 4DV1J 1X0PA 5FD1A 2GZOA 2RD5C 3BJYA 2J7UA 2IJNA 2A6OA 2IFYA 2GVZB 4ZP7A 2HNYA 2VKZG 4N8NA 1FSUA 1JLCA 1RT2A 1PCAA 4YB5A 3T5LA 2F63A 3SCKE 2DNNA 2LA4A 1P9YA 3D6FB 4J9NA 3WHIA 2CIMA 1IQZA 1TKXA 3EVOA 5L1KA 2ZH6A 1WDTA 3BYPA 4Y28C 4ILMA 4TU7A 2COLA 2KRBA 1UVIA 4CXKA 1KHWA 2CJYB 4NLPA 1JK9B 3FZBA 4I69A 1R6YA 2H5JB 3V6KA 3QJLA 1S48A 4O3NA 1BE4A 1LXJA 2E29A 2KO1A 3KFWX 1JLFA 5GAEU 5L8RC 2EBGA 4DQQA 2ZH3A 3BBCA 4QWDA 1LK5A 1EETA 1HBUA 3AODA 1BQMA 3GIIA 3KWMA 3QWUA 3MD3A 3FSXA 1RYRA 3W5XA 4BWJA 2RS2A 1VYAA 2QTWA 1TKZB 2GO8A 3HKWA 1FFSB 4OYIA 3KMSA 4A8QA 3EGZA 1HI1A 2E1AA 4E8UA 1AW0A 3OPKA 2HS0A 3HD2A 1UW9A 2VUGA 2HQCA 4FKYA 4DV3F 1DTTA 2W25A 5KFPA 4DR4J 1OQ3A 2B3TB 4URSA 4FBUA 2PA8D 3SV3A 2HW3A 3QIPB 1AZSA 1TU0B 3QGIA 4ZVSB 2B51A 4BWMA 4GTYA 3TYTA 3A8KA 1MU2B 1U1OA 2DO4A 3BYRA 3MAAA 2M3DA 3QATA 3WIVA 3ZZRA 3HSDA 1NK7A 1VBZA 1FDAA 3OFHA 4DL7A 1TUVA 3VF0B 2QMUB 2OPRA 2VC1A 1WEZA 4R0EA 3KHRA 2HVDA 2O5DA 2ZWOA 3KLEA 3DRRA 4KJIA 4P72A 4CLTA 4Q45A 4FXDA 1UPMB 5HO4A 1FESA 3PRBA 2HHUA 1YJ7A 4OZ0A 1RT3B 3MM6B 4UORA 3MR5A 2VASA 3AOAA 2VDHA 1LWFA 2C22A 1X5SA 3IG1B 3UWTA 4F7VA 2ZM6F 1RZMA 2BOPA 1SHQA 1ZAXA 3RGIA 1MMDA 2VG7A 1JLQA 4R0JA 2K2PA 5F0WA 5HQMA 2KM8C 1SKUB 2VFVA 2VC0A 2W7OA 3RAMA 3G6YA 4NWXA 1UPPA 3WQPA 5A6WA 1B64A 1X4GA 3KK2A 2DNLA 5GAHI 3OUYA 4NWBA 3TJAA 3VGSA 4D3HA 3PZPA 1SKWA 1RBLA 4YN3B 2Z8QA 4ANCA 3LOUA 2FIUA 4DV3J 5KFKA 1YDLA 1WF0A 2RDDA 3CJ5A 4USUA 4U7CA 1K0TA 4ZP8A 2ACMA 1QJHA 2OPSB 5HQ8A 3KJVA 2XS7A 1URRA 2HFNA 3CB4A 1TKTA 4FPRA 2UXBJ 4ZG7A 3KKFA 3G6ES 2AZ1A 3QIPA 3FSIA 4K4XA 4P73A 1NZ8A 4F4XA 5IQ6A 4DR6J 3ZZOA 2MQOA 1ZEDA 1H73A 2FHKA 1FKAF 1LFPA 2CFXA 1VDHA 3A3OB 2KJWA 3H2VE 5K8MA 1R89A 2Q66A 2ZNYA 4AXJA 4DPYA 2J9DA 2HQDA 1I3OB 1NDKA 3H0PA 1GX6A 1UL3A 3MR7A 4IYQA 2D9PA 2CG8A 2IAJA 1R43A 1KKHA 4JI0F 2CPDA 2UUAF 2CVEA 2GX8A 2HFOA 2RILA 4ID5B 1YJ9S 1QDUB 2IDLA 4O0IA 5LRNA 3ICLA 1J2VA 4QOTA 1FD2A 2C28A 4OZ2A 2QEXS 1ACMB 3I56S 4B3RJ 1XMOF 2HMIA 3C6UB 3I5CA 2ZVSA 1CG2A 1RA7A 2ZE2A 1YVFA 1HHQA 2XLIA 5D8HB 2PN6A 4P75A 2BMBA 3UDEA 4X4UA 4A4JA 4ELUA 4TNOA 2GSOA 1JB0C 3ZZUA 4DUZJ 3GV8B 3S8SA 3M8RA 3V81B 3QT5A 4WFNQ 3KK1B 4XDDA 2KYXA 3CCUS 3UFCX 2VPZB 2W8KA 3LGHA 4UZCA 4MYTA 5E3CA 4YHHJ 3H4DA 4LR2A 5DGBA 4ED6A 1P27B 1B3TA 1HFEL 3R6LB 2HYIB 2KXFA 2C2EA 1AJAA 4M63A 2ATCB 4HDGA 2YXLA 2BJ7A 3UNGC 5C24B 2DGTA 3J7YI 4DQSA 1FJGF 2FJAB 2ZWPA 1ROFA 3C19A 3PG9A 5TJ3A 1IR0A 2CJXB 2D3O1 2FJEB 2F4VF 1HYSA 2F65A 1IUJA 1RWMB 2H65B 2YWHA 3EZOA 4YY3F 3J80Y 1SPBP 1MLAA 3HLUA 3SZYA 8ATCB 2AIRB 3LP0A 1QSYA 1T8EA 1S9EA 2EFOA 2NYHA 4LBIA 3PKYA 4FN5A 3ILOA 2HEKA 2OD4A 5KG0A 3I55S 1RLCL 2BE2A 2LYVA 2MPUA 4PXBA 3U1NA 2JFDA 5GAGI 1CLFA 1KHJA 2XLKA 2FVPA 5HVGA 3KLGB 3R97A 3ZTSA 4HH1A 1WC1A 2HRUA 4OYXA 1J5EF 4UOFA 3P5TL 3GFZA 1TV6B 3RW6A 1EX8A 4B9TA 3WAVA 1GXLA 2W2QP 2FZCB 3MPVA 1OS5A 1S1WB 3LP2A 1VQ8S 1S0NA 5LSRA 2V5HG 1CBKA 1EIYB 3WAYA 1XBWA 3BGOP 4KIAA 2XZTB 5DO2A 4V1Ak 5K9FA 5I42A 4YR3A 2AX0A 1VRTA 4QIEA 3VVTA 1TL3A 2DNQA 3NCQA 4IQMA 4XPCA 1TK8A 3NVLA 4FDIA 1IKVB 3B4DA 2UU9F 4K4UA 3ZZTA 2F8EX 1S0MA 4OHXA 3JAMY 3EXYA 4XO0A 2XGPA 5A0YB 4N7TA 2RH3A 4X64J 5HSPA 5G4DA 1Q8LA 1AROP 3AXMA 4A8SA 2O67A 3VALA 2EFNA 4KAVA 5MAOA 5GOVA 2VIHA 2MEWA 1N5QA 2JSXA 2LQ5A 3TAMB 1WF2A 2QJ3A 2V4JA 4XAKA 1KVKA 1EW2A 2GQQA 4ED0A 3LP0B 2V2QA 3A8JA 2BABA 3H25A 1R0BG 2LVWA 4YY3J 4YFUA 4RZRA 3WX4A 1VQPS 1FEEA 3NY0A 2KRRA 2HNDA 4C3KA 3G96A 3RG6A 2J8AA 2ASYA 3GU0A 2AYBA 4M5HA 1LKZA 4OFZA 2K06A 2PDAA 3RR7A 4ED4A 4TU9A 1NJZA 2M8HA 2UUCJ 4R25A 3FEZA 4PWDB 4YMEA 3M1VA 3MMBA 3UNYA 2RKIA 4OI3A 2BV3A 4BBYA 5IT4A 2BA9A 2F8HA 2FJBB 1OYDA 4FF3A 1L3UA 3T3FA 2EFQA 3WC2A 1NK0A 2HVHA 1O98A 1EARA 4P71A 1YBTA 3CCES 3N6MA 1EP4A 2ADCA 1VK3A 2CXEA 2QL7B 1F3VA 2YNGB 5M2PA 4JI7F 4CLSA 2DR6A 4B9LA 4RX6A 3DYCA 2YBVA 3MK0A 1ZBTA 3QT8A 2DR7A 4BS2A 1GXUA 4N5SA 2HFUA 2JL9A 2YNFA 4CLYA 1Y9OA 4CNZA 3IGNA 5D3GA 2BACA 1GT8A 4LSNA 3TX0A 4F4ZA 2R9LA 1RE1B 2CQHA 1E1ZP 2OO4A 3ITHB 5H9FJ 1FVQA 3QFHA 1RKIA 2RHSB 4O3OA 5A2QU 3GSDA 5LSLA 2DEJA 1KLMA 2B4VA 3M2VA 3WX8A 3R5GA 1GMVA 4M5LA 2QL9B 3VTIA 1W7WA 2G13A 3TZWA 3V5RA 1NK9A 4U6PA 1S0OA 4YR2A 4HKQA 4UY8T 2ZKTA 3BDEA 5ETLA 1BWEA 3M8SA 4GRSA 1W25A 7FDRA 3R7SB 2LQ9A 5KXAA 4N76A 1LEOA 2AJ2A 3CCWA 3JQMA 3A12A 3TJ9A 1HMVB 5KAKA 1VQ4S 3Q2TC 1RAOA 2YPYA 4PKDB 3IA0A 1NSQA 4MT1A 1YJTA 2XBPA 3SDEA 2DY9A 1VQ5S 4EYIB 3DFEA 4Q43A 3ZC4A 1NCLA 2L48A 1HI0P 1BXNA 1Y3JA 4WCEQ 2OPRB 2ZM6J 2DHHA 2DNGA 3EICA 3MM9B 4DFJA 3H4BA 3DRSB 4FS2A 4MKYA 3KUGA 2BJDA 3MI7X 1YRUA 3GR0A 1MU2A 3UDCA 1OPZA 1HNVB 4NE9C 3T6JA 3QJPA 2EW9A 1U0HB 1PIEA 3W7BA 4F8RA 3NS5A 3PHTA 1LW2B 4HDHA 3MPDA 4Q5VA 4N8OA 2ZBCA 1RDRA 4FNIA 4GKJF 1ED8A 4WTOB 3MUVP 1G4CA 3ZZYA 2XO7A 3FK4A 4M5IA 3LA0A 3R3TA 2YWGA 3DOLA 5KFWA 4OL8A 2DNKA 5D4NA 4X65F 1N33F 2JC1A 2H3EB 2QLBB 4X64F 2C2OB 2OTJS 2W5XA 3BQ1A 2RF2A 1H2TZ 1ITPA 2ZHAA 2OIHA 3MR3A 4ZPDA 1IM6A 5B09A 4NLOA 3A3NB 1S79A 1T7PA 1O0PA 1RHJB 2KVQE 4DR3F 2XGQA 1OPIA 1YITS 1K7HA 1UMJA 2F9DA 2IAJB 4ZP9A 1IKWA 3GIMA 1VOMA 2ATLA 3ZZ0A 2CPHA 4PABA 4JI3F 2MQ8A 2OPSA 3QRPA 1VS3A 3MCSA 3QGGA 5HROA 3PR5B 3CDUA 4J9OA 1V5IB 4NCAA 1S6QA 1WDDA 4H4MB 3BO4A 4ECRA 3N5FA 5CXTA 1PJ6A 1UZDA 1S6UA 2VB6A 3SBMA 2MKIA 1W2BR 3KK2B 3NNCA 3VAFA 5ETQA 3MEGB 3WZ0A 1KHNA 2DKOB 1YLXA 3AXKA 1JJHA 2NLWA 2V8VA 3C15B 3NGKA 3OFFA 4RBTA 3J7YU 3DLGB 4PEOA 4K8RA 2RE1A 3TR5A 2QX0A 3MAQA 1N34J 4DV1F 1UEUA 1X4CA 2U2FA 4DOZA 1U47A 4DG1A 2HHXA 2O66A 2RH6A 1U7LA 1RHQB 1CC7A 2W2PP 3GYGA 2MJNA 3CMES 2C2DA 2DHSA 2HBQB 3JB9k 4IDKB 4I2PB 2GVZA 2ILZA 1XEZA 3PJ9A 1SL1A 2B56A 1BD6A 1Q95G 4R5PA 1U4BA 5BYQA 2R2TA 1E6YB 2ZBQA 3KLIA 1FD8A 1B70B 1HQEB 1AXQA 1PKUA 2MKJA 2W9CA 3WAXA 2W24A 2B4UA 2EPIA 3LGMA 2V0NA 4ELVA 3NKPA 3JQKA 3NMAA 2WVBA 1S7IA 5AE2A 1N6QB 1IBKJ 3C15A 4RBVA 5KFTA 4BHQA 4PG5A 2CVIA 2E7VA 4DPOA 3MCNA 5AE1A 2WSEC 4LREA 5HL7Q 4X62F 2MGZB 3EVMA 2XTJP 1HIYA 1YWXA 4CH7A 1WEXA 2L41A 4DS5A 4LF9F 3CXCR 4TN0A 4IOCQ 4OV1A 5CH7B 1U8SA 1YKWA 2YKAA 5CYMA 1IKXA 1S6OA 1NKCA 3OLBA 3BB5A 2FLLA 3L3CA 4FS1A 4LF8F 2FVQA 1BQMB 3CW2C 4ZHRA 2DNZA 2XHCA 4QQBA 1R6VA 3DHWC 1S6PA 1HR0F 4ZCKA 2G4BA 2DGSA 4N77A 3DM2A 4OX9F 2ROGA 3FCHA 5A8KB 3PYGA 3PACA 1DTTB 3UQSA 3BZQA 1M1KT 1KQSR 2AF6A 1M5VC 2W4CA 2JRSA 3MEEB 5A2QY 1VQLS 4KKOA 3HFKA 3UN3A 4NASA 4DQPA 1QUVA 4IRCA 5DJBA 2PI5A 1EQMA 1HW8A 1VC5A 1PJ5A 5EWGA 3UN2A 3CD6S 3R5AA 2NPFA 2VFTA 1I94F 5HVHA 3HK2A 4TY8A 4KGVB 2VPWB 2E5GA 3IC1A 3FFIB 4RW4A 3D68A 2YKPA 1SCJB 4J37A 3LAKA 3NNAA 4LF2A 3OUYB 3D0GE 5CCMA 4GVBA 4WIIA 1VI7A 3ZZPA 1FDNA 2LXIA 3QAUA 1HWJA 2M52A 1U6BA 3G9CA 3T1HF 4DSIA 3CVKA 4HEA9 1ZS6A 2YWFA 5I4MA 2A3JA 5I3UB 2AZ3A 3DXSX 3Q2SC 3GCXP 3W64A 3G82A 3LF0A 1R31A 4HI1A 1C1BA 3I6PA 1VRUB 1KTVA 3BO2A 3Q83A 4ZPTR 1VIOA 3I0RA 4LF1A 2KG0A 1QVGR 2DNRA 3DI6B 1YG0A 1N6QA 3A13A 1A0OB 2DXDA 3NCPA 2E5IA 4CLLA 3HXMA 4LF7F 3UD4P 2J6UA 1I51B 1XR7A 5B0GA 3GB0A 2YQ3A 1WTBA 4U96A 1NK5A 2JEFA 3UE2A 4EEYA 4CT9A 1KD1T 2Y9HA 4KO0A 4JB8B 2G2OA 2KT3A 2DJWA 5F8LA 4R8UB 1QY7A 5ETPA 4DL5A 1U1QA 1XNQF 3LALA 2N7CA 4CLFA 1CJTA 3G2XA 1S4FA 3IP0A 1LFWA 4KAIA 1RHMB 4AQYF 1SKSA 4LF8J 1SBRA 2XY7A 3HFZB 2DR5A 1DQAA 2KI2A 1NPKA 2CQ3A 4RWXA 2MKKA 1FHTA 2GLQA 2HQGA 2PC6A 3GTYX 4IG0A 2X3GA 2M2BA 4Y2IA 4C0OC 3BV8A 5GAEI 2XCAA 1CULA 1AUSL 1KH7A 3K5MA 1VFJA 3BH7B 3MR6A 3PO4A 1A9NB 4LBPA 5D3GB 1VCTA 1RAHB 1ZM2A 2CQ0A 4RL1A 4RW7B 3VHQA 2CQBA 1NEEA 2WVCA 3CJ4A 4HR2A 1YGYA 3EUNA 4KE5A 4ZG9A 1H2VZ 4C6AA 1B8JA 4KQZA 1N32F 3PW7A 3E2DA 3BSCA 1RU2A 3FQKA 2FLPA 1JQGA 1DTQA 2HS3A 5EUHA 3W65A 3ZTPA 3Q0AA 2MKCA 4UY85 2DHGA 2FPHX 2R42A 2JFKA 2C3UA 3FRYA 1T11A 3TVZA 4RPFA 3EWGA 4WE1A 3W2WA 1YQHA 3IM8A 4AL6A 1NU4A 5GVQA 1FRXA 4RU2A 4RUAA 2VFUA 3H2LA 1V3RA 3BBFA 1IWGA 2XM3A 2G0IA 3AJ2A 2ZJRQ 4CM0A 3ISNC 2HHHF 1ELXA 1K8AT 1FEHA 3Q3QA 4EUVA 4UZBA 3CJKA 2LA6A 4KH1B 1OYEA 2JEJA 4MH8A 4YB7A 2KM8B 5KFCA 2H4YB 5ITHA 4NI2B 5LMNF 4GTZA 1HQEA 1R8PA 1S1XA 1C4CA 2RS8A 2XMVA 3BF4A 3GG0A 5L1JA 1IBMF 1KP6A 3CJ2A 3K17A 4H4KC 2WW4A 4H4KA 3MM5B 5HN0A 1YTYA 3DLBA 3RBXA 2DK2A 3N9UC 4L73A 2MZTA 4K4YA 4KO0B 2XEXA 4JYAJ 1HL6A 3MM9A 4QYZK 2DGWA 4FVCA 1NPRA 2EXUA 4ZGAA 4B3TF 4RUHA 2LKZA 5D4OA 4F4AA 2AD9A 4WU3A 2ALZA 2W2MP 2GJIA 3EJMA 5KFMA 4G3IA 4NPOA 3TG0A 1RKJA 3EMTA 4M5NA 1X4EA 1YRTA 2XI3A 2FJWA 1D3WA 4U95A 3QSYB 1S6QB 4PUOA 3PEJA 2BVZA 1OY9A 3M6WA 5KFOA 1YJNS 1L5UA 2KN4A 4FF4A 2R7SA 4JV5F 3CJSA 3OVSA 5DLVA 1FNXH 5L0KA 2ZD1B 1TK0A 3HI9A 1NZAA 2J5AA 3T01A 4OX6A 1L3SA 2IMWP 4QR1A 2HZCA 2MSSA 2FJVA 4Q2MA 4HYKA 3ZTOA 4V19J 1TFWA 3CMQA 4MAKA 3FFIA 3I31A 2PEBA 3OTCA 4RW4B 2ASDA 4LF4F 2YWKA 1WOPA 2WBMA 5A8RA 4LFBF 1TKZA 5IC4B 1JLGB 2K3IA 2MQPA 3J81j 1H7WA 3Q8SB 2J76E 4DF8A 1J5OB 1W2IA 2DH8A 4PQAA 2NR0A 4U8VA 4DR3J 4PQUA 4KGMA 3ULHA 4ENOA 4DV4J 1IVZA 2BKOA 3FBEA 1LW2A 4QR2A 1VIXA 4IRKA 2FB0A 2KH9A 4P2XA 3OBIA 3WC0A 1C4AA 4JI2F 3M8PB 4F2SA 2XNQA 4C98A 1ZZFA 4KV8B 1HI8A 4NYOA 2I0XA 2DGUA 3AA9A 1T3NA 3ZZZA 4OHYA 1T94A 1Q79A 2M4MA 1TKXB 4U9RA 4EZ6A 4F0MA 2PI4A 3DDKA 1Y5NB 2W1BA 4YR0A 2MKSA 3BR9A 1H74A 3MPUB 2IBKA 3DMJB 1JLBB 5BR8F 1OY8A 3NGRA 4ED3A 4USMA 2D1GA 4NCBA 1SJQA 1UETA 3MR2A 4DR2F 3DGPA 5J1NA 2ZD1A 4OYPA 4ZPCA 4YHHF 3DN9A 2AJ1A 2XR9A 1ZA2B 4RNOA 2XMTA 4ECQA 4FNHA 2YTCA 3VGTA 4C8KA 4GC7A 4M5MA 3E3XA 1SHNA 5C25A 1GTEA 3TUIC 3ETMA 2XO6A 3EZ5A 3MXHP 1HWLA 2CJKA 3FZ2A 3QNWB 3MHYA 4PWWA 3G86A 3GJRB 2I8EA 3SFGA 1YI2S 4I2PA 2FVCA 1LXNA 2PFDA 1IBLF 3JYTB 5F3TA 2AYGA 4CCHA 3JTOA 4MYUA 3NEKA 2CJQA 2JDJA 2HGMA 4P6QA 4I4BA 2YH0A 2FUG9 1N8RT 2OTLS 3CWJA 4DR1F 2CPXA 3D2WA 2F9JA 1IJFB 1TL1A 4ZLJA 3PXGa 4FVMA 3I0SB 3EX7B 3HSZA 4UPIA 1SQFA 2FYXA 3FQLA 1E6YA 2NZ4A 3SYZA 4UPHA 2BRKA 4IOBA 4RO0A 1S1TA 1RAJA 2ZH8A 2QA4G 4KGKA 1RCOB 1E3CP 2K3KA 3ENWA 4DV0J 1DURA 4K4TA 2P2CB 2DPJA 5CYQA 1TAQA 1ELOA 4WU2A 1TL3B 1TKDA 4XK8C 4JI1F 1ZM4A 2KVIA 4DV6F 2R8JA 3NBPA 2DT9A 1Q8BA 5AJ3F 4X4VA 4C0BA 2RRBA 1KDNA 1C0UB 1K0VA 2V2VA 3I96A 4C3LA 3D3CJ 4NEZA 1NJYA 1NK4A 3AB4B 4CTAA 3PYEA 2RU9A 1YBUA 3NOCA 4B3OB 4J9MA 1UWBB 2CNKB 1VISA 3PYDA 1JKHA 4LFAF 1E6VA 2E1RA 2GW8A 3CD7A 4I67A 3LWMA 4OYMA 3OHAA 1MW7A 1CJVA 3DRPA 4X65J 5AE3A 1RTHB 4UQGA 3DC2A 3Q8VA 3OL7A 4ED2A 3OR1A 2AYMA 4NXMF 3CJQA 2HPUA 3MUTP 2E5HA 3R9LA 2B9EA 2G1HA 2NCKL 2R7VA 5DLFA 4DLGA 3PX0A 1HNWF 2DHAA 3AOCA 3KJQB 2DTJA 1Z2LA 5CD4H 3OLAA 3G71S 4DR5F 3KG1A 3I9V9 3TNVA 1KQGB 1UVLA 1ZPVA 2B43A 3R2DJ 1SH3A 1FTRA 1UTAA 3MTJA 2I38A 2BUNA 2RIJA 4F3OA 4W90B 1KH4A 3DGPB 1H0HB 4NZ7A 1GNKA 1VK8A 5E3AA 1TQLA 1EAYC 2P9EA 3GV5B 4P2FA 2UXCJ 3NS6A 2VICA 1SJRA 2Y1IA 1X9MA 1TUWA 5HANA 5IV3A 3K2YA 2QZ8A 2VQFF 4DPUA 2QA1A 2U1AA 3PNIA 4JI4J 4WFBQ 4MHXA 3QWPA 1RTIA 1S7HA 3LP1A 2UVUA 2IY5B 4DSKA 3SFUA 2K8GA 3AFGA 5IS2A 2BM1A 3X3UA 1KFSA 4NWJA 4X4TA 2KHCA 1RYSA 5I42B 2FD2A 4IG3B 3MUMP 2IJFA 1VJWA 3JSRA 1E6VB 2VQEJ 2CAJA 2V50A 5HP1B 3RAQA 2GC8A 4DSFA 1TAUA 4F26A 2BQUA 1LWEA 2IM1A 3NGSA 5A0YA 7AT1B 5KFDA 5DM7Q 2YPZA 4BDPA 2J7KA 2C3MA 3VCDA 2DRBA 3RR8A 2DNYA 1HWKA 2EK6A 4DR7J 3JS9A 3K5LA 4J9VA 5FDLA 1KLMB 5F8HA 3JTPA 1AJDA 1VQOS 4DV5J 2D7SA 1S1UB 2LLZA 1GEHA 4LFAJ 5K20B 1BC6A 1F5AA 1EI6A 2YKNA 1MROA 4JI1J 2OHDA 3VGVA 1F2HA 3KG0A 1TTHB 1X7VA 4MKAA 3CGIA 5KT7A 4A48A 2HBYB 3R7BB 1J5EJ 2V63A 4TVAB 1TUGB 2PD1A 2CWXA 2YNFB 3KD8A 1S12A 1C0UA 1FNOA 2ZH2A 2JZ5A 2OP5A 1U48A 3NS7B 1PBAA 3NBPB 3HMJG 5F8JA 2M7SA 3MWBA 2E5JA 2VDIA 3POTB 1F6TA 4JI6J 1Q5VA 4RNHA 4MK7A 4K4VA 1ALKA 2RSQA 4WKRA 2RU3A 3JTNA 2HG4A 4OJ3A 4NCGA 4RW6B 3KK3A 1U1NA 4B9MA 3SQGA 3A52A 2VJUA 1KSPA 2OH2A 4JI7J 2HVIA 2G9YA 1FRJA 1I5OB 1M5PC 2NXNA 1O5JA 2CPYA 2HFSA 4ICLA 3TX8A 3KHLA 3IAS9 1RABB 2JJ4D 3I82A 1NLKL 3JSBA 5J2PB 2J8SA 2BEFA 2WK4A 1Q8IA 3D54A 4BC7A 3K0JA 1NSPA 5ETTA 2OPQB 1WTFA 1URNA 4EMDA 2LQJA 2H4WB 4PWDA 3RUBL 1IBKF 1BUXA 5KFGA 2XMMA 1FWLA 1U25A 1QUPA 1FK9A 1RCXB 2IFXA 2R7QA 3A8EA 5LMUJ 5C2GA 1FT8A 2QN6B 4CM2A 4ES1A 4OLPA 3ET6A 2G9OA 4NL5A 2Y8WA 3PW5A 2LP4A 2JOQA 2QT7A 3SQGB 3F56A 3T19A 3P8BB 2AV5A 3QGPA 3DLLQ 3M1VB 1Y3KA 3TAMA 2YX4A 1WSRA 2EG1A 4EYHB 4NRUA 3CF5Q 3U1LA 4DU8A 3BDFA 3QPIA 5AT1B 4LR8A 3PIOQ 3M8PA 2DEIA 3M2UA 4OI1A 3PVXA 1GXTA 3AOBA 5JVGQ 3RB0A 4OYAA 2DR8A 5J2QB 3LTOA 3UI3A 1U1MA 4WJBA 5KFLA 3RJMB 4ZIWA 4JI6F 3KUHA 4WZMA 1S57A 3HSJA 3M2VB 4MK9A 2PEHA 4AD6A 3HX9A 1J5OA 2JEGA 4X84A 3VAHA 1N5VA 4WFYA 4JI2J 3MTKA 1ZM9A 2ZUAA 4NLGA 3EGNA 3GP9A 1WUUA 4FXWA 4UQTA 1VHIA 2CQ2A 5ETKA 1ZH5A 1RACB 2M0GB 1H6KX 4K59A 2RRAA 2L9WA 2Y1LB 2J6SA 2RNEA 2JLFA 2UXBF 4LSNB 4ES2A 2DNOA 2P6TA 4ED7A 1R27B 4DEZA 3HPOA 2JVRA 3ZTQA 2MHNA 1ALJA 2FGCA 1LWCA 2E1CA 3IMQJ 4LF6J 2YKNB 5D0RA 1SB6A 4UT4A 4DV5F 1CS4A 3RB4A 3LW5C 2XMWA 1ZAVA 5HROB 3TZYA 4OZLA 3A1YG 1PG5B 1WJ9A 3MURP 4KAYA 1UW4A 2NPIA 2RT3A 3MECB 3R27A 4LR9A 2D69A 3IGVA 4WWSA 4DN0A 4F50A 1HBMB 4PR6A 4AYBD 1X9SA 2F8MA 3S01A 4QU7A 3GMGA 2VL1A 1LQ9A 2YNIB 4DL6A 1HBNA 3VQSA 3TW0A 4P52A 1VR6A 1X5TA 1EQJA 3UN5A 2ERRA 5AJ9A 1B0PA 5T7LA 1IN0A 5LOQA 2EG2A 5K14A 1ZOTA 1M5SA 3NMRA 1SIWB 2HWIA 2OMOA 2K7JA 2ZNZA 1YZ6A 4I56A 2X51A 4I6YA 1RB0A 4YOEA 1OO0B 4RBUA 4BC9A 4JYAF 2R7RA 4OLOA 3H42A 3F73A 4A8KA 4Z37A 1RHKB 1YK9A 2AYEA 4KB7A 1NO8A 4URQU 5DG7A 2AP6A 2QSFA 3Q86A 2BDPA 1FKPB 5IM0B 1SQEA 3PY8A 4B3TJ 1M5KC 2XYPB 3IWNC 3H40A 1KH9A 4TLRA 2VKRA 1CQMA 3ENVA 2G1DA 4DJBA 2M8DB 3ZNUA 1SUQB 5LJ3Y 2L9DA 3KHGA 3RAXA 4I6WA 1S59A 3LANA 2HMIB 1IKYA 4F3MA 1RQ0A 5F0UA 5J2PA 2Z4PA 3FCWA 4DX6A 5BJRA 4H4OA 4TYBA 2OEJA 3SZZA 5HMYA 4PRFA 2HHVA 5FJ4A 4ZN1A 4QPXA 4Y2AA 1RP5A 1X4BA 4RNFA 1R8AA 1TL4A 5BYSA 3T1YF 1FJ7A 3B6BA 3H20A 3JSYA 3OXGA 3L4BC 2QRRA 1A6LA 4TLQA 3UCUP 3J81U 5AXMA 1EETB 2VH7A 2LFVA 3GCWP 4C8OA 2HSEB 2HVZA 2UXDF 2WOMB 3LQVA 4B3OA 3VGUA 1UEVA 1JX4A 3GWCA 1TL7A 1RUSA 2ACYA 2BE9B 5H9FK 3IR6B 2ALYB 2HGLA 3GQCA 1QLNA 4B56A 4RNNA 3X1LB 4FYVB 2APOA 3CJTA 2YQ1A 4L3NA 4MFBB 2CJAA 1CULB 4DV6J 1DFDA 5B0CA 2YQ0A 1N32J 2HNZB 1FX2A 3D5MA 2RHQB 2W2NP 1FF2A 2XULA 3H5YA 2ZBRA 3PHEA 4WFAQ 4ZG6A 2ZITA 4I64A 4LIRA 4MJKA 2GNKA 2MSTA 3RBEA 1VQMS 4K0KF 4Y0FA 4RW7A 2ZHBA 2MGZA 1Q82T 1TVRA 2ABYA 2HK3A 4RW9B 4CWBA 3T5HA 4ERDA 1E33P 2DVIA 2W9AA 2FVSA 2IA0A 1Y4ZB 2ADBA 1DZ5A 2VODA 5KFQA 4Q7AA 1MSWD 2Z58B 5T7LB 4WK3A 2D3UA 5DZ7A 3UD5A 1R0AA 1QTNB 3IG1A 5DG9A 4ZJOA 2HWTA 1IJEB 2YNGA 2MY7A 4M8LA 1L3TA 1JIHA 2XS2A 1ED9A 3RU0A 5A8WA 3C2PA 2PFFB 3GG1A 2VG6A 1RBAA 1VRUA 4FXVA 1ZYQA 2XSJB 3FGVA 2XMAA 3P49B 2W5TA 1FFWB 4U7UK 4TQRA 4Q8FA 3PO5A 2GHPA 1VBKA 1WEYA 3PTWA 4LFCF 1XNRJ 4DL0C 2E7XA 2FZGB 5EX3A 2RVJA 2QA2A 4EBCA 3CC4S 4Q0BB 1Q78A 4DR2J 2N4CA 2WB1D 2UUBJ 1DLOA 2ZBPA 5KT5A 3IN5A 4X4PA 1ZEFA 3E51A 1PYSB 5H9EJ 5EGEA 3QYYA 2CNOB 3ADAC 4OI0A 3MM5A 1UFKA 5DDOC 3TO8A 1NXIA 3KLFB 1XQIA 2J9CA 5DS7A 4DUYF 2R8GA 2KFYA 3OTDA 3VAIA 1EJ7L 2V8HA 4NOHA 3I32A 1ANJA 4NYPA 4DV2F 2XQCA 3TRGA 4ZVQB 1SV5A 3W62A 3IBFB 2YWEA 4EO6A 2BM0A 4F36A 3A8IA 4DPWA 5EGHA 3C8YA 3FKBA 2XSFA 1RT1B 4KTQA 3C6TB 2QV6A 4NEYA 1HHTP 3M4XA 2HGNA 2R8KA 4ZVTB 4USJC 1PAUB 1VMBA 4WP3A 3RTVA 4LF4J 1U24A 2R7TA 2GSNA 3OFGA 9ATCB 3ZFVA 1I94J 2CPFA 3CJ0A 3HHDA 3IRXA 5B0AA 4AL7A 1MN7A 2AKWB 5LXRA 3J80U 3O6QA 4O3RA 4PQUB 2D9OA 2W01A 4KRWA 2CQDA 3UR0A 2RDJA 1HR0J 1FVSA 4LFBJ 1P49A 1DTQB 4MIBA 3M7VA 4WFZA 4EO8A 1RTZA 5EDWA 1XC9A 1KLNA 2EK1A 1Q5YA 2LXFA 1V6HA 4HT7A 1ALIA 4IFYB 5DQIA 2LU1A 3ILLA 1G7CB 4PG7A 1V3ZA 3BPDA 1UFWA 2O01C 3M8QA 1T0TV 1N48A 3OL9A 4EBDA 1AT1B 2KTQA 2NS1B 5FIIA 4A47A 4IFVB 2MQLA 2V68A 2XYHB 4CLZA 2AT1B 1FCAA 1GK8A 2X3DA 4J7CA 3S6EA 1K47A 5IT0A 2VA2A 2JEIA 5J2MB 2AX1A 2I1RA 4ZITA 5H1SV 4J9UE 1K44A 3GFXA 5CQGA 2W5QA 5RUBA 2KZMA 5E2QA 3LXQA 2AJ0A 2AEMA 1FERA 3V4IA 4ICLB 1SL0A 2DNPA 5E41A 3M9MB 1PO6A 4JV1A 1UWAA 1D9AA 1EW8A 3J7ZT 5GAHU 2YNHB 1RTDB 2JH3A 4IRDA 1WG1A 1REGX 2V4QA 4AUKA 4OX8A 1KOOA 3M30B 5K14B 5ETSA 3CIMA 2HRTA 2OGUA 4EU0A 2HS4A 5L9XA 4AFFA 1UJ5A 2IM2A 3M6VA 3ILJA 2QA4S 1S49A 4YR1A 4JI5J 4XTTA 1UJ4A 2GIQA 4DCOB 3PFOA 4KPYA 2LU2A 1T95A 4OZNA 2AHOB 2RB7A 2IC3A 1NJXA 5GRRA 1REVB 1G3OA 4EZ9A 3NG8A 3MCMA 4K0KJ 1NRKA 1R0CB 4HHJA 3NKNA 4GTWA 4KM4A 3OSNA 1NAQA 2MLXA 2FDNA 3V6JA 1RT7A 2CQ4A 1NUEA 4Y2MA 3LO3A 2UP1A 5LXYA 4ZP6A 2LDIA 2RDIA 1YIJS 1IQTA 4FDJA 4P10A 4X2BA 2HHHJ 4CLPA 1Q7YT 2PT0A 1YZ7A 2KG1A 4B17A 4IFVA 5KOWA 3R2CJ 2WVFA 4JI3J 4NLUA 4X4NA 2MJUA 2VU5A 5KG6A 4B9NA 4KHPJ 1ZPWX 2JLGA 1Y11A 4OZ1A 1LOUA 2UUWA 3WBZA 2W9BB 3SSRA 2OJ3A 3DPCA 3CJ3A 3QGHA 1X0FA 2KFZA 1IM4A 2BRLA 2LCWA 5D4LA 1V3SA 2GVDB 1T02A 4DR7F 1C1CA 1M5HA 1NMEB 3BKTA 4IH5A 1XK8A 3KLHB 4DQIA 3H5XA 1FRMA 3E01A 3UR3C 5F8IA 1Q4RA 3H90A 3P5BP 4OZJA 3K8WA 3ZXWA 1X9WA 3CMRA 4O3PA 3NCRA 2DH9A 3KLVA 2FY1A 2GJ2A 3GFHA 4NLYA 4USIA 1UP1A 3TEHB 4OYWA 4YDDB 1Y0HA 5KFJA 5I3PA 2GAHC 5M2UA 2CYYA 4DV7J 1NDLA 1GMUA 2EBEA 1S9GB 3QT7A 1C0TB 5J1EA 3IR7B 3Q8QB 4ECZA 1XR6A 2DYAA 4F67A 3THVA 1S72S 4GMKA 3RBZA 3AD9C 3GLJA 4LQ3A 3HSGA 2A2CA 3M30A 3QMQA 1PC4A 1SIZA 1KC8T 1TZ0A 1FKPA 4C8ZA 5KFSA 2KKHA 3BR8A 4C8MA 2OI2A 4R8UA 3TQEA 3EM1A 1KN6A 3IWXA 1XR5A 1S97A 2MLYA 4ED5A 3N6NA 3R7NB 1DAXA 4CYSA 1NHKL 4UOHA 3VQTA 3R5DA 3NKQA 2OFGX 3SSQA 5HJXA 5D0EA 3HD1A 2Z57B 3T9NA 1R0AB 1VBYA 4ILLA 2E9TA 5HVFA 1HNWJ 4DG1B 3CDAA 1NK6A 2EC0A 5SZTA 3C3LA 3QFWA 4NA1A 2GHWA 4PWUA 1LWFB 1X4HA 1YJWS 2OMLA 3OXLA 4QBUA 1SJ4P 2LQBA 1KQFB 1RT5B 4PAAA 3PJWA 4DZ6A 1M90T 3P6YC 1C1BB 3MOZA 3PM9A 3W60A 4GVBB 4F0KA 5IWAJ 2CG4A 3CDBA 2UV8G 5HBMA 4X4OA 5ETRA 1HW9A 2HQFA 4K2XA 4HI2A 4PPZA 3VVUA 3MDFA 2MXYA 3K5OA 1JWWA 3V4MA 2QGFB 3HHLC 2Y8YA 2V94A 3DLJA 4X66F 5I3UA 1N5TA 1U2FA 5ETOA 3AD8C 5IJSA 2C2KB 2V2KA 3D0HE 4GO7X 4YB6A 1PAEX 4CXSA 1CJUA 4O3QA 2Q6BA 3G6XA 4KHRA 1TR0A 4NLRA 3SI8A 3J7AN 2OLWA 1TL7B 3U02A 5AJ3J 5INHA 1JLAB 2Y3YA 2HLUA 3LH2S 5KT6A 4NA3A 1VC6A 5A8KA 1HJKA 4MY4A 3IFEA 2PGCA 5LM7E 2F4FA 1TFYA 3THPA 1RT1A 2HNZA 2YX1A 4C48A 3HHLB 4OV6A 2QYCA 3HF5A 4ZHRB 5C2CA 4YEAA 2CWKA 5A6PA 2SXLA 1NH8A 1NBEB 3TARA 1IKXB 3A4TA 1U1PA 1JJ2R 2CNLB 1LWEB 3TVKA 1QAXA 2CUYA 2HQ3A 3PRVA 3OTOF 5J2QA 1CC8A 1RT6A 2HBRB 2LQ8A 2IMOA 2V67A 3KNGA 3LUYA 5HLFB 4LF9J 1HNVA 4OX9J 1ZZNA 3D67A 4RW8A 4TXSA 1VGYA 2EEYA 3UD3P 1VC0A 5B0DA 5IT9U 5CHCB 4ZJLA 3NGDA 4X62J 1VQNS 1U45A 2HURA 4RUCA 2CZ4A 2H9ZA 3BSNA 2EFVA 5T41A 3SCLE 3NGTA 1Y5LB 4ANDA 2FHJA 3WIUA 2C2MB 2A18A 2D3OR 1HNZJ 5LIAA 4P2MA 4LRFA 2FHMA 1WORA 1ANIA 3AY0A 4MTPA 2IC3B 3BM7A 3CJRA 4A8WA 4DFPA 1NNDA 2VFSA 2IHR1 1VQ7S 4NXNF 3P96A 3OV7A 4LF7J 5F8MA 2PMHA 3D1HA 4ZCLA 2YWWA 1RU1A 5BR8J 3CULA 2RRNA 1HNXJ 4LJMA 1WD6A 4W4MA 2F5GA 2WB4A 5B0EA 4ZKAA 3HHNB 1RJJA 2DO0A 2Y0BB 3BGRA 1AA1B 1Y6VA 1QSSA 1HBNB 1RWUA 2R3VA 3BDGA 1CJKA 5L9NA 2HFVA 1HNIB 2Z0GA 4F25A 3LPYA 4H54A 1N36F 1ELYA 2GMJA 3CSKA 3MEKA 1K1QA 1UEKA 3BPSP 5KG3A 3CE8A 3D6MB 3FMBA 2DD8S 1MROB 1RHRB 5DLGA 3K5NA 5KFFA 3CO9A 4PG6A 4Q44A 2H5EA 4O4RA 1B7YB 2E7WA 5M2RA 4CO3A 4KC5A 3PIPQ 1D09B 1QE1A 4OJ1A 4OI4A 1HLWA 3VAMA 2PMWA 4GC6A 1AJCA 4C8LA 2ROEA 2R8IA 1BQNB 4WXOA 3DHXA 3MMJA 3OJUA 3MEGA 5DQHA 2UU9J 2UVWA 2WW8A 1CJUB 1SKRA 2QSWA 2J9EA 3DDNA 2ZC4A 4FYYB 4RNMA 3KJVB 2GMLA 2RF2B 4UOOA 3GFYA 3FRZA 1S99A 1R7IA 1N88A 2ZBIA 2V8GA 2P6SA 3BKUA 3GJQB 3H5UA 2QE5A 2WVEA 3ZTRA 2YKOA 1ZAWA 1T9UA 2ZZTA 3M32B 2R7WA 1IKWB 3KTQA 5D15A 1DQ8A 1AFIA 1FKOA 4NA2A 4MKBA 4CLKA 1RTJA 2QIFA 1URBA 2W5SA 3IDDA 2GV1A 2EC2A 4QU6A 4OJHA 2Z56B 2D41A 2KDOA 1XIQA 2B9XA 1U0HA 4ZPBA 4QYRA 4NLSA 3M9NB 3NOGA 3PYFA 1MN9A 1A7GE 1TL5A 2VPXB 5ETMA 1FRHA 1T03A 4DBQA 3FUYA 5DZ6A 1NSKL 4QIWD 4QPTA 1K73T 5L0BA 1SUQA 2Q3PA 2VA3A 1RWOB 1WI8A 4WTYA 3HO1A 1QM9A 2VQFJ 2HQIA 3CUNA 1U6ZA 5KFYA 1RT3A 4ED8A 3BDGB 5DLTA 3SCIE 2Z30B 2XY5A 4L6V3 3MK2A 4IUFA 1JJ4A 1WWHA 4JP8A 3G8TA 4J9SA 1WKJA 3QRRA 1RHUB 3BGUA 4I2QB 4RUBA 4DUZF 3MFIA 3MMAA 4MIWA 2RKIB 2NXUA 4MIAA 4F4KA 1JNRB 4K5RA 3TJ8A 2LDYA 1CJVB 4K2JA 4WIQA 2BX6A 2MLZA 2XHWA 3AD7C 2W7PA 3BBBA 5HI7A 3THTA 5G0RB 2XG8A 2KT2A 1Q81T 3W5YA 1Q86T 3FC9A 3L7OA 3U7JA 3F41A 4Y2CA 3W66A 1FJEB 1ULRA 1WSVA 2JWNA 3NAHA 2R2UA 4Z7CA 4NXMJ 2WVDA 3NL0A 4C11B 2N3OA 3GSIA 3D9BA 2EI5A 3W3SA 2AU0A 1G2EA 3S7RA 3R8YA 3KLHA 4E2FB 4PYDA 4JI8F 4RJVA 3M32A 4PG8A 3EYZA 2BBEA 1NKEA 1L3VA 2PA3A 4B9SA 3NKOA 3HCXA 1VQ9S 3O3LA 4DI6A 4UPKA 5IZHA 1RWPB 2E1PA 2YVSA 3FBBA 3CD5A 5KFEA 4GO5X 3KOAA 1JLFB 3PX4A 1MWYA 5B7WA 2BANB 3GIJA 1KVJA 3NGUA 5KFZA 1U2RA 4KSEB 3CD0A 2VBXA 2CDRB 4RW9A 2NXJA 1BQNA 4JUZA 3T5KA 2V8PA 2E66A 5IFMA 3KLGA 3K59A 4ZK7M 1JLGA 1QD1A 2MYFA 2FC9A 1N0VC 4DUTA 3Q24A 3POTA 1FTCA 1TMJA 2MZJA 4ELTA 2UXDJ 4MIVA 4DV0F 1RT7B 3BQ0A 3N28A 1YHQS 2CQ1A 1V5VA 2B4OA 2ZOGA 3ITHA 2VFRA 5B08A 2DCLA 4OIXA 3IWLA 4CH1A 1EP4B 2EVZA 2P5VA 2MKYA 2KFNA 3H59A 3M8WA 7FD1A 5IWAF 4L74A 2D3ZA 3HVTA 3M2UB 1P1LA 3NXZA 3TP2A 4UUXA 1MNEA 5THWA 5G0RA 1S1UA 2VQEF 3TA2A 5DM6Q 3CDEA 3OHBA 2CPZA 5GAGU 1T9WA 4CQ1A 3OVBA 3B5QA 1XMBA 4ZVPB 2BQRA 2FTRA 2H54B 1PYTA 4I2QA 3BDPA 3UDLA 3US5A 1EB0A 1RI7A 2NXEA 4KYZA 1Q7LB 1F0XA 1XWLA 4PPDA 4C11A 3HM9A 1B7FA 3IR5B 5D0GA 4J9RA 4OZ3A 2CJ9A 2P9CA 3EE3A 3AQPA 4ZCIA 2ZZNA 3IXQA 4DX7A 2WHOA 4WP9A 5C24A 4HT5A 4K7QA 3B82A 5MLCV 2LECA 1QSLA 2E9RX 4MK8A 2C2ZB 3KXDA 3AA8A
chains in the Genus database with same CATH topology
2GSNA 1KH4A 1ZEFA 1AUKA 4UOPA 1KHKA 2GA3A 5EGEA 3WAVA 1ALJA 2W8SA 4UOOA 3M8YA 3WAYA 1ANJA 3T00A 2IUCA 5LQQA 4MHXA 1ED8A 4KAYA 3NVLA 4LR9A 4FDIA 4UORA 5EGHA 2W5VA 5DLWA 4LRBA 4NWJA 2W5SA 3NKQA 3A52A 4CYSA 3IDDA 4N7TA 1SHQA 1EQJA 2XRGA 3UN5A 3MK1A 1HQAA 2W5XA 5AJ9A 1KH5A 2GSUA 3IGZB 4YR1A 1ELZA 1HDHA 4KAVA 5GOVA 1URBA 2W5RA 3UO0A 4GTXA 4NWXA 1K7HA 1KH9A 1EW2A 4LR2A 1P49A 5GRRA 3M7VA 5DLTA 3BDGB 1AJDA 1EJJA 4LRAA 2IUCB 3MK2A 1EI6A 1ALIA 3WBHA 5IJSA 2D1GA 3M8ZA 4ZG7A 1E2SP 4CXSA 1KHNA 1KH7A 2GLQA 3KD8A 3UNYA 5INHA 5IJQA 1EW9A 2XR9A 1ZEDA 1FSUA 2RH6A 2X98A 3IGYB 5K4PA 4ZG9A 2W5WA 3SZZA 1HJKA 2W5QA 4MY4A 1SHNA 1ALHA 3LXQA 1Y7AA 1ALKA 1O98A 3E2DA 3OT9A 1EW8A 3BDHA 1N2LA 4LQYA 1B8JA 3DYCA 2G9YA 3MK0A 3NKOA 5LRNA 4UPKA 2VQRA 3WAXA 3NKPA 1ZEBA 4UPIA 1ELXA 4B56A 4UPHA 3TX0A 1AJBA 3NKRA 3Q3QA 1E3CP 1E1ZP 4GTWA 3NKNA 5L0EA 2IFYA 5L0BA 4KM4A 1URAA 4LREA 2GSOA 1O99A 4GTZA 4MIVA 3WAWA 4TN0A 4ZG6A 5HRTA 5LIAA 4LRFA 1ANIA 3BDFA 2ANHA 3M8WA 4CYRA 4CXKA 1E33P 1AJAA 3ED4A 3T02A 2ZKTA 4ZGAA 5C66A 4LR8A 4KJDA 3DPCA 4FDJA 4QAXA 5KXAA 5TJ3A 1Y6VA 4LR7A 3BDGA 3UN3A 1KHLA 3B5QA 3SZYA 1ELYA 5LRMA 1ED9A 1N2KA 2W8DA 3TG0A 3UN2A 4KJGA 4CXUA 2W5TA 3CMRA 1KHJA 4UPLA 1AJCA 4LRCA 5DLVA 2QZUA 4LRDA 5L0KA 4GTYA 3TWZA 3T01A 3NKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSN A;  1KH4 A;  1ZEF A;  1AUK A;  4UOP A;  1KHK A;  2GA3 A;  5EGE A;  3WAV A;  1ALJ A;  2W8S A;  4UOO A;  3M8Y A;  3WAY A;  1ANJ A;  3T00 A;  2IUC A;  5LQQ A;  4MHX A;  1ED8 A;  4KAY A;  3NVL A;  4LR9 A;  4FDI A;  4UOR A;  5EGH A;  2W5V A;  5DLW A;  4LRB A;  4NWJ A;  2W5S A;  3NKQ A;  3A52 A;  4CYS A;  3IDD A;  4N7T A;  1SHQ A;  1EQJ A;  2XRG A;  3UN5 A;  3MK1 A;  1HQA A;  2W5X A;  5AJ9 A;  1KH5 A;  2GSU A;  3IGZ B;  4YR1 A;  1ELZ A;  1HDH A;  4KAV A;  5GOV A;  1URB A;  2W5R A;  3UO0 A;  4GTX A;  4NWX A;  1K7H A;  1KH9 A;  1EW2 A;  4LR2 A;  1P49 A;  5GRR A;  3M7V A;  5DLT A;  3BDG B;  1AJD A;  1EJJ A;  4LRA A;  2IUC B;  3MK2 A;  1EI6 A;  1ALI A;  3WBH A;  5IJS A;  2D1G A;  3M8Z A;  4ZG7 A;  1E2S P;  4CXS A;  1KHN A;  1KH7 A;  2GLQ A;  3KD8 A;  3UNY A;  5INH A;  5IJQ A;  1EW9 A;  2XR9 A;  1ZED A;  1FSU A;  2RH6 A;  2X98 A;  3IGY B;  5K4P A;  4ZG9 A;  2W5W A;  3SZZ A;  1HJK A;  2W5Q A;  4MY4 A;  1SHN A;  1ALH A;  3LXQ A;  1Y7A A;  1ALK A;  1O98 A;  3E2D A;  3OT9 A;  1EW8 A;  3BDH A;  1N2L A;  4LQY A;  1B8J A;  3DYC A;  2G9Y A;  3MK0 A;  3NKO A;  5LRN A;  4UPK A;  2VQR A;  3WAX A;  3NKP A;  1ZEB A;  4UPI A;  1ELX A;  4B56 A;  4UPH A;  3TX0 A;  1AJB A;  3NKR A;  3Q3Q A;  1E3C P;  1E1Z P;  4GTW A;  3NKN A;  5L0E A;  2IFY A;  5L0B A;  4KM4 A;  1URA A;  4LRE A;  2GSO A;  1O99 A;  4GTZ A;  4MIV A;  3WAW A;  4TN0 A;  4ZG6 A;  5HRT A;  5LIA A;  4LRF A;  1ANI A;  3BDF A;  2ANH A;  3M8W A;  4CYR A;  4CXK A;  1E33 P;  1AJA A;  3ED4 A;  3T02 A;  2ZKT A;  4ZGA A;  5C66 A;  4LR8 A;  4KJD A;  3DPC A;  4FDJ A;  4QAX A;  5KXA A;  5TJ3 A;  1Y6V A;  4LR7 A;  3BDG A;  3UN3 A;  1KHL A;  3B5Q A;  3SZY A;  1ELY A;  5LRM A;  1ED9 A;  1N2K A;  2W8D A;  3TG0 A;  3UN2 A;  4KJG A;  4CXU A;  2W5T A;  3CMR A;  1KHJ A;  4UPL A;  1AJC A;  4LRC A;  5DLV A;  2QZU A;  4LRD A;  5L0K A;  4GTY A;  3TWZ A;  3T01 A;  3NKM A; 
#chains in the Genus database with same CATH topology
 4S0M A;  1O51 A;  4ZIV A;  4ZPA A;  5C7P A;  4K4W A;  3RRH A;  4KGX B;  2IYI A;  1AUK A;  2I5J B;  2CNN B;  3F44 A;  2CJB A;  5KFB A;  3FNN A;  1UKU A;  4Y65 A;  3SQO P;  1I6J A;  5J1P A;  5KFA A;  4DR4 F;  2C1E B;  1P8G A;  1WC4 A;  1OQ6 A;  1F5C A;  3SDE B;  5EGY A;  5L1L A;  1N5S A;  2H51 B;  1C0T A;  5J1E B;  2HHW A;  2AJQ A;  3E01 B;  5K5M A;  2GQC A;  2OFH X;  4Y3C A;  3DRP B;  2CQI A;  1KRP A;  3C16 B;  4P9S A;  1KS2 A;  4J90 A;  1N5Y B;  1X5O A;  4HVZ A;  4CO5 A;  3C6U A;  4NX9 A;  4DSL A;  3IBC B;  3EPI A;  1S1W A;  3LP2 B;  2NSB A;  1RWW B;  2W2O P;  4D3G A;  2XZD B;  2YNI A;  4LF6 F;  1WHY A;  2CA9 A;  2BYC A;  3QBC A;  2IRX A;  4V19 X;  4K4Z A;  2GHV C;  4W92 B;  4ZLL A;  1EQ0 A;  1X60 A;  2CQP A;  4XDC A;  4CYU B;  2IDE A;  3GZ7 A;  1JXL A;  1BHN A;  1RA6 A;  3W8P A;  1NK8 A;  2YKM A;  4KHM A;  4LRA A;  2IUC B;  2NXC A;  3J81 Y;  4O0N A;  1O6X A;  2XCP A;  2O1P A;  3LAM A;  3FBC A;  1RT2 B;  3KLF A;  5HBM B;  4B9V A;  3R5B A;  4DF4 A;  2MY8 A;  3G87 A;  4QCL A;  1TV6 A;  1I1G A;  2KYZ A;  2RML A;  1HPZ A;  3CCJ S;  3PRD A;  3Q23 A;  4ECW A;  4LMZ A;  3HVW A;  1HBO A;  1DBD A;  4NLD A;  2Y0S D;  1T9X A;  3I9Z A;  1Y00 A;  4HL9 A;  3SIP B;  3O2I A;  4CRJ A;  4YQW A;  3HJF A;  1AB8 A;  1FWK A;  2JVO A;  1Q0N A;  2RQC A;  3OW2 R;  4L3K A;  1G1X A;  2BJ3 A;  1Y10 A;  3DYA B;  5JXS A;  1Y7A A;  3JSM A;  2QMX A;  1S9E B;  2OEM A;  2HHS A;  3D0I E;  2XSJ A;  2DB1 A;  1BQX A;  2CQC A;  1HNI A;  2HLT A;  2NSC A;  3E8O A;  3QAE A;  1PYO B;  1Q8K A;  1M1H A;  1REV A;  1MMN A;  1EHW A;  2AW0 A;  3MF5 A;  3N5B A;  4NZ0 A;  4PXC A;  4Z2X A;  3MMC B;  2KU7 A;  3UVJ B;  5F9N A;  1HD1 A;  3BSO A;  1N2L A;  3QID A;  4CIO A;  4LBH A;  4LT6 A;  1KVI A;  1D0E A;  3DLK B;  1JLQ B;  1GMW D;  1HHS A;  2ZC3 A;  3B8H A;  3RYL A;  4QJV A;  2FY8 A;  4NLT A;  3D66 A;  5J2M A;  2BXJ A;  3M05 A;  4G1P A;  2B5J A;  4C2M A;  6AT1 B;  5KOX A;  3DLG A;  2CPJ A;  1WC3 A;  1B0V A;  2CDQ A;  4A8X A;  1PIL A;  1AZS B;  1ICE B;  4DHV A;  1U1K A;  1BY9 A;  2GIR A;  2O3D A;  5CA5 A;  2ZH7 A;  1IBM J;  3L09 A;  1KNZ A;  2NYI A;  3MZI A;  3GYX B;  1WHW A;  5C25 B;  4U67 Q;  5KFV A;  4BLG A;  2ZH1 A;  4F0H A;  2ZDO A;  2DNH A;  2FVR A;  2MZR A;  2YKM B;  1JNZ B;  4N47 A;  3U1M A;  1QVF R;  1V9O A;  3K8V A;  5DDQ C;  3Q22 A;  3TA0 A;  1C1C B;  3MPW A;  4JI0 J;  2OPP A;  1RK8 A;  4DPX A;  1PBU A;  2BW2 A;  3SCJ E;  2UVV A;  4QIF A;  5E3R A;  2AWZ A;  2DXE A;  3QQC D;  5D4P A;  2HHT A;  5C66 A;  2ZJQ Q;  2G0J A;  3CCS S;  1OSD A;  3P45 B;  2HAI A;  2J0X A;  2I2Y A;  2UUA J;  2C3Y A;  2GCF A;  2MZS A;  2MDA A;  4TY8 B;  3CCR S;  1DY3 A;  1KR4 A;  2VBW A;  5DGA A;  4I6A A;  2DNM A;  4MKV A;  4ECU A;  1IWA A;  3FEY B;  1N2K A;  1IKV A;  6FDR A;  3AAW B;  5I3Q A;  3VAJ A;  4DV4 F;  2VG5 B;  3TEG A;  1KON A;  3AJ1 A;  2OUG A;  1FJG J;  4PYA A;  1JMT A;  4UPL A;  1RAE B;  1NDP A;  2FQQ B;  3K7R A;  4H4O B;  2OAU A;  2ZHO A;  3BN4 A;  4CZC A;  2J6T A;  3TOQ A;  3DLH A;  3GYN A;  2QG9 B;  3RB6 A;  2GIF A;  1RAA B;  2BJ1 A;  2K7K A;  2PO4 A;  6FD1 A;  5F9L A;  3QLH B;  1QAY A;  3W5Z A;  1S1V B;  4IO9 Q;  4WF9 Q;  4DL2 A;  3NKM A;  2ZEJ A;  2JNJ A;  4UOP A;  5KFU A;  4ZN3 A;  1WHX A;  4Q0B A;  2DBB A;  2VG7 B;  3CT9 A;  4PUO B;  2IM0 A;  4USK A;  5HJY A;  3CC2 S;  5D78 A;  4JV5 J;  4LFC J;  4AQY J;  1NB2 A;  1XNR F;  2J7W A;  1KHV A;  2N4D A;  2YNH A;  1RTD A;  1UVM A;  2WAQ D;  2A1B A;  3I0R B;  2R2R A;  2NRE A;  4YUD A;  2EFP A;  2ZKU A;  1ZTT A;  5CZX A;  2HZV A;  3R5C A;  2CZV C;  5AXK A;  3N79 A;  5HMX A;  2UUB F;  3QO9 B;  5DLW A;  1HMV A;  4UW2 A;  1TMM A;  2XY6 A;  3W61 A;  2PE8 A;  3C14 B;  1M1G A;  2QLW A;  3CDW A;  3UW1 A;  3MK1 A;  2WSC C;  2X7I A;  4FDF A;  3TUZ C;  4IQX A;  4A46 A;  2GSU A;  4ZS6 A;  3BGL A;  3D1Q A;  1ELZ A;  5LJ5 Y;  2W5R A;  4NYZ A;  4ZDN A;  3UO0 A;  3Q8U A;  2QLJ B;  1LV5 A;  4GTX A;  3KLI B;  1SL2 A;  3QLH A;  3H2U B;  2AEF A;  3MM6 A;  5A8W B;  3KJF B;  4USH A;  3AH6 A;  4I7F A;  3GJS B;  1RSC A;  4J91 A;  3T1A A;  4G1I A;  1SI9 A;  2AJF E;  4WKY A;  3R1L A;  2DR9 A;  2B9W A;  4B3M F;  1RT4 B;  3FSY A;  3I5A A;  4C7Q A;  2QMW A;  2BKP A;  4ATN A;  1CS4 B;  1S9G A;  3M6U A;  4ZPW R;  1FRI A;  4DV7 F;  3SV4 A;  2M70 A;  4PXD A;  5LMN J;  4EGL A;  4N56 A;  3FEX B;  1KQK A;  1T05 A;  3TUP A;  3ETO A;  1PGZ A;  2ILY A;  4OZ5 A;  4AE5 A;  2VBY A;  4ES3 A;  3V6D A;  3R1H A;  2ROP A;  1TEL A;  1WC5 A;  3H8Y A;  3ONQ A;  3CIZ A;  4RW8 B;  2Z2Z A;  4AXI A;  5K4P A;  2ZH4 A;  1SC1 B;  5F8N A;  3M6X A;  4YS2 A;  2RQ4 A;  3EGW B;  1S6P B;  4LVN P;  4DN9 A;  4J5O A;  4KHP F;  3G8S A;  2GGP B;  2VF3 A;  4QWB A;  4CO1 A;  2MQM A;  2Q6C A;  1SC3 B;  2OEL A;  2XMU A;  2LEP A;  2Y1R I;  1YJV A;  3GE9 A;  3GR1 A;  3MEE A;  3L9Z A;  3W9H A;  3T1Y J;  2IM3 A;  2KXN B;  2PMZ D;  2E44 A;  2HNY B;  2J0Q D;  2POK A;  2JHE A;  2NUH A;  3HKZ D;  3EXC X;  4UST A;  3U27 A;  4CTA B;  3W2W B;  5D0H A;  3CCL S;  4FF2 A;  4C4W A;  1H2U X;  4AT1 B;  1KBR A;  1UFL A;  2IVM A;  2UV8 A;  3ENA A;  5KFR A;  4B3S J;  1AJB A;  1CEZ A;  3NKR A;  2HIY A;  2A0F B;  1Y7P A;  4QWA A;  5GME A;  3BEG B;  3Q89 A;  1O99 A;  1NJW A;  4C9D A;  1FJC A;  3AT1 B;  1P9Q C;  4ECY A;  1JLC B;  3QZ8 A;  2Q79 A;  1NJI T;  1T3O A;  2XMK A;  2HND B;  3SZ2 A;  1X4D A;  2BZ2 A;  1RWK B;  3I5B A;  3IBW A;  2E5L J;  4B3M J;  3B78 A;  1T9Y A;  4DWI A;  3KHH A;  1AFJ A;  1R8H A;  3HZE A;  4ECS A;  1XN9 A;  1R3N A;  4IDK A;  4ECT A;  3DYA A;  2VOO A;  2XB2 D;  3D7S B;  2DY1 A;  3NKY A;  2XWX A;  1D9D A;  2ZH9 A;  2RAQ A;  3QRQ A;  3C14 A;  4YB1 P;  4CLU A;  3DI6 A;  5HQL A;  4LR7 A;  4RLE A;  3UVJ A;  2B9Y A;  3FVY A;  3CMA S;  4M94 A;  4U7U D;  4IO1 A;  1VLO A;  3M8Q B;  4QIG A;  3KG4 A;  2ZOM A;  4RW6 A;  2A2D A;  3KK3 B;  3HHK A;  2OKQ A;  4RR5 A;  5L46 A;  1IXK A;  2D1C A;  2ASL A;  1W26 A;  2G0C A;  3GJT B;  4NI2 A;  1LW0 B;  4JV0 A;  3BQ2 A;  1S10 A;  4GKK J;  4M1K A;  4PXE A;  1PC5 A;  1YX2 A;  3OFE A;  4IH7 A;  3TVY A;  4M5K A;  5L38 A;  1HBO B;  2VZ9 A;  1KWM A;  1NH7 A;  2WCX A;  3LPE A;  1KFD A;  4USW A;  2M5Y A;  2DGV A;  5L39 A;  1QE1 B;  2NZC A;  1FE0 A;  2KB2 A;  4H4M A;  3KJN B;  4QW9 A;  2IUC A;  2IIH A;  3QSI A;  4WPA A;  3T41 A;  2G2Y A;  2IRY A;  4CNY A;  1ZM3 A;  5FDL B;  5D77 A;  3SMZ A;  3EVW A;  1S1V A;  4G65 A;  2XZW A;  4NLQ A;  4O44 A;  4ZVU B;  2RUG A;  3OQ2 A;  5HMW A;  3ENQ A;  3OVA A;  4JBC A;  4DCJ B;  3PW0 A;  1S5Z A;  4FPI A;  4WFX A;  5E5N A;  3HP6 A;  1JLE A;  4OMF G;  4XIU A;  2W9B A;  5F41 A;  3K58 A;  4TQS A;  2WOM A;  2GO9 A;  4ZVO B;  4OYB A;  1F2G A;  1H98 A;  3G8Q A;  1IKY B;  2CAD A;  4QAX A;  3V6D B;  2XMJ A;  2XWY A;  3UCZ P;  1EZZ B;  2DRD A;  3OD2 A;  4GVL A;  2HFZ A;  3DLE B;  4DDF A;  2F4V J;  1H38 A;  1UZH A;  5F8G A;  4ETX A;  5A8R B;  4DUY J;  2QLX A;  2IBO A;  1D1U A;  4J9P A;  1RAD B;  2DH7 A;  2H5I B;  1N0U A;  3HHL D;  3KK1 A;  3J7A 1;  3Q8Y A;  2OSR A;  1AYE A;  3HUL A;  3UPF A;  2HIQ A;  4HAC A;  2IJR A;  1FK9 B;  2W4P A;  3M8Z A;  4WBF A;  1DLO B;  2UUT A;  3D28 A;  4FKX A;  4P2S A;  2X1B A;  2K1R B;  5DDP C;  2OPP B;  2LXU A;  2B5J B;  1F9F A;  4J9Q A;  3QT6 A;  5GAD U;  5CZV A;  4ZA1 A;  5KT2 A;  4ECV A;  2B0G A;  2DIT A;  2V6A A;  2ZE2 B;  4C8N A;  1K9M T;  1SJF A;  2ZZM A;  3IGY B;  3ET6 B;  1SJ3 P;  5CYJ A;  2W5W A;  1DHM A;  3VV2 B;  5LMU F;  3MCO A;  2MQN A;  1IBC B;  3O44 A;  3GV7 B;  1ALH A;  1X31 C;  3CTR A;  3DCA A;  4ZPV R;  4UF4 A;  3R6G B;  4CO0 A;  3O5T B;  4R5P B;  2VPY B;  3B4M A;  1DRZ A;  4QZV B;  3CNQ P;  1TVR B;  4YDX A;  3DU5 A;  2V4R A;  3MGJ A;  5BYR A;  4OHV A;  3C46 A;  4ZOS A;  4ER8 A;  3SEO A;  1HKA A;  1XMO J;  1Y5I B;  2C2N A;  4PG4 A;  2E5L F;  3VR1 A;  5KFH A;  1QAI A;  5T14 A;  3PKM A;  2KHD A;  2Q43 A;  2WBR A;  4O4G A;  1WKL A;  1N54 B;  1UWB A;  3TA1 A;  2M9K A;  1RIS A;  3EDQ B;  1JLA A;  4AL5 A;  4OYZ A;  2NQP A;  3FCV A;  1X4F A;  4I1T A;  3JQJ A;  4ZCM A;  2B6A A;  5DG8 A;  2DGQ A;  1URA A;  2M88 A;  3EDR B;  4M5D A;  4IFY A;  8RUC A;  3PJX A;  1X4A A;  4ANE A;  3C66 A;  1U26 A;  5ETV A;  4A8O A;  2VG5 A;  2ZVI A;  4O3S A;  5KTQ A;  4DR6 F;  1NB7 A;  2GAG C;  1VJQ A;  2ANH A;  1IR1 A;  4NZ6 A;  2J9D E;  4CLW A;  3P4U B;  1R8C A;  5HAO A;  1RT5 A;  4A8Y A;  1NKB A;  3MED A;  2HHP A;  1EKR A;  5K8P A;  2V34 A;  1CQN A;  3W2V B;  2ZJP Q;  3D4J A;  2F3J A;  3IM9 A;  4NRT A;  2R4F A;  3D6T B;  3MM8 B;  4O4G B;  2VON A;  3R5J B;  2BE7 D;  2IVY A;  2HAF A;  2VD3 A;  1DJ0 A;  3DOL B;  3H5S A;  4WE1 B;  4ZVF A;  3O1L A;  4CDI A;  3TZZ A;  2BR0 A;  2P8I A;  2RQM A;  3MMB B;  4M95 A;  5KG7 A;  1HWU A;  1SV5 B;  1YBA A;  2HWH A;  2W8D A;  3LP1 B;  4GKK F;  5E3Q A;  4F4W A;  5JVH Q;  1WAC A;  1FX4 A;  4LIW A;  2CPI A;  2HRY A;  5E3P A;  5HK4 A;  4OHZ A;  3OJS A;  4GKJ J;  1FA0 A;  5CAB A;  2CQG A;  2DHX A;  4LRC A;  5BXI A;  3KLE B;  3M2R A;  4LRD A;  3IRW P;  3V6H A;  4WYL A;  4DFK A;  4IG3 A;  8AT1 B;  4X4Q A;  4DU7 A;  5CAA A;  5KG2 A;  4BCA A;  1NM2 A;  3M9O B;  2UUC F;  5KT3 A;  2V9K A;  2IRU A;  1LWX A;  2FGO A;  1MML A;  2V4J B;  3VZI A;  1XNQ J;  4KR0 B;  2K1R A;  1S77 D;  3PV8 A;  2GA3 A;  3TZX A;  2VHG A;  4Y34 A;  3QZ7 A;  1GTH A;  2GA7 A;  3DOK B;  5CD4 A;  2GMH A;  2XS5 A;  2YX7 A;  3KUE A;  2C3P A;  2AGO A;  2HBZ B;  3T00 A;  4CI0 B;  1N52 B;  4CP5 A;  2R7X A;  2L3M A;  3AQO A;  3CED A;  3DOM A;  4NMX A;  2BW7 A;  2OD6 A;  5KG5 A;  5C42 B;  2W5V A;  3CCT A;  3CPW R;  3E2E A;  3OR1 B;  4LRB A;  4B08 A;  3TAQ A;  1X5P A;  3S1T A;  1H7X A;  4JOU A;  4B02 A;  3IAM 9;  3L7U A;  2DCU B;  4ALZ A;  3JSM B;  1XMQ J;  2WON B;  2IA6 A;  1T03 B;  1HQA A;  1HQU A;  2YH1 A;  4G1Q B;  4MMO A;  2R2S A;  2ZDP A;  3W2V A;  3QO9 A;  2EKN A;  3DDI A;  4ID5 A;  5CCL A;  3T1H J;  1WI6 A;  5E7O B;  2VV5 A;  5EX0 A;  1HBM A;  1HPZ B;  2BJE A;  2L9N A;  2RJZ A;  2F7V A;  2V2Z A;  4KT0 C;  1FRL A;  2G2Z A;  4Z7Y A;  5IXU A;  4DSE A;  3RRG A;  3TQ1 A;  3PW4 A;  3VZH A;  3KNA A;  1SC4 B;  1VQK S;  2HHQ A;  4UOC A;  5B0F A;  3PEH A;  2R7U A;  1C2P A;  4ZLP A;  4URG A;  2PSZ A;  4FYX B;  4DL4 A;  1SH0 A;  4USV A;  4DS4 A;  1H72 C;  3TAP A;  3WBH A;  2B8Q A;  1RXO B;  2ZFH A;  4U8Y A;  4A8M P;  5CYQ B;  3HVT B;  1HQ2 A;  3W8G A;  5GMK a;  2FHO B;  2PII A;  3GIR A;  4X4S A;  2KL8 A;  4A8F A;  3DXB A;  1FXD A;  3EGV A;  4G6V B;  4CO2 A;  1EW9 A;  1RAI B;  5HP1 A;  1FWP A;  1HAR A;  1Q53 A;  2AMC B;  3ILI A;  4G1Q A;  4E98 A;  1Z2Z A;  4ETZ A;  1RAG B;  5EHH A;  3T9Z A;  2LEA A;  1P1T A;  1TL1 B;  3CCZ A;  3Q8P B;  1WG5 A;  1DQ9 A;  3DRY A;  1RWV B;  2WTF A;  1N5Y A;  1FRK A;  4FYW B;  5JJB A;  3J7Z 5;  4EFA C;  5H9E K;  3OR2 B;  4I0W A;  2B6A B;  2BJ9 A;  4L72 B;  2W7A A;  3FDS A;  3D3B J;  2QLF B;  2VBZ A;  3MD1 A;  2VJV A;  1IBL J;  4JI8 J;  2E9Z A;  4LUB A;  1CJK B;  1S76 D;  4LQY A;  2DGX A;  3DKD A;  4PCQ A;  1N56 A;  4K5S A;  2C2R A;  3TAN A;  1FE4 A;  4E0D A;  2BAN A;  1AUD A;  2HZA A;  1RGV A;  4F02 A;  2DXF A;  3NRB A;  3NAI A;  4CO4 A;  5KFN A;  2A6M A;  2QYG A;  3HZG A;  4OHW A;  2WON A;  5DQG A;  2MKH A;  1F60 B;  2X1A A;  4C8Y A;  3HT0 A;  4EI2 A;  2W4D A;  1UJ6 A;  2HK2 A;  2WSF C;  1SXL A;  3DRS A;  3JXO A;  3MMA B;  2OPQ A;  1YRX A;  3ELH A;  4TYA A;  4ZJQ A;  1GFW B;  5C42 A;  5L0E A;  2JC0 A;  5LSO A;  2XYG B;  3BN7 A;  1QTM A;  3RW7 A;  4DXL A;  3G6V A;  1JXE A;  2DIV A;  1YJR A;  3DMJ A;  3N0V A;  3RZA A;  5FLX Y;  3WAW A;  3BH6 B;  5KT4 A;  1LK7 A;  1G6B A;  3DOK A;  4IR9 A;  2F40 A;  4KY3 A;  1UAW A;  2DIS A;  2Z2Y B;  3KDO A;  4OYO A;  3W63 A;  1S9F A;  1J27 A;  1P6T A;  4NCG B;  1H3D A;  2IPO B;  4EK2 A;  5K8N A;  3Q8R B;  2ZH5 A;  1UVJ A;  1CPZ A;  3I4H X;  2QL5 B;  5IQQ A;  3ED4 A;  1UA0 A;  3I4P A;  1VHF A;  4P7T A;  4QIV A;  3KYL A;  3T02 A;  1NPP A;  1OWX A;  3OTO J;  1JLB A;  4PZV A;  2W8L A;  2XLJ A;  2FC8 A;  2AEJ A;  4ZVE A;  3OSP A;  4DX5 A;  4NLW A;  1RWX B;  1RT6 B;  3MMC A;  1WC0 A;  3HT3 A;  5HLF A;  1UA1 A;  1N34 F;  2FJX A;  1VQY A;  1Z1Z A;  2AQ4 A;  1UVN A;  3C6T A;  1NHU A;  3OR2 A;  2AGQ A;  4O44 B;  4KPC A;  3O8W A;  1U1L A;  3MEC A;  2UVR A;  3ISN D;  4DLE A;  4WZQ A;  4J9K A;  2B7C B;  4CXU A;  2I9S A;  3KDN A;  4HTI A;  1NHV A;  4RWW A;  3MAH A;  2EWH A;  5KG1 A;  4DMZ A;  4F3Q A;  1Q16 B;  2DIU A;  1WC6 A;  4ID8 A;  1JKH B;  4WP8 A;  1LWC B;  1KEK A;  1JLE B;  1JXV A;  3L7P A;  4RKU C;  3TWZ A;  3ZO7 A;  2ZUG A;  1MG7 A;  1S1T B;  1WEL A;  1RTJ B;  1D8Y A;  4WYW A;  5E0O A;  3VAG A;  2WRM A;  4X66 J;  2JLE A;  3GON A;  1L3K A;  4Y2K A;  1OJ4 A;  2GQ2 A;  2R7O A;  4DV2 J;  1WHV A;  2W8S A;  1FDB A;  2BE2 B;  3HDS A;  4DCP B;  3M8Y A;  1T9T A;  4FF1 A;  2OSQ A;  3T5J A;  2B7B B;  1XTZ A;  1N33 J;  3HVA A;  5LQQ A;  1WF1 A;  5LL6 d;  3PX6 A;  3BRE A;  4I68 A;  1XMQ F;  4DZD A;  1QAJ A;  2I6W A;  2GS8 A;  4N41 A;  1BLU A;  5ADZ A;  2AJ4 A;  3G4S S;  3FMW A;  5DRK A;  5EN1 A;  1HYS B;  4JI4 F;  3BGR B;  1JJC B;  1ZTW A;  3LGN A;  1KH5 A;  3N4W A;  3IGZ B;  1RAF B;  2GFF A;  3OTE A;  4W98 A;  1BWV A;  5AXL A;  5HMZ A;  4RU9 A;  1MWQ A;  3ISZ A;  1D9F A;  1FFG B;  4Y00 A;  3C16 A;  4DQR A;  1DAR A;  3RB3 A;  1HNX F;  4EBE A;  1U6F A;  4WK1 A;  2AGP A;  2CKW A;  1RTI B;  4LSZ B;  3TUJ C;  4KBI A;  1PSD A;  2V69 A;  3AHP A;  4HAC B;  1U49 A;  4Q8E A;  1F9H A;  3M2R B;  3K89 A;  1X8D A;  3MM7 B;  3UDV A;  2LEB A;  1N4L A;  1WOS A;  2UXC F;  2L08 A;  1VQS A;  4Q2L A;  4DR5 J;  2KJV A;  1HNZ F;  1S1X B;  1TP7 A;  2IVF B;  3KMQ A;  2GJF A;  3H7H B;  1LNQ A;  4UOG A;  4LVO P;  2EKY A;  1WG4 A;  4MFB A;  5ETN A;  4F04 B;  4ZMM A;  2XC9 A;  4M5G A;  5GAD I;  3L95 X;  4TKT A;  4KV8 A;  3W9I A;  2V9W A;  4F2R A;  5IJQ A;  2MMY A;  4HHH A;  2C42 A;  4EWT A;  2X98 A;  4HHU A;  4WXW A;  4DSJ A;  1GAO A;  1OIA A;  2H1Y A;  2IYG A;  3DGV A;  5F3Z A;  2MQQ A;  4B3R F;  1D8Z A;  4TN2 A;  1FNM A;  1XER A;  5A76 A;  3V2U C;  3CO0 P;  2HVE A;  4LSL A;  4M5J A;  5J2N B;  3V81 A;  3OL6 A;  1F5B A;  1FKO B;  3DLE A;  4NLX A;  5EWE A;  3EPG A;  2B4P A;  3CJK B;  4B3S F;  3CC7 S;  3BDH A;  4HTJ A;  4TY9 A;  3SSS A;  3OTB A;  1HBU B;  2BJ8 A;  2KXH A;  3MPY A;  3IRX B;  2GVD A;  2KT5 A;  2E1M C;  5DET A;  3I87 A;  5LT5 A;  3MM8 A;  3BKF A;  3CCQ S;  4C3M A;  2VQR A;  1RBO B;  2X1F A;  3A3P B;  3MED B;  2FLN A;  4ZVG A;  1KOH A;  1ZEB A;  3DM2 B;  4J9L A;  4ZLN A;  5KFI A;  1TKT B;  5IV4 A;  3NWG A;  4XPE A;  4P74 A;  1UCN A;  3BGF A;  4F4Y A;  5IC6 B;  1U02 A;  2GGP A;  1R8B A;  1RWN B;  1T05 B;  1VQ6 S;  1M5O C;  1TK5 A;  4IG0 B;  1HA1 A;  1UVK A;  1VRQ C;  1WOO A;  3H98 A;  1SJ1 A;  1OSC A;  1U09 A;  3K5P A;  3N6L A;  3P3D A;  4M5D B;  1B4S A;  3PR4 A;  3DRX A;  3MFH A;  4OI2 A;  4K4S A;  5HRT A;  1IR2 A;  3NLC A;  3PCO B;  3MM7 A;  1NSA A;  3JYT A;  4ED1 A;  4P7V A;  2FZK B;  2NUU G;  4DPT A;  1Z4U A;  3IO1 A;  2DGO A;  5K8O A;  2BQ3 A;  3IS9 A;  3BSA A;  4CYR A;  2Z2M A;  2QO3 A;  3I0S A;  5DDR C;  3OL8 A;  3V4I B;  3AB2 B;  1OMS A;  4QR0 A;  3RBD A;  4DR1 J;  1ZET A;  2FJD B;  2J0S D;  4HH0 A;  1HQU B;  2B8P A;  3D1O A;  5JUM A;  4C97 A;  3VAK A;  3PW2 A;  1LW0 A;  4FYD A;  4KJD A;  3DLK A;  2XNR A;  2HKE A;  2LMI A;  4QWE A;  5FLX U;  3TI0 A;  4B9U A;  4QYZ J;  9RUB A;  1SC6 A;  5KFX A;  1KHL A;  2VG6 B;  4ITS A;  5D6G A;  5LRM A;  2A10 A;  1WKK A;  3WDO A;  3DOM B;  2OEK A;  4KJG A;  2CRL A;  2Y1J A;  2MZQ A;  2Z2L A;  4NLV A;  4KFB A;  1FXL A;  3JAM U;  3D6H B;  1XJW B;  4LF5 J;  2QZU A;  3PDN A;  1GMW A;  1OY6 A;  1CVJ A;  2D74 B;  3OXF A;  2BKN A;  3EZU A;  2YKQ A;  2DPI A;  3IS9 B;  2QFI A;  2VOP A;  3NWR A;  4L76 A;  1VLY A;  4O23 A;  4TU8 A;  3LWL A;  4CT8 A;  4X4R A;  3K57 A;  1VBX A;  1KHK A;  2V8D A;  1U0S A;  4QWC A;  2EFG A;  3HHE A;  3N01 A;  2MB0 B;  3GIL A;  4OI6 A;  4Y6I A;  1RLD A;  4HLB A;  3W9J A;  5C5J A;  2X1G A;  4KGZ B;  4ILR A;  1F9E B;  4UTG A;  4C0H A;  2F1F A;  3BO3 A;  4CYU A;  4FBT A;  1RTH A;  3HHL A;  1U2C A;  3GPA A;  1WNE A;  2FLO A;  3MAA B;  1U1R A;  2XI2 A;  2MHE A;  4ZVR B;  3AJD A;  2ZOF A;  1KTQ A;  1PJ7 A;  3CCM S;  2N7Y A;  3CCV S;  2XRG A;  4QW8 A;  1GX5 A;  1B0T A;  2YY3 A;  1HDH A;  4UUW A;  3W1Y C;  1K1S A;  2DRA A;  3NNH A;  1U8W A;  2JX2 A;  1S0V A;  3CJ8 A;  5HAT A;  1ZA1 B;  1F1B B;  1FO1 A;  2CPE A;  1YJU A;  3B54 A;  3HFV A;  3HJV A;  2N3L A;  1B99 A;  1BGX T;  3GIK A;  2N82 B;  4DFM A;  4L75 A;  1GH8 A;  3VWS A;  3F0N A;  1VRT B;  3MOJ B;  4KKO B;  3FJ2 A;  1EJJ A;  1RT4 A;  2QC3 A;  4LSL B;  3NP5 A;  3BS9 A;  5J2N A;  1FI4 A;  2BOA A;  4KFB B;  4ZVH A;  2KZZ A;  5SUH A;  5B0B A;  4KH0 B;  4DL3 A;  3QJJ A;  5EWF A;  2QFJ A;  2H48 B;  4FP9 A;  1FXR A;  4I7F B;  2P9G A;  4YP3 A;  1HWI A;  2I5J A;  1E2S P;  1HD0 A;  1SH2 A;  4NML A;  1F3F A;  1NDC A;  3ZNJ 1;  4CH0 S;  1N36 J;  4IKA A;  4IOA Q;  2CZ9 A;  3DNC A;  3PFE A;  5IOL A;  2MZ1 A;  4LF5 F;  5AXN A;  5E33 A;  3RRK A;  1O8B A;  2ASJ A;  5CYM B;  1SVD A;  3SXL A;  1EKS A;  2R8H A;  2WZ1 A;  2W9C B;  4JI5 F;  5IM0 A;  2C3O A;  4JV2 A;  2Q1L A;  4OJG A;  4K50 A;  2MTL A;  5GMD A;  1Q1K A;  2RUS A;  1CJT B;  1FDD A;  1MWZ A;  1T9V A;  3OT9 A;  1SQG A;  2J0W A;  3FBF A;  4NXN J;  4LQ9 A;  5IT9 Y;  4DX8 H;  3HVR A;  5KG4 A;  1M0S A;  3G82 B;  3T6B A;  3UCG A;  4IR1 A;  1S4E A;  5U47 A;  1YSJ A;  1GQE A;  3DRR B;  2RQK A;  2FHJ D;  1CSJ A;  4OQJ A;  5JMN A;  4FZV A;  4ECX A;  2UZA A;  1APS A;  4IH6 A;  1BMQ B;  3DU6 A;  5L1I A;  4OX7 A;  4DV1 J;  1X0P A;  5FD1 A;  2GZO A;  2RD5 C;  3BJY A;  2J7U A;  2IJN A;  2A6O A;  2IFY A;  2GVZ B;  4ZP7 A;  2HNY A;  2VKZ G;  4N8N A;  1FSU A;  1JLC A;  1RT2 A;  1PCA A;  4YB5 A;  3T5L A;  2F63 A;  3SCK E;  2DNN A;  2LA4 A;  1P9Y A;  3D6F B;  4J9N A;  3WHI A;  2CIM A;  1IQZ A;  1TKX A;  3EVO A;  5L1K A;  2ZH6 A;  1WDT A;  3BYP A;  4Y28 C;  4ILM A;  4TU7 A;  2COL A;  2KRB A;  1UVI A;  4CXK A;  1KHW A;  2CJY B;  4NLP A;  1JK9 B;  3FZB A;  4I69 A;  1R6Y A;  2H5J B;  3V6K A;  3QJL A;  1S48 A;  4O3N A;  1BE4 A;  1LXJ A;  2E29 A;  2KO1 A;  3KFW X;  1JLF A;  5GAE U;  5L8R C;  2EBG A;  4DQQ A;  2ZH3 A;  3BBC A;  4QWD A;  1LK5 A;  1EET A;  1HBU A;  3AOD A;  1BQM A;  3GII A;  3KWM A;  3QWU A;  3MD3 A;  3FSX A;  1RYR A;  3W5X A;  4BWJ A;  2RS2 A;  1VYA A;  2QTW A;  1TKZ B;  2GO8 A;  3HKW A;  1FFS B;  4OYI A;  3KMS A;  4A8Q A;  3EGZ A;  1HI1 A;  2E1A A;  4E8U A;  1AW0 A;  3OPK A;  2HS0 A;  3HD2 A;  1UW9 A;  2VUG A;  2HQC A;  4FKY A;  4DV3 F;  1DTT A;  2W25 A;  5KFP A;  4DR4 J;  1OQ3 A;  2B3T B;  4URS A;  4FBU A;  2PA8 D;  3SV3 A;  2HW3 A;  3QIP B;  1AZS A;  1TU0 B;  3QGI A;  4ZVS B;  2B51 A;  4BWM A;  4GTY A;  3TYT A;  3A8K A;  1MU2 B;  1U1O A;  2DO4 A;  3BYR A;  3MAA A;  2M3D A;  3QAT A;  3WIV A;  3ZZR A;  3HSD A;  1NK7 A;  1VBZ A;  1FDA A;  3OFH A;  4DL7 A;  1TUV A;  3VF0 B;  2QMU B;  2OPR A;  2VC1 A;  1WEZ A;  4R0E A;  3KHR A;  2HVD A;  2O5D A;  2ZWO A;  3KLE A;  3DRR A;  4KJI A;  4P72 A;  4CLT A;  4Q45 A;  4FXD A;  1UPM B;  5HO4 A;  1FES A;  3PRB A;  2HHU A;  1YJ7 A;  4OZ0 A;  1RT3 B;  3MM6 B;  4UOR A;  3MR5 A;  2VAS A;  3AOA A;  2VDH A;  1LWF A;  2C22 A;  1X5S A;  3IG1 B;  3UWT A;  4F7V A;  2ZM6 F;  1RZM A;  2BOP A;  1SHQ A;  1ZAX A;  3RGI A;  1MMD A;  2VG7 A;  1JLQ A;  4R0J A;  2K2P A;  5F0W A;  5HQM A;  2KM8 C;  1SKU B;  2VFV A;  2VC0 A;  2W7O A;  3RAM A;  3G6Y A;  4NWX A;  1UPP A;  3WQP A;  5A6W A;  1B64 A;  1X4G A;  3KK2 A;  2DNL A;  5GAH I;  3OUY A;  4NWB A;  3TJA A;  3VGS A;  4D3H A;  3PZP A;  1SKW A;  1RBL A;  4YN3 B;  2Z8Q A;  4ANC A;  3LOU A;  2FIU A;  4DV3 J;  5KFK A;  1YDL A;  1WF0 A;  2RDD A;  3CJ5 A;  4USU A;  4U7C A;  1K0T A;  4ZP8 A;  2ACM A;  1QJH A;  2OPS B;  5HQ8 A;  3KJV A;  2XS7 A;  1URR A;  2HFN A;  3CB4 A;  1TKT A;  4FPR A;  2UXB J;  4ZG7 A;  3KKF A;  3G6E S;  2AZ1 A;  3QIP A;  3FSI A;  4K4X A;  4P73 A;  1NZ8 A;  4F4X A;  5IQ6 A;  4DR6 J;  3ZZO A;  2MQO A;  1ZED A;  1H73 A;  2FHK A;  1FKA F;  1LFP A;  2CFX A;  1VDH A;  3A3O B;  2KJW A;  3H2V E;  5K8M A;  1R89 A;  2Q66 A;  2ZNY A;  4AXJ A;  4DPY A;  2J9D A;  2HQD A;  1I3O B;  1NDK A;  3H0P A;  1GX6 A;  1UL3 A;  3MR7 A;  4IYQ A;  2D9P A;  2CG8 A;  2IAJ A;  1R43 A;  1KKH A;  4JI0 F;  2CPD A;  2UUA F;  2CVE A;  2GX8 A;  2HFO A;  2RIL A;  4ID5 B;  1YJ9 S;  1QDU B;  2IDL A;  4O0I A;  5LRN A;  3ICL A;  1J2V A;  4QOT A;  1FD2 A;  2C28 A;  4OZ2 A;  2QEX S;  1ACM B;  3I56 S;  4B3R J;  1XMO F;  2HMI A;  3C6U B;  3I5C A;  2ZVS A;  1CG2 A;  1RA7 A;  2ZE2 A;  1YVF A;  1HHQ A;  2XLI A;  5D8H B;  2PN6 A;  4P75 A;  2BMB A;  3UDE A;  4X4U A;  4A4J A;  4ELU A;  4TNO A;  2GSO A;  1JB0 C;  3ZZU A;  4DUZ J;  3GV8 B;  3S8S A;  3M8R A;  3V81 B;  3QT5 A;  4WFN Q;  3KK1 B;  4XDD A;  2KYX A;  3CCU S;  3UFC X;  2VPZ B;  2W8K A;  3LGH A;  4UZC A;  4MYT A;  5E3C A;  4YHH J;  3H4D A;  4LR2 A;  5DGB A;  4ED6 A;  1P27 B;  1B3T A;  1HFE L;  3R6L B;  2HYI B;  2KXF A;  2C2E A;  1AJA A;  4M63 A;  2ATC B;  4HDG A;  2YXL A;  2BJ7 A;  3UNG C;  5C24 B;  2DGT A;  3J7Y I;  4DQS A;  1FJG F;  2FJA B;  2ZWP A;  1ROF A;  3C19 A;  3PG9 A;  5TJ3 A;  1IR0 A;  2CJX B;  2D3O 1;  2FJE B;  2F4V F;  1HYS A;  2F65 A;  1IUJ A;  1RWM B;  2H65 B;  2YWH A;  3EZO A;  4YY3 F;  3J80 Y;  1SPB P;  1MLA A;  3HLU A;  3SZY A;  8ATC B;  2AIR B;  3LP0 A;  1QSY A;  1T8E A;  1S9E A;  2EFO A;  2NYH A;  4LBI A;  3PKY A;  4FN5 A;  3ILO A;  2HEK A;  2OD4 A;  5KG0 A;  3I55 S;  1RLC L;  2BE2 A;  2LYV A;  2MPU A;  4PXB A;  3U1N A;  2JFD A;  5GAG I;  1CLF A;  1KHJ A;  2XLK A;  2FVP A;  5HVG A;  3KLG B;  3R97 A;  3ZTS A;  4HH1 A;  1WC1 A;  2HRU A;  4OYX A;  1J5E F;  4UOF A;  3P5T L;  3GFZ A;  1TV6 B;  3RW6 A;  1EX8 A;  4B9T A;  3WAV A;  1GXL A;  2W2Q P;  2FZC B;  3MPV A;  1OS5 A;  1S1W B;  3LP2 A;  1VQ8 S;  1S0N A;  5LSR A;  2V5H G;  1CBK A;  1EIY B;  3WAY A;  1XBW A;  3BGO P;  4KIA A;  2XZT B;  5DO2 A;  4V1A k;  5K9F A;  5I42 A;  4YR3 A;  2AX0 A;  1VRT A;  4QIE A;  3VVT A;  1TL3 A;  2DNQ A;  3NCQ A;  4IQM A;  4XPC A;  1TK8 A;  3NVL A;  4FDI A;  1IKV B;  3B4D A;  2UU9 F;  4K4U A;  3ZZT A;  2F8E X;  1S0M A;  4OHX A;  3JAM Y;  3EXY A;  4XO0 A;  2XGP A;  5A0Y B;  4N7T A;  2RH3 A;  4X64 J;  5HSP A;  5G4D A;  1Q8L A;  1ARO P;  3AXM A;  4A8S A;  2O67 A;  3VAL A;  2EFN A;  4KAV A;  5MAO A;  5GOV A;  2VIH A;  2MEW A;  1N5Q A;  2JSX A;  2LQ5 A;  3TAM B;  1WF2 A;  2QJ3 A;  2V4J A;  4XAK A;  1KVK A;  1EW2 A;  2GQQ A;  4ED0 A;  3LP0 B;  2V2Q A;  3A8J A;  2BAB A;  3H25 A;  1R0B G;  2LVW A;  4YY3 J;  4YFU A;  4RZR A;  3WX4 A;  1VQP S;  1FEE A;  3NY0 A;  2KRR A;  2HND A;  4C3K A;  3G96 A;  3RG6 A;  2J8A A;  2ASY A;  3GU0 A;  2AYB A;  4M5H A;  1LKZ A;  4OFZ A;  2K06 A;  2PDA A;  3RR7 A;  4ED4 A;  4TU9 A;  1NJZ A;  2M8H A;  2UUC J;  4R25 A;  3FEZ A;  4PWD B;  4YME A;  3M1V A;  3MMB A;  3UNY A;  2RKI A;  4OI3 A;  2BV3 A;  4BBY A;  5IT4 A;  2BA9 A;  2F8H A;  2FJB B;  1OYD A;  4FF3 A;  1L3U A;  3T3F A;  2EFQ A;  3WC2 A;  1NK0 A;  2HVH A;  1O98 A;  1EAR A;  4P71 A;  1YBT A;  3CCE S;  3N6M A;  1EP4 A;  2ADC A;  1VK3 A;  2CXE A;  2QL7 B;  1F3V A;  2YNG B;  5M2P A;  4JI7 F;  4CLS A;  2DR6 A;  4B9L A;  4RX6 A;  3DYC A;  2YBV A;  3MK0 A;  1ZBT A;  3QT8 A;  2DR7 A;  4BS2 A;  1GXU A;  4N5S A;  2HFU A;  2JL9 A;  2YNF A;  4CLY A;  1Y9O A;  4CNZ A;  3IGN A;  5D3G A;  2BAC A;  1GT8 A;  4LSN A;  3TX0 A;  4F4Z A;  2R9L A;  1RE1 B;  2CQH A;  1E1Z P;  2OO4 A;  3ITH B;  5H9F J;  1FVQ A;  3QFH A;  1RKI A;  2RHS B;  4O3O A;  5A2Q U;  3GSD A;  5LSL A;  2DEJ A;  1KLM A;  2B4V A;  3M2V A;  3WX8 A;  3R5G A;  1GMV A;  4M5L A;  2QL9 B;  3VTI A;  1W7W A;  2G13 A;  3TZW A;  3V5R A;  1NK9 A;  4U6P A;  1S0O A;  4YR2 A;  4HKQ A;  4UY8 T;  2ZKT A;  3BDE A;  5ETL A;  1BWE A;  3M8S A;  4GRS A;  1W25 A;  7FDR A;  3R7S B;  2LQ9 A;  5KXA A;  4N76 A;  1LEO A;  2AJ2 A;  3CCW A;  3JQM A;  3A12 A;  3TJ9 A;  1HMV B;  5KAK A;  1VQ4 S;  3Q2T C;  1RAO A;  2YPY A;  4PKD B;  3IA0 A;  1NSQ A;  4MT1 A;  1YJT A;  2XBP A;  3SDE A;  2DY9 A;  1VQ5 S;  4EYI B;  3DFE A;  4Q43 A;  3ZC4 A;  1NCL A;  2L48 A;  1HI0 P;  1BXN A;  1Y3J A;  4WCE Q;  2OPR B;  2ZM6 J;  2DHH A;  2DNG A;  3EIC A;  3MM9 B;  4DFJ A;  3H4B A;  3DRS B;  4FS2 A;  4MKY A;  3KUG A;  2BJD A;  3MI7 X;  1YRU A;  3GR0 A;  1MU2 A;  3UDC A;  1OPZ A;  1HNV B;  4NE9 C;  3T6J A;  3QJP A;  2EW9 A;  1U0H B;  1PIE A;  3W7B A;  4F8R A;  3NS5 A;  3PHT A;  1LW2 B;  4HDH A;  3MPD A;  4Q5V A;  4N8O A;  2ZBC A;  1RDR A;  4FNI A;  4GKJ F;  1ED8 A;  4WTO B;  3MUV P;  1G4C A;  3ZZY A;  2XO7 A;  3FK4 A;  4M5I A;  3LA0 A;  3R3T A;  2YWG A;  3DOL A;  5KFW A;  4OL8 A;  2DNK A;  5D4N A;  4X65 F;  1N33 F;  2JC1 A;  2H3E B;  2QLB B;  4X64 F;  2C2O B;  2OTJ S;  2W5X A;  3BQ1 A;  2RF2 A;  1H2T Z;  1ITP A;  2ZHA A;  2OIH A;  3MR3 A;  4ZPD A;  1IM6 A;  5B09 A;  4NLO A;  3A3N B;  1S79 A;  1T7P A;  1O0P A;  1RHJ B;  2KVQ E;  4DR3 F;  2XGQ A;  1OPI A;  1YIT S;  1K7H A;  1UMJ A;  2F9D A;  2IAJ B;  4ZP9 A;  1IKW A;  3GIM A;  1VOM A;  2ATL A;  3ZZ0 A;  2CPH A;  4PAB A;  4JI3 F;  2MQ8 A;  2OPS A;  3QRP A;  1VS3 A;  3MCS A;  3QGG A;  5HRO A;  3PR5 B;  3CDU A;  4J9O A;  1V5I B;  4NCA A;  1S6Q A;  1WDD A;  4H4M B;  3BO4 A;  4ECR A;  3N5F A;  5CXT A;  1PJ6 A;  1UZD A;  1S6U A;  2VB6 A;  3SBM A;  2MKI A;  1W2B R;  3KK2 B;  3NNC A;  3VAF A;  5ETQ A;  3MEG B;  3WZ0 A;  1KHN A;  2DKO B;  1YLX A;  3AXK A;  1JJH A;  2NLW A;  2V8V A;  3C15 B;  3NGK A;  3OFF A;  4RBT A;  3J7Y U;  3DLG B;  4PEO A;  4K8R A;  2RE1 A;  3TR5 A;  2QX0 A;  3MAQ A;  1N34 J;  4DV1 F;  1UEU A;  1X4C A;  2U2F A;  4DOZ A;  1U47 A;  4DG1 A;  2HHX A;  2O66 A;  2RH6 A;  1U7L A;  1RHQ B;  1CC7 A;  2W2P P;  3GYG A;  2MJN A;  3CME S;  2C2D A;  2DHS A;  2HBQ B;  3JB9 k;  4IDK B;  4I2P B;  2GVZ A;  2ILZ A;  1XEZ A;  3PJ9 A;  1SL1 A;  2B56 A;  1BD6 A;  1Q95 G;  4R5P A;  1U4B A;  5BYQ A;  2R2T A;  1E6Y B;  2ZBQ A;  3KLI A;  1FD8 A;  1B70 B;  1HQE B;  1AXQ A;  1PKU A;  2MKJ A;  2W9C A;  3WAX A;  2W24 A;  2B4U A;  2EPI A;  3LGM A;  2V0N A;  4ELV A;  3NKP A;  3JQK A;  3NMA A;  2WVB A;  1S7I A;  5AE2 A;  1N6Q B;  1IBK J;  3C15 A;  4RBV A;  5KFT A;  4BHQ A;  4PG5 A;  2CVI A;  2E7V A;  4DPO A;  3MCN A;  5AE1 A;  2WSE C;  4LRE A;  5HL7 Q;  4X62 F;  2MGZ B;  3EVM A;  2XTJ P;  1HIY A;  1YWX A;  4CH7 A;  1WEX A;  2L41 A;  4DS5 A;  4LF9 F;  3CXC R;  4TN0 A;  4IOC Q;  4OV1 A;  5CH7 B;  1U8S A;  1YKW A;  2YKA A;  5CYM A;  1IKX A;  1S6O A;  1NKC A;  3OLB A;  3BB5 A;  2FLL A;  3L3C A;  4FS1 A;  4LF8 F;  2FVQ A;  1BQM B;  3CW2 C;  4ZHR A;  2DNZ A;  2XHC A;  4QQB A;  1R6V A;  3DHW C;  1S6P A;  1HR0 F;  4ZCK A;  2G4B A;  2DGS A;  4N77 A;  3DM2 A;  4OX9 F;  2ROG A;  3FCH A;  5A8K B;  3PYG A;  3PAC A;  1DTT B;  3UQS A;  3BZQ A;  1M1K T;  1KQS R;  2AF6 A;  1M5V C;  2W4C A;  2JRS A;  3MEE B;  5A2Q Y;  1VQL S;  4KKO A;  3HFK A;  3UN3 A;  4NAS A;  4DQP A;  1QUV A;  4IRC A;  5DJB A;  2PI5 A;  1EQM A;  1HW8 A;  1VC5 A;  1PJ5 A;  5EWG A;  3UN2 A;  3CD6 S;  3R5A A;  2NPF A;  2VFT A;  1I94 F;  5HVH A;  3HK2 A;  4TY8 A;  4KGV B;  2VPW B;  2E5G A;  3IC1 A;  3FFI B;  4RW4 A;  3D68 A;  2YKP A;  1SCJ B;  4J37 A;  3LAK A;  3NNA A;  4LF2 A;  3OUY B;  3D0G E;  5CCM A;  4GVB A;  4WII A;  1VI7 A;  3ZZP A;  1FDN A;  2LXI A;  3QAU A;  1HWJ A;  2M52 A;  1U6B A;  3G9C A;  3T1H F;  4DSI A;  3CVK A;  4HEA 9;  1ZS6 A;  2YWF A;  5I4M A;  2A3J A;  5I3U B;  2AZ3 A;  3DXS X;  3Q2S C;  3GCX P;  3W64 A;  3G82 A;  3LF0 A;  1R31 A;  4HI1 A;  1C1B A;  3I6P A;  1VRU B;  1KTV A;  3BO2 A;  3Q83 A;  4ZPT R;  1VIO A;  3I0R A;  4LF1 A;  2KG0 A;  1QVG R;  2DNR A;  3DI6 B;  1YG0 A;  1N6Q A;  3A13 A;  1A0O B;  2DXD A;  3NCP A;  2E5I A;  4CLL A;  3HXM A;  4LF7 F;  3UD4 P;  2J6U A;  1I51 B;  1XR7 A;  5B0G A;  3GB0 A;  2YQ3 A;  1WTB A;  4U96 A;  1NK5 A;  2JEF A;  3UE2 A;  4EEY A;  4CT9 A;  1KD1 T;  2Y9H A;  4KO0 A;  4JB8 B;  2G2O A;  2KT3 A;  2DJW A;  5F8L A;  4R8U B;  1QY7 A;  5ETP A;  4DL5 A;  1U1Q A;  1XNQ F;  3LAL A;  2N7C A;  4CLF A;  1CJT A;  3G2X A;  1S4F A;  3IP0 A;  1LFW A;  4KAI A;  1RHM B;  4AQY F;  1SKS A;  4LF8 J;  1SBR A;  2XY7 A;  3HFZ B;  2DR5 A;  1DQA A;  2KI2 A;  1NPK A;  2CQ3 A;  4RWX A;  2MKK A;  1FHT A;  2GLQ A;  2HQG A;  2PC6 A;  3GTY X;  4IG0 A;  2X3G A;  2M2B A;  4Y2I A;  4C0O C;  3BV8 A;  5GAE I;  2XCA A;  1CUL A;  1AUS L;  1KH7 A;  3K5M A;  1VFJ A;  3BH7 B;  3MR6 A;  3PO4 A;  1A9N B;  4LBP A;  5D3G B;  1VCT A;  1RAH B;  1ZM2 A;  2CQ0 A;  4RL1 A;  4RW7 B;  3VHQ A;  2CQB A;  1NEE A;  2WVC A;  3CJ4 A;  4HR2 A;  1YGY A;  3EUN A;  4KE5 A;  4ZG9 A;  1H2V Z;  4C6A A;  1B8J A;  4KQZ A;  1N32 F;  3PW7 A;  3E2D A;  3BSC A;  1RU2 A;  3FQK A;  2FLP A;  1JQG A;  1DTQ A;  2HS3 A;  5EUH A;  3W65 A;  3ZTP A;  3Q0A A;  2MKC A;  4UY8 5;  2DHG A;  2FPH X;  2R42 A;  2JFK A;  2C3U A;  3FRY A;  1T11 A;  3TVZ A;  4RPF A;  3EWG A;  4WE1 A;  3W2W A;  1YQH A;  3IM8 A;  4AL6 A;  1NU4 A;  5GVQ A;  1FRX A;  4RU2 A;  4RUA A;  2VFU A;  3H2L A;  1V3R A;  3BBF A;  1IWG A;  2XM3 A;  2G0I A;  3AJ2 A;  2ZJR Q;  4CM0 A;  3ISN C;  2HHH F;  1ELX A;  1K8A T;  1FEH A;  3Q3Q A;  4EUV A;  4UZB A;  3CJK A;  2LA6 A;  4KH1 B;  1OYE A;  2JEJ A;  4MH8 A;  4YB7 A;  2KM8 B;  5KFC A;  2H4Y B;  5ITH A;  4NI2 B;  5LMN F;  4GTZ A;  1HQE A;  1R8P A;  1S1X A;  1C4C A;  2RS8 A;  2XMV A;  3BF4 A;  3GG0 A;  5L1J A;  1IBM F;  1KP6 A;  3CJ2 A;  3K17 A;  4H4K C;  2WW4 A;  4H4K A;  3MM5 B;  5HN0 A;  1YTY A;  3DLB A;  3RBX A;  2DK2 A;  3N9U C;  4L73 A;  2MZT A;  4K4Y A;  4KO0 B;  2XEX A;  4JYA J;  1HL6 A;  3MM9 A;  4QYZ K;  2DGW A;  4FVC A;  1NPR A;  2EXU A;  4ZGA A;  4B3T F;  4RUH A;  2LKZ A;  5D4O A;  4F4A A;  2AD9 A;  4WU3 A;  2ALZ A;  2W2M P;  2GJI A;  3EJM A;  5KFM A;  4G3I A;  4NPO A;  3TG0 A;  1RKJ A;  3EMT A;  4M5N A;  1X4E A;  1YRT A;  2XI3 A;  2FJW A;  1D3W A;  4U95 A;  3QSY B;  1S6Q B;  4PUO A;  3PEJ A;  2BVZ A;  1OY9 A;  3M6W A;  5KFO A;  1YJN S;  1L5U A;  2KN4 A;  4FF4 A;  2R7S A;  4JV5 F;  3CJS A;  3OVS A;  5DLV A;  1FNX H;  5L0K A;  2ZD1 B;  1TK0 A;  3HI9 A;  1NZA A;  2J5A A;  3T01 A;  4OX6 A;  1L3S A;  2IMW P;  4QR1 A;  2HZC A;  2MSS A;  2FJV A;  4Q2M A;  4HYK A;  3ZTO A;  4V19 J;  1TFW A;  3CMQ A;  4MAK A;  3FFI A;  3I31 A;  2PEB A;  3OTC A;  4RW4 B;  2ASD A;  4LF4 F;  2YWK A;  1WOP A;  2WBM A;  5A8R A;  4LFB F;  1TKZ A;  5IC4 B;  1JLG B;  2K3I A;  2MQP A;  3J81 j;  1H7W A;  3Q8S B;  2J76 E;  4DF8 A;  1J5O B;  1W2I A;  2DH8 A;  4PQA A;  2NR0 A;  4U8V A;  4DR3 J;  4PQU A;  4KGM A;  3ULH A;  4ENO A;  4DV4 J;  1IVZ A;  2BKO A;  3FBE A;  1LW2 A;  4QR2 A;  1VIX A;  4IRK A;  2FB0 A;  2KH9 A;  4P2X A;  3OBI A;  3WC0 A;  1C4A A;  4JI2 F;  3M8P B;  4F2S A;  2XNQ A;  4C98 A;  1ZZF A;  4KV8 B;  1HI8 A;  4NYO A;  2I0X A;  2DGU A;  3AA9 A;  1T3N A;  3ZZZ A;  4OHY A;  1T94 A;  1Q79 A;  2M4M A;  1TKX B;  4U9R A;  4EZ6 A;  4F0M A;  2PI4 A;  3DDK A;  1Y5N B;  2W1B A;  4YR0 A;  2MKS A;  3BR9 A;  1H74 A;  3MPU B;  2IBK A;  3DMJ B;  1JLB B;  5BR8 F;  1OY8 A;  3NGR A;  4ED3 A;  4USM A;  2D1G A;  4NCB A;  1SJQ A;  1UET A;  3MR2 A;  4DR2 F;  3DGP A;  5J1N A;  2ZD1 A;  4OYP A;  4ZPC A;  4YHH F;  3DN9 A;  2AJ1 A;  2XR9 A;  1ZA2 B;  4RNO A;  2XMT A;  4ECQ A;  4FNH A;  2YTC A;  3VGT A;  4C8K A;  4GC7 A;  4M5M A;  3E3X A;  1SHN A;  5C25 A;  1GTE A;  3TUI C;  3ETM A;  2XO6 A;  3EZ5 A;  3MXH P;  1HWL A;  2CJK A;  3FZ2 A;  3QNW B;  3MHY A;  4PWW A;  3G86 A;  3GJR B;  2I8E A;  3SFG A;  1YI2 S;  4I2P A;  2FVC A;  1LXN A;  2PFD A;  1IBL F;  3JYT B;  5F3T A;  2AYG A;  4CCH A;  3JTO A;  4MYU A;  3NEK A;  2CJQ A;  2JDJ A;  2HGM A;  4P6Q A;  4I4B A;  2YH0 A;  2FUG 9;  1N8R T;  2OTL S;  3CWJ A;  4DR1 F;  2CPX A;  3D2W A;  2F9J A;  1IJF B;  1TL1 A;  4ZLJ A;  3PXG a;  4FVM A;  3I0S B;  3EX7 B;  3HSZ A;  4UPI A;  1SQF A;  2FYX A;  3FQL A;  1E6Y A;  2NZ4 A;  3SYZ A;  4UPH A;  2BRK A;  4IOB A;  4RO0 A;  1S1T A;  1RAJ A;  2ZH8 A;  2QA4 G;  4KGK A;  1RCO B;  1E3C P;  2K3K A;  3ENW A;  4DV0 J;  1DUR A;  4K4T A;  2P2C B;  2DPJ A;  5CYQ A;  1TAQ A;  1ELO A;  4WU2 A;  1TL3 B;  1TKD A;  4XK8 C;  4JI1 F;  1ZM4 A;  2KVI A;  4DV6 F;  2R8J A;  3NBP A;  2DT9 A;  1Q8B A;  5AJ3 F;  4X4V A;  4C0B A;  2RRB A;  1KDN A;  1C0U B;  1K0V A;  2V2V A;  3I96 A;  4C3L A;  3D3C J;  4NEZ A;  1NJY A;  1NK4 A;  3AB4 B;  4CTA A;  3PYE A;  2RU9 A;  1YBU A;  3NOC A;  4B3O B;  4J9M A;  1UWB B;  2CNK B;  1VIS A;  3PYD A;  1JKH A;  4LFA F;  1E6V A;  2E1R A;  2GW8 A;  3CD7 A;  4I67 A;  3LWM A;  4OYM A;  3OHA A;  1MW7 A;  1CJV A;  3DRP A;  4X65 J;  5AE3 A;  1RTH B;  4UQG A;  3DC2 A;  3Q8V A;  3OL7 A;  4ED2 A;  3OR1 A;  2AYM A;  4NXM F;  3CJQ A;  2HPU A;  3MUT P;  2E5H A;  3R9L A;  2B9E A;  2G1H A;  2NCK L;  2R7V A;  5DLF A;  4DLG A;  3PX0 A;  1HNW F;  2DHA A;  3AOC A;  3KJQ B;  2DTJ A;  1Z2L A;  5CD4 H;  3OLA A;  3G71 S;  4DR5 F;  3KG1 A;  3I9V 9;  3TNV A;  1KQG B;  1UVL A;  1ZPV A;  2B43 A;  3R2D J;  1SH3 A;  1FTR A;  1UTA A;  3MTJ A;  2I38 A;  2BUN A;  2RIJ A;  4F3O A;  4W90 B;  1KH4 A;  3DGP B;  1H0H B;  4NZ7 A;  1GNK A;  1VK8 A;  5E3A A;  1TQL A;  1EAY C;  2P9E A;  3GV5 B;  4P2F A;  2UXC J;  3NS6 A;  2VIC A;  1SJR A;  2Y1I A;  1X9M A;  1TUW A;  5HAN A;  5IV3 A;  3K2Y A;  2QZ8 A;  2VQF F;  4DPU A;  2QA1 A;  2U1A A;  3PNI A;  4JI4 J;  4WFB Q;  4MHX A;  3QWP A;  1RTI A;  1S7H A;  3LP1 A;  2UVU A;  2IY5 B;  4DSK A;  3SFU A;  2K8G A;  3AFG A;  5IS2 A;  2BM1 A;  3X3U A;  1KFS A;  4NWJ A;  4X4T A;  2KHC A;  1RYS A;  5I42 B;  2FD2 A;  4IG3 B;  3MUM P;  2IJF A;  1VJW A;  3JSR A;  1E6V B;  2VQE J;  2CAJ A;  2V50 A;  5HP1 B;  3RAQ A;  2GC8 A;  4DSF A;  1TAU A;  4F26 A;  2BQU A;  1LWE A;  2IM1 A;  3NGS A;  5A0Y A;  7AT1 B;  5KFD A;  5DM7 Q;  2YPZ A;  4BDP A;  2J7K A;  2C3M A;  3VCD A;  2DRB A;  3RR8 A;  2DNY A;  1HWK A;  2EK6 A;  4DR7 J;  3JS9 A;  3K5L A;  4J9V A;  5FDL A;  1KLM B;  5F8H A;  3JTP A;  1AJD A;  1VQO S;  4DV5 J;  2D7S A;  1S1U B;  2LLZ A;  1GEH A;  4LFA J;  5K20 B;  1BC6 A;  1F5A A;  1EI6 A;  2YKN A;  1MRO A;  4JI1 J;  2OHD A;  3VGV A;  1F2H A;  3KG0 A;  1TTH B;  1X7V A;  4MKA A;  3CGI A;  5KT7 A;  4A48 A;  2HBY B;  3R7B B;  1J5E J;  2V63 A;  4TVA B;  1TUG B;  2PD1 A;  2CWX A;  2YNF B;  3KD8 A;  1S12 A;  1C0U A;  1FNO A;  2ZH2 A;  2JZ5 A;  2OP5 A;  1U48 A;  3NS7 B;  1PBA A;  3NBP B;  3HMJ G;  5F8J A;  2M7S A;  3MWB A;  2E5J A;  2VDI A;  3POT B;  1F6T A;  4JI6 J;  1Q5V A;  4RNH A;  4MK7 A;  4K4V A;  1ALK A;  2RSQ A;  4WKR A;  2RU3 A;  3JTN A;  2HG4 A;  4OJ3 A;  4NCG A;  4RW6 B;  3KK3 A;  1U1N A;  4B9M A;  3SQG A;  3A52 A;  2VJU A;  1KSP A;  2OH2 A;  4JI7 J;  2HVI A;  2G9Y A;  1FRJ A;  1I5O B;  1M5P C;  2NXN A;  1O5J A;  2CPY A;  2HFS A;  4ICL A;  3TX8 A;  3KHL A;  3IAS 9;  1RAB B;  2JJ4 D;  3I82 A;  1NLK L;  3JSB A;  5J2P B;  2J8S A;  2BEF A;  2WK4 A;  1Q8I A;  3D54 A;  4BC7 A;  3K0J A;  1NSP A;  5ETT A;  2OPQ B;  1WTF A;  1URN A;  4EMD A;  2LQJ A;  2H4W B;  4PWD A;  3RUB L;  1IBK F;  1BUX A;  5KFG A;  2XMM A;  1FWL A;  1U25 A;  1QUP A;  1FK9 A;  1RCX B;  2IFX A;  2R7Q A;  3A8E A;  5LMU J;  5C2G A;  1FT8 A;  2QN6 B;  4CM2 A;  4ES1 A;  4OLP A;  3ET6 A;  2G9O A;  4NL5 A;  2Y8W A;  3PW5 A;  2LP4 A;  2JOQ A;  2QT7 A;  3SQG B;  3F56 A;  3T19 A;  3P8B B;  2AV5 A;  3QGP A;  3DLL Q;  3M1V B;  1Y3K A;  3TAM A;  2YX4 A;  1WSR A;  2EG1 A;  4EYH B;  4NRU A;  3CF5 Q;  3U1L A;  4DU8 A;  3BDF A;  3QPI A;  5AT1 B;  4LR8 A;  3PIO Q;  3M8P A;  2DEI A;  3M2U A;  4OI1 A;  3PVX A;  1GXT A;  3AOB A;  5JVG Q;  3RB0 A;  4OYA A;  2DR8 A;  5J2Q B;  3LTO A;  3UI3 A;  1U1M A;  4WJB A;  5KFL A;  3RJM B;  4ZIW A;  4JI6 F;  3KUH A;  4WZM A;  1S57 A;  3HSJ A;  3M2V B;  4MK9 A;  2PEH A;  4AD6 A;  3HX9 A;  1J5O A;  2JEG A;  4X84 A;  3VAH A;  1N5V A;  4WFY A;  4JI2 J;  3MTK A;  1ZM9 A;  2ZUA A;  4NLG A;  3EGN A;  3GP9 A;  1WUU A;  4FXW A;  4UQT A;  1VHI A;  2CQ2 A;  5ETK A;  1ZH5 A;  1RAC B;  2M0G B;  1H6K X;  4K59 A;  2RRA A;  2L9W A;  2Y1L B;  2J6S A;  2RNE A;  2JLF A;  2UXB F;  4LSN B;  4ES2 A;  2DNO A;  2P6T A;  4ED7 A;  1R27 B;  4DEZ A;  3HPO A;  2JVR A;  3ZTQ A;  2MHN A;  1ALJ A;  2FGC A;  1LWC A;  2E1C A;  3IMQ J;  4LF6 J;  2YKN B;  5D0R A;  1SB6 A;  4UT4 A;  4DV5 F;  1CS4 A;  3RB4 A;  3LW5 C;  2XMW A;  1ZAV A;  5HRO B;  3TZY A;  4OZL A;  3A1Y G;  1PG5 B;  1WJ9 A;  3MUR P;  4KAY A;  1UW4 A;  2NPI A;  2RT3 A;  3MEC B;  3R27 A;  4LR9 A;  2D69 A;  3IGV A;  4WWS A;  4DN0 A;  4F50 A;  1HBM B;  4PR6 A;  4AYB D;  1X9S A;  2F8M A;  3S01 A;  4QU7 A;  3GMG A;  2VL1 A;  1LQ9 A;  2YNI B;  4DL6 A;  1HBN A;  3VQS A;  3TW0 A;  4P52 A;  1VR6 A;  1X5T A;  1EQJ A;  3UN5 A;  2ERR A;  5AJ9 A;  1B0P A;  5T7L A;  1IN0 A;  5LOQ A;  2EG2 A;  5K14 A;  1ZOT A;  1M5S A;  3NMR A;  1SIW B;  2HWI A;  2OMO A;  2K7J A;  2ZNZ A;  1YZ6 A;  4I56 A;  2X51 A;  4I6Y A;  1RB0 A;  4YOE A;  1OO0 B;  4RBU A;  4BC9 A;  4JYA F;  2R7R A;  4OLO A;  3H42 A;  3F73 A;  4A8K A;  4Z37 A;  1RHK B;  1YK9 A;  2AYE A;  4KB7 A;  1NO8 A;  4URQ U;  5DG7 A;  2AP6 A;  2QSF A;  3Q86 A;  2BDP A;  1FKP B;  5IM0 B;  1SQE A;  3PY8 A;  4B3T J;  1M5K C;  2XYP B;  3IWN C;  3H40 A;  1KH9 A;  4TLR A;  2VKR A;  1CQM A;  3ENV A;  2G1D A;  4DJB A;  2M8D B;  3ZNU A;  1SUQ B;  5LJ3 Y;  2L9D A;  3KHG A;  3RAX A;  4I6W A;  1S59 A;  3LAN A;  2HMI B;  1IKY A;  4F3M A;  1RQ0 A;  5F0U A;  5J2P A;  2Z4P A;  3FCW A;  4DX6 A;  5BJR A;  4H4O A;  4TYB A;  2OEJ A;  3SZZ A;  5HMY A;  4PRF A;  2HHV A;  5FJ4 A;  4ZN1 A;  4QPX A;  4Y2A A;  1RP5 A;  1X4B A;  4RNF A;  1R8A A;  1TL4 A;  5BYS A;  3T1Y F;  1FJ7 A;  3B6B A;  3H20 A;  3JSY A;  3OXG A;  3L4B C;  2QRR A;  1A6L A;  4TLQ A;  3UCU P;  3J81 U;  5AXM A;  1EET B;  2VH7 A;  2LFV A;  3GCW P;  4C8O A;  2HSE B;  2HVZ A;  2UXD F;  2WOM B;  3LQV A;  4B3O A;  3VGU A;  1UEV A;  1JX4 A;  3GWC A;  1TL7 A;  1RUS A;  2ACY A;  2BE9 B;  5H9F K;  3IR6 B;  2ALY B;  2HGL A;  3GQC A;  1QLN A;  4B56 A;  4RNN A;  3X1L B;  4FYV B;  2APO A;  3CJT A;  2YQ1 A;  4L3N A;  4MFB B;  2CJA A;  1CUL B;  4DV6 J;  1DFD A;  5B0C A;  2YQ0 A;  1N32 J;  2HNZ B;  1FX2 A;  3D5M A;  2RHQ B;  2W2N P;  1FF2 A;  2XUL A;  3H5Y A;  2ZBR A;  3PHE A;  4WFA Q;  4ZG6 A;  2ZIT A;  4I64 A;  4LIR A;  4MJK A;  2GNK A;  2MST A;  3RBE A;  1VQM S;  4K0K F;  4Y0F A;  4RW7 A;  2ZHB A;  2MGZ A;  1Q82 T;  1TVR A;  2ABY A;  2HK3 A;  4RW9 B;  4CWB A;  3T5H A;  4ERD A;  1E33 P;  2DVI A;  2W9A A;  2FVS A;  2IA0 A;  1Y4Z B;  2ADB A;  1DZ5 A;  2VOD A;  5KFQ A;  4Q7A A;  1MSW D;  2Z58 B;  5T7L B;  4WK3 A;  2D3U A;  5DZ7 A;  3UD5 A;  1R0A A;  1QTN B;  3IG1 A;  5DG9 A;  4ZJO A;  2HWT A;  1IJE B;  2YNG A;  2MY7 A;  4M8L A;  1L3T A;  1JIH A;  2XS2 A;  1ED9 A;  3RU0 A;  5A8W A;  3C2P A;  2PFF B;  3GG1 A;  2VG6 A;  1RBA A;  1VRU A;  4FXV A;  1ZYQ A;  2XSJ B;  3FGV A;  2XMA A;  3P49 B;  2W5T A;  1FFW B;  4U7U K;  4TQR A;  4Q8F A;  3PO5 A;  2GHP A;  1VBK A;  1WEY A;  3PTW A;  4LFC F;  1XNR J;  4DL0 C;  2E7X A;  2FZG B;  5EX3 A;  2RVJ A;  2QA2 A;  4EBC A;  3CC4 S;  4Q0B B;  1Q78 A;  4DR2 J;  2N4C A;  2WB1 D;  2UUB J;  1DLO A;  2ZBP A;  5KT5 A;  3IN5 A;  4X4P A;  1ZEF A;  3E51 A;  1PYS B;  5H9E J;  5EGE A;  3QYY A;  2CNO B;  3ADA C;  4OI0 A;  3MM5 A;  1UFK A;  5DDO C;  3TO8 A;  1NXI A;  3KLF B;  1XQI A;  2J9C A;  5DS7 A;  4DUY F;  2R8G A;  2KFY A;  3OTD A;  3VAI A;  1EJ7 L;  2V8H A;  4NOH A;  3I32 A;  1ANJ A;  4NYP A;  4DV2 F;  2XQC A;  3TRG A;  4ZVQ B;  1SV5 A;  3W62 A;  3IBF B;  2YWE A;  4EO6 A;  2BM0 A;  4F36 A;  3A8I A;  4DPW A;  5EGH A;  3C8Y A;  3FKB A;  2XSF A;  1RT1 B;  4KTQ A;  3C6T B;  2QV6 A;  4NEY A;  1HHT P;  3M4X A;  2HGN A;  2R8K A;  4ZVT B;  4USJ C;  1PAU B;  1VMB A;  4WP3 A;  3RTV A;  4LF4 J;  1U24 A;  2R7T A;  2GSN A;  3OFG A;  9ATC B;  3ZFV A;  1I94 J;  2CPF A;  3CJ0 A;  3HHD A;  3IRX A;  5B0A A;  4AL7 A;  1MN7 A;  2AKW B;  5LXR A;  3J80 U;  3O6Q A;  4O3R A;  4PQU B;  2D9O A;  2W01 A;  4KRW A;  2CQD A;  3UR0 A;  2RDJ A;  1HR0 J;  1FVS A;  4LFB J;  1P49 A;  1DTQ B;  4MIB A;  3M7V A;  4WFZ A;  4EO8 A;  1RTZ A;  5EDW A;  1XC9 A;  1KLN A;  2EK1 A;  1Q5Y A;  2LXF A;  1V6H A;  4HT7 A;  1ALI A;  4IFY B;  5DQI A;  2LU1 A;  3ILL A;  1G7C B;  4PG7 A;  1V3Z A;  3BPD A;  1UFW A;  2O01 C;  3M8Q A;  1T0T V;  1N48 A;  3OL9 A;  4EBD A;  1AT1 B;  2KTQ A;  2NS1 B;  5FII A;  4A47 A;  4IFV B;  2MQL A;  2V68 A;  2XYH B;  4CLZ A;  2AT1 B;  1FCA A;  1GK8 A;  2X3D A;  4J7C A;  3S6E A;  1K47 A;  5IT0 A;  2VA2 A;  2JEI A;  5J2M B;  2AX1 A;  2I1R A;  4ZIT A;  5H1S V;  4J9U E;  1K44 A;  3GFX A;  5CQG A;  2W5Q A;  5RUB A;  2KZM A;  5E2Q A;  3LXQ A;  2AJ0 A;  2AEM A;  1FER A;  3V4I A;  4ICL B;  1SL0 A;  2DNP A;  5E41 A;  3M9M B;  1PO6 A;  4JV1 A;  1UWA A;  1D9A A;  1EW8 A;  3J7Z T;  5GAH U;  2YNH B;  1RTD B;  2JH3 A;  4IRD A;  1WG1 A;  1REG X;  2V4Q A;  4AUK A;  4OX8 A;  1KOO A;  3M30 B;  5K14 B;  5ETS A;  3CIM A;  2HRT A;  2OGU A;  4EU0 A;  2HS4 A;  5L9X A;  4AFF A;  1UJ5 A;  2IM2 A;  3M6V A;  3ILJ A;  2QA4 S;  1S49 A;  4YR1 A;  4JI5 J;  4XTT A;  1UJ4 A;  2GIQ A;  4DCO B;  3PFO A;  4KPY A;  2LU2 A;  1T95 A;  4OZN A;  2AHO B;  2RB7 A;  2IC3 A;  1NJX A;  5GRR A;  1REV B;  1G3O A;  4EZ9 A;  3NG8 A;  3MCM A;  4K0K J;  1NRK A;  1R0C B;  4HHJ A;  3NKN A;  4GTW A;  4KM4 A;  3OSN A;  1NAQ A;  2MLX A;  2FDN A;  3V6J A;  1RT7 A;  2CQ4 A;  1NUE A;  4Y2M A;  3LO3 A;  2UP1 A;  5LXY A;  4ZP6 A;  2LDI A;  2RDI A;  1YIJ S;  1IQT A;  4FDJ A;  4P10 A;  4X2B A;  2HHH J;  4CLP A;  1Q7Y T;  2PT0 A;  1YZ7 A;  2KG1 A;  4B17 A;  4IFV A;  5KOW A;  3R2C J;  2WVF A;  4JI3 J;  4NLU A;  4X4N A;  2MJU A;  2VU5 A;  5KG6 A;  4B9N A;  4KHP J;  1ZPW X;  2JLG A;  1Y11 A;  4OZ1 A;  1LOU A;  2UUW A;  3WBZ A;  2W9B B;  3SSR A;  2OJ3 A;  3DPC A;  3CJ3 A;  3QGH A;  1X0F A;  2KFZ A;  1IM4 A;  2BRL A;  2LCW A;  5D4L A;  1V3S A;  2GVD B;  1T02 A;  4DR7 F;  1C1C A;  1M5H A;  1NME B;  3BKT A;  4IH5 A;  1XK8 A;  3KLH B;  4DQI A;  3H5X A;  1FRM A;  3E01 A;  3UR3 C;  5F8I A;  1Q4R A;  3H90 A;  3P5B P;  4OZJ A;  3K8W A;  3ZXW A;  1X9W A;  3CMR A;  4O3P A;  3NCR A;  2DH9 A;  3KLV A;  2FY1 A;  2GJ2 A;  3GFH A;  4NLY A;  4USI A;  1UP1 A;  3TEH B;  4OYW A;  4YDD B;  1Y0H A;  5KFJ A;  5I3P A;  2GAH C;  5M2U A;  2CYY A;  4DV7 J;  1NDL A;  1GMU A;  2EBE A;  1S9G B;  3QT7 A;  1C0T B;  5J1E A;  3IR7 B;  3Q8Q B;  4ECZ A;  1XR6 A;  2DYA A;  4F67 A;  3THV A;  1S72 S;  4GMK A;  3RBZ A;  3AD9 C;  3GLJ A;  4LQ3 A;  3HSG A;  2A2C A;  3M30 A;  3QMQ A;  1PC4 A;  1SIZ A;  1KC8 T;  1TZ0 A;  1FKP A;  4C8Z A;  5KFS A;  2KKH A;  3BR8 A;  4C8M A;  2OI2 A;  4R8U A;  3TQE A;  3EM1 A;  1KN6 A;  3IWX A;  1XR5 A;  1S97 A;  2MLY A;  4ED5 A;  3N6N A;  3R7N B;  1DAX A;  4CYS A;  1NHK L;  4UOH A;  3VQT A;  3R5D A;  3NKQ A;  2OFG X;  3SSQ A;  5HJX A;  5D0E A;  3HD1 A;  2Z57 B;  3T9N A;  1R0A B;  1VBY A;  4ILL A;  2E9T A;  5HVF A;  1HNW J;  4DG1 B;  3CDA A;  1NK6 A;  2EC0 A;  5SZT A;  3C3L A;  3QFW A;  4NA1 A;  2GHW A;  4PWU A;  1LWF B;  1X4H A;  1YJW S;  2OML A;  3OXL A;  4QBU A;  1SJ4 P;  2LQB A;  1KQF B;  1RT5 B;  4PAA A;  3PJW A;  4DZ6 A;  1M90 T;  3P6Y C;  1C1B B;  3MOZ A;  3PM9 A;  3W60 A;  4GVB B;  4F0K A;  5IWA J;  2CG4 A;  3CDB A;  2UV8 G;  5HBM A;  4X4O A;  5ETR A;  1HW9 A;  2HQF A;  4K2X A;  4HI2 A;  4PPZ A;  3VVU A;  3MDF A;  2MXY A;  3K5O A;  1JWW A;  3V4M A;  2QGF B;  3HHL C;  2Y8Y A;  2V94 A;  3DLJ A;  4X66 F;  5I3U A;  1N5T A;  1U2F A;  5ETO A;  3AD8 C;  5IJS A;  2C2K B;  2V2K A;  3D0H E;  4GO7 X;  4YB6 A;  1PAE X;  4CXS A;  1CJU A;  4O3Q A;  2Q6B A;  3G6X A;  4KHR A;  1TR0 A;  4NLR A;  3SI8 A;  3J7A N;  2OLW A;  1TL7 B;  3U02 A;  5AJ3 J;  5INH A;  1JLA B;  2Y3Y A;  2HLU A;  3LH2 S;  5KT6 A;  4NA3 A;  1VC6 A;  5A8K A;  1HJK A;  4MY4 A;  3IFE A;  2PGC A;  5LM7 E;  2F4F A;  1TFY A;  3THP A;  1RT1 A;  2HNZ A;  2YX1 A;  4C48 A;  3HHL B;  4OV6 A;  2QYC A;  3HF5 A;  4ZHR B;  5C2C A;  4YEA A;  2CWK A;  5A6P A;  2SXL A;  1NH8 A;  1NBE B;  3TAR A;  1IKX B;  3A4T A;  1U1P A;  1JJ2 R;  2CNL B;  1LWE B;  3TVK A;  1QAX A;  2CUY A;  2HQ3 A;  3PRV A;  3OTO F;  5J2Q A;  1CC8 A;  1RT6 A;  2HBR B;  2LQ8 A;  2IMO A;  2V67 A;  3KNG A;  3LUY A;  5HLF B;  4LF9 J;  1HNV A;  4OX9 J;  1ZZN A;  3D67 A;  4RW8 A;  4TXS A;  1VGY A;  2EEY A;  3UD3 P;  1VC0 A;  5B0D A;  5IT9 U;  5CHC B;  4ZJL A;  3NGD A;  4X62 J;  1VQN S;  1U45 A;  2HUR A;  4RUC A;  2CZ4 A;  2H9Z A;  3BSN A;  2EFV A;  5T41 A;  3SCL E;  3NGT A;  1Y5L B;  4AND A;  2FHJ A;  3WIU A;  2C2M B;  2A18 A;  2D3O R;  1HNZ J;  5LIA A;  4P2M A;  4LRF A;  2FHM A;  1WOR A;  1ANI A;  3AY0 A;  4MTP A;  2IC3 B;  3BM7 A;  3CJR A;  4A8W A;  4DFP A;  1NND A;  2VFS A;  2IHR 1;  1VQ7 S;  4NXN F;  3P96 A;  3OV7 A;  4LF7 J;  5F8M A;  2PMH A;  3D1H A;  4ZCL A;  2YWW A;  1RU1 A;  5BR8 J;  3CUL A;  2RRN A;  1HNX J;  4LJM A;  1WD6 A;  4W4M A;  2F5G A;  2WB4 A;  5B0E A;  4ZKA A;  3HHN B;  1RJJ A;  2DO0 A;  2Y0B B;  3BGR A;  1AA1 B;  1Y6V A;  1QSS A;  1HBN B;  1RWU A;  2R3V A;  3BDG A;  1CJK A;  5L9N A;  2HFV A;  1HNI B;  2Z0G A;  4F25 A;  3LPY A;  4H54 A;  1N36 F;  1ELY A;  2GMJ A;  3CSK A;  3MEK A;  1K1Q A;  1UEK A;  3BPS P;  5KG3 A;  3CE8 A;  3D6M B;  3FMB A;  2DD8 S;  1MRO B;  1RHR B;  5DLG A;  3K5N A;  5KFF A;  3CO9 A;  4PG6 A;  4Q44 A;  2H5E A;  4O4R A;  1B7Y B;  2E7W A;  5M2R A;  4CO3 A;  4KC5 A;  3PIP Q;  1D09 B;  1QE1 A;  4OJ1 A;  4OI4 A;  1HLW A;  3VAM A;  2PMW A;  4GC6 A;  1AJC A;  4C8L A;  2ROE A;  2R8I A;  1BQN B;  4WXO A;  3DHX A;  3MMJ A;  3OJU A;  3MEG A;  5DQH A;  2UU9 J;  2UVW A;  2WW8 A;  1CJU B;  1SKR A;  2QSW A;  2J9E A;  3DDN A;  2ZC4 A;  4FYY B;  4RNM A;  3KJV B;  2GML A;  2RF2 B;  4UOO A;  3GFY A;  3FRZ A;  1S99 A;  1R7I A;  1N88 A;  2ZBI A;  2V8G A;  2P6S A;  3BKU A;  3GJQ B;  3H5U A;  2QE5 A;  2WVE A;  3ZTR A;  2YKO A;  1ZAW A;  1T9U A;  2ZZT A;  3M32 B;  2R7W A;  1IKW B;  3KTQ A;  5D15 A;  1DQ8 A;  1AFI A;  1FKO A;  4NA2 A;  4MKB A;  4CLK A;  1RTJ A;  2QIF A;  1URB A;  2W5S A;  3IDD A;  2GV1 A;  2EC2 A;  4QU6 A;  4OJH A;  2Z56 B;  2D41 A;  2KDO A;  1XIQ A;  2B9X A;  1U0H A;  4ZPB A;  4QYR A;  4NLS A;  3M9N B;  3NOG A;  3PYF A;  1MN9 A;  1A7G E;  1TL5 A;  2VPX B;  5ETM A;  1FRH A;  1T03 A;  4DBQ A;  3FUY A;  5DZ6 A;  1NSK L;  4QIW D;  4QPT A;  1K73 T;  5L0B A;  1SUQ A;  2Q3P A;  2VA3 A;  1RWO B;  1WI8 A;  4WTY A;  3HO1 A;  1QM9 A;  2VQF J;  2HQI A;  3CUN A;  1U6Z A;  5KFY A;  1RT3 A;  4ED8 A;  3BDG B;  5DLT A;  3SCI E;  2Z30 B;  2XY5 A;  4L6V 3;  3MK2 A;  4IUF A;  1JJ4 A;  1WWH A;  4JP8 A;  3G8T A;  4J9S A;  1WKJ A;  3QRR A;  1RHU B;  3BGU A;  4I2Q B;  4RUB A;  4DUZ F;  3MFI A;  3MMA A;  4MIW A;  2RKI B;  2NXU A;  4MIA A;  4F4K A;  1JNR B;  4K5R A;  3TJ8 A;  2LDY A;  1CJV B;  4K2J A;  4WIQ A;  2BX6 A;  2MLZ A;  2XHW A;  3AD7 C;  2W7P A;  3BBB A;  5HI7 A;  3THT A;  5G0R B;  2XG8 A;  2KT2 A;  1Q81 T;  3W5Y A;  1Q86 T;  3FC9 A;  3L7O A;  3U7J A;  3F41 A;  4Y2C A;  3W66 A;  1FJE B;  1ULR A;  1WSV A;  2JWN A;  3NAH A;  2R2U A;  4Z7C A;  4NXM J;  2WVD A;  3NL0 A;  4C11 B;  2N3O A;  3GSI A;  3D9B A;  2EI5 A;  3W3S A;  2AU0 A;  1G2E A;  3S7R A;  3R8Y A;  3KLH A;  4E2F B;  4PYD A;  4JI8 F;  4RJV A;  3M32 A;  4PG8 A;  3EYZ A;  2BBE A;  1NKE A;  1L3V A;  2PA3 A;  4B9S A;  3NKO A;  3HCX A;  1VQ9 S;  3O3L A;  4DI6 A;  4UPK A;  5IZH A;  1RWP B;  2E1P A;  2YVS A;  3FBB A;  3CD5 A;  5KFE A;  4GO5 X;  3KOA A;  1JLF B;  3PX4 A;  1MWY A;  5B7W A;  2BAN B;  3GIJ A;  1KVJ A;  3NGU A;  5KFZ A;  1U2R A;  4KSE B;  3CD0 A;  2VBX A;  2CDR B;  4RW9 A;  2NXJ A;  1BQN A;  4JUZ A;  3T5K A;  2V8P A;  2E66 A;  5IFM A;  3KLG A;  3K59 A;  4ZK7 M;  1JLG A;  1QD1 A;  2MYF A;  2FC9 A;  1N0V C;  4DUT A;  3Q24 A;  3POT A;  1FTC A;  1TMJ A;  2MZJ A;  4ELT A;  2UXD J;  4MIV A;  4DV0 F;  1RT7 B;  3BQ0 A;  3N28 A;  1YHQ S;  2CQ1 A;  1V5V A;  2B4O A;  2ZOG A;  3ITH A;  2VFR A;  5B08 A;  2DCL A;  4OIX A;  3IWL A;  4CH1 A;  1EP4 B;  2EVZ A;  2P5V A;  2MKY A;  2KFN A;  3H59 A;  3M8W A;  7FD1 A;  5IWA F;  4L74 A;  2D3Z A;  3HVT A;  3M2U B;  1P1L A;  3NXZ A;  3TP2 A;  4UUX A;  1MNE A;  5THW A;  5G0R A;  1S1U A;  2VQE F;  3TA2 A;  5DM6 Q;  3CDE A;  3OHB A;  2CPZ A;  5GAG U;  1T9W A;  4CQ1 A;  3OVB A;  3B5Q A;  1XMB A;  4ZVP B;  2BQR A;  2FTR A;  2H54 B;  1PYT A;  4I2Q A;  3BDP A;  3UDL A;  3US5 A;  1EB0 A;  1RI7 A;  2NXE A;  4KYZ A;  1Q7L B;  1F0X A;  1XWL A;  4PPD A;  4C11 A;  3HM9 A;  1B7F A;  3IR5 B;  5D0G A;  4J9R A;  4OZ3 A;  2CJ9 A;  2P9C A;  3EE3 A;  3AQP A;  4ZCI A;  2ZZN A;  3IXQ A;  4DX7 A;  2WHO A;  4WP9 A;  5C24 A;  4HT5 A;  4K7Q A;  3B82 A;  5MLC V;  2LEC A;  1QSL A;  2E9R X;  4MK8 A;  2C2Z B;  3KXD A;  3AA8 A; 
#chains in the Genus database with same CATH homology
 2GSN A;  1KH4 A;  1ZEF A;  1AUK A;  4UOP A;  1KHK A;  2GA3 A;  5EGE A;  3WAV A;  1ALJ A;  2W8S A;  4UOO A;  3M8Y A;  3WAY A;  1ANJ A;  3T00 A;  2IUC A;  5LQQ A;  4MHX A;  1ED8 A;  4KAY A;  3NVL A;  4LR9 A;  4FDI A;  4UOR A;  5EGH A;  2W5V A;  5DLW A;  4LRB A;  4NWJ A;  2W5S A;  3NKQ A;  3A52 A;  4CYS A;  3IDD A;  4N7T A;  1SHQ A;  1EQJ A;  2XRG A;  3UN5 A;  3MK1 A;  1HQA A;  2W5X A;  5AJ9 A;  1KH5 A;  2GSU A;  3IGZ B;  4YR1 A;  1ELZ A;  1HDH A;  4KAV A;  5GOV A;  1URB A;  2W5R A;  3UO0 A;  4GTX A;  4NWX A;  1K7H A;  1KH9 A;  1EW2 A;  4LR2 A;  1P49 A;  5GRR A;  3M7V A;  5DLT A;  3BDG B;  1AJD A;  1EJJ A;  4LRA A;  2IUC B;  3MK2 A;  1EI6 A;  1ALI A;  3WBH A;  5IJS A;  2D1G A;  3M8Z A;  4ZG7 A;  1E2S P;  4CXS A;  1KHN A;  1KH7 A;  2GLQ A;  3KD8 A;  3UNY A;  5INH A;  5IJQ A;  1EW9 A;  2XR9 A;  1ZED A;  1FSU A;  2RH6 A;  2X98 A;  3IGY B;  5K4P A;  4ZG9 A;  2W5W A;  3SZZ A;  1HJK A;  2W5Q A;  4MY4 A;  1SHN A;  1ALH A;  3LXQ A;  1Y7A A;  1ALK A;  1O98 A;  3E2D A;  3OT9 A;  1EW8 A;  3BDH A;  1N2L A;  4LQY A;  1B8J A;  3DYC A;  2G9Y A;  3MK0 A;  3NKO A;  5LRN A;  4UPK A;  2VQR A;  3WAX A;  3NKP A;  1ZEB A;  4UPI A;  1ELX A;  4B56 A;  4UPH A;  3TX0 A;  1AJB A;  3NKR A;  3Q3Q A;  1E3C P;  1E1Z P;  4GTW A;  3NKN A;  5L0E A;  2IFY A;  5L0B A;  4KM4 A;  1URA A;  4LRE A;  2GSO A;  1O99 A;  4GTZ A;  4MIV A;  3WAW A;  4TN0 A;  4ZG6 A;  5HRT A;  5LIA A;  4LRF A;  1ANI A;  3BDF A;  2ANH A;  3M8W A;  4CYR A;  4CXK A;  1E33 P;  1AJA A;  3ED4 A;  3T02 A;  2ZKT A;  4ZGA A;  5C66 A;  4LR8 A;  4KJD A;  3DPC A;  4FDJ A;  4QAX A;  5KXA A;  5TJ3 A;  1Y6V A;  4LR7 A;  3BDG A;  3UN3 A;  1KHL A;  3B5Q A;  3SZY A;  1ELY A;  5LRM A;  1ED9 A;  1N2K A;  2W8D A;  3TG0 A;  3UN2 A;  4KJG A;  4CXU A;  2W5T A;  3CMR A;  1KHJ A;  4UPL A;  1AJC A;  4LRC A;  5DLV A;  2QZU A;  4LRD A;  5L0K A;  4GTY A;  3TWZ A;  3T01 A;  3NKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...