4LRFA

Phosphopentomutase s154g variant soaked with ribose 5-phosphate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
total genus 137
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrfA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrfA01
4MY4A 1ANJA 1Y6VA 5IJSA 5L0KA 1ELXA 2W5RA 3LXQA 1B8JA 4FDJA 4CYRA 4FDIA 3NKNA 2W8SA 1ELYA 3DPCA 1KH4A 4ZG9A 3NKQA 4LR7A 3B5QA 1AJCA 1O98A 3NKPA 5L0EA 2IUCB 3IGYB 4ZG6A 1ZEBA 4LRAA 4MHXA 3CMRA 2GSOA 5LQQA 1ALKA 1HQAA 1E3CP 5IJQA 1HJKA 4LRDA 4MIVA 2W5SA 4LRBA 3SZYA 1E2SP 1N2KA 4GTWA 1E1ZP 5L0BA 5DLWA 3UN5A 1KHKA 5EGHA 3SZZA 3TWZA 2W5QA 4UPKA 4CXKA 3WAXA 1KH5A 5EGEA 4GTYA 3M8WA 3WBHA 3ED4A 4UPIA 2GA3A 3WAWA 1ED9A 3IDDA 3TG0A 1AUKA 4TN0A 3T01A 5LRMA 1EW8A 3MK2A 3NVLA 1EQJA 1EW2A 2XRGA 3BDGB 3BDGA 2D1GA 3BDHA 3NKRA 4CXSA 5INHA 2GSUA 3DYCA 4NWJA 5AJ9A 2QZUA 2IFYA 3E2DA 4NWXA 1EJJA 1EW9A 4YR1A 5KXAA 1N2LA 4GTZA 3T00A 3UN3A 4GTXA 3BDFA 1ALIA 5HRTA 1KH9A 1P49A 3M7VA 2X98A 4CYSA 2GLQA 2ANHA 4UORA 4LQYA 3IGZB 1AJBA 1ANIA 3NKMA 1ELZA 1K7HA 1ZEFA 2W5XA 3KD8A 1HDHA 1KHLA 4KJGA 4LREA 1AJDA 4UOPA 5C66A 2RH6A 4UPLA 3A52A 4LRCA 4N7TA 1ZEDA 5TJ3A 1EI6A 2GSNA 4LRFA 1KH7A 1AJAA 1Y7AA 3Q3QA 2G9YA 4CXUA 4ZG7A 4ZGAA 2W5WA 2XR9A 3MK1A 3MK0A 4LR9A 3UN2A 2W5TA 4UOOA 1URAA 1O99A 1SHNA 1FSUA 4KAVA 4LR2A 2ZKTA 2VQRA 1URBA 5LIAA 4UPHA 1ALJA 3OT9A 3TX0A 4QAXA 5LRNA 3WAYA 3UO0A 1KHNA 3UNYA 4LR8A 3T02A 1E33P 5K4PA 2IUCA 5DLVA 3M8ZA 1ALHA 3M8YA 4KM4A 5GOVA 2W5VA 3WAVA 5GRRA 4KAYA 4B56A 1ED8A 1SHQA 2W8DA 4KJDA 5DLTA 3NKOA 1KHJA
chains in the Genus database with same CATH superfamily
5L0KA 3RB6A 5KTQA 2MY8A 3FGVA 4RW4A 4B9TA 3VVTA 3FBEA 1WF1A 4QZVB 3C14B 3SBMA 2J6SA 4DR7F 2RH3A 1RZMA 2JOQA 5IC4B 4NA3A 4V19X 4YR3A 3ITHB 2DGVA 4PRFA 4ZITA 2M8DB 1NXIA 4DR7J 3CC2S 4ZCKA 4F02A 1G1XA 3R9LA 1EARA 1VQYA 2DD8S 4UOCA 3F0NA 2G1HA 2CZ9A 1WF2A 2V8DA 2CPJA 1RSCA 2WRMA 3M7VA 1SQGA 1KQSR 1VYAA 2X51A 3V81A 1Y10A 3BKFA 2EXUA 4ALZA 1C4AA 2GQQA 2KHDA 4TN2A 3BQ2A 4J91A 3NBPB 5KFVA 1D8ZA 4DUZF 1SL0A 4ATNA 3O2IA 4UY8T 4YMEA 1R0AA 5AT1B 4DL7A 4PXEA 1PC4A 2H54B 1QDUB 4DUZJ 1Y00A 2IM3A 3QZ7A 1KLMB 4OV6A 5IXUA 1MLAA 2R7SA 1UA1A 4WKRA 3SDEB 3EGVA 4DR4F 3T9NA 4CH1A 4KTQA 4F04B 3QO9B 1ICEB 2IJNA 1YZ6A 3HULA 1X4DA 1IBMF 4DR4J 2CAJA 3IGVA 5L9XA 5KT4A 5CD4H 3OTBA 2GCFA 1RHRB 2MJUA 1IBMJ 2RDDA 4ELVA 2DNOA 4P73A 1Y5NB 2E5HA 5D0HA 1DAXA 3K58A 1TK5A 1SH3A 4F2SA 3V6JA 1SH0A 3FEYB 2R3VA 5DDOC 2GFFA 2YNGA 1HBMB 2NXNA 3H42A 3PVXA 2DRAA 1JX4A 2W2MP 4FVMA 2WBMA 3CJ3A 2W01A 4CLKA 2AHOB 5DJBA 1URBA 1J5OA 2UVWA 3W5YA 4M5HA 4ZVRB 4KM4A 3BH7B 2N4CA 1S4EA 4WWSA 3UVJB 4KJDA 1VIOA 4CP5A 2OTJS 2P9CA 4IOCQ 3L7UA 2LVWA 2Q79A 3HSGA 1SJ4P 2HVIA 2V8PA 4LF2A 4DL5A 2YNHB 1HNIB 3ULHA 1XJWB 3AFGA 1S4FA 5F0WA 3JQMA 1U0SA 4CH7A 2DNMA 3BDPA 3VZIA 5LOQA 3KXDA 4OYMA 3MDFA 4S0MA 3IDDA 2VQFF 2MMYA 3LANA 2H1YA 2H4YB 3NKRA 2GVDA 4IFVB 3OSNA 4Q5VA 4B3RF 3F73A 3NGRA 2OELA 2BXJA 2VQFJ 3OL9A 3M2UA 1KONA 4DR6F 3F44A 4I0WA 3DKDA 3GE9A 3DLBA 1FX2A 2E5IA 3M2VA 4JI3F 3BYPA 3NY0A 4ZGAA 5IS2A 4ECYA 4L75A 4P7VA 1F2HA 4DR6J 4O3OA 4IQMA 2RKIA 2RAQA 2FLLA 5HP1A 1F9HA 4JI3J 3MR7A 4P71A 4B17A 1AZSA 2UUTA 2V67A 3KLFB 2Y0SD 3I4PA 4KBIA 2LEAA 1JXLA 4KAYA 4R8UB 3A4TA 3GILA 1JJ2R 1RJJA 1DTTB 3K5NA 4F0MA 4OZNA 4QIVA 1IXKA 2GSOA 3GIMA 1D9FA 1IJEB 4UT4A 2AYEA 1NJYA 3TZWA 2ROEA 2B6AA 4PKDB 2VC1A 3MD1A 3BKTA 1AYEA 2X1GA 4YR0A 1X0FA 4M95A 3OR1A 3DGVA 4OYXA 1J5EF 3BKUA 2GMJA 5DS7A 4GTXA 1A6LA 3DRXA 1Y9OA 4YB7A 2BM1A 1RTIA 1BWVA 5KFLA 1R43A 4ANCA 1J5EJ 1TAQA 1UWBB 1SC3B 5I3UA 3CF5Q 3CGIA 2W7OA 2W5WA 3OTCA 5L1KA 4O3RA 4DQPA 1RWMB 2HGNA 5DGAA 5KFCA 2AT1B 4PWDA 4OV1A 2OMLA 3VAFA 1U8WA 5T14A 2CPIA 5AXKA 4X4PA 3M2RB 3PHEA 4LSZB 2VG6B 2QEXS 1RT1B 1SV5A 1SL1A 2DGTA 4TXSA 3KLVA 2I0XA 4F8RA 4JI7F 2XHWA 2OHDA 4E8UA 1WELA 2ASYA 2XMVA 4KFBA 3NWRA 5E2QA 4NEZA 1FJCA 3ITHA 4NZ6A 4JI7J 2E1RA 4A8XA 1YI2S 4ICLB 1V3ZA 2BZ2A 5J2NB 5M2UA 3CJKB 2JNJA 1WKKA 2ERRA 2XSJA 5KG2A 1PJ6A 3BO3A 4ECZA 1FRMA 2DHSA 4C2MA 1KR4A 3G4SS 1L3UA 2W7AA 2WB1D 4OX8A 1JLAB 3PX4A 4QPXA 4RW8B 2BX6A 4J9UE 3MCMA 3JYTB 3UCZP 4A8KA 3SMZA 4HT7A 4I4BA 3OJSA 1RBLA 2QL9B 1CS4B 4FF4A 3KYLA 1G2EA 2WK4A 4Y2AA 3AB4B 2ADCA 2MPUA 2B43A 3AOCA 4LFBF 2FVPA 2W1BA 1Q53A 5KFNA 1KLMA 2W8SA 1SJRA 2YWWA 4FYWB 2A6OA 2IIHA 3JTOA 3SDEA 4JV5F 4C8NA 1R6VA 4MT1A 1N5YB 3QO9A 4LFBJ 5KG6A 2GO8A 4M5MA 2A6MA 4PAAA 4A4JA 2YKNA 2G0CA 5D4PA 1RI7A 3TARA 2GHVC 3K8VA 4JV5J 2ZD1A 2FZKB 3UW1A 3C3LA 3MPUB 8RUCA 3RB0A 3GZ7A 3GWCA 3S6EA 3E2DA 3DLLQ 4URSA 1YRXA 4IFYB 3OVBA 1HBMA 1S9EB 2IC3B 2XMWA 1FX4A 3GYGA 5CCMA 1PC5A 3MR6A 4NYPA 4ZP6A 2EPIA 4P9SA 1AUSL 3WAYA 3QGPA 3NNHA 4G65A 3MMAA 4BS2A 4GRSA 3UVJA 5D0GA 2C2ZB 2R7VA 4C9DA 2CNKB 4I2QB 3N79A 2I6WA 1RHKB 2YNFB 4A8OA 1LWEB 2I8EA 2PT0A 2YNHA 5HK4A 1NKEA 5GAHI 1HNIA 4O3QA 5A2QU 3LQVA 3JSYA 2I9SA 1N5SA 4U67Q 4K0KF 1X4GA 4ZJQA 4MH8A 1BQMB 5KFBA 3J7AN 3NMAA 2J76E 3DOLB 1C0TA 2VKZG 4TVAB 3HSJA 2BV3A 3HVTA 4N76A 4XAKA 5I4MA 1UVKA 4P7TA 3GIRA 2BJ9A 4W98A 3TJ9A 5U47A 5DO2A 3I6PA 2WHOA 5A0YB 3TQEA 4ZP7A 3J7Z5 3CJ8A 4H4OB 1S0VA 1GMUA 2FJAB 2FGCA 4DFKA 2RHSB 4OI0A 3K5OA 5J1NA 4GKJF 4P2FA 3DN9A 2ILYA 1TR0A 4OI6A 3BSNA 3MD3A 2PDAA 4U8VA 1M5HA 4KB7A 4R8UA 1ANJA 4R0JA 3CJ0A 4GKJJ 4OQJA 3VAKA 2K8GA 4LSNB 2ZZMA 2D3OR 1PBAA 3X1LB 1T7PA 4QIEA 4M5IA 4KHPF 1LFWA 3DU6A 1B0PA 1ZA1B 2HFSA 2BVZA 5KFEA 4O4GB 3C46A 5F8NA 2QC3A 3Q89A 4AXJA 2Z57B 4KHPJ 4PQUA 4KH1B 1FWPA 1EW2A 1O5JA 2VDIA 3K59A 3IFEA 4YQWA 4ECRA 3D3CJ 4F3QA 2NZCA 4M5DB 5SUHA 3ZNUA 4CM2A 2B5JA 4CLPA 1BHNA 4K50A 2K1RA 3QAUA 1ELZA 5FLXU 4ZOSA 4RNFA 5C66A 3AA9A 4OHXA 3W63A 1UWBA 1KFDA 1FJGF 2CQGA 3GR1A 3BB5A 3QNWB 1O99A 1CJKB 4CO0A 4MKAA 1FJGJ 3UO0A 2C2RA 4M8LA 1SC6A 5AXNA 2EG1A 3LP1A 1TP7A 2Y8WA 2DNGA 2JEJA 1Q8IA 2J7KA 2BE7D 2V68A 3IXQA 2DPJA 3SV4A 4IRKA 3HT3A 5LSOA 3M6UA 4TNOA 4ES3A 2LXUA 2CPDA 2RQMA 1C2PA 5KFYA 5C2CA 4A8WA 4FYDA 4CNYA 4USVA 2QFJA 4ZVTB 4EO6A 3EPGA 4CXKA 4USHA 3NS6A 4LSLB 1FERA 3E51A 3SCJE 3UDVA 2WW8A 1VFJA 5D4OA 2E7VA 3BBBA 2LQ5A 2V6AA 2OSQA 4Y65A 3WIVA 3NWGA 2BJEA 3DDNA 4MK8A 3HHLB 4ZVEA 3UN3A 2V94A 3AH6A 2MQOA 1HNZF 1U1LA 1MU2A 1DURA 4XTTA 1SJQA 3ZZUA 1FRLA 5CYJA 1FXDA 3R5AA 3HO1A 1PJ7A 4QPTA 4QIWD 4RW8A 2W9CA 4H4MB 3JYTA 1HNZJ 1N0VC 1Q0NA 3HD2A 1IN0A 2VF3A 2EC2A 2L9NA 4IO9Q 4YDXA 2EBEA 2V8GA 3G6ES 1CS4A 2G0JA 2QL7B 2HLTA 1SL2A 4GO7X 3H7HB 4TKTA 1O6XA 2PIIA 2YWEA 2X1FA 2V8HA 2VG7A 1S1VB 3K8WA 1N5YA 2FGOA 4K4VA 2BE9B 2MQ8A 4K4YA 1FKAF 4A46A 5CYMB 2YKMA 1RACB 3N01A 1M5OC 5C42B 2B4UA 3P6YC 2OPRB 2IJFA 3W65A 3FDSA 2XRGA 5KXAA 2PI4A 4C3KA 1UCNA 5HATA 5I42A 5T7LB 2BJ8A 1NDPA 2J0QD 1S9EA 2IC3A 1WTBA 2BW2A 3LH2S 3HK2A 1U48A 2HGMA 3CE8A 4K4SA 5F8HA 1IBLJ 4MKYA 3QIPB 4F4WA 4LBHA 4I1TA 2HK2A 2MSTA 3AXMA 3GMGA 3MTKA 3DRYA 4I2QA 1HNVB 1CULB 2VBXA 3FCHA 4DX8H 5EWFA 4M5JA 3POTB 2GQ2A 3V6KA 1LWEA 5LMNF 4NASA 5HJYA 1NH7A 3A12A 4FP9A 4DN9A 3CULA 1X8DA 1FO1A 1RT7B 5J1PA 3GP9A 5EHHA 2F5GA 5A8RA 5LMNJ 1BQMA 2MY7A 2E1MC 1S6UA 2LQ8A 4IR1A 2M0GB 3ISND 2EFPA 3TZZA 2QX0A 3CDAA 3DOLA 3ZTSA 3PV8A 3CD6S 5IWAJ 5LSRA 3T00A 3EZUA 1JLEB 3NKMA 3CJ4A 5HLFB 5HMYA 4UF4A 1XC9A 3VGUA 4IOBA 4F2RA 3QBCA 3R2DJ 3D66A 5ITHA 4H4OA 5KG1A 1QUVA 1Q78A 2H3EB 3BGFA 4IQXA 3E2EA 4FF3A 5CQGA 3CDEA 5IZHA 1RTZA 3BBCA 2EW9A 1F3VA 2G2ZA 4U7CA 3GR0A 4NX9A 1NK4A 1IUJA 3QIDA 1OQ6A 2W5RA 3OBIA 4CLYA 2ACMA 1PGZA 3W62A 4HEA9 4N47A 3KTQA 2CZ4A 3O3LA 5CAAA 3SCKE 3H4DA 3L09A 4MHXA 2WSEC 3DLGB 1HQUB 4O4GA 1OYEA 1SUQB 1NRKA 3D67A 1DTQB 4EFAC 3M6VA 1RK8A 4CWBA 2FD2A 3BR8A 3OHBA 1OSCA 1RT4A 4CXSA 4M5DA 5CA5A 3LP2A 2DNNA 5B0DA 5HRTA 2WSCC 3DI6A 4X4QA 1MMDA 1B0VA 4Y34A 3PXGa 1S1UB 2XZWA 1CPZA 2MTLA 3OL7A 2QYGA 2EI5A 3EDRB 1S76D 3KDNA 2DH8A 3BBFA 2C3UA 1Q82T 4ES2A 3UR3C 2OLWA 4URGA 4X4RA 3EICA 1CJKA 1RTDB 2OPSB 3W2WB 1G7CB 4JI1F 2CPHA 2P2CB 4ZJLA 2HMIA 2IUCA 2ZKUA 4YB6A 4DPWA 1RAAB 4I6WA 2CPYA 4I6AA 2UVUA 4NCGA 2YWGA 4JI1J 3WX4A 2F4FA 5IFMA 4X66F 3O44A 2A10A 2DNZA 3I5CA 3M8QA 1WG5A 4C11B 3MOJB 3CO0P 4ED6A 2VH7A 3SQGB 1RAJA 4X66J 2MKKA 1NKBA 1KQGB 1GX5A 3V6DB 1HQ2A 5IT9U 4LSLA 2HHSA 1UPPA 5HQLA 5HN0A 4ZVQB 5KFQA 2ASDA 3DM2B 3Q86A 3R5CA 3HHLA 3C16A 5GAHU 2DY9A 4IH6A 4RBVA 3BYRA 1VQ4S 4CIOA 2GC8A 2KRRA 2F7VA 3VAGA 3VAJA 3Q0AA 2LKZA 4H4MA 3H90A 3FQKA 2J5AA 1CLFA 1V3SA 2DB1A 2LYVA 4C3MA 4TU8A 3T9ZA 4I68A 4WP9A 5KFFA 1HI1A 3B78A 1V3RA 2CFXA 1IR0A 3GLJA 2OD4A 2AJQA 3R7SB 5JJBA 2DXEA 4GKKF 2WSFC 4KV8B 4ZVGA 1BQXA 3J7ZT 3CCSS 1QJHA 1UVMA 1YBTA 2OSRA 2QYCA 3HX9A 4GKKJ 2WVBA 5LMUF 3RZAA 2OPRA 5IQ6A 3GFHA 3G2XA 4ITSA 1ITPA 3DYCA 1KQFB 1FDDA 4OZ2A 2XLJA 5LMUJ 5CHCB 3QPIA 3TX8A 2UP1A 5C5JA 1NB7A 1JJ4A 3PKYA 4DXLA 5T7LA 3CCJS 1WC1A 5AJ3F 4MIBA 5KFAA 3GFZA 1P8GA 4FYYB 2QIFA 2I2YA 2AP6A 1NSQA 3TVKA 2J9CA 4PABA 4H54A 2CPXA 1R0CB 1M5PC 5AJ3J 4K59A 4UQTA 3VWSA 1ZZNA 3HKZD 3QIPA 3H20A 1JKHB 1I1GA 2V4JA 4WTOB 2H48B 1HNVA 4UOFA 4FNHA 5A8WA 2Y8YA 2CXEA 2FLNA 1KOHA 2XM3A 2DGSA 3AQPA 2AJ1A 2VQEF 1YJWS 1RAEB 1QSYA 4R5PB 2HAIA 4ZLNA 4ZVOB 1VRUB 1EETB 4CLUA 2VQEJ 3D0IE 4NZ7A 1X4HA 1WHWA 2C1EB 3CJ2A 2VDHA 4MYUA 4DL4A 3CJQA 2AF6A 1JLEA 4LBPA 3JSMA 5KFUA 3QRQA 4LVOP 2X3GA 4F3OA 3IRWP 2XZTB 2DHAA 2J0WA 3C6UB 1R8BA 4PYAA 3NAIA 2IRUA 3J80Y 1R8PA 4PPDA 1ZM4A 2M2BA 4DSLA 1QAXA 1U7LA 4DEZA 1IJFB 2EK1A 5DLGA 3MUMP 4J7CA 4LFCF 4DX7A 4PYDA 1XMQF 4JI2F 3NRBA 1APSA 4ZVPB 1ELYA 2E9RX 2Q3PA 4DF4A 3SV3A 1FFGB 4LFCJ 1SKSA 3HT0A 5A6WA 1XMQJ 3WIUA 4JI2J 3DLGA 4RO0A 3SFUA 2C2NA 3N6MA 1HQUA 2UV8G 5E7OB 3RU0A 3OR2A 4Y2MA 1DTQA 4IG3B 2HFVA 3CO9A 4UOHA 4I64A 2BACA 5KT6A 2E1CA 1GXUA 3FBCA 3K89A 1S9GB 4ZMMA 2MGZA 4WYWA 1B7FA 1NB2A 2EFOA 2R7TA 3T5JA 3W64A 1BY9A 4DLGA 3R5BA 1S1UA 3QWUA 4JI4F 3VHQA 1X60A 2BMBA 5CCLA 2F40A 2E7WA 1FKPA 4WFYA 2N7CA 3KOAA 4DOZA 4JI4J 4B3OA 2OPSA 2V2QA 3US5A 3QGIA 3U1NA 1UVNA 1H73A 1N32F 1DLOB 3V4IB 2VBYA 3QMQA 2CPFA 3R1LA 3RUBL 1JLCB 1U2RA 1N32J 4PPZA 2KYXA 2QLXA 3HJFA 5EUHA 2RU3A 3W60A 3G6VA 2A2DA 3LWMA 4U7UK 2GA7A 1F1BB 1N5QA 3W61A 4HTJA 3V6DA 3WAXA 1I51B 2ZJPQ 4OMFG 1O51A 3RYLA 2HNDB 3B82A 1U1MA 2DGXA 1RYSA 3SFGA 2O3DA 3M8PB 3E3XA 2HVEA 4A8SA 1HPZB 4B9MA 1TFWA 5C25B 2Y9HA 1TUVA 3CC4S 2B9YA 2MKIA 5E5NA 2OPQB 1T9UA 3B8HA 1SPBP 1UP1A 4OYZA 3E8OA 4QR1A 2WOMA 1O0PA 1XNRF 1QD1A 2ZE2B 1W26A 1QE1A 2Y1RI 3P8BB 5CYQB 1VJQA 3BPSP 4M5NA 1VJWA 1XNRJ 1MWZA 2M88A 1JK9B 2DNRA 5ETLA 4UQGA 3G8QA 2FLOA 1S6PB 3HD1A 2HHHF 3UWTA 5LJ5Y 4OHWA 4PR6A 1OPIA 4KV8A 5F8MA 4DFJA 3NNAA 1KP6A 4USWA 2G9OA 3PRBA 3PFOA 3MEGA 1VHIA 1HQEA 3I5AA 2HHHJ 4DQQA 5L8RC 2LU2A 4A8FA 3AAWB 2J7WA 4N41A 4P10A 5F8GA 1H7WA 3I96A 1FESA 5F9LA 5BXIA 4I7FA 1TFYA 1UA0A 1HMVB 4KT0C 2FJVA 3S8SA 1XR7A 4DSIA 2N3OA 1YWXA 2FJDB 2ZBPA 4FXDA 1DQ8A 2HGLA 3JAMU 2V4RA 1T9TA 1NK8A 1FJEB 1RLCL 5JVGQ 2X7IA 2MZ1A 2RF2A 5E3RA 3QT5A 2RNEA 3MCSA 5JVHQ 1C0UA 3DRPA 2IVFB 5HQMA 3WZ0A 4YB1P 3SI8A 4NLTA 3PYFA 1A7GE 1RWXB 4X4VA 3Q8VA 1XQIA 1S6QA 2RSQA 2HWIA 1BUXA 4XDDA 4R5PA 1KSPA 4ZIVA 2XB2D 1VRUA 4IH5A 4QR0A 4R25A 3K5LA 3B4DA 2EG2A 3J7A1 5GMEA 3MPWA 1UVLA 4JP8A 4OJ3A 4CH0S 5HAOA 4CLZA 3PJXA 4LQYA 4ZJOA 5ETMA 1EIYB 1UFKA 3I0SB 5HMXA 3UD4P 1HW8A 3AT1B 3BN4A 1S1TA 4ZHRB 1U0HA 4KGXB 3QAEA 1M5SA 1GMWD 2C2MB 3PIPQ 3TI0A 4DR5F 3M32B 2J8AA 1PILA 3OT9A 4LQ3A 3KLHB 4NCBA 4U6PA 2PMWA 1RKJA 4DLEA 4USUA 4WFNQ 3AD8C 3TVZA 4H4KC 1PIEA 3OVSA 2LXIA 4KO0B 4DR5J 3JQKA 1KHJA 3THVA 1LOUA 1K8AT 2KVQE 1P27B 3HHDA 4K7QA 2POKA 4ZN1A 4WF9Q 1CQNA 4IDKB 2ZH5A 3A3PB 4RL1A 5BJRA 1Y3JA 4DZ6A 4BWJA 2B9WA 3FKBA 3KKFA 1QM9A 2HVZA 2MZTA 3H2UB 3M30A 4WIIA 3QLHB 1X5TA 4ELTA 3PFEA 1VLOA 4RU9A 4U9RA 3W9IA 3L7OA 2MLZA 2J7UA 1RAOA 3CJTA 3UDCA 4B9UA 3NOGA 2IRXA 4QWDA 2KZMA 2M9KA 1FRHA 2NYIA 3FC9A 1NDKA 2PA3A 2J9DE 4AL7A 1VC0A 3UDLA 1GK8A 2AEFA 1DQ9A 3V4MA 4LFAF 4RR5A 2XYGB 3EZ5A 2HG4A 1ALJA 2AGPA 5LRNA 2DKOB 4XPCA 4J9SA 3M05A 4LFAJ 2B0GA 2XMMA 1DLOA 3V4IA 2D7SA 1NBEB 4WFBQ 5E3CA 3OL8A 1OY9A 4MY4A 2AGQA 2QLJB 1JLCA 1D3WA 4OX9F 3T41A 5GAGI 3PW4A 2GX8A 3IGYB 5K8OA 3EWGA 1RBAA 1TKXB 4Z37A 3MM7B 2VZ9A 4LUBA 4OX9J 4DUYF 4ANEA 2BQRA 3TUPA 3EGWB 2OMOA 5K8MA 2DGOA 1FKOA 1RGVA 3M8WA 1PBUA 1CJVB 4DUYJ 2E66A 2DIVA 3MUTP 2X1AA 3K7RA 2LCWA 1M0SA 3MR3A 1HPZA 2HHVA 4WKYA 2NUUG 1U2CA 3MMBB 1MWQA 3AOAA 2XI2A 3A52A 3HMJG 5K5MA 4F3MA 3A8KA 3QRPA 1RT2B 1G6BA 1UWAA 4PXBA 2HQIA 3LAKA 3GV8B 1DJ0A 4KGKA 4W4MA 5K14B 4ANDA 3CSKA 2QL5B 4FKYA 1B64A 1NPPA 3VQSA 4CZCA 5D78A 3F41A 1N4LA 4TYAA 2Y1JA 2M3DA 1S6PA 4CYRA 4B3MF 2AJ0A 3IM9A 4L76A 2MQLA 1Q7YT 2C3PA 5KFGA 1KTVA 9RUBA 1GAOA 2DYAA 3EJMA 3VTIA 4B3MJ 4I6YA 2W4DA 3LUYA 1YIJS 4ZKAA 1BQNB 4NYOA 3H5SA 2HAFA 2V2ZA 3N4WA 3ICLA 2CQHA 2XSFA 2BE2B 4CTAB 2YPZA 1NH8A 1HMVA 3ET6B 2HS4A 1FEEA 2VG5B 3HFKA 1TV6B 5HROB 2VBWA 3OV7A 1KN6A 3PRVA 3CIMA 5B0BA 1N5TA 3D0HE 1S6OA 3AHPA 2WVFA 3N5FA 5KAKA 2I38A 4KH0B 3MM6A 1L3SA 1MW7A 3HHLC 2GGPB 3MAHA 2JC1A 3AY0A 4RUCA 1JLFA 2CJKA 3EX7B 3MM8B 2Q66A 1J27A 4RNMA 5KT7A 1QUPA 3TUJC 2OEKA 1CJTA 1VQOS 1EKRA 2V2VA 2GZOA 2FHJD 1NU4A 3KNGA 4OYOA 3R6LB 3OW2R 2W4PA 2FQQB 4LF1A 2NXJA 1GTEA 2O1PA 4QW9A 1F2GA 1N36F 1VISA 2ZBRA 2QTWA 1RHJB 1HD0A 3UQSA 1YJUA 1N36J 1S59A 1HWLA 1S48A 3QT6A 5JMNA 5J1EA 3PYGA 1XNQF 4FF2A 1RT3B 3BM7A 3E01B 4GTZA 1JQGA 4CYSA 3WC2A 4KGVB 2NLWA 1JIHA 5EWGA 3IWNC 1XNQJ 4LBIA 3I0SA 3IAS9 5DDRC 1TZ0A 1JNRB 2OI2A 2KM8C 1CC8A 2XNRA 4FN5A 2W4CA 2DGQA 4OI1A 1XN9A 3TX0A 1R6YA 1RT5A 1TL1A 3MXHP 4LF9F 1VQSA 4HACB 3JAMY 4EZ6A 3WBZA 3Q23A 4KO0A 1CVJA 4C3LA 4F4YA 1SH2A 2E44A 3D3BJ 4LF4F 8ATCB 3PACA 1TMMA 2EEYA 2DRBA 4LF9J 1S99A 3ZZRA 4EYIB 2HURA 4AQYF 4EMDA 3GJQB 1ZYQA 2ZZTA 3KG1A 1D1UA 4LF4J 1UPMB 3CCLS 3DMJA 3ZO7A 3L7PA 4B9LA 1PYSB 4AQYJ 2IAJB 4OYAA 2FJEB 2AX0A 3QLHA 3IMQJ 2BKNA 2DCLA 2N7YA 3DLHA 1KWMA 2NCKL 3HCXA 3CJRA 1RABB 4URQU 4EBEA 4UZCA 3VAHA 2QZUA 2GJFA 3D9BA 4QR2A 2XI3A 4Q8EA 1AXQA 3OUYA 2IHR1 2CJXB 1UZDA 3NNCA 2XY5A 2YKAA 4F4XA 4Z7CA 2CQCA 3IP0A 1CJUB 5KG0A 3KDOA 2R7UA 4LF8F 1FSUA 1I94F 2DHHA 2EC0A 3GJTB 1W7WA 2HVDA 2B4PA 1SKRA 3NLCA 1UJ5A 2CWXA 4LF8J 1PAEX 1I94J 3MECB 4P75A 1Y6VA 4X2BA 4C8OA 1OY8A 3NKNA 3FQLA 3JTPA 2ZUAA 2IVYA 2RD5C 2HK3A 4NRUA 2D9OA 4CLFA 2DBBA 1RISA 4PUOA 4DQSA 2VIHA 1TKXA 3TZYA 4F4ZA 3MM7A 5ETTA 4DR2F 1XERA 2XGQA 4YFUA 2VV5A 1AFJA 2MJNA 2ACYA 2LMIA 2ZH3A 3PNIA 1NHVA 1CJVA 4U96A 4DR2J 5D0EA 4Z7YA 1HWJA 3RRHA 3DYAB 1S5ZA 3FSXA 2CVIA 3DRRA 1OIAA 2DNYA 3S7RA 3PW2A 5L38A 3G71S 3MMBA 2AD9A 1NPRA 2BJ3A 1OQ3A 4QWEA 4DV7F 2XR9A 4GVBA 1RT2A 3KJNB 2CZVC 3FUYA 2LA6A 1FWLA 1PYOB 4OYBA 5G0RA 5K14A 4MJKA 4ED4A 4DV7J 3CD7A 5G4DA 3VR1A 3UD3P 1IKXB 2CIMA 5DLFA 3OXGA 3AXKA 2FLPA 1Y5IB 5HBMB 2ROGA 4C8MA 1FWKA 1U2FA 1S1WB 3BSOA 1XWLA 5H1SV 4DF8A 4NA1A 5KFHA 2VFVA 3RJMB 1RQ0A 2YPYA 3OPKA 3ED4A 3D1QA 2R9LA 4LF7F 3TUIC 4DS4A 3CVKA 3DOKB 1F60B 2BE2A 2QT7A 5INHA 4KE5A 3J81U 4CTAA 1KBRA 2RS8A 1G3OA 2LU1A 1YJRA 4Q0BA 4LF7J 1EX8A 3ILIA 1WSVA 4HR2A 5LSLA 2VG5A 1TV6A 3NG8A 4GVLA 3N6NA 5HROA 2ZDPA 3I32A 1LKZA 4DPXA 1WEXA 4MK7A 4USIA 4CYUB 2QSFA 1S1XA 4QOTA 4DSEA 4OX6A 3HP6A 2BW7A 1RLDA 4J90A 3GG0A 1ZTWA 4EBDA 1XR5A 2WTFA 2HQGA 2ASJA 1T9VA 6AT1B 2UZAA 3F56A 4NLGA 2QLWA 1NK5A 4DV4F 3ZFVA 4O4RA 2KRBA 4WU3A 4U8YA 4ZG9A 4ZPVR 4DV4J 1HQAA 1HW9A 3CDWA 4XO0A 4EUVA 1X4EA 1UJ6A 3SZ2A 1VGYA 4Y6IA 4FXVA 3UCGA 3KHLA 2Z56B 2RQKA 3R7NB 3K5MA 4D3HA 2GAGC 4A48A 2HHUA 4TY8B 1RT3A 2B51A 2RIJA 1JLBA 3E01A 5L39A 4DG1B 2QJ3A 1RAHB 1NDLA 1K73T 2ZWPA 3MF5A 3KLGB 1V5VA 3TA0A 2G2OA 1U1RA 2O67A 1IR1A 3OFFA 2XO6A 1F6TA 4O3SA 1YJNS 1U25A 2VFRA 4P6QA 5HANA 4TLRA 3VZHA 3GJRB 2BA9A 2AGOA 2KH9A 4YP3A 3GYXB 1FT8A 1Q1KA 2A18A 4HACA 2BQ3A 1EB0A 4WE1B 5HO4A 1H3DA 1QVFR 3ADAC 1VRQC 3L95X 1TL3B 2I5JA 3IS9B 1AUDA 2H5JB 5KFOA 1L3KA 4OZ5A 4WXOA 2W2QP 2FVQA 4PWWA 1HWKA 2W8KA 2HBRB 1TL4A 2M52A 2QLBB 4EU0A 2EWHA 2H51B 5BR8F 3IBFB 2HRYA 4QIGA 3DRSA 5D3GB 3KK3B 1V6HA 2DJWA 2W8LA 4NRTA 3B54A 2CQBA 1ULRA 3ZNJ1 1IKVB 5BR8J 2PI5A 2B56A 1HD1A 4XPEA 2RS2A 5LT5A 1ANIA 3DHXA 4CO4A 1WC0A 2QZ8A 3EUNA 1GT8A 1YBUA 2Y1IA 1NK0A 1U1KA 2OEMA 2QMWA 2FJBB 5LIAA 5KG5A 2BYCA 4KGZB 4ECWA 1KLNA 2R2UA 3NCRA 4DV0F 4F36A 1FDAA 2IBKA 4DU7A 5K8PA 4X4TA 5DQHA 1AROP 2VODA 2LFVA 4DV0J 5KFMA 1LQ9A 4K4UA 1FRKA 1WHVA 5E33A 3FK4A 4A8YA 3DLKA 3SCLE 2JFKA 1VC5A 3NGDA 2GW8A 1GH8A 4JI6F 4DCJB 2QA2A 3RGIA 1HNXF 4NI2B 3QZ8A 1ZAVA 7FD1A 2G4BA 1NSPA 4CO1A 3GIJA 3Q2SC 3DYAA 1ZAWA 3SSSA 2KT3A 4JI6J 2CNNB 1BD6A 2A2CA 3FFIB 3D6MB 2DISA 1X5PA 4JI0F 1HNXJ 1S77D 2VASA 1HKAA 1B3TA 3BO4A 3IBCB 3HFZB 1EI6A 4JI0J 4HHUA 2F9DA 2NR0A 1RU2A 2HS3A 5KFDA 3MM9A 4O0IA 4C7QA 1MROB 1JWWA 1X4AA 2Z30B 5AXMA 3P5TL 3R1HA 2VICA 3PKMA 4FBTA 1WC6A 1VBZA 5I3QA 1KFSA 5BYRA 3CD0A 2F4VJ 1X5OA 1KHWA 1WACA 2MZRA 1SKWA 4C8LA 5D8HB 1R8AA 5EX0A 3PM9A 1GXTA 4FZVA 2YKOA 2EFQA 1O98A 2LP4A 5ETSA 1UVJA 4ZLLA 2LECA 1ALKA 4DR3F 4ILMA 5DDPC 4NXMF 2O66A 3NOCA 2MXYA 3AQOA 4TY9A 3G82B 4DR3J 5LRMA 3K0JA 4KKOA 2BABA 1M5KC 3DOKA 5B0CA 2ZWOA 4DPTA 3I5BA 1RHQB 3MMCA 4Y28C 2BKOA 4NXMJ 5FDLA 4QQBA 1B0TA 4I2PB 3Q22A 1N2LA 3BDFA 5DDQC 2O01C 4F67A 4FNIA 1ZEFA 1LWXA 2R7QA 2UV8A 3NMRA 4ZPBA 3I9ZA 5SZTA 4WBFA 4DL0C 1Y7AA 5KOWA 4TQRA 2LDYA 3AD7C 4RX6A 3ISZA 5J2MB 2OO4A 3DDKA 3PZPA 2W25A 1SHQA 3LO3A 2Z2ZA 2YNIA 4P74A 2CKWA 2C22A 5A76A 2EKYA 4CT8A 2KB2A 4PWUA 1GQEA 2BJ7A 2JVOA 1RHUB 1TUWA 3ZZ0A 4A47A 1RWPB 2H9ZA 3GPAA 4HH0A 3SIPB 2Z2MA 4KR0B 3CB4A 3PDNA 2GO9A 3R6GB 2FC9A 2VJUA 3BR9A 3LGNA 3CJ5A 3CTRA 1P49A 3X3UA 4RW7B 2RE1A 3RW7A 1X9SA 4WFAQ 1C1CA 5KFWA 1N56A 1KOOA 1FEHA 1IKWA 3KLGA 4MK9A 3Q83A 3J81Y 1NSKL 4DBQA 3Q8PB 5F41A 1FCAA 2DO4A 2BBEA 3FEZA 1CG2A 4Q2MA 1JMTA 2AZ3A 4C0HA 2GVZB 3C14A 4ECQA 4WE1A 2BEFA 3TA1A 1FNMA 3Q8YA 2ROPA 3C8YA 2MLYA 1W25A 2C3OA 2HZVA 2FVCA 2N82B 3CCVS 1VQNS 5LQQA 1FVQA 1MN7A 4AT1B 1YHQS 1KHVA 2Y1LB 1JB0C 4IO1A 3VQTA 5GAEI 5D3GA 2GV1A 2D3O1 2LEPA 2ILZA 1R31A 2G13A 1IKVA 2MZQA 4LIRA 4OLPA 2DNQA 3N0VA 3NBPA 4AXIA 3KUEA 1WOOA 1QY7A 3D54A 3KWMA 1QSLA 1QTMA 4P2MA 1VQ9S 2EBGA 4LRCA 3T1YF 2CQIA 4ZLJA 2FVSA 1RP5A 2OH2A 4FYXB 5GADI 2FHJA 3TP2A 3KLEB 1F3FA 4AUKA 4PXDA 2DXDA 3RAXA 4FF1A 2Q1LA 3A8JA 1OPZA 4NPOA 1P9YA 4YB5A 3T1YJ 3ZTQA 4FKXA 5EN1A 3KK1B 2QLFB 2BQUA 4K4XA 5K4PA 4OHYA 1WC5A 3S01A 4DL6A 5B0FA 2W2PP 3AJ2A 2XLKA 2YKQA 2HQFA 4DDFA 3BGOP 4GO5X 1JXEA 2JHEA 4RU2A 5DZ7A 3EYZA 1U6BA 1VHFA 4FS2A 1T11A 1SXLA 2R7RA 4B9SA 3DGPB 2GJIA 3BQ0A 2KXHA 1RA7A 4DV5F 1IWGA 3IG1B 3NXZA 5K8NA 3BSCA 2WVCA 2BR0A 1B4SA 2W24A 4X4SA 1EW8A 4GMKA 1JJCB 5BYSA 4EO8A 2IM1A 3ZZOA 4DV5J 5K20B 2DR9A 4DUTA 5E0OA 1ZAXA 1WEYA 4NXNF 1NJWA 3SXLA 2D3ZA 2EKNA 2QA4S 1PO6A 1ZBTA 7FDRA 2AEMA 3CNQP 1W2IA 5C24B 3A3OB 1HBOB 1RTHB 4NXNJ 2ZNYA 1AW0A 3PHTA 3GSDA 1WD6A 4HI2A 4TYBA 2LLZA 2GMLA 2DEJA 2C2OB 2DH7A 2BDPA 3BGLA 2RB7A 3ZTOA 2FHMA 1CBKA 2RMLA 3AD9C 3NKOA 2PD1A 2MEWA 4P72A 1BLUA 1I5OB 3DXBA 3MPVA 3P5BP 1BC6A 3D5MA 1AA1B 1ZPWX 2XS7A 3I0RB 3MEDB 5A8KB 5KFTA 2CPEA 4ED7A 1HLWA 1IQZA 4X64F 1RB0A 3M8SA 1B70B 4IFVA 1WG4A 1IM6A 3ONQA 4DV3F 1HJKA 4ID5B 1DBDA 2G0IA 1OYDA 4DX5A 1ZZFA 2FB0A 1FI4A 1FJ7A 4QU6A 4X64J 3FCWA 1UAWA 1YLXA 4DV3J 3FVYA 4ED3A 1YJ7A 4I2PA 2W9AA 5KG4A 1KH9A 4K4TA 4O3PA 1X9WA 1PJ5A 3GCWP 3KLFA 3RBDA 5F9NA 4LF6F 2DGUA 2HRTA 1KD1T 3W5ZA 4LF6J 1DTTA 2KDOA 4NZ0A 2ZC3A 1KHNA 5J2MA 4U95A 3C2PA 4BWMA 2XGPA 2E7XA 2F9JA 4NLOA 4K5RA 5IT4A 2LA4A 2PFFB 2JFDA 1U09A 3WHIA 2KHCA 4K4WA 4X65F 2JEFA 3B5QA 3UD5A 2ZZNA 1UTAA 2HWHA 1VDHA 1M5VC 3NP5A 5DQGA 1YK9A 1KDNA 2IVMA 4MIVA 2UXDJ 4X65J 2PEHA 1MSWD 1XTZA 3O8WA 1KHKA 2OUGA 4EGLA 3Q24A 3H8YA 2ZHAA 1NKCA 3ILLA 4ZA1A 4ER8A 1D0EA 1Z1ZA 2B9XA 3KK2B 2HS0A 2NXEA 4PQAA 1FTRA 2VONA 2V63A 1XIQA 1PSDA 4K5SA 3PEJA 4LRFA 3M2RA 1A9NB 2VG6A 2R2TA 1RT1A 2ATLA 4RWXA 1MN9A 4QJVA 5ETOA 1HI0P 2R8KA 3MUVP 1W2BR 4W92B 4RPFA 2YBVA 4MMOA 3CT9A 2DITA 4FDFA 5BYQA 2C2KB 2RT3A 3GV7B 4RUBA 4WCEQ 3EE3A 1ALHA 4G1PA 3KHGA 1X31C 4ZN3A 2X1BA 5DLTA 2MHEA 3V2UC 3IWXA 5K9FA 2DH9A 3M9NB 3NCPA 4ICLA 4DFPA 4LR7A 5J2NA 2IY5B 3CJKA 3T5HA 1RCOB 3LF0A 2V5HG 2D3UA 1B99A 3IBWA 1R8HA 1NK9A 3JSRA 2K7JA 4KIAA 3T19A 2V4QA 1JLAA 1PCAA 2LDIA 2CJYB 1SIWB 1OY6A 1UL3A 1RHMB 4YOEA 5D0RA 4NWJA 1EKSA 2DR6A 4Y2KA 3ILJA 3DCAA 3JQJA 4OI2A 1YITS 3W5XA 4HL9A 1AJDA 3W7BA 5H9EK 2YXLA 5HMZA 3KLEA 4DCPB 2UU9F 3P96A 3FSYA 3A1YG 3G8SA 2CDQA 2QO3A 1QAJA 3UNYA 1VQ8S 3CUNA 1DRZA 3IWLA 1ZH5A 3U1LA 2VFSA 2UU9J 4YN3B 3MURP 3ILOA 2DEIA 3R97A 3M1VB 4NMXA 4MKVA 2RKIB 5HP1B 2V50A 1AJCA 1YQHA 1RADB 2HFUA 3DGPA 3IAM9 4KQZA 3J80U 3IG1A 2HBQB 4IFYA 2C28A 1IQTA 1S9FA 2FY8A 4UPIA 2HPUA 5THWA 2ZJQQ 2XYHB 4B9NA 2NQPA 2WVDA 4J9OA 1UMJA 1SJ3P 1URNA 2E1AA 5KG7A 3CWJA 3WQPA 1IBLF 2CJAA 2HNZB 1VRTB 1T94A 4V1Ak 2B6AB 1N54B 2CRLA 3ZZPA 4BC7A 2RILA 2NXCA 3SYZA 5C24A 2BOAA 2GSNA 3OR1B 1CC7A 5CD4A 4ZPDA 3QATA 3MM5B 1URAA 2YNFA 3BZQA 5KT5A 1WDDA 2COLA 4QAXA 1RTIB 1J2VA 2ADBA 1VI7A 1XBWA 4NLXA 5I3UB 5IJSA 2P6TA 5IWAF 4J9PA 1TELA 2VA3A 4IRCA 2QG9B 3RR8A 4PWDB 3MEDA 3TUZC 5A8KA 3PG9A 1HHSA 3M6XA 2N3LA 3GSIA 3D1HA 4ID5A 4DPYA 1S72S 1U24A 2KL8A 4G1IA 5KFZA 5DZ6A 2RRNA 3Q8UA 4C8ZA 1AUKA 2L9DA 3NGUA 2LQ9A 5A0YA 4J37A 3DC2A 1C1BB 2XWXA 4YR1A 4KFBB 2GMHA 2FDNA 3PR4A 1U02A 1AJBA 3CIZA 2UVVA 4LREA 1RT6B 2DCUB 4Q8FA 4C4WA 2XSJB 3G96A 2YX4A 3FEXB 4KJIA 2MKSA 3MGJA 5GAEU 2JDJA 2AYMA 5HL7Q 4ECVA 3I55S 3PJWA 3FNNA 1FE4A 4LSNA 5LJ3Y 2D41A 4PG7A 1TK0A 3TW0A 4DV6F 1ZPVA 1ELOA 3SQOP 2IDEA 2VPYB 1E6VB 1ELXA 2HHXA 5B09A 5GADU 1TL5A 4DV6J 2ZEJA 4JBCA 1Y5LB 4CI0B 1Q79A 2RRBA 3D0GE 3QFHA 1YKWA 2OD6A 4MKBA 3WDOA 1RWWB 4PG8A 1OSDA 3H59A 4E98A 4CO2A 3OTOF 3NVLA 1LEOA 2R7OA 1T03B 5HVFA 2JX2A 2YKNB 3EMTA 2HIQA 2QA4G 2M70A 3KK2A 1UFWA 3GB0A 2JVRA 2ZD1B 3OTOJ 1NCLA 4DV1F 2L3MA 2AJ4A 2HIYA 4ELUA 1AT1B 5KFPA 3HF5A 1MWYA 4ZPAA 2HQDA 4M63A 2Y0BB 3R8YA 3HZGA 2J6TA 4DV1J 1T05B 2C42A 3CCZA 3M4XA 3RG6A 2GNKA 1KKHA 4KSEB 3HM9A 9ATCB 3J81j 4KC5A 3K2YA 2R7XA 1ZETA 4MFBB 5L1IA 4OX7A 1FTCA 3DU5A 2Z58B 3UR0A 5C7PA 5ETKA 2YX7A 3MMAB 4PG6A 2W5SA 1R89A 2K7KA 2CWKA 3MEKA 5B7WA 4M5KA 2XTJP 5EGEA 2K2PA 1EQMA 2FJXA 4V19J 1HBUB 3AJDA 2UUCF 2D9PA 3P3DA 2BRKA 1SIZA 2AW0A 2OEJA 1FE0A 3CDBA 3R7BB 1SC4B 3EM1A 3Q2TC 2UUCJ 3KG4A 1C0TB 2AZ1A 3H5YA 1KC8T 3UNGC 3HVTB 1NK7A 4ED5A 3ZXWA 3QSYB 3RAMA 3EZOA 4M5LA 4RNNA 5JXSA 1S1VA 2XS2A 2JEGA 2XMAA 5F8JA 3GCXP 4B3RJ 4WZMA 3HHLD 1JLGB 3M1VA 2YQ3A 5CYMA 5C42A 3R2CJ 5IOLA 2KJVA 2OFHX 2VC0A 1SKUB 3MR5A 2FHOB 1VIXA 5H9EJ 3R5DA 1K0TA 1Q8KA 4USKA 4NEYA 4CLWA 2XULA 2JLEA 1KVJA 4KPCA 1REGX 3D6TB 1Y11A 1GEHA 3MAQA 2FHKA 1ZA2B 3EVWA 2R4FA 2HNZA 1VRTA 2VOOA 5HQ8A 2R8GA 3KNAA 3IGZB 5DRKA 3M6WA 2VBZA 1HR0F 4PQUB 4OHZA 2VKRA 1QSSA 3CMES 3NS7B 2XC9A 3D2WA 4YEAA 1TVRB 4NWBA 2B5JB 1CULA 3MM5A 1HR0J 1FF2A 2K1RB 3POTA 2QV6A 1TMJA 2EFVA 5IV3A 3LALA 2VA2A 5JUMA 1N33F 4MIWA 4ZCMA 3PJ9A 4J9LA 2V69A 1RT7A 3KHHA 2Z8QA 1S7IA 3PTWA 1N33J 2IFXA 3R3TA 1SQEA 5CXTA 1L3VA 2HLUA 3BH6B 4ZVSB 2H4WB 3BDEA 3WX8A 2FTRA 4LRAA 4BBYA 3KJVB 1N52B 2VUGA 3GTYX 1D09B 4CCHA 3LP1B 1E1ZP 1WTFA 2AWZA 1LK5A 5HLFA 2LXFA 1RWOB 3IO1A 1QAYA 1ZOTA 1UEKA 4C0OC 3DXSX 3MAAB 1C1BA 3HSDA 4NE9C 2UVRA 1KVIA 3A3NB 5DGBA 4WFXA 3U02A 5E3AA 1UETA 1RT6A 3AA8A 1SB6A 4Y3CA 4B02A 3GONA 3D7SB 4NLDA 4QBUA 2FUG9 4KHMA 2MB0B 1MU2B 2UXCF 1RXOB 3QYYA 2CJBA 2RQCA 2E5LF 4QW8A 4TU9A 2IYIA 3IGNA 2W9CB 4MTPA 4ES1A 3BQ1A 1VR6A 3TAMB 2UXCJ 3KFWX 1SUQA 1E6VA 2E5LJ 2AJ2A 1IM4A 2B9EA 4I69A 1Q5VA 2DGWA 2NSCA 1U6FA 1E3CP 2PMZD 2J9EA 4F0HA 2PMHA 2Z2YB 1REVB 1RE1B 1VCTA 2VPZB 2XHCA 3IM8A 1N88A 3WAWA 4QYZK 5L9NA 2VG7B 1OO0B 1T03A 4BLGA 1YVFA 2OGUA 2V8VA 3TO8A 5ADZA 4DI6A 2ZUGA 4G1QB 1RTDA 2ANHA 4UORA 3W2WA 1SI9A 1NSAA 2YKMB 4JI5F 3FRZA 3T6BA 1JNZB 1SCJB 2RH6A 4JUZA 3CCMS 2NPIA 2HRUA 4N7TA 4HYKA 2CQ0A 2G1DA 2Z4PA 3QJPA 2HEKA 3MZIA 2XMTA 1IKYB 1FNOA 1KQKA 5LXYA 1T05A 4JI5J 3DHWC 1L5UA 5I42B 2XBPA 4NA2A 1RA6A 4C11A 2QMXA 4QCLA 1B7YB 2AIRB 3SQGA 3VGTA 4CO5A 2YTCA 4F4AA 1Y0HA 4DR1F 4ETXA 1HL6A 2ZM6F 2YWHA 3N9UC 2DR5A 4MFBA 2SXLA 4DPUA 1YDLA 3N6LA 4DR1J 3DM2A 2ZM6J 2D74B 2RRAA 2KFZA 4LRBA 3ZZTA 2PEBA 3PIOQ 2ZOGA 2CQ2A 2JJ4D 4BCAA 1F9FA 1GFWB 3GIIA 1ED9A 4TN0A 2KXFA 3IRXB 3FMWA 3HLUA 1HBUA 5C2GA 1CQMA 2DT9A 1NJXA 5A8RB 3AODA 3PX0A 1GXLA 1OWXA 1H2TZ 4RNOA 5L1LA 3THTA 2ZBQA 2JH3A 5DG8A 1K44A 4K0KJ 2QSWA 2L41A 4C8KA 1UFLA 2OJ3A 4JV2A 1YRUA 1AB8A 2K3IA 1IVZA 4EWTA 3RR7A 2MKCA 3FBBA 1OMSA 1Y7PA 2Z0GA 3ENWA 2HQCA 3HDSA 4ZDNA 1JLGA 4C0BA 5E41A 4KPYA 3LPEA 1N6QB 2GS8A 3FJ2A 3D4JA 2CG8A 4OYWA 5ETQA 3T6JA 1PKUA 2CNOB 3ELHA 4N8OA 2A3JA 2RUGA 2BJDA 3MR2A 2RQ4A 4ED8A 1U4BA 3L4BC 2M5YA 1LXNA 4RW6B 1N2KA 1XK8A 3ENAA 1H6KX 1BMQB 1WG1A 4ZP9A 2APOA 3QQCD 3ZTPA 2MQQA 4FPIA 3OJUA 3BREA 2HFOA 3TEGA 2ZC4A 3W8PA 1ALIA 4D3GA 2HBZB 2X3DA 3I82A 5ETVA 1MG7A 1HDHA 3RB4A 2MQNA 4O44B 2BUNA 4NCAA 3G6YA 3WC0A 4HKQA 1JKHA 1T3NA 1RT4B 2CDRB 2GIQA 1TVRA 4DJBA 1NAQA 5D6GA 3LP2B 2VOPA 2HBYB 5AXLA 2ABYA 1YJVA 3DI6B 2YQ0A 4MAKA 2KYZA 2GHPA 3KJQB 4FS1A 2HZCA 3HHKA 3UPFA 1NHKL 4OJGA 3QSIA 1UJ4A 4KY3A 3OHAA 1KTQA 1RWUA 2A1BA 4WU2A 1EETA 1WF0A 4OZ0A 1HNWF 2W9BB 1Q95G 2HMIB 2IUCB 1GX6A 3D1OA 3KJVA 1HIYA 4Q43A 2XY7A 1Z2ZA 4LRDA 2JEIA 4NCGB 2KG0A 1RKIA 1VC6A 3OTEA 5D4LA 1HNWJ 4Y2CA 1X4BA 3UFCX 2P6SA 4YS2A 4OIXA 3H2LA 3H0PA 3M8QB 4QWBA 5DQIA 4NLSA 1RUSA 1EQJA 2AX1A 3C6UA 3MAAA 2EFNA 3DFEA 1U1NA 4NWXA 1H7XA 4PEOA 4XIUA 3RTVA 3UCUP 1D9DA 3UDEA 2AV5A 3RAQA 3S1TA 4OHVA 1WI8A 3PYEA 4YR2A 2ZOMA 1YGYA 1TQLA 1H2VZ 5M2PA 4WP8A 3C6TB 3C16B 4LIWA 3EPIA 1X4CA 3QRRA 4J9MA 4UPHA 1GNKA 3QT8A 5DLVA 2HQ3A 4O3NA 1BXNA 2VHGA 6FD1A 3TAMA 4JI8F 2MLXA 3C66A 4UUWA 2WZ1A 1TU0B 3TQ1A 2VB6A 3NGTA 4IG3A 3U27A 1DZ5A 2Q6BA 4ZIWA 4JI8J 1WKLA 1S9GA 5H9FK 2CUYA 1X9MA 3TR5A 2BRLA 2WCXA 1E2SP 4HHHA 3SZZA 1REVA 1T0TV 4MYTA 4DMZA 2HHQA 1K1QA 2NUHA 3OLBA 1NEEA 3H98A 1Q81T 4IYQA 3D68A 3DDIA 4USMA 4XK8C 2XY6A 4YY3F 1I6JA 4CNZA 2R8HA 4JV1A 4UTGA 4G1QA 2ZNZA 3KMQA 3HSZA 1NJZA 2KM8B 1T8EA 4ZCLA 5F3ZA 2MZSA 2E9ZA 4YY3J 4M5GA 1IKYA 2HNYB 4IOAQ 2E1PA 1S0MA 1OJ4A 4LR2A 1PG5B 2ZKTA 1FNXH 4H4KA 1ACMB 1TL7B 4UOGA 1ROFA 1PYTA 1QVGR 3MI7X 1T95A 3VGVA 4QYZJ 3VF0B 4L3NA 2GJ2A 1WUUA 4GC6A 4DQIA 4AL6A 2F8EX 1WSRA 1VQPS 2DNHA 2HNDA 2YKPA 4WK1A 1VK8A 2EVZA 2CYYA 5A6PA 1FVSA 4F7VA 2FZCB 3M8PA 3GQCA 5HSPA 3OFHA 1U1PA 3SZYA 1F0XA 2V4JB 1V9OA 1X4FA 3OQ2A 2UUAF 5HMWA 5C25A 2ZH6A 5A8WB 2OPQA 2H65B 3IRXA 1RYRA 3VVUA 5L1JA 4KYZA 2UUAJ 2ZE2A 4DPOA 3EDQB 3QFWA 1U26A 5CYQA 4YHHF 4HLBA 2IRYA 2W7PA 3LP0B 2ZH9A 3JSBA 3MWBA 1R27B 3N5BA 3P45B 5IM0B 2J0XA 4YHHJ 1JXVA 3J7YI 3JSMB 1N48A 5EDWA 2B7CB 3K5PA 3EGNA 3W9JA 3PW0A 4IG0B 1HBNB 7AT1B 4B56A 1MNEA 3N28A 2CADA 2ZH1A 2XZDB 2DVIA 4JV0A 1N6QA 1P1LA 4WIQA 4USJC 5DG7A 4DSKA 1KH4A 4EEYA 1YG0A 4LMZA 2XMUA 3H2VE 1ZEBA 3K57A 3HFVA 2NZ4A 3SCIE 1N8RT 4RW6A 3JS9A 4B3TF 4G6VB 2GHWA 2PO4A 5IV4A 2ZHOA 5F3TA 2KO1A 1DFDA 3M8RA 1LXJA 1M1HA 3VCDA 4B3TJ 2F63A 1EW9A 1VMBA 2JWNA 3OR2B 1FXRA 3LGHA 4M94A 4OYIA 1SJFA 2V0NA 3HXMA 2MSSA 4O44A 3U7JA 5FIIA 5A2QY 2IA6A 1LNQA 2P5VA 2J6UA 1FDBA 2MGZB 1N5VA 1ZM9A 3ZZYA 1U47A 5KFKA 2LEBA 1TKZB 1T9WA 2YH1A 3Q8SB 4C97A 4NYZA 2ZHBA 5GRRA 1FKPB 4DL3A 2MKYA 1WOSA 2WBRA 4B3OB 2V9KA 5LL6d 3D6HB 1RWNB 4QWAA 2W9BA 5EGYA 1NUEA 4OZLA 1X7VA 1VQ5S 1FK9B 1YRTA 2CVEA 4F25A 5AE3A 4BC9A 3PO5A 4RJVA 1WC3A 1KH5A 4KHRA 3B6BA 2GA3A 3W1YC 3TG0A 2P8IA 2B3TB 3A13A 2PFDA 2XO7A 4ZHRA 4J9RA 1VQMS 3CMAS 3BGUA 3M32A 4EYHB 2HHTA 3ENQA 2VPXB 1TKTB 3KLHA 2JC0A 3CEDA 5AE1A 1LW0B 2VL1A 2YQ1A 4ZG7A 3LTOA 3TAQA 1CSJA 1WC4A 5B0GA 2ZBCA 3C6TA 2G2YA 4BDPA 2IBOA 2YY3A 2M4MA 4WXWA 3OVAA 4IDKA 2PSZA 2L9WA 4FXWA 2VFUA 1VBKA 1UEVA 2WOMB 4L72B 4Q45A 1KEKA 1KS2A 1QE1B 1T02A 5FLXY 2DNLA 2KU7A 2KKHA 1N34F 2AQ4A 2C3MA 4AL5A 1R7IA 4N5SA 1DHMA 3W66A 1WNEA 3C15B 3MEEB 1N34J 3QWPA 5KT2A 5HVGA 4RUHA 3MEGB 1HQEB 3CJSA 4Z2XA 2HW3A 5KT3A 2MHNA 1HWUA 4Y2IA 3H40A 2ZH4A 2LQBA 3MHYA 3BEGB 2KG1A 1ZEDA 3ENVA 4F50A 5H9FJ 2AYGA 2YX1A 3UE2A 5T41A 1RAGB 2HNYA 4I7FB 3OL6A 4PXCA 2NYHA 5GMDA 2GAHC 3TVYA 1IBCB 1EP4B 3M9OB 2DY1A 1TL7A 1XR6A 3V5RA 2DTJA 5KFRA 2FZGB 3NGKA 5GOVA 2IA0A 2MKJA 4RLEA 1HFEL 5MLCV 4ZVHA 1WWHA 2U2FA 4RKUC 4JOUA 3GV5B 2RF2B 4P2SA 2N4DA 2F8MA 1FRJA 2C2DA 2R8IA 3A8IA 4ZPCA 4HDHA 4OL8A 3DLEB 1C0UB 3GYNA 3DRPB 5L0BA 2MDAA 4I56A 2F3JA 4Y0FA 4L74A 2HSEB 5IC6B 1NO8A 1VS3A 3IN5A 1MMNA 4USTA 1G4CA 4ERDA 3C19A 1S6QB 2AEJA 1M1GA 2R8JA 1M90T 4X62F 4DN0A 1KHLA 2KN4A 4YUDA 1VK3A 1KH7A 3LP0A 3G6XA 3VAIA 4HT5A 4X62J 3GFXA 4CXUA 5CABA 5IM0A 4E2FB 1YSJA 4AFFA 3NAHA 4ZS6A 2ALYB 1FA0A 4IG0A 4WTYA 1S1TB 1HBNA 1U0HB 4I67A 4P2XA 4IH7A 1BQNA 5KFJA 1WI6A 2BJ1A 3NKQA 4X84A 4WK3A 1SBRA 4OI4A 3TJ8A 4FVCA 2JLFA 2AYBA 4L3KA 1URRA 3ET6A 2KI2A 2JSXA 4BHQA 3TWZA 1VQLS 2DR7A 1FFSB 2U1AA 4CDIA 2UXBF 3GG1A 5KFXA 2UUBF 2XMKA 4YDDB 2XWYA 1IBKF 4NLQA 1F9EB 4RBTA 4CLTA 3FZ2A 1TK8A 2UXBJ 4EBCA 1ZM3A 1Z4UA 4HH1A 3M30B 3KD8A 1D9AA 1LWFB 2GGPA 2UUBJ 1VBYA 2IMWP 3M9MB 5D4NA 1IBKJ 3MM8A 3EXCX 3EGZA 4DX6A 1FXLA 3KUGA 3AB2B 2UUWA 1S0NA 4RZRA 3CXCR 2YWKA 2QA1A 2VJVA 2L48A 2ATCB 3RBXA 2OPPB 3T1HF 1TKZA 4CLSA 2K3KA 3MMJA 2E5GA 1I3OB 5HVHA 1FRIA 3ZTRA 3T1HJ 3H5XA 3CCWA 4ENOA 3KJFB 4P52A 5GAGU 4UZBA 1KNZA 2FIUA 3TA2A 1FK9A 1U6ZA 2D69A 4GTWA 5IT0A 4WPAA 2BANB 2PGCA 4CQ1A 4ECXA 4OFZA 4NLYA 1U1OA 1DARA 1Z2LA 4LJMA 2DHXA 4ZK7M 4HTIA 4PZVA 5ETPA 1DQAA 3CCES 2RHQB 3OLAA 2F8HA 4OJ1A 4TU7A 1F5CA 1TAUA 5EWEA 4NLRA 3I31A 3QT7A 2DO0A 3PW7A 1TKTA 4KJGA 1FKOB 2DNKA 3T1AA 2J0SD 3R27A 3O1LA 3CMQA 3T5KA 1X5SA 1XMBA 2DXFA 1LW0A 1CEZA 3HPOA 3MK0A 3UI3A 5FJ4A 1LW2B 4C98A 2QGFB 2PC6A 2QMUB 3KHRA 4J9KA 4F0KA 1T9YA 2DHGA 4O0NA 2VD3A 2IAJA 3TYTA 1FFWB 3DPCA 1V5IB 4WZQA 2XNQA 5E3PA 4FPRA 2E29A 3NKPA 2HWTA 2BKPA 3J7YU 4RWWA 4XDCA 3GIKA 4ECTA 5ETNA 3C15A 2AKWB 3MEEA 1WDTA 3MFHA 2Z2LA 2GIRA 5J2QB 3G9CA 4UPKA 5DM6Q 3TEHB 3T5LA 4JB8B 5RUBA 5CZXA 3WBHA 3P49B 2B8QA 2CNLB 4ZP8A 4WP3A 3HHEA 3RW6A 4NOHA 3IR6B 6FDRA 3NKYA 4OYPA 1SC1B 1CJUA 4NMLA 3KG0A 3W3SA 2PE8A 1Q4RA 4OJHA 2XG8A 2PN6A 1H2UX 1NZ8A 3OXFA 3D28A 4X4NA 2H5EA 2G9YA 4OLOA 2YH0A 1HA1A 3MECA 4C48A 1E6YB 2CA9A 5IT9Y 4IRDA 1EP4A 3O5TB 1FHTA 5J2PB 1UKUA 1FRXA 3BJYA 4DZDA 1VLYA 2D1CA 4LR8A 2CG4A 1AFIA 4CLLA 3DOMB 5HI7A 2QE5A 1K0VA 5B0EA 4ZVFA 1KRPA 2CQ1A 3VGSA 3MFIA 5IQQA 3LPYA 3MM6B 3HI9A 1EHWA 2ALZA 1JLFB 2NXUA 1GMWA 5IJQA 2ZOFA 3DLEA 1CJTB 2CQDA 5DLWA 1H38A 5EGHA 4LF5F 2IMOA 4CO3A 1TTHB 4DS5A 1K9MT 5L46A 3MCNA 1F5BA 3BDGB 2D1GA 3OTDA 4LF5J 2NSBA 1WHYA 4Q7AA 3EVMA 4HVZA 2F4VF 2GLQA 2QFIA 3OXLA 4N56A 3TOQA 5J1EB 3JB9k 4DQRA 1IKXA 2CQ4A 4DV2F 1K1SA 4L6V3 3W9HA 1N0UA 1NM2A 5F8IA 4ILRA 1SHNA 4LVNP 2K06A 5HBMA 1VBXA 2KZZA 3BS9A 3BO2A 4DV2J 3HKWA 1Q7LB 5KFIA 1H72C 1S1WA 3OD2A 2Q43A 3PYDA 4RW9B 3FMBA 1S12A 2KVIA 1B8JA 4FDJA 4A8QA 1WOPA 4RUAA 3MCOA 4IKAA 4K4ZA 1RT5B 1TL1B 2DIUA 2HFNA 2E5JA 3ISNC 4ECSA 3LOUA 4QWCA 1FD8A 4PCQA 4QYRA 2KFNA 4ZLPA 1Q8BA 3JTNA 1F5AA 1YJ9S 5B08A 2AU0A 2RDJA 1YX2A 4J9NA 4EZ9A 1BWEA 1HWIA 1S79A 5KG3A 3HHNB 3GU0A 1U8SA 4CYUA 3CW2C 2ASLA 2ZDOA 3DMJB 4Q44A 3BGRB 2MQPA 3TAPA 2LQJA 1K7HA 4HHJA 1LWFA 1XEZA 2DRDA 2OFGX 1MMLA 2OP5A 2ZJRQ 4G3IA 2XEXA 2OIHA 2NREA 2YWFA 2HHWA 3EXYA 1SQFA 2E9TA 3OUYB 2ZVSA 4UW2A 4LT6A 2RVJA 2OTLS 2NS1B 3RBZA 1U45A 2OPPA 4K2XA 4N8NA 3A8EA 1QLNA 1RAFB 2R2RA 4NLWA 3RRGA 1HYSB 2JZ5A 2W2OP 4TY8A 2KXNB 2ZFHA 1LFPA 4DG1A 4IR9A 4ZCIA 5EX3A 3QGHA 5I3PA 3W8GA 4TQSA 2BANA 4DCOB 2XLIA 4ETZA 1X0PA 1H0HB 5DG9A 3MK2A 4PUOB 4O23A 5GMKa 1L3TA 3LA0A 4FBUA 2JL9A 1WORA 2RJZA 1EJJA 2DNPA 4OZJA 3Q8QB 1C4CA 1IWAA 2B7BB 4LQ9A 1IR2A 4PG4A 3ETMA 3KLIB 4AD6A 1GMVA 4AYBD 1XMOF 2MKHA 2XS5A 2KT5A 3SEOA 2V9WA 4UUXA 2M8HA 4CM0A 1JLQB 2WONB 3H25A 3MK1A 4JYAF 1RBOB 1TL3A 5D77A 2RUSA 1LW2A 3DRRB 1XMOJ 2XCPA 3IS9A 1S7HA 5E3QA 2XCAA 2JLGA 4Y00A 4JYAJ 1RTJB 3DLJA 1LWCB 1ED8A 4GVBB 1UW4A 2KFYA 3HVWA 5G0RB 1FD2A 1RWKB 3G87A 4ZPWR 1DY3A 1P6TA 4W90B 3KK3A 5KOXA 3NGSA 3GJSB 3CD5A 2IPOB 5LM7E 4ZVUB 1S57A 4C8YA 3L9ZA 3OFGA 5J2QA 1NDCA 1Y3KA 2FYXA 4UY85 4U7UD 3BV8A 2GSUA 3R5GA 2FJWA 1Q86T 3VALA 1RDRA 2V2KA 1QAIA 1NJIT 4DSFA 1BE4A 2GQCA 2EK6A 5B0AA 3SSRA 2ZITA 1VOMA 3U1MA 4J9QA 1EJ7L 1NMEB 4UOOA 1E6YA 2BM0A 3MPDA 2HFZA 4Q0BB 1HHQA 3DNCA 5J2PA 3NEKA 2VFTA 3JXOA 3AOBA 3K17A 1HI8A 3LGMA 3NL0A 2PA8D 2CQ3A 2KTQA 2WAQD 2J8SA 3DOMA 2W8DA 2VPWB 3I87A 1S1XB 3THPA 5AE2A 2B8PA 3RRKA 5DETA 5MAOA 2F65A 4DL2A 4C6AA 2XQCA 4NLPA 4NI2A 3H4BA 5L0EA 1VQKS 3FFIA 4WFZA 3OFEA 4NL5A 2ZH2A 3SSQA 4X4UA 2IDLA 4GTYA 4ED2A 2F1FA 3HJVA 2J9DA 1WEZA 3BDGA 5D15A 3HVAA 3W2VB 1MROA 1QTNB 1D8YA 1Q8LA 4RBUA 1RAIB 4UOPA 2MZJA 3NS5A 2FPHX 3MTJA 2DR8A 1S97A 2CJQA 4WJBA 2XMJA 2ZH7A 1JLBB 3CCUS 2C3YA 1VQ6S 1RCXB 4ILLA 2Y3YA 2KT2A 2VU5A 3PEHA 3BF4A 4K2JA 3T3FA 3PR5B 2DPIA 1E33P 2HHPA 3M8ZA 3M8YA 1YZ7A 3G8TA 1UZHA 4QU7A 3HVRA 2FY1A 2L08A 3CCQS 4ECUA 2JRSA 4RW9A 3IC1A 4WYLA 3ZZZA 4RW4B 4PG5A 3BSAA 3G82A 2RU9A 2NPFA 4EI2A 3QGGA 5DM7Q 2IM2A 4K8RA 2I5JB 2C2EA 4DWIA 3IR7B 3PW5A 1NHUA 2P9EA 3T01A 4NLUA 3BDHA 3PRDA 3IA0A 1H74A 2GIFA 3FRYA 3FCVA 5HJXA 1UEUA 2CPZA 1ZTTA 3BGRA 4OI3A 3R5JB 5LXRA 2DK2A 4RNHA 3V81B 3DRSB 4UPLA 3BN7A 1ZM2A 4CT9A 4A8MP 2HZAA 2H5IB 3Q3QA 3LAMA 3PO4A 2IYGA 1YJTA 4LR9A 2FVRA 5ETRA 4DSJA 4J9VA 2QRRA 4B3SF 1UW9A 2UXDF 2M7SA 1T9XA 4IUFA 3MPYA 1R0AB 5FD1A 3D6FB 3PX6A 1S10A 1WKJA 1T3OA 3O6QA 4B3SJ 3ETOA 4KGMA 1BGXT 3LXQA 4F4KA 1P1TA 3V6HA 3I4HX 1HYSA 1JJHA 3ZC4A 4AE5A 4KAIA 3TJAA 3CMRA 4HI1A 1KVKA 2FC8A 1WHXA 4RW7A 3UN5A 1RWVB 1OS5A 2XYPB 4HDGA 3CCRS 2HKEA 1U49A 3P4UB 3G86A 3TNVA 3DLKB 2R2SA 1U1QA 3KLIA 2GVZA 4OZ3A 1H98A 1HARA 2YNGB 3L3CA 3LWLA 3NCQA 1Y4ZB 1JLQA 2WONA 2B4VA 3UN2A 2W5TA 1K47A 3KMSA 4X4OA 2YVSA 1NPKA 2VQRA 2W2NP 4Q2LA 1EAYC 1J5OB 3KUHA 5M2RA 1ZS6A 3T02A 2B4OA 2MYFA 1RTJA 1WJ9A 2W5VA 3I9V9 3WAVA 1LWCA 4FYVB 1R3NA 3MM9B 1S49A 1LK7A 1UVIA 2R7WA 3PCOB 4TLQA 3OSPA 3GFYA 5GVQA 2V34A 4ZG6A 1P9QC 4EK2A 2AJFE 1TKDA 2EFGA 2ZBIA 3BPDA 2ZVIA 3QJLA 2I1RA 2ZH8A 2BOPA 2WW4A 4J5OA 3QJJA 3VV2B 4L73A 2GVDB 1HHTP 4DHVA 3VAMA 2Q6CA 3IR5B 2MQMA 1NLKL 2O5DA 3M2UB 4R0EA 3KK1A 2OKQA 3M2VB 4KKOB 5TJ3A 4ZPTR 2HYIB 3MMCB 2A0FB 5FDLB 2KJWA 1R0BG 3RBEA 1LV5A 3AJ1A 1FDNA 3CC7S 5CZVA 4KAVA 1EZZB 1RU1A 4OZ1A 5F8LA 3CDUA 1O8BA 4MIAA 1EQ0A 1AZSB 5CH7B 3I56S 1NNDA 2CQPA 4E0DA 3FSIA 2IJRA 4ED0A 3TRGA 4DFMA 1TUGB 4FDIA 4GC7A 1YBAA 1Q16B 5F0UA 1VQ7S 2IM0A 4F26A 3HZEA 3RB3A 2WB4A 3B4MA 1R8CA 2YNIB 2HVHA 2W5QA 1Q5YA 3EVOA 1S0OA 4ID8A 4QIFA 1GTHA 1HBOA 1RTHA 2R42A 3FBFA 2QN6B 5KFSA 5AJ9A 4DU8A 2IFYA 3TZXA 3W2VA 2WVEA 2X98A 3CPWR 3Q8RB 1SVDA 1NZAA 2W5XA 3TANA 4M1KA 4CRJA 3CCTA 4NLVA 3H5UA 2RDIA 1SJ1A 1AJAA 8AT1B 3PY8A 2CJ9A 4KRWA 4ED1A 1YTYA 4B9VA 2AMCB 1NK6A 3I0RA 4N77A 1C1CB 1IKWB 4B08A 3LW5C 2OAUA 1PAUB 1M1KT 3FZBA 3MOZA 1A0OB 2P9GA 1SV5B
chains in the Genus database with same CATH topology
4MY4A 1ANJA 1Y6VA 5IJSA 5L0KA 1ELXA 2W5RA 3LXQA 1B8JA 4FDJA 4CYRA 4FDIA 3NKNA 2W8SA 1ELYA 3DPCA 1KH4A 4ZG9A 3NKQA 4LR7A 3B5QA 1AJCA 1O98A 3NKPA 5L0EA 2IUCB 3IGYB 4ZG6A 1ZEBA 4LRAA 4MHXA 3CMRA 2GSOA 5LQQA 1ALKA 1HQAA 1E3CP 5IJQA 1HJKA 4LRDA 4MIVA 2W5SA 4LRBA 3SZYA 1E2SP 1N2KA 4GTWA 1E1ZP 5L0BA 5DLWA 3UN5A 1KHKA 5EGHA 3SZZA 3TWZA 2W5QA 4UPKA 4CXKA 3WAXA 1KH5A 5EGEA 4GTYA 3M8WA 3WBHA 3ED4A 4UPIA 2GA3A 3WAWA 1ED9A 3IDDA 3TG0A 1AUKA 4TN0A 3T01A 5LRMA 1EW8A 3MK2A 3NVLA 1EQJA 1EW2A 2XRGA 3BDGB 3BDGA 2D1GA 3BDHA 3NKRA 4CXSA 5INHA 2GSUA 3DYCA 4NWJA 5AJ9A 2QZUA 2IFYA 3E2DA 4NWXA 1EJJA 1EW9A 4YR1A 5KXAA 1N2LA 4GTZA 3T00A 3UN3A 4GTXA 3BDFA 1ALIA 5HRTA 1KH9A 1P49A 3M7VA 2X98A 4CYSA 2GLQA 2ANHA 4UORA 4LQYA 3IGZB 1AJBA 1ANIA 3NKMA 1ELZA 1K7HA 1ZEFA 2W5XA 3KD8A 1HDHA 1KHLA 4KJGA 4LREA 1AJDA 4UOPA 5C66A 2RH6A 4UPLA 3A52A 4LRCA 4N7TA 1ZEDA 5TJ3A 1EI6A 2GSNA 4LRFA 1KH7A 1AJAA 1Y7AA 3Q3QA 2G9YA 4CXUA 4ZG7A 4ZGAA 2W5WA 2XR9A 3MK1A 3MK0A 4LR9A 3UN2A 2W5TA 4UOOA 1URAA 1O99A 1SHNA 1FSUA 4KAVA 4LR2A 2ZKTA 2VQRA 1URBA 5LIAA 4UPHA 1ALJA 3OT9A 3TX0A 4QAXA 5LRNA 3WAYA 3UO0A 1KHNA 3UNYA 4LR8A 3T02A 1E33P 5K4PA 2IUCA 5DLVA 3M8ZA 1ALHA 3M8YA 4KM4A 5GOVA 2W5VA 3WAVA 5GRRA 4KAYA 4B56A 1ED8A 1SHQA 2W8DA 4KJDA 5DLTA 3NKOA 1KHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY4 A;  1ANJ A;  1Y6V A;  5IJS A;  5L0K A;  1ELX A;  2W5R A;  3LXQ A;  1B8J A;  4FDJ A;  4CYR A;  4FDI A;  3NKN A;  2W8S A;  1ELY A;  3DPC A;  1KH4 A;  4ZG9 A;  3NKQ A;  4LR7 A;  3B5Q A;  1AJC A;  1O98 A;  3NKP A;  5L0E A;  2IUC B;  3IGY B;  4ZG6 A;  1ZEB A;  4LRA A;  4MHX A;  3CMR A;  2GSO A;  5LQQ A;  1ALK A;  1HQA A;  1E3C P;  5IJQ A;  1HJK A;  4LRD A;  4MIV A;  2W5S A;  4LRB A;  3SZY A;  1E2S P;  1N2K A;  4GTW A;  1E1Z P;  5L0B A;  5DLW A;  3UN5 A;  1KHK A;  5EGH A;  3SZZ A;  3TWZ A;  2W5Q A;  4UPK A;  4CXK A;  3WAX A;  1KH5 A;  5EGE A;  4GTY A;  3M8W A;  3WBH A;  3ED4 A;  4UPI A;  2GA3 A;  3WAW A;  1ED9 A;  3IDD A;  3TG0 A;  1AUK A;  4TN0 A;  3T01 A;  5LRM A;  1EW8 A;  3MK2 A;  3NVL A;  1EQJ A;  1EW2 A;  2XRG A;  3BDG B;  3BDG A;  2D1G A;  3BDH A;  3NKR A;  4CXS A;  5INH A;  2GSU A;  3DYC A;  4NWJ A;  5AJ9 A;  2QZU A;  2IFY A;  3E2D A;  4NWX A;  1EJJ A;  1EW9 A;  4YR1 A;  5KXA A;  1N2L A;  4GTZ A;  3T00 A;  3UN3 A;  4GTX A;  3BDF A;  1ALI A;  5HRT A;  1KH9 A;  1P49 A;  3M7V A;  2X98 A;  4CYS A;  2GLQ A;  2ANH A;  4UOR A;  4LQY A;  3IGZ B;  1AJB A;  1ANI A;  3NKM A;  1ELZ A;  1K7H A;  1ZEF A;  2W5X A;  3KD8 A;  1HDH A;  1KHL A;  4KJG A;  4LRE A;  1AJD A;  4UOP A;  5C66 A;  2RH6 A;  4UPL A;  3A52 A;  4LRC A;  4N7T A;  1ZED A;  5TJ3 A;  1EI6 A;  2GSN A;  4LRF A;  1KH7 A;  1AJA A;  1Y7A A;  3Q3Q A;  2G9Y A;  4CXU A;  4ZG7 A;  4ZGA A;  2W5W A;  2XR9 A;  3MK1 A;  3MK0 A;  4LR9 A;  3UN2 A;  2W5T A;  4UOO A;  1URA A;  1O99 A;  1SHN A;  1FSU A;  4KAV A;  4LR2 A;  2ZKT A;  2VQR A;  1URB A;  5LIA A;  4UPH A;  1ALJ A;  3OT9 A;  3TX0 A;  4QAX A;  5LRN A;  3WAY A;  3UO0 A;  1KHN A;  3UNY A;  4LR8 A;  3T02 A;  1E33 P;  5K4P A;  2IUC A;  5DLV A;  3M8Z A;  1ALH A;  3M8Y A;  4KM4 A;  5GOV A;  2W5V A;  3WAV A;  5GRR A;  4KAY A;  4B56 A;  1ED8 A;  1SHQ A;  2W8D A;  4KJD A;  5DLT A;  3NKO A;  1KHJ A; 
#chains in the Genus database with same CATH topology
 5L0K A;  3RB6 A;  5KTQ A;  2MY8 A;  3FGV A;  4RW4 A;  4B9T A;  3VVT A;  3FBE A;  1WF1 A;  4QZV B;  3C14 B;  3SBM A;  2J6S A;  4DR7 F;  2RH3 A;  1RZM A;  2JOQ A;  5IC4 B;  4NA3 A;  4V19 X;  4YR3 A;  3ITH B;  2DGV A;  4PRF A;  4ZIT A;  2M8D B;  1NXI A;  4DR7 J;  3CC2 S;  4ZCK A;  4F02 A;  1G1X A;  3R9L A;  1EAR A;  1VQY A;  2DD8 S;  4UOC A;  3F0N A;  2G1H A;  2CZ9 A;  1WF2 A;  2V8D A;  2CPJ A;  1RSC A;  2WRM A;  3M7V A;  1SQG A;  1KQS R;  1VYA A;  2X51 A;  3V81 A;  1Y10 A;  3BKF A;  2EXU A;  4ALZ A;  1C4A A;  2GQQ A;  2KHD A;  4TN2 A;  3BQ2 A;  4J91 A;  3NBP B;  5KFV A;  1D8Z A;  4DUZ F;  1SL0 A;  4ATN A;  3O2I A;  4UY8 T;  4YME A;  1R0A A;  5AT1 B;  4DL7 A;  4PXE A;  1PC4 A;  2H54 B;  1QDU B;  4DUZ J;  1Y00 A;  2IM3 A;  3QZ7 A;  1KLM B;  4OV6 A;  5IXU A;  1MLA A;  2R7S A;  1UA1 A;  4WKR A;  3SDE B;  3EGV A;  4DR4 F;  3T9N A;  4CH1 A;  4KTQ A;  4F04 B;  3QO9 B;  1ICE B;  2IJN A;  1YZ6 A;  3HUL A;  1X4D A;  1IBM F;  4DR4 J;  2CAJ A;  3IGV A;  5L9X A;  5KT4 A;  5CD4 H;  3OTB A;  2GCF A;  1RHR B;  2MJU A;  1IBM J;  2RDD A;  4ELV A;  2DNO A;  4P73 A;  1Y5N B;  2E5H A;  5D0H A;  1DAX A;  3K58 A;  1TK5 A;  1SH3 A;  4F2S A;  3V6J A;  1SH0 A;  3FEY B;  2R3V A;  5DDO C;  2GFF A;  2YNG A;  1HBM B;  2NXN A;  3H42 A;  3PVX A;  2DRA A;  1JX4 A;  2W2M P;  4FVM A;  2WBM A;  3CJ3 A;  2W01 A;  4CLK A;  2AHO B;  5DJB A;  1URB A;  1J5O A;  2UVW A;  3W5Y A;  4M5H A;  4ZVR B;  4KM4 A;  3BH7 B;  2N4C A;  1S4E A;  4WWS A;  3UVJ B;  4KJD A;  1VIO A;  4CP5 A;  2OTJ S;  2P9C A;  4IOC Q;  3L7U A;  2LVW A;  2Q79 A;  3HSG A;  1SJ4 P;  2HVI A;  2V8P A;  4LF2 A;  4DL5 A;  2YNH B;  1HNI B;  3ULH A;  1XJW B;  3AFG A;  1S4F A;  5F0W A;  3JQM A;  1U0S A;  4CH7 A;  2DNM A;  3BDP A;  3VZI A;  5LOQ A;  3KXD A;  4OYM A;  3MDF A;  4S0M A;  3IDD A;  2VQF F;  2MMY A;  3LAN A;  2H1Y A;  2H4Y B;  3NKR A;  2GVD A;  4IFV B;  3OSN A;  4Q5V A;  4B3R F;  3F73 A;  3NGR A;  2OEL A;  2BXJ A;  2VQF J;  3OL9 A;  3M2U A;  1KON A;  4DR6 F;  3F44 A;  4I0W A;  3DKD A;  3GE9 A;  3DLB A;  1FX2 A;  2E5I A;  3M2V A;  4JI3 F;  3BYP A;  3NY0 A;  4ZGA A;  5IS2 A;  4ECY A;  4L75 A;  4P7V A;  1F2H A;  4DR6 J;  4O3O A;  4IQM A;  2RKI A;  2RAQ A;  2FLL A;  5HP1 A;  1F9H A;  4JI3 J;  3MR7 A;  4P71 A;  4B17 A;  1AZS A;  2UUT A;  2V67 A;  3KLF B;  2Y0S D;  3I4P A;  4KBI A;  2LEA A;  1JXL A;  4KAY A;  4R8U B;  3A4T A;  3GIL A;  1JJ2 R;  1RJJ A;  1DTT B;  3K5N A;  4F0M A;  4OZN A;  4QIV A;  1IXK A;  2GSO A;  3GIM A;  1D9F A;  1IJE B;  4UT4 A;  2AYE A;  1NJY A;  3TZW A;  2ROE A;  2B6A A;  4PKD B;  2VC1 A;  3MD1 A;  3BKT A;  1AYE A;  2X1G A;  4YR0 A;  1X0F A;  4M95 A;  3OR1 A;  3DGV A;  4OYX A;  1J5E F;  3BKU A;  2GMJ A;  5DS7 A;  4GTX A;  1A6L A;  3DRX A;  1Y9O A;  4YB7 A;  2BM1 A;  1RTI A;  1BWV A;  5KFL A;  1R43 A;  4ANC A;  1J5E J;  1TAQ A;  1UWB B;  1SC3 B;  5I3U A;  3CF5 Q;  3CGI A;  2W7O A;  2W5W A;  3OTC A;  5L1K A;  4O3R A;  4DQP A;  1RWM B;  2HGN A;  5DGA A;  5KFC A;  2AT1 B;  4PWD A;  4OV1 A;  2OML A;  3VAF A;  1U8W A;  5T14 A;  2CPI A;  5AXK A;  4X4P A;  3M2R B;  3PHE A;  4LSZ B;  2VG6 B;  2QEX S;  1RT1 B;  1SV5 A;  1SL1 A;  2DGT A;  4TXS A;  3KLV A;  2I0X A;  4F8R A;  4JI7 F;  2XHW A;  2OHD A;  4E8U A;  1WEL A;  2ASY A;  2XMV A;  4KFB A;  3NWR A;  5E2Q A;  4NEZ A;  1FJC A;  3ITH A;  4NZ6 A;  4JI7 J;  2E1R A;  4A8X A;  1YI2 S;  4ICL B;  1V3Z A;  2BZ2 A;  5J2N B;  5M2U A;  3CJK B;  2JNJ A;  1WKK A;  2ERR A;  2XSJ A;  5KG2 A;  1PJ6 A;  3BO3 A;  4ECZ A;  1FRM A;  2DHS A;  4C2M A;  1KR4 A;  3G4S S;  1L3U A;  2W7A A;  2WB1 D;  4OX8 A;  1JLA B;  3PX4 A;  4QPX A;  4RW8 B;  2BX6 A;  4J9U E;  3MCM A;  3JYT B;  3UCZ P;  4A8K A;  3SMZ A;  4HT7 A;  4I4B A;  3OJS A;  1RBL A;  2QL9 B;  1CS4 B;  4FF4 A;  3KYL A;  1G2E A;  2WK4 A;  4Y2A A;  3AB4 B;  2ADC A;  2MPU A;  2B43 A;  3AOC A;  4LFB F;  2FVP A;  2W1B A;  1Q53 A;  5KFN A;  1KLM A;  2W8S A;  1SJR A;  2YWW A;  4FYW B;  2A6O A;  2IIH A;  3JTO A;  3SDE A;  4JV5 F;  4C8N A;  1R6V A;  4MT1 A;  1N5Y B;  3QO9 A;  4LFB J;  5KG6 A;  2GO8 A;  4M5M A;  2A6M A;  4PAA A;  4A4J A;  2YKN A;  2G0C A;  5D4P A;  1RI7 A;  3TAR A;  2GHV C;  3K8V A;  4JV5 J;  2ZD1 A;  2FZK B;  3UW1 A;  3C3L A;  3MPU B;  8RUC A;  3RB0 A;  3GZ7 A;  3GWC A;  3S6E A;  3E2D A;  3DLL Q;  4URS A;  1YRX A;  4IFY B;  3OVB A;  1HBM A;  1S9E B;  2IC3 B;  2XMW A;  1FX4 A;  3GYG A;  5CCM A;  1PC5 A;  3MR6 A;  4NYP A;  4ZP6 A;  2EPI A;  4P9S A;  1AUS L;  3WAY A;  3QGP A;  3NNH A;  4G65 A;  3MMA A;  4BS2 A;  4GRS A;  3UVJ A;  5D0G A;  2C2Z B;  2R7V A;  4C9D A;  2CNK B;  4I2Q B;  3N79 A;  2I6W A;  1RHK B;  2YNF B;  4A8O A;  1LWE B;  2I8E A;  2PT0 A;  2YNH A;  5HK4 A;  1NKE A;  5GAH I;  1HNI A;  4O3Q A;  5A2Q U;  3LQV A;  3JSY A;  2I9S A;  1N5S A;  4U67 Q;  4K0K F;  1X4G A;  4ZJQ A;  4MH8 A;  1BQM B;  5KFB A;  3J7A N;  3NMA A;  2J76 E;  3DOL B;  1C0T A;  2VKZ G;  4TVA B;  3HSJ A;  2BV3 A;  3HVT A;  4N76 A;  4XAK A;  5I4M A;  1UVK A;  4P7T A;  3GIR A;  2BJ9 A;  4W98 A;  3TJ9 A;  5U47 A;  5DO2 A;  3I6P A;  2WHO A;  5A0Y B;  3TQE A;  4ZP7 A;  3J7Z 5;  3CJ8 A;  4H4O B;  1S0V A;  1GMU A;  2FJA B;  2FGC A;  4DFK A;  2RHS B;  4OI0 A;  3K5O A;  5J1N A;  4GKJ F;  4P2F A;  3DN9 A;  2ILY A;  1TR0 A;  4OI6 A;  3BSN A;  3MD3 A;  2PDA A;  4U8V A;  1M5H A;  4KB7 A;  4R8U A;  1ANJ A;  4R0J A;  3CJ0 A;  4GKJ J;  4OQJ A;  3VAK A;  2K8G A;  4LSN B;  2ZZM A;  2D3O R;  1PBA A;  3X1L B;  1T7P A;  4QIE A;  4M5I A;  4KHP F;  1LFW A;  3DU6 A;  1B0P A;  1ZA1 B;  2HFS A;  2BVZ A;  5KFE A;  4O4G B;  3C46 A;  5F8N A;  2QC3 A;  3Q89 A;  4AXJ A;  2Z57 B;  4KHP J;  4PQU A;  4KH1 B;  1FWP A;  1EW2 A;  1O5J A;  2VDI A;  3K59 A;  3IFE A;  4YQW A;  4ECR A;  3D3C J;  4F3Q A;  2NZC A;  4M5D B;  5SUH A;  3ZNU A;  4CM2 A;  2B5J A;  4CLP A;  1BHN A;  4K50 A;  2K1R A;  3QAU A;  1ELZ A;  5FLX U;  4ZOS A;  4RNF A;  5C66 A;  3AA9 A;  4OHX A;  3W63 A;  1UWB A;  1KFD A;  1FJG F;  2CQG A;  3GR1 A;  3BB5 A;  3QNW B;  1O99 A;  1CJK B;  4CO0 A;  4MKA A;  1FJG J;  3UO0 A;  2C2R A;  4M8L A;  1SC6 A;  5AXN A;  2EG1 A;  3LP1 A;  1TP7 A;  2Y8W A;  2DNG A;  2JEJ A;  1Q8I A;  2J7K A;  2BE7 D;  2V68 A;  3IXQ A;  2DPJ A;  3SV4 A;  4IRK A;  3HT3 A;  5LSO A;  3M6U A;  4TNO A;  4ES3 A;  2LXU A;  2CPD A;  2RQM A;  1C2P A;  5KFY A;  5C2C A;  4A8W A;  4FYD A;  4CNY A;  4USV A;  2QFJ A;  4ZVT B;  4EO6 A;  3EPG A;  4CXK A;  4USH A;  3NS6 A;  4LSL B;  1FER A;  3E51 A;  3SCJ E;  3UDV A;  2WW8 A;  1VFJ A;  5D4O A;  2E7V A;  3BBB A;  2LQ5 A;  2V6A A;  2OSQ A;  4Y65 A;  3WIV A;  3NWG A;  2BJE A;  3DDN A;  4MK8 A;  3HHL B;  4ZVE A;  3UN3 A;  2V94 A;  3AH6 A;  2MQO A;  1HNZ F;  1U1L A;  1MU2 A;  1DUR A;  4XTT A;  1SJQ A;  3ZZU A;  1FRL A;  5CYJ A;  1FXD A;  3R5A A;  3HO1 A;  1PJ7 A;  4QPT A;  4QIW D;  4RW8 A;  2W9C A;  4H4M B;  3JYT A;  1HNZ J;  1N0V C;  1Q0N A;  3HD2 A;  1IN0 A;  2VF3 A;  2EC2 A;  2L9N A;  4IO9 Q;  4YDX A;  2EBE A;  2V8G A;  3G6E S;  1CS4 A;  2G0J A;  2QL7 B;  2HLT A;  1SL2 A;  4GO7 X;  3H7H B;  4TKT A;  1O6X A;  2PII A;  2YWE A;  2X1F A;  2V8H A;  2VG7 A;  1S1V B;  3K8W A;  1N5Y A;  2FGO A;  4K4V A;  2BE9 B;  2MQ8 A;  4K4Y A;  1FKA F;  4A46 A;  5CYM B;  2YKM A;  1RAC B;  3N01 A;  1M5O C;  5C42 B;  2B4U A;  3P6Y C;  2OPR B;  2IJF A;  3W65 A;  3FDS A;  2XRG A;  5KXA A;  2PI4 A;  4C3K A;  1UCN A;  5HAT A;  5I42 A;  5T7L B;  2BJ8 A;  1NDP A;  2J0Q D;  1S9E A;  2IC3 A;  1WTB A;  2BW2 A;  3LH2 S;  3HK2 A;  1U48 A;  2HGM A;  3CE8 A;  4K4S A;  5F8H A;  1IBL J;  4MKY A;  3QIP B;  4F4W A;  4LBH A;  4I1T A;  2HK2 A;  2MST A;  3AXM A;  3GMG A;  3MTK A;  3DRY A;  4I2Q A;  1HNV B;  1CUL B;  2VBX A;  3FCH A;  4DX8 H;  5EWF A;  4M5J A;  3POT B;  2GQ2 A;  3V6K A;  1LWE A;  5LMN F;  4NAS A;  5HJY A;  1NH7 A;  3A12 A;  4FP9 A;  4DN9 A;  3CUL A;  1X8D A;  1FO1 A;  1RT7 B;  5J1P A;  3GP9 A;  5EHH A;  2F5G A;  5A8R A;  5LMN J;  1BQM A;  2MY7 A;  2E1M C;  1S6U A;  2LQ8 A;  4IR1 A;  2M0G B;  3ISN D;  2EFP A;  3TZZ A;  2QX0 A;  3CDA A;  3DOL A;  3ZTS A;  3PV8 A;  3CD6 S;  5IWA J;  5LSR A;  3T00 A;  3EZU A;  1JLE B;  3NKM A;  3CJ4 A;  5HLF B;  5HMY A;  4UF4 A;  1XC9 A;  3VGU A;  4IOB A;  4F2R A;  3QBC A;  3R2D J;  3D66 A;  5ITH A;  4H4O A;  5KG1 A;  1QUV A;  1Q78 A;  2H3E B;  3BGF A;  4IQX A;  3E2E A;  4FF3 A;  5CQG A;  3CDE A;  5IZH A;  1RTZ A;  3BBC A;  2EW9 A;  1F3V A;  2G2Z A;  4U7C A;  3GR0 A;  4NX9 A;  1NK4 A;  1IUJ A;  3QID A;  1OQ6 A;  2W5R A;  3OBI A;  4CLY A;  2ACM A;  1PGZ A;  3W62 A;  4HEA 9;  4N47 A;  3KTQ A;  2CZ4 A;  3O3L A;  5CAA A;  3SCK E;  3H4D A;  3L09 A;  4MHX A;  2WSE C;  3DLG B;  1HQU B;  4O4G A;  1OYE A;  1SUQ B;  1NRK A;  3D67 A;  1DTQ B;  4EFA C;  3M6V A;  1RK8 A;  4CWB A;  2FD2 A;  3BR8 A;  3OHB A;  1OSC A;  1RT4 A;  4CXS A;  4M5D A;  5CA5 A;  3LP2 A;  2DNN A;  5B0D A;  5HRT A;  2WSC C;  3DI6 A;  4X4Q A;  1MMD A;  1B0V A;  4Y34 A;  3PXG a;  1S1U B;  2XZW A;  1CPZ A;  2MTL A;  3OL7 A;  2QYG A;  2EI5 A;  3EDR B;  1S76 D;  3KDN A;  2DH8 A;  3BBF A;  2C3U A;  1Q82 T;  4ES2 A;  3UR3 C;  2OLW A;  4URG A;  4X4R A;  3EIC A;  1CJK A;  1RTD B;  2OPS B;  3W2W B;  1G7C B;  4JI1 F;  2CPH A;  2P2C B;  4ZJL A;  2HMI A;  2IUC A;  2ZKU A;  4YB6 A;  4DPW A;  1RAA B;  4I6W A;  2CPY A;  4I6A A;  2UVU A;  4NCG A;  2YWG A;  4JI1 J;  3WX4 A;  2F4F A;  5IFM A;  4X66 F;  3O44 A;  2A10 A;  2DNZ A;  3I5C A;  3M8Q A;  1WG5 A;  4C11 B;  3MOJ B;  3CO0 P;  4ED6 A;  2VH7 A;  3SQG B;  1RAJ A;  4X66 J;  2MKK A;  1NKB A;  1KQG B;  1GX5 A;  3V6D B;  1HQ2 A;  5IT9 U;  4LSL A;  2HHS A;  1UPP A;  5HQL A;  5HN0 A;  4ZVQ B;  5KFQ A;  2ASD A;  3DM2 B;  3Q86 A;  3R5C A;  3HHL A;  3C16 A;  5GAH U;  2DY9 A;  4IH6 A;  4RBV A;  3BYR A;  1VQ4 S;  4CIO A;  2GC8 A;  2KRR A;  2F7V A;  3VAG A;  3VAJ A;  3Q0A A;  2LKZ A;  4H4M A;  3H90 A;  3FQK A;  2J5A A;  1CLF A;  1V3S A;  2DB1 A;  2LYV A;  4C3M A;  4TU8 A;  3T9Z A;  4I68 A;  4WP9 A;  5KFF A;  1HI1 A;  3B78 A;  1V3R A;  2CFX A;  1IR0 A;  3GLJ A;  2OD4 A;  2AJQ A;  3R7S B;  5JJB A;  2DXE A;  4GKK F;  2WSF C;  4KV8 B;  4ZVG A;  1BQX A;  3J7Z T;  3CCS S;  1QJH A;  1UVM A;  1YBT A;  2OSR A;  2QYC A;  3HX9 A;  4GKK J;  2WVB A;  5LMU F;  3RZA A;  2OPR A;  5IQ6 A;  3GFH A;  3G2X A;  4ITS A;  1ITP A;  3DYC A;  1KQF B;  1FDD A;  4OZ2 A;  2XLJ A;  5LMU J;  5CHC B;  3QPI A;  3TX8 A;  2UP1 A;  5C5J A;  1NB7 A;  1JJ4 A;  3PKY A;  4DXL A;  5T7L A;  3CCJ S;  1WC1 A;  5AJ3 F;  4MIB A;  5KFA A;  3GFZ A;  1P8G A;  4FYY B;  2QIF A;  2I2Y A;  2AP6 A;  1NSQ A;  3TVK A;  2J9C A;  4PAB A;  4H54 A;  2CPX A;  1R0C B;  1M5P C;  5AJ3 J;  4K59 A;  4UQT A;  3VWS A;  1ZZN A;  3HKZ D;  3QIP A;  3H20 A;  1JKH B;  1I1G A;  2V4J A;  4WTO B;  2H48 B;  1HNV A;  4UOF A;  4FNH A;  5A8W A;  2Y8Y A;  2CXE A;  2FLN A;  1KOH A;  2XM3 A;  2DGS A;  3AQP A;  2AJ1 A;  2VQE F;  1YJW S;  1RAE B;  1QSY A;  4R5P B;  2HAI A;  4ZLN A;  4ZVO B;  1VRU B;  1EET B;  4CLU A;  2VQE J;  3D0I E;  4NZ7 A;  1X4H A;  1WHW A;  2C1E B;  3CJ2 A;  2VDH A;  4MYU A;  4DL4 A;  3CJQ A;  2AF6 A;  1JLE A;  4LBP A;  3JSM A;  5KFU A;  3QRQ A;  4LVO P;  2X3G A;  4F3O A;  3IRW P;  2XZT B;  2DHA A;  2J0W A;  3C6U B;  1R8B A;  4PYA A;  3NAI A;  2IRU A;  3J80 Y;  1R8P A;  4PPD A;  1ZM4 A;  2M2B A;  4DSL A;  1QAX A;  1U7L A;  4DEZ A;  1IJF B;  2EK1 A;  5DLG A;  3MUM P;  4J7C A;  4LFC F;  4DX7 A;  4PYD A;  1XMQ F;  4JI2 F;  3NRB A;  1APS A;  4ZVP B;  1ELY A;  2E9R X;  2Q3P A;  4DF4 A;  3SV3 A;  1FFG B;  4LFC J;  1SKS A;  3HT0 A;  5A6W A;  1XMQ J;  3WIU A;  4JI2 J;  3DLG A;  4RO0 A;  3SFU A;  2C2N A;  3N6M A;  1HQU A;  2UV8 G;  5E7O B;  3RU0 A;  3OR2 A;  4Y2M A;  1DTQ A;  4IG3 B;  2HFV A;  3CO9 A;  4UOH A;  4I64 A;  2BAC A;  5KT6 A;  2E1C A;  1GXU A;  3FBC A;  3K89 A;  1S9G B;  4ZMM A;  2MGZ A;  4WYW A;  1B7F A;  1NB2 A;  2EFO A;  2R7T A;  3T5J A;  3W64 A;  1BY9 A;  4DLG A;  3R5B A;  1S1U A;  3QWU A;  4JI4 F;  3VHQ A;  1X60 A;  2BMB A;  5CCL A;  2F40 A;  2E7W A;  1FKP A;  4WFY A;  2N7C A;  3KOA A;  4DOZ A;  4JI4 J;  4B3O A;  2OPS A;  2V2Q A;  3US5 A;  3QGI A;  3U1N A;  1UVN A;  1H73 A;  1N32 F;  1DLO B;  3V4I B;  2VBY A;  3QMQ A;  2CPF A;  3R1L A;  3RUB L;  1JLC B;  1U2R A;  1N32 J;  4PPZ A;  2KYX A;  2QLX A;  3HJF A;  5EUH A;  2RU3 A;  3W60 A;  3G6V A;  2A2D A;  3LWM A;  4U7U K;  2GA7 A;  1F1B B;  1N5Q A;  3W61 A;  4HTJ A;  3V6D A;  3WAX A;  1I51 B;  2ZJP Q;  4OMF G;  1O51 A;  3RYL A;  2HND B;  3B82 A;  1U1M A;  2DGX A;  1RYS A;  3SFG A;  2O3D A;  3M8P B;  3E3X A;  2HVE A;  4A8S A;  1HPZ B;  4B9M A;  1TFW A;  5C25 B;  2Y9H A;  1TUV A;  3CC4 S;  2B9Y A;  2MKI A;  5E5N A;  2OPQ B;  1T9U A;  3B8H A;  1SPB P;  1UP1 A;  4OYZ A;  3E8O A;  4QR1 A;  2WOM A;  1O0P A;  1XNR F;  1QD1 A;  2ZE2 B;  1W26 A;  1QE1 A;  2Y1R I;  3P8B B;  5CYQ B;  1VJQ A;  3BPS P;  4M5N A;  1VJW A;  1XNR J;  1MWZ A;  2M88 A;  1JK9 B;  2DNR A;  5ETL A;  4UQG A;  3G8Q A;  2FLO A;  1S6P B;  3HD1 A;  2HHH F;  3UWT A;  5LJ5 Y;  4OHW A;  4PR6 A;  1OPI A;  4KV8 A;  5F8M A;  4DFJ A;  3NNA A;  1KP6 A;  4USW A;  2G9O A;  3PRB A;  3PFO A;  3MEG A;  1VHI A;  1HQE A;  3I5A A;  2HHH J;  4DQQ A;  5L8R C;  2LU2 A;  4A8F A;  3AAW B;  2J7W A;  4N41 A;  4P10 A;  5F8G A;  1H7W A;  3I96 A;  1FES A;  5F9L A;  5BXI A;  4I7F A;  1TFY A;  1UA0 A;  1HMV B;  4KT0 C;  2FJV A;  3S8S A;  1XR7 A;  4DSI A;  2N3O A;  1YWX A;  2FJD B;  2ZBP A;  4FXD A;  1DQ8 A;  2HGL A;  3JAM U;  2V4R A;  1T9T A;  1NK8 A;  1FJE B;  1RLC L;  5JVG Q;  2X7I A;  2MZ1 A;  2RF2 A;  5E3R A;  3QT5 A;  2RNE A;  3MCS A;  5JVH Q;  1C0U A;  3DRP A;  2IVF B;  5HQM A;  3WZ0 A;  4YB1 P;  3SI8 A;  4NLT A;  3PYF A;  1A7G E;  1RWX B;  4X4V A;  3Q8V A;  1XQI A;  1S6Q A;  2RSQ A;  2HWI A;  1BUX A;  4XDD A;  4R5P A;  1KSP A;  4ZIV A;  2XB2 D;  1VRU A;  4IH5 A;  4QR0 A;  4R25 A;  3K5L A;  3B4D A;  2EG2 A;  3J7A 1;  5GME A;  3MPW A;  1UVL A;  4JP8 A;  4OJ3 A;  4CH0 S;  5HAO A;  4CLZ A;  3PJX A;  4LQY A;  4ZJO A;  5ETM A;  1EIY B;  1UFK A;  3I0S B;  5HMX A;  3UD4 P;  1HW8 A;  3AT1 B;  3BN4 A;  1S1T A;  4ZHR B;  1U0H A;  4KGX B;  3QAE A;  1M5S A;  1GMW D;  2C2M B;  3PIP Q;  3TI0 A;  4DR5 F;  3M32 B;  2J8A A;  1PIL A;  3OT9 A;  4LQ3 A;  3KLH B;  4NCB A;  4U6P A;  2PMW A;  1RKJ A;  4DLE A;  4USU A;  4WFN Q;  3AD8 C;  3TVZ A;  4H4K C;  1PIE A;  3OVS A;  2LXI A;  4KO0 B;  4DR5 J;  3JQK A;  1KHJ A;  3THV A;  1LOU A;  1K8A T;  2KVQ E;  1P27 B;  3HHD A;  4K7Q A;  2POK A;  4ZN1 A;  4WF9 Q;  1CQN A;  4IDK B;  2ZH5 A;  3A3P B;  4RL1 A;  5BJR A;  1Y3J A;  4DZ6 A;  4BWJ A;  2B9W A;  3FKB A;  3KKF A;  1QM9 A;  2HVZ A;  2MZT A;  3H2U B;  3M30 A;  4WII A;  3QLH B;  1X5T A;  4ELT A;  3PFE A;  1VLO A;  4RU9 A;  4U9R A;  3W9I A;  3L7O A;  2MLZ A;  2J7U A;  1RAO A;  3CJT A;  3UDC A;  4B9U A;  3NOG A;  2IRX A;  4QWD A;  2KZM A;  2M9K A;  1FRH A;  2NYI A;  3FC9 A;  1NDK A;  2PA3 A;  2J9D E;  4AL7 A;  1VC0 A;  3UDL A;  1GK8 A;  2AEF A;  1DQ9 A;  3V4M A;  4LFA F;  4RR5 A;  2XYG B;  3EZ5 A;  2HG4 A;  1ALJ A;  2AGP A;  5LRN A;  2DKO B;  4XPC A;  4J9S A;  3M05 A;  4LFA J;  2B0G A;  2XMM A;  1DLO A;  3V4I A;  2D7S A;  1NBE B;  4WFB Q;  5E3C A;  3OL8 A;  1OY9 A;  4MY4 A;  2AGQ A;  2QLJ B;  1JLC A;  1D3W A;  4OX9 F;  3T41 A;  5GAG I;  3PW4 A;  2GX8 A;  3IGY B;  5K8O A;  3EWG A;  1RBA A;  1TKX B;  4Z37 A;  3MM7 B;  2VZ9 A;  4LUB A;  4OX9 J;  4DUY F;  4ANE A;  2BQR A;  3TUP A;  3EGW B;  2OMO A;  5K8M A;  2DGO A;  1FKO A;  1RGV A;  3M8W A;  1PBU A;  1CJV B;  4DUY J;  2E66 A;  2DIV A;  3MUT P;  2X1A A;  3K7R A;  2LCW A;  1M0S A;  3MR3 A;  1HPZ A;  2HHV A;  4WKY A;  2NUU G;  1U2C A;  3MMB B;  1MWQ A;  3AOA A;  2XI2 A;  3A52 A;  3HMJ G;  5K5M A;  4F3M A;  3A8K A;  3QRP A;  1RT2 B;  1G6B A;  1UWA A;  4PXB A;  2HQI A;  3LAK A;  3GV8 B;  1DJ0 A;  4KGK A;  4W4M A;  5K14 B;  4AND A;  3CSK A;  2QL5 B;  4FKY A;  1B64 A;  1NPP A;  3VQS A;  4CZC A;  5D78 A;  3F41 A;  1N4L A;  4TYA A;  2Y1J A;  2M3D A;  1S6P A;  4CYR A;  4B3M F;  2AJ0 A;  3IM9 A;  4L76 A;  2MQL A;  1Q7Y T;  2C3P A;  5KFG A;  1KTV A;  9RUB A;  1GAO A;  2DYA A;  3EJM A;  3VTI A;  4B3M J;  4I6Y A;  2W4D A;  3LUY A;  1YIJ S;  4ZKA A;  1BQN B;  4NYO A;  3H5S A;  2HAF A;  2V2Z A;  3N4W A;  3ICL A;  2CQH A;  2XSF A;  2BE2 B;  4CTA B;  2YPZ A;  1NH8 A;  1HMV A;  3ET6 B;  2HS4 A;  1FEE A;  2VG5 B;  3HFK A;  1TV6 B;  5HRO B;  2VBW A;  3OV7 A;  1KN6 A;  3PRV A;  3CIM A;  5B0B A;  1N5T A;  3D0H E;  1S6O A;  3AHP A;  2WVF A;  3N5F A;  5KAK A;  2I38 A;  4KH0 B;  3MM6 A;  1L3S A;  1MW7 A;  3HHL C;  2GGP B;  3MAH A;  2JC1 A;  3AY0 A;  4RUC A;  1JLF A;  2CJK A;  3EX7 B;  3MM8 B;  2Q66 A;  1J27 A;  4RNM A;  5KT7 A;  1QUP A;  3TUJ C;  2OEK A;  1CJT A;  1VQO S;  1EKR A;  2V2V A;  2GZO A;  2FHJ D;  1NU4 A;  3KNG A;  4OYO A;  3R6L B;  3OW2 R;  2W4P A;  2FQQ B;  4LF1 A;  2NXJ A;  1GTE A;  2O1P A;  4QW9 A;  1F2G A;  1N36 F;  1VIS A;  2ZBR A;  2QTW A;  1RHJ B;  1HD0 A;  3UQS A;  1YJU A;  1N36 J;  1S59 A;  1HWL A;  1S48 A;  3QT6 A;  5JMN A;  5J1E A;  3PYG A;  1XNQ F;  4FF2 A;  1RT3 B;  3BM7 A;  3E01 B;  4GTZ A;  1JQG A;  4CYS A;  3WC2 A;  4KGV B;  2NLW A;  1JIH A;  5EWG A;  3IWN C;  1XNQ J;  4LBI A;  3I0S A;  3IAS 9;  5DDR C;  1TZ0 A;  1JNR B;  2OI2 A;  2KM8 C;  1CC8 A;  2XNR A;  4FN5 A;  2W4C A;  2DGQ A;  4OI1 A;  1XN9 A;  3TX0 A;  1R6Y A;  1RT5 A;  1TL1 A;  3MXH P;  4LF9 F;  1VQS A;  4HAC B;  3JAM Y;  4EZ6 A;  3WBZ A;  3Q23 A;  4KO0 A;  1CVJ A;  4C3L A;  4F4Y A;  1SH2 A;  2E44 A;  3D3B J;  4LF4 F;  8ATC B;  3PAC A;  1TMM A;  2EEY A;  2DRB A;  4LF9 J;  1S99 A;  3ZZR A;  4EYI B;  2HUR A;  4AQY F;  4EMD A;  3GJQ B;  1ZYQ A;  2ZZT A;  3KG1 A;  1D1U A;  4LF4 J;  1UPM B;  3CCL S;  3DMJ A;  3ZO7 A;  3L7P A;  4B9L A;  1PYS B;  4AQY J;  2IAJ B;  4OYA A;  2FJE B;  2AX0 A;  3QLH A;  3IMQ J;  2BKN A;  2DCL A;  2N7Y A;  3DLH A;  1KWM A;  2NCK L;  3HCX A;  3CJR A;  1RAB B;  4URQ U;  4EBE A;  4UZC A;  3VAH A;  2QZU A;  2GJF A;  3D9B A;  4QR2 A;  2XI3 A;  4Q8E A;  1AXQ A;  3OUY A;  2IHR 1;  2CJX B;  1UZD A;  3NNC A;  2XY5 A;  2YKA A;  4F4X A;  4Z7C A;  2CQC A;  3IP0 A;  1CJU B;  5KG0 A;  3KDO A;  2R7U A;  4LF8 F;  1FSU A;  1I94 F;  2DHH A;  2EC0 A;  3GJT B;  1W7W A;  2HVD A;  2B4P A;  1SKR A;  3NLC A;  1UJ5 A;  2CWX A;  4LF8 J;  1PAE X;  1I94 J;  3MEC B;  4P75 A;  1Y6V A;  4X2B A;  4C8O A;  1OY8 A;  3NKN A;  3FQL A;  3JTP A;  2ZUA A;  2IVY A;  2RD5 C;  2HK3 A;  4NRU A;  2D9O A;  4CLF A;  2DBB A;  1RIS A;  4PUO A;  4DQS A;  2VIH A;  1TKX A;  3TZY A;  4F4Z A;  3MM7 A;  5ETT A;  4DR2 F;  1XER A;  2XGQ A;  4YFU A;  2VV5 A;  1AFJ A;  2MJN A;  2ACY A;  2LMI A;  2ZH3 A;  3PNI A;  1NHV A;  1CJV A;  4U96 A;  4DR2 J;  5D0E A;  4Z7Y A;  1HWJ A;  3RRH A;  3DYA B;  1S5Z A;  3FSX A;  2CVI A;  3DRR A;  1OIA A;  2DNY A;  3S7R A;  3PW2 A;  5L38 A;  3G71 S;  3MMB A;  2AD9 A;  1NPR A;  2BJ3 A;  1OQ3 A;  4QWE A;  4DV7 F;  2XR9 A;  4GVB A;  1RT2 A;  3KJN B;  2CZV C;  3FUY A;  2LA6 A;  1FWL A;  1PYO B;  4OYB A;  5G0R A;  5K14 A;  4MJK A;  4ED4 A;  4DV7 J;  3CD7 A;  5G4D A;  3VR1 A;  3UD3 P;  1IKX B;  2CIM A;  5DLF A;  3OXG A;  3AXK A;  2FLP A;  1Y5I B;  5HBM B;  2ROG A;  4C8M A;  1FWK A;  1U2F A;  1S1W B;  3BSO A;  1XWL A;  5H1S V;  4DF8 A;  4NA1 A;  5KFH A;  2VFV A;  3RJM B;  1RQ0 A;  2YPY A;  3OPK A;  3ED4 A;  3D1Q A;  2R9L A;  4LF7 F;  3TUI C;  4DS4 A;  3CVK A;  3DOK B;  1F60 B;  2BE2 A;  2QT7 A;  5INH A;  4KE5 A;  3J81 U;  4CTA A;  1KBR A;  2RS8 A;  1G3O A;  2LU1 A;  1YJR A;  4Q0B A;  4LF7 J;  1EX8 A;  3ILI A;  1WSV A;  4HR2 A;  5LSL A;  2VG5 A;  1TV6 A;  3NG8 A;  4GVL A;  3N6N A;  5HRO A;  2ZDP A;  3I32 A;  1LKZ A;  4DPX A;  1WEX A;  4MK7 A;  4USI A;  4CYU B;  2QSF A;  1S1X A;  4QOT A;  4DSE A;  4OX6 A;  3HP6 A;  2BW7 A;  1RLD A;  4J90 A;  3GG0 A;  1ZTW A;  4EBD A;  1XR5 A;  2WTF A;  2HQG A;  2ASJ A;  1T9V A;  6AT1 B;  2UZA A;  3F56 A;  4NLG A;  2QLW A;  1NK5 A;  4DV4 F;  3ZFV A;  4O4R A;  2KRB A;  4WU3 A;  4U8Y A;  4ZG9 A;  4ZPV R;  4DV4 J;  1HQA A;  1HW9 A;  3CDW A;  4XO0 A;  4EUV A;  1X4E A;  1UJ6 A;  3SZ2 A;  1VGY A;  4Y6I A;  4FXV A;  3UCG A;  3KHL A;  2Z56 B;  2RQK A;  3R7N B;  3K5M A;  4D3H A;  2GAG C;  4A48 A;  2HHU A;  4TY8 B;  1RT3 A;  2B51 A;  2RIJ A;  1JLB A;  3E01 A;  5L39 A;  4DG1 B;  2QJ3 A;  1RAH B;  1NDL A;  1K73 T;  2ZWP A;  3MF5 A;  3KLG B;  1V5V A;  3TA0 A;  2G2O A;  1U1R A;  2O67 A;  1IR1 A;  3OFF A;  2XO6 A;  1F6T A;  4O3S A;  1YJN S;  1U25 A;  2VFR A;  4P6Q A;  5HAN A;  4TLR A;  3VZH A;  3GJR B;  2BA9 A;  2AGO A;  2KH9 A;  4YP3 A;  3GYX B;  1FT8 A;  1Q1K A;  2A18 A;  4HAC A;  2BQ3 A;  1EB0 A;  4WE1 B;  5HO4 A;  1H3D A;  1QVF R;  3ADA C;  1VRQ C;  3L95 X;  1TL3 B;  2I5J A;  3IS9 B;  1AUD A;  2H5J B;  5KFO A;  1L3K A;  4OZ5 A;  4WXO A;  2W2Q P;  2FVQ A;  4PWW A;  1HWK A;  2W8K A;  2HBR B;  1TL4 A;  2M52 A;  2QLB B;  4EU0 A;  2EWH A;  2H51 B;  5BR8 F;  3IBF B;  2HRY A;  4QIG A;  3DRS A;  5D3G B;  3KK3 B;  1V6H A;  2DJW A;  2W8L A;  4NRT A;  3B54 A;  2CQB A;  1ULR A;  3ZNJ 1;  1IKV B;  5BR8 J;  2PI5 A;  2B56 A;  1HD1 A;  4XPE A;  2RS2 A;  5LT5 A;  1ANI A;  3DHX A;  4CO4 A;  1WC0 A;  2QZ8 A;  3EUN A;  1GT8 A;  1YBU A;  2Y1I A;  1NK0 A;  1U1K A;  2OEM A;  2QMW A;  2FJB B;  5LIA A;  5KG5 A;  2BYC A;  4KGZ B;  4ECW A;  1KLN A;  2R2U A;  3NCR A;  4DV0 F;  4F36 A;  1FDA A;  2IBK A;  4DU7 A;  5K8P A;  4X4T A;  5DQH A;  1ARO P;  2VOD A;  2LFV A;  4DV0 J;  5KFM A;  1LQ9 A;  4K4U A;  1FRK A;  1WHV A;  5E33 A;  3FK4 A;  4A8Y A;  3DLK A;  3SCL E;  2JFK A;  1VC5 A;  3NGD A;  2GW8 A;  1GH8 A;  4JI6 F;  4DCJ B;  2QA2 A;  3RGI A;  1HNX F;  4NI2 B;  3QZ8 A;  1ZAV A;  7FD1 A;  2G4B A;  1NSP A;  4CO1 A;  3GIJ A;  3Q2S C;  3DYA A;  1ZAW A;  3SSS A;  2KT3 A;  4JI6 J;  2CNN B;  1BD6 A;  2A2C A;  3FFI B;  3D6M B;  2DIS A;  1X5P A;  4JI0 F;  1HNX J;  1S77 D;  2VAS A;  1HKA A;  1B3T A;  3BO4 A;  3IBC B;  3HFZ B;  1EI6 A;  4JI0 J;  4HHU A;  2F9D A;  2NR0 A;  1RU2 A;  2HS3 A;  5KFD A;  3MM9 A;  4O0I A;  4C7Q A;  1MRO B;  1JWW A;  1X4A A;  2Z30 B;  5AXM A;  3P5T L;  3R1H A;  2VIC A;  3PKM A;  4FBT A;  1WC6 A;  1VBZ A;  5I3Q A;  1KFS A;  5BYR A;  3CD0 A;  2F4V J;  1X5O A;  1KHW A;  1WAC A;  2MZR A;  1SKW A;  4C8L A;  5D8H B;  1R8A A;  5EX0 A;  3PM9 A;  1GXT A;  4FZV A;  2YKO A;  2EFQ A;  1O98 A;  2LP4 A;  5ETS A;  1UVJ A;  4ZLL A;  2LEC A;  1ALK A;  4DR3 F;  4ILM A;  5DDP C;  4NXM F;  2O66 A;  3NOC A;  2MXY A;  3AQO A;  4TY9 A;  3G82 B;  4DR3 J;  5LRM A;  3K0J A;  4KKO A;  2BAB A;  1M5K C;  3DOK A;  5B0C A;  2ZWO A;  4DPT A;  3I5B A;  1RHQ B;  3MMC A;  4Y28 C;  2BKO A;  4NXM J;  5FDL A;  4QQB A;  1B0T A;  4I2P B;  3Q22 A;  1N2L A;  3BDF A;  5DDQ C;  2O01 C;  4F67 A;  4FNI A;  1ZEF A;  1LWX A;  2R7Q A;  2UV8 A;  3NMR A;  4ZPB A;  3I9Z A;  5SZT A;  4WBF A;  4DL0 C;  1Y7A A;  5KOW A;  4TQR A;  2LDY A;  3AD7 C;  4RX6 A;  3ISZ A;  5J2M B;  2OO4 A;  3DDK A;  3PZP A;  2W25 A;  1SHQ A;  3LO3 A;  2Z2Z A;  2YNI A;  4P74 A;  2CKW A;  2C22 A;  5A76 A;  2EKY A;  4CT8 A;  2KB2 A;  4PWU A;  1GQE A;  2BJ7 A;  2JVO A;  1RHU B;  1TUW A;  3ZZ0 A;  4A47 A;  1RWP B;  2H9Z A;  3GPA A;  4HH0 A;  3SIP B;  2Z2M A;  4KR0 B;  3CB4 A;  3PDN A;  2GO9 A;  3R6G B;  2FC9 A;  2VJU A;  3BR9 A;  3LGN A;  3CJ5 A;  3CTR A;  1P49 A;  3X3U A;  4RW7 B;  2RE1 A;  3RW7 A;  1X9S A;  4WFA Q;  1C1C A;  5KFW A;  1N56 A;  1KOO A;  1FEH A;  1IKW A;  3KLG A;  4MK9 A;  3Q83 A;  3J81 Y;  1NSK L;  4DBQ A;  3Q8P B;  5F41 A;  1FCA A;  2DO4 A;  2BBE A;  3FEZ A;  1CG2 A;  4Q2M A;  1JMT A;  2AZ3 A;  4C0H A;  2GVZ B;  3C14 A;  4ECQ A;  4WE1 A;  2BEF A;  3TA1 A;  1FNM A;  3Q8Y A;  2ROP A;  3C8Y A;  2MLY A;  1W25 A;  2C3O A;  2HZV A;  2FVC A;  2N82 B;  3CCV S;  1VQN S;  5LQQ A;  1FVQ A;  1MN7 A;  4AT1 B;  1YHQ S;  1KHV A;  2Y1L B;  1JB0 C;  4IO1 A;  3VQT A;  5GAE I;  5D3G A;  2GV1 A;  2D3O 1;  2LEP A;  2ILZ A;  1R31 A;  2G13 A;  1IKV A;  2MZQ A;  4LIR A;  4OLP A;  2DNQ A;  3N0V A;  3NBP A;  4AXI A;  3KUE A;  1WOO A;  1QY7 A;  3D54 A;  3KWM A;  1QSL A;  1QTM A;  4P2M A;  1VQ9 S;  2EBG A;  4LRC A;  3T1Y F;  2CQI A;  4ZLJ A;  2FVS A;  1RP5 A;  2OH2 A;  4FYX B;  5GAD I;  2FHJ A;  3TP2 A;  3KLE B;  1F3F A;  4AUK A;  4PXD A;  2DXD A;  3RAX A;  4FF1 A;  2Q1L A;  3A8J A;  1OPZ A;  4NPO A;  1P9Y A;  4YB5 A;  3T1Y J;  3ZTQ A;  4FKX A;  5EN1 A;  3KK1 B;  2QLF B;  2BQU A;  4K4X A;  5K4P A;  4OHY A;  1WC5 A;  3S01 A;  4DL6 A;  5B0F A;  2W2P P;  3AJ2 A;  2XLK A;  2YKQ A;  2HQF A;  4DDF A;  3BGO P;  4GO5 X;  1JXE A;  2JHE A;  4RU2 A;  5DZ7 A;  3EYZ A;  1U6B A;  1VHF A;  4FS2 A;  1T11 A;  1SXL A;  2R7R A;  4B9S A;  3DGP B;  2GJI A;  3BQ0 A;  2KXH A;  1RA7 A;  4DV5 F;  1IWG A;  3IG1 B;  3NXZ A;  5K8N A;  3BSC A;  2WVC A;  2BR0 A;  1B4S A;  2W24 A;  4X4S A;  1EW8 A;  4GMK A;  1JJC B;  5BYS A;  4EO8 A;  2IM1 A;  3ZZO A;  4DV5 J;  5K20 B;  2DR9 A;  4DUT A;  5E0O A;  1ZAX A;  1WEY A;  4NXN F;  1NJW A;  3SXL A;  2D3Z A;  2EKN A;  2QA4 S;  1PO6 A;  1ZBT A;  7FDR A;  2AEM A;  3CNQ P;  1W2I A;  5C24 B;  3A3O B;  1HBO B;  1RTH B;  4NXN J;  2ZNY A;  1AW0 A;  3PHT A;  3GSD A;  1WD6 A;  4HI2 A;  4TYB A;  2LLZ A;  2GML A;  2DEJ A;  2C2O B;  2DH7 A;  2BDP A;  3BGL A;  2RB7 A;  3ZTO A;  2FHM A;  1CBK A;  2RML A;  3AD9 C;  3NKO A;  2PD1 A;  2MEW A;  4P72 A;  1BLU A;  1I5O B;  3DXB A;  3MPV A;  3P5B P;  1BC6 A;  3D5M A;  1AA1 B;  1ZPW X;  2XS7 A;  3I0R B;  3MED B;  5A8K B;  5KFT A;  2CPE A;  4ED7 A;  1HLW A;  1IQZ A;  4X64 F;  1RB0 A;  3M8S A;  1B70 B;  4IFV A;  1WG4 A;  1IM6 A;  3ONQ A;  4DV3 F;  1HJK A;  4ID5 B;  1DBD A;  2G0I A;  1OYD A;  4DX5 A;  1ZZF A;  2FB0 A;  1FI4 A;  1FJ7 A;  4QU6 A;  4X64 J;  3FCW A;  1UAW A;  1YLX A;  4DV3 J;  3FVY A;  4ED3 A;  1YJ7 A;  4I2P A;  2W9A A;  5KG4 A;  1KH9 A;  4K4T A;  4O3P A;  1X9W A;  1PJ5 A;  3GCW P;  3KLF A;  3RBD A;  5F9N A;  4LF6 F;  2DGU A;  2HRT A;  1KD1 T;  3W5Z A;  4LF6 J;  1DTT A;  2KDO A;  4NZ0 A;  2ZC3 A;  1KHN A;  5J2M A;  4U95 A;  3C2P A;  4BWM A;  2XGP A;  2E7X A;  2F9J A;  4NLO A;  4K5R A;  5IT4 A;  2LA4 A;  2PFF B;  2JFD A;  1U09 A;  3WHI A;  2KHC A;  4K4W A;  4X65 F;  2JEF A;  3B5Q A;  3UD5 A;  2ZZN A;  1UTA A;  2HWH A;  1VDH A;  1M5V C;  3NP5 A;  5DQG A;  1YK9 A;  1KDN A;  2IVM A;  4MIV A;  2UXD J;  4X65 J;  2PEH A;  1MSW D;  1XTZ A;  3O8W A;  1KHK A;  2OUG A;  4EGL A;  3Q24 A;  3H8Y A;  2ZHA A;  1NKC A;  3ILL A;  4ZA1 A;  4ER8 A;  1D0E A;  1Z1Z A;  2B9X A;  3KK2 B;  2HS0 A;  2NXE A;  4PQA A;  1FTR A;  2VON A;  2V63 A;  1XIQ A;  1PSD A;  4K5S A;  3PEJ A;  4LRF A;  3M2R A;  1A9N B;  2VG6 A;  2R2T A;  1RT1 A;  2ATL A;  4RWX A;  1MN9 A;  4QJV A;  5ETO A;  1HI0 P;  2R8K A;  3MUV P;  1W2B R;  4W92 B;  4RPF A;  2YBV A;  4MMO A;  3CT9 A;  2DIT A;  4FDF A;  5BYQ A;  2C2K B;  2RT3 A;  3GV7 B;  4RUB A;  4WCE Q;  3EE3 A;  1ALH A;  4G1P A;  3KHG A;  1X31 C;  4ZN3 A;  2X1B A;  5DLT A;  2MHE A;  3V2U C;  3IWX A;  5K9F A;  2DH9 A;  3M9N B;  3NCP A;  4ICL A;  4DFP A;  4LR7 A;  5J2N A;  2IY5 B;  3CJK A;  3T5H A;  1RCO B;  3LF0 A;  2V5H G;  2D3U A;  1B99 A;  3IBW A;  1R8H A;  1NK9 A;  3JSR A;  2K7J A;  4KIA A;  3T19 A;  2V4Q A;  1JLA A;  1PCA A;  2LDI A;  2CJY B;  1SIW B;  1OY6 A;  1UL3 A;  1RHM B;  4YOE A;  5D0R A;  4NWJ A;  1EKS A;  2DR6 A;  4Y2K A;  3ILJ A;  3DCA A;  3JQJ A;  4OI2 A;  1YIT S;  3W5X A;  4HL9 A;  1AJD A;  3W7B A;  5H9E K;  2YXL A;  5HMZ A;  3KLE A;  4DCP B;  2UU9 F;  3P96 A;  3FSY A;  3A1Y G;  3G8S A;  2CDQ A;  2QO3 A;  1QAJ A;  3UNY A;  1VQ8 S;  3CUN A;  1DRZ A;  3IWL A;  1ZH5 A;  3U1L A;  2VFS A;  2UU9 J;  4YN3 B;  3MUR P;  3ILO A;  2DEI A;  3R97 A;  3M1V B;  4NMX A;  4MKV A;  2RKI B;  5HP1 B;  2V50 A;  1AJC A;  1YQH A;  1RAD B;  2HFU A;  3DGP A;  3IAM 9;  4KQZ A;  3J80 U;  3IG1 A;  2HBQ B;  4IFY A;  2C28 A;  1IQT A;  1S9F A;  2FY8 A;  4UPI A;  2HPU A;  5THW A;  2ZJQ Q;  2XYH B;  4B9N A;  2NQP A;  2WVD A;  4J9O A;  1UMJ A;  1SJ3 P;  1URN A;  2E1A A;  5KG7 A;  3CWJ A;  3WQP A;  1IBL F;  2CJA A;  2HNZ B;  1VRT B;  1T94 A;  4V1A k;  2B6A B;  1N54 B;  2CRL A;  3ZZP A;  4BC7 A;  2RIL A;  2NXC A;  3SYZ A;  5C24 A;  2BOA A;  2GSN A;  3OR1 B;  1CC7 A;  5CD4 A;  4ZPD A;  3QAT A;  3MM5 B;  1URA A;  2YNF A;  3BZQ A;  5KT5 A;  1WDD A;  2COL A;  4QAX A;  1RTI B;  1J2V A;  2ADB A;  1VI7 A;  1XBW A;  4NLX A;  5I3U B;  5IJS A;  2P6T A;  5IWA F;  4J9P A;  1TEL A;  2VA3 A;  4IRC A;  2QG9 B;  3RR8 A;  4PWD B;  3MED A;  3TUZ C;  5A8K A;  3PG9 A;  1HHS A;  3M6X A;  2N3L A;  3GSI A;  3D1H A;  4ID5 A;  4DPY A;  1S72 S;  1U24 A;  2KL8 A;  4G1I A;  5KFZ A;  5DZ6 A;  2RRN A;  3Q8U A;  4C8Z A;  1AUK A;  2L9D A;  3NGU A;  2LQ9 A;  5A0Y A;  4J37 A;  3DC2 A;  1C1B B;  2XWX A;  4YR1 A;  4KFB B;  2GMH A;  2FDN A;  3PR4 A;  1U02 A;  1AJB A;  3CIZ A;  2UVV A;  4LRE A;  1RT6 B;  2DCU B;  4Q8F A;  4C4W A;  2XSJ B;  3G96 A;  2YX4 A;  3FEX B;  4KJI A;  2MKS A;  3MGJ A;  5GAE U;  2JDJ A;  2AYM A;  5HL7 Q;  4ECV A;  3I55 S;  3PJW A;  3FNN A;  1FE4 A;  4LSN A;  5LJ3 Y;  2D41 A;  4PG7 A;  1TK0 A;  3TW0 A;  4DV6 F;  1ZPV A;  1ELO A;  3SQO P;  2IDE A;  2VPY B;  1E6V B;  1ELX A;  2HHX A;  5B09 A;  5GAD U;  1TL5 A;  4DV6 J;  2ZEJ A;  4JBC A;  1Y5L B;  4CI0 B;  1Q79 A;  2RRB A;  3D0G E;  3QFH A;  1YKW A;  2OD6 A;  4MKB A;  3WDO A;  1RWW B;  4PG8 A;  1OSD A;  3H59 A;  4E98 A;  4CO2 A;  3OTO F;  3NVL A;  1LEO A;  2R7O A;  1T03 B;  5HVF A;  2JX2 A;  2YKN B;  3EMT A;  2HIQ A;  2QA4 G;  2M70 A;  3KK2 A;  1UFW A;  3GB0 A;  2JVR A;  2ZD1 B;  3OTO J;  1NCL A;  4DV1 F;  2L3M A;  2AJ4 A;  2HIY A;  4ELU A;  1AT1 B;  5KFP A;  3HF5 A;  1MWY A;  4ZPA A;  2HQD A;  4M63 A;  2Y0B B;  3R8Y A;  3HZG A;  2J6T A;  4DV1 J;  1T05 B;  2C42 A;  3CCZ A;  3M4X A;  3RG6 A;  2GNK A;  1KKH A;  4KSE B;  3HM9 A;  9ATC B;  3J81 j;  4KC5 A;  3K2Y A;  2R7X A;  1ZET A;  4MFB B;  5L1I A;  4OX7 A;  1FTC A;  3DU5 A;  2Z58 B;  3UR0 A;  5C7P A;  5ETK A;  2YX7 A;  3MMA B;  4PG6 A;  2W5S A;  1R89 A;  2K7K A;  2CWK A;  3MEK A;  5B7W A;  4M5K A;  2XTJ P;  5EGE A;  2K2P A;  1EQM A;  2FJX A;  4V19 J;  1HBU B;  3AJD A;  2UUC F;  2D9P A;  3P3D A;  2BRK A;  1SIZ A;  2AW0 A;  2OEJ A;  1FE0 A;  3CDB A;  3R7B B;  1SC4 B;  3EM1 A;  3Q2T C;  2UUC J;  3KG4 A;  1C0T B;  2AZ1 A;  3H5Y A;  1KC8 T;  3UNG C;  3HVT B;  1NK7 A;  4ED5 A;  3ZXW A;  3QSY B;  3RAM A;  3EZO A;  4M5L A;  4RNN A;  5JXS A;  1S1V A;  2XS2 A;  2JEG A;  2XMA A;  5F8J A;  3GCX P;  4B3R J;  4WZM A;  3HHL D;  1JLG B;  3M1V A;  2YQ3 A;  5CYM A;  5C42 A;  3R2C J;  5IOL A;  2KJV A;  2OFH X;  2VC0 A;  1SKU B;  3MR5 A;  2FHO B;  1VIX A;  5H9E J;  3R5D A;  1K0T A;  1Q8K A;  4USK A;  4NEY A;  4CLW A;  2XUL A;  2JLE A;  1KVJ A;  4KPC A;  1REG X;  3D6T B;  1Y11 A;  1GEH A;  3MAQ A;  2FHK A;  1ZA2 B;  3EVW A;  2R4F A;  2HNZ A;  1VRT A;  2VOO A;  5HQ8 A;  2R8G A;  3KNA A;  3IGZ B;  5DRK A;  3M6W A;  2VBZ A;  1HR0 F;  4PQU B;  4OHZ A;  2VKR A;  1QSS A;  3CME S;  3NS7 B;  2XC9 A;  3D2W A;  4YEA A;  1TVR B;  4NWB A;  2B5J B;  1CUL A;  3MM5 A;  1HR0 J;  1FF2 A;  2K1R B;  3POT A;  2QV6 A;  1TMJ A;  2EFV A;  5IV3 A;  3LAL A;  2VA2 A;  5JUM A;  1N33 F;  4MIW A;  4ZCM A;  3PJ9 A;  4J9L A;  2V69 A;  1RT7 A;  3KHH A;  2Z8Q A;  1S7I A;  3PTW A;  1N33 J;  2IFX A;  3R3T A;  1SQE A;  5CXT A;  1L3V A;  2HLU A;  3BH6 B;  4ZVS B;  2H4W B;  3BDE A;  3WX8 A;  2FTR A;  4LRA A;  4BBY A;  3KJV B;  1N52 B;  2VUG A;  3GTY X;  1D09 B;  4CCH A;  3LP1 B;  1E1Z P;  1WTF A;  2AWZ A;  1LK5 A;  5HLF A;  2LXF A;  1RWO B;  3IO1 A;  1QAY A;  1ZOT A;  1UEK A;  4C0O C;  3DXS X;  3MAA B;  1C1B A;  3HSD A;  4NE9 C;  2UVR A;  1KVI A;  3A3N B;  5DGB A;  4WFX A;  3U02 A;  5E3A A;  1UET A;  1RT6 A;  3AA8 A;  1SB6 A;  4Y3C A;  4B02 A;  3GON A;  3D7S B;  4NLD A;  4QBU A;  2FUG 9;  4KHM A;  2MB0 B;  1MU2 B;  2UXC F;  1RXO B;  3QYY A;  2CJB A;  2RQC A;  2E5L F;  4QW8 A;  4TU9 A;  2IYI A;  3IGN A;  2W9C B;  4MTP A;  4ES1 A;  3BQ1 A;  1VR6 A;  3TAM B;  2UXC J;  3KFW X;  1SUQ A;  1E6V A;  2E5L J;  2AJ2 A;  1IM4 A;  2B9E A;  4I69 A;  1Q5V A;  2DGW A;  2NSC A;  1U6F A;  1E3C P;  2PMZ D;  2J9E A;  4F0H A;  2PMH A;  2Z2Y B;  1REV B;  1RE1 B;  1VCT A;  2VPZ B;  2XHC A;  3IM8 A;  1N88 A;  3WAW A;  4QYZ K;  5L9N A;  2VG7 B;  1OO0 B;  1T03 A;  4BLG A;  1YVF A;  2OGU A;  2V8V A;  3TO8 A;  5ADZ A;  4DI6 A;  2ZUG A;  4G1Q B;  1RTD A;  2ANH A;  4UOR A;  3W2W A;  1SI9 A;  1NSA A;  2YKM B;  4JI5 F;  3FRZ A;  3T6B A;  1JNZ B;  1SCJ B;  2RH6 A;  4JUZ A;  3CCM S;  2NPI A;  2HRU A;  4N7T A;  4HYK A;  2CQ0 A;  2G1D A;  2Z4P A;  3QJP A;  2HEK A;  3MZI A;  2XMT A;  1IKY B;  1FNO A;  1KQK A;  5LXY A;  1T05 A;  4JI5 J;  3DHW C;  1L5U A;  5I42 B;  2XBP A;  4NA2 A;  1RA6 A;  4C11 A;  2QMX A;  4QCL A;  1B7Y B;  2AIR B;  3SQG A;  3VGT A;  4CO5 A;  2YTC A;  4F4A A;  1Y0H A;  4DR1 F;  4ETX A;  1HL6 A;  2ZM6 F;  2YWH A;  3N9U C;  2DR5 A;  4MFB A;  2SXL A;  4DPU A;  1YDL A;  3N6L A;  4DR1 J;  3DM2 A;  2ZM6 J;  2D74 B;  2RRA A;  2KFZ A;  4LRB A;  3ZZT A;  2PEB A;  3PIO Q;  2ZOG A;  2CQ2 A;  2JJ4 D;  4BCA A;  1F9F A;  1GFW B;  3GII A;  1ED9 A;  4TN0 A;  2KXF A;  3IRX B;  3FMW A;  3HLU A;  1HBU A;  5C2G A;  1CQM A;  2DT9 A;  1NJX A;  5A8R B;  3AOD A;  3PX0 A;  1GXL A;  1OWX A;  1H2T Z;  4RNO A;  5L1L A;  3THT A;  2ZBQ A;  2JH3 A;  5DG8 A;  1K44 A;  4K0K J;  2QSW A;  2L41 A;  4C8K A;  1UFL A;  2OJ3 A;  4JV2 A;  1YRU A;  1AB8 A;  2K3I A;  1IVZ A;  4EWT A;  3RR7 A;  2MKC A;  3FBB A;  1OMS A;  1Y7P A;  2Z0G A;  3ENW A;  2HQC A;  3HDS A;  4ZDN A;  1JLG A;  4C0B A;  5E41 A;  4KPY A;  3LPE A;  1N6Q B;  2GS8 A;  3FJ2 A;  3D4J A;  2CG8 A;  4OYW A;  5ETQ A;  3T6J A;  1PKU A;  2CNO B;  3ELH A;  4N8O A;  2A3J A;  2RUG A;  2BJD A;  3MR2 A;  2RQ4 A;  4ED8 A;  1U4B A;  3L4B C;  2M5Y A;  1LXN A;  4RW6 B;  1N2K A;  1XK8 A;  3ENA A;  1H6K X;  1BMQ B;  1WG1 A;  4ZP9 A;  2APO A;  3QQC D;  3ZTP A;  2MQQ A;  4FPI A;  3OJU A;  3BRE A;  2HFO A;  3TEG A;  2ZC4 A;  3W8P A;  1ALI A;  4D3G A;  2HBZ B;  2X3D A;  3I82 A;  5ETV A;  1MG7 A;  1HDH A;  3RB4 A;  2MQN A;  4O44 B;  2BUN A;  4NCA A;  3G6Y A;  3WC0 A;  4HKQ A;  1JKH A;  1T3N A;  1RT4 B;  2CDR B;  2GIQ A;  1TVR A;  4DJB A;  1NAQ A;  5D6G A;  3LP2 B;  2VOP A;  2HBY B;  5AXL A;  2ABY A;  1YJV A;  3DI6 B;  2YQ0 A;  4MAK A;  2KYZ A;  2GHP A;  3KJQ B;  4FS1 A;  2HZC A;  3HHK A;  3UPF A;  1NHK L;  4OJG A;  3QSI A;  1UJ4 A;  4KY3 A;  3OHA A;  1KTQ A;  1RWU A;  2A1B A;  4WU2 A;  1EET A;  1WF0 A;  4OZ0 A;  1HNW F;  2W9B B;  1Q95 G;  2HMI B;  2IUC B;  1GX6 A;  3D1O A;  3KJV A;  1HIY A;  4Q43 A;  2XY7 A;  1Z2Z A;  4LRD A;  2JEI A;  4NCG B;  2KG0 A;  1RKI A;  1VC6 A;  3OTE A;  5D4L A;  1HNW J;  4Y2C A;  1X4B A;  3UFC X;  2P6S A;  4YS2 A;  4OIX A;  3H2L A;  3H0P A;  3M8Q B;  4QWB A;  5DQI A;  4NLS A;  1RUS A;  1EQJ A;  2AX1 A;  3C6U A;  3MAA A;  2EFN A;  3DFE A;  1U1N A;  4NWX A;  1H7X A;  4PEO A;  4XIU A;  3RTV A;  3UCU P;  1D9D A;  3UDE A;  2AV5 A;  3RAQ A;  3S1T A;  4OHV A;  1WI8 A;  3PYE A;  4YR2 A;  2ZOM A;  1YGY A;  1TQL A;  1H2V Z;  5M2P A;  4WP8 A;  3C6T B;  3C16 B;  4LIW A;  3EPI A;  1X4C A;  3QRR A;  4J9M A;  4UPH A;  1GNK A;  3QT8 A;  5DLV A;  2HQ3 A;  4O3N A;  1BXN A;  2VHG A;  6FD1 A;  3TAM A;  4JI8 F;  2MLX A;  3C66 A;  4UUW A;  2WZ1 A;  1TU0 B;  3TQ1 A;  2VB6 A;  3NGT A;  4IG3 A;  3U27 A;  1DZ5 A;  2Q6B A;  4ZIW A;  4JI8 J;  1WKL A;  1S9G A;  5H9F K;  2CUY A;  1X9M A;  3TR5 A;  2BRL A;  2WCX A;  1E2S P;  4HHH A;  3SZZ A;  1REV A;  1T0T V;  4MYT A;  4DMZ A;  2HHQ A;  1K1Q A;  2NUH A;  3OLB A;  1NEE A;  3H98 A;  1Q81 T;  4IYQ A;  3D68 A;  3DDI A;  4USM A;  4XK8 C;  2XY6 A;  4YY3 F;  1I6J A;  4CNZ A;  2R8H A;  4JV1 A;  4UTG A;  4G1Q A;  2ZNZ A;  3KMQ A;  3HSZ A;  1NJZ A;  2KM8 B;  1T8E A;  4ZCL A;  5F3Z A;  2MZS A;  2E9Z A;  4YY3 J;  4M5G A;  1IKY A;  2HNY B;  4IOA Q;  2E1P A;  1S0M A;  1OJ4 A;  4LR2 A;  1PG5 B;  2ZKT A;  1FNX H;  4H4K A;  1ACM B;  1TL7 B;  4UOG A;  1ROF A;  1PYT A;  1QVG R;  3MI7 X;  1T95 A;  3VGV A;  4QYZ J;  3VF0 B;  4L3N A;  2GJ2 A;  1WUU A;  4GC6 A;  4DQI A;  4AL6 A;  2F8E X;  1WSR A;  1VQP S;  2DNH A;  2HND A;  2YKP A;  4WK1 A;  1VK8 A;  2EVZ A;  2CYY A;  5A6P A;  1FVS A;  4F7V A;  2FZC B;  3M8P A;  3GQC A;  5HSP A;  3OFH A;  1U1P A;  3SZY A;  1F0X A;  2V4J B;  1V9O A;  1X4F A;  3OQ2 A;  2UUA F;  5HMW A;  5C25 A;  2ZH6 A;  5A8W B;  2OPQ A;  2H65 B;  3IRX A;  1RYR A;  3VVU A;  5L1J A;  4KYZ A;  2UUA J;  2ZE2 A;  4DPO A;  3EDQ B;  3QFW A;  1U26 A;  5CYQ A;  4YHH F;  4HLB A;  2IRY A;  2W7P A;  3LP0 B;  2ZH9 A;  3JSB A;  3MWB A;  1R27 B;  3N5B A;  3P45 B;  5IM0 B;  2J0X A;  4YHH J;  1JXV A;  3J7Y I;  3JSM B;  1N48 A;  5EDW A;  2B7C B;  3K5P A;  3EGN A;  3W9J A;  3PW0 A;  4IG0 B;  1HBN B;  7AT1 B;  4B56 A;  1MNE A;  3N28 A;  2CAD A;  2ZH1 A;  2XZD B;  2DVI A;  4JV0 A;  1N6Q A;  1P1L A;  4WIQ A;  4USJ C;  5DG7 A;  4DSK A;  1KH4 A;  4EEY A;  1YG0 A;  4LMZ A;  2XMU A;  3H2V E;  1ZEB A;  3K57 A;  3HFV A;  2NZ4 A;  3SCI E;  1N8R T;  4RW6 A;  3JS9 A;  4B3T F;  4G6V B;  2GHW A;  2PO4 A;  5IV4 A;  2ZHO A;  5F3T A;  2KO1 A;  1DFD A;  3M8R A;  1LXJ A;  1M1H A;  3VCD A;  4B3T J;  2F63 A;  1EW9 A;  1VMB A;  2JWN A;  3OR2 B;  1FXR A;  3LGH A;  4M94 A;  4OYI A;  1SJF A;  2V0N A;  3HXM A;  2MSS A;  4O44 A;  3U7J A;  5FII A;  5A2Q Y;  2IA6 A;  1LNQ A;  2P5V A;  2J6U A;  1FDB A;  2MGZ B;  1N5V A;  1ZM9 A;  3ZZY A;  1U47 A;  5KFK A;  2LEB A;  1TKZ B;  1T9W A;  2YH1 A;  3Q8S B;  4C97 A;  4NYZ A;  2ZHB A;  5GRR A;  1FKP B;  4DL3 A;  2MKY A;  1WOS A;  2WBR A;  4B3O B;  2V9K A;  5LL6 d;  3D6H B;  1RWN B;  4QWA A;  2W9B A;  5EGY A;  1NUE A;  4OZL A;  1X7V A;  1VQ5 S;  1FK9 B;  1YRT A;  2CVE A;  4F25 A;  5AE3 A;  4BC9 A;  3PO5 A;  4RJV A;  1WC3 A;  1KH5 A;  4KHR A;  3B6B A;  2GA3 A;  3W1Y C;  3TG0 A;  2P8I A;  2B3T B;  3A13 A;  2PFD A;  2XO7 A;  4ZHR A;  4J9R A;  1VQM S;  3CMA S;  3BGU A;  3M32 A;  4EYH B;  2HHT A;  3ENQ A;  2VPX B;  1TKT B;  3KLH A;  2JC0 A;  3CED A;  5AE1 A;  1LW0 B;  2VL1 A;  2YQ1 A;  4ZG7 A;  3LTO A;  3TAQ A;  1CSJ A;  1WC4 A;  5B0G A;  2ZBC A;  3C6T A;  2G2Y A;  4BDP A;  2IBO A;  2YY3 A;  2M4M A;  4WXW A;  3OVA A;  4IDK A;  2PSZ A;  2L9W A;  4FXW A;  2VFU A;  1VBK A;  1UEV A;  2WOM B;  4L72 B;  4Q45 A;  1KEK A;  1KS2 A;  1QE1 B;  1T02 A;  5FLX Y;  2DNL A;  2KU7 A;  2KKH A;  1N34 F;  2AQ4 A;  2C3M A;  4AL5 A;  1R7I A;  4N5S A;  1DHM A;  3W66 A;  1WNE A;  3C15 B;  3MEE B;  1N34 J;  3QWP A;  5KT2 A;  5HVG A;  4RUH A;  3MEG B;  1HQE B;  3CJS A;  4Z2X A;  2HW3 A;  5KT3 A;  2MHN A;  1HWU A;  4Y2I A;  3H40 A;  2ZH4 A;  2LQB A;  3MHY A;  3BEG B;  2KG1 A;  1ZED A;  3ENV A;  4F50 A;  5H9F J;  2AYG A;  2YX1 A;  3UE2 A;  5T41 A;  1RAG B;  2HNY A;  4I7F B;  3OL6 A;  4PXC A;  2NYH A;  5GMD A;  2GAH C;  3TVY A;  1IBC B;  1EP4 B;  3M9O B;  2DY1 A;  1TL7 A;  1XR6 A;  3V5R A;  2DTJ A;  5KFR A;  2FZG B;  3NGK A;  5GOV A;  2IA0 A;  2MKJ A;  4RLE A;  1HFE L;  5MLC V;  4ZVH A;  1WWH A;  2U2F A;  4RKU C;  4JOU A;  3GV5 B;  2RF2 B;  4P2S A;  2N4D A;  2F8M A;  1FRJ A;  2C2D A;  2R8I A;  3A8I A;  4ZPC A;  4HDH A;  4OL8 A;  3DLE B;  1C0U B;  3GYN A;  3DRP B;  5L0B A;  2MDA A;  4I56 A;  2F3J A;  4Y0F A;  4L74 A;  2HSE B;  5IC6 B;  1NO8 A;  1VS3 A;  3IN5 A;  1MMN A;  4UST A;  1G4C A;  4ERD A;  3C19 A;  1S6Q B;  2AEJ A;  1M1G A;  2R8J A;  1M90 T;  4X62 F;  4DN0 A;  1KHL A;  2KN4 A;  4YUD A;  1VK3 A;  1KH7 A;  3LP0 A;  3G6X A;  3VAI A;  4HT5 A;  4X62 J;  3GFX A;  4CXU A;  5CAB A;  5IM0 A;  4E2F B;  1YSJ A;  4AFF A;  3NAH A;  4ZS6 A;  2ALY B;  1FA0 A;  4IG0 A;  4WTY A;  1S1T B;  1HBN A;  1U0H B;  4I67 A;  4P2X A;  4IH7 A;  1BQN A;  5KFJ A;  1WI6 A;  2BJ1 A;  3NKQ A;  4X84 A;  4WK3 A;  1SBR A;  4OI4 A;  3TJ8 A;  4FVC A;  2JLF A;  2AYB A;  4L3K A;  1URR A;  3ET6 A;  2KI2 A;  2JSX A;  4BHQ A;  3TWZ A;  1VQL S;  2DR7 A;  1FFS B;  2U1A A;  4CDI A;  2UXB F;  3GG1 A;  5KFX A;  2UUB F;  2XMK A;  4YDD B;  2XWY A;  1IBK F;  4NLQ A;  1F9E B;  4RBT A;  4CLT A;  3FZ2 A;  1TK8 A;  2UXB J;  4EBC A;  1ZM3 A;  1Z4U A;  4HH1 A;  3M30 B;  3KD8 A;  1D9A A;  1LWF B;  2GGP A;  2UUB J;  1VBY A;  2IMW P;  3M9M B;  5D4N A;  1IBK J;  3MM8 A;  3EXC X;  3EGZ A;  4DX6 A;  1FXL A;  3KUG A;  3AB2 B;  2UUW A;  1S0N A;  4RZR A;  3CXC R;  2YWK A;  2QA1 A;  2VJV A;  2L48 A;  2ATC B;  3RBX A;  2OPP B;  3T1H F;  1TKZ A;  4CLS A;  2K3K A;  3MMJ A;  2E5G A;  1I3O B;  5HVH A;  1FRI A;  3ZTR A;  3T1H J;  3H5X A;  3CCW A;  4ENO A;  3KJF B;  4P52 A;  5GAG U;  4UZB A;  1KNZ A;  2FIU A;  3TA2 A;  1FK9 A;  1U6Z A;  2D69 A;  4GTW A;  5IT0 A;  4WPA A;  2BAN B;  2PGC A;  4CQ1 A;  4ECX A;  4OFZ A;  4NLY A;  1U1O A;  1DAR A;  1Z2L A;  4LJM A;  2DHX A;  4ZK7 M;  4HTI A;  4PZV A;  5ETP A;  1DQA A;  3CCE S;  2RHQ B;  3OLA A;  2F8H A;  4OJ1 A;  4TU7 A;  1F5C A;  1TAU A;  5EWE A;  4NLR A;  3I31 A;  3QT7 A;  2DO0 A;  3PW7 A;  1TKT A;  4KJG A;  1FKO B;  2DNK A;  3T1A A;  2J0S D;  3R27 A;  3O1L A;  3CMQ A;  3T5K A;  1X5S A;  1XMB A;  2DXF A;  1LW0 A;  1CEZ A;  3HPO A;  3MK0 A;  3UI3 A;  5FJ4 A;  1LW2 B;  4C98 A;  2QGF B;  2PC6 A;  2QMU B;  3KHR A;  4J9K A;  4F0K A;  1T9Y A;  2DHG A;  4O0N A;  2VD3 A;  2IAJ A;  3TYT A;  1FFW B;  3DPC A;  1V5I B;  4WZQ A;  2XNQ A;  5E3P A;  4FPR A;  2E29 A;  3NKP A;  2HWT A;  2BKP A;  3J7Y U;  4RWW A;  4XDC A;  3GIK A;  4ECT A;  5ETN A;  3C15 A;  2AKW B;  3MEE A;  1WDT A;  3MFH A;  2Z2L A;  2GIR A;  5J2Q B;  3G9C A;  4UPK A;  5DM6 Q;  3TEH B;  3T5L A;  4JB8 B;  5RUB A;  5CZX A;  3WBH A;  3P49 B;  2B8Q A;  2CNL B;  4ZP8 A;  4WP3 A;  3HHE A;  3RW6 A;  4NOH A;  3IR6 B;  6FDR A;  3NKY A;  4OYP A;  1SC1 B;  1CJU A;  4NML A;  3KG0 A;  3W3S A;  2PE8 A;  1Q4R A;  4OJH A;  2XG8 A;  2PN6 A;  1H2U X;  1NZ8 A;  3OXF A;  3D28 A;  4X4N A;  2H5E A;  2G9Y A;  4OLO A;  2YH0 A;  1HA1 A;  3MEC A;  4C48 A;  1E6Y B;  2CA9 A;  5IT9 Y;  4IRD A;  1EP4 A;  3O5T B;  1FHT A;  5J2P B;  1UKU A;  1FRX A;  3BJY A;  4DZD A;  1VLY A;  2D1C A;  4LR8 A;  2CG4 A;  1AFI A;  4CLL A;  3DOM B;  5HI7 A;  2QE5 A;  1K0V A;  5B0E A;  4ZVF A;  1KRP A;  2CQ1 A;  3VGS A;  3MFI A;  5IQQ A;  3LPY A;  3MM6 B;  3HI9 A;  1EHW A;  2ALZ A;  1JLF B;  2NXU A;  1GMW A;  5IJQ A;  2ZOF A;  3DLE A;  1CJT B;  2CQD A;  5DLW A;  1H38 A;  5EGH A;  4LF5 F;  2IMO A;  4CO3 A;  1TTH B;  4DS5 A;  1K9M T;  5L46 A;  3MCN A;  1F5B A;  3BDG B;  2D1G A;  3OTD A;  4LF5 J;  2NSB A;  1WHY A;  4Q7A A;  3EVM A;  4HVZ A;  2F4V F;  2GLQ A;  2QFI A;  3OXL A;  4N56 A;  3TOQ A;  5J1E B;  3JB9 k;  4DQR A;  1IKX A;  2CQ4 A;  4DV2 F;  1K1S A;  4L6V 3;  3W9H A;  1N0U A;  1NM2 A;  5F8I A;  4ILR A;  1SHN A;  4LVN P;  2K06 A;  5HBM A;  1VBX A;  2KZZ A;  3BS9 A;  3BO2 A;  4DV2 J;  3HKW A;  1Q7L B;  5KFI A;  1H72 C;  1S1W A;  3OD2 A;  2Q43 A;  3PYD A;  4RW9 B;  3FMB A;  1S12 A;  2KVI A;  1B8J A;  4FDJ A;  4A8Q A;  1WOP A;  4RUA A;  3MCO A;  4IKA A;  4K4Z A;  1RT5 B;  1TL1 B;  2DIU A;  2HFN A;  2E5J A;  3ISN C;  4ECS A;  3LOU A;  4QWC A;  1FD8 A;  4PCQ A;  4QYR A;  2KFN A;  4ZLP A;  1Q8B A;  3JTN A;  1F5A A;  1YJ9 S;  5B08 A;  2AU0 A;  2RDJ A;  1YX2 A;  4J9N A;  4EZ9 A;  1BWE A;  1HWI A;  1S79 A;  5KG3 A;  3HHN B;  3GU0 A;  1U8S A;  4CYU A;  3CW2 C;  2ASL A;  2ZDO A;  3DMJ B;  4Q44 A;  3BGR B;  2MQP A;  3TAP A;  2LQJ A;  1K7H A;  4HHJ A;  1LWF A;  1XEZ A;  2DRD A;  2OFG X;  1MML A;  2OP5 A;  2ZJR Q;  4G3I A;  2XEX A;  2OIH A;  2NRE A;  2YWF A;  2HHW A;  3EXY A;  1SQF A;  2E9T A;  3OUY B;  2ZVS A;  4UW2 A;  4LT6 A;  2RVJ A;  2OTL S;  2NS1 B;  3RBZ A;  1U45 A;  2OPP A;  4K2X A;  4N8N A;  3A8E A;  1QLN A;  1RAF B;  2R2R A;  4NLW A;  3RRG A;  1HYS B;  2JZ5 A;  2W2O P;  4TY8 A;  2KXN B;  2ZFH A;  1LFP A;  4DG1 A;  4IR9 A;  4ZCI A;  5EX3 A;  3QGH A;  5I3P A;  3W8G A;  4TQS A;  2BAN A;  4DCO B;  2XLI A;  4ETZ A;  1X0P A;  1H0H B;  5DG9 A;  3MK2 A;  4PUO B;  4O23 A;  5GMK a;  1L3T A;  3LA0 A;  4FBU A;  2JL9 A;  1WOR A;  2RJZ A;  1EJJ A;  2DNP A;  4OZJ A;  3Q8Q B;  1C4C A;  1IWA A;  2B7B B;  4LQ9 A;  1IR2 A;  4PG4 A;  3ETM A;  3KLI B;  4AD6 A;  1GMV A;  4AYB D;  1XMO F;  2MKH A;  2XS5 A;  2KT5 A;  3SEO A;  2V9W A;  4UUX A;  2M8H A;  4CM0 A;  1JLQ B;  2WON B;  3H25 A;  3MK1 A;  4JYA F;  1RBO B;  1TL3 A;  5D77 A;  2RUS A;  1LW2 A;  3DRR B;  1XMO J;  2XCP A;  3IS9 A;  1S7H A;  5E3Q A;  2XCA A;  2JLG A;  4Y00 A;  4JYA J;  1RTJ B;  3DLJ A;  1LWC B;  1ED8 A;  4GVB B;  1UW4 A;  2KFY A;  3HVW A;  5G0R B;  1FD2 A;  1RWK B;  3G87 A;  4ZPW R;  1DY3 A;  1P6T A;  4W90 B;  3KK3 A;  5KOX A;  3NGS A;  3GJS B;  3CD5 A;  2IPO B;  5LM7 E;  4ZVU B;  1S57 A;  4C8Y A;  3L9Z A;  3OFG A;  5J2Q A;  1NDC A;  1Y3K A;  2FYX A;  4UY8 5;  4U7U D;  3BV8 A;  2GSU A;  3R5G A;  2FJW A;  1Q86 T;  3VAL A;  1RDR A;  2V2K A;  1QAI A;  1NJI T;  4DSF A;  1BE4 A;  2GQC A;  2EK6 A;  5B0A A;  3SSR A;  2ZIT A;  1VOM A;  3U1M A;  4J9Q A;  1EJ7 L;  1NME B;  4UOO A;  1E6Y A;  2BM0 A;  3MPD A;  2HFZ A;  4Q0B B;  1HHQ A;  3DNC A;  5J2P A;  3NEK A;  2VFT A;  3JXO A;  3AOB A;  3K17 A;  1HI8 A;  3LGM A;  3NL0 A;  2PA8 D;  2CQ3 A;  2KTQ A;  2WAQ D;  2J8S A;  3DOM A;  2W8D A;  2VPW B;  3I87 A;  1S1X B;  3THP A;  5AE2 A;  2B8P A;  3RRK A;  5DET A;  5MAO A;  2F65 A;  4DL2 A;  4C6A A;  2XQC A;  4NLP A;  4NI2 A;  3H4B A;  5L0E A;  1VQK S;  3FFI A;  4WFZ A;  3OFE A;  4NL5 A;  2ZH2 A;  3SSQ A;  4X4U A;  2IDL A;  4GTY A;  4ED2 A;  2F1F A;  3HJV A;  2J9D A;  1WEZ A;  3BDG A;  5D15 A;  3HVA A;  3W2V B;  1MRO A;  1QTN B;  1D8Y A;  1Q8L A;  4RBU A;  1RAI B;  4UOP A;  2MZJ A;  3NS5 A;  2FPH X;  3MTJ A;  2DR8 A;  1S97 A;  2CJQ A;  4WJB A;  2XMJ A;  2ZH7 A;  1JLB B;  3CCU S;  2C3Y A;  1VQ6 S;  1RCX B;  4ILL A;  2Y3Y A;  2KT2 A;  2VU5 A;  3PEH A;  3BF4 A;  4K2J A;  3T3F A;  3PR5 B;  2DPI A;  1E33 P;  2HHP A;  3M8Z A;  3M8Y A;  1YZ7 A;  3G8T A;  1UZH A;  4QU7 A;  3HVR A;  2FY1 A;  2L08 A;  3CCQ S;  4ECU A;  2JRS A;  4RW9 A;  3IC1 A;  4WYL A;  3ZZZ A;  4RW4 B;  4PG5 A;  3BSA A;  3G82 A;  2RU9 A;  2NPF A;  4EI2 A;  3QGG A;  5DM7 Q;  2IM2 A;  4K8R A;  2I5J B;  2C2E A;  4DWI A;  3IR7 B;  3PW5 A;  1NHU A;  2P9E A;  3T01 A;  4NLU A;  3BDH A;  3PRD A;  3IA0 A;  1H74 A;  2GIF A;  3FRY A;  3FCV A;  5HJX A;  1UEU A;  2CPZ A;  1ZTT A;  3BGR A;  4OI3 A;  3R5J B;  5LXR A;  2DK2 A;  4RNH A;  3V81 B;  3DRS B;  4UPL A;  3BN7 A;  1ZM2 A;  4CT9 A;  4A8M P;  2HZA A;  2H5I B;  3Q3Q A;  3LAM A;  3PO4 A;  2IYG A;  1YJT A;  4LR9 A;  2FVR A;  5ETR A;  4DSJ A;  4J9V A;  2QRR A;  4B3S F;  1UW9 A;  2UXD F;  2M7S A;  1T9X A;  4IUF A;  3MPY A;  1R0A B;  5FD1 A;  3D6F B;  3PX6 A;  1S10 A;  1WKJ A;  1T3O A;  3O6Q A;  4B3S J;  3ETO A;  4KGM A;  1BGX T;  3LXQ A;  4F4K A;  1P1T A;  3V6H A;  3I4H X;  1HYS A;  1JJH A;  3ZC4 A;  4AE5 A;  4KAI A;  3TJA A;  3CMR A;  4HI1 A;  1KVK A;  2FC8 A;  1WHX A;  4RW7 A;  3UN5 A;  1RWV B;  1OS5 A;  2XYP B;  4HDG A;  3CCR S;  2HKE A;  1U49 A;  3P4U B;  3G86 A;  3TNV A;  3DLK B;  2R2S A;  1U1Q A;  3KLI A;  2GVZ A;  4OZ3 A;  1H98 A;  1HAR A;  2YNG B;  3L3C A;  3LWL A;  3NCQ A;  1Y4Z B;  1JLQ A;  2WON A;  2B4V A;  3UN2 A;  2W5T A;  1K47 A;  3KMS A;  4X4O A;  2YVS A;  1NPK A;  2VQR A;  2W2N P;  4Q2L A;  1EAY C;  1J5O B;  3KUH A;  5M2R A;  1ZS6 A;  3T02 A;  2B4O A;  2MYF A;  1RTJ A;  1WJ9 A;  2W5V A;  3I9V 9;  3WAV A;  1LWC A;  4FYV B;  1R3N A;  3MM9 B;  1S49 A;  1LK7 A;  1UVI A;  2R7W A;  3PCO B;  4TLQ A;  3OSP A;  3GFY A;  5GVQ A;  2V34 A;  4ZG6 A;  1P9Q C;  4EK2 A;  2AJF E;  1TKD A;  2EFG A;  2ZBI A;  3BPD A;  2ZVI A;  3QJL A;  2I1R A;  2ZH8 A;  2BOP A;  2WW4 A;  4J5O A;  3QJJ A;  3VV2 B;  4L73 A;  2GVD B;  1HHT P;  4DHV A;  3VAM A;  2Q6C A;  3IR5 B;  2MQM A;  1NLK L;  2O5D A;  3M2U B;  4R0E A;  3KK1 A;  2OKQ A;  3M2V B;  4KKO B;  5TJ3 A;  4ZPT R;  2HYI B;  3MMC B;  2A0F B;  5FDL B;  2KJW A;  1R0B G;  3RBE A;  1LV5 A;  3AJ1 A;  1FDN A;  3CC7 S;  5CZV A;  4KAV A;  1EZZ B;  1RU1 A;  4OZ1 A;  5F8L A;  3CDU A;  1O8B A;  4MIA A;  1EQ0 A;  1AZS B;  5CH7 B;  3I56 S;  1NND A;  2CQP A;  4E0D A;  3FSI A;  2IJR A;  4ED0 A;  3TRG A;  4DFM A;  1TUG B;  4FDI A;  4GC7 A;  1YBA A;  1Q16 B;  5F0U A;  1VQ7 S;  2IM0 A;  4F26 A;  3HZE A;  3RB3 A;  2WB4 A;  3B4M A;  1R8C A;  2YNI B;  2HVH A;  2W5Q A;  1Q5Y A;  3EVO A;  1S0O A;  4ID8 A;  4QIF A;  1GTH A;  1HBO A;  1RTH A;  2R42 A;  3FBF A;  2QN6 B;  5KFS A;  5AJ9 A;  4DU8 A;  2IFY A;  3TZX A;  3W2V A;  2WVE A;  2X98 A;  3CPW R;  3Q8R B;  1SVD A;  1NZA A;  2W5X A;  3TAN A;  4M1K A;  4CRJ A;  3CCT A;  4NLV A;  3H5U A;  2RDI A;  1SJ1 A;  1AJA A;  8AT1 B;  3PY8 A;  2CJ9 A;  4KRW A;  4ED1 A;  1YTY A;  4B9V A;  2AMC B;  1NK6 A;  3I0R A;  4N77 A;  1C1C B;  1IKW B;  4B08 A;  3LW5 C;  2OAU A;  1PAU B;  1M1K T;  3FZB A;  3MOZ A;  1A0O B;  2P9G A;  1SV5 B; 
#chains in the Genus database with same CATH homology
 4MY4 A;  1ANJ A;  1Y6V A;  5IJS A;  5L0K A;  1ELX A;  2W5R A;  3LXQ A;  1B8J A;  4FDJ A;  4CYR A;  4FDI A;  3NKN A;  2W8S A;  1ELY A;  3DPC A;  1KH4 A;  4ZG9 A;  3NKQ A;  4LR7 A;  3B5Q A;  1AJC A;  1O98 A;  3NKP A;  5L0E A;  2IUC B;  3IGY B;  4ZG6 A;  1ZEB A;  4LRA A;  4MHX A;  3CMR A;  2GSO A;  5LQQ A;  1ALK A;  1HQA A;  1E3C P;  5IJQ A;  1HJK A;  4LRD A;  4MIV A;  2W5S A;  4LRB A;  3SZY A;  1E2S P;  1N2K A;  4GTW A;  1E1Z P;  5L0B A;  5DLW A;  3UN5 A;  1KHK A;  5EGH A;  3SZZ A;  3TWZ A;  2W5Q A;  4UPK A;  4CXK A;  3WAX A;  1KH5 A;  5EGE A;  4GTY A;  3M8W A;  3WBH A;  3ED4 A;  4UPI A;  2GA3 A;  3WAW A;  1ED9 A;  3IDD A;  3TG0 A;  1AUK A;  4TN0 A;  3T01 A;  5LRM A;  1EW8 A;  3MK2 A;  3NVL A;  1EQJ A;  1EW2 A;  2XRG A;  3BDG B;  3BDG A;  2D1G A;  3BDH A;  3NKR A;  4CXS A;  5INH A;  2GSU A;  3DYC A;  4NWJ A;  5AJ9 A;  2QZU A;  2IFY A;  3E2D A;  4NWX A;  1EJJ A;  1EW9 A;  4YR1 A;  5KXA A;  1N2L A;  4GTZ A;  3T00 A;  3UN3 A;  4GTX A;  3BDF A;  1ALI A;  5HRT A;  1KH9 A;  1P49 A;  3M7V A;  2X98 A;  4CYS A;  2GLQ A;  2ANH A;  4UOR A;  4LQY A;  3IGZ B;  1AJB A;  1ANI A;  3NKM A;  1ELZ A;  1K7H A;  1ZEF A;  2W5X A;  3KD8 A;  1HDH A;  1KHL A;  4KJG A;  4LRE A;  1AJD A;  4UOP A;  5C66 A;  2RH6 A;  4UPL A;  3A52 A;  4LRC A;  4N7T A;  1ZED A;  5TJ3 A;  1EI6 A;  2GSN A;  4LRF A;  1KH7 A;  1AJA A;  1Y7A A;  3Q3Q A;  2G9Y A;  4CXU A;  4ZG7 A;  4ZGA A;  2W5W A;  2XR9 A;  3MK1 A;  3MK0 A;  4LR9 A;  3UN2 A;  2W5T A;  4UOO A;  1URA A;  1O99 A;  1SHN A;  1FSU A;  4KAV A;  4LR2 A;  2ZKT A;  2VQR A;  1URB A;  5LIA A;  4UPH A;  1ALJ A;  3OT9 A;  3TX0 A;  4QAX A;  5LRN A;  3WAY A;  3UO0 A;  1KHN A;  3UNY A;  4LR8 A;  3T02 A;  1E33 P;  5K4P A;  2IUC A;  5DLV A;  3M8Z A;  1ALH A;  3M8Y A;  4KM4 A;  5GOV A;  2W5V A;  3WAV A;  5GRR A;  4KAY A;  4B56 A;  1ED8 A;  1SHQ A;  2W8D A;  4KJD A;  5DLT A;  3NKO A;  1KHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...