4LRFA

Phosphopentomutase s154g variant soaked with ribose 5-phosphate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 137
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrfA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrfA01
4ZG9A 3WAYA 4ZG7A 3M8YA 5L0KA 2ZKTA 1URBA 2IUCB 2XR9A 4LR9A 3SZYA 5EGHA 4CXKA 3TX0A 4MIVA 1E2SP 2W8DA 5IJQA 3NKRA 1SHQA 5C66A 1ALHA 1N2LA 2VQRA 4LR7A 3UN5A 1KHKA 4LR8A 1FSUA 5GRRA 4GTYA 3UO0A 1KHNA 3NKNA 1E3CP 2RH6A 3LXQA 5DLWA 4LRFA 2W5QA 4LQYA 3T01A 1SHNA 4TN0A 3T00A 2W5XA 5HRTA 3NKPA 3BDGA 5IJSA 2X98A 5K4PA 1P49A 4MHXA 4ZG6A 5LRNA 5INHA 3SZZA 1O99A 1ANIA 4UOPA 3WAVA 3NVLA 1KHJA 1Y7AA 1Y6VA 2W5TA 4LRAA 4NWXA 3UN2A 1ED8A 3Q3QA 1K7HA 3IGYB 3NKOA 4GTZA 4N7TA 3WAXA 4YR1A 5LQQA 1AJDA 2W5WA 1AJBA 3BDHA 5TJ3A 1ANJA 1AJAA 4QAXA 4UPLA 3NKQA 2G9YA 4KJGA 4LRBA 1ELZA 4ZGAA 1EQJA 4CXSA 1EW8A 2GSUA 1KH7A 3B5QA 4NWJA 4UORA 3T02A 3WBHA 1B8JA 3BDGB 3M8ZA 5LRMA 5KXAA 4UPIA 1ELXA 2QZUA 5EGEA 2W8SA 3M8WA 4KM4A 5DLVA 1EW9A 2GSOA 3TG0A 1E1ZP 3WAWA 3BDFA 4CYRA 4CYSA 1HQAA 3IGZB 2GLQA 1ZEFA 1HJKA 4MY4A 4GTXA 5DLTA 3UN3A 5AJ9A 5L0BA 1O98A 2D1GA 5GOVA 1E33P 3IDDA 2GA3A 3MK2A 3DPCA 4LR2A 3NKMA 1URAA 4UOOA 3OT9A 5LIAA 1EJJA 4GTWA 4UPKA 3M7VA 1AUKA 1EI6A 1KH9A 1ZEBA 4FDJA 3MK1A 1AJCA 1N2KA 4KAYA 4B56A 3A52A 4KAVA 2GSNA 4UPHA 1HDHA 3DYCA 3ED4A 2ANHA 3KD8A 1EW2A 3E2DA 2W5SA 4KJDA 1ELYA 1KH5A 1KH4A 1ALJA 3MK0A 4LRDA 1ED9A 1KHLA 2IFYA 1ALIA 4FDIA 1ZEDA 3TWZA 3UNYA 3CMRA 2W5RA 2W5VA 4LRCA 4CXUA 4LREA 2XRGA 1ALKA 5L0EA 2IUCA
chains in the Genus database with same CATH superfamily
1Y5NB 4DEZA 2XR9A 3ZZZA 1E2SP 1NDPA 5KFCA 2VFSA 3RYLA 1FKAF 1KHKA 3AOBA 4DR3F 3MAHA 2J7KA 2MZJA 1QJHA 4LSNB 3TOQA 1IBMJ 2NYIA 5B0BA 2Q43A 1YRXA 2IJRA 1H7WA 1X31C 2IRYA 5INHA 3DLBA 4ZP9A 1NAQA 2JJ4D 2W5TA 4NWXA 3KTQA 2J0WA 3EM1A 3CB4A 2ZBPA 1S1WB 1R8AA 4I1TA 4NYPA 3DLEA 2AJQA 4DU8A 3W8PA 2GCFA 1CS4B 4KV8A 1PG5B 4RUCA 1HNVB 2FHKA 2FLLA 4MY4A 4OYOA 2QV6A 3MM7B 1VQLS 3ZZUA 2BR0A 4F02A 4FXVA 3PX0A 2AU0A 5I4MA 2R7WA 2XSFA 4N8OA 3DI6B 3KUEA 1DQAA 1VGYA 3M6XA 4I6WA 1I5OB 2XGQA 4ZOSA 1FNXH 2F5GA 3SQGB 2R9LA 2M52A 3HFZB 1X0FA 2IUCB 3FDSA 1DLOB 3QZ8A 3D6FB 4I6AA 3Q8PB 1VDHA 2C3MA 3ZC4A 3CGIA 1HBUA 1Q4RA 4IH6A 2KKHA 3M2RB 2IIHA 3DOMA 3JSMA 3QT5A 2CUYA 2LA6A 3A13A 3FCHA 3JS9A 4DR1J 4Q8EA 1MNEA 2RDIA 2W5WA 1PIEA 3BDHA 2J76E 4MK9A 2WHOA 2ZFHA 1RAJA 3CJKB 4ZLNA 3QO9B 4X4PA 1U1RA 3PW7A 2CA9A 4DWIA 3I4PA 5D15A 4ZPWR 2XGPA 4DR2J 4K5SA 2FJBB 1TL1B 1SH0A 4OZ0A 3QGHA 2ZH9A 2IC3B 1DQ8A 2BZ2A 2C2KB 2RNEA 3PJXA 1FE4A 1SC1B 2CJ9A 1FX2A 2QA4S 4Y00A 2CJXB 2Z30B 1FFSB 4P75A 4YY3J 1U1KA 2HNZA 1S72S 4OZNA 4PRFA 3KHGA 2DGUA 2YXLA 2MPUA 4I2PB 2ZH6A 4WK3A 4CLSA 1I94F 3QPIA 2V94A 1RAGB 1FK9B 4AFFA 4F4KA 5IFMA 4WFYA 4B9SA 3IGVA 5FLXY 1AB8A 4N7TA 3UE2A 2V5HG 1DTTA 4LF5F 1F9EB 2EI5A 2HHHF 2BKNA 3EVWA 1JLEB 1FKOA 1BQXA 4C0HA 3BF4A 1NJZA 2MGZA 5KOWA 3K8WA 4C11A 3C19A 1S6PB 3H5UA 3S7RA 5KT3A 2WVFA 4C48A 3T19A 2RAQA 2MQ8A 4LR2A 2M5YA 2W4PA 2WK4A 2HVZA 1M0SA 4ETZA 1WG1A 2ZM6F 4P9SA 1EI6A 2AHOB 2JVRA 4F3OA 1CBKA 1KWMA 3TA1A 2X3GA 2HG4A 3WBZA 4QWAA 3F0NA 4RNOA 4ZMMA 1PYSB 4K4ZA 5T14A 3MR6A 1MW7A 1RBOB 3SZYA 5HP1B 1BQNB 1IR2A 3KLFB 2KYXA 1RA7A 4HLBA 2HHSA 3JYTA 3LXQA 2EBGA 1D0EA 4KT0C 3CD7A 3G4SS 1SHNA 2F8HA 4WKYA 1R3NA 3LTOA 3PYFA 1UVIA 4I69A 2FJEB 1LK5A 1UVKA 4DX5A 3H90A 2A6OA 2DXFA 1BGXT 1YLXA 1IJEB 4YDXA 3LO3A 2JLEA 3PNIA 3AH6A 4BDPA 2BJ9A 5T7LB 4IUFA 3QATA 3BDGB 4PZVA 3IS9A 2HNYB 2ABYA 2OTJS 2AJFE 4H4MA 4KM4A 1TKXA 2YNIB 1RHMB 5A8RB 2YWHA 4WKRA 2RQKA 2IA6A 2MLZA 3GP9A 3RBZA 1N54B 1RTHA 2DNRA 2ZH3A 2ZZMA 3PFOA 1LFPA 2W5VA 3CTRA 2W2OP 4DZ6A 4U67Q 1NH7A 1TUWA 2XI2A 1GFWB 3MECA 4MT1A 2FUG9 2GHVC 2V2QA 3ETOA 1SHQA 2OPSA 3F73A 3ONQA 1CULA 3AXMA 4Q5VA 3N28A 4OJ1A 4DZDA 4ZG6A 3ZTRA 5GADU 3K7RA 4DPTA 5HO4A 4EZ9A 3KLGA 1FJGF 1TKTA 4HL9A 2MQPA 1JLFB 4CO3A 3W64A 5DM7Q 4NCGB 5LRMA 5KXAA 4AD6A 4UPIA 4F4XA 4DSKA 4M63A 2CPYA 3KDNA 4LFBJ 3T1AA 1NBEB 2JH3A 3CJ3A 4FBUA 2C1EB 1D9DA 2L08A 1ZS6A 4JI6F 1C1BB 2ZITA 4CYUA 2M70A 4OJ3A 2HSEB 1HHQA 4UZCA 3A52A 1DQ9A 4J9VA 4B3TJ 2FQQB 1IKWB 1S1TB 3ELHA 2NQPA 1RT1A 4B9TA 3NGKA 3OLAA 2CPIA 5K9FA 1KC8T 1RWMB 3IBWA 2X1AA 3KWMA 3IWNC 2R8GA 1BXNA 2CKWA 1WNEA 3RR7A 2V6AA 4DV0F 4CLLA 1M1GA 4QR1A 4Y0FA 4ZPTR 2W5QA 4F67A 1RLDA 2RT3A 4ZJQA 4ZK7M 4KPCA 3LP2B 3DU6A 1RTDB 1P49A 4JUZA 2I6WA 5DDOC 4QWDA 1NSKL 3MEKA 1SJFA 4DR7J 4A8OA 5KG6A 2Q1LA 1S9EA 4ID5B 4TY9A 4QZVB 3LH2S 1YDLA 2F65A 2OEMA 4CM2A 2BQUA 3DLHA 5L1IA 5FLXU 2BMBA 3RAMA 5G0RA 5AJ9A 5GOVA 2XLKA 1AZSA 1ZZFA 3KLHA 1NDCA 3KLIA 4USTA 3BN4A 4ZKAA 1R8HA 4ED1A 1N8RT 2FJDB 1T0TV 4FDIA 4FN5A 1ZEDA 3CCZA 1XBWA 3P6YC 4PG7A 3VQSA 1Q7LB 4F8RA 5KFSA 3D2WA 4ZPDA 2FHJA 1R27B 2DTJA 4LRFA 4U6PA 3NS6A 5ETRA 3SMZA 1HHSA 3IR5B 4NX9A 1HYSA 3CNQP 1FD2A 3DRSA 3UDCA 2KJWA 5HVFA 3ET6A 5JJBA 1HW8A 1VMBA 4RO0A 2RIJA 1WF1A 2WB1D 3RGIA 3LANA 3AOCA 3SDEB 4TLQA 3KJVB 2D3ZA 5HLFA 1KN6A 3IGZB 4K7QA 4JI4J 3BQ0A 2I1RA 3W1YC 3PG9A 2POKA 5J2PA 4CIOA 4PG6A 4ZCMA 1VQPS 4MKAA 2KM8B 4KV8B 4IH5A 4AL6A 4OYAA 3GCXP 3WC2A 5F8IA 4XO0A 3M05A 1VHIA 3RB3A 2N4DA 1FWLA 3G82A 3THVA 3TUZC 3W2VA 3AHPA 1FSUA 3S8SA 2AX1A 4K50A 3D66A 2Z2LA 3GFYA 4IR1A 1TAQA 1T94A 3RUBL 3R8YA 1LXJA 3SCIE 2RD5C 2IMWP 3R9LA 3I6PA 4HH1A 5I3UB 1XMBA 5L39A 1H3DA 1SJQA 1T03A 5D6GA 2KRRA 3EGNA 4DHVA 2MQMA 5IXUA 4KR0B 3NAIA 3DOMB 4OZ3A 2WRMA 3LGMA 5CYMB 4I6YA 2Q6BA 3H40A 4CYRA 3LPEA 1QTNB 1TKDA 2N4CA 1BD6A 4HEA9 2BJ3A 1S9GA 3DPCA 2HMIB 2W9AA 3MMBB 2UUCF 4N41A 2FJVA 4J9QA 4JI1F 3ZTSA 4IOBA 1FEHA 3JAMY 2MXYA 4DV3F 4DN0A 2V50A 5C24A 3DLKA 4J7CA 2R8HA 2LA4A 2WB4A 3O8WA 1S76D 3G6YA 2HFZA 3DMJA 3M2VA 2VOPA 1ZM4A 2B43A 4R8UB 2MQLA 3MAQA 1KTQA 4EYHB 4XTTA 3T1YF 4AQYF 2OPQA 4LUBA 4DXLA 2I5JA 2CIMA 2VQEJ 2HGLA 5AJ3F 2M8DB 1X5TA 2L48A 3PFEA 5DDRC 3A3OB 4BWJA 1IR1A 1U1LA 3Q8VA 1HW9A 1ZAWA 3IM8A 2EFOA 1UFLA 2CPJA 1N4LA 5SZTA 2RU3A 1FX4A 1REVB 4WE1B 3T3FA 2VBZA 5BJRA 1VC5A 5CXTA 1HBOB 2L9WA 2EFNA 1DTTB 3POTA 4RUBA 4OZ2A 2Z2MA 3MPWA 4C8ZA 1I51B 3QIPB 2HWTA 3BM7A 1WI8A 3CCTA 2GSNA 3DYCA 2OPRA 2RF2A 1PO6A 1U0HA 4JI2J 2UUWA 4OHWA 2XRGA 4DV4J 1URBA 3P4UB 5HVGA 5C2GA 4PCQA 3PYEA 5THWA 5ADZA 1CQNA 2Y3YA 3R3TA 5LSOA 2CQ2A 2CFXA 1ZH5A 5LMUF 3A1YG 3CJ4A 4Q2LA 4A48A 3ULHA 1N52B 2LXFA 5IQQA 1ANIA 2VQFJ 2DB1A 3EICA 1EQ0A 3L9ZA 3CCWA 4LSZB 5D0RA 4A47A 2PC6A 5KG0A 1CJTA 2YKNB 2JL9A 2XMJA 3ILJA 1RT3B 2M2BA 1VBYA 4DPWA 1BQMB 2RHQB 2FC8A 2J6TA 5KAKA 4LFAJ 2C2OB 4URGA 4O0NA 3MAAA 3WAWA 3O3LA 4KY3A 4LF2A 4R5PB 1WEXA 4USUA 3IN5A 1F5BA 2CJBA 4ZVHA 5B0FA 3M8QB 1Q78A 4WFBQ 1BWEA 4P52A 2BACA 1H2VZ 4A8SA 3KJNB 3MM6A 3D6HB 3FKBA 3J7AN 2RVJA 4C97A 1MWZA 4ZDNA 3V4IB 1F2GA 2NREA 2ILZA 2WAQD 2J8SA 5IQ6A 1H73A 4RW7A 1HNZJ 4QYZK 2VBXA 1HHTP 3KK2B 2YWKA 1YVFA 4HTIA 2MLYA 2UU9F 2WSEC 1WOOA 2YNHA 1ZAVA 1XERA 4HACB 3GIKA 4ES1A 3W5XA 2W1BA 4O3OA 2JNJA 1MN7A 4CP5A 4EK2A 1QVGR 4ECYA 3PR5B 4PYAA 2AP6A 3OL9A 1FXRA 3JXOA 4DU7A 1B7FA 3EWGA 3FZ2A 4DQIA 5KFLA 1ZPWX 4ZVFA 4WF9Q 3WBHA 3O1LA 2XCPA 1Q8KA 3VAIA 2DY1A 3J7Z5 2FZCB 3I9V9 5CHCB 3GV8B 1JNZB 4DQQA 4X65F 1D3WA 3I87A 3IDDA 1WORA 4NLDA 2XI3A 3V6JA 1T02A 2H1YA 3PHEA 3BGRB 2IAJB 4DPOA 1RWKB 4A8MP 4U8YA 1NK5A 3AD8C 5IT0A 3QWUA 4IR9A 4Q45A 2HKEA 2QMWA 5EGHA 1EETB 2MY8A 4CYUB 1UVJA 3TJ9A 1MN9A 2OSRA 3PZPA 2PI4A 3JAMU 5K8OA 4DLEA 5B0CA 3M30B 3ENQA 3DOKA 1JLCA 4ECSA 1UCNA 3UN2A 3FFIA 3RAQA 1RTZA 2A1BA 1L3UA 1WC1A 1Q16B 1WUUA 1SJ3P 3D68A 5DDQC 4ED7A 2OELA 1V3SA 2BJEA 3T02A 2E29A 2DPIA 5C42A 3R7SB 4ZVGA 2JC0A 4GRSA 4H4OB 2D7SA 2NXCA 2CG4A 3TA2A 2LXUA 1KLMA 3KLEB 4DV1F 2FZGB 2DXDA 3WIVA 4LFCF 4N56A 2JOQA 2HRTA 4WFNQ 4UOFA 1LWEA 4KRWA 4LBPA 3Q89A 2IJFA 2EFVA 3OUYA 1XK8A 1T3OA 5HBMA 1BLUA 3HHLB 3M1VA 4O3PA 1B0TA 1AZSB 5EHHA 3KLHB 4PQUB 2CQ0A 3TX8A 4QIGA 2BRKA 5A2QY 5KFMA 1E3CP 1S6OA 4OX7A 1U8WA 1U1OA 4WBFA 2ZOMA 1ELOA 1O99A 4PUOA 3CEDA 4DL3A 2B6AB 1C4AA 2IM2A 3IFEA 2OP5A 3NXZA 5DLFA 4OHZA 3TVKA 1U6FA 5K8PA 4HVZA 1KRPA 2IHR1 2O5DA 4CTAA 3THTA 3OJSA 3DGPB 2G9YA 2VZ9A 2YY3A 1VK8A 2V8DA 4ZITA 1G4CA 2HQCA 3THPA 1OO0B 4HHJA 2FHOB 3M8PB 4P2XA 4KIAA 1HR0J 4MTPA 3ILIA 3UFCX 1CEZA 4CRJA 2LVWA 2SXLA 1MSWD 1LXNA 2LEBA 4HT5A 1QAIA 2ZH5A 1RHKB 4RX6A 3DKDA 1FKPB 5J1EB 3SCJE 1AROP 1HKAA 3BYRA 5D4PA 3QJJA 2DYAA 3K17A 1HMVA 1RI7A 1WG4A 1EAYC 1VBZA 4B9NA 2WONB 3SZ2A 4E8UA 2W8DA 5E0OA 4EMDA 2H48B 1B64A 1PBAA 3NNCA 5LT5A 3NCPA 3VZHA 5ETOA 4FYYB 4CO0A 4KGZB 4UOGA 1NHVA 5D77A 4M5GA 3NL0A 3FVYA 4ZVUB 3OTOJ 1D1UA 4Q2MA 1XMQJ 3EVMA 1NM2A 2FHMA 4QPXA 5KFHA 3W2VB 6AT1B 2B8QA 4HHHA 5IM0B 2GAHC 4JV0A 3HT0A 3NKQA 5JXSA 4KJGA 4YB7A 4L6V3 2W8LA 3TRGA 1SQEA 4L74A 2RQ4A 4KB7A 1AA1B 1B0PA 1ZBTA 1TV6B 3LPYA 2GMJA 2EKYA 1VRUA 4BC7A 3L3CA 3CMQA 3V81A 2GA7A 1BMQB 2KL8A 4QIVA 4G3IA 3E2EA 4L73A 3QAEA 3DNCA 2C2DA 2AYGA 3AB4B 2AZ1A 5LMNJ 7FDRA 4RKUC 1GK8A 1RT2A 4DPUA 5KT7A 4DQRA 1UEKA 5A8KA 2MZQA 3HJFA 3N4WA 3CJTA 4ED5A 1EW2A 4OYIA 1RAEB 3BH7B 1DTQA 4I0WA 2YNFB 2HBRB 2XY7A 4ES2A 3T6JA 2AEJA 4CLWA 1QY7A 1E6YA 2AYEA 1KHNA 3C6UA 2JFKA 2GFFA 4PXEA 4TVAB 2GIRA 1S6QA 4CWBA 3NKPA 2GJFA 1WD6A 1KD1T 3DLKB 4ZVQB 2KU7A 4KTQA 4J9OA 2VBYA 3SIPB 3M2VB 3HZGA 1HARA 1T11A 1ROFA 4FF1A 3K57A 2R8KA 1HLWA 3C6TA 3GIIA 1ELZA 1P6TA 2C3YA 4CH0S 5F8LA 3W5YA 2I5JB 2DGXA 3QAUA 5AE2A 2RH3A 3GSDA 2LEAA 1YTYA 2KYZA 4NL5A 2GLQA 4UY8T 4DUYJ 1H0HB 2MZSA 1YZ6A 5ETSA 2LQ8A 2NCKL 1ZA1B 4TU7A 1S1XA 3AB2B 4M5DA 4G1PA 3BSCA 4GTWA 4BS2A 3C66A 2EWHA 2DR7A 4DR1F 4PPDA 5L1LA 4ED3A 4EBEA 3HT3A 1HPZA 5GAEI 4FS2A 1HI8A 4LT6A 4X4RA 2BE2A 1VHFA 1VISA 1DARA 2HIQA 1Q86T 4PXBA 2BA9A 3DDIA 1REGX 1VRQC 3IBCB 2RF2B 3QLHA 1B0VA 4DR2F 3R7BB 3NEKA 1LV5A 3TAMB 2G9OA 3KK1A 4FZVA 5GMDA 3QIDA 1JLAA 1NDKA 1Q53A 3MEDA 1QTMA 5I42A 3MM9A 3RRHA 1UAWA 2VICA 4U7UK 5A2QU 1OPIA 3DLGA 2KDOA 4XIUA 1SBRA 2DGSA 2XMAA 4QYZJ 4YY3F 3DGVA 3I82A 4B08A 5EX0A 2GC8A 5CZXA 3W61A 4LF5J 5DLVA 1RADB 2HVDA 3W2WA 4X64J 1U1NA 1UWBA 2ALYB 2WVEA 2XSJA 2Q66A 1EP4B 2D9OA 2QTWA 1S77D 2DNNA 2JDJA 2BANA 2QIFA 3KD8A 3GR1A 3A3PB 2E5IA 2HHVA 4M95A 4PAAA 5DRKA 5HK4A 2ZM6J 3SSQA 4C4WA 4OLPA 1PCAA 3L7UA 3RB6A 2A3JA 2NR0A 4ZA1A 2VQRA 3MM8B 4LR7A 5KFEA 2CJAA 1FEEA 1SUQA 5A0YA 1SPBP 1G2EA 2XMTA 3GZ7A 3MM6B 2DH8A 3GIJA 4DFKA 1FRHA 4DL2A 3MEGB 1C2PA 4FNIA 1VFJA 4CH1A 1SKUB 4OI6A 2XS7A 3H42A 4RW7B 3QYYA 4RUHA 3D1OA 1N5QA 4OYXA 4TQRA 2XS5A 3NMRA 4J91A 1KLNA 4RNMA 2N7CA 4GO5X 5D0EA 3N6LA 3MDFA 3MM5B 1FI4A 1TL3B 3SFGA 1D9FA 1VK3A 2ADBA 4O44B 4QAXA 2VFRA 5ITHA 4CNYA 3N6MA 5A8WB 2QG9B 2GIQA 1SL1A 2Q3PA 3H0PA 3X1LB 4IFYB 1YRUA 3GR0A 1H74A 2VH7A 2QGFB 2MJUA 3Q8RB 1XR6A 4ZCKA 5KG5A 3MUTP 4OL8A 2HAFA 5E3QA 3CDAA 4PXDA 3ZTOA 2LQJA 2XMVA 2VJUA 2DGTA 1RB0A 1LFWA 2W7PA 1TKZB 1S49A 2ZJPQ 4AUKA 1ANJA 1M5SA 3IRXB 2OEJA 2X3DA 2GW8A 1Q95G 2JEJA 1FRIA 1CJUA 5EN1A 2VV5A 2DNYA 1H2UX 1Q79A 2LFVA 1DJ0A 1L3VA 5EGYA 1P27B 5GMEA 3FQLA 5KT4A 1KOOA 2HVIA 5CD4H 2FGOA 1N5YA 2Y9HA 1FO1A 1FNOA 4P2FA 5IV3A 2VJVA 1RTIA 3A8EA 3SSRA 4FYXB 1X4EA 2N82B 3PACA 2BYCA 1D8YA 2E66A 2RRNA 4DF8A 3K5NA 5ETKA 1FDDA 5L9XA 2XZDB 3OR2A 5ETQA 1ALHA 2XC9A 5J1NA 4JP8A 5DQIA 2V4RA 1FE0A 3IG1A 4LFBF 2QYGA 2W7AA 3HP6A 2VB6A 5LOQA 5K4PA 2ZC3A 2NXJA 3ZZPA 4LF7F 2IRXA 2YWWA 4DV0J 1ED8A 3OXGA 1R0AA 3UD3P 4PPZA 2GO9A 2U2FA 1N33F 3PXGa 1H38A 2V68A 1S4EA 3M8ZA 3QWPA 3GFZA 1NSQA 2YH0A 1RGVA 2Y1RI 3ZZRA 1FA0A 2EXUA 1X9MA 1FRLA 3OXFA 3EVOA 3HHEA 1NH8A 1NU4A 1U48A 4CTAB 2GA3A 3FZBA 2I2YA 1U1MA 1B99A 3C15B 3M4XA 1AUKA 3V6HA 4FDJA 3R5DA 3W8GA 2LYVA 1D8ZA 4MK7A 2PFFB 4FYVB 3P8BB 4P2MA 3GV7B 4JI7J 1KFSA 4DR7F 1TL5A 1NK7A 4C6AA 4N47A 3MPYA 1SC4B 1FDNA 2V4JA 2ZD1A 2V34A 3KK3B 2FPHX 4FF3A 5CCLA 1A0OB 1HMVB 1FRKA 1JXEA 3RRGA 4DG1A 1B4SA 3WDOA 2CQ3A 1C1CA 4LVOP 1IKYB 2AJ4A 2IM0A 2X1GA 2Y8WA 2V8VA 3ZTPA 2HNDA 2M8HA 2RUSA 4TN2A 2K1RA 4CT8A 4WK1A 3EYZA 3I32A 3CJQA 1GT8A 5CAAA 2YNGA 2AW0A 3Q22A 1V6HA 1HA1A 4DV7J 4FYWB 2HWHA 1O6XA 2ZBCA 2E9ZA 2H51B 2XULA 2X51A 1YKWA 5MAOA 3KHRA 3QFHA 4E2FB 4RNHA 3GE9A 3Q83A 5KFRA 2KT5A 3DCAA 4IQXA 5J2NA 3BJYA 1FFWB 4ZG9A 3BZQA 2HRUA 1B3TA 1FCAA 2G0CA 1BUXA 1TVRB 4CXKA 3D1QA 2XS2A 1U6BA 2BW7A 4LR8A 5DLWA 3LOUA 3EUNA 1NUEA 2KHDA 1JLGB 5HRTA 3B54A 1O8BA 2DXEA 1TR0A 2DNPA 2R2SA 5DGAA 5KFDA 3E01A 3VQTA 4QWCA 1DURA 4ZHRB 1UP1A 4V19J 2E1MC 3GG1A 3GONA 1EW8A 4IDKB 3CO0P 2MZ1A 3B5QA 2B7CB 3CVKA 3ADAC 5H9FK 1KKHA 2O67A 3UQSA 3ILLA 3RAXA 1FJ7A 2DHAA 1TK5A 1RWXB 2Z2ZA 2BABA 3H20A 2RHSB 1EJJA 5LXYA 3MMAA 2WOMA 4RW4A 1W25A 4YB5A 5HQLA 1CJKA 4KYZA 1C4CA 4ZIVA 3M32B 4ZCIA 3K59A 3SYZA 1WSRA 1X4HA 1OSDA 1R8CA 4HKQA 1K9MT 3T5HA 4NEYA 2DHSA 3KYLA 3BYPA 5BXIA 5KFVA 4J9RA 4M5DB 1N5SA 1KHWA 4LF1A 1MLAA 2KZMA 3H5XA 5DQHA 4Y2AA 2FHJD 2AF6A 4NYZA 4IRKA 2B4UA 2X1BA 4F4WA 2G0IA 5KT6A 2V67A 5K5MA 3HVAA 2KRBA 3T1YJ 3TP2A 2E5HA 1AJDA 1RWVB 5KFZA 4DV6J 1IXKA 1S99A 3M2UA 3W62A 3MPUB 3BQ2A 2QSWA 5I3PA 4C3LA 3DOLB 2IPOB 1RT5B 2OUGA 1T7PA 1S1VB 1E1ZP 2YPYA 3G6ES 1N0VC 3PYGA 2WW4A 2W9CA 2R7RA 2RQCA 4G1QB 3MMCB 4WIQA 1ZAXA 2RDDA 5B09A 5DO2A 3CSKA 3SV3A 1JJ2R 3MK1A 2PFDA 3D6MB 2MJNA 2CPXA 1C0TB 1IQZA 3WHIA 2FVQA 1VQYA 4H4KA 4CM0A 2AZ3A 2VHGA 1KHLA 3ITHB 2PIIA 4QQBA 2NSCA 2G1HA 4O3SA 1OY9A 3VAFA 3MF5A 4DPXA 2W4CA 1KDNA 4ED2A 1RBAA 1E6VB 1HL6A 2PSZA 2BANB 4ZVRB 3NKNA 3TZXA 2ASJA 4OHYA 4EWTA 1FWPA 1HNIA 1UFWA 1F6TA 1J27A 2HK2A 1GXTA 2FTRA 1S7IA 3HCXA 1F1BB 4K4WA 3ILOA 1SI9A 3R2CJ 4QU6A 3I5CA 4OJGA 2RRAA 1X4GA 3NG8A 3GJRB 5KFAA 4DDFA 4J9LA 2QEXS 4CLFA 1XNQJ 2ACYA 2OPPA 3R6GB 4JI2F 1WKJA 4UORA 3DHXA 3U7JA 4DV4F 3CT9A 2IMOA 3D5MA 5CYQA 5KFTA 2B5JA 1OIAA 2GSOA 1R8PA 3GB0A 2KB2A 2XWYA 1HBMB 1UJ6A 2E1AA 1KQKA 5U47A 4OX9J 1NMEB 4GVLA 2VQFF 1QSYA 2HBYB 1ED9A 1O0PA 4ICLB 3TQEA 1WTFA 1NK6A 2DGOA 5F8MA 2GIFA 1NZAA 1ZPVA 4MIVA 3EDRB 3OVSA 4NLSA 2OFHX 2ATCB 1IN0A 2FVRA 4GTYA 4LFAF 2HFVA 1UVMA 2ZHAA 3QT8A 2AJ2A 1RT6B 3MCSA 1W7WA 3GSIA 1RWPB 3ZNJ1 2RKIA 5FD1A 2J7UA 4KH1B 1WACA 1NK9A 1EIYB 3FBCA 4HI2A 4ZGAA 3CD5A 2UUAJ 1WOSA 2NXNA 5KFXA 1MWYA 2ASLA 5IOLA 2OMLA 1TL4A 4YEAA 2BXJA 1HNZF 3PY8A 5IC4B 1TFYA 1NJIT 2AEMA 3UDVA 2EFPA 4A8XA 3FMWA 3U1NA 6FD1A 1UETA 3ZTQA 1A6LA 2P6TA 3HSGA 4Q0BA 2LLZA 1NO8A 2MKKA 1JMTA 1TL7A 3MTJA 2VA3A 2OFGX 4FS1A 2J9CA 3BPDA 1RAIB 2QT7A 3CCJS 2DHXA 4Q7AA 2UXCJ 2MKJA 4OX6A 4LR9A 1YRTA 2WTFA 4MKYA 1DRZA 3HFKA 3UCUP 4X4NA 5CZVA 4LF8F 2IA0A 3V6DB 1APSA 3BV8A 2HQFA 3C16B 4BC9A 2C3UA 3D0HE 3KLVA 4DJBA 3EZUA 4CLPA 3RU0A 4WU2A 3G2XA 1LW2A 2CPHA 2XNQA 2ZOGA 1VIOA 2X1FA 1FF2A 3OR2B 4IH7A 2HHTA 2DRAA 2VC1A 4JB8B 5J2MA 1RISA 1U24A 4DX8H 3D4JA 3PIPQ 1FTRA 4KKOA 1QUPA 4NPOA 4LSLA 4AYBD 4B3OB 3C14B 2IM3A 2AJ0A 3CD0A 3OFGA 4K4YA 1UZDA 1Y3KA 4OYMA 1N6QA 2YKAA 3HJVA 3KJFB 4NRTA 2C2MB 4WP9A 3DYAA 3FBEA 2HHXA 4JOUA 1AJCA 3NNAA 4ID8A 2P8IA 1LWFA 2PGCA 2Y1LB 2N3OA 2B3TB 2R7UA 1QAYA 4LRCA 1PBUA 1CVJA 3J81Y 4IFVA 4NMLA 2WBRA 1N34J 2MB0B 3QBCA 4F50A 2YKQA 2OD6A 4TY8A 1IM4A 5AXNA 4DL5A 2DD8S 5LJ5Y 4YMEA 4FBTA 1S1UA 2R7QA 4NOHA 1NPKA 3J81j 2FD2A 1W2BR 5B08A 1XR5A 3QGGA 1NKCA 1YJ9S 2QC3A 1P1TA 3G71S 1S0NA 3RRKA 2ROEA 1IM6A 4X4VA 1SB6A 2OO4A 2HBZB 2H4WB 3WX4A 5DG8A 3AXKA 1HQUA 3TAQA 1HJKA 1T8EA 1X60A 4WTOB 3FCVA 3UDLA 1V3ZA 2HURA 5HATA 3D67A 1IKVA 2E1PA 1UEUA 2UV8A 4G65A 4DL7A 2C42A 2IBOA 4B9UA 3K5LA 1C0UB 3CCSS 1LWCA 2VA2A 2VOOA 1MMNA 3VAMA 2RILA 3CW2C 3LAMA 5H9FJ 4XPEA 2FJAB 3R7NB 2DRBA 2DO0A 3EZ5A 2G4BA 4NXNJ 4QIFA 2GZOA 4O23A 2GVZA 1HR0F 2F63A 5IC6B 5J2NB 4EFAC 2XNRA 5HI7A 1JLQB 5FIIA 2HFOA 4NCAA 2NPFA 4A8FA 1Y5LB 1KQGB 2V8PA 2R7XA 4FPIA 4GTZA 1HD1A 4KJIA 3HSZA 2P9CA 1IQTA 3RB0A 2XBPA 2GJIA 2DNOA 1R0CB 3U1MA 4J9KA 2DIVA 1GXUA 3FMBA 1EX8A 3E01B 2CQGA 3DRRA 5D3GB 1R43A 1RTJB 4K4XA 3P45B 2ZUAA 1XC9A 1IKXB 2DR5A 2KM8C 3PDNA 5E3RA 4NYOA 3RW7A 3QGIA 1CC8A 1JLBB 3OJUA 3OTOF 4ECTA 2FLPA 2W5SA 1XMQF 5EWFA 4YOEA 3IWLA 3OTBA 4LRDA 1J5EJ 1I3OB 4TLRA 3QSYB 4QW8A 2ACMA 5A76A 4CZCA 4ZVSB 2KN4A 4C3KA 1U2FA 5IJQA 3I56S 1RP5A 4ZVPB 3UI3A 2FGCA 3MMAB 3DU5A 2WOMB 4RW4B 4Y2IA 3DLJA 2VG7A 2R3VA 2NYHA 2OEKA 2UUBF 4DR4J 5LMNF 4DF4A 4XK8C 3IMQJ 3VAJA 4LRAA 1AJBA 2RQMA 1ZTTA 4WFZA 1L3KA 4C8NA 4C8LA 2PEBA 1J5OA 4B3RJ 2V2VA 4FF4A 1TUVA 4WZMA 2GGPA 2YWEA 2HYIB 4MH8A 3PKMA 5D4LA 3O44A 1CC7A 4HHUA 2D74B 3QGPA 4DSEA 4CT9A 3HKZD 3EDQB 4USJC 2DBBA 4KAYA 4KAVA 4I4BA 3KG0A 2J0SD 2VG6B 2E1RA 2PE8A 3NBPB 4IG0A 3CMAS 4MIBA 1PSDA 4J9SA 1EJ7L 5C66A 3DHWC 1WHYA 3TAPA 1QE1A 3JSBA 3Q23A 2RS2A 1L5UA 1ZA2B 1QUVA 2DIUA 1WTBA 5CQGA 1HQEA 3MUMP 1OY6A 4DUYF 3OW2R 2G0JA 1HQ2A 3HVTB 1QSSA 2FIUA 3LP0B 1JKHA 1NKBA 1SV5B 3LGHA 2UUTA 1UJ4A 1U2CA 4DV2J 2QFIA 3NAHA 2B8PA 2AYBA 3MHYA 3FSYA 4ZPVR 2YKMA 1OQ6A 1SH3A 1RHUB 3TANA 2NZCA 4RJVA 2A10A 2Y1IA 4R0JA 3TUIC 2CPZA 3K5MA 1K1QA 2CJYB 4ECUA 1XMOJ 2R7OA 5HANA 1AXQA 4JI3J 2ZZTA 2VD3A 3CO9A 2XO7A 2LU2A 2QSFA 4Z7YA 3UVJA 1XIQA 4PQAA 1ALJA 3CMRA 3TVZA 3BBFA 4I7FA 3CMES 3U1LA 3SBMA 4ZIWA 3EZOA 2BDPA 2YVSA 2UXBF 4LF4J 3H4BA 3U27A 4C0OC 4MFBA 3MI7X 1LOUA 3LP1A 4CLTA 4HR2A 4DCPB 3G6XA 5LM7E 3LUYA 3MR2A 1N48A 4X64F 1PKUA 1NHKL 3Q8SB 5LRNA 4OZ5A 2AIRB 1IJFB 4JI5J 2HK3A 1TAUA 2KTQA 4DFJA 4TYBA 5ETLA 3T6BA 4RW6B 3R5BA 5AT1B 3HPOA 4KO0A 4UZBA 2OIHA 1SL2A 1TMJA 1UA1A 3OVAA 1OYDA 1QM9A 2F8MA 3GU0A 1GX6A 1TZ0A 2K7KA 1RT7B 4NMXA 1ZEBA 3OTEA 2QLJB 3D3BJ 3P3DA 4ZPAA 2LQ9A 3E2DA 1RQ0A 2W9BA 3GYXB 2IFYA 4USWA 1GMWD 1UL3A 2W2MP 4IKAA 4ZG7A 3RZAA 3BN7A 3GJQB 4RBUA 3S1TA 4WYWA 3MFHA 1XQIA 1VJWA 3MR5A 3MEEA 4F36A 3Q2TC 2CJKA 3SZZA 3OQ2A 4OZJA 2CNOB 3NVLA 2AMCB 5L9NA 5J2QB 3OL7A 3DM2B 3Q8YA 5KG1A 4UUXA 2F4VJ 4QJVA 3OPKA 1M1KT 1NEEA 3RBXA 1K0VA 4X4OA 2Y0SD 1Z2ZA 2YQ3A 1OMSA 2XLJA 1NB2A 1VQ6S 2ZJQQ 1MROB 4B3MJ 5IT4A 4TXSA 5K14A 2IDEA 3DFEA 4EO8A 3H8YA 2HWIA 1M5OC 4OFZA 4GO7X 5KFUA 3VAGA 3OR1A 3CCVS 3UWTA 4QIEA 3FK4A 2IRUA 2GJ2A 4CO1A 3NGUA 5EWEA 3M8YA 1N6QB 4OI0A 2ZUGA 2CWXA 3DC2A 4X66J 3QJLA 1KQFB 1HBNB 4LSNA 1HI1A 1S9FA 5HROA 4DSJA 2YQ1A 2FVCA 1JXLA 1HNWJ 1VQ8S 3B82A 4DMZA 2KFNA 1WHXA 4IFVB 2ZH1A 1KSPA 1T9UA 2QRRA 3C8YA 2Y0BB 3TO8A 3BGLA 4K59A 4O4GA 1S1WA 2JZ5A 5E3PA 1GQEA 5TJ3A 2K06A 4LF7J 2Z8QA 1H2TZ 3H2VE 3KXDA 2VBWA 4IQMA 4LF9J 4U8VA 1YIJS 2ASDA 1CS4A 2MKYA 2DNKA 1HNVA 2QN6B 1N33J 4ECZA 3IAM9 2W7OA 4F25A 4PWDB 4QR0A 4J9NA 1Y11A 2A2CA 5H1SV 1RT4B 3RW6A 3DI6A 5HN0A 4F2RA 2ZE2B 4G1IA 2MTLA 1F3FA 4ZP8A 1HQUB 2HHUA 3SQGA 2N3LA 3QT7A 2CQ1A 2IUCA 2MMYA 1DLOA 3W7BA 2QA1A 2OH2A 2FJWA 4F2SA 1IKVB 1N2LA 5BYRA 1SVDA 2V9WA 3ZZYA 3D1HA 3M2RA 2OD4A 1PAEX 4C8MA 2DR9A 5KT2A 4CLZA 4JI0J 3V6KA 5C25B 3FSXA 3MXHP 1LWCB 2R42A 2JX2A 5IZHA 3EE3A 1FVSA 2CZ9A 2VPWB 2K8GA 3G8QA 3CJKA 4QOTA 3T9NA 3QO9A 2GVZB 2JSXA 2ZZNA 4JI7F 3NKYA 1S97A 5HQ8A 3VWSA 1DBDA 5F0WA 3R1LA 4KPYA 2ZVSA 1JK9B 2VG5B 3TA0A 2E7VA 3CC2S 2B4PA 1MU2B 1NK4A 1ZEFA 2HFUA 3TJAA 2IC3A 1VQNS 1CPZA 4JI8F 4ERDA 4EO6A 1N36J 4B56A 4PR6A 1GTEA 3NRBA 3H59A 3T5LA 1YSJA 4KJDA 3DRRB 1VQMS 3F41A 2ZC4A 4KGVB 2XLIA 1AT1B 2CJQA 4I2PA 2K2PA 4IYQA 5CYJA 2GMHA 4NXMJ 2E7XA 4U9RA 2BW2A 4AXIA 3KHLA 3OL8A 4AE5A 4DSFA 3JQMA 1FK9A 4DV7F 4ITSA 1MG7A 2DR8A 2F1FA 1G7CB 3KNGA 1G6BA 4CO2A 4WP3A 3IC1A 6FDRA 4LRBA 3K89A 1ZOTA 2R8IA 1JLEA 4PWUA 2R7TA 5D4OA 7FD1A 2BE9B 3DLEB 4ZPBA 1EKRA 1G1XA 2R4FA 1YITS 4QPTA 5D8HB 1Y7PA 4DI6A 4NLPA 1NPPA 3K8VA 2LEPA 1P8GA 2VODA 2HS4A 1VQOS 2C3PA 2QMUB 2E5LJ 3A4TA 1KH9A 2HLUA 3EGZA 3JQJA 4NLGA 1N5VA 5F3ZA 3TWZA 1QVFR 1HIYA 1JB0C 5HP1A 1BQNA 2CWKA 3KLFA 1HWLA 3BQ1A 5GVQA 3BSOA 3VVUA 3D54A 4OI4A 2E1CA 1LWXA 1HBUB 2FC9A 1FDBA 1VQ7S 5GAGU 4RNNA 3IBFB 1R7IA 1WC3A 5D4NA 4I64A 4TU9A 3JSMB 1BY9A 3W66A 3NS5A 1VQSA 4EBDA 2BRLA 2ZWOA 4UOCA 2ZDPA 4ECWA 2LU1A 4XDCA 3H2UB 3K2YA 5ETVA 2YPZA 1TU0B 3LQVA 4KGMA 3PR4A 5T7LA 3PJ9A 4Y2CA 1HNXF 1Q1KA 1XJWB 2HNYA 1WC4A 3G86A 1WC6A 1D09B 4LVNP 2YNIA 4FYDA 3MR7A 5A8RA 2D1GA 1JKHB 1Q8BA 3CJ2A 4BBYA 3CJ0A 5ETTA 3EJMA 4O4RA 4P72A 3JQKA 3DXBA 5KT5A 2H65B 1FT8A 1UEVA 3GJSB 5IT9Y 1JQGA 4CXUA 2CNLB 3BR9A 4NZ0A 2MQNA 4DV6F 2VU5A 2HNZB 1RABB 1YHQS 5DGBA 3VTIA 3H98A 3QT6A 1PYTA 2OTLS 4OZLA 4UOHA 5LJ3Y 2HQDA 1QD1A 1WF2A 4OYBA 3F56A 2KHCA 5J1PA 1KVIA 3D6TB 2GS8A 3LF0A 3P96A 1NPRA 1Y5IB 1VIXA 2J5AA 2NSBA 1GMVA 4P6QA 3EXCX 1YJRA 1MMDA 2DGWA 5IS2A 2M7SA 5C7PA 4V19X 3GG0A 4B9LA 4P74A 3VGTA 1JLFA 3CF5Q 1UFKA 3G96A 2IY5B 1J2VA 2DY9A 1FD8A 4RW9A 1FKOB 1UPPA 2W8SA 2MGZB 3AODA 4C11B 3G9CA 4ZLLA 3TYTA 4ED0A 4MKBA 1ZZNA 1C1BA 1V5IB 1RYRA 2V8HA 1R6VA 4AXJA 3FCWA 2ALZA 1TUGB 1TELA 4CLKA 1T95A 1IKWA 1S1TA 3ENWA 1NNDA 4QBUA 1KHVA 4UW2A 2NUHA 4Y2KA 1S10A 3NOCA 5DZ6A 4IOCQ 4FNHA 2PMWA 4MKVA 4DUZJ 1XNQF 5MLCV 4Q43A 4ETXA 2P6SA 2F9DA 2DNMA 4OX8A 2MKHA 3JYTB 4TKTA 2W9BB 3NS7B 4TN0A 3LP2A 1RTDA 1YK9A 4RR5A 3HO1A 2FYXA 4B17A 2DCUB 2DO4A 4PG8A 4EYIB 4D3HA 2VONA 3WZ0A 1TFWA 4ID5A 4OX9F 3ZNUA 2KXNB 1AUDA 1SJ4P 3NOGA 1RKIA 4R0EA 2KO1A 5JUMA 3PRBA 2W4DA 3IS9B 1YWXA 4I56A 2LQBA 3NGDA 3R97A 2UVUA 3AT1B 4H4MB 2NS1B 1TKXB 3PW5A 4ZLJA 2Z0GA 1NJWA 3NKMA 1NJXA 2RE1A 2HHWA 1ZETA 4M5LA 4P73A 5KFWA 1UPMB 3WQPA 1RTHB 2LP4A 1WHVA 1AUSL 1S59A 3G8SA 1X4DA 2IJNA 5IWAJ 1H6KX 3KFWX 5L0EA 4Y6IA 1FRXA 2B4VA 2FJXA 4J9PA 2UUAF 3MECB 5KFFA 2PDAA 2E44A 2GMLA 4DBQA 2OPSB 4WYLA 3PV8A 4Y3CA 3M6WA 3VVTA 2GQCA 1CULB 4IO1A 3CC4S 2JLGA 2V9KA 4LF8J 3KMSA 2ERRA 1SC6A 2ASYA 2CDQA 1T9VA 4F4ZA 1YJ7A 3KLGB 1NXIA 1TKTB 5LQQA 2B56A 1I1GA 5HROB 3E8OA 3SQOP 2KFZA 1DFDA 4ELTA 1KVJA 3UCGA 3QNWB 2AV5A 2BEFA 2DT9A 2HFSA 3W9JA 4KSEB 2UXCF 3SDEA 4XDDA 4GKKF 2I9SA 4H4KC 3KJVA 4DQPA 2YWGA 4AT1B 5EGEA 3BB5A 4FXWA 2ZNZA 1GAOA 3T5JA 1H72C 1JXVA 4O4GB 2LKZA 5B0EA 4PKDB 3OBIA 4QCLA 4D3GA 2CQ4A 4FF2A 3LALA 3CULA 3ED4A 5EDWA 2OKQA 2HHPA 1RT1B 1ALKA 3KG1A 3F44A 1RCXB 4ZJLA 3CDWA 2VDIA 2HZVA 4K0KJ 2O1PA 1VS3A 5IT9U 3AAWB 1Q82T 3CXCR 4EBCA 5I3UA 2NXEA 1GEHA 2GO8A 3D7SB 2HZAA 1N32J 3V4MA 4P10A 1F9HA 2W25A 1U7LA 1WF0A 4DLGA 4URSA 1S9EB 1TTHB 2CQHA 2FLNA 4I2QA 3OFFA 3IP0A 5LSRA 5CYMA 3MCMA 5CA5A 1VQ4S 2JC1A 1WI6A 2NXUA 3CPWR 2N7YA 1T9TA 2XHCA 1N34F 4DR6J 2J8AA 4C8OA 4LF6F 1L3SA 2DHHA 2QX0A 1RCOB 1WSVA 4NCBA 4K4TA 2GHWA 2HMIA 5G0RB 1FXDA 3MMBA 4FKXA 3LWLA 4RW8A 3JTPA 5ETNA 3KLIB 2QJ3A 2AD9A 3PHTA 4KFBA 1K1SA 2XCAA 1K44A 4YS2A 4KGXB 1X5SA 1M5HA 3PO5A 4USMA 5C5JA 1P1LA 4R8UA 2ZDOA 1Q5VA 3CCMS 4QW9A 4ALZA 4NA1A 3MD3A 1VC0A 3M8SA 1TQLA 3CCLS 1X9SA 4OIXA 3HXMA 4A8QA 2C2NA 1HYSB 3DRSB 4Z37A 1GH8A 1RZMA 2I0XA 1V5VA 1EQJA 1RWUA 3ET6B 4CDIA 3HK2A 1REVA 2G13A 2KFYA 3HD2A 2EC2A 2DNHA 4WE1A 1IWGA 3VV2B 1HBOA 3P49B 1OY8A 5HLFB 4NXNF 3CIZA 3LA0A 2ZWPA 1IBLF 5J2PB 1M5PC 1SJ1A 1FERA 2O66A 2D3UA 2JWNA 3QIPA 4CNZA 4RNFA 2KVQE 3MD1A 3E3XA 1YJTA 2KZZA 3I55S 1YJUA 4ECVA 3CDEA 2BQRA 4WWSA 3G82B 4XAKA 2DH9A 2ZHBA 2B9WA 5E33A 3GIMA 1RDRA 1SC3B 4L72B 1VRTA 4B3SJ 4MHXA 1V3RA 2WSCC 1WKLA 5KFQA 2GHPA 3VF0B 1LNQA 2QZ8A 3HHNB 2YKNA 2UUBJ 1RT3A 1T03B 2V0NA 3W9IA 2WVCA 2R7SA 1F5CA 1BQMA 2BOAA 1J5EF 2GAGC 5KG7A 2IDLA 2ZBIA 3BREA 2HFNA 4R5PA 3AJDA 2QL7B 4ZN1A 3AD7C 3AQOA 2EK6A 3R27A 3AOAA 1LEOA 3M8QA 3N0VA 1S9GB 1SQGA 3EPGA 2EK1A 4YR3A 4DR4F 4UPHA 2CXEA 3TR5A 4ANCA 2DISA 2EPIA 2RDJA 3EXYA 2W5RA 3V4IA 3SFUA 5C24B 1AFIA 4DL0C 1Z2LA 1PGZA 2EFGA 3KK2A 3AA8A 3DMJB 5LXRA 3RTVA 3T9ZA 3MURP 3UN5A 2X7IA 4CLYA 5EWGA 4FPRA 4B3RF 4HACA 4UT4A 8RUCA 1EZZB 2OPQB 1KS2A 2DNQA 4KE5A 5KTQA 2HIYA 3N5BA 1YGYA 2D9PA 4J9UE 2H54B 3MMJA 3TNVA 3D9BA 4YHHJ 2HBQB 4Y65A 2CZVC 5JVGQ 3M9OB 2KXHA 2DGQA 4HT7A 5M2UA 4ZP6A 3OHAA 3PX6A 1VR6A 3A3NB 1GMWA 2XY5A 2ZH7A 2J6UA 1V9OA 4GTXA 3IXQA 2QYCA 4WP8A 3GMGA 3POTB 5DZ7A 2DK2A 3PIOQ 4PABA 2QL5B 4K2XA 4RW9B 4KHPJ 3M7VA 1NB7A 1QAJA 3BGRA 2IAJA 1HDHA 3OXLA 2CDRB 2QA2A 2OPRB 2W01A 2DNZA 1U0HB 2W2NP 3D0GE 4F0KA 3R5GA 1EETA 1VQ9S 1H7XA 1M5KC 4DV2F 4M94A 2OAUA 3T1HF 3HULA 4NRUA 2IVYA 4QYRA 3M9MB 1AYEA 2NZ4A 5HSPA 3M30A 3B78A 2UXBJ 2PN6A 3OFEA 1PILA 1Y00A 2PMHA 1ULRA 3M9NB 3H5SA 1XMOF 3TW0A 2C2ZB 4JI3F 2E9TA 2WSFC 3UPFA 4W98A 1CJTB 3MGJA 3R2DJ 2JEIA 2P9GA 3KUHA 3I0SA 3IGNA 1WC0A 2KG1A 4KQZA 2VF3A 4H4OA 1SKWA 3TI0A 1RA6A 2MSTA 3MAAB 3SSSA 4LF4F 1RXOB 1O98A 4GMKA 3KLEA 3P5BP 4UOOA 3A12A 3HHDA 4ECRA 1KP6A 1RU2A 4H54A 4JI5F 4DSLA 5DDPC 3I31A 4HYKA 5SUHA 3A8KA 2ZBQA 2CZ4A 1LQ9A 3HHLA 3RBEA 2D3OR 1JWWA 4DV5J 2WVDA 2HPUA 3KJQB 4PQUA 1OSCA 4MAKA 2B9YA 3HSDA 4HTJA 1FXLA 4W90B 3NMAA 2AT1B 2IFXA 4A46A 1Q8LA 3MUVP 2K7JA 2YNHB 2ZNYA 2LECA 4QU7A 2QA4G 1WWHA 4USHA 1R89A 3TZWA 2HGMA 2B6AA 1FWKA 2HGNA 3DGPA 2HZCA 3ENAA 2VPYB 1VC6A 2J9EA 3J7ZT 4RWXA 5BR8J 3M8PA 4P71A 2GNKA 2W2QP 3HDSA 4NEZA 4ENOA 4OZ1A 1X7VA 2L41A 2F7VA 2HAIA 2QLXA 4UUWA 1JX4A 4ZVEA 3GV5B 2CG8A 4X2BA 1CSJA 1Y4ZB 1FKPA 5J1EA 1RAFB 1XNRF 4UPKA 4AL5A 3L09A 3JSRA 2RB7A 1VOMA 4NASA 1T3NA 1URRA 4ECXA 4FP9A 3GILA 5BYSA 3MK0A 2CVIA 4XPCA 1IVZA 2ZH2A 2WONA 4NZ6A 2F4VF 2AYMA 1X9WA 3BSAA 3H7HB 2H9ZA 4DSIA 2IM1A 3MCNA 5L1JA 4M5NA 2XYHB 1X4BA 5HQMA 2LDIA 2HHQA 3PTWA 1XN9A 3UW1A 4B3MF 2MHNA 3VALA 4DFPA 3T5KA 4DCOB 3NKOA 3DOKB 1JLCB 5IM0A 2RS8A 3FFIB 2YKPA 1AJAA 1YG0A 3N01A 2CQIA 1F3VA 2NPIA 4OJHA 4NWJA 2QFJA 4P2SA 3BEGB 4GKJF 1TV6A 4BHQA 5C42B 1Y10A 1PJ6A 2G2YA 3EGWB 4X66F 4PG5A 2FY8A 1RBLA 4X62J 1EKSA 4WFAQ 3K5OA 4MIWA 1OQ3A 2FY1A 1KLMB 5CABA 1HNWF 1M1HA 4A8KA 3L95X 4I2QB 1Y9OA 3SEOA 4OQJA 1N2KA 4EGLA 2ROPA 1LWEB 4DR5J 1CLFA 3OFHA 4EZ6A 4JV1A 1SIWB 1FDAA 2YNFA 4UOPA 4C3MA 3WAYA 3OUYB 3L7OA 4BWMA 5HBMB 4JV2A 2EBEA 3M1VB 4RW8B 3KUGA 1WHWA 4LF9F 1FRMA 4L76A 4ZPCA 2KT2A 1X4AA 4KFBB 2B51A 2D3O1 3IR6B 3HKWA 3ISND 3L7PA 1Z4UA 3CE8A 4ECQA 1RAHB 4UQTA 2O3DA 4PUOB 3HZEA 2PT0A 5F8GA 4LQ9A 1IR0A 3OTCA 1K73T 3EPIA 3BPSP 3S01A 4UPLA 1KOHA 4ELUA 2EEYA 2C3OA 4USIA 3RR8A 1D9AA 4M5HA 3I5AA 4DFMA 3CCES 2I38A 3Q24A 2NUUG 2BM0A 2MKIA 2P5VA 4DL6A 1R8BA 4KHRA 2R2TA 1UA0A 1UJ5A 4JV5F 4DOZA 1URAA 3OT9A 4UY85 4JI0F 5CH7B 2VC0A 1JJ4A 5LL6d 2PO4A 2ILYA 3BDEA 2CQDA 3ISNC 1KH4A 5GAHI 4JYAJ 2PA3A 5CD4A 2XMUA 4K4VA 4JI8J 4N8NA 5HMXA 4A8WA 3BKUA 2HEKA 3J7A1 5L8RC 1RK8A 1U8SA 3TUPA 1BHNA 1ZM3A 3NLCA 3MZIA 4JBCA 3K58A 2RRBA 2RU9A 2GX8A 5DETA 3TAMA 3R1HA 3M6VA 1Q5YA 4NE9C 1T9WA 4LIRA 1QDUB 5HMZA 1N36F 4CI0B 2XO6A 1YBTA 1CQMA 1U4BA 4TQSA 2HLTA 2HS0A 1F0XA 1VRTB 2XMMA 2RSQA 4HH0A 2DNLA 3VGVA 3D28A 3HFVA 1HQAA 1VRUB 1T9XA 4NXMF 3V81B 5L0BA 2V69A 1UZHA 1E33P 1EP4A 2HVEA 1AFJA 4O3RA 4NLUA 3QQCD 2PMZD 1RT2B 3NNHA 4E0DA 1X4CA 5A8KB 4WFXA 2K3KA 3OSPA 1LKZA 1HWKA 3OSNA 4LREA 1ACMB 1DTQB 1HI0P 2W2PP 1S57A 3R6LB 1RKJA 3MM8A 3FEZA 3JB9k 2COLA 1I6JA 5AXMA 2E9RX 2BUNA 2V4QA 1E6YB 3MWBA 1U26A 3LWMA 2IBKA 3C6UB 1WG5A 3SCLE 3CJSA 3MEGA 1S6QB 2XYPB 4RL1A 4TYAA 2E5LF 3VAKA 2A2DA 3C6TB 5F0UA 2RMLA 1ELXA 4ILMA 3NCQA 4EI2A 2CPFA 3TG0A 1S48A 4GC6A 1HNXJ 2UXDJ 2M88A 1MMLA 4U7CA 2E5JA 3MM5A 3B4MA 2OJ3A 5L1KA 1S1XB 1TL3A 1WOPA 2KXFA 1KQSR 2YWFA 4N76A 1IBCB 5I3QA 3H5YA 3FRYA 4KAIA 4P7VA 1JJCB 4ANDA 4O44A 4OI1A 4YFUA 2J6SA 2CQCA 1HPZB 5A8WA 2BJDA 2BE2B 3SCKE 2CAJA 1FJEB 4IFYA 1O51A 4ZN3A 4C9DA 2ATLA 4J90A 2VFUA 3G6VA 3OTDA 4KH0B 4YUDA 3QLHB 2MY7A 4PEOA 3FC9A 3KK1B 4A8YA 3ETMA 4HDGA 1JLAB 5E41A 2M3DA 2HVHA 5KG4A 1S0VA 1TKZA 3MEDB 5I42B 3MM9B 2G1DA 3IRXA 2P2CB 4NLYA 1QAXA 3OHBA 1AW0A 3BGUA 1X5PA 3MCOA 3DLGB 1KH7A 3TZYA 2J9DA 3MFIA 4KHMA 4LQ3A 5D0GA 1UW4A 4MYTA 2R8JA 1H98A 2DCLA 2EKNA 3W2WB 4K2JA 9ATCB 3BSNA 2J0XA 1UWBB 2JHEA 2GV1A 2XSJB 4X4QA 1X8DA 2H5IB 2UVRA 1M5VC 4MK8A 3I0SB 1IBKJ 1BE4A 3UR0A 1WELA 2Z2YB 5FJ4A 3NCRA 2AGOA 3L4BC 3S6EA 3TEGA 3BBCA 2HW3A 3HSJA 3FJ2A 5FDLA 3PEJA 2YQ0A 1G3OA 4MMOA 4YR0A 1S0MA 3PM9A 3GFXA 1HWJA 4M5MA 3UO0A 4Y2MA 1N88A 4EUVA 1SUQB 1QLNA 5A0YB 4OV1A 2FB0A 2GVDA 2XZTB 4DUTA 2DKOB 2M0GB 3MOZA 1Y6VA 2J7WA 4QIWD 1HFEL 1UWAA 3W9HA 3O5TB 4LBHA 4N77A 3UDEA 2C2RA 5L46A 3C2PA 2R2RA 2XZWA 2DH7A 4PYDA 3IAS9 5E5NA 1EW9A 1XEZA 4DUZF 3BDFA 1GNKA 1EHWA 4L75A 1S0OA 4YDDB 2CQPA 1JIHA 2B0GA 3C15A 3KOAA 5HAOA 2RJZA 2Y1JA 2UZAA 4ZJOA 1K8AT 2OSQA 2LXIA 2YX1A 2HQGA 5L0KA 3CCUS 5K8NA 2QLFB 3NKRA 1S7HA 3KK3A 5GRRA 5B0GA 2DVIA 4NLRA 3GJTB 1CJVA 2RUGA 3T00A 5KFIA 2BM1A 3EGVA 7AT1B 2PI5A 3PYDA 3Q86A 2VASA 8ATCB 1IKYA 3A8IA 5RUBA 3GWCA 4Q44A 4F26A 1P9YA 2OHDA 3BR8A 3QZ7A 3J7YI 3Q0AA 4ZS6A 4J37A 3ZZ0A 5IWAF 4DR3J 3W63A 4L3KA 1CJUB 3W3SA 2CRLA 1KFDA 1OS5A 4CYSA 3V5RA 3BO4A 1KNZA 1N5YB 4GKKJ 2XY6A 1NRKA 3CIMA 2G2ZA 1U09A 4ZCLA 4WXOA 1RTIB 3SV4A 1RU1A 3PO4A 5M2RA 5HJXA 2IYGA 5KG3A 3FEYB 1IBMF 1TVRA 4YQWA 1LK7A 4WTYA 2AQ4A 2EC0A 4K8RA 1M90T 1CG2A 1JLGA 3IG1B 4NLOA 2DRDA 2U1AA 5DJBA 4EU0A 4NI2A 5DQGA 1UTAA 1YJWS 4ZHRA 3C3LA 1K7HA 2H4YB 4CLUA 3OVBA 4IRCA 4IDKA 2MQOA 1R0AB 1GTHA 1T05A 1U2RA 3M8WA 5GAHU 4ER8A 5DG9A 4V1Ak 2QMXA 4K0KF 2QO3A 2KVIA 3ICLA 1RHRB 4B9MA 3MR3A 3AD9C 4LF6J 1U1QA 2AGPA 1BC6A 2QLBB 3CCRS 2MSSA 5JVHQ 3M32A 1N32F 4DCJB 2DEJA 2YX7A 1S4FA 5K8MA 1PAUB 4NLTA 2B9XA 3A8JA 4DX6A 3R5JB 3CCQS 2UVWA 1VCTA 4C8KA 2V4JB 3H2LA 2ZD1B 2MZRA 3MOJB 4DR6F 1UW9A 3VGUA 3CDBA 2O01C 2F8EX 1ZTWA 2MZTA 1SKRA 4DG1B 2YX4A 3VCDA 1NCLA 3BGFA 1C1CB 3IGYB 3GIRA 1RWNB 2HNDB 2K1RB 2KH9A 5E2QA 1FNMA 3HM9A 3HVRA 3AJ2A 3Q8UA 3DOLA 4WU3A 1RT5A 1S1VA 5DG7A 1VBXA 2Q79A 2YNGB 2IVFB 3UD5A 3M8RA 1I94J 2MKSA 9RUBA 4G1QA 3MMCA 3JTOA 1YI2S 3O6QA 4F3MA 1U25A 4PXCA 1PJ7A 2AGQA 5H9EK 1C0TA 1P9QC 2VL1A 2HHHJ 2C22A 4F3QA 1IBLJ 5HVHA 3ITHA 4DQSA 2BOPA 3UR3C 5KFPA 1YJVA 3P5TL 1WC5A 3PRVA 1E6VA 2JRSA 4Y34A 3Q8QB 3BKTA 4RUAA 1RACB 4RZRA 3PJWA 3OLBA 4M5IA 4O0IA 2V2KA 4J5OA 4OV6A 1RWOB 1ZYQA 1DHMA 3I0RA 1OWXA 2VKRA 1Y7AA 4Z2XA 2ZJRQ 4N5SA 2DITA 4U7UD 2VFVA 5T41A 1U1PA 4EEYA 1RAOA 2EW9A 1HWUA 4KBIA 3AJ1A 3CJ8A 1VQKS 1NSAA 4KGKA 1Z1ZA 1U47A 5C2CA 1HBMA 4YP3A 4O3QA 1SL0A 3DRPA 4K5RA 1LW0A 2R2UA 5F3TA 2KI2A 4B3SF 1R0BG 4WCEQ 1KBRA 3E51A 1U02A 5KFBA 4ICLA 1NDLA 1CJKB 2CNNB 1RHQB 2XB2D 1YBUA 2YKOA 3BKFA 1JNRB 3PKYA 1RWWB 2UV8G 1VBKA 4B9VA 1RE1B 2W5XA 2AJ1A 2G2OA 2YH1A 2IYIA 1RT6A 3K0JA 4NLQA 4USKA 2C28A 3GYGA 3UD4P 1O5JA 4S0MA 5F8HA 2B4OA 3SXLA 3M2UB 3CUNA 3J80Y 1B8JA 3N5FA 3PW2A 3NWGA 2CPDA 4OMFG 3QMQA 2A6MA 3NY0A 3UN3A 2W9CB 1VJQA 4P7TA 3QJPA 5M2PA 1FJGJ 4URQU 2AWZA 2VIHA 4OI2A 1WEYA 4ZP7A 4YN3B 3GTYX 1ICEB 3J81U 3RG6A 2KG0A 2K3IA 3TX0A 4YHHF 1SH2A 3GFHA 2XG8A 3V6DA 4I68A 3C16A 2DNGA 1TMMA 3IA0A 4JI6J 4ED8A 3T01A 3MTKA 5GAGI 1HNIB 5JMNA 2LQ5A 4C7QA 3T1HJ 3PEHA 5FDLB 1VYAA 4K4UA 4KHPF 2MYFA 3OL6A 4CXSA 1HD0A 2GVDB 3B4DA 3G8TA 2OPPB 4OHVA 4B3OA 3C14A 5HMWA 2XM3A 4F7VA 5CYQB 2B5JB 3HHKA 4NA3A 1KR4A 1YJNS 4J9MA 2BKOA 3TZZA 4B3TF 1RUSA 5E7OB 4MIAA 4C0BA 2R7VA 4GVBA 2ZOFA 4DX7A 3M6UA 4C8YA 2D41A 4YB6A 1F9FA 3O2IA 4OLOA 2EG1A 1YBAA 4MYUA 2OLWA 2P9EA 3CJRA 4TU8A 3T41A 2BBEA 3ZFVA 4LMZA 1YZ7A 4U95A 2GQ2A 1NZ8A 1Y3JA 2QL9B 1Y0HA 3MPDA 3J7YU 3N6NA 2EG2A 2AX0A 3BO3A 2APOA 1PC4A 1A7GE 4U96A 1ZM2A 4X84A 1KHJA 4RU9A 4ZLPA 3I5BA 2RKIB 1Q0NA 2HQIA 5D0HA 3RBDA 4DS5A 1CJVB 1FESA 2QLWA 1IUJA 4DV5F 3PW4A 1EB0A 3FBFA 2ZEJA 4F4YA 2BJ8A 1NK8A 3TUJC 3NGSA 3BS9A 3FNNA 5E3AA 3ISZA 4KC5A 5E3CA 4DL4A 4WXWA 4FVMA 4Q0BB 2AKWB 3HI9A 5KFYA 1U49A 2BJ1A 1TL7B 3FUYA 1KH5A 4LIWA 1C0UA 1ALIA 5AE3A 1U45A 4DPYA 1XNRJ 4LBIA 2Y8YA 3HX9A 5BR8F 2BE7D 1NJYA 4M1KA 2M9KA 5F9LA 1JLQA 4OI3A 2CPEA 1SJRA 2MLXA 2L9DA 1DZ5A 1LW2B 2IVMA 4IG3A 2MQQA 1S12A 2OI2A 3ZZOA 3LAKA 3VZIA 3UCZP 5J2MB 2GQQA 1UMJA 1MWQA 4JI4F 2FVPA 2VDHA 2Q6CA 3DRYA 2JVOA 5DM6Q 3TARA 4NI2B 4KKOB 4X4SA 5D3GA 4LSLB 3W65A 4ED4A 1RTJA 3FEXB 2OGUA 4GKJJ 2ZH8A 1IKXA 1OPZA 1PC5A 4M8LA 1T05B 3J80U 4IOAQ 1JLBA 4NA2A 1SCJB 3DXSX 3DYAB 2DHGA 4M5JA 5HL7Q 5GAEU 4GC7A 1LWFB 2C2EA 1FFGB 3CC7S 2MEWA 2NLWA 3IRWP 1W26A 3PCOB 2ZKTA 3HHLD 3GYNA 2XMWA 2BQ3A 1X5OA 1XR7A 2DR6A 4RBVA 3AA9A 3HF5A 4IO9Q 3FQKA 1SQFA 2VPZB 2UUCJ 4TY8B 1WEZA 2LDYA 5EUHA 1OYEA 4JI1J 1PYOB 4HI1A 4TNOA 5ETMA 5H9EJ 4E98A 4X62F 1S1UB 3WAVA 3VR1A 4DV3J 3EMTA 3Q3QA 1QSLA 2EFQA 3WIUA 4WZQA 3FRZA 1B70B 3MM7A 1PJ5A 2F40A 5A6WA 2KJVA 4DR5F 1URNA 1IWAA 4I67A 2GSUA 2UP1A 1EARA 1K0TA 4ILRA 1T9YA 4QR2A 5F9NA 3CWJA 4AQYJ 3HHLC 3B6BA 4WPAA 1S6UA 2J0QD 4G6VB 3FGVA 4ZVOB 1B7YB 5AJ3J 3OD2A 2WZ1A 4BCAA 3IO1A 4F0MA 4B02A 2VG6A 4JV5J 2MDAA 2ZKUA 4FDFA 3NBPA 3N79A 3I96A 4UF4A 5A6PA 2LMIA 3HD1A 1FRJA 3AFGA 3JSYA 2Z57B 3ZXWA 4ED6A 2VQEF 2XYGB 2RH6A 1S79A 3H4DA 3LGNA 2X98A 5L38A 5G4DA 4NZ7A 2JLFA 3HVTA 1OJ4A 3R5CA 3LP0A 1TL1A 2XEXA 5F41A 1RYSA 1SV5A 2ZVIA 5AE1A 1N56A 3WC0A 1KTVA 1UKUA 2Z4PA 4JYAF 2QE5A 2XQCA 2BX6A 1K47A 2V8GA 3TJ8A 3BO2A 2JFDA 3I0RB 4L3NA 3B8HA 5GMKa 5KOXA 5LMUJ 2LCWA 1YQHA 3LW5C 1NSPA 2BKPA 3CJ5A 1R6YA 2ANHA 5EX3A 2XTJP 1KONA 3IWXA 3QSIA 2HRYA 2V63A 1BWVA 1SKSA 4X4UA 3KMQA 1VQ5S 2OMOA 4F0HA 3DRPB 1VLYA 1WKKA 1LW0B 3DDNA 3Q2SC 1NLKL 2L9NA 1WJ9A 2MHEA 4CO5A 1NK0A 2CNKB 3JTNA 3KG4A 4NLXA 3GLJA 3GPAA 1TK8A 2M4MA 4PG4A 2VG7B 2JEFA 4Q8FA 1RAAB 2F3JA 1U0SA 1Q81T 3HVWA 1N5TA 1S6PA 4K4SA 3MPVA 1RJJA 1GMUA 2D69A 5DS7A 4FVCA 2A0FB 4YB1P 2CQBA 3V2UC 2DPJA 4RW6A 2XMKA 1UVNA 3UNGC 3FSIA 3H25A 2PD1A 4NWBA 2UU9J 5F8JA 1HWIA 1J5OB 1KVKA 2BVZA 4Y28C 3DDKA 4DN9A 2GGPB 2XWXA 1WDDA 3BBBA 2E7WA 3QFWA 3KKFA 1RT7A 1X0PA 3I9ZA 4W92B 3FBBA 2VUGA 4CCHA 2UVVA 4UQGA 5AXLA 3K5PA 3DRXA 2ZH4A 4DS4A 4BLGA 1VLOA 3KNAA 3UNYA 4RPFA 5IV4A 1UVLA 3AY0A 4IG0B 5KFKA 4HDHA 3DLLQ 2VPXB 2FZKB 2F4FA 3QRPA 3W60A 2BV3A 1F60B 1QE1B 4RBTA 4X65J 4ATNA 4W4MA 1GXLA 4NLVA 2UXDF 3BDGA 1HQEB 2YBVA 1RLCL 4IRDA 5J2QA 5B0AA 5KFGA 4YR2A 3ZO7A 4CO4A 3DM2A 1EQMA 3I4HX 2W8KA 2DEIA 2PEHA 4OHXA 1DY3A 2HS3A 2ROGA 1SXLA 2VKZG 4Z7CA 3NP5A 3RB4A 5HJYA 4A4JA 2YKMB 2DJWA 3IR7B 2H5EA 4UTGA 1KEKA 4X4TA 5AXKA 4ZVTB 5DLTA 4RLEA 1MROA 3OV7A 3MK2A 1F5AA 2VFTA 3AQPA 1JJHA 5KFJA 3D0IE 5HMYA 1YX2A 1FTCA 4ES3A 2Z58B 1RHJB 3NWRA 1ELYA 2H5JB 2FLOA 3CD6S 3BGOP 3UVJB 2I8EA 2WCXA 2YTCA 3N9UC 5K20B 4QWEA 2CADA 4I7FB 2ADCA 4WIIA 1NKEA 1ZM9A 2Z56B 4GVBB 1HBNA 2ZBRA 2WW8A 2BJ7A 2L3MA 3HLUA 4DV1J 4MFBB 1VI7A 5B7WA 1SIZA 1TP7A 2CVEA 4O3NA 4ELVA 3LP1B 4LFCJ 4NCGA 3EX7B 3G87A 2F9JA 5B0DA 3NGRA 1FHTA 1NHUA 4WJBA 3TQ1A 1FJCA 3WAXA 1XTZA 1XWLA 4OYZA 3BDPA 4PWWA 1IBKF 2EVZA 1S5ZA 3VHQA 5D78A 2XHWA 4RWWA 3TVYA 3R5AA 4FXDA 3WX8A 2FDNA 3U02A 4RU2A 5F8NA 5GADI 4ILLA 4M5KA 5KFOA 4KO0B 3HMJG 3TEHB 3US5A 4QWBA 4F4AA 3GQCA 2A18A 4PWDA 2CYYA 2B9EA 2FVSA 4FKYA 5LSLA 1RT4A 5LIAA 2ZE2A 2D1CA 4AL7A 2DGVA 2HQ3A 8AT1B 3RJMB 4R25A 2B7BB 1FVQA 5DLGA 1RSCA 2W24A 2H3EB 5ETPA 5KFNA 1W2IA 3KDOA 2J9DE 2PA8D 1DAXA 3BH6B 4USVA 2ZHOA 3NGTA 3SI8A 3IM9A 4C2MA 5C25A 4LQYA 3VAHA 5IJSA 3KHHA 3MEEB 3D3CJ 4CQ1A 4C98A 3QRQA 2KT3A 2E5GA 1F2HA 4NLWA 5BYQA 4LJMA 5CCMA 4YR1A 1L3TA 4OYPA 4OYWA 2AEFA 3VGSA 3PRDA 4CH7A 3ENVA 1R31A 3PVXA 3C46A 1X4FA 4ANEA 1U6ZA 2VG5A 2QZUA 3PX4A 1ITPA 1MU2A 4IG3B 3CDUA 3X3UA 1Q7YT 3GCWP 1A9NB 2V2ZA 1Q8IA 3QRRA 2WVBA 3W5ZA 5K14B 4F04B 2JEGA 1N0UA 1GX5A 2WBMA 4MJKA 1WDTA 3ZZTA 3OR1B 5KG2A 3DN9A 1TK0A 2MKCA 3PW0A
chains in the Genus database with same CATH topology
4ZG9A 3WAYA 4ZG7A 3M8YA 5L0KA 2ZKTA 1URBA 2IUCB 2XR9A 4LR9A 3SZYA 5EGHA 4CXKA 3TX0A 4MIVA 1E2SP 2W8DA 5IJQA 3NKRA 1SHQA 5C66A 1ALHA 1N2LA 2VQRA 4LR7A 3UN5A 1KHKA 4LR8A 1FSUA 5GRRA 4GTYA 3UO0A 1KHNA 3NKNA 1E3CP 2RH6A 3LXQA 5DLWA 4LRFA 2W5QA 4LQYA 3T01A 1SHNA 4TN0A 3T00A 2W5XA 5HRTA 3NKPA 3BDGA 5IJSA 2X98A 5K4PA 1P49A 4MHXA 4ZG6A 5LRNA 5INHA 3SZZA 1O99A 1ANIA 4UOPA 3WAVA 3NVLA 1KHJA 1Y7AA 1Y6VA 2W5TA 4LRAA 4NWXA 3UN2A 1ED8A 3Q3QA 1K7HA 3IGYB 3NKOA 4GTZA 4N7TA 3WAXA 4YR1A 5LQQA 1AJDA 2W5WA 1AJBA 3BDHA 5TJ3A 1ANJA 1AJAA 4QAXA 4UPLA 3NKQA 2G9YA 4KJGA 4LRBA 1ELZA 4ZGAA 1EQJA 4CXSA 1EW8A 2GSUA 1KH7A 3B5QA 4NWJA 4UORA 3T02A 3WBHA 1B8JA 3BDGB 3M8ZA 5LRMA 5KXAA 4UPIA 1ELXA 2QZUA 5EGEA 2W8SA 3M8WA 4KM4A 5DLVA 1EW9A 2GSOA 3TG0A 1E1ZP 3WAWA 3BDFA 4CYRA 4CYSA 1HQAA 3IGZB 2GLQA 1ZEFA 1HJKA 4MY4A 4GTXA 5DLTA 3UN3A 5AJ9A 5L0BA 1O98A 2D1GA 5GOVA 1E33P 3IDDA 2GA3A 3MK2A 3DPCA 4LR2A 3NKMA 1URAA 4UOOA 3OT9A 5LIAA 1EJJA 4GTWA 4UPKA 3M7VA 1AUKA 1EI6A 1KH9A 1ZEBA 4FDJA 3MK1A 1AJCA 1N2KA 4KAYA 4B56A 3A52A 4KAVA 2GSNA 4UPHA 1HDHA 3DYCA 3ED4A 2ANHA 3KD8A 1EW2A 3E2DA 2W5SA 4KJDA 1ELYA 1KH5A 1KH4A 1ALJA 3MK0A 4LRDA 1ED9A 1KHLA 2IFYA 1ALIA 4FDIA 1ZEDA 3TWZA 3UNYA 3CMRA 2W5RA 2W5VA 4LRCA 4CXUA 4LREA 2XRGA 1ALKA 5L0EA 2IUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZG9 A;  3WAY A;  4ZG7 A;  3M8Y A;  5L0K A;  2ZKT A;  1URB A;  2IUC B;  2XR9 A;  4LR9 A;  3SZY A;  5EGH A;  4CXK A;  3TX0 A;  4MIV A;  1E2S P;  2W8D A;  5IJQ A;  3NKR A;  1SHQ A;  5C66 A;  1ALH A;  1N2L A;  2VQR A;  4LR7 A;  3UN5 A;  1KHK A;  4LR8 A;  1FSU A;  5GRR A;  4GTY A;  3UO0 A;  1KHN A;  3NKN A;  1E3C P;  2RH6 A;  3LXQ A;  5DLW A;  4LRF A;  2W5Q A;  4LQY A;  3T01 A;  1SHN A;  4TN0 A;  3T00 A;  2W5X A;  5HRT A;  3NKP A;  3BDG A;  5IJS A;  2X98 A;  5K4P A;  1P49 A;  4MHX A;  4ZG6 A;  5LRN A;  5INH A;  3SZZ A;  1O99 A;  1ANI A;  4UOP A;  3WAV A;  3NVL A;  1KHJ A;  1Y7A A;  1Y6V A;  2W5T A;  4LRA A;  4NWX A;  3UN2 A;  1ED8 A;  3Q3Q A;  1K7H A;  3IGY B;  3NKO A;  4GTZ A;  4N7T A;  3WAX A;  4YR1 A;  5LQQ A;  1AJD A;  2W5W A;  1AJB A;  3BDH A;  5TJ3 A;  1ANJ A;  1AJA A;  4QAX A;  4UPL A;  3NKQ A;  2G9Y A;  4KJG A;  4LRB A;  1ELZ A;  4ZGA A;  1EQJ A;  4CXS A;  1EW8 A;  2GSU A;  1KH7 A;  3B5Q A;  4NWJ A;  4UOR A;  3T02 A;  3WBH A;  1B8J A;  3BDG B;  3M8Z A;  5LRM A;  5KXA A;  4UPI A;  1ELX A;  2QZU A;  5EGE A;  2W8S A;  3M8W A;  4KM4 A;  5DLV A;  1EW9 A;  2GSO A;  3TG0 A;  1E1Z P;  3WAW A;  3BDF A;  4CYR A;  4CYS A;  1HQA A;  3IGZ B;  2GLQ A;  1ZEF A;  1HJK A;  4MY4 A;  4GTX A;  5DLT A;  3UN3 A;  5AJ9 A;  5L0B A;  1O98 A;  2D1G A;  5GOV A;  1E33 P;  3IDD A;  2GA3 A;  3MK2 A;  3DPC A;  4LR2 A;  3NKM A;  1URA A;  4UOO A;  3OT9 A;  5LIA A;  1EJJ A;  4GTW A;  4UPK A;  3M7V A;  1AUK A;  1EI6 A;  1KH9 A;  1ZEB A;  4FDJ A;  3MK1 A;  1AJC A;  1N2K A;  4KAY A;  4B56 A;  3A52 A;  4KAV A;  2GSN A;  4UPH A;  1HDH A;  3DYC A;  3ED4 A;  2ANH A;  3KD8 A;  1EW2 A;  3E2D A;  2W5S A;  4KJD A;  1ELY A;  1KH5 A;  1KH4 A;  1ALJ A;  3MK0 A;  4LRD A;  1ED9 A;  1KHL A;  2IFY A;  1ALI A;  4FDI A;  1ZED A;  3TWZ A;  3UNY A;  3CMR A;  2W5R A;  2W5V A;  4LRC A;  4CXU A;  4LRE A;  2XRG A;  1ALK A;  5L0E A;  2IUC A; 
#chains in the Genus database with same CATH topology
 1Y5N B;  4DEZ A;  2XR9 A;  3ZZZ A;  1E2S P;  1NDP A;  5KFC A;  2VFS A;  3RYL A;  1FKA F;  1KHK A;  3AOB A;  4DR3 F;  3MAH A;  2J7K A;  2MZJ A;  1QJH A;  4LSN B;  3TOQ A;  1IBM J;  2NYI A;  5B0B A;  2Q43 A;  1YRX A;  2IJR A;  1H7W A;  1X31 C;  2IRY A;  5INH A;  3DLB A;  4ZP9 A;  1NAQ A;  2JJ4 D;  2W5T A;  4NWX A;  3KTQ A;  2J0W A;  3EM1 A;  3CB4 A;  2ZBP A;  1S1W B;  1R8A A;  4I1T A;  4NYP A;  3DLE A;  2AJQ A;  4DU8 A;  3W8P A;  2GCF A;  1CS4 B;  4KV8 A;  1PG5 B;  4RUC A;  1HNV B;  2FHK A;  2FLL A;  4MY4 A;  4OYO A;  2QV6 A;  3MM7 B;  1VQL S;  3ZZU A;  2BR0 A;  4F02 A;  4FXV A;  3PX0 A;  2AU0 A;  5I4M A;  2R7W A;  2XSF A;  4N8O A;  3DI6 B;  3KUE A;  1DQA A;  1VGY A;  3M6X A;  4I6W A;  1I5O B;  2XGQ A;  4ZOS A;  1FNX H;  2F5G A;  3SQG B;  2R9L A;  2M52 A;  3HFZ B;  1X0F A;  2IUC B;  3FDS A;  1DLO B;  3QZ8 A;  3D6F B;  4I6A A;  3Q8P B;  1VDH A;  2C3M A;  3ZC4 A;  3CGI A;  1HBU A;  1Q4R A;  4IH6 A;  2KKH A;  3M2R B;  2IIH A;  3DOM A;  3JSM A;  3QT5 A;  2CUY A;  2LA6 A;  3A13 A;  3FCH A;  3JS9 A;  4DR1 J;  4Q8E A;  1MNE A;  2RDI A;  2W5W A;  1PIE A;  3BDH A;  2J76 E;  4MK9 A;  2WHO A;  2ZFH A;  1RAJ A;  3CJK B;  4ZLN A;  3QO9 B;  4X4P A;  1U1R A;  3PW7 A;  2CA9 A;  4DWI A;  3I4P A;  5D15 A;  4ZPW R;  2XGP A;  4DR2 J;  4K5S A;  2FJB B;  1TL1 B;  1SH0 A;  4OZ0 A;  3QGH A;  2ZH9 A;  2IC3 B;  1DQ8 A;  2BZ2 A;  2C2K B;  2RNE A;  3PJX A;  1FE4 A;  1SC1 B;  2CJ9 A;  1FX2 A;  2QA4 S;  4Y00 A;  2CJX B;  2Z30 B;  1FFS B;  4P75 A;  4YY3 J;  1U1K A;  2HNZ A;  1S72 S;  4OZN A;  4PRF A;  3KHG A;  2DGU A;  2YXL A;  2MPU A;  4I2P B;  2ZH6 A;  4WK3 A;  4CLS A;  1I94 F;  3QPI A;  2V94 A;  1RAG B;  1FK9 B;  4AFF A;  4F4K A;  5IFM A;  4WFY A;  4B9S A;  3IGV A;  5FLX Y;  1AB8 A;  4N7T A;  3UE2 A;  2V5H G;  1DTT A;  4LF5 F;  1F9E B;  2EI5 A;  2HHH F;  2BKN A;  3EVW A;  1JLE B;  1FKO A;  1BQX A;  4C0H A;  3BF4 A;  1NJZ A;  2MGZ A;  5KOW A;  3K8W A;  4C11 A;  3C19 A;  1S6P B;  3H5U A;  3S7R A;  5KT3 A;  2WVF A;  4C48 A;  3T19 A;  2RAQ A;  2MQ8 A;  4LR2 A;  2M5Y A;  2W4P A;  2WK4 A;  2HVZ A;  1M0S A;  4ETZ A;  1WG1 A;  2ZM6 F;  4P9S A;  1EI6 A;  2AHO B;  2JVR A;  4F3O A;  1CBK A;  1KWM A;  3TA1 A;  2X3G A;  2HG4 A;  3WBZ A;  4QWA A;  3F0N A;  4RNO A;  4ZMM A;  1PYS B;  4K4Z A;  5T14 A;  3MR6 A;  1MW7 A;  1RBO B;  3SZY A;  5HP1 B;  1BQN B;  1IR2 A;  3KLF B;  2KYX A;  1RA7 A;  4HLB A;  2HHS A;  3JYT A;  3LXQ A;  2EBG A;  1D0E A;  4KT0 C;  3CD7 A;  3G4S S;  1SHN A;  2F8H A;  4WKY A;  1R3N A;  3LTO A;  3PYF A;  1UVI A;  4I69 A;  2FJE B;  1LK5 A;  1UVK A;  4DX5 A;  3H90 A;  2A6O A;  2DXF A;  1BGX T;  1YLX A;  1IJE B;  4YDX A;  3LO3 A;  2JLE A;  3PNI A;  3AH6 A;  4BDP A;  2BJ9 A;  5T7L B;  4IUF A;  3QAT A;  3BDG B;  4PZV A;  3IS9 A;  2HNY B;  2ABY A;  2OTJ S;  2AJF E;  4H4M A;  4KM4 A;  1TKX A;  2YNI B;  1RHM B;  5A8R B;  2YWH A;  4WKR A;  2RQK A;  2IA6 A;  2MLZ A;  3GP9 A;  3RBZ A;  1N54 B;  1RTH A;  2DNR A;  2ZH3 A;  2ZZM A;  3PFO A;  1LFP A;  2W5V A;  3CTR A;  2W2O P;  4DZ6 A;  4U67 Q;  1NH7 A;  1TUW A;  2XI2 A;  1GFW B;  3MEC A;  4MT1 A;  2FUG 9;  2GHV C;  2V2Q A;  3ETO A;  1SHQ A;  2OPS A;  3F73 A;  3ONQ A;  1CUL A;  3AXM A;  4Q5V A;  3N28 A;  4OJ1 A;  4DZD A;  4ZG6 A;  3ZTR A;  5GAD U;  3K7R A;  4DPT A;  5HO4 A;  4EZ9 A;  3KLG A;  1FJG F;  1TKT A;  4HL9 A;  2MQP A;  1JLF B;  4CO3 A;  3W64 A;  5DM7 Q;  4NCG B;  5LRM A;  5KXA A;  4AD6 A;  4UPI A;  4F4X A;  4DSK A;  4M63 A;  2CPY A;  3KDN A;  4LFB J;  3T1A A;  1NBE B;  2JH3 A;  3CJ3 A;  4FBU A;  2C1E B;  1D9D A;  2L08 A;  1ZS6 A;  4JI6 F;  1C1B B;  2ZIT A;  4CYU A;  2M70 A;  4OJ3 A;  2HSE B;  1HHQ A;  4UZC A;  3A52 A;  1DQ9 A;  4J9V A;  4B3T J;  2FQQ B;  1IKW B;  1S1T B;  3ELH A;  2NQP A;  1RT1 A;  4B9T A;  3NGK A;  3OLA A;  2CPI A;  5K9F A;  1KC8 T;  1RWM B;  3IBW A;  2X1A A;  3KWM A;  3IWN C;  2R8G A;  1BXN A;  2CKW A;  1WNE A;  3RR7 A;  2V6A A;  4DV0 F;  4CLL A;  1M1G A;  4QR1 A;  4Y0F A;  4ZPT R;  2W5Q A;  4F67 A;  1RLD A;  2RT3 A;  4ZJQ A;  4ZK7 M;  4KPC A;  3LP2 B;  3DU6 A;  1RTD B;  1P49 A;  4JUZ A;  2I6W A;  5DDO C;  4QWD A;  1NSK L;  3MEK A;  1SJF A;  4DR7 J;  4A8O A;  5KG6 A;  2Q1L A;  1S9E A;  4ID5 B;  4TY9 A;  4QZV B;  3LH2 S;  1YDL A;  2F65 A;  2OEM A;  4CM2 A;  2BQU A;  3DLH A;  5L1I A;  5FLX U;  2BMB A;  3RAM A;  5G0R A;  5AJ9 A;  5GOV A;  2XLK A;  1AZS A;  1ZZF A;  3KLH A;  1NDC A;  3KLI A;  4UST A;  3BN4 A;  4ZKA A;  1R8H A;  4ED1 A;  1N8R T;  2FJD B;  1T0T V;  4FDI A;  4FN5 A;  1ZED A;  3CCZ A;  1XBW A;  3P6Y C;  4PG7 A;  3VQS A;  1Q7L B;  4F8R A;  5KFS A;  3D2W A;  4ZPD A;  2FHJ A;  1R27 B;  2DTJ A;  4LRF A;  4U6P A;  3NS6 A;  5ETR A;  3SMZ A;  1HHS A;  3IR5 B;  4NX9 A;  1HYS A;  3CNQ P;  1FD2 A;  3DRS A;  3UDC A;  2KJW A;  5HVF A;  3ET6 A;  5JJB A;  1HW8 A;  1VMB A;  4RO0 A;  2RIJ A;  1WF1 A;  2WB1 D;  3RGI A;  3LAN A;  3AOC A;  3SDE B;  4TLQ A;  3KJV B;  2D3Z A;  5HLF A;  1KN6 A;  3IGZ B;  4K7Q A;  4JI4 J;  3BQ0 A;  2I1R A;  3W1Y C;  3PG9 A;  2POK A;  5J2P A;  4CIO A;  4PG6 A;  4ZCM A;  1VQP S;  4MKA A;  2KM8 B;  4KV8 B;  4IH5 A;  4AL6 A;  4OYA A;  3GCX P;  3WC2 A;  5F8I A;  4XO0 A;  3M05 A;  1VHI A;  3RB3 A;  2N4D A;  1FWL A;  3G82 A;  3THV A;  3TUZ C;  3W2V A;  3AHP A;  1FSU A;  3S8S A;  2AX1 A;  4K50 A;  3D66 A;  2Z2L A;  3GFY A;  4IR1 A;  1TAQ A;  1T94 A;  3RUB L;  3R8Y A;  1LXJ A;  3SCI E;  2RD5 C;  2IMW P;  3R9L A;  3I6P A;  4HH1 A;  5I3U B;  1XMB A;  5L39 A;  1H3D A;  1SJQ A;  1T03 A;  5D6G A;  2KRR A;  3EGN A;  4DHV A;  2MQM A;  5IXU A;  4KR0 B;  3NAI A;  3DOM B;  4OZ3 A;  2WRM A;  3LGM A;  5CYM B;  4I6Y A;  2Q6B A;  3H40 A;  4CYR A;  3LPE A;  1QTN B;  1TKD A;  2N4C A;  1BD6 A;  4HEA 9;  2BJ3 A;  1S9G A;  3DPC A;  2HMI B;  2W9A A;  3MMB B;  2UUC F;  4N41 A;  2FJV A;  4J9Q A;  4JI1 F;  3ZTS A;  4IOB A;  1FEH A;  3JAM Y;  2MXY A;  4DV3 F;  4DN0 A;  2V50 A;  5C24 A;  3DLK A;  4J7C A;  2R8H A;  2LA4 A;  2WB4 A;  3O8W A;  1S76 D;  3G6Y A;  2HFZ A;  3DMJ A;  3M2V A;  2VOP A;  1ZM4 A;  2B43 A;  4R8U B;  2MQL A;  3MAQ A;  1KTQ A;  4EYH B;  4XTT A;  3T1Y F;  4AQY F;  2OPQ A;  4LUB A;  4DXL A;  2I5J A;  2CIM A;  2VQE J;  2HGL A;  5AJ3 F;  2M8D B;  1X5T A;  2L48 A;  3PFE A;  5DDR C;  3A3O B;  4BWJ A;  1IR1 A;  1U1L A;  3Q8V A;  1HW9 A;  1ZAW A;  3IM8 A;  2EFO A;  1UFL A;  2CPJ A;  1N4L A;  5SZT A;  2RU3 A;  1FX4 A;  1REV B;  4WE1 B;  3T3F A;  2VBZ A;  5BJR A;  1VC5 A;  5CXT A;  1HBO B;  2L9W A;  2EFN A;  1DTT B;  3POT A;  4RUB A;  4OZ2 A;  2Z2M A;  3MPW A;  4C8Z A;  1I51 B;  3QIP B;  2HWT A;  3BM7 A;  1WI8 A;  3CCT A;  2GSN A;  3DYC A;  2OPR A;  2RF2 A;  1PO6 A;  1U0H A;  4JI2 J;  2UUW A;  4OHW A;  2XRG A;  4DV4 J;  1URB A;  3P4U B;  5HVG A;  5C2G A;  4PCQ A;  3PYE A;  5THW A;  5ADZ A;  1CQN A;  2Y3Y A;  3R3T A;  5LSO A;  2CQ2 A;  2CFX A;  1ZH5 A;  5LMU F;  3A1Y G;  3CJ4 A;  4Q2L A;  4A48 A;  3ULH A;  1N52 B;  2LXF A;  5IQQ A;  1ANI A;  2VQF J;  2DB1 A;  3EIC A;  1EQ0 A;  3L9Z A;  3CCW A;  4LSZ B;  5D0R A;  4A47 A;  2PC6 A;  5KG0 A;  1CJT A;  2YKN B;  2JL9 A;  2XMJ A;  3ILJ A;  1RT3 B;  2M2B A;  1VBY A;  4DPW A;  1BQM B;  2RHQ B;  2FC8 A;  2J6T A;  5KAK A;  4LFA J;  2C2O B;  4URG A;  4O0N A;  3MAA A;  3WAW A;  3O3L A;  4KY3 A;  4LF2 A;  4R5P B;  1WEX A;  4USU A;  3IN5 A;  1F5B A;  2CJB A;  4ZVH A;  5B0F A;  3M8Q B;  1Q78 A;  4WFB Q;  1BWE A;  4P52 A;  2BAC A;  1H2V Z;  4A8S A;  3KJN B;  3MM6 A;  3D6H B;  3FKB A;  3J7A N;  2RVJ A;  4C97 A;  1MWZ A;  4ZDN A;  3V4I B;  1F2G A;  2NRE A;  2ILZ A;  2WAQ D;  2J8S A;  5IQ6 A;  1H73 A;  4RW7 A;  1HNZ J;  4QYZ K;  2VBX A;  1HHT P;  3KK2 B;  2YWK A;  1YVF A;  4HTI A;  2MLY A;  2UU9 F;  2WSE C;  1WOO A;  2YNH A;  1ZAV A;  1XER A;  4HAC B;  3GIK A;  4ES1 A;  3W5X A;  2W1B A;  4O3O A;  2JNJ A;  1MN7 A;  4CP5 A;  4EK2 A;  1QVG R;  4ECY A;  3PR5 B;  4PYA A;  2AP6 A;  3OL9 A;  1FXR A;  3JXO A;  4DU7 A;  1B7F A;  3EWG A;  3FZ2 A;  4DQI A;  5KFL A;  1ZPW X;  4ZVF A;  4WF9 Q;  3WBH A;  3O1L A;  2XCP A;  1Q8K A;  3VAI A;  2DY1 A;  3J7Z 5;  2FZC B;  3I9V 9;  5CHC B;  3GV8 B;  1JNZ B;  4DQQ A;  4X65 F;  1D3W A;  3I87 A;  3IDD A;  1WOR A;  4NLD A;  2XI3 A;  3V6J A;  1T02 A;  2H1Y A;  3PHE A;  3BGR B;  2IAJ B;  4DPO A;  1RWK B;  4A8M P;  4U8Y A;  1NK5 A;  3AD8 C;  5IT0 A;  3QWU A;  4IR9 A;  4Q45 A;  2HKE A;  2QMW A;  5EGH A;  1EET B;  2MY8 A;  4CYU B;  1UVJ A;  3TJ9 A;  1MN9 A;  2OSR A;  3PZP A;  2PI4 A;  3JAM U;  5K8O A;  4DLE A;  5B0C A;  3M30 B;  3ENQ A;  3DOK A;  1JLC A;  4ECS A;  1UCN A;  3UN2 A;  3FFI A;  3RAQ A;  1RTZ A;  2A1B A;  1L3U A;  1WC1 A;  1Q16 B;  1WUU A;  1SJ3 P;  3D68 A;  5DDQ C;  4ED7 A;  2OEL A;  1V3S A;  2BJE A;  3T02 A;  2E29 A;  2DPI A;  5C42 A;  3R7S B;  4ZVG A;  2JC0 A;  4GRS A;  4H4O B;  2D7S A;  2NXC A;  2CG4 A;  3TA2 A;  2LXU A;  1KLM A;  3KLE B;  4DV1 F;  2FZG B;  2DXD A;  3WIV A;  4LFC F;  4N56 A;  2JOQ A;  2HRT A;  4WFN Q;  4UOF A;  1LWE A;  4KRW A;  4LBP A;  3Q89 A;  2IJF A;  2EFV A;  3OUY A;  1XK8 A;  1T3O A;  5HBM A;  1BLU A;  3HHL B;  3M1V A;  4O3P A;  1B0T A;  1AZS B;  5EHH A;  3KLH B;  4PQU B;  2CQ0 A;  3TX8 A;  4QIG A;  2BRK A;  5A2Q Y;  5KFM A;  1E3C P;  1S6O A;  4OX7 A;  1U8W A;  1U1O A;  4WBF A;  2ZOM A;  1ELO A;  1O99 A;  4PUO A;  3CED A;  4DL3 A;  2B6A B;  1C4A A;  2IM2 A;  3IFE A;  2OP5 A;  3NXZ A;  5DLF A;  4OHZ A;  3TVK A;  1U6F A;  5K8P A;  4HVZ A;  1KRP A;  2IHR 1;  2O5D A;  4CTA A;  3THT A;  3OJS A;  3DGP B;  2G9Y A;  2VZ9 A;  2YY3 A;  1VK8 A;  2V8D A;  4ZIT A;  1G4C A;  2HQC A;  3THP A;  1OO0 B;  4HHJ A;  2FHO B;  3M8P B;  4P2X A;  4KIA A;  1HR0 J;  4MTP A;  3ILI A;  3UFC X;  1CEZ A;  4CRJ A;  2LVW A;  2SXL A;  1MSW D;  1LXN A;  2LEB A;  4HT5 A;  1QAI A;  2ZH5 A;  1RHK B;  4RX6 A;  3DKD A;  1FKP B;  5J1E B;  3SCJ E;  1ARO P;  1HKA A;  3BYR A;  5D4P A;  3QJJ A;  2DYA A;  3K17 A;  1HMV A;  1RI7 A;  1WG4 A;  1EAY C;  1VBZ A;  4B9N A;  2WON B;  3SZ2 A;  4E8U A;  2W8D A;  5E0O A;  4EMD A;  2H48 B;  1B64 A;  1PBA A;  3NNC A;  5LT5 A;  3NCP A;  3VZH A;  5ETO A;  4FYY B;  4CO0 A;  4KGZ B;  4UOG A;  1NHV A;  5D77 A;  4M5G A;  3NL0 A;  3FVY A;  4ZVU B;  3OTO J;  1D1U A;  4Q2M A;  1XMQ J;  3EVM A;  1NM2 A;  2FHM A;  4QPX A;  5KFH A;  3W2V B;  6AT1 B;  2B8Q A;  4HHH A;  5IM0 B;  2GAH C;  4JV0 A;  3HT0 A;  3NKQ A;  5JXS A;  4KJG A;  4YB7 A;  4L6V 3;  2W8L A;  3TRG A;  1SQE A;  4L74 A;  2RQ4 A;  4KB7 A;  1AA1 B;  1B0P A;  1ZBT A;  1TV6 B;  3LPY A;  2GMJ A;  2EKY A;  1VRU A;  4BC7 A;  3L3C A;  3CMQ A;  3V81 A;  2GA7 A;  1BMQ B;  2KL8 A;  4QIV A;  4G3I A;  3E2E A;  4L73 A;  3QAE A;  3DNC A;  2C2D A;  2AYG A;  3AB4 B;  2AZ1 A;  5LMN J;  7FDR A;  4RKU C;  1GK8 A;  1RT2 A;  4DPU A;  5KT7 A;  4DQR A;  1UEK A;  5A8K A;  2MZQ A;  3HJF A;  3N4W A;  3CJT A;  4ED5 A;  1EW2 A;  4OYI A;  1RAE B;  3BH7 B;  1DTQ A;  4I0W A;  2YNF B;  2HBR B;  2XY7 A;  4ES2 A;  3T6J A;  2AEJ A;  4CLW A;  1QY7 A;  1E6Y A;  2AYE A;  1KHN A;  3C6U A;  2JFK A;  2GFF A;  4PXE A;  4TVA B;  2GIR A;  1S6Q A;  4CWB A;  3NKP A;  2GJF A;  1WD6 A;  1KD1 T;  3DLK B;  4ZVQ B;  2KU7 A;  4KTQ A;  4J9O A;  2VBY A;  3SIP B;  3M2V B;  3HZG A;  1HAR A;  1T11 A;  1ROF A;  4FF1 A;  3K57 A;  2R8K A;  1HLW A;  3C6T A;  3GII A;  1ELZ A;  1P6T A;  2C3Y A;  4CH0 S;  5F8L A;  3W5Y A;  2I5J B;  2DGX A;  3QAU A;  5AE2 A;  2RH3 A;  3GSD A;  2LEA A;  1YTY A;  2KYZ A;  4NL5 A;  2GLQ A;  4UY8 T;  4DUY J;  1H0H B;  2MZS A;  1YZ6 A;  5ETS A;  2LQ8 A;  2NCK L;  1ZA1 B;  4TU7 A;  1S1X A;  3AB2 B;  4M5D A;  4G1P A;  3BSC A;  4GTW A;  4BS2 A;  3C66 A;  2EWH A;  2DR7 A;  4DR1 F;  4PPD A;  5L1L A;  4ED3 A;  4EBE A;  3HT3 A;  1HPZ A;  5GAE I;  4FS2 A;  1HI8 A;  4LT6 A;  4X4R A;  2BE2 A;  1VHF A;  1VIS A;  1DAR A;  2HIQ A;  1Q86 T;  4PXB A;  2BA9 A;  3DDI A;  1REG X;  1VRQ C;  3IBC B;  2RF2 B;  3QLH A;  1B0V A;  4DR2 F;  3R7B B;  3NEK A;  1LV5 A;  3TAM B;  2G9O A;  3KK1 A;  4FZV A;  5GMD A;  3QID A;  1JLA A;  1NDK A;  1Q53 A;  3MED A;  1QTM A;  5I42 A;  3MM9 A;  3RRH A;  1UAW A;  2VIC A;  4U7U K;  5A2Q U;  1OPI A;  3DLG A;  2KDO A;  4XIU A;  1SBR A;  2DGS A;  2XMA A;  4QYZ J;  4YY3 F;  3DGV A;  3I82 A;  4B08 A;  5EX0 A;  2GC8 A;  5CZX A;  3W61 A;  4LF5 J;  5DLV A;  1RAD B;  2HVD A;  3W2W A;  4X64 J;  1U1N A;  1UWB A;  2ALY B;  2WVE A;  2XSJ A;  2Q66 A;  1EP4 B;  2D9O A;  2QTW A;  1S77 D;  2DNN A;  2JDJ A;  2BAN A;  2QIF A;  3KD8 A;  3GR1 A;  3A3P B;  2E5I A;  2HHV A;  4M95 A;  4PAA A;  5DRK A;  5HK4 A;  2ZM6 J;  3SSQ A;  4C4W A;  4OLP A;  1PCA A;  3L7U A;  3RB6 A;  2A3J A;  2NR0 A;  4ZA1 A;  2VQR A;  3MM8 B;  4LR7 A;  5KFE A;  2CJA A;  1FEE A;  1SUQ A;  5A0Y A;  1SPB P;  1G2E A;  2XMT A;  3GZ7 A;  3MM6 B;  2DH8 A;  3GIJ A;  4DFK A;  1FRH A;  4DL2 A;  3MEG B;  1C2P A;  4FNI A;  1VFJ A;  4CH1 A;  1SKU B;  4OI6 A;  2XS7 A;  3H42 A;  4RW7 B;  3QYY A;  4RUH A;  3D1O A;  1N5Q A;  4OYX A;  4TQR A;  2XS5 A;  3NMR A;  4J91 A;  1KLN A;  4RNM A;  2N7C A;  4GO5 X;  5D0E A;  3N6L A;  3MDF A;  3MM5 B;  1FI4 A;  1TL3 B;  3SFG A;  1D9F A;  1VK3 A;  2ADB A;  4O44 B;  4QAX A;  2VFR A;  5ITH A;  4CNY A;  3N6M A;  5A8W B;  2QG9 B;  2GIQ A;  1SL1 A;  2Q3P A;  3H0P A;  3X1L B;  4IFY B;  1YRU A;  3GR0 A;  1H74 A;  2VH7 A;  2QGF B;  2MJU A;  3Q8R B;  1XR6 A;  4ZCK A;  5KG5 A;  3MUT P;  4OL8 A;  2HAF A;  5E3Q A;  3CDA A;  4PXD A;  3ZTO A;  2LQJ A;  2XMV A;  2VJU A;  2DGT A;  1RB0 A;  1LFW A;  2W7P A;  1TKZ B;  1S49 A;  2ZJP Q;  4AUK A;  1ANJ A;  1M5S A;  3IRX B;  2OEJ A;  2X3D A;  2GW8 A;  1Q95 G;  2JEJ A;  1FRI A;  1CJU A;  5EN1 A;  2VV5 A;  2DNY A;  1H2U X;  1Q79 A;  2LFV A;  1DJ0 A;  1L3V A;  5EGY A;  1P27 B;  5GME A;  3FQL A;  5KT4 A;  1KOO A;  2HVI A;  5CD4 H;  2FGO A;  1N5Y A;  2Y9H A;  1FO1 A;  1FNO A;  4P2F A;  5IV3 A;  2VJV A;  1RTI A;  3A8E A;  3SSR A;  4FYX B;  1X4E A;  2N82 B;  3PAC A;  2BYC A;  1D8Y A;  2E66 A;  2RRN A;  4DF8 A;  3K5N A;  5ETK A;  1FDD A;  5L9X A;  2XZD B;  3OR2 A;  5ETQ A;  1ALH A;  2XC9 A;  5J1N A;  4JP8 A;  5DQI A;  2V4R A;  1FE0 A;  3IG1 A;  4LFB F;  2QYG A;  2W7A A;  3HP6 A;  2VB6 A;  5LOQ A;  5K4P A;  2ZC3 A;  2NXJ A;  3ZZP A;  4LF7 F;  2IRX A;  2YWW A;  4DV0 J;  1ED8 A;  3OXG A;  1R0A A;  3UD3 P;  4PPZ A;  2GO9 A;  2U2F A;  1N33 F;  3PXG a;  1H38 A;  2V68 A;  1S4E A;  3M8Z A;  3QWP A;  3GFZ A;  1NSQ A;  2YH0 A;  1RGV A;  2Y1R I;  3ZZR A;  1FA0 A;  2EXU A;  1X9M A;  1FRL A;  3OXF A;  3EVO A;  3HHE A;  1NH8 A;  1NU4 A;  1U48 A;  4CTA B;  2GA3 A;  3FZB A;  2I2Y A;  1U1M A;  1B99 A;  3C15 B;  3M4X A;  1AUK A;  3V6H A;  4FDJ A;  3R5D A;  3W8G A;  2LYV A;  1D8Z A;  4MK7 A;  2PFF B;  4FYV B;  3P8B B;  4P2M A;  3GV7 B;  4JI7 J;  1KFS A;  4DR7 F;  1TL5 A;  1NK7 A;  4C6A A;  4N47 A;  3MPY A;  1SC4 B;  1FDN A;  2V4J A;  2ZD1 A;  2V34 A;  3KK3 B;  2FPH X;  4FF3 A;  5CCL A;  1A0O B;  1HMV B;  1FRK A;  1JXE A;  3RRG A;  4DG1 A;  1B4S A;  3WDO A;  2CQ3 A;  1C1C A;  4LVO P;  1IKY B;  2AJ4 A;  2IM0 A;  2X1G A;  2Y8W A;  2V8V A;  3ZTP A;  2HND A;  2M8H A;  2RUS A;  4TN2 A;  2K1R A;  4CT8 A;  4WK1 A;  3EYZ A;  3I32 A;  3CJQ A;  1GT8 A;  5CAA A;  2YNG A;  2AW0 A;  3Q22 A;  1V6H A;  1HA1 A;  4DV7 J;  4FYW B;  2HWH A;  1O6X A;  2ZBC A;  2E9Z A;  2H51 B;  2XUL A;  2X51 A;  1YKW A;  5MAO A;  3KHR A;  3QFH A;  4E2F B;  4RNH A;  3GE9 A;  3Q83 A;  5KFR A;  2KT5 A;  3DCA A;  4IQX A;  5J2N A;  3BJY A;  1FFW B;  4ZG9 A;  3BZQ A;  2HRU A;  1B3T A;  1FCA A;  2G0C A;  1BUX A;  1TVR B;  4CXK A;  3D1Q A;  2XS2 A;  1U6B A;  2BW7 A;  4LR8 A;  5DLW A;  3LOU A;  3EUN A;  1NUE A;  2KHD A;  1JLG B;  5HRT A;  3B54 A;  1O8B A;  2DXE A;  1TR0 A;  2DNP A;  2R2S A;  5DGA A;  5KFD A;  3E01 A;  3VQT A;  4QWC A;  1DUR A;  4ZHR B;  1UP1 A;  4V19 J;  2E1M C;  3GG1 A;  3GON A;  1EW8 A;  4IDK B;  3CO0 P;  2MZ1 A;  3B5Q A;  2B7C B;  3CVK A;  3ADA C;  5H9F K;  1KKH A;  2O67 A;  3UQS A;  3ILL A;  3RAX A;  1FJ7 A;  2DHA A;  1TK5 A;  1RWX B;  2Z2Z A;  2BAB A;  3H20 A;  2RHS B;  1EJJ A;  5LXY A;  3MMA A;  2WOM A;  4RW4 A;  1W25 A;  4YB5 A;  5HQL A;  1CJK A;  4KYZ A;  1C4C A;  4ZIV A;  3M32 B;  4ZCI A;  3K59 A;  3SYZ A;  1WSR A;  1X4H A;  1OSD A;  1R8C A;  4HKQ A;  1K9M T;  3T5H A;  4NEY A;  2DHS A;  3KYL A;  3BYP A;  5BXI A;  5KFV A;  4J9R A;  4M5D B;  1N5S A;  1KHW A;  4LF1 A;  1MLA A;  2KZM A;  3H5X A;  5DQH A;  4Y2A A;  2FHJ D;  2AF6 A;  4NYZ A;  4IRK A;  2B4U A;  2X1B A;  4F4W A;  2G0I A;  5KT6 A;  2V67 A;  5K5M A;  3HVA A;  2KRB A;  3T1Y J;  3TP2 A;  2E5H A;  1AJD A;  1RWV B;  5KFZ A;  4DV6 J;  1IXK A;  1S99 A;  3M2U A;  3W62 A;  3MPU B;  3BQ2 A;  2QSW A;  5I3P A;  4C3L A;  3DOL B;  2IPO B;  1RT5 B;  2OUG A;  1T7P A;  1S1V B;  1E1Z P;  2YPY A;  3G6E S;  1N0V C;  3PYG A;  2WW4 A;  2W9C A;  2R7R A;  2RQC A;  4G1Q B;  3MMC B;  4WIQ A;  1ZAX A;  2RDD A;  5B09 A;  5DO2 A;  3CSK A;  3SV3 A;  1JJ2 R;  3MK1 A;  2PFD A;  3D6M B;  2MJN A;  2CPX A;  1C0T B;  1IQZ A;  3WHI A;  2FVQ A;  1VQY A;  4H4K A;  4CM0 A;  2AZ3 A;  2VHG A;  1KHL A;  3ITH B;  2PII A;  4QQB A;  2NSC A;  2G1H A;  4O3S A;  1OY9 A;  3VAF A;  3MF5 A;  4DPX A;  2W4C A;  1KDN A;  4ED2 A;  1RBA A;  1E6V B;  1HL6 A;  2PSZ A;  2BAN B;  4ZVR B;  3NKN A;  3TZX A;  2ASJ A;  4OHY A;  4EWT A;  1FWP A;  1HNI A;  1UFW A;  1F6T A;  1J27 A;  2HK2 A;  1GXT A;  2FTR A;  1S7I A;  3HCX A;  1F1B B;  4K4W A;  3ILO A;  1SI9 A;  3R2C J;  4QU6 A;  3I5C A;  4OJG A;  2RRA A;  1X4G A;  3NG8 A;  3GJR B;  5KFA A;  4DDF A;  4J9L A;  2QEX S;  4CLF A;  1XNQ J;  2ACY A;  2OPP A;  3R6G B;  4JI2 F;  1WKJ A;  4UOR A;  3DHX A;  3U7J A;  4DV4 F;  3CT9 A;  2IMO A;  3D5M A;  5CYQ A;  5KFT A;  2B5J A;  1OIA A;  2GSO A;  1R8P A;  3GB0 A;  2KB2 A;  2XWY A;  1HBM B;  1UJ6 A;  2E1A A;  1KQK A;  5U47 A;  4OX9 J;  1NME B;  4GVL A;  2VQF F;  1QSY A;  2HBY B;  1ED9 A;  1O0P A;  4ICL B;  3TQE A;  1WTF A;  1NK6 A;  2DGO A;  5F8M A;  2GIF A;  1NZA A;  1ZPV A;  4MIV A;  3EDR B;  3OVS A;  4NLS A;  2OFH X;  2ATC B;  1IN0 A;  2FVR A;  4GTY A;  4LFA F;  2HFV A;  1UVM A;  2ZHA A;  3QT8 A;  2AJ2 A;  1RT6 B;  3MCS A;  1W7W A;  3GSI A;  1RWP B;  3ZNJ 1;  2RKI A;  5FD1 A;  2J7U A;  4KH1 B;  1WAC A;  1NK9 A;  1EIY B;  3FBC A;  4HI2 A;  4ZGA A;  3CD5 A;  2UUA J;  1WOS A;  2NXN A;  5KFX A;  1MWY A;  2ASL A;  5IOL A;  2OML A;  1TL4 A;  4YEA A;  2BXJ A;  1HNZ F;  3PY8 A;  5IC4 B;  1TFY A;  1NJI T;  2AEM A;  3UDV A;  2EFP A;  4A8X A;  3FMW A;  3U1N A;  6FD1 A;  1UET A;  3ZTQ A;  1A6L A;  2P6T A;  3HSG A;  4Q0B A;  2LLZ A;  1NO8 A;  2MKK A;  1JMT A;  1TL7 A;  3MTJ A;  2VA3 A;  2OFG X;  4FS1 A;  2J9C A;  3BPD A;  1RAI B;  2QT7 A;  3CCJ S;  2DHX A;  4Q7A A;  2UXC J;  2MKJ A;  4OX6 A;  4LR9 A;  1YRT A;  2WTF A;  4MKY A;  1DRZ A;  3HFK A;  3UCU P;  4X4N A;  5CZV A;  4LF8 F;  2IA0 A;  3V6D B;  1APS A;  3BV8 A;  2HQF A;  3C16 B;  4BC9 A;  2C3U A;  3D0H E;  3KLV A;  4DJB A;  3EZU A;  4CLP A;  3RU0 A;  4WU2 A;  3G2X A;  1LW2 A;  2CPH A;  2XNQ A;  2ZOG A;  1VIO A;  2X1F A;  1FF2 A;  3OR2 B;  4IH7 A;  2HHT A;  2DRA A;  2VC1 A;  4JB8 B;  5J2M A;  1RIS A;  1U24 A;  4DX8 H;  3D4J A;  3PIP Q;  1FTR A;  4KKO A;  1QUP A;  4NPO A;  4LSL A;  4AYB D;  4B3O B;  3C14 B;  2IM3 A;  2AJ0 A;  3CD0 A;  3OFG A;  4K4Y A;  1UZD A;  1Y3K A;  4OYM A;  1N6Q A;  2YKA A;  3HJV A;  3KJF B;  4NRT A;  2C2M B;  4WP9 A;  3DYA A;  3FBE A;  2HHX A;  4JOU A;  1AJC A;  3NNA A;  4ID8 A;  2P8I A;  1LWF A;  2PGC A;  2Y1L B;  2N3O A;  2B3T B;  2R7U A;  1QAY A;  4LRC A;  1PBU A;  1CVJ A;  3J81 Y;  4IFV A;  4NML A;  2WBR A;  1N34 J;  2MB0 B;  3QBC A;  4F50 A;  2YKQ A;  2OD6 A;  4TY8 A;  1IM4 A;  5AXN A;  4DL5 A;  2DD8 S;  5LJ5 Y;  4YME A;  4FBT A;  1S1U A;  2R7Q A;  4NOH A;  1NPK A;  3J81 j;  2FD2 A;  1W2B R;  5B08 A;  1XR5 A;  3QGG A;  1NKC A;  1YJ9 S;  2QC3 A;  1P1T A;  3G71 S;  1S0N A;  3RRK A;  2ROE A;  1IM6 A;  4X4V A;  1SB6 A;  2OO4 A;  2HBZ B;  2H4W B;  3WX4 A;  5DG8 A;  3AXK A;  1HQU A;  3TAQ A;  1HJK A;  1T8E A;  1X60 A;  4WTO B;  3FCV A;  3UDL A;  1V3Z A;  2HUR A;  5HAT A;  3D67 A;  1IKV A;  2E1P A;  1UEU A;  2UV8 A;  4G65 A;  4DL7 A;  2C42 A;  2IBO A;  4B9U A;  3K5L A;  1C0U B;  3CCS S;  1LWC A;  2VA2 A;  2VOO A;  1MMN A;  3VAM A;  2RIL A;  3CW2 C;  3LAM A;  5H9F J;  4XPE A;  2FJA B;  3R7N B;  2DRB A;  2DO0 A;  3EZ5 A;  2G4B A;  4NXN J;  4QIF A;  2GZO A;  4O23 A;  2GVZ A;  1HR0 F;  2F63 A;  5IC6 B;  5J2N B;  4EFA C;  2XNR A;  5HI7 A;  1JLQ B;  5FII A;  2HFO A;  4NCA A;  2NPF A;  4A8F A;  1Y5L B;  1KQG B;  2V8P A;  2R7X A;  4FPI A;  4GTZ A;  1HD1 A;  4KJI A;  3HSZ A;  2P9C A;  1IQT A;  3RB0 A;  2XBP A;  2GJI A;  2DNO A;  1R0C B;  3U1M A;  4J9K A;  2DIV A;  1GXU A;  3FMB A;  1EX8 A;  3E01 B;  2CQG A;  3DRR A;  5D3G B;  1R43 A;  1RTJ B;  4K4X A;  3P45 B;  2ZUA A;  1XC9 A;  1IKX B;  2DR5 A;  2KM8 C;  3PDN A;  5E3R A;  4NYO A;  3RW7 A;  3QGI A;  1CC8 A;  1JLB B;  3OJU A;  3OTO F;  4ECT A;  2FLP A;  2W5S A;  1XMQ F;  5EWF A;  4YOE A;  3IWL A;  3OTB A;  4LRD A;  1J5E J;  1I3O B;  4TLR A;  3QSY B;  4QW8 A;  2ACM A;  5A76 A;  4CZC A;  4ZVS B;  2KN4 A;  4C3K A;  1U2F A;  5IJQ A;  3I56 S;  1RP5 A;  4ZVP B;  3UI3 A;  2FGC A;  3MMA B;  3DU5 A;  2WOM B;  4RW4 B;  4Y2I A;  3DLJ A;  2VG7 A;  2R3V A;  2NYH A;  2OEK A;  2UUB F;  4DR4 J;  5LMN F;  4DF4 A;  4XK8 C;  3IMQ J;  3VAJ A;  4LRA A;  1AJB A;  2RQM A;  1ZTT A;  4WFZ A;  1L3K A;  4C8N A;  4C8L A;  2PEB A;  1J5O A;  4B3R J;  2V2V A;  4FF4 A;  1TUV A;  4WZM A;  2GGP A;  2YWE A;  2HYI B;  4MH8 A;  3PKM A;  5D4L A;  3O44 A;  1CC7 A;  4HHU A;  2D74 B;  3QGP A;  4DSE A;  4CT9 A;  3HKZ D;  3EDQ B;  4USJ C;  2DBB A;  4KAY A;  4KAV A;  4I4B A;  3KG0 A;  2J0S D;  2VG6 B;  2E1R A;  2PE8 A;  3NBP B;  4IG0 A;  3CMA S;  4MIB A;  1PSD A;  4J9S A;  1EJ7 L;  5C66 A;  3DHW C;  1WHY A;  3TAP A;  1QE1 A;  3JSB A;  3Q23 A;  2RS2 A;  1L5U A;  1ZA2 B;  1QUV A;  2DIU A;  1WTB A;  5CQG A;  1HQE A;  3MUM P;  1OY6 A;  4DUY F;  3OW2 R;  2G0J A;  1HQ2 A;  3HVT B;  1QSS A;  2FIU A;  3LP0 B;  1JKH A;  1NKB A;  1SV5 B;  3LGH A;  2UUT A;  1UJ4 A;  1U2C A;  4DV2 J;  2QFI A;  3NAH A;  2B8P A;  2AYB A;  3MHY A;  3FSY A;  4ZPV R;  2YKM A;  1OQ6 A;  1SH3 A;  1RHU B;  3TAN A;  2NZC A;  4RJV A;  2A10 A;  2Y1I A;  4R0J A;  3TUI C;  2CPZ A;  3K5M A;  1K1Q A;  2CJY B;  4ECU A;  1XMO J;  2R7O A;  5HAN A;  1AXQ A;  4JI3 J;  2ZZT A;  2VD3 A;  3CO9 A;  2XO7 A;  2LU2 A;  2QSF A;  4Z7Y A;  3UVJ A;  1XIQ A;  4PQA A;  1ALJ A;  3CMR A;  3TVZ A;  3BBF A;  4I7F A;  3CME S;  3U1L A;  3SBM A;  4ZIW A;  3EZO A;  2BDP A;  2YVS A;  2UXB F;  4LF4 J;  3H4B A;  3U27 A;  4C0O C;  4MFB A;  3MI7 X;  1LOU A;  3LP1 A;  4CLT A;  4HR2 A;  4DCP B;  3G6X A;  5LM7 E;  3LUY A;  3MR2 A;  1N48 A;  4X64 F;  1PKU A;  1NHK L;  3Q8S B;  5LRN A;  4OZ5 A;  2AIR B;  1IJF B;  4JI5 J;  2HK3 A;  1TAU A;  2KTQ A;  4DFJ A;  4TYB A;  5ETL A;  3T6B A;  4RW6 B;  3R5B A;  5AT1 B;  3HPO A;  4KO0 A;  4UZB A;  2OIH A;  1SL2 A;  1TMJ A;  1UA1 A;  3OVA A;  1OYD A;  1QM9 A;  2F8M A;  3GU0 A;  1GX6 A;  1TZ0 A;  2K7K A;  1RT7 B;  4NMX A;  1ZEB A;  3OTE A;  2QLJ B;  3D3B J;  3P3D A;  4ZPA A;  2LQ9 A;  3E2D A;  1RQ0 A;  2W9B A;  3GYX B;  2IFY A;  4USW A;  1GMW D;  1UL3 A;  2W2M P;  4IKA A;  4ZG7 A;  3RZA A;  3BN7 A;  3GJQ B;  4RBU A;  3S1T A;  4WYW A;  3MFH A;  1XQI A;  1VJW A;  3MR5 A;  3MEE A;  4F36 A;  3Q2T C;  2CJK A;  3SZZ A;  3OQ2 A;  4OZJ A;  2CNO B;  3NVL A;  2AMC B;  5L9N A;  5J2Q B;  3OL7 A;  3DM2 B;  3Q8Y A;  5KG1 A;  4UUX A;  2F4V J;  4QJV A;  3OPK A;  1M1K T;  1NEE A;  3RBX A;  1K0V A;  4X4O A;  2Y0S D;  1Z2Z A;  2YQ3 A;  1OMS A;  2XLJ A;  1NB2 A;  1VQ6 S;  2ZJQ Q;  1MRO B;  4B3M J;  5IT4 A;  4TXS A;  5K14 A;  2IDE A;  3DFE A;  4EO8 A;  3H8Y A;  2HWI A;  1M5O C;  4OFZ A;  4GO7 X;  5KFU A;  3VAG A;  3OR1 A;  3CCV S;  3UWT A;  4QIE A;  3FK4 A;  2IRU A;  2GJ2 A;  4CO1 A;  3NGU A;  5EWE A;  3M8Y A;  1N6Q B;  4OI0 A;  2ZUG A;  2CWX A;  3DC2 A;  4X66 J;  3QJL A;  1KQF B;  1HBN B;  4LSN A;  1HI1 A;  1S9F A;  5HRO A;  4DSJ A;  2YQ1 A;  2FVC A;  1JXL A;  1HNW J;  1VQ8 S;  3B82 A;  4DMZ A;  2KFN A;  1WHX A;  4IFV B;  2ZH1 A;  1KSP A;  1T9U A;  2QRR A;  3C8Y A;  2Y0B B;  3TO8 A;  3BGL A;  4K59 A;  4O4G A;  1S1W A;  2JZ5 A;  5E3P A;  1GQE A;  5TJ3 A;  2K06 A;  4LF7 J;  2Z8Q A;  1H2T Z;  3H2V E;  3KXD A;  2VBW A;  4IQM A;  4LF9 J;  4U8V A;  1YIJ S;  2ASD A;  1CS4 A;  2MKY A;  2DNK A;  1HNV A;  2QN6 B;  1N33 J;  4ECZ A;  3IAM 9;  2W7O A;  4F25 A;  4PWD B;  4QR0 A;  4J9N A;  1Y11 A;  2A2C A;  5H1S V;  1RT4 B;  3RW6 A;  3DI6 A;  5HN0 A;  4F2R A;  2ZE2 B;  4G1I A;  2MTL A;  1F3F A;  4ZP8 A;  1HQU B;  2HHU A;  3SQG A;  2N3L A;  3QT7 A;  2CQ1 A;  2IUC A;  2MMY A;  1DLO A;  3W7B A;  2QA1 A;  2OH2 A;  2FJW A;  4F2S A;  1IKV B;  1N2L A;  5BYR A;  1SVD A;  2V9W A;  3ZZY A;  3D1H A;  3M2R A;  2OD4 A;  1PAE X;  4C8M A;  2DR9 A;  5KT2 A;  4CLZ A;  4JI0 J;  3V6K A;  5C25 B;  3FSX A;  3MXH P;  1LWC B;  2R42 A;  2JX2 A;  5IZH A;  3EE3 A;  1FVS A;  2CZ9 A;  2VPW B;  2K8G A;  3G8Q A;  3CJK A;  4QOT A;  3T9N A;  3QO9 A;  2GVZ B;  2JSX A;  2ZZN A;  4JI7 F;  3NKY A;  1S97 A;  5HQ8 A;  3VWS A;  1DBD A;  5F0W A;  3R1L A;  4KPY A;  2ZVS A;  1JK9 B;  2VG5 B;  3TA0 A;  2E7V A;  3CC2 S;  2B4P A;  1MU2 B;  1NK4 A;  1ZEF A;  2HFU A;  3TJA A;  2IC3 A;  1VQN S;  1CPZ A;  4JI8 F;  4ERD A;  4EO6 A;  1N36 J;  4B56 A;  4PR6 A;  1GTE A;  3NRB A;  3H59 A;  3T5L A;  1YSJ A;  4KJD A;  3DRR B;  1VQM S;  3F41 A;  2ZC4 A;  4KGV B;  2XLI A;  1AT1 B;  2CJQ A;  4I2P A;  2K2P A;  4IYQ A;  5CYJ A;  2GMH A;  4NXM J;  2E7X A;  4U9R A;  2BW2 A;  4AXI A;  3KHL A;  3OL8 A;  4AE5 A;  4DSF A;  3JQM A;  1FK9 A;  4DV7 F;  4ITS A;  1MG7 A;  2DR8 A;  2F1F A;  1G7C B;  3KNG A;  1G6B A;  4CO2 A;  4WP3 A;  3IC1 A;  6FDR A;  4LRB A;  3K89 A;  1ZOT A;  2R8I A;  1JLE A;  4PWU A;  2R7T A;  5D4O A;  7FD1 A;  2BE9 B;  3DLE B;  4ZPB A;  1EKR A;  1G1X A;  2R4F A;  1YIT S;  4QPT A;  5D8H B;  1Y7P A;  4DI6 A;  4NLP A;  1NPP A;  3K8V A;  2LEP A;  1P8G A;  2VOD A;  2HS4 A;  1VQO S;  2C3P A;  2QMU B;  2E5L J;  3A4T A;  1KH9 A;  2HLU A;  3EGZ A;  3JQJ A;  4NLG A;  1N5V A;  5F3Z A;  3TWZ A;  1QVF R;  1HIY A;  1JB0 C;  5HP1 A;  1BQN A;  2CWK A;  3KLF A;  1HWL A;  3BQ1 A;  5GVQ A;  3BSO A;  3VVU A;  3D54 A;  4OI4 A;  2E1C A;  1LWX A;  1HBU B;  2FC9 A;  1FDB A;  1VQ7 S;  5GAG U;  4RNN A;  3IBF B;  1R7I A;  1WC3 A;  5D4N A;  4I64 A;  4TU9 A;  3JSM B;  1BY9 A;  3W66 A;  3NS5 A;  1VQS A;  4EBD A;  2BRL A;  2ZWO A;  4UOC A;  2ZDP A;  4ECW A;  2LU1 A;  4XDC A;  3H2U B;  3K2Y A;  5ETV A;  2YPZ A;  1TU0 B;  3LQV A;  4KGM A;  3PR4 A;  5T7L A;  3PJ9 A;  4Y2C A;  1HNX F;  1Q1K A;  1XJW B;  2HNY A;  1WC4 A;  3G86 A;  1WC6 A;  1D09 B;  4LVN P;  2YNI A;  4FYD A;  3MR7 A;  5A8R A;  2D1G A;  1JKH B;  1Q8B A;  3CJ2 A;  4BBY A;  3CJ0 A;  5ETT A;  3EJM A;  4O4R A;  4P72 A;  3JQK A;  3DXB A;  5KT5 A;  2H65 B;  1FT8 A;  1UEV A;  3GJS B;  5IT9 Y;  1JQG A;  4CXU A;  2CNL B;  3BR9 A;  4NZ0 A;  2MQN A;  4DV6 F;  2VU5 A;  2HNZ B;  1RAB B;  1YHQ S;  5DGB A;  3VTI A;  3H98 A;  3QT6 A;  1PYT A;  2OTL S;  4OZL A;  4UOH A;  5LJ3 Y;  2HQD A;  1QD1 A;  1WF2 A;  4OYB A;  3F56 A;  2KHC A;  5J1P A;  1KVI A;  3D6T B;  2GS8 A;  3LF0 A;  3P96 A;  1NPR A;  1Y5I B;  1VIX A;  2J5A A;  2NSB A;  1GMV A;  4P6Q A;  3EXC X;  1YJR A;  1MMD A;  2DGW A;  5IS2 A;  2M7S A;  5C7P A;  4V19 X;  3GG0 A;  4B9L A;  4P74 A;  3VGT A;  1JLF A;  3CF5 Q;  1UFK A;  3G96 A;  2IY5 B;  1J2V A;  2DY9 A;  1FD8 A;  4RW9 A;  1FKO B;  1UPP A;  2W8S A;  2MGZ B;  3AOD A;  4C11 B;  3G9C A;  4ZLL A;  3TYT A;  4ED0 A;  4MKB A;  1ZZN A;  1C1B A;  1V5I B;  1RYR A;  2V8H A;  1R6V A;  4AXJ A;  3FCW A;  2ALZ A;  1TUG B;  1TEL A;  4CLK A;  1T95 A;  1IKW A;  1S1T A;  3ENW A;  1NND A;  4QBU A;  1KHV A;  4UW2 A;  2NUH A;  4Y2K A;  1S10 A;  3NOC A;  5DZ6 A;  4IOC Q;  4FNH A;  2PMW A;  4MKV A;  4DUZ J;  1XNQ F;  5MLC V;  4Q43 A;  4ETX A;  2P6S A;  2F9D A;  2DNM A;  4OX8 A;  2MKH A;  3JYT B;  4TKT A;  2W9B B;  3NS7 B;  4TN0 A;  3LP2 A;  1RTD A;  1YK9 A;  4RR5 A;  3HO1 A;  2FYX A;  4B17 A;  2DCU B;  2DO4 A;  4PG8 A;  4EYI B;  4D3H A;  2VON A;  3WZ0 A;  1TFW A;  4ID5 A;  4OX9 F;  3ZNU A;  2KXN B;  1AUD A;  1SJ4 P;  3NOG A;  1RKI A;  4R0E A;  2KO1 A;  5JUM A;  3PRB A;  2W4D A;  3IS9 B;  1YWX A;  4I56 A;  2LQB A;  3NGD A;  3R97 A;  2UVU A;  3AT1 B;  4H4M B;  2NS1 B;  1TKX B;  3PW5 A;  4ZLJ A;  2Z0G A;  1NJW A;  3NKM A;  1NJX A;  2RE1 A;  2HHW A;  1ZET A;  4M5L A;  4P73 A;  5KFW A;  1UPM B;  3WQP A;  1RTH B;  2LP4 A;  1WHV A;  1AUS L;  1S59 A;  3G8S A;  1X4D A;  2IJN A;  5IWA J;  1H6K X;  3KFW X;  5L0E A;  4Y6I A;  1FRX A;  2B4V A;  2FJX A;  4J9P A;  2UUA F;  3MEC B;  5KFF A;  2PDA A;  2E44 A;  2GML A;  4DBQ A;  2OPS B;  4WYL A;  3PV8 A;  4Y3C A;  3M6W A;  3VVT A;  2GQC A;  1CUL B;  4IO1 A;  3CC4 S;  2JLG A;  2V9K A;  4LF8 J;  3KMS A;  2ERR A;  1SC6 A;  2ASY A;  2CDQ A;  1T9V A;  4F4Z A;  1YJ7 A;  3KLG B;  1NXI A;  1TKT B;  5LQQ A;  2B56 A;  1I1G A;  5HRO B;  3E8O A;  3SQO P;  2KFZ A;  1DFD A;  4ELT A;  1KVJ A;  3UCG A;  3QNW B;  2AV5 A;  2BEF A;  2DT9 A;  2HFS A;  3W9J A;  4KSE B;  2UXC F;  3SDE A;  4XDD A;  4GKK F;  2I9S A;  4H4K C;  3KJV A;  4DQP A;  2YWG A;  4AT1 B;  5EGE A;  3BB5 A;  4FXW A;  2ZNZ A;  1GAO A;  3T5J A;  1H72 C;  1JXV A;  4O4G B;  2LKZ A;  5B0E A;  4PKD B;  3OBI A;  4QCL A;  4D3G A;  2CQ4 A;  4FF2 A;  3LAL A;  3CUL A;  3ED4 A;  5EDW A;  2OKQ A;  2HHP A;  1RT1 B;  1ALK A;  3KG1 A;  3F44 A;  1RCX B;  4ZJL A;  3CDW A;  2VDI A;  2HZV A;  4K0K J;  2O1P A;  1VS3 A;  5IT9 U;  3AAW B;  1Q82 T;  3CXC R;  4EBC A;  5I3U A;  2NXE A;  1GEH A;  2GO8 A;  3D7S B;  2HZA A;  1N32 J;  3V4M A;  4P10 A;  1F9H A;  2W25 A;  1U7L A;  1WF0 A;  4DLG A;  4URS A;  1S9E B;  1TTH B;  2CQH A;  2FLN A;  4I2Q A;  3OFF A;  3IP0 A;  5LSR A;  5CYM A;  3MCM A;  5CA5 A;  1VQ4 S;  2JC1 A;  1WI6 A;  2NXU A;  3CPW R;  2N7Y A;  1T9T A;  2XHC A;  1N34 F;  4DR6 J;  2J8A A;  4C8O A;  4LF6 F;  1L3S A;  2DHH A;  2QX0 A;  1RCO B;  1WSV A;  4NCB A;  4K4T A;  2GHW A;  2HMI A;  5G0R B;  1FXD A;  3MMB A;  4FKX A;  3LWL A;  4RW8 A;  3JTP A;  5ETN A;  3KLI B;  2QJ3 A;  2AD9 A;  3PHT A;  4KFB A;  1K1S A;  2XCA A;  1K44 A;  4YS2 A;  4KGX B;  1X5S A;  1M5H A;  3PO5 A;  4USM A;  5C5J A;  1P1L A;  4R8U A;  2ZDO A;  1Q5V A;  3CCM S;  4QW9 A;  4ALZ A;  4NA1 A;  3MD3 A;  1VC0 A;  3M8S A;  1TQL A;  3CCL S;  1X9S A;  4OIX A;  3HXM A;  4A8Q A;  2C2N A;  1HYS B;  3DRS B;  4Z37 A;  1GH8 A;  1RZM A;  2I0X A;  1V5V A;  1EQJ A;  1RWU A;  3ET6 B;  4CDI A;  3HK2 A;  1REV A;  2G13 A;  2KFY A;  3HD2 A;  2EC2 A;  2DNH A;  4WE1 A;  1IWG A;  3VV2 B;  1HBO A;  3P49 B;  1OY8 A;  5HLF B;  4NXN F;  3CIZ A;  3LA0 A;  2ZWP A;  1IBL F;  5J2P B;  1M5P C;  1SJ1 A;  1FER A;  2O66 A;  2D3U A;  2JWN A;  3QIP A;  4CNZ A;  4RNF A;  2KVQ E;  3MD1 A;  3E3X A;  1YJT A;  2KZZ A;  3I55 S;  1YJU A;  4ECV A;  3CDE A;  2BQR A;  4WWS A;  3G82 B;  4XAK A;  2DH9 A;  2ZHB A;  2B9W A;  5E33 A;  3GIM A;  1RDR A;  1SC3 B;  4L72 B;  1VRT A;  4B3S J;  4MHX A;  1V3R A;  2WSC C;  1WKL A;  5KFQ A;  2GHP A;  3VF0 B;  1LNQ A;  2QZ8 A;  3HHN B;  2YKN A;  2UUB J;  1RT3 A;  1T03 B;  2V0N A;  3W9I A;  2WVC A;  2R7S A;  1F5C A;  1BQM A;  2BOA A;  1J5E F;  2GAG C;  5KG7 A;  2IDL A;  2ZBI A;  3BRE A;  2HFN A;  4R5P A;  3AJD A;  2QL7 B;  4ZN1 A;  3AD7 C;  3AQO A;  2EK6 A;  3R27 A;  3AOA A;  1LEO A;  3M8Q A;  3N0V A;  1S9G B;  1SQG A;  3EPG A;  2EK1 A;  4YR3 A;  4DR4 F;  4UPH A;  2CXE A;  3TR5 A;  4ANC A;  2DIS A;  2EPI A;  2RDJ A;  3EXY A;  2W5R A;  3V4I A;  3SFU A;  5C24 B;  1AFI A;  4DL0 C;  1Z2L A;  1PGZ A;  2EFG A;  3KK2 A;  3AA8 A;  3DMJ B;  5LXR A;  3RTV A;  3T9Z A;  3MUR P;  3UN5 A;  2X7I A;  4CLY A;  5EWG A;  4FPR A;  4B3R F;  4HAC A;  4UT4 A;  8RUC A;  1EZZ B;  2OPQ B;  1KS2 A;  2DNQ A;  4KE5 A;  5KTQ A;  2HIY A;  3N5B A;  1YGY A;  2D9P A;  4J9U E;  2H54 B;  3MMJ A;  3TNV A;  3D9B A;  4YHH J;  2HBQ B;  4Y65 A;  2CZV C;  5JVG Q;  3M9O B;  2KXH A;  2DGQ A;  4HT7 A;  5M2U A;  4ZP6 A;  3OHA A;  3PX6 A;  1VR6 A;  3A3N B;  1GMW A;  2XY5 A;  2ZH7 A;  2J6U A;  1V9O A;  4GTX A;  3IXQ A;  2QYC A;  4WP8 A;  3GMG A;  3POT B;  5DZ7 A;  2DK2 A;  3PIO Q;  4PAB A;  2QL5 B;  4K2X A;  4RW9 B;  4KHP J;  3M7V A;  1NB7 A;  1QAJ A;  3BGR A;  2IAJ A;  1HDH A;  3OXL A;  2CDR B;  2QA2 A;  2OPR B;  2W01 A;  2DNZ A;  1U0H B;  2W2N P;  3D0G E;  4F0K A;  3R5G A;  1EET A;  1VQ9 S;  1H7X A;  1M5K C;  4DV2 F;  4M94 A;  2OAU A;  3T1H F;  3HUL A;  4NRU A;  2IVY A;  4QYR A;  3M9M B;  1AYE A;  2NZ4 A;  5HSP A;  3M30 A;  3B78 A;  2UXB J;  2PN6 A;  3OFE A;  1PIL A;  1Y00 A;  2PMH A;  1ULR A;  3M9N B;  3H5S A;  1XMO F;  3TW0 A;  2C2Z B;  4JI3 F;  2E9T A;  2WSF C;  3UPF A;  4W98 A;  1CJT B;  3MGJ A;  3R2D J;  2JEI A;  2P9G A;  3KUH A;  3I0S A;  3IGN A;  1WC0 A;  2KG1 A;  4KQZ A;  2VF3 A;  4H4O A;  1SKW A;  3TI0 A;  1RA6 A;  2MST A;  3MAA B;  3SSS A;  4LF4 F;  1RXO B;  1O98 A;  4GMK A;  3KLE A;  3P5B P;  4UOO A;  3A12 A;  3HHD A;  4ECR A;  1KP6 A;  1RU2 A;  4H54 A;  4JI5 F;  4DSL A;  5DDP C;  3I31 A;  4HYK A;  5SUH A;  3A8K A;  2ZBQ A;  2CZ4 A;  1LQ9 A;  3HHL A;  3RBE A;  2D3O R;  1JWW A;  4DV5 J;  2WVD A;  2HPU A;  3KJQ B;  4PQU A;  1OSC A;  4MAK A;  2B9Y A;  3HSD A;  4HTJ A;  1FXL A;  4W90 B;  3NMA A;  2AT1 B;  2IFX A;  4A46 A;  1Q8L A;  3MUV P;  2K7J A;  2YNH B;  2ZNY A;  2LEC A;  4QU7 A;  2QA4 G;  1WWH A;  4USH A;  1R89 A;  3TZW A;  2HGM A;  2B6A A;  1FWK A;  2HGN A;  3DGP A;  2HZC A;  3ENA A;  2VPY B;  1VC6 A;  2J9E A;  3J7Z T;  4RWX A;  5BR8 J;  3M8P A;  4P71 A;  2GNK A;  2W2Q P;  3HDS A;  4NEZ A;  4ENO A;  4OZ1 A;  1X7V A;  2L41 A;  2F7V A;  2HAI A;  2QLX A;  4UUW A;  1JX4 A;  4ZVE A;  3GV5 B;  2CG8 A;  4X2B A;  1CSJ A;  1Y4Z B;  1FKP A;  5J1E A;  1RAF B;  1XNR F;  4UPK A;  4AL5 A;  3L09 A;  3JSR A;  2RB7 A;  1VOM A;  4NAS A;  1T3N A;  1URR A;  4ECX A;  4FP9 A;  3GIL A;  5BYS A;  3MK0 A;  2CVI A;  4XPC A;  1IVZ A;  2ZH2 A;  2WON A;  4NZ6 A;  2F4V F;  2AYM A;  1X9W A;  3BSA A;  3H7H B;  2H9Z A;  4DSI A;  2IM1 A;  3MCN A;  5L1J A;  4M5N A;  2XYH B;  1X4B A;  5HQM A;  2LDI A;  2HHQ A;  3PTW A;  1XN9 A;  3UW1 A;  4B3M F;  2MHN A;  3VAL A;  4DFP A;  3T5K A;  4DCO B;  3NKO A;  3DOK B;  1JLC B;  5IM0 A;  2RS8 A;  3FFI B;  2YKP A;  1AJA A;  1YG0 A;  3N01 A;  2CQI A;  1F3V A;  2NPI A;  4OJH A;  4NWJ A;  2QFJ A;  4P2S A;  3BEG B;  4GKJ F;  1TV6 A;  4BHQ A;  5C42 B;  1Y10 A;  1PJ6 A;  2G2Y A;  3EGW B;  4X66 F;  4PG5 A;  2FY8 A;  1RBL A;  4X62 J;  1EKS A;  4WFA Q;  3K5O A;  4MIW A;  1OQ3 A;  2FY1 A;  1KLM B;  5CAB A;  1HNW F;  1M1H A;  4A8K A;  3L95 X;  4I2Q B;  1Y9O A;  3SEO A;  4OQJ A;  1N2K A;  4EGL A;  2ROP A;  1LWE B;  4DR5 J;  1CLF A;  3OFH A;  4EZ6 A;  4JV1 A;  1SIW B;  1FDA A;  2YNF A;  4UOP A;  4C3M A;  3WAY A;  3OUY B;  3L7O A;  4BWM A;  5HBM B;  4JV2 A;  2EBE A;  3M1V B;  4RW8 B;  3KUG A;  1WHW A;  4LF9 F;  1FRM A;  4L76 A;  4ZPC A;  2KT2 A;  1X4A A;  4KFB B;  2B51 A;  2D3O 1;  3IR6 B;  3HKW A;  3ISN D;  3L7P A;  1Z4U A;  3CE8 A;  4ECQ A;  1RAH B;  4UQT A;  2O3D A;  4PUO B;  3HZE A;  2PT0 A;  5F8G A;  4LQ9 A;  1IR0 A;  3OTC A;  1K73 T;  3EPI A;  3BPS P;  3S01 A;  4UPL A;  1KOH A;  4ELU A;  2EEY A;  2C3O A;  4USI A;  3RR8 A;  1D9A A;  4M5H A;  3I5A A;  4DFM A;  3CCE S;  2I38 A;  3Q24 A;  2NUU G;  2BM0 A;  2MKI A;  2P5V A;  4DL6 A;  1R8B A;  4KHR A;  2R2T A;  1UA0 A;  1UJ5 A;  4JV5 F;  4DOZ A;  1URA A;  3OT9 A;  4UY8 5;  4JI0 F;  5CH7 B;  2VC0 A;  1JJ4 A;  5LL6 d;  2PO4 A;  2ILY A;  3BDE A;  2CQD A;  3ISN C;  1KH4 A;  5GAH I;  4JYA J;  2PA3 A;  5CD4 A;  2XMU A;  4K4V A;  4JI8 J;  4N8N A;  5HMX A;  4A8W A;  3BKU A;  2HEK A;  3J7A 1;  5L8R C;  1RK8 A;  1U8S A;  3TUP A;  1BHN A;  1ZM3 A;  3NLC A;  3MZI A;  4JBC A;  3K58 A;  2RRB A;  2RU9 A;  2GX8 A;  5DET A;  3TAM A;  3R1H A;  3M6V A;  1Q5Y A;  4NE9 C;  1T9W A;  4LIR A;  1QDU B;  5HMZ A;  1N36 F;  4CI0 B;  2XO6 A;  1YBT A;  1CQM A;  1U4B A;  4TQS A;  2HLT A;  2HS0 A;  1F0X A;  1VRT B;  2XMM A;  2RSQ A;  4HH0 A;  2DNL A;  3VGV A;  3D28 A;  3HFV A;  1HQA A;  1VRU B;  1T9X A;  4NXM F;  3V81 B;  5L0B A;  2V69 A;  1UZH A;  1E33 P;  1EP4 A;  2HVE A;  1AFJ A;  4O3R A;  4NLU A;  3QQC D;  2PMZ D;  1RT2 B;  3NNH A;  4E0D A;  1X4C A;  5A8K B;  4WFX A;  2K3K A;  3OSP A;  1LKZ A;  1HWK A;  3OSN A;  4LRE A;  1ACM B;  1DTQ B;  1HI0 P;  2W2P P;  1S57 A;  3R6L B;  1RKJ A;  3MM8 A;  3FEZ A;  3JB9 k;  2COL A;  1I6J A;  5AXM A;  2E9R X;  2BUN A;  2V4Q A;  1E6Y B;  3MWB A;  1U26 A;  3LWM A;  2IBK A;  3C6U B;  1WG5 A;  3SCL E;  3CJS A;  3MEG A;  1S6Q B;  2XYP B;  4RL1 A;  4TYA A;  2E5L F;  3VAK A;  2A2D A;  3C6T B;  5F0U A;  2RML A;  1ELX A;  4ILM A;  3NCQ A;  4EI2 A;  2CPF A;  3TG0 A;  1S48 A;  4GC6 A;  1HNX J;  2UXD J;  2M88 A;  1MML A;  4U7C A;  2E5J A;  3MM5 A;  3B4M A;  2OJ3 A;  5L1K A;  1S1X B;  1TL3 A;  1WOP A;  2KXF A;  1KQS R;  2YWF A;  4N76 A;  1IBC B;  5I3Q A;  3H5Y A;  3FRY A;  4KAI A;  4P7V A;  1JJC B;  4AND A;  4O44 A;  4OI1 A;  4YFU A;  2J6S A;  2CQC A;  1HPZ B;  5A8W A;  2BJD A;  2BE2 B;  3SCK E;  2CAJ A;  1FJE B;  4IFY A;  1O51 A;  4ZN3 A;  4C9D A;  2ATL A;  4J90 A;  2VFU A;  3G6V A;  3OTD A;  4KH0 B;  4YUD A;  3QLH B;  2MY7 A;  4PEO A;  3FC9 A;  3KK1 B;  4A8Y A;  3ETM A;  4HDG A;  1JLA B;  5E41 A;  2M3D A;  2HVH A;  5KG4 A;  1S0V A;  1TKZ A;  3MED B;  5I42 B;  3MM9 B;  2G1D A;  3IRX A;  2P2C B;  4NLY A;  1QAX A;  3OHB A;  1AW0 A;  3BGU A;  1X5P A;  3MCO A;  3DLG B;  1KH7 A;  3TZY A;  2J9D A;  3MFI A;  4KHM A;  4LQ3 A;  5D0G A;  1UW4 A;  4MYT A;  2R8J A;  1H98 A;  2DCL A;  2EKN A;  3W2W B;  4K2J A;  9ATC B;  3BSN A;  2J0X A;  1UWB B;  2JHE A;  2GV1 A;  2XSJ B;  4X4Q A;  1X8D A;  2H5I B;  2UVR A;  1M5V C;  4MK8 A;  3I0S B;  1IBK J;  1BE4 A;  3UR0 A;  1WEL A;  2Z2Y B;  5FJ4 A;  3NCR A;  2AGO A;  3L4B C;  3S6E A;  3TEG A;  3BBC A;  2HW3 A;  3HSJ A;  3FJ2 A;  5FDL A;  3PEJ A;  2YQ0 A;  1G3O A;  4MMO A;  4YR0 A;  1S0M A;  3PM9 A;  3GFX A;  1HWJ A;  4M5M A;  3UO0 A;  4Y2M A;  1N88 A;  4EUV A;  1SUQ B;  1QLN A;  5A0Y B;  4OV1 A;  2FB0 A;  2GVD A;  2XZT B;  4DUT A;  2DKO B;  2M0G B;  3MOZ A;  1Y6V A;  2J7W A;  4QIW D;  1HFE L;  1UWA A;  3W9H A;  3O5T B;  4LBH A;  4N77 A;  3UDE A;  2C2R A;  5L46 A;  3C2P A;  2R2R A;  2XZW A;  2DH7 A;  4PYD A;  3IAS 9;  5E5N A;  1EW9 A;  1XEZ A;  4DUZ F;  3BDF A;  1GNK A;  1EHW A;  4L75 A;  1S0O A;  4YDD B;  2CQP A;  1JIH A;  2B0G A;  3C15 A;  3KOA A;  5HAO A;  2RJZ A;  2Y1J A;  2UZA A;  4ZJO A;  1K8A T;  2OSQ A;  2LXI A;  2YX1 A;  2HQG A;  5L0K A;  3CCU S;  5K8N A;  2QLF B;  3NKR A;  1S7H A;  3KK3 A;  5GRR A;  5B0G A;  2DVI A;  4NLR A;  3GJT B;  1CJV A;  2RUG A;  3T00 A;  5KFI A;  2BM1 A;  3EGV A;  7AT1 B;  2PI5 A;  3PYD A;  3Q86 A;  2VAS A;  8ATC B;  1IKY A;  3A8I A;  5RUB A;  3GWC A;  4Q44 A;  4F26 A;  1P9Y A;  2OHD A;  3BR8 A;  3QZ7 A;  3J7Y I;  3Q0A A;  4ZS6 A;  4J37 A;  3ZZ0 A;  5IWA F;  4DR3 J;  3W63 A;  4L3K A;  1CJU B;  3W3S A;  2CRL A;  1KFD A;  1OS5 A;  4CYS A;  3V5R A;  3BO4 A;  1KNZ A;  1N5Y B;  4GKK J;  2XY6 A;  1NRK A;  3CIM A;  2G2Z A;  1U09 A;  4ZCL A;  4WXO A;  1RTI B;  3SV4 A;  1RU1 A;  3PO4 A;  5M2R A;  5HJX A;  2IYG A;  5KG3 A;  3FEY B;  1IBM F;  1TVR A;  4YQW A;  1LK7 A;  4WTY A;  2AQ4 A;  2EC0 A;  4K8R A;  1M90 T;  1CG2 A;  1JLG A;  3IG1 B;  4NLO A;  2DRD A;  2U1A A;  5DJB A;  4EU0 A;  4NI2 A;  5DQG A;  1UTA A;  1YJW S;  4ZHR A;  3C3L A;  1K7H A;  2H4Y B;  4CLU A;  3OVB A;  4IRC A;  4IDK A;  2MQO A;  1R0A B;  1GTH A;  1T05 A;  1U2R A;  3M8W A;  5GAH U;  4ER8 A;  5DG9 A;  4V1A k;  2QMX A;  4K0K F;  2QO3 A;  2KVI A;  3ICL A;  1RHR B;  4B9M A;  3MR3 A;  3AD9 C;  4LF6 J;  1U1Q A;  2AGP A;  1BC6 A;  2QLB B;  3CCR S;  2MSS A;  5JVH Q;  3M32 A;  1N32 F;  4DCJ B;  2DEJ A;  2YX7 A;  1S4F A;  5K8M A;  1PAU B;  4NLT A;  2B9X A;  3A8J A;  4DX6 A;  3R5J B;  3CCQ S;  2UVW A;  1VCT A;  4C8K A;  2V4J B;  3H2L A;  2ZD1 B;  2MZR A;  3MOJ B;  4DR6 F;  1UW9 A;  3VGU A;  3CDB A;  2O01 C;  2F8E X;  1ZTW A;  2MZT A;  1SKR A;  4DG1 B;  2YX4 A;  3VCD A;  1NCL A;  3BGF A;  1C1C B;  3IGY B;  3GIR A;  1RWN B;  2HND B;  2K1R B;  2KH9 A;  5E2Q A;  1FNM A;  3HM9 A;  3HVR A;  3AJ2 A;  3Q8U A;  3DOL A;  4WU3 A;  1RT5 A;  1S1V A;  5DG7 A;  1VBX A;  2Q79 A;  2YNG B;  2IVF B;  3UD5 A;  3M8R A;  1I94 J;  2MKS A;  9RUB A;  4G1Q A;  3MMC A;  3JTO A;  1YI2 S;  3O6Q A;  4F3M A;  1U25 A;  4PXC A;  1PJ7 A;  2AGQ A;  5H9E K;  1C0T A;  1P9Q C;  2VL1 A;  2HHH J;  2C22 A;  4F3Q A;  1IBL J;  5HVH A;  3ITH A;  4DQS A;  2BOP A;  3UR3 C;  5KFP A;  1YJV A;  3P5T L;  1WC5 A;  3PRV A;  1E6V A;  2JRS A;  4Y34 A;  3Q8Q B;  3BKT A;  4RUA A;  1RAC B;  4RZR A;  3PJW A;  3OLB A;  4M5I A;  4O0I A;  2V2K A;  4J5O A;  4OV6 A;  1RWO B;  1ZYQ A;  1DHM A;  3I0R A;  1OWX A;  2VKR A;  1Y7A A;  4Z2X A;  2ZJR Q;  4N5S A;  2DIT A;  4U7U D;  2VFV A;  5T41 A;  1U1P A;  4EEY A;  1RAO A;  2EW9 A;  1HWU A;  4KBI A;  3AJ1 A;  3CJ8 A;  1VQK S;  1NSA A;  4KGK A;  1Z1Z A;  1U47 A;  5C2C A;  1HBM A;  4YP3 A;  4O3Q A;  1SL0 A;  3DRP A;  4K5R A;  1LW0 A;  2R2U A;  5F3T A;  2KI2 A;  4B3S F;  1R0B G;  4WCE Q;  1KBR A;  3E51 A;  1U02 A;  5KFB A;  4ICL A;  1NDL A;  1CJK B;  2CNN B;  1RHQ B;  2XB2 D;  1YBU A;  2YKO A;  3BKF A;  1JNR B;  3PKY A;  1RWW B;  2UV8 G;  1VBK A;  4B9V A;  1RE1 B;  2W5X A;  2AJ1 A;  2G2O A;  2YH1 A;  2IYI A;  1RT6 A;  3K0J A;  4NLQ A;  4USK A;  2C28 A;  3GYG A;  3UD4 P;  1O5J A;  4S0M A;  5F8H A;  2B4O A;  3SXL A;  3M2U B;  3CUN A;  3J80 Y;  1B8J A;  3N5F A;  3PW2 A;  3NWG A;  2CPD A;  4OMF G;  3QMQ A;  2A6M A;  3NY0 A;  3UN3 A;  2W9C B;  1VJQ A;  4P7T A;  3QJP A;  5M2P A;  1FJG J;  4URQ U;  2AWZ A;  2VIH A;  4OI2 A;  1WEY A;  4ZP7 A;  4YN3 B;  3GTY X;  1ICE B;  3J81 U;  3RG6 A;  2KG0 A;  2K3I A;  3TX0 A;  4YHH F;  1SH2 A;  3GFH A;  2XG8 A;  3V6D A;  4I68 A;  3C16 A;  2DNG A;  1TMM A;  3IA0 A;  4JI6 J;  4ED8 A;  3T01 A;  3MTK A;  5GAG I;  1HNI B;  5JMN A;  2LQ5 A;  4C7Q A;  3T1H J;  3PEH A;  5FDL B;  1VYA A;  4K4U A;  4KHP F;  2MYF A;  3OL6 A;  4CXS A;  1HD0 A;  2GVD B;  3B4D A;  3G8T A;  2OPP B;  4OHV A;  4B3O A;  3C14 A;  5HMW A;  2XM3 A;  4F7V A;  5CYQ B;  2B5J B;  3HHK A;  4NA3 A;  1KR4 A;  1YJN S;  4J9M A;  2BKO A;  3TZZ A;  4B3T F;  1RUS A;  5E7O B;  4MIA A;  4C0B A;  2R7V A;  4GVB A;  2ZOF A;  4DX7 A;  3M6U A;  4C8Y A;  2D41 A;  4YB6 A;  1F9F A;  3O2I A;  4OLO A;  2EG1 A;  1YBA A;  4MYU A;  2OLW A;  2P9E A;  3CJR A;  4TU8 A;  3T41 A;  2BBE A;  3ZFV A;  4LMZ A;  1YZ7 A;  4U95 A;  2GQ2 A;  1NZ8 A;  1Y3J A;  2QL9 B;  1Y0H A;  3MPD A;  3J7Y U;  3N6N A;  2EG2 A;  2AX0 A;  3BO3 A;  2APO A;  1PC4 A;  1A7G E;  4U96 A;  1ZM2 A;  4X84 A;  1KHJ A;  4RU9 A;  4ZLP A;  3I5B A;  2RKI B;  1Q0N A;  2HQI A;  5D0H A;  3RBD A;  4DS5 A;  1CJV B;  1FES A;  2QLW A;  1IUJ A;  4DV5 F;  3PW4 A;  1EB0 A;  3FBF A;  2ZEJ A;  4F4Y A;  2BJ8 A;  1NK8 A;  3TUJ C;  3NGS A;  3BS9 A;  3FNN A;  5E3A A;  3ISZ A;  4KC5 A;  5E3C A;  4DL4 A;  4WXW A;  4FVM A;  4Q0B B;  2AKW B;  3HI9 A;  5KFY A;  1U49 A;  2BJ1 A;  1TL7 B;  3FUY A;  1KH5 A;  4LIW A;  1C0U A;  1ALI A;  5AE3 A;  1U45 A;  4DPY A;  1XNR J;  4LBI A;  2Y8Y A;  3HX9 A;  5BR8 F;  2BE7 D;  1NJY A;  4M1K A;  2M9K A;  5F9L A;  1JLQ A;  4OI3 A;  2CPE A;  1SJR A;  2MLX A;  2L9D A;  1DZ5 A;  1LW2 B;  2IVM A;  4IG3 A;  2MQQ A;  1S12 A;  2OI2 A;  3ZZO A;  3LAK A;  3VZI A;  3UCZ P;  5J2M B;  2GQQ A;  1UMJ A;  1MWQ A;  4JI4 F;  2FVP A;  2VDH A;  2Q6C A;  3DRY A;  2JVO A;  5DM6 Q;  3TAR A;  4NI2 B;  4KKO B;  4X4S A;  5D3G A;  4LSL B;  3W65 A;  4ED4 A;  1RTJ A;  3FEX B;  2OGU A;  4GKJ J;  2ZH8 A;  1IKX A;  1OPZ A;  1PC5 A;  4M8L A;  1T05 B;  3J80 U;  4IOA Q;  1JLB A;  4NA2 A;  1SCJ B;  3DXS X;  3DYA B;  2DHG A;  4M5J A;  5HL7 Q;  5GAE U;  4GC7 A;  1LWF B;  2C2E A;  1FFG B;  3CC7 S;  2MEW A;  2NLW A;  3IRW P;  1W26 A;  3PCO B;  2ZKT A;  3HHL D;  3GYN A;  2XMW A;  2BQ3 A;  1X5O A;  1XR7 A;  2DR6 A;  4RBV A;  3AA9 A;  3HF5 A;  4IO9 Q;  3FQK A;  1SQF A;  2VPZ B;  2UUC J;  4TY8 B;  1WEZ A;  2LDY A;  5EUH A;  1OYE A;  4JI1 J;  1PYO B;  4HI1 A;  4TNO A;  5ETM A;  5H9E J;  4E98 A;  4X62 F;  1S1U B;  3WAV A;  3VR1 A;  4DV3 J;  3EMT A;  3Q3Q A;  1QSL A;  2EFQ A;  3WIU A;  4WZQ A;  3FRZ A;  1B70 B;  3MM7 A;  1PJ5 A;  2F40 A;  5A6W A;  2KJV A;  4DR5 F;  1URN A;  1IWA A;  4I67 A;  2GSU A;  2UP1 A;  1EAR A;  1K0T A;  4ILR A;  1T9Y A;  4QR2 A;  5F9N A;  3CWJ A;  4AQY J;  3HHL C;  3B6B A;  4WPA A;  1S6U A;  2J0Q D;  4G6V B;  3FGV A;  4ZVO B;  1B7Y B;  5AJ3 J;  3OD2 A;  2WZ1 A;  4BCA A;  3IO1 A;  4F0M A;  4B02 A;  2VG6 A;  4JV5 J;  2MDA A;  2ZKU A;  4FDF A;  3NBP A;  3N79 A;  3I96 A;  4UF4 A;  5A6P A;  2LMI A;  3HD1 A;  1FRJ A;  3AFG A;  3JSY A;  2Z57 B;  3ZXW A;  4ED6 A;  2VQE F;  2XYG B;  2RH6 A;  1S79 A;  3H4D A;  3LGN A;  2X98 A;  5L38 A;  5G4D A;  4NZ7 A;  2JLF A;  3HVT A;  1OJ4 A;  3R5C A;  3LP0 A;  1TL1 A;  2XEX A;  5F41 A;  1RYS A;  1SV5 A;  2ZVI A;  5AE1 A;  1N56 A;  3WC0 A;  1KTV A;  1UKU A;  2Z4P A;  4JYA F;  2QE5 A;  2XQC A;  2BX6 A;  1K47 A;  2V8G A;  3TJ8 A;  3BO2 A;  2JFD A;  3I0R B;  4L3N A;  3B8H A;  5GMK a;  5KOX A;  5LMU J;  2LCW A;  1YQH A;  3LW5 C;  1NSP A;  2BKP A;  3CJ5 A;  1R6Y A;  2ANH A;  5EX3 A;  2XTJ P;  1KON A;  3IWX A;  3QSI A;  2HRY A;  2V63 A;  1BWV A;  1SKS A;  4X4U A;  3KMQ A;  1VQ5 S;  2OMO A;  4F0H A;  3DRP B;  1VLY A;  1WKK A;  1LW0 B;  3DDN A;  3Q2S C;  1NLK L;  2L9N A;  1WJ9 A;  2MHE A;  4CO5 A;  1NK0 A;  2CNK B;  3JTN A;  3KG4 A;  4NLX A;  3GLJ A;  3GPA A;  1TK8 A;  2M4M A;  4PG4 A;  2VG7 B;  2JEF A;  4Q8F A;  1RAA B;  2F3J A;  1U0S A;  1Q81 T;  3HVW A;  1N5T A;  1S6P A;  4K4S A;  3MPV A;  1RJJ A;  1GMU A;  2D69 A;  5DS7 A;  4FVC A;  2A0F B;  4YB1 P;  2CQB A;  3V2U C;  2DPJ A;  4RW6 A;  2XMK A;  1UVN A;  3UNG C;  3FSI A;  3H25 A;  2PD1 A;  4NWB A;  2UU9 J;  5F8J A;  1HWI A;  1J5O B;  1KVK A;  2BVZ A;  4Y28 C;  3DDK A;  4DN9 A;  2GGP B;  2XWX A;  1WDD A;  3BBB A;  2E7W A;  3QFW A;  3KKF A;  1RT7 A;  1X0P A;  3I9Z A;  4W92 B;  3FBB A;  2VUG A;  4CCH A;  2UVV A;  4UQG A;  5AXL A;  3K5P A;  3DRX A;  2ZH4 A;  4DS4 A;  4BLG A;  1VLO A;  3KNA A;  3UNY A;  4RPF A;  5IV4 A;  1UVL A;  3AY0 A;  4IG0 B;  5KFK A;  4HDH A;  3DLL Q;  2VPX B;  2FZK B;  2F4F A;  3QRP A;  3W60 A;  2BV3 A;  1F60 B;  1QE1 B;  4RBT A;  4X65 J;  4ATN A;  4W4M A;  1GXL A;  4NLV A;  2UXD F;  3BDG A;  1HQE B;  2YBV A;  1RLC L;  4IRD A;  5J2Q A;  5B0A A;  5KFG A;  4YR2 A;  3ZO7 A;  4CO4 A;  3DM2 A;  1EQM A;  3I4H X;  2W8K A;  2DEI A;  2PEH A;  4OHX A;  1DY3 A;  2HS3 A;  2ROG A;  1SXL A;  2VKZ G;  4Z7C A;  3NP5 A;  3RB4 A;  5HJY A;  4A4J A;  2YKM B;  2DJW A;  3IR7 B;  2H5E A;  4UTG A;  1KEK A;  4X4T A;  5AXK A;  4ZVT B;  5DLT A;  4RLE A;  1MRO A;  3OV7 A;  3MK2 A;  1F5A A;  2VFT A;  3AQP A;  1JJH A;  5KFJ A;  3D0I E;  5HMY A;  1YX2 A;  1FTC A;  4ES3 A;  2Z58 B;  1RHJ B;  3NWR A;  1ELY A;  2H5J B;  2FLO A;  3CD6 S;  3BGO P;  3UVJ B;  2I8E A;  2WCX A;  2YTC A;  3N9U C;  5K20 B;  4QWE A;  2CAD A;  4I7F B;  2ADC A;  4WII A;  1NKE A;  1ZM9 A;  2Z56 B;  4GVB B;  1HBN A;  2ZBR A;  2WW8 A;  2BJ7 A;  2L3M A;  3HLU A;  4DV1 J;  4MFB B;  1VI7 A;  5B7W A;  1SIZ A;  1TP7 A;  2CVE A;  4O3N A;  4ELV A;  3LP1 B;  4LFC J;  4NCG A;  3EX7 B;  3G87 A;  2F9J A;  5B0D A;  3NGR A;  1FHT A;  1NHU A;  4WJB A;  3TQ1 A;  1FJC A;  3WAX A;  1XTZ A;  1XWL A;  4OYZ A;  3BDP A;  4PWW A;  1IBK F;  2EVZ A;  1S5Z A;  3VHQ A;  5D78 A;  2XHW A;  4RWW A;  3TVY A;  3R5A A;  4FXD A;  3WX8 A;  2FDN A;  3U02 A;  4RU2 A;  5F8N A;  5GAD I;  4ILL A;  4M5K A;  5KFO A;  4KO0 B;  3HMJ G;  3TEH B;  3US5 A;  4QWB A;  4F4A A;  3GQC A;  2A18 A;  4PWD A;  2CYY A;  2B9E A;  2FVS A;  4FKY A;  5LSL A;  1RT4 A;  5LIA A;  2ZE2 A;  2D1C A;  4AL7 A;  2DGV A;  2HQ3 A;  8AT1 B;  3RJM B;  4R25 A;  2B7B B;  1FVQ A;  5DLG A;  1RSC A;  2W24 A;  2H3E B;  5ETP A;  5KFN A;  1W2I A;  3KDO A;  2J9D E;  2PA8 D;  1DAX A;  3BH6 B;  4USV A;  2ZHO A;  3NGT A;  3SI8 A;  3IM9 A;  4C2M A;  5C25 A;  4LQY A;  3VAH A;  5IJS A;  3KHH A;  3MEE B;  3D3C J;  4CQ1 A;  4C98 A;  3QRQ A;  2KT3 A;  2E5G A;  1F2H A;  4NLW A;  5BYQ A;  4LJM A;  5CCM A;  4YR1 A;  1L3T A;  4OYP A;  4OYW A;  2AEF A;  3VGS A;  3PRD A;  4CH7 A;  3ENV A;  1R31 A;  3PVX A;  3C46 A;  1X4F A;  4ANE A;  1U6Z A;  2VG5 A;  2QZU A;  3PX4 A;  1ITP A;  1MU2 A;  4IG3 B;  3CDU A;  3X3U A;  1Q7Y T;  3GCW P;  1A9N B;  2V2Z A;  1Q8I A;  3QRR A;  2WVB A;  3W5Z A;  5K14 B;  4F04 B;  2JEG A;  1N0U A;  1GX5 A;  2WBM A;  4MJK A;  1WDT A;  3ZZT A;  3OR1 B;  5KG2 A;  3DN9 A;  1TK0 A;  2MKC A;  3PW0 A; 
#chains in the Genus database with same CATH homology
 4ZG9 A;  3WAY A;  4ZG7 A;  3M8Y A;  5L0K A;  2ZKT A;  1URB A;  2IUC B;  2XR9 A;  4LR9 A;  3SZY A;  5EGH A;  4CXK A;  3TX0 A;  4MIV A;  1E2S P;  2W8D A;  5IJQ A;  3NKR A;  1SHQ A;  5C66 A;  1ALH A;  1N2L A;  2VQR A;  4LR7 A;  3UN5 A;  1KHK A;  4LR8 A;  1FSU A;  5GRR A;  4GTY A;  3UO0 A;  1KHN A;  3NKN A;  1E3C P;  2RH6 A;  3LXQ A;  5DLW A;  4LRF A;  2W5Q A;  4LQY A;  3T01 A;  1SHN A;  4TN0 A;  3T00 A;  2W5X A;  5HRT A;  3NKP A;  3BDG A;  5IJS A;  2X98 A;  5K4P A;  1P49 A;  4MHX A;  4ZG6 A;  5LRN A;  5INH A;  3SZZ A;  1O99 A;  1ANI A;  4UOP A;  3WAV A;  3NVL A;  1KHJ A;  1Y7A A;  1Y6V A;  2W5T A;  4LRA A;  4NWX A;  3UN2 A;  1ED8 A;  3Q3Q A;  1K7H A;  3IGY B;  3NKO A;  4GTZ A;  4N7T A;  3WAX A;  4YR1 A;  5LQQ A;  1AJD A;  2W5W A;  1AJB A;  3BDH A;  5TJ3 A;  1ANJ A;  1AJA A;  4QAX A;  4UPL A;  3NKQ A;  2G9Y A;  4KJG A;  4LRB A;  1ELZ A;  4ZGA A;  1EQJ A;  4CXS A;  1EW8 A;  2GSU A;  1KH7 A;  3B5Q A;  4NWJ A;  4UOR A;  3T02 A;  3WBH A;  1B8J A;  3BDG B;  3M8Z A;  5LRM A;  5KXA A;  4UPI A;  1ELX A;  2QZU A;  5EGE A;  2W8S A;  3M8W A;  4KM4 A;  5DLV A;  1EW9 A;  2GSO A;  3TG0 A;  1E1Z P;  3WAW A;  3BDF A;  4CYR A;  4CYS A;  1HQA A;  3IGZ B;  2GLQ A;  1ZEF A;  1HJK A;  4MY4 A;  4GTX A;  5DLT A;  3UN3 A;  5AJ9 A;  5L0B A;  1O98 A;  2D1G A;  5GOV A;  1E33 P;  3IDD A;  2GA3 A;  3MK2 A;  3DPC A;  4LR2 A;  3NKM A;  1URA A;  4UOO A;  3OT9 A;  5LIA A;  1EJJ A;  4GTW A;  4UPK A;  3M7V A;  1AUK A;  1EI6 A;  1KH9 A;  1ZEB A;  4FDJ A;  3MK1 A;  1AJC A;  1N2K A;  4KAY A;  4B56 A;  3A52 A;  4KAV A;  2GSN A;  4UPH A;  1HDH A;  3DYC A;  3ED4 A;  2ANH A;  3KD8 A;  1EW2 A;  3E2D A;  2W5S A;  4KJD A;  1ELY A;  1KH5 A;  1KH4 A;  1ALJ A;  3MK0 A;  4LRD A;  1ED9 A;  1KHL A;  2IFY A;  1ALI A;  4FDI A;  1ZED A;  3TWZ A;  3UNY A;  3CMR A;  2W5R A;  2W5V A;  4LRC A;  4CXU A;  4LRE A;  2XRG A;  1ALK A;  5L0E A;  2IUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...