4LQYA

Crystal structure of human enpp4 with amp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lqyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lqyA01
4GTZA 5IJSA 1URAA 4FDIA 3MK2A 1KHJA 3TG0A 4UPIA 2X98A 1E3CP 2IFYA 5HRTA 1O98A 2VQRA 1SHQA 2G9YA 5LIAA 3TWZA 4N7TA 4CYRA 3NKRA 2RH6A 4NWXA 1EJJA 4UOPA 3NVLA 4CXKA 4GTYA 4LR9A 4LRBA 4ZG9A 1KHKA 3ED4A 2ZKTA 1ALKA 3WAWA 4LRAA 1ALHA 4B56A 1EQJA 1ALJA 3OT9A 2IUCB 4KM4A 3WAVA 4KJDA 1EW8A 4LR8A 2QZUA 1AJDA 5INHA 3UN2A 2GSUA 1ED9A 4LRDA 3BDFA 1E1ZP 1KHLA 3DYCA 4CYSA 4MY4A 2XR9A 3WAYA 3A52A 3M8YA 1EI6A 1ED8A 3BDHA 3MK0A 3T01A 4GTWA 2GSNA 1EW9A 3UNYA 1ZEDA 3Q3QA 1KH9A 1E2SP 5TJ3A 3BDGB 4QAXA 3NKQA 4UPHA 4UPLA 1N2KA 5GRRA 1KH4A 3KD8A 4ZG7A 5L0KA 1KHNA 1ELYA 3UN5A 2GA3A 4NWJA 5IJQA 2ANHA 3CMRA 3M7VA 4UPKA 1ELXA 4ZGAA 1P49A 3M8ZA 2W5WA 3UO0A 5DLVA 1HQAA 5DLTA 2GLQA 1HJKA 3NKNA 2W5VA 1O99A 1FSUA 1URBA 4KJGA 5EGEA 1AJBA 1ANJA 3TX0A 3WBHA 2W5TA 4LR7A 5EGHA 1SHNA 3T00A 1ZEFA 1EW2A 1AJAA 2W8DA 3IDDA 1E33P 5LQQA 2W5RA 2D1GA 5LRMA 5KXAA 2IUCA 3IGYB 3UN3A 4TN0A 1B8JA 4ZG6A 5L0EA 5DLWA 4LREA 2W5SA 1K7HA 3DPCA 3NKPA 3LXQA 1AJCA 4CXUA 3NKOA 2GSOA 4FDJA 4LRFA 4GTXA 4UORA 4CXSA 3M8WA 1N2LA 4MHXA 3IGZB 4LQYA 4KAYA 4MIVA 1ALIA 5C66A 3T02A 4LR2A 1ZEBA 3E2DA 3SZZA 3MK1A 1HDHA 3BDGA 3B5QA 5K4PA 1AUKA 3WAXA 4LRCA 4YR1A 1KH7A 4KAVA 5GOVA 1Y7AA 4UOOA 1KH5A 5L0BA 1ELZA 2XRGA 2W8SA 1Y6VA 5AJ9A 3NKMA 2W5QA 5LRNA 2W5XA 3SZYA 1ANIA
chains in the Genus database with same CATH superfamily
4GTZA 2P5MA 2PA8D 4MEXA 5M5XK 4UPIA 1E3CP 1BS2A 2NVTK 1XZPB 4BLBA 1VRQC 4GZYA 3IPJA 5LIAA 4Q5SA 4KDDA 2R93K 3RZOK 2B63K 4OIPA 1JVIA 4N7TA 3GTOC 3GTMK 2RH6A 5FLMK 4PABA 4A3IK 4GTYA 1KHKA 1ALKA 3I4MC 5IP7K 2VUMA 1EQJA 3L4KA 1TWAK 3RZDC 4WJ4A 3HOWK 4C2MC 3A8IA 4KM4A 1HI9A 1KQ4A 2P8TA 5INHA 3GTPC 3GTOK 2GSUA 1PJ5A 3TFHA 3BDFA 1EK8A 1E1ZP 4G7OA 3DYCA 4P9SA 3GDZA 3V4GA 2XR9A 3WAYA 1I50C 2NVYK 1F7VA 3RZDK 2WB1L 3BDHA 4GTAA 1XZQB 2R93A 4C2MK 2B63A 1USOA 1EW9A 4KB2A 3GIRA 2E2JK 3Q3QA 3H3VD 3GTMA 1EH1A 3HKZD 3BDGB 3NKQA 3HOZC 2O5JA 3FHZA 2A6EA 4BBRK 1B4BA 3KD8A 4ILDA 1XZPA 4ZG7A 4NWJA 1TWAA 4ZH4A 2ANHA 3M7VA 5IJQA 3FKIC 4GFQA 3GTQC 1INNA 3BP3A 1DD5A 3GTOA 4A3MC 2EBBA 3JSTA 3S2DC 2W5VA 1FSUA 3TFIA 1VH2A 2A6HA 4WJ3M 4KATA 2W5TA 4LR7A 1EW2A 1AJAA 2W8DA 5LQQA 4NOIA 2W5RA 1WIHA 2D1GA 2NVYA 4G0VA 1SFOC 3FKIK 2XCOA 3UN3A 3GTQK 2W7VA 5C4XC 4ZG6A 5DLWA 4AYBD 4A3MK 3S2DK 3I4NC 3NKOA 3AH5A 3PO3C 4LRFA 3GEHA 1VLOA 1N2LA 1XZQA 4LQYA 4KAYA 1VGXA 4C3IK 4QJVB 5C4XK 1WOSA 4KN4A 4C3JK 3PO2C 3BDGA 3H3VL 1AUKA 5C44C 3WAXA 1YX2A 3I4NK 4KAVA 2YU9K 3PO3K 2JA6K 4XLNA 1TWFK 1ELZA 3GTGC 3FKIA 2CW0A 4P5AA 3S2HK 2W5QA 3N0CA 1F93A 5C44K 1URAA 4FDIA 3MK2A 3TG0A 2X98A 2IFYA 3QX3A 3S1QK 3N3YA 1O98A 1O27A 4Y52C 4BKWA 1ZBSA 3GTGK 3S16K 3TWZA 4YFKA 3G4AA 4XCHA 3NKRA 1TWCC 2ZUFA 4X6AC 3S15C 2D6FC 1EJJA 4CXKA 1YNNA 2A69A 4C3HK 4LRBA 3GSIA 4AH6A 2PPBA 4OINA 2YU9A 1ALHA 2B63C 3OT9A 4LRAA 4B56A 1ALJA 2JA6A 1TWFA 1ZXOA 4Y52K 2IUCB 3WAVA 1EW8A 1DCHA 4YFNA 4LR8A 4QJVA 2QZUA 1AJDA 4A3IC 3OPFA 1TWCK 4KMDA 4X6AK 3S15K 5M3MK 1KHLA 5IP7C 1TWAC 4KMAA 1ISEA 3HOWC 3A52A 3M8YA 1JQWA 1EI6A 4BBSK 4OIOA 1HQMA 1Y1WC 1WOPA 4J3NA 2GSNA 4GTEA 2V6TA 3GTGA 2A68A 1ZEDA 1O2FB 5TJ3A 4QAXA 1USMA 3WODA 4GTFA 1UV7A 3A8KA 5HL8A 4UPLA 1N2KA 2NVYC 3HXAA 5JFEA 1KH4A 4QIWD 5IYDC 4KB4A 3CMRA 2CFAB 2V6UA 2E2JC 1Y1WK 1I6HK 4ZGAA 2W5WA 5DLVA 1V5VA 1ZVUA 1TWCA 1WORA 4BBRC 3M4OK 1ANJA 4G7ZA 5EGHA 3IDDA 2PMZD 4WILA 3BP8C 5LRMA 1TWHC 1WQGA 5IYDK 2Y3PA 2IUCA 4KASA 5KXAA 5IYCK 5IYBC 4TN0A 1B8JA 1I6VA 1IBAA 4OIRA 4LREA 3MMLB 1EFWA 3NKPA 1IQ0A 2PA8L 1IE0A 1AJCA 4CXUA 2PHCB 1O26A 4UORA 4FM9A 4KN7A 4BLAA 4MHXA 1TWHK 2V6SA 2R7ZC 1J6VA 1Y1WA 4GTLA 3HOXC 4LR2A 5IYBK 4DDQA 5M5YK 3S17K 3HOVC 1HDHA 1BJTA 5K4PA 5M3FK 4A3FK 1WSVA 4LRCA 4YR1A 1KH7A 4GTCA 2JA7A 2NVXC 5GOVA 1Y7AA 3LAPA 4A3KK 1KH5A 4OIQA 4QIWL 4C3IC 5TMCA 2CFAA 2XRGA 5IP9K 4C3JC 2R7ZK 3HOXK 4JK1A 1Y1VK 3EQLA 4XLPA 2NVQC 1WQFA 3HOVK 1ANIA 4GT9A 2YU9C 2KWAA 1B4AA 5D4DA 1KHJA 1ZQ1C 2JA6C 1TWFC 2NVXK 3ADAC 5TMFA 5HRTA 1SHQA 2G9YA 2VQRA 2PMZL 4MQ9A 3S2HC 1TWHA 2E2IC 2JA8C 4CYRA 4A3DK 1GE9A 3HKZL 3S1NC 2NVQK 4NWXA 1O24A 2O5IA 1O28A 3NVLA 4A3JC 4YFXA 4LR9A 4ZG9A 3CQZC 4KAWX 3ED4A 2ZKTA 3WAWA 3S1QC 2JA5K 5FJ8K 2XCQA 1XXCA 3S16C 4M1XA 3LPXA 2XCRB 1WSRA 1J6XA 1BDFA 2Y0SD 1TWGK 3DXJA 2R7ZA 2E2IK 2JA8K 3S1NK 1Y1VA 4C3HC 1ED9A 4LRDA 3H0GA 4A3JK 3CQZK 3G4CA 2NVXA 4MEYA 1I3QC 1L0WA 1ED8A 3MK0A 1XXBA 2GAHC 3T01A 4GTWA 1G51A 4BY7K 4PAAA 1E2SP 4XSXA 4AYBL 3TFJA 4UPHA 5GRRA 3BUEA 4BBSC 2JA5A 1K83K 1ELYA 4RMFA 4A3BK 1KHNA 3UN5A 1I3QK 4UPKA 1ELXA 4A3EC 1P49A 3M8ZA 2FQOA 1TWGA 3K7AC 1HQAA 5DLTA 2E2IA 4G0UA 2GLQA 3TTGA 3GTJC 4KJGA 1AJBA 3TX0A 5CJ9A 4BY1C 3ERED 3T00A 3CQZA 1E33P 1I6HC 5L46A 3AQPA 4A3CK 1RU0A 4A3EK 3S1MK 1WOOA 3M4OC 4A93C 2Y0SL 3K7AK 5IOSA 2JA7C 1O29A 3HOYC 1WCMK 4P5BA 3GTJK 4BY1K 4FDJA 4CXSA 4Y7NC 5IYCC 1K83A 3IGZB 1I3QA 4MIVA 5C66A 4G0WA 1VJEA 3OREA 1ZEBA 3SZZA 4A93K 1J98A 5JVOA 2ZUEA 3B5QA 2JA7K 3HOYK 1AB4A 1YCLA 4GTBA 3GTKC 4UOOA 5L0BA 4Y7NK 4KMHA 2W8SA 3S17C 1EQRA 2FQTA 1Y6VA 3NKMA 5AJ9A 1PJ6A 5LRNA 4A3FC 2W5XA 1SMYA 3SZYA 5C3EC 1F9NA 1O25A 5IJSA 1WCMA 3AQOA 4A3KC 3GTJA 5IOTA 3FOFA 3AD8C 3GTKK 3I4MK 5IP9C 2BE5A 1R9TC 4FZBA 1XXAA 4LOWA 1Y1VC 3H0GC 3M3YC 3S14C 3N0BA 5C3EK 5IOQA 4UOPA 3GTPK 1O2AA 3CAGA 1YNJA 1PJ7A 4BXXC 1BGWA 1XPPA 2R92C 1I50K 1R9TK 4A3DC 4KJDA 4Q4ZA 1O2BA 3UN2A 3H0GK 3M3YK 3S14K 2JA5C 4KM9A 3GTLC 3HOZK 4CYSA 3LAJA 4MY4A 4BXXK 3GEIA 3GTKA 2GAGC 1TWGC 1WQHA 5C4JC 2R92K 4LK0A 3S1RC 3UNYA 2WAQD 1KH9A 3GTPA 1C0AA 3S0XA 3GTLK 5CHPA 4A3LC 5L0KA 2GA3A 4BY7C 1DCPA 4LK1A 1I50A 5C4JK 3S1RK 4YG2A 1R9TA 3UO0A 1SFOK 2E2HC 3L4JA 5IORA 4C45A 4KM8A 1X31C 3HOUC 1HJKA 3NKNA 1O99A 1URBA 5EGEA 3WBHA 1K83C 4A3BC 1SHNA 1ZEFA 4GTDA 4KMUA 4G7HA 4A3LK 2JH3A 1IS1A 2ZFZA 3IGYB 2R92A 3AD9C 1DCOA 1IL2A 5L0EA 4LJZA 2E2HK 2W5SA 3GTQA 1K7HA 4LLGA 3HOUK 3DPCA 1F7UA 3LXQA 3PO2K 4A3GC 2GSOA 5E68A 2VUMC 3GTLA 4GTXA 4A3CC 3M8WA 3AD7C 1ZYRA 3GEEA 1JOEA 3S1MC 3NUHA 1ALIA 3T02A 5M5WK 3E2DA 3VA7A 1WCMC 1SFOA 3MK1A 3FOEA 2WAQL 4KC6A 1IW7A 4KARA 3A8JA 4O2DA 4A3GK 2NVTC 1J6WA 2VUMK 2WB1D 3OEPA 2RGRA 2R93C 3RZOC 3GTMC 4XSZA 5FLMC 2E2HA
chains in the Genus database with same CATH topology
4GTZA 2P5MA 4UPIA 1E3CP 4BLBA 5LIAA 4KDDA 4N7TA 2RH6A 4GTYA 1KHKA 1ALKA 2VUMA 1EQJA 3L4KA 4C2MC 4KM4A 1KQ4A 5INHA 2GSUA 3BDFA 1EK8A 1E1ZP 3DYCA 3V4GA 2XR9A 3WAYA 3BDHA 4GTAA 2R93A 2B63A 1EW9A 4KB2A 3Q3QA 3GTMA 1EH1A 3BDGB 3NKQA 3FHZA 1B4BA 3KD8A 4ILDA 4ZG7A 4NWJA 1TWAA 5IJQA 2ANHA 3M7VA 4GFQA 1DD5A 3GTOA 2W5VA 1FSUA 4KATA 2W5TA 4LR7A 1EW2A 1AJAA 2W8DA 5LQQA 2W5RA 1WIHA 2D1GA 2NVYA 4G0VA 2XCOA 3UN3A 4ZG6A 5DLWA 3NKOA 3AH5A 4LRFA 1N2LA 4LQYA 4KAYA 3BDGA 1AUKA 3WAXA 4KAVA 1ELZA 3FKIA 4P5AA 2W5QA 3N0CA 1URAA 4FDIA 3MK2A 3TG0A 2X98A 2IFYA 3QX3A 1O98A 3N3YA 1O27A 4BKWA 1ZBSA 3TWZA 3G4AA 3NKRA 1EJJA 4CXKA 4LRBA 4LRAA 1ALHA 4B56A 2YU9A 1ALJA 3OT9A 2JA6A 1TWFA 1ZXOA 2IUCB 3WAVA 1EW8A 4LR8A 2QZUA 1AJDA 3OPFA 4KMDA 1KHLA 4KMAA 1ISEA 3A52A 3M8YA 1EI6A 4J3NA 2GSNA 4GTEA 3GTGA 1ZEDA 5TJ3A 4QAXA 4GTFA 4UPLA 1N2KA 5JFEA 1KH4A 3CMRA 4KB4A 2CFAB 4ZGAA 2W5WA 5DLVA 1ZVUA 1TWCA 1ANJA 5EGHA 3IDDA 5LRMA 1WQGA 5KXAA 2Y3PA 2IUCA 4KASA 4TN0A 1B8JA 4LREA 3MMLB 3NKPA 1AJCA 4CXUA 2PHCB 1O26A 4UORA 4FM9A 4MHXA 4BLAA 1Y1WA 4GTLA 4LR2A 4DDQA 1HDHA 1BJTA 5K4PA 4LRCA 4YR1A 1KH7A 4GTCA 2JA7A 5GOVA 1Y7AA 3LAPA 1KH5A 4C3IC 2CFAA 2XRGA 4C3JC 1WQFA 1ANIA 4GT9A 2KWAA 1B4AA 1KHJA 5HRTA 1SHQA 2G9YA 2VQRA 1TWHA 4CYRA 1GE9A 4NWXA 1O24A 3NVLA 1O28A 4LR9A 4ZG9A 4KAWX 3ED4A 2ZKTA 3WAWA 2XCQA 1XXCA 4M1XA 3LPXA 2XCRB 2R7ZA 1Y1VA 4C3HC 1ED9A 4LRDA 3H0GA 3G4CA 2NVXA 1ED8A 3MK0A 1XXBA 3T01A 4GTWA 1E2SP 4UPHA 5GRRA 3BUEA 2JA5A 1KHNA 1ELYA 3UN5A 4UPKA 1ELXA 1P49A 3M8ZA 1TWGA 1HQAA 5DLTA 2E2IA 4G0UA 2GLQA 4KJGA 1AJBA 3TX0A 5CJ9A 3ERED 3T00A 3CQZA 1E33P 3AQPA 5IOSA 1O29A 4P5BA 4FDJA 4CXSA 1K83A 3IGZB 1I3QA 4MIVA 5C66A 4G0WA 3OREA 1ZEBA 3SZZA 5JVOA 3B5QA 1AB4A 4GTBA 4UOOA 5L0BA 4KMHA 2W8SA 1Y6VA 5AJ9A 3NKMA 5LRNA 2W5XA 3SZYA 1F9NA 1O25A 5IJSA 1WCMA 3AQOA 3GTJA 5IOTA 3FOFA 4FZBA 1XXAA 3N0BA 5IOQA 4UOPA 1O2AA 3CAGA 1BGWA 4KJDA 1O2BA 3UN2A 4KM9A 4CYSA 3LAJA 4MY4A 3GTKA 1WQHA 3UNYA 1KH9A 3GTPA 3S0XA 5CHPA 5L0KA 2GA3A 1I50A 1R9TA 3UO0A 3L4JA 5IORA 1HJKA 4KM8A 3NKNA 1O99A 1URBA 5EGEA 3WBHA 1SHNA 1ZEFA 4GTDA 2JH3A 1IS1A 2ZFZA 3IGYB 2R92A 5L0EA 2W5SA 3GTQA 1K7HA 3DPCA 3LXQA 2GSOA 3GTLA 4GTXA 3M8WA 3NUHA 1ALIA 3T02A 3E2DA 3VA7A 1SFOA 3MK1A 3FOEA 4KC6A 4KARA 3OEPA 2RGRA 2E2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTZ A;  5IJS A;  1URA A;  4FDI A;  3MK2 A;  1KHJ A;  3TG0 A;  4UPI A;  2X98 A;  1E3C P;  2IFY A;  5HRT A;  1O98 A;  2VQR A;  1SHQ A;  2G9Y A;  5LIA A;  3TWZ A;  4N7T A;  4CYR A;  3NKR A;  2RH6 A;  4NWX A;  1EJJ A;  4UOP A;  3NVL A;  4CXK A;  4GTY A;  4LR9 A;  4LRB A;  4ZG9 A;  1KHK A;  3ED4 A;  2ZKT A;  1ALK A;  3WAW A;  4LRA A;  1ALH A;  4B56 A;  1EQJ A;  1ALJ A;  3OT9 A;  2IUC B;  4KM4 A;  3WAV A;  4KJD A;  1EW8 A;  4LR8 A;  2QZU A;  1AJD A;  5INH A;  3UN2 A;  2GSU A;  1ED9 A;  4LRD A;  3BDF A;  1E1Z P;  1KHL A;  3DYC A;  4CYS A;  4MY4 A;  2XR9 A;  3WAY A;  3A52 A;  3M8Y A;  1EI6 A;  1ED8 A;  3BDH A;  3MK0 A;  3T01 A;  4GTW A;  2GSN A;  1EW9 A;  3UNY A;  1ZED A;  3Q3Q A;  1KH9 A;  1E2S P;  5TJ3 A;  3BDG B;  4QAX A;  3NKQ A;  4UPH A;  4UPL A;  1N2K A;  5GRR A;  1KH4 A;  3KD8 A;  4ZG7 A;  5L0K A;  1KHN A;  1ELY A;  3UN5 A;  2GA3 A;  4NWJ A;  5IJQ A;  2ANH A;  3CMR A;  3M7V A;  4UPK A;  1ELX A;  4ZGA A;  1P49 A;  3M8Z A;  2W5W A;  3UO0 A;  5DLV A;  1HQA A;  5DLT A;  2GLQ A;  1HJK A;  3NKN A;  2W5V A;  1O99 A;  1FSU A;  1URB A;  4KJG A;  5EGE A;  1AJB A;  1ANJ A;  3TX0 A;  3WBH A;  2W5T A;  4LR7 A;  5EGH A;  1SHN A;  3T00 A;  1ZEF A;  1EW2 A;  1AJA A;  2W8D A;  3IDD A;  1E33 P;  5LQQ A;  2W5R A;  2D1G A;  5LRM A;  5KXA A;  2IUC A;  3IGY B;  3UN3 A;  4TN0 A;  1B8J A;  4ZG6 A;  5L0E A;  5DLW A;  4LRE A;  2W5S A;  1K7H A;  3DPC A;  3NKP A;  3LXQ A;  1AJC A;  4CXU A;  3NKO A;  2GSO A;  4FDJ A;  4LRF A;  4GTX A;  4UOR A;  4CXS A;  3M8W A;  1N2L A;  4MHX A;  3IGZ B;  4LQY A;  4KAY A;  4MIV A;  1ALI A;  5C66 A;  3T02 A;  4LR2 A;  1ZEB A;  3E2D A;  3SZZ A;  3MK1 A;  1HDH A;  3BDG A;  3B5Q A;  5K4P A;  1AUK A;  3WAX A;  4LRC A;  4YR1 A;  1KH7 A;  4KAV A;  5GOV A;  1Y7A A;  4UOO A;  1KH5 A;  5L0B A;  1ELZ A;  2XRG A;  2W8S A;  1Y6V A;  5AJ9 A;  3NKM A;  2W5Q A;  5LRN A;  2W5X A;  3SZY A;  1ANI A; 
#chains in the Genus database with same CATH topology
 4GTZ A;  2P5M A;  2PA8 D;  4MEX A;  5M5X K;  4UPI A;  1E3C P;  1BS2 A;  2NVT K;  1XZP B;  4BLB A;  1VRQ C;  4GZY A;  3IPJ A;  5LIA A;  4Q5S A;  4KDD A;  2R93 K;  3RZO K;  2B63 K;  4OIP A;  1JVI A;  4N7T A;  3GTO C;  3GTM K;  2RH6 A;  5FLM K;  4PAB A;  4A3I K;  4GTY A;  1KHK A;  1ALK A;  3I4M C;  5IP7 K;  2VUM A;  1EQJ A;  3L4K A;  1TWA K;  3RZD C;  4WJ4 A;  3HOW K;  4C2M C;  3A8I A;  4KM4 A;  1HI9 A;  1KQ4 A;  2P8T A;  5INH A;  3GTP C;  3GTO K;  2GSU A;  1PJ5 A;  3TFH A;  3BDF A;  1EK8 A;  1E1Z P;  4G7O A;  3DYC A;  4P9S A;  3GDZ A;  3V4G A;  2XR9 A;  3WAY A;  1I50 C;  2NVY K;  1F7V A;  3RZD K;  2WB1 L;  3BDH A;  4GTA A;  1XZQ B;  2R93 A;  4C2M K;  2B63 A;  1USO A;  1EW9 A;  4KB2 A;  3GIR A;  2E2J K;  3Q3Q A;  3H3V D;  3GTM A;  1EH1 A;  3HKZ D;  3BDG B;  3NKQ A;  3HOZ C;  2O5J A;  3FHZ A;  2A6E A;  4BBR K;  1B4B A;  3KD8 A;  4ILD A;  1XZP A;  4ZG7 A;  4NWJ A;  1TWA A;  4ZH4 A;  2ANH A;  3M7V A;  5IJQ A;  3FKI C;  4GFQ A;  3GTQ C;  1INN A;  3BP3 A;  1DD5 A;  3GTO A;  4A3M C;  2EBB A;  3JST A;  3S2D C;  2W5V A;  1FSU A;  3TFI A;  1VH2 A;  2A6H A;  4WJ3 M;  4KAT A;  2W5T A;  4LR7 A;  1EW2 A;  1AJA A;  2W8D A;  5LQQ A;  4NOI A;  2W5R A;  1WIH A;  2D1G A;  2NVY A;  4G0V A;  1SFO C;  3FKI K;  2XCO A;  3UN3 A;  3GTQ K;  2W7V A;  5C4X C;  4ZG6 A;  5DLW A;  4AYB D;  4A3M K;  3S2D K;  3I4N C;  3NKO A;  3AH5 A;  3PO3 C;  4LRF A;  3GEH A;  1VLO A;  1N2L A;  1XZQ A;  4LQY A;  4KAY A;  1VGX A;  4C3I K;  4QJV B;  5C4X K;  1WOS A;  4KN4 A;  4C3J K;  3PO2 C;  3BDG A;  3H3V L;  1AUK A;  5C44 C;  3WAX A;  1YX2 A;  3I4N K;  4KAV A;  2YU9 K;  3PO3 K;  2JA6 K;  4XLN A;  1TWF K;  1ELZ A;  3GTG C;  3FKI A;  2CW0 A;  4P5A A;  3S2H K;  2W5Q A;  3N0C A;  1F93 A;  5C44 K;  1URA A;  4FDI A;  3MK2 A;  3TG0 A;  2X98 A;  2IFY A;  3QX3 A;  3S1Q K;  3N3Y A;  1O98 A;  1O27 A;  4Y52 C;  4BKW A;  1ZBS A;  3GTG K;  3S16 K;  3TWZ A;  4YFK A;  3G4A A;  4XCH A;  3NKR A;  1TWC C;  2ZUF A;  4X6A C;  3S15 C;  2D6F C;  1EJJ A;  4CXK A;  1YNN A;  2A69 A;  4C3H K;  4LRB A;  3GSI A;  4AH6 A;  2PPB A;  4OIN A;  2YU9 A;  1ALH A;  2B63 C;  3OT9 A;  4LRA A;  4B56 A;  1ALJ A;  2JA6 A;  1TWF A;  1ZXO A;  4Y52 K;  2IUC B;  3WAV A;  1EW8 A;  1DCH A;  4YFN A;  4LR8 A;  4QJV A;  2QZU A;  1AJD A;  4A3I C;  3OPF A;  1TWC K;  4KMD A;  4X6A K;  3S15 K;  5M3M K;  1KHL A;  5IP7 C;  1TWA C;  4KMA A;  1ISE A;  3HOW C;  3A52 A;  3M8Y A;  1JQW A;  1EI6 A;  4BBS K;  4OIO A;  1HQM A;  1Y1W C;  1WOP A;  4J3N A;  2GSN A;  4GTE A;  2V6T A;  3GTG A;  2A68 A;  1ZED A;  1O2F B;  5TJ3 A;  4QAX A;  1USM A;  3WOD A;  4GTF A;  1UV7 A;  3A8K A;  5HL8 A;  4UPL A;  1N2K A;  2NVY C;  3HXA A;  5JFE A;  1KH4 A;  4QIW D;  5IYD C;  4KB4 A;  3CMR A;  2CFA B;  2V6U A;  2E2J C;  1Y1W K;  1I6H K;  4ZGA A;  2W5W A;  5DLV A;  1V5V A;  1ZVU A;  1TWC A;  1WOR A;  4BBR C;  3M4O K;  1ANJ A;  4G7Z A;  5EGH A;  3IDD A;  2PMZ D;  4WIL A;  3BP8 C;  5LRM A;  1TWH C;  1WQG A;  5IYD K;  2Y3P A;  2IUC A;  4KAS A;  5KXA A;  5IYC K;  5IYB C;  4TN0 A;  1B8J A;  1I6V A;  1IBA A;  4OIR A;  4LRE A;  3MML B;  1EFW A;  3NKP A;  1IQ0 A;  2PA8 L;  1IE0 A;  1AJC A;  4CXU A;  2PHC B;  1O26 A;  4UOR A;  4FM9 A;  4KN7 A;  4BLA A;  4MHX A;  1TWH K;  2V6S A;  2R7Z C;  1J6V A;  1Y1W A;  4GTL A;  3HOX C;  4LR2 A;  5IYB K;  4DDQ A;  5M5Y K;  3S17 K;  3HOV C;  1HDH A;  1BJT A;  5K4P A;  5M3F K;  4A3F K;  1WSV A;  4LRC A;  4YR1 A;  1KH7 A;  4GTC A;  2JA7 A;  2NVX C;  5GOV A;  1Y7A A;  3LAP A;  4A3K K;  1KH5 A;  4OIQ A;  4QIW L;  4C3I C;  5TMC A;  2CFA A;  2XRG A;  5IP9 K;  4C3J C;  2R7Z K;  3HOX K;  4JK1 A;  1Y1V K;  3EQL A;  4XLP A;  2NVQ C;  1WQF A;  3HOV K;  1ANI A;  4GT9 A;  2YU9 C;  2KWA A;  1B4A A;  5D4D A;  1KHJ A;  1ZQ1 C;  2JA6 C;  1TWF C;  2NVX K;  3ADA C;  5TMF A;  5HRT A;  1SHQ A;  2G9Y A;  2VQR A;  2PMZ L;  4MQ9 A;  3S2H C;  1TWH A;  2E2I C;  2JA8 C;  4CYR A;  4A3D K;  1GE9 A;  3HKZ L;  3S1N C;  2NVQ K;  4NWX A;  1O24 A;  2O5I A;  1O28 A;  3NVL A;  4A3J C;  4YFX A;  4LR9 A;  4ZG9 A;  3CQZ C;  4KAW X;  3ED4 A;  2ZKT A;  3WAW A;  3S1Q C;  2JA5 K;  5FJ8 K;  2XCQ A;  1XXC A;  3S16 C;  4M1X A;  3LPX A;  2XCR B;  1WSR A;  1J6X A;  1BDF A;  2Y0S D;  1TWG K;  3DXJ A;  2R7Z A;  2E2I K;  2JA8 K;  3S1N K;  1Y1V A;  4C3H C;  1ED9 A;  4LRD A;  3H0G A;  4A3J K;  3CQZ K;  3G4C A;  2NVX A;  4MEY A;  1I3Q C;  1L0W A;  1ED8 A;  3MK0 A;  1XXB A;  2GAH C;  3T01 A;  4GTW A;  1G51 A;  4BY7 K;  4PAA A;  1E2S P;  4XSX A;  4AYB L;  3TFJ A;  4UPH A;  5GRR A;  3BUE A;  4BBS C;  2JA5 A;  1K83 K;  1ELY A;  4RMF A;  4A3B K;  1KHN A;  3UN5 A;  1I3Q K;  4UPK A;  1ELX A;  4A3E C;  1P49 A;  3M8Z A;  2FQO A;  1TWG A;  3K7A C;  1HQA A;  5DLT A;  2E2I A;  4G0U A;  2GLQ A;  3TTG A;  3GTJ C;  4KJG A;  1AJB A;  3TX0 A;  5CJ9 A;  4BY1 C;  3ERE D;  3T00 A;  3CQZ A;  1E33 P;  1I6H C;  5L46 A;  3AQP A;  4A3C K;  1RU0 A;  4A3E K;  3S1M K;  1WOO A;  3M4O C;  4A93 C;  2Y0S L;  3K7A K;  5IOS A;  2JA7 C;  1O29 A;  3HOY C;  1WCM K;  4P5B A;  3GTJ K;  4BY1 K;  4FDJ A;  4CXS A;  4Y7N C;  5IYC C;  1K83 A;  3IGZ B;  1I3Q A;  4MIV A;  5C66 A;  4G0W A;  1VJE A;  3ORE A;  1ZEB A;  3SZZ A;  4A93 K;  1J98 A;  5JVO A;  2ZUE A;  3B5Q A;  2JA7 K;  3HOY K;  1AB4 A;  1YCL A;  4GTB A;  3GTK C;  4UOO A;  5L0B A;  4Y7N K;  4KMH A;  2W8S A;  3S17 C;  1EQR A;  2FQT A;  1Y6V A;  3NKM A;  5AJ9 A;  1PJ6 A;  5LRN A;  4A3F C;  2W5X A;  1SMY A;  3SZY A;  5C3E C;  1F9N A;  1O25 A;  5IJS A;  1WCM A;  3AQO A;  4A3K C;  3GTJ A;  5IOT A;  3FOF A;  3AD8 C;  3GTK K;  3I4M K;  5IP9 C;  2BE5 A;  1R9T C;  4FZB A;  1XXA A;  4LOW A;  1Y1V C;  3H0G C;  3M3Y C;  3S14 C;  3N0B A;  5C3E K;  5IOQ A;  4UOP A;  3GTP K;  1O2A A;  3CAG A;  1YNJ A;  1PJ7 A;  4BXX C;  1BGW A;  1XPP A;  2R92 C;  1I50 K;  1R9T K;  4A3D C;  4KJD A;  4Q4Z A;  1O2B A;  3UN2 A;  3H0G K;  3M3Y K;  3S14 K;  2JA5 C;  4KM9 A;  3GTL C;  3HOZ K;  4CYS A;  3LAJ A;  4MY4 A;  4BXX K;  3GEI A;  3GTK A;  2GAG C;  1TWG C;  1WQH A;  5C4J C;  2R92 K;  4LK0 A;  3S1R C;  3UNY A;  2WAQ D;  1KH9 A;  3GTP A;  1C0A A;  3S0X A;  3GTL K;  5CHP A;  4A3L C;  5L0K A;  2GA3 A;  4BY7 C;  1DCP A;  4LK1 A;  1I50 A;  5C4J K;  3S1R K;  4YG2 A;  1R9T A;  3UO0 A;  1SFO K;  2E2H C;  3L4J A;  5IOR A;  4C45 A;  4KM8 A;  1X31 C;  3HOU C;  1HJK A;  3NKN A;  1O99 A;  1URB A;  5EGE A;  3WBH A;  1K83 C;  4A3B C;  1SHN A;  1ZEF A;  4GTD A;  4KMU A;  4G7H A;  4A3L K;  2JH3 A;  1IS1 A;  2ZFZ A;  3IGY B;  2R92 A;  3AD9 C;  1DCO A;  1IL2 A;  5L0E A;  4LJZ A;  2E2H K;  2W5S A;  3GTQ A;  1K7H A;  4LLG A;  3HOU K;  3DPC A;  1F7U A;  3LXQ A;  3PO2 K;  4A3G C;  2GSO A;  5E68 A;  2VUM C;  3GTL A;  4GTX A;  4A3C C;  3M8W A;  3AD7 C;  1ZYR A;  3GEE A;  1JOE A;  3S1M C;  3NUH A;  1ALI A;  3T02 A;  5M5W K;  3E2D A;  3VA7 A;  1WCM C;  1SFO A;  3MK1 A;  3FOE A;  2WAQ L;  4KC6 A;  1IW7 A;  4KAR A;  3A8J A;  4O2D A;  4A3G K;  2NVT C;  1J6W A;  2VUM K;  2WB1 D;  3OEP A;  2RGR A;  2R93 C;  3RZO C;  3GTM C;  4XSZ A;  5FLM C;  2E2H A; 
#chains in the Genus database with same CATH homology
 4GTZ A;  2P5M A;  4UPI A;  1E3C P;  4BLB A;  5LIA A;  4KDD A;  4N7T A;  2RH6 A;  4GTY A;  1KHK A;  1ALK A;  2VUM A;  1EQJ A;  3L4K A;  4C2M C;  4KM4 A;  1KQ4 A;  5INH A;  2GSU A;  3BDF A;  1EK8 A;  1E1Z P;  3DYC A;  3V4G A;  2XR9 A;  3WAY A;  3BDH A;  4GTA A;  2R93 A;  2B63 A;  1EW9 A;  4KB2 A;  3Q3Q A;  3GTM A;  1EH1 A;  3BDG B;  3NKQ A;  3FHZ A;  1B4B A;  3KD8 A;  4ILD A;  4ZG7 A;  4NWJ A;  1TWA A;  5IJQ A;  2ANH A;  3M7V A;  4GFQ A;  1DD5 A;  3GTO A;  2W5V A;  1FSU A;  4KAT A;  2W5T A;  4LR7 A;  1EW2 A;  1AJA A;  2W8D A;  5LQQ A;  2W5R A;  1WIH A;  2D1G A;  2NVY A;  4G0V A;  2XCO A;  3UN3 A;  4ZG6 A;  5DLW A;  3NKO A;  3AH5 A;  4LRF A;  1N2L A;  4LQY A;  4KAY A;  3BDG A;  1AUK A;  3WAX A;  4KAV A;  1ELZ A;  3FKI A;  4P5A A;  2W5Q A;  3N0C A;  1URA A;  4FDI A;  3MK2 A;  3TG0 A;  2X98 A;  2IFY A;  3QX3 A;  1O98 A;  3N3Y A;  1O27 A;  4BKW A;  1ZBS A;  3TWZ A;  3G4A A;  3NKR A;  1EJJ A;  4CXK A;  4LRB A;  4LRA A;  1ALH A;  4B56 A;  2YU9 A;  1ALJ A;  3OT9 A;  2JA6 A;  1TWF A;  1ZXO A;  2IUC B;  3WAV A;  1EW8 A;  4LR8 A;  2QZU A;  1AJD A;  3OPF A;  4KMD A;  1KHL A;  4KMA A;  1ISE A;  3A52 A;  3M8Y A;  1EI6 A;  4J3N A;  2GSN A;  4GTE A;  3GTG A;  1ZED A;  5TJ3 A;  4QAX A;  4GTF A;  4UPL A;  1N2K A;  5JFE A;  1KH4 A;  3CMR A;  4KB4 A;  2CFA B;  4ZGA A;  2W5W A;  5DLV A;  1ZVU A;  1TWC A;  1ANJ A;  5EGH A;  3IDD A;  5LRM A;  1WQG A;  5KXA A;  2Y3P A;  2IUC A;  4KAS A;  4TN0 A;  1B8J A;  4LRE A;  3MML B;  3NKP A;  1AJC A;  4CXU A;  2PHC B;  1O26 A;  4UOR A;  4FM9 A;  4MHX A;  4BLA A;  1Y1W A;  4GTL A;  4LR2 A;  4DDQ A;  1HDH A;  1BJT A;  5K4P A;  4LRC A;  4YR1 A;  1KH7 A;  4GTC A;  2JA7 A;  5GOV A;  1Y7A A;  3LAP A;  1KH5 A;  4C3I C;  2CFA A;  2XRG A;  4C3J C;  1WQF A;  1ANI A;  4GT9 A;  2KWA A;  1B4A A;  1KHJ A;  5HRT A;  1SHQ A;  2G9Y A;  2VQR A;  1TWH A;  4CYR A;  1GE9 A;  4NWX A;  1O24 A;  3NVL A;  1O28 A;  4LR9 A;  4ZG9 A;  4KAW X;  3ED4 A;  2ZKT A;  3WAW A;  2XCQ A;  1XXC A;  4M1X A;  3LPX A;  2XCR B;  2R7Z A;  1Y1V A;  4C3H C;  1ED9 A;  4LRD A;  3H0G A;  3G4C A;  2NVX A;  1ED8 A;  3MK0 A;  1XXB A;  3T01 A;  4GTW A;  1E2S P;  4UPH A;  5GRR A;  3BUE A;  2JA5 A;  1KHN A;  1ELY A;  3UN5 A;  4UPK A;  1ELX A;  1P49 A;  3M8Z A;  1TWG A;  1HQA A;  5DLT A;  2E2I A;  4G0U A;  2GLQ A;  4KJG A;  1AJB A;  3TX0 A;  5CJ9 A;  3ERE D;  3T00 A;  3CQZ A;  1E33 P;  3AQP A;  5IOS A;  1O29 A;  4P5B A;  4FDJ A;  4CXS A;  1K83 A;  3IGZ B;  1I3Q A;  4MIV A;  5C66 A;  4G0W A;  3ORE A;  1ZEB A;  3SZZ A;  5JVO A;  3B5Q A;  1AB4 A;  4GTB A;  4UOO A;  5L0B A;  4KMH A;  2W8S A;  1Y6V A;  5AJ9 A;  3NKM A;  5LRN A;  2W5X A;  3SZY A;  1F9N A;  1O25 A;  5IJS A;  1WCM A;  3AQO A;  3GTJ A;  5IOT A;  3FOF A;  4FZB A;  1XXA A;  3N0B A;  5IOQ A;  4UOP A;  1O2A A;  3CAG A;  1BGW A;  4KJD A;  1O2B A;  3UN2 A;  4KM9 A;  4CYS A;  3LAJ A;  4MY4 A;  3GTK A;  1WQH A;  3UNY A;  1KH9 A;  3GTP A;  3S0X A;  5CHP A;  5L0K A;  2GA3 A;  1I50 A;  1R9T A;  3UO0 A;  3L4J A;  5IOR A;  1HJK A;  4KM8 A;  3NKN A;  1O99 A;  1URB A;  5EGE A;  3WBH A;  1SHN A;  1ZEF A;  4GTD A;  2JH3 A;  1IS1 A;  2ZFZ A;  3IGY B;  2R92 A;  5L0E A;  2W5S A;  3GTQ A;  1K7H A;  3DPC A;  3LXQ A;  2GSO A;  3GTL A;  4GTX A;  3M8W A;  3NUH A;  1ALI A;  3T02 A;  3E2D A;  3VA7 A;  1SFO A;  3MK1 A;  3FOE A;  4KC6 A;  4KAR A;  3OEP A;  2RGR A;  2E2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...