4LQYA

Crystal structure of human enpp4 with amp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lqyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lqyA01
4UPHA 5IJSA 3T01A 4KJDA 4KJGA 2W5WA 3TX0A 1E1ZP 2RH6A 1P49A 2QZUA 4KAVA 3SZZA 1KH5A 1EW9A 2D1GA 4MHXA 1KHNA 4ZG6A 2GSUA 3MK1A 3WAWA 1AJDA 4LR7A 4LREA 4QAXA 5GOVA 4GTYA 1ED8A 3UO0A 4LR8A 1AJBA 5EGHA 3DYCA 1K7HA 5LRNA 5AJ9A 1EW8A 3NKQA 1EW2A 1N2KA 1SHNA 3TG0A 3SZYA 1ELYA 3UNYA 1ALJA 4LQYA 2W5TA 4NWJA 1ZEDA 3B5QA 5DLWA 1EI6A 2W5SA 3E2DA 2GSOA 2W8DA 4N7TA 4LRFA 1ZEFA 5L0BA 1KHKA 3BDHA 3NKOA 4LRAA 1SHQA 3WAYA 3TWZA 5LQQA 5EGEA 4GTWA 3T02A 1URBA 5C66A 5LRMA 4ZG7A 3LXQA 2GLQA 3A52A 4FDIA 4ZGAA 1EJJA 5LIAA 5INHA 3BDGB 2G9YA 1Y7AA 4CYRA 3WBHA 2IFYA 1B8JA 3NKPA 4LR2A 4KAYA 1O98A 1FSUA 2ZKTA 4CXSA 2W5RA 1AJAA 3T00A 1O99A 2W5QA 1EQJA 4GTXA 1ANJA 1ALHA 1ALIA 1KH9A 4TN0A 4NWXA 4GTZA 4CXKA 3MK2A 1ELZA 4UOPA 2XRGA 3UN5A 3M8ZA 1E33P 1HDHA 3NKNA 1ALKA 1KHJA 4FDJA 5KXAA 2IUCA 2X98A 3OT9A 3WAVA 3IDDA 4ZG9A 5HRTA 3M7VA 3NVLA 4MIVA 1ED9A 4UORA 1KH4A 3BDFA 1ELXA 2XR9A 3MK0A 4UPLA 1AUKA 3Q3QA 5DLTA 2W8SA 3WAXA 3NKRA 3UN3A 4LRBA 3NKMA 1KHLA 5IJQA 1AJCA 1HJKA 2GSNA 4KM4A 2VQRA 3KD8A 1N2LA 4UPIA 1E2SP 3DPCA 4UPKA 1URAA 2GA3A 2IUCB 4LR9A 1ZEBA 5L0KA 4UOOA 1HQAA 2W5VA 1Y6VA 5DLVA 1E3CP 3M8WA 2W5XA 4LRCA 4CYSA 3IGYB 3UN2A 4CXUA 5K4PA 5L0EA 4LRDA 4MY4A 4B56A 5TJ3A 5GRRA 3CMRA 4YR1A 3ED4A 2ANHA 3BDGA 3IGZB 1ANIA 1KH7A 3M8YA
chains in the Genus database with same CATH superfamily
4A3CC 3PO3K 1I50K 2CW0A 2JA6C 2P8TA 2YU9A 4A3IK 2Y3PA 3ERED 2D1GA 4MHXA 1AJDA 2O5JA 3GEIA 4KMAA 2PA8D 1ED8A 5IP7C 2JA7K 5D4DA 5IOSA 1O28A 5FLMK 4YFNA 1VLOA 1I50C 2WAQD 4KATA 3PO3C 1EW8A 3NKQA 1EW2A 2E2JC 2W5TA 4X6AC 3S1RC 1C0AA 1ZEDA 1TWGK 1SFOC 3E2DA 4GTLA 2WB1D 2JA7C 3N0BA 5IORA 4KB2A 4KC6A 4GTDA 5FLMC 1O2BA 3T02A 4KDDA 1YNNA 1URBA 3CAGA 3A8JA 5C66A 4G7ZA 1XXCA 3OEPA 4ZGAA 1SMYA 1TWHA 2YU9K 2XCRB 2NVTK 3BDGB 4CYRA 4A3DC 3AD7C 2D6FC 5IP9C 1TWGC 3NKPA 1XZQB 2JA5K 3GDZA 1FSUA 2W5RA 4M1XA 5IYCK 1PJ6A 1EQJA 4BXXK 4GTXA 4A3LK 1VGXA 4NWXA 5HL8A 1F9NA 4CXKA 1WCMK 2YU9C 3S17K 5TMCA 2KWAA 4QJVB 4P5BA 2NVTC 1YNJA 2XRGA 1TWFA 3UN5A 4C3HC 4KM8A 1KHJA 2IUCA 3WAVA 3GTPK 1PJ7A 2R7ZA 4JK1A 1O27A 1ED9A 1KH4A 3BDFA 1ELXA 2FQTA 3GTJA 5IYCC 2XR9A 4UORA 3K7AK 4BXXC 5IYDC 4A3LC 5DLTA 2XCQA 5C4XC 3NKMA 4XLPA 1J6WA 3MMLB 1AJCA 3L4KA 1HJKA 3FKIA 4YG2A 1Y1WA 3KD8A 4Q5SA 4UPIA 1IW7A 2A6HA 3GTKA 2NVYA 2ZFZA 5IOQA 4Y52K 1ZEBA 1VJEA 1F7VA 2W5VA 1J6XA 4UOOA 1K83A 3K7AC 4XSXA 1TWAA 1USOA 2CFAA 4G7OA 2W5XA 4LRCA 1YX2A 4CXUA 4AYBD 4BLAA 5K4PA 2JA8C 5L0EA 1TWHC 4B56A 1Y1VK 3DXJA 1RU0A 4A3KK 2ZUFA 3BDGA 4A3MC 1KH7A 1IQ0A 5M3MK 2R93A 4Y52C 1ZBSA 4A3GC 2R7ZK 3EQLA 2W5WA 3GTJK 1E1ZP 2RH6A 5FJ8K 1KH5A 1USMA 3WAWA 4GFQA 4QAXA 1Y1VC 4A3CK 4GTEA 2V6TA 3S14K 5C4JK 4A3KC 3UO0A 3LPXA 4GZYA 4BY1K 2FQOA 5EGHA 3DYCA 2R7ZC 3GEEA 3GTJC 1TWAK 1DCOA 3I4MK 1SHNA 1ELYA 4LQYA 5IOTA 1I6HK 4LK0A 3LAPA 4WJ3M 3S14C 1B4AA 5C4JC 3LAJA 1B4BA 2W8DA 3HOWK 4BKWA 4BBSK 3FKIC 4BY1C 4LRAA 1V5VA 1AB4A 2NVYC 2WAQL 2E2JK 3GTKC 3H3VD 2A69A 3S1RK 2Y0SL 2R93K 4X6AK 3TWZA 3WAYA 4PABA 4Y7NK 1K83C 1SFOK 1TWAC 3HOUK 2GAHC 3A52A 3I4MC 3L4JA 1EJJA 4QIWD 4KN7A 1I6HC 2R92A 4G0WA 2G9YA 2IFYA 3QX3A 2E2IA 4LR2A 1XZPA 2WB1L 3HOWC 4KAYA 4BBSC 2JH3A 3HKZL 4CXSA 3T00A 3GSIA 2R93C 1DCHA 4A3DK 3N3YA 4Y7NC 5IP9K 1KH9A 5L46A 4TN0A 3HOUC 4LLGA 3MK2A 1BDFA 3M8ZA 1HDHA 4P5AA 3NKNA 1JQWA 4G0UA 4FDJA 2X98A 4KMDA 4A93K 3M7VA 3NVLA 4P9SA 3I4NK 1EQRA 2E2HA 4DDQA 3RZDK 3MK0A 4FZBA 4UPLA 4G7HA 2PPBA 4C3HK 2W8SA 3NKRA 3AD8C 1VH2A 3UN3A 1R9TA 5IJQA 2R92K 1BS2A 3GTMA 1X31C 5IYDK 1N2LA 4A93C 3DPCA 2E2IK 3GIRA 1UV7A 1F93A 1URAA 2GA3A 3I4NC 5L0KA 4LK1A 5C4XK 1HQAA 1O2FB 1JVIA 3RZDC 1Y6VA 3AQPA 5DLVA 3AD9C 4A3BC 1PJ5A 3CQZA 2V6SA 1WOSA 4OIPA 3GTLA 1JOEA 4MY4A 1DCPA 1ZVUA 5M5YK 2R92C 4XSZA 2NVXA 3M4OK 1HQMA 3GTGA 4AH6A 1WQHA 2E2IC 3FOFA 3M8YA 2PMZL 3TTGA 4UPHA 3WODA 3T01A 5IJSA 2JA8K 1TWHK 5M5XK 4KJGA 3TX0A 4KARA 3SZZA 4WJ4A 1INNA 2QZUA 3S1NK 4A3MK 2GSUA 4WILA 4LR7A 4LREA 4A3GK 1R9TK 3M4OC 4GTYA 3GTMK 1BJTA 1AJBA 1IS1A 1TWCA 1K7HA 5LRNA 5AJ9A 3A8IA 2ZUEA 1WQFA 3S1QC 1TWFK 4RMFA 1N2KA 3S1NC 3SZYA 3TG0A 3UNYA 4XLNA 1ALJA 4NWJA 3CQZK 1XZQA 5DLWA 1R9TC 1EI6A 2GSOA 3GTMC 4YFXA 1F7UA 4OIOA 3GTGK 1KHKA 3BDHA 4KM9A 1SHQA 1YCLA 1VRQC 5EGEA 4GTWA 5LRMA 3G4AA 4ZG7A 1TWFC 3VA7A 3S1MK 4KN4A 1ZYRA 3LXQA 4FDIA 4QJVA 3HOYK 4OIRA 5LIAA 3FKIK 3AQOA 1Y1WK 5INHA 3CQZC 3GTLC 3WBHA 2A6EA 1WORA 2NVYK 3GTKK 4BLBA 1B8JA 2NVXC 1K83K 3GTQA 3HXAA 3GTGC 2A68A 2W5QA 1TWCK 5E68A 1L0WA 4OINA 2PA8L 3HOVK 3S1MC 4C45A 3HOYC 3S16K 4GTZA 1Y1WC 1ELZA 1EFWA 1ALKA 3S0XA 4ZG9A 5HRTA 3PO2K 4MIVA 3BP3A 4O2DA 1TWCC 1XPPA 2PHCB 4GTFA 3Q3QA 4A3FC 3HOVC 3WAXA 1KQ4A 3S16C 4LRBA 1BGWA 4LJZA 5CHPA 4GT9A 3H0GA 2W7VA 4KB4A 3GTOA 1O24A 2GSNA 1J98A 3OREA 3S2DK 1E2SP 3PO2C 2IUCB 1WIHA 3GTQK 4LR9A 2JA5A 4MEYA 5JFEA 1GE9A 1E3CP 4CYSA 4C3JK 3UN2A 4GTBA 5TJ3A 4BBRK 2Y0SD 1WCMA 4A3IC 5JVOA 3S2DC 2BE5A 2ANHA 3ED4A 4A3BK 1ANIA 3GTQC 1WQGA 3BUEA 4ILDA 4A3JK 4KJDA 3GTPA 3TFIA 3ADAC 5CJ9A 3FOEA 1O2AA 4KAVA 1P49A 2CFAB 4C3JC 3HKZD 5C3EK 1EW9A 1KHNA 4KMHA 3OPFA 4ZG6A 3MK1A 1WOPA 3FHZA 4BBRC 5GOVA 4KAWX 4C3IK 2EBBA 3AH5A 3H0GK 3N0CA 5C44K 3GTOK 1IBAA 4LR8A 2VUMA 2O5IA 4A3JC 3RZOK 4FM9A 2V6UA 4MEXA 3TFJA 1WSVA 3JSTA 2RGRA 4J3NA 1I6VA 3IPJA 4C2MK 5C3EC 3NUHA 3A8KA 5TMFA 3V4GA 3B5QA 2E2HK 4C3IC 2W5SA 1EK8A 4N7TA 5C44C 3H0GC 3GTOC 4LRFA 3S1QK 1ZEFA 1Y1VA 5L0BA 3NKOA 4AYBL 1IL2A 2GAGC 3RZOC 3S15K 4ZH4A 5LQQA 2JA5C 4BY7K 1ZXOA 1O29A 1ISEA 1ZQ1C 2GLQA 1DD5A 1I3QA 4C2MC 3M3YK 2B63A 1Y7AA 1WOOA 2E2HC 3S2HK 1WCMC 4NOIA 1O98A 4KMUA 4MQ9A 3S17C 2ZKTA 1AJAA 3GEHA 5IYBK 2VUMK 3S15C 1O99A 2JA6A 3GTLK 4BY7C 4LOWA 3GTPC 1ANJA 1ALHA 1ALIA 4G0VA 2P5MA 2NVXK 3M3YC 2PMZD 4UOPA 4PAAA 1E33P 5KXAA 3OT9A 3S2HC 3IDDA 3HOZK 1XZPB 4Q4ZA 1I50A 3G4CA 5IYBC 2VUMC 1G51A 5M5WK 1WSRA 1AUKA 2NVQK 1EH1A 3BP8C 3TFHA 1I3QK 1O26A 1SFOA 1KHLA 3H3VL 4A3EK 2B63K 3HOXK 4YFKA 4KM4A 1IE0A 2JA7A 2VQRA 3HOZC 4KASA 4A3FK 4UPKA 4QIWL 2XCOA 1O25A 1XXAA 2NVQC 2JA6K 1J6VA 3M8WA 3IGYB 1XXBA 4OIQA 4GTCA 4LRDA 1I3QC 1TWGA 5M3FK 4GTAA 4A3EC 5GRRA 4XCHA 2B63C 3HOXC 3CMRA 4YR1A 5IP7K 1HI9A 3IGZB
chains in the Genus database with same CATH topology
2YU9A 2Y3PA 3ERED 2D1GA 4MHXA 1AJDA 4KMAA 1ED8A 5IOSA 1O28A 4KATA 1EW8A 3NKQA 1EW2A 2W5TA 1ZEDA 3E2DA 4GTLA 3N0BA 5IORA 4KB2A 4KC6A 4GTDA 1O2BA 4KDDA 3T02A 1URBA 3CAGA 5C66A 1XXCA 3OEPA 4ZGAA 1TWHA 2XCRB 3BDGB 4CYRA 3NKPA 1FSUA 2W5RA 4M1XA 1EQJA 4GTXA 4NWXA 1F9NA 4CXKA 2KWAA 4P5BA 2XRGA 1TWFA 3UN5A 4C3HC 4KM8A 1KHJA 2IUCA 3WAVA 2R7ZA 1O27A 1ED9A 1KH4A 3BDFA 1ELXA 4UORA 3GTJA 2XR9A 5DLTA 2XCQA 3NKMA 1AJCA 3MMLB 3L4KA 1HJKA 3FKIA 1Y1WA 3KD8A 4UPIA 3GTKA 2NVYA 2ZFZA 5IOQA 1ZEBA 4UOOA 2W5VA 1K83A 1TWAA 2CFAA 2W5XA 4LRCA 4CXUA 4BLAA 5K4PA 5L0EA 4B56A 3BDGA 1KH7A 2R93A 1ZBSA 2W5WA 1E1ZP 2RH6A 1KH5A 3WAWA 4GFQA 4QAXA 4GTEA 3UO0A 3LPXA 5EGHA 3DYCA 1SHNA 1ELYA 4LQYA 5IOTA 3LAPA 1B4AA 3LAJA 1B4BA 2W8DA 4BKWA 4LRAA 1AB4A 3WAYA 3TWZA 3A52A 3L4JA 1EJJA 2R92A 4G0WA 2G9YA 2IFYA 3QX3A 2E2IA 4LR2A 4KAYA 2JH3A 4CXSA 3T00A 3N3YA 1KH9A 4TN0A 3MK2A 3M8ZA 1HDHA 4P5AA 3NKNA 4G0UA 4FDJA 2X98A 4KMDA 3M7VA 3NVLA 2E2HA 4DDQA 3MK0A 4FZBA 4UPLA 2W8SA 3NKRA 3UN3A 1R9TA 5IJQA 3GTMA 1N2LA 3DPCA 1URAA 2GA3A 5L0KA 1HQAA 1Y6VA 3AQPA 5DLVA 3CQZA 3GTLA 4MY4A 1ZVUA 2NVXA 3GTGA 1WQHA 3M8YA 3FOFA 4UPHA 5IJSA 3T01A 4KJGA 3TX0A 4KARA 2QZUA 3SZZA 2GSUA 4LR7A 4LREA 4GTYA 1BJTA 1AJBA 1IS1A 1TWCA 1K7HA 5LRNA 5AJ9A 1WQFA 1N2KA 3TG0A 3SZYA 3UNYA 1ALJA 4NWJA 5DLWA 1EI6A 2GSOA 1KHKA 3BDHA 4KM9A 1SHQA 5EGEA 4GTWA 5LRMA 3G4AA 4ZG7A 3VA7A 3LXQA 4FDIA 5LIAA 3AQOA 5INHA 3WBHA 1B8JA 4BLBA 3GTQA 2W5QA 4GTZA 1ELZA 1ALKA 3S0XA 4ZG9A 5HRTA 4MIVA 2PHCB 4GTFA 3Q3QA 3WAXA 1KQ4A 4LRBA 1BGWA 5CHPA 4GT9A 3H0GA 3GTOA 4KB4A 1O24A 2GSNA 3OREA 1E2SP 2IUCB 1WIHA 4LR9A 2JA5A 5JFEA 1GE9A 1E3CP 4CYSA 3UN2A 4GTBA 5TJ3A 1WCMA 5JVOA 3ED4A 2ANHA 1ANIA 1WQGA 3BUEA 4ILDA 4KJDA 3GTPA 5CJ9A 3FOEA 1O2AA 4KAVA 1P49A 2CFAB 4C3JC 1EW9A 1KHNA 4KMHA 3OPFA 4ZG6A 3MK1A 3FHZA 5GOVA 4KAWX 3AH5A 3N0CA 4LR8A 2VUMA 4FM9A 2RGRA 4J3NA 3NUHA 3V4GA 3B5QA 4C3IC 2W5SA 1EK8A 4N7TA 4LRFA 1ZEFA 1Y1VA 5L0BA 3NKOA 5LQQA 1ZXOA 1O29A 1ISEA 2GLQA 1DD5A 1I3QA 4C2MC 2B63A 1Y7AA 1O98A 2ZKTA 1AJAA 1O99A 2JA6A 1ANJA 1ALHA 1ALIA 4G0VA 2P5MA 4UOPA 1E33P 5KXAA 3OT9A 3IDDA 1I50A 3G4CA 1AUKA 1EH1A 1O26A 1SFOA 1KHLA 4KM4A 2JA7A 2VQRA 4KASA 4UPKA 2XCOA 1O25A 1XXAA 3M8WA 3IGYB 1XXBA 4GTCA 4LRDA 1TWGA 4GTAA 5GRRA 3CMRA 4YR1A 3IGZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPH A;  5IJS A;  3T01 A;  4KJD A;  4KJG A;  2W5W A;  3TX0 A;  1E1Z P;  2RH6 A;  1P49 A;  2QZU A;  4KAV A;  3SZZ A;  1KH5 A;  1EW9 A;  2D1G A;  4MHX A;  1KHN A;  4ZG6 A;  2GSU A;  3MK1 A;  3WAW A;  1AJD A;  4LR7 A;  4LRE A;  4QAX A;  5GOV A;  4GTY A;  1ED8 A;  3UO0 A;  4LR8 A;  1AJB A;  5EGH A;  3DYC A;  1K7H A;  5LRN A;  5AJ9 A;  1EW8 A;  3NKQ A;  1EW2 A;  1N2K A;  1SHN A;  3TG0 A;  3SZY A;  1ELY A;  3UNY A;  1ALJ A;  4LQY A;  2W5T A;  4NWJ A;  1ZED A;  3B5Q A;  5DLW A;  1EI6 A;  2W5S A;  3E2D A;  2GSO A;  2W8D A;  4N7T A;  4LRF A;  1ZEF A;  5L0B A;  1KHK A;  3BDH A;  3NKO A;  4LRA A;  1SHQ A;  3WAY A;  3TWZ A;  5LQQ A;  5EGE A;  4GTW A;  3T02 A;  1URB A;  5C66 A;  5LRM A;  4ZG7 A;  3LXQ A;  2GLQ A;  3A52 A;  4FDI A;  4ZGA A;  1EJJ A;  5LIA A;  5INH A;  3BDG B;  2G9Y A;  1Y7A A;  4CYR A;  3WBH A;  2IFY A;  1B8J A;  3NKP A;  4LR2 A;  4KAY A;  1O98 A;  1FSU A;  2ZKT A;  4CXS A;  2W5R A;  1AJA A;  3T00 A;  1O99 A;  2W5Q A;  1EQJ A;  4GTX A;  1ANJ A;  1ALH A;  1ALI A;  1KH9 A;  4TN0 A;  4NWX A;  4GTZ A;  4CXK A;  3MK2 A;  1ELZ A;  4UOP A;  2XRG A;  3UN5 A;  3M8Z A;  1E33 P;  1HDH A;  3NKN A;  1ALK A;  1KHJ A;  4FDJ A;  5KXA A;  2IUC A;  2X98 A;  3OT9 A;  3WAV A;  3IDD A;  4ZG9 A;  5HRT A;  3M7V A;  3NVL A;  4MIV A;  1ED9 A;  4UOR A;  1KH4 A;  3BDF A;  1ELX A;  2XR9 A;  3MK0 A;  4UPL A;  1AUK A;  3Q3Q A;  5DLT A;  2W8S A;  3WAX A;  3NKR A;  3UN3 A;  4LRB A;  3NKM A;  1KHL A;  5IJQ A;  1AJC A;  1HJK A;  2GSN A;  4KM4 A;  2VQR A;  3KD8 A;  1N2L A;  4UPI A;  1E2S P;  3DPC A;  4UPK A;  1URA A;  2GA3 A;  2IUC B;  4LR9 A;  1ZEB A;  5L0K A;  4UOO A;  1HQA A;  2W5V A;  1Y6V A;  5DLV A;  1E3C P;  3M8W A;  2W5X A;  4LRC A;  4CYS A;  3IGY B;  3UN2 A;  4CXU A;  5K4P A;  5L0E A;  4LRD A;  4MY4 A;  4B56 A;  5TJ3 A;  5GRR A;  3CMR A;  4YR1 A;  3ED4 A;  2ANH A;  3BDG A;  3IGZ B;  1ANI A;  1KH7 A;  3M8Y A; 
#chains in the Genus database with same CATH topology
 4A3C C;  3PO3 K;  1I50 K;  2CW0 A;  2JA6 C;  2P8T A;  2YU9 A;  4A3I K;  2Y3P A;  3ERE D;  2D1G A;  4MHX A;  1AJD A;  2O5J A;  3GEI A;  4KMA A;  2PA8 D;  1ED8 A;  5IP7 C;  2JA7 K;  5D4D A;  5IOS A;  1O28 A;  5FLM K;  4YFN A;  1VLO A;  1I50 C;  2WAQ D;  4KAT A;  3PO3 C;  1EW8 A;  3NKQ A;  1EW2 A;  2E2J C;  2W5T A;  4X6A C;  3S1R C;  1C0A A;  1ZED A;  1TWG K;  1SFO C;  3E2D A;  4GTL A;  2WB1 D;  2JA7 C;  3N0B A;  5IOR A;  4KB2 A;  4KC6 A;  4GTD A;  5FLM C;  1O2B A;  3T02 A;  4KDD A;  1YNN A;  1URB A;  3CAG A;  3A8J A;  5C66 A;  4G7Z A;  1XXC A;  3OEP A;  4ZGA A;  1SMY A;  1TWH A;  2YU9 K;  2XCR B;  2NVT K;  3BDG B;  4CYR A;  4A3D C;  3AD7 C;  2D6F C;  5IP9 C;  1TWG C;  3NKP A;  1XZQ B;  2JA5 K;  3GDZ A;  1FSU A;  2W5R A;  4M1X A;  5IYC K;  1PJ6 A;  1EQJ A;  4BXX K;  4GTX A;  4A3L K;  1VGX A;  4NWX A;  5HL8 A;  1F9N A;  4CXK A;  1WCM K;  2YU9 C;  3S17 K;  5TMC A;  2KWA A;  4QJV B;  4P5B A;  2NVT C;  1YNJ A;  2XRG A;  1TWF A;  3UN5 A;  4C3H C;  4KM8 A;  1KHJ A;  2IUC A;  3WAV A;  3GTP K;  1PJ7 A;  2R7Z A;  4JK1 A;  1O27 A;  1ED9 A;  1KH4 A;  3BDF A;  1ELX A;  2FQT A;  3GTJ A;  5IYC C;  2XR9 A;  4UOR A;  3K7A K;  4BXX C;  5IYD C;  4A3L C;  5DLT A;  2XCQ A;  5C4X C;  3NKM A;  4XLP A;  1J6W A;  3MML B;  1AJC A;  3L4K A;  1HJK A;  3FKI A;  4YG2 A;  1Y1W A;  3KD8 A;  4Q5S A;  4UPI A;  1IW7 A;  2A6H A;  3GTK A;  2NVY A;  2ZFZ A;  5IOQ A;  4Y52 K;  1ZEB A;  1VJE A;  1F7V A;  2W5V A;  1J6X A;  4UOO A;  1K83 A;  3K7A C;  4XSX A;  1TWA A;  1USO A;  2CFA A;  4G7O A;  2W5X A;  4LRC A;  1YX2 A;  4CXU A;  4AYB D;  4BLA A;  5K4P A;  2JA8 C;  5L0E A;  1TWH C;  4B56 A;  1Y1V K;  3DXJ A;  1RU0 A;  4A3K K;  2ZUF A;  3BDG A;  4A3M C;  1KH7 A;  1IQ0 A;  5M3M K;  2R93 A;  4Y52 C;  1ZBS A;  4A3G C;  2R7Z K;  3EQL A;  2W5W A;  3GTJ K;  1E1Z P;  2RH6 A;  5FJ8 K;  1KH5 A;  1USM A;  3WAW A;  4GFQ A;  4QAX A;  1Y1V C;  4A3C K;  4GTE A;  2V6T A;  3S14 K;  5C4J K;  4A3K C;  3UO0 A;  3LPX A;  4GZY A;  4BY1 K;  2FQO A;  5EGH A;  3DYC A;  2R7Z C;  3GEE A;  3GTJ C;  1TWA K;  1DCO A;  3I4M K;  1SHN A;  1ELY A;  4LQY A;  5IOT A;  1I6H K;  4LK0 A;  3LAP A;  4WJ3 M;  3S14 C;  1B4A A;  5C4J C;  3LAJ A;  1B4B A;  2W8D A;  3HOW K;  4BKW A;  4BBS K;  3FKI C;  4BY1 C;  4LRA A;  1V5V A;  1AB4 A;  2NVY C;  2WAQ L;  2E2J K;  3GTK C;  3H3V D;  2A69 A;  3S1R K;  2Y0S L;  2R93 K;  4X6A K;  3TWZ A;  3WAY A;  4PAB A;  4Y7N K;  1K83 C;  1SFO K;  1TWA C;  3HOU K;  2GAH C;  3A52 A;  3I4M C;  3L4J A;  1EJJ A;  4QIW D;  4KN7 A;  1I6H C;  2R92 A;  4G0W A;  2G9Y A;  2IFY A;  3QX3 A;  2E2I A;  4LR2 A;  1XZP A;  2WB1 L;  3HOW C;  4KAY A;  4BBS C;  2JH3 A;  3HKZ L;  4CXS A;  3T00 A;  3GSI A;  2R93 C;  1DCH A;  4A3D K;  3N3Y A;  4Y7N C;  5IP9 K;  1KH9 A;  5L46 A;  4TN0 A;  3HOU C;  4LLG A;  3MK2 A;  1BDF A;  3M8Z A;  1HDH A;  4P5A A;  3NKN A;  1JQW A;  4G0U A;  4FDJ A;  2X98 A;  4KMD A;  4A93 K;  3M7V A;  3NVL A;  4P9S A;  3I4N K;  1EQR A;  2E2H A;  4DDQ A;  3RZD K;  3MK0 A;  4FZB A;  4UPL A;  4G7H A;  2PPB A;  4C3H K;  2W8S A;  3NKR A;  3AD8 C;  1VH2 A;  3UN3 A;  1R9T A;  5IJQ A;  2R92 K;  1BS2 A;  3GTM A;  1X31 C;  5IYD K;  1N2L A;  4A93 C;  3DPC A;  2E2I K;  3GIR A;  1UV7 A;  1F93 A;  1URA A;  2GA3 A;  3I4N C;  5L0K A;  4LK1 A;  5C4X K;  1HQA A;  1O2F B;  1JVI A;  3RZD C;  1Y6V A;  3AQP A;  5DLV A;  3AD9 C;  4A3B C;  1PJ5 A;  3CQZ A;  2V6S A;  1WOS A;  4OIP A;  3GTL A;  1JOE A;  4MY4 A;  1DCP A;  1ZVU A;  5M5Y K;  2R92 C;  4XSZ A;  2NVX A;  3M4O K;  1HQM A;  3GTG A;  4AH6 A;  1WQH A;  2E2I C;  3FOF A;  3M8Y A;  2PMZ L;  3TTG A;  4UPH A;  3WOD A;  3T01 A;  5IJS A;  2JA8 K;  1TWH K;  5M5X K;  4KJG A;  3TX0 A;  4KAR A;  3SZZ A;  4WJ4 A;  1INN A;  2QZU A;  3S1N K;  4A3M K;  2GSU A;  4WIL A;  4LR7 A;  4LRE A;  4A3G K;  1R9T K;  3M4O C;  4GTY A;  3GTM K;  1BJT A;  1AJB A;  1IS1 A;  1TWC A;  1K7H A;  5LRN A;  5AJ9 A;  3A8I A;  2ZUE A;  1WQF A;  3S1Q C;  1TWF K;  4RMF A;  1N2K A;  3S1N C;  3SZY A;  3TG0 A;  3UNY A;  4XLN A;  1ALJ A;  4NWJ A;  3CQZ K;  1XZQ A;  5DLW A;  1R9T C;  1EI6 A;  2GSO A;  3GTM C;  4YFX A;  1F7U A;  4OIO A;  3GTG K;  1KHK A;  3BDH A;  4KM9 A;  1SHQ A;  1YCL A;  1VRQ C;  5EGE A;  4GTW A;  5LRM A;  3G4A A;  4ZG7 A;  1TWF C;  3VA7 A;  3S1M K;  4KN4 A;  1ZYR A;  3LXQ A;  4FDI A;  4QJV A;  3HOY K;  4OIR A;  5LIA A;  3FKI K;  3AQO A;  1Y1W K;  5INH A;  3CQZ C;  3GTL C;  3WBH A;  2A6E A;  1WOR A;  2NVY K;  3GTK K;  4BLB A;  1B8J A;  2NVX C;  1K83 K;  3GTQ A;  3HXA A;  3GTG C;  2A68 A;  2W5Q A;  1TWC K;  5E68 A;  1L0W A;  4OIN A;  2PA8 L;  3HOV K;  3S1M C;  4C45 A;  3HOY C;  3S16 K;  4GTZ A;  1Y1W C;  1ELZ A;  1EFW A;  1ALK A;  3S0X A;  4ZG9 A;  5HRT A;  3PO2 K;  4MIV A;  3BP3 A;  4O2D A;  1TWC C;  1XPP A;  2PHC B;  4GTF A;  3Q3Q A;  4A3F C;  3HOV C;  3WAX A;  1KQ4 A;  3S16 C;  4LRB A;  1BGW A;  4LJZ A;  5CHP A;  4GT9 A;  3H0G A;  2W7V A;  4KB4 A;  3GTO A;  1O24 A;  2GSN A;  1J98 A;  3ORE A;  3S2D K;  1E2S P;  3PO2 C;  2IUC B;  1WIH A;  3GTQ K;  4LR9 A;  2JA5 A;  4MEY A;  5JFE A;  1GE9 A;  1E3C P;  4CYS A;  4C3J K;  3UN2 A;  4GTB A;  5TJ3 A;  4BBR K;  2Y0S D;  1WCM A;  4A3I C;  5JVO A;  3S2D C;  2BE5 A;  2ANH A;  3ED4 A;  4A3B K;  1ANI A;  3GTQ C;  1WQG A;  3BUE A;  4ILD A;  4A3J K;  4KJD A;  3GTP A;  3TFI A;  3ADA C;  5CJ9 A;  3FOE A;  1O2A A;  4KAV A;  1P49 A;  2CFA B;  4C3J C;  3HKZ D;  5C3E K;  1EW9 A;  1KHN A;  4KMH A;  3OPF A;  4ZG6 A;  3MK1 A;  1WOP A;  3FHZ A;  4BBR C;  5GOV A;  4KAW X;  4C3I K;  2EBB A;  3AH5 A;  3H0G K;  3N0C A;  5C44 K;  3GTO K;  1IBA A;  4LR8 A;  2VUM A;  2O5I A;  4A3J C;  3RZO K;  4FM9 A;  2V6U A;  4MEX A;  3TFJ A;  1WSV A;  3JST A;  2RGR A;  4J3N A;  1I6V A;  3IPJ A;  4C2M K;  5C3E C;  3NUH A;  3A8K A;  5TMF A;  3V4G A;  3B5Q A;  2E2H K;  4C3I C;  2W5S A;  1EK8 A;  4N7T A;  5C44 C;  3H0G C;  3GTO C;  4LRF A;  3S1Q K;  1ZEF A;  1Y1V A;  5L0B A;  3NKO A;  4AYB L;  1IL2 A;  2GAG C;  3RZO C;  3S15 K;  4ZH4 A;  5LQQ A;  2JA5 C;  4BY7 K;  1ZXO A;  1O29 A;  1ISE A;  1ZQ1 C;  2GLQ A;  1DD5 A;  1I3Q A;  4C2M C;  3M3Y K;  2B63 A;  1Y7A A;  1WOO A;  2E2H C;  3S2H K;  1WCM C;  4NOI A;  1O98 A;  4KMU A;  4MQ9 A;  3S17 C;  2ZKT A;  1AJA A;  3GEH A;  5IYB K;  2VUM K;  3S15 C;  1O99 A;  2JA6 A;  3GTL K;  4BY7 C;  4LOW A;  3GTP C;  1ANJ A;  1ALH A;  1ALI A;  4G0V A;  2P5M A;  2NVX K;  3M3Y C;  2PMZ D;  4UOP A;  4PAA A;  1E33 P;  5KXA A;  3OT9 A;  3S2H C;  3IDD A;  3HOZ K;  1XZP B;  4Q4Z A;  1I50 A;  3G4C A;  5IYB C;  2VUM C;  1G51 A;  5M5W K;  1WSR A;  1AUK A;  2NVQ K;  1EH1 A;  3BP8 C;  3TFH A;  1I3Q K;  1O26 A;  1SFO A;  1KHL A;  3H3V L;  4A3E K;  2B63 K;  3HOX K;  4YFK A;  4KM4 A;  1IE0 A;  2JA7 A;  2VQR A;  3HOZ C;  4KAS A;  4A3F K;  4UPK A;  4QIW L;  2XCO A;  1O25 A;  1XXA A;  2NVQ C;  2JA6 K;  1J6V A;  3M8W A;  3IGY B;  1XXB A;  4OIQ A;  4GTC A;  4LRD A;  1I3Q C;  1TWG A;  5M3F K;  4GTA A;  4A3E C;  5GRR A;  4XCH A;  2B63 C;  3HOX C;  3CMR A;  4YR1 A;  5IP7 K;  1HI9 A;  3IGZ B; 
#chains in the Genus database with same CATH homology
 2YU9 A;  2Y3P A;  3ERE D;  2D1G A;  4MHX A;  1AJD A;  4KMA A;  1ED8 A;  5IOS A;  1O28 A;  4KAT A;  1EW8 A;  3NKQ A;  1EW2 A;  2W5T A;  1ZED A;  3E2D A;  4GTL A;  3N0B A;  5IOR A;  4KB2 A;  4KC6 A;  4GTD A;  1O2B A;  4KDD A;  3T02 A;  1URB A;  3CAG A;  5C66 A;  1XXC A;  3OEP A;  4ZGA A;  1TWH A;  2XCR B;  3BDG B;  4CYR A;  3NKP A;  1FSU A;  2W5R A;  4M1X A;  1EQJ A;  4GTX A;  4NWX A;  1F9N A;  4CXK A;  2KWA A;  4P5B A;  2XRG A;  1TWF A;  3UN5 A;  4C3H C;  4KM8 A;  1KHJ A;  2IUC A;  3WAV A;  2R7Z A;  1O27 A;  1ED9 A;  1KH4 A;  3BDF A;  1ELX A;  4UOR A;  3GTJ A;  2XR9 A;  5DLT A;  2XCQ A;  3NKM A;  1AJC A;  3MML B;  3L4K A;  1HJK A;  3FKI A;  1Y1W A;  3KD8 A;  4UPI A;  3GTK A;  2NVY A;  2ZFZ A;  5IOQ A;  1ZEB A;  4UOO A;  2W5V A;  1K83 A;  1TWA A;  2CFA A;  2W5X A;  4LRC A;  4CXU A;  4BLA A;  5K4P A;  5L0E A;  4B56 A;  3BDG A;  1KH7 A;  2R93 A;  1ZBS A;  2W5W A;  1E1Z P;  2RH6 A;  1KH5 A;  3WAW A;  4GFQ A;  4QAX A;  4GTE A;  3UO0 A;  3LPX A;  5EGH A;  3DYC A;  1SHN A;  1ELY A;  4LQY A;  5IOT A;  3LAP A;  1B4A A;  3LAJ A;  1B4B A;  2W8D A;  4BKW A;  4LRA A;  1AB4 A;  3WAY A;  3TWZ A;  3A52 A;  3L4J A;  1EJJ A;  2R92 A;  4G0W A;  2G9Y A;  2IFY A;  3QX3 A;  2E2I A;  4LR2 A;  4KAY A;  2JH3 A;  4CXS A;  3T00 A;  3N3Y A;  1KH9 A;  4TN0 A;  3MK2 A;  3M8Z A;  1HDH A;  4P5A A;  3NKN A;  4G0U A;  4FDJ A;  2X98 A;  4KMD A;  3M7V A;  3NVL A;  2E2H A;  4DDQ A;  3MK0 A;  4FZB A;  4UPL A;  2W8S A;  3NKR A;  3UN3 A;  1R9T A;  5IJQ A;  3GTM A;  1N2L A;  3DPC A;  1URA A;  2GA3 A;  5L0K A;  1HQA A;  1Y6V A;  3AQP A;  5DLV A;  3CQZ A;  3GTL A;  4MY4 A;  1ZVU A;  2NVX A;  3GTG A;  1WQH A;  3M8Y A;  3FOF A;  4UPH A;  5IJS A;  3T01 A;  4KJG A;  3TX0 A;  4KAR A;  2QZU A;  3SZZ A;  2GSU A;  4LR7 A;  4LRE A;  4GTY A;  1BJT A;  1AJB A;  1IS1 A;  1TWC A;  1K7H A;  5LRN A;  5AJ9 A;  1WQF A;  1N2K A;  3TG0 A;  3SZY A;  3UNY A;  1ALJ A;  4NWJ A;  5DLW A;  1EI6 A;  2GSO A;  1KHK A;  3BDH A;  4KM9 A;  1SHQ A;  5EGE A;  4GTW A;  5LRM A;  3G4A A;  4ZG7 A;  3VA7 A;  3LXQ A;  4FDI A;  5LIA A;  3AQO A;  5INH A;  3WBH A;  1B8J A;  4BLB A;  3GTQ A;  2W5Q A;  4GTZ A;  1ELZ A;  1ALK A;  3S0X A;  4ZG9 A;  5HRT A;  4MIV A;  2PHC B;  4GTF A;  3Q3Q A;  3WAX A;  1KQ4 A;  4LRB A;  1BGW A;  5CHP A;  4GT9 A;  3H0G A;  3GTO A;  4KB4 A;  1O24 A;  2GSN A;  3ORE A;  1E2S P;  2IUC B;  1WIH A;  4LR9 A;  2JA5 A;  5JFE A;  1GE9 A;  1E3C P;  4CYS A;  3UN2 A;  4GTB A;  5TJ3 A;  1WCM A;  5JVO A;  3ED4 A;  2ANH A;  1ANI A;  1WQG A;  3BUE A;  4ILD A;  4KJD A;  3GTP A;  5CJ9 A;  3FOE A;  1O2A A;  4KAV A;  1P49 A;  2CFA B;  4C3J C;  1EW9 A;  1KHN A;  4KMH A;  3OPF A;  4ZG6 A;  3MK1 A;  3FHZ A;  5GOV A;  4KAW X;  3AH5 A;  3N0C A;  4LR8 A;  2VUM A;  4FM9 A;  2RGR A;  4J3N A;  3NUH A;  3V4G A;  3B5Q A;  4C3I C;  2W5S A;  1EK8 A;  4N7T A;  4LRF A;  1ZEF A;  1Y1V A;  5L0B A;  3NKO A;  5LQQ A;  1ZXO A;  1O29 A;  1ISE A;  2GLQ A;  1DD5 A;  1I3Q A;  4C2M C;  2B63 A;  1Y7A A;  1O98 A;  2ZKT A;  1AJA A;  1O99 A;  2JA6 A;  1ANJ A;  1ALH A;  1ALI A;  4G0V A;  2P5M A;  4UOP A;  1E33 P;  5KXA A;  3OT9 A;  3IDD A;  1I50 A;  3G4C A;  1AUK A;  1EH1 A;  1O26 A;  1SFO A;  1KHL A;  4KM4 A;  2JA7 A;  2VQR A;  4KAS A;  4UPK A;  2XCO A;  1O25 A;  1XXA A;  3M8W A;  3IGY B;  1XXB A;  4GTC A;  4LRD A;  1TWG A;  4GTA A;  5GRR A;  3CMR A;  4YR1 A;  3IGZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...