4LQYA

Crystal structure of human enpp4 with amp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
379
structure length
379
Chain Sequence
b'LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lqyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lqyA01
3T01A 3TG0A 3NKPA 3BDHA 4N7TA 4UPKA 4UPIA 1ANJA 1E3CP 5DLTA 1ELZA 5HRTA 4LRBA 1ZEDA 3IDDA 2W5RA 4LRAA 2ANHA 1ED9A 3WAVA 5EGHA 5EGEA 4ZGAA 1E1ZP 1FSUA 2GSNA 4UOPA 5L0KA 1SHQA 2RH6A 3NKRA 1AJBA 1ELXA 3MK1A 3LXQA 4MHXA 3UO0A 2XR9A 4LR7A 3BDFA 2W5SA 3M8ZA 2X98A 3M8YA 3NKOA 2D1GA 1ALIA 4LREA 1N2KA 4CXUA 5IJQA 5LIAA 5GRRA 4ZG9A 4CYRA 1EJJA 1EW8A 4CXKA 4KAVA 1AJAA 2IUCB 1ANIA 4LR8A 5INHA 1KHNA 2GLQA 4KJDA 1EQJA 2GA3A 3TX0A 2IFYA 3T02A 3WAXA 4LRDA 4YR1A 4LRCA 3UN2A 3DYCA 2VQRA 1O99A 1Y6VA 3CMRA 4KAYA 4KJGA 5L0EA 1ALJA 2XRGA 4LR9A 4CXSA 1ELYA 2W5XA 4GTZA 3SZYA 1ZEFA 5KXAA 1URAA 4FDIA 3IGZB 4CYSA 2GSOA 2W5VA 3KD8A 3WBHA 5IJSA 1N2LA 5AJ9A 3Q3QA 1ALHA 4MIVA 3M7VA 3UN3A 3A52A 3NKNA 5DLWA 1AJCA 4GTWA 1O98A 1HJKA 3TWZA 5LRMA 4UORA 2W5QA 4ZG7A 2W8SA 1KH9A 4QAXA 1EI6A 1AUKA 4GTXA 5TJ3A 3DPCA 3WAWA 4UPHA 2GSUA 4GTYA 1E2SP 2QZUA 1EW9A 4ZG6A 3OT9A 3NVLA 3NKQA 5GOVA 4UPLA 5LRNA 4UOOA 5LQQA 2W5WA 3BDGA 1KH7A 3UNYA 1HDHA 4KM4A 3SZZA 2ZKTA 4TN0A 3BDGB 4MY4A 3T00A 1ZEBA 1B8JA 1KHLA 1E33P 4LRFA 3UN5A 1KHJA 4B56A 3B5QA 1KH5A 4LR2A 4NWJA 2W8DA 3IGYB 3MK0A 1K7HA 5K4PA 1ED8A 3M8WA 2W5TA 5L0BA 1Y7AA 3E2DA 1KH4A 1KHKA 1P49A 1EW2A 1URBA 3MK2A 1AJDA 5C66A 4FDJA 4NWXA 3WAYA 1SHNA 2IUCA 3NKMA 5DLVA 3ED4A 1HQAA 2G9YA 1ALKA 4LQYA
chains in the Genus database with same CATH superfamily
1ZBSA 4N7TA 1USMA 3GEEA 3HOXC 1IL2A 4UPKA 5HRTA 1ELZA 2R92C 3CQZC 1USOA 2ZFZA 3TFJA 3GTOA 2PA8D 1ZQ1C 2GSNA 1I6VA 3HOYK 3NKRA 4A3EC 3RZOC 4G7OA 2ZUEA 2V6UA 3HOZK 3GTOC 3NKOA 2D1GA 5M3FK 3GEIA 1N2KA 4LREA 2CFAA 5M5YK 1IQ0A 1EJJA 1I50C 2A6EA 4CXKA 1AJAA 1YX2A 4BXXK 1KHNA 1Y1VA 1J6VA 1V5VA 1EQJA 4QJVA 5M5XK 3H3VD 1ZXOA 3UN2A 3K7AK 4BY7K 3DYCA 4KDDA 4G0VA 3S16K 3S14C 4KAYA 2R93A 5L0EA 1Y1VC 2XRGA 4LR9A 4CXSA 4GTAA 3SZYA 4FDIA 1G51A 2A69A 1PJ7A 1WCMA 1VGXA 1XXBA 3PO2C 1I3QC 4LK1A 5FLMK 3GTQK 3S1MK 4A3DK 3UN3A 3NKNA 1TWAA 4A3JK 2JA6C 3CAGA 1EH1A 1WCMC 3GTLK 4UORA 3OREA 1Y1WK 4GTXA 5TJ3A 2ZUFA 4YFXA 5M3MK 1E2SP 2WAQD 4XSZA 1ISEA 1O2FB 1XZPB 3GTJC 3NVLA 4M1XA 3ERED 3HOVK 5IP9K 1RU0A 4A3BC 2JA7C 5IYDK 1C0AA 1K83K 2ZKTA 4MY4A 5JVOA 1VRQC 3S2DK 1WSVA 4B56A 1KHJA 1UV7A 5C4JK 2V6TA 3B5QA 1KH5A 1TWHK 4NWJA 2PHCB 4GT9A 2NVTK 2JA5K 5JFEA 1VJEA 4Y52C 4A3CC 4KAWX 1ED8A 3I4NC 5C3EC 2E2IK 4XLPA 2B63K 3TFHA 1KH4A 1J98A 1KQ4A 3S1RK 3H0GA 4LLGA 4O2DA 3GIRA 1R9TK 3M3YK 1IE0A 1URBA 2R7ZA 1YNNA 3WAYA 2NVYA 3FHZA 3H3VL 3GTGA 2YU9K 4A3LK 1YNJA 3NKMA 1HI9A 2Y3PA 2O5JA 4LK0A 4P5BA 4A3KK 1BGWA 3H0GC 1TWGK 3T01A 4P5AA 4C3JK 3TG0A 4KASA 4A3GC 3BDHA 1EQRA 1WQFA 2NVYC 4C2MC 4BBSC 1ANJA 4A3IK 4GZYA 1WOSA 1WSRA 5C4XK 4A93C 2ANHA 2V6SA 3S0XA 3WAVA 4ZGAA 3AD7C 4GTBA 1E1ZP 4UOPA 2NVXK 1SHQA 2E2HK 2E2JK 2VUMC 1AJBA 1ELXA 4MHXA 3GTMC 1XZQA 1F9NA 2XR9A 4LR7A 3BDFA 3GTKK 3M8ZA 4KN4A 1TWFC 5FJ8K 1B4AA 3WODA 1AB4A 3BP3A 4J3NA 4LR8A 5INHA 2PPBA 3N0BA 2WAQL 2GA3A 3TX0A 2IFYA 4OIPA 4LRDA 4YR1A 1EFWA 4LRCA 1IW7A 3VA7A 3QX3A 1L0WA 4MEXA 2NVQK 1O99A 2VQRA 5IOTA 1ALJA 4YG2A 4KM9A 2P5MA 1ELYA 1J6XA 1VLOA 5KXAA 1URAA 3IGZB 3ADAC 2Y0SL 5L46A 1BDFA 4AYBD 2W5VA 3WBHA 3HOXK 2R92K 3I4MK 2PMZD 3DXJA 3Q3QA 3TTGA 3HKZL 1F7VA 3M7VA 3A52A 5DLWA 2CFAB 4GTWA 1I6HC 1YCLA 3LPXA 1EK8A 2WB1D 3TWZA 5IYCC 4KB2A 4A3EK 3RZOK 2KWAA 3LAJA 4QJVB 5IP7C 3DPCA 4UPHA 3M4OC 2GSUA 3FKIA 4KMAA 1ZVUA 3N3YA 5C44C 3OT9A 4GTFA 1I50K 3S16C 1O2BA 3NKQA 4A3MC 5LRNA 4NOIA 1BJTA 4WJ3M 5LQQA 2W5WA 1KH7A 3GTQA 1DCPA 2R93C 5CHPA 3UNYA 3FKIC 4TN0A 3FOFA 1ZEBA 3S1NC 1B8JA 3S17K 3UN5A 3GTLA 4WJ4A 1Y1WA 4LR2A 1TWCK 1INNA 4QIWL 3MK0A 4BY1C 5IYBC 5L0BA 1Y7AA 1TWAC 1Y1WC 1I3QK 1SFOA 4Y7NK 4LOWA 1GE9A 5C66A 4C3IC 4C3HC 1K83A 2IUCA 1DD5A 2JA6K 4KMDA 1WCMK 3G4CA 4KMUA 3S2HK 1ALKA 4LQYA 2PA8L 1TWHA 1SFOC 4MQ9A 3GDZA 5IYDC 3L4KA 2JA5A 4UPIA 1PJ5A 1ZEDA 2W5RA 3IDDA 3S2DC 2E2IA 4LRAA 1ED9A 3GTJK 5C4JC 2B63A 3V4GA 1JQWA 4KJGA 4A3BK 4A3FK 2JA7K 2PMZL 1R9TA 3FOEA 3MK1A 1O26A 3LXQA 2W5SA 2YU9A 2X98A 2XCQA 1F7UA 1WIHA 1TWGA 4PABA 3MMLB 4CYRA 3HXAA 4A3CK 4Y52K 4KAVA 3I4NK 1DCHA 5C3EK 2YU9C 4KJDA 2BE5A 3PO3C 3NUHA 4G7ZA 2R7ZC 2CW0A 1O25A 4Q4ZA 3S1QK 3GTGC 2JA8K 4FM9A 2NVXA 4XCHA 3GTPA 2E2HA 4YFKA 3N0CA 3A8IA 4BBRC 3GTKA 3HOUK 2W5XA 4GTZA 1ZEFA 3GTPC 4A3GK 2E2HC 1XZQB 4G7HA 3KD8A 5IJSA 2NVYK 4C2MK 1O2AA 5AJ9A 4A93K 4AH6A 4OIRA 3OPFA 4RMFA 4DDQA 1O98A 1HJKA 3S15C 2VUMK 4BLAA 3GTMK 2W8SA 4QAXA 1EI6A 1J6WA 3HOWK 5M5WK 4X6AK 4OIQA 3G4AA 1ZYRA 1TWFK 4KMHA 1EW9A 4ZG6A 4PAAA 4UPLA 5GOVA 4UOOA 3RZDK 2R92A 2XCRB 3BDGA 3HOYC 1DCOA 3SZZA 3BDGB 3TFIA 5TMFA 3HOZC 3CQZK 5HL8A 4Q5SA 3AH5A 1KHLA 5IOQA 4LRFA 1HQMA 1IS1A 3AD8C 3IGYB 3I4MC 1K7HA 5K4PA 2XCOA 1WOPA 3M8WA 4BXXC 2GAGC 2W5TA 3GTOK 1O28A 2W7VA 2RGRA 1WQGA 4GTDA 1I50A 1B4BA 4OIOA 1P49A 3K7AC 4BY7C 3MK2A 3GEHA 3AQPA 1X31C 1I6HK 1SHNA 4LJZA 3LAPA 4XSXA 5IYCK 3EQLA 1E3CP 5LRMA 1TWCA 3NKPA 4MEYA 4KATA 5IP7K 2FQTA 1SMYA 3S14K 3M4OK 5DLTA 1O27A 1Y1VK 4LRBA 5C44K 4KARA 5FLMC 3GTQC 3S17C 3S1MC 4A3DC 5EGHA 5EGEA 4A3MK 1FSUA 5L0KA 1TWCC 4A3JC 2EBBA 1I3QA 3RZDC 1WQHA 4GTLA 2GAHC 2RH6A 3GTLC 2R93K 3JSTA 3FKIK 3UO0A 3PO2K 1JVIA 3S1NK 2JA6A 4BKWA 3M8YA 4C45A 2P8TA 1PJ6A 1ALIA 4CXUA 5IJQA 4Y7NC 5LIAA 5GRRA 1EW8A 4BY1K 1ANIA 2IUCB 4XLNA 3HOVC 2GLQA 5IP9C 5IYBK 4FZBA 1TWAK 3BUEA 3T02A 3GTJA 3WAXA 1K83C 3S2HC 2A6HA 5E68A 1XXAA 4KN7A 2JA7A 1Y6VA 1O29A 3CMRA 3AD9C 4C3IK 1XXCA 1XZPA 4GFQA 1TWHC 4AYBL 4C3HK 4OINA 2NVTC 2JA5C 4G0WA 1SFOK 4YFNA 2E2IC 4CYSA 4A3FC 2GSOA 2WB1L 2B63C 1VH2A 1N2LA 3S1RC 4ZH4A 1O24A 1F93A 4P9SA 1ALHA 1R9TC 3M3YC 4MIVA 4GTEA 1AJCA 2Y0SD 4A3LC 4WILA 2W5QA 4ZG7A 4A3KC 1KH9A 1TWGC 4C3JC 1AUKA 4KC6A 3HKZD 4BLBA 3WAWA 3S1QC 4GTYA 2QZUA 3GSIA 4A3IC 2JA8C 5C4XC 3A8KA 4ILDA 3BP8C 1JOEA 3H0GK 4KM8A 2NVXC 3PO3K 2R7ZK 2E2JC 3HOUC 1HDHA 3A8JA 4BBSK 2D6FC 4KM4A 4GTCA 3GTGK 3GTKC 1E33P 1BS2A 3L4JA 1WOOA 2VUMA 3GTMA 1WORA 3IPJA 2W8DA 5TMCA 4BBRK 4KB4A 4JK1A 3AQOA 1IBAA 5IORA 4G0UA 1XPPA 1TWFA 3GTPK 3E2DA 4QIWD 3HOWC 1KHKA 4X6AC 3OEPA 1EW2A 2A68A 2NVQC 1AJDA 2FQOA 4FDJA 4NWXA 5CJ9A 5D4DA 2O5IA 3CQZA 5IOSA 3S15K 5DLVA 2JH3A 3ED4A 1HQAA 2G9YA 4ZG9A 3T00A
chains in the Genus database with same CATH topology
1ZBSA 4N7TA 4UPKA 5HRTA 1ELZA 2ZFZA 3GTOA 2GSNA 3NKRA 3NKOA 2D1GA 4LREA 1N2KA 2CFAA 1EJJA 4CXKA 1AJAA 1KHNA 1Y1VA 1EQJA 1ZXOA 3UN2A 3DYCA 4KDDA 4G0VA 4KAYA 2R93A 5L0EA 2XRGA 4LR9A 4CXSA 4GTAA 3SZYA 4FDIA 1WCMA 1XXBA 3UN3A 3NKNA 1TWAA 3CAGA 1EH1A 4UORA 3OREA 4GTXA 5TJ3A 1E2SP 1ISEA 3NVLA 4M1XA 3ERED 2ZKTA 4MY4A 5JVOA 4B56A 1KHJA 3B5QA 1KH5A 4NWJA 2PHCB 4GT9A 5JFEA 4KAWX 1ED8A 1KH4A 1KQ4A 3H0GA 1URBA 2R7ZA 3WAYA 2NVYA 3FHZA 3GTGA 3NKMA 2Y3PA 4P5BA 1BGWA 3T01A 4P5AA 3TG0A 4KASA 3BDHA 1WQFA 4C2MC 1ANJA 2ANHA 3S0XA 3WAVA 4ZGAA 4GTBA 1E1ZP 4UOPA 1SHQA 4MHXA 1AJBA 1ELXA 1F9NA 2XR9A 4LR7A 3BDFA 3M8ZA 1B4AA 1AB4A 4J3NA 4LR8A 5INHA 3N0BA 2GA3A 3TX0A 2IFYA 4YR1A 4LRDA 4LRCA 3VA7A 3QX3A 2VQRA 1O99A 5IOTA 1ALJA 4KM9A 2P5MA 1ELYA 5KXAA 1URAA 3IGZB 2W5VA 3WBHA 3Q3QA 3M7VA 3A52A 5DLWA 2CFAB 4GTWA 3LPXA 1EK8A 3TWZA 4KB2A 2KWAA 3LAJA 3DPCA 4UPHA 2GSUA 3FKIA 4KMAA 1ZVUA 3N3YA 3OT9A 4GTFA 1O2BA 3NKQA 5LRNA 1BJTA 5LQQA 2W5WA 1KH7A 3GTQA 3UNYA 5CHPA 4TN0A 3FOFA 1ZEBA 1B8JA 3UN5A 3GTLA 1Y1WA 4LR2A 3MK0A 5L0BA 1Y7AA 1SFOA 1GE9A 5C66A 4C3IC 4C3HC 1K83A 2IUCA 1DD5A 4KMDA 3G4CA 1ALKA 4LQYA 1TWHA 3L4KA 2JA5A 4UPIA 1ZEDA 3IDDA 2W5RA 4LRAA 2E2IA 1ED9A 2B63A 3V4GA 1R9TA 3FOEA 3MK1A 1O26A 3LXQA 2W5SA 2YU9A 2X98A 2XCQA 1WIHA 1TWGA 3MMLB 4CYRA 4KAVA 4KJDA 3NUHA 1O25A 4FM9A 2NVXA 3GTPA 2E2HA 3N0CA 3GTKA 2W5XA 4GTZA 1ZEFA 3KD8A 5IJSA 1O2AA 5AJ9A 3OPFA 4DDQA 1O98A 1HJKA 4BLAA 2W8SA 4QAXA 1EI6A 3G4AA 4KMHA 1EW9A 4ZG6A 4UPLA 5GOVA 4UOOA 2R92A 2XCRB 3BDGA 3SZZA 3BDGB 3AH5A 1KHLA 5IOQA 4LRFA 1IS1A 3IGYB 1K7HA 5K4PA 2XCOA 3M8WA 2W5TA 1O28A 2RGRA 1WQGA 4GTDA 1I50A 1B4BA 1P49A 3MK2A 3AQPA 1SHNA 3LAPA 1E3CP 5LRMA 1TWCA 3NKPA 4KATA 5DLTA 1O27A 4LRBA 4KARA 5EGHA 5EGEA 1FSUA 5L0KA 1I3QA 1WQHA 4GTLA 2RH6A 3UO0A 2JA6A 4BKWA 3M8YA 1ALIA 4CXUA 5IJQA 5LIAA 5GRRA 1EW8A 1ANIA 2IUCB 2GLQA 4FZBA 3BUEA 3T02A 3GTJA 3WAXA 1XXAA 2JA7A 4KJGA 1O29A 1Y6VA 3CMRA 1XXCA 4GFQA 4G0WA 4CYSA 2GSOA 1N2LA 1O24A 1ALHA 4MIVA 4GTEA 1AJCA 2W5QA 4ZG7A 1KH9A 4C3JC 1AUKA 4KC6A 4BLBA 3WAWA 4GTYA 2QZUA 4ILDA 4KM8A 1HDHA 4KM4A 4GTCA 1E33P 3L4JA 2VUMA 3GTMA 2W8DA 4KB4A 3AQOA 5IORA 4G0UA 1TWFA 3E2DA 1KHKA 3OEPA 1EW2A 1AJDA 4FDJA 4NWXA 5CJ9A 3CQZA 5IOSA 5DLVA 2JH3A 3ED4A 1HQAA 2G9YA 4ZG9A 3T00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T01 A;  3TG0 A;  3NKP A;  3BDH A;  4N7T A;  4UPK A;  4UPI A;  1ANJ A;  1E3C P;  5DLT A;  1ELZ A;  5HRT A;  4LRB A;  1ZED A;  3IDD A;  2W5R A;  4LRA A;  2ANH A;  1ED9 A;  3WAV A;  5EGH A;  5EGE A;  4ZGA A;  1E1Z P;  1FSU A;  2GSN A;  4UOP A;  5L0K A;  1SHQ A;  2RH6 A;  3NKR A;  1AJB A;  1ELX A;  3MK1 A;  3LXQ A;  4MHX A;  3UO0 A;  2XR9 A;  4LR7 A;  3BDF A;  2W5S A;  3M8Z A;  2X98 A;  3M8Y A;  3NKO A;  2D1G A;  1ALI A;  4LRE A;  1N2K A;  4CXU A;  5IJQ A;  5LIA A;  5GRR A;  4ZG9 A;  4CYR A;  1EJJ A;  1EW8 A;  4CXK A;  4KAV A;  1AJA A;  2IUC B;  1ANI A;  4LR8 A;  5INH A;  1KHN A;  2GLQ A;  4KJD A;  1EQJ A;  2GA3 A;  3TX0 A;  2IFY A;  3T02 A;  3WAX A;  4LRD A;  4YR1 A;  4LRC A;  3UN2 A;  3DYC A;  2VQR A;  1O99 A;  1Y6V A;  3CMR A;  4KAY A;  4KJG A;  5L0E A;  1ALJ A;  2XRG A;  4LR9 A;  4CXS A;  1ELY A;  2W5X A;  4GTZ A;  3SZY A;  1ZEF A;  5KXA A;  1URA A;  4FDI A;  3IGZ B;  4CYS A;  2GSO A;  2W5V A;  3KD8 A;  3WBH A;  5IJS A;  1N2L A;  5AJ9 A;  3Q3Q A;  1ALH A;  4MIV A;  3M7V A;  3UN3 A;  3A52 A;  3NKN A;  5DLW A;  1AJC A;  4GTW A;  1O98 A;  1HJK A;  3TWZ A;  5LRM A;  4UOR A;  2W5Q A;  4ZG7 A;  2W8S A;  1KH9 A;  4QAX A;  1EI6 A;  1AUK A;  4GTX A;  5TJ3 A;  3DPC A;  3WAW A;  4UPH A;  2GSU A;  4GTY A;  1E2S P;  2QZU A;  1EW9 A;  4ZG6 A;  3OT9 A;  3NVL A;  3NKQ A;  5GOV A;  4UPL A;  5LRN A;  4UOO A;  5LQQ A;  2W5W A;  3BDG A;  1KH7 A;  3UNY A;  1HDH A;  4KM4 A;  3SZZ A;  2ZKT A;  4TN0 A;  3BDG B;  4MY4 A;  3T00 A;  1ZEB A;  1B8J A;  1KHL A;  1E33 P;  4LRF A;  3UN5 A;  1KHJ A;  4B56 A;  3B5Q A;  1KH5 A;  4LR2 A;  4NWJ A;  2W8D A;  3IGY B;  3MK0 A;  1K7H A;  5K4P A;  1ED8 A;  3M8W A;  2W5T A;  5L0B A;  1Y7A A;  3E2D A;  1KH4 A;  1KHK A;  1P49 A;  1EW2 A;  1URB A;  3MK2 A;  1AJD A;  5C66 A;  4FDJ A;  4NWX A;  3WAY A;  1SHN A;  2IUC A;  3NKM A;  5DLV A;  3ED4 A;  1HQA A;  2G9Y A;  1ALK A;  4LQY A; 
#chains in the Genus database with same CATH topology
 1ZBS A;  4N7T A;  1USM A;  3GEE A;  3HOX C;  1IL2 A;  4UPK A;  5HRT A;  1ELZ A;  2R92 C;  3CQZ C;  1USO A;  2ZFZ A;  3TFJ A;  3GTO A;  2PA8 D;  1ZQ1 C;  2GSN A;  1I6V A;  3HOY K;  3NKR A;  4A3E C;  3RZO C;  4G7O A;  2ZUE A;  2V6U A;  3HOZ K;  3GTO C;  3NKO A;  2D1G A;  5M3F K;  3GEI A;  1N2K A;  4LRE A;  2CFA A;  5M5Y K;  1IQ0 A;  1EJJ A;  1I50 C;  2A6E A;  4CXK A;  1AJA A;  1YX2 A;  4BXX K;  1KHN A;  1Y1V A;  1J6V A;  1V5V A;  1EQJ A;  4QJV A;  5M5X K;  3H3V D;  1ZXO A;  3UN2 A;  3K7A K;  4BY7 K;  3DYC A;  4KDD A;  4G0V A;  3S16 K;  3S14 C;  4KAY A;  2R93 A;  5L0E A;  1Y1V C;  2XRG A;  4LR9 A;  4CXS A;  4GTA A;  3SZY A;  4FDI A;  1G51 A;  2A69 A;  1PJ7 A;  1WCM A;  1VGX A;  1XXB A;  3PO2 C;  1I3Q C;  4LK1 A;  5FLM K;  3GTQ K;  3S1M K;  4A3D K;  3UN3 A;  3NKN A;  1TWA A;  4A3J K;  2JA6 C;  3CAG A;  1EH1 A;  1WCM C;  3GTL K;  4UOR A;  3ORE A;  1Y1W K;  4GTX A;  5TJ3 A;  2ZUF A;  4YFX A;  5M3M K;  1E2S P;  2WAQ D;  4XSZ A;  1ISE A;  1O2F B;  1XZP B;  3GTJ C;  3NVL A;  4M1X A;  3ERE D;  3HOV K;  5IP9 K;  1RU0 A;  4A3B C;  2JA7 C;  5IYD K;  1C0A A;  1K83 K;  2ZKT A;  4MY4 A;  5JVO A;  1VRQ C;  3S2D K;  1WSV A;  4B56 A;  1KHJ A;  1UV7 A;  5C4J K;  2V6T A;  3B5Q A;  1KH5 A;  1TWH K;  4NWJ A;  2PHC B;  4GT9 A;  2NVT K;  2JA5 K;  5JFE A;  1VJE A;  4Y52 C;  4A3C C;  4KAW X;  1ED8 A;  3I4N C;  5C3E C;  2E2I K;  4XLP A;  2B63 K;  3TFH A;  1KH4 A;  1J98 A;  1KQ4 A;  3S1R K;  3H0G A;  4LLG A;  4O2D A;  3GIR A;  1R9T K;  3M3Y K;  1IE0 A;  1URB A;  2R7Z A;  1YNN A;  3WAY A;  2NVY A;  3FHZ A;  3H3V L;  3GTG A;  2YU9 K;  4A3L K;  1YNJ A;  3NKM A;  1HI9 A;  2Y3P A;  2O5J A;  4LK0 A;  4P5B A;  4A3K K;  1BGW A;  3H0G C;  1TWG K;  3T01 A;  4P5A A;  4C3J K;  3TG0 A;  4KAS A;  4A3G C;  3BDH A;  1EQR A;  1WQF A;  2NVY C;  4C2M C;  4BBS C;  1ANJ A;  4A3I K;  4GZY A;  1WOS A;  1WSR A;  5C4X K;  4A93 C;  2ANH A;  2V6S A;  3S0X A;  3WAV A;  4ZGA A;  3AD7 C;  4GTB A;  1E1Z P;  4UOP A;  2NVX K;  1SHQ A;  2E2H K;  2E2J K;  2VUM C;  1AJB A;  1ELX A;  4MHX A;  3GTM C;  1XZQ A;  1F9N A;  2XR9 A;  4LR7 A;  3BDF A;  3GTK K;  3M8Z A;  4KN4 A;  1TWF C;  5FJ8 K;  1B4A A;  3WOD A;  1AB4 A;  3BP3 A;  4J3N A;  4LR8 A;  5INH A;  2PPB A;  3N0B A;  2WAQ L;  2GA3 A;  3TX0 A;  2IFY A;  4OIP A;  4LRD A;  4YR1 A;  1EFW A;  4LRC A;  1IW7 A;  3VA7 A;  3QX3 A;  1L0W A;  4MEX A;  2NVQ K;  1O99 A;  2VQR A;  5IOT A;  1ALJ A;  4YG2 A;  4KM9 A;  2P5M A;  1ELY A;  1J6X A;  1VLO A;  5KXA A;  1URA A;  3IGZ B;  3ADA C;  2Y0S L;  5L46 A;  1BDF A;  4AYB D;  2W5V A;  3WBH A;  3HOX K;  2R92 K;  3I4M K;  2PMZ D;  3DXJ A;  3Q3Q A;  3TTG A;  3HKZ L;  1F7V A;  3M7V A;  3A52 A;  5DLW A;  2CFA B;  4GTW A;  1I6H C;  1YCL A;  3LPX A;  1EK8 A;  2WB1 D;  3TWZ A;  5IYC C;  4KB2 A;  4A3E K;  3RZO K;  2KWA A;  3LAJ A;  4QJV B;  5IP7 C;  3DPC A;  4UPH A;  3M4O C;  2GSU A;  3FKI A;  4KMA A;  1ZVU A;  3N3Y A;  5C44 C;  3OT9 A;  4GTF A;  1I50 K;  3S16 C;  1O2B A;  3NKQ A;  4A3M C;  5LRN A;  4NOI A;  1BJT A;  4WJ3 M;  5LQQ A;  2W5W A;  1KH7 A;  3GTQ A;  1DCP A;  2R93 C;  5CHP A;  3UNY A;  3FKI C;  4TN0 A;  3FOF A;  1ZEB A;  3S1N C;  1B8J A;  3S17 K;  3UN5 A;  3GTL A;  4WJ4 A;  1Y1W A;  4LR2 A;  1TWC K;  1INN A;  4QIW L;  3MK0 A;  4BY1 C;  5IYB C;  5L0B A;  1Y7A A;  1TWA C;  1Y1W C;  1I3Q K;  1SFO A;  4Y7N K;  4LOW A;  1GE9 A;  5C66 A;  4C3I C;  4C3H C;  1K83 A;  2IUC A;  1DD5 A;  2JA6 K;  4KMD A;  1WCM K;  3G4C A;  4KMU A;  3S2H K;  1ALK A;  4LQY A;  2PA8 L;  1TWH A;  1SFO C;  4MQ9 A;  3GDZ A;  5IYD C;  3L4K A;  2JA5 A;  4UPI A;  1PJ5 A;  1ZED A;  2W5R A;  3IDD A;  3S2D C;  2E2I A;  4LRA A;  1ED9 A;  3GTJ K;  5C4J C;  2B63 A;  3V4G A;  1JQW A;  4KJG A;  4A3B K;  4A3F K;  2JA7 K;  2PMZ L;  1R9T A;  3FOE A;  3MK1 A;  1O26 A;  3LXQ A;  2W5S A;  2YU9 A;  2X98 A;  2XCQ A;  1F7U A;  1WIH A;  1TWG A;  4PAB A;  3MML B;  4CYR A;  3HXA A;  4A3C K;  4Y52 K;  4KAV A;  3I4N K;  1DCH A;  5C3E K;  2YU9 C;  4KJD A;  2BE5 A;  3PO3 C;  3NUH A;  4G7Z A;  2R7Z C;  2CW0 A;  1O25 A;  4Q4Z A;  3S1Q K;  3GTG C;  2JA8 K;  4FM9 A;  2NVX A;  4XCH A;  3GTP A;  2E2H A;  4YFK A;  3N0C A;  3A8I A;  4BBR C;  3GTK A;  3HOU K;  2W5X A;  4GTZ A;  1ZEF A;  3GTP C;  4A3G K;  2E2H C;  1XZQ B;  4G7H A;  3KD8 A;  5IJS A;  2NVY K;  4C2M K;  1O2A A;  5AJ9 A;  4A93 K;  4AH6 A;  4OIR A;  3OPF A;  4RMF A;  4DDQ A;  1O98 A;  1HJK A;  3S15 C;  2VUM K;  4BLA A;  3GTM K;  2W8S A;  4QAX A;  1EI6 A;  1J6W A;  3HOW K;  5M5W K;  4X6A K;  4OIQ A;  3G4A A;  1ZYR A;  1TWF K;  4KMH A;  1EW9 A;  4ZG6 A;  4PAA A;  4UPL A;  5GOV A;  4UOO A;  3RZD K;  2R92 A;  2XCR B;  3BDG A;  3HOY C;  1DCO A;  3SZZ A;  3BDG B;  3TFI A;  5TMF A;  3HOZ C;  3CQZ K;  5HL8 A;  4Q5S A;  3AH5 A;  1KHL A;  5IOQ A;  4LRF A;  1HQM A;  1IS1 A;  3AD8 C;  3IGY B;  3I4M C;  1K7H A;  5K4P A;  2XCO A;  1WOP A;  3M8W A;  4BXX C;  2GAG C;  2W5T A;  3GTO K;  1O28 A;  2W7V A;  2RGR A;  1WQG A;  4GTD A;  1I50 A;  1B4B A;  4OIO A;  1P49 A;  3K7A C;  4BY7 C;  3MK2 A;  3GEH A;  3AQP A;  1X31 C;  1I6H K;  1SHN A;  4LJZ A;  3LAP A;  4XSX A;  5IYC K;  3EQL A;  1E3C P;  5LRM A;  1TWC A;  3NKP A;  4MEY A;  4KAT A;  5IP7 K;  2FQT A;  1SMY A;  3S14 K;  3M4O K;  5DLT A;  1O27 A;  1Y1V K;  4LRB A;  5C44 K;  4KAR A;  5FLM C;  3GTQ C;  3S17 C;  3S1M C;  4A3D C;  5EGH A;  5EGE A;  4A3M K;  1FSU A;  5L0K A;  1TWC C;  4A3J C;  2EBB A;  1I3Q A;  3RZD C;  1WQH A;  4GTL A;  2GAH C;  2RH6 A;  3GTL C;  2R93 K;  3JST A;  3FKI K;  3UO0 A;  3PO2 K;  1JVI A;  3S1N K;  2JA6 A;  4BKW A;  3M8Y A;  4C45 A;  2P8T A;  1PJ6 A;  1ALI A;  4CXU A;  5IJQ A;  4Y7N C;  5LIA A;  5GRR A;  1EW8 A;  4BY1 K;  1ANI A;  2IUC B;  4XLN A;  3HOV C;  2GLQ A;  5IP9 C;  5IYB K;  4FZB A;  1TWA K;  3BUE A;  3T02 A;  3GTJ A;  3WAX A;  1K83 C;  3S2H C;  2A6H A;  5E68 A;  1XXA A;  4KN7 A;  2JA7 A;  1Y6V A;  1O29 A;  3CMR A;  3AD9 C;  4C3I K;  1XXC A;  1XZP A;  4GFQ A;  1TWH C;  4AYB L;  4C3H K;  4OIN A;  2NVT C;  2JA5 C;  4G0W A;  1SFO K;  4YFN A;  2E2I C;  4CYS A;  4A3F C;  2GSO A;  2WB1 L;  2B63 C;  1VH2 A;  1N2L A;  3S1R C;  4ZH4 A;  1O24 A;  1F93 A;  4P9S A;  1ALH A;  1R9T C;  3M3Y C;  4MIV A;  4GTE A;  1AJC A;  2Y0S D;  4A3L C;  4WIL A;  2W5Q A;  4ZG7 A;  4A3K C;  1KH9 A;  1TWG C;  4C3J C;  1AUK A;  4KC6 A;  3HKZ D;  4BLB A;  3WAW A;  3S1Q C;  4GTY A;  2QZU A;  3GSI A;  4A3I C;  2JA8 C;  5C4X C;  3A8K A;  4ILD A;  3BP8 C;  1JOE A;  3H0G K;  4KM8 A;  2NVX C;  3PO3 K;  2R7Z K;  2E2J C;  3HOU C;  1HDH A;  3A8J A;  4BBS K;  2D6F C;  4KM4 A;  4GTC A;  3GTG K;  3GTK C;  1E33 P;  1BS2 A;  3L4J A;  1WOO A;  2VUM A;  3GTM A;  1WOR A;  3IPJ A;  2W8D A;  5TMC A;  4BBR K;  4KB4 A;  4JK1 A;  3AQO A;  1IBA A;  5IOR A;  4G0U A;  1XPP A;  1TWF A;  3GTP K;  3E2D A;  4QIW D;  3HOW C;  1KHK A;  4X6A C;  3OEP A;  1EW2 A;  2A68 A;  2NVQ C;  1AJD A;  2FQO A;  4FDJ A;  4NWX A;  5CJ9 A;  5D4D A;  2O5I A;  3CQZ A;  5IOS A;  3S15 K;  5DLV A;  2JH3 A;  3ED4 A;  1HQA A;  2G9Y A;  4ZG9 A;  3T00 A; 
#chains in the Genus database with same CATH homology
 1ZBS A;  4N7T A;  4UPK A;  5HRT A;  1ELZ A;  2ZFZ A;  3GTO A;  2GSN A;  3NKR A;  3NKO A;  2D1G A;  4LRE A;  1N2K A;  2CFA A;  1EJJ A;  4CXK A;  1AJA A;  1KHN A;  1Y1V A;  1EQJ A;  1ZXO A;  3UN2 A;  3DYC A;  4KDD A;  4G0V A;  4KAY A;  2R93 A;  5L0E A;  2XRG A;  4LR9 A;  4CXS A;  4GTA A;  3SZY A;  4FDI A;  1WCM A;  1XXB A;  3UN3 A;  3NKN A;  1TWA A;  3CAG A;  1EH1 A;  4UOR A;  3ORE A;  4GTX A;  5TJ3 A;  1E2S P;  1ISE A;  3NVL A;  4M1X A;  3ERE D;  2ZKT A;  4MY4 A;  5JVO A;  4B56 A;  1KHJ A;  3B5Q A;  1KH5 A;  4NWJ A;  2PHC B;  4GT9 A;  5JFE A;  4KAW X;  1ED8 A;  1KH4 A;  1KQ4 A;  3H0G A;  1URB A;  2R7Z A;  3WAY A;  2NVY A;  3FHZ A;  3GTG A;  3NKM A;  2Y3P A;  4P5B A;  1BGW A;  3T01 A;  4P5A A;  3TG0 A;  4KAS A;  3BDH A;  1WQF A;  4C2M C;  1ANJ A;  2ANH A;  3S0X A;  3WAV A;  4ZGA A;  4GTB A;  1E1Z P;  4UOP A;  1SHQ A;  4MHX A;  1AJB A;  1ELX A;  1F9N A;  2XR9 A;  4LR7 A;  3BDF A;  3M8Z A;  1B4A A;  1AB4 A;  4J3N A;  4LR8 A;  5INH A;  3N0B A;  2GA3 A;  3TX0 A;  2IFY A;  4YR1 A;  4LRD A;  4LRC A;  3VA7 A;  3QX3 A;  2VQR A;  1O99 A;  5IOT A;  1ALJ A;  4KM9 A;  2P5M A;  1ELY A;  5KXA A;  1URA A;  3IGZ B;  2W5V A;  3WBH A;  3Q3Q A;  3M7V A;  3A52 A;  5DLW A;  2CFA B;  4GTW A;  3LPX A;  1EK8 A;  3TWZ A;  4KB2 A;  2KWA A;  3LAJ A;  3DPC A;  4UPH A;  2GSU A;  3FKI A;  4KMA A;  1ZVU A;  3N3Y A;  3OT9 A;  4GTF A;  1O2B A;  3NKQ A;  5LRN A;  1BJT A;  5LQQ A;  2W5W A;  1KH7 A;  3GTQ A;  3UNY A;  5CHP A;  4TN0 A;  3FOF A;  1ZEB A;  1B8J A;  3UN5 A;  3GTL A;  1Y1W A;  4LR2 A;  3MK0 A;  5L0B A;  1Y7A A;  1SFO A;  1GE9 A;  5C66 A;  4C3I C;  4C3H C;  1K83 A;  2IUC A;  1DD5 A;  4KMD A;  3G4C A;  1ALK A;  4LQY A;  1TWH A;  3L4K A;  2JA5 A;  4UPI A;  1ZED A;  3IDD A;  2W5R A;  4LRA A;  2E2I A;  1ED9 A;  2B63 A;  3V4G A;  1R9T A;  3FOE A;  3MK1 A;  1O26 A;  3LXQ A;  2W5S A;  2YU9 A;  2X98 A;  2XCQ A;  1WIH A;  1TWG A;  3MML B;  4CYR A;  4KAV A;  4KJD A;  3NUH A;  1O25 A;  4FM9 A;  2NVX A;  3GTP A;  2E2H A;  3N0C A;  3GTK A;  2W5X A;  4GTZ A;  1ZEF A;  3KD8 A;  5IJS A;  1O2A A;  5AJ9 A;  3OPF A;  4DDQ A;  1O98 A;  1HJK A;  4BLA A;  2W8S A;  4QAX A;  1EI6 A;  3G4A A;  4KMH A;  1EW9 A;  4ZG6 A;  4UPL A;  5GOV A;  4UOO A;  2R92 A;  2XCR B;  3BDG A;  3SZZ A;  3BDG B;  3AH5 A;  1KHL A;  5IOQ A;  4LRF A;  1IS1 A;  3IGY B;  1K7H A;  5K4P A;  2XCO A;  3M8W A;  2W5T A;  1O28 A;  2RGR A;  1WQG A;  4GTD A;  1I50 A;  1B4B A;  1P49 A;  3MK2 A;  3AQP A;  1SHN A;  3LAP A;  1E3C P;  5LRM A;  1TWC A;  3NKP A;  4KAT A;  5DLT A;  1O27 A;  4LRB A;  4KAR A;  5EGH A;  5EGE A;  1FSU A;  5L0K A;  1I3Q A;  1WQH A;  4GTL A;  2RH6 A;  3UO0 A;  2JA6 A;  4BKW A;  3M8Y A;  1ALI A;  4CXU A;  5IJQ A;  5LIA A;  5GRR A;  1EW8 A;  1ANI A;  2IUC B;  2GLQ A;  4FZB A;  3BUE A;  3T02 A;  3GTJ A;  3WAX A;  1XXA A;  2JA7 A;  4KJG A;  1O29 A;  1Y6V A;  3CMR A;  1XXC A;  4GFQ A;  4G0W A;  4CYS A;  2GSO A;  1N2L A;  1O24 A;  1ALH A;  4MIV A;  4GTE A;  1AJC A;  2W5Q A;  4ZG7 A;  1KH9 A;  4C3J C;  1AUK A;  4KC6 A;  4BLB A;  3WAW A;  4GTY A;  2QZU A;  4ILD A;  4KM8 A;  1HDH A;  4KM4 A;  4GTC A;  1E33 P;  3L4J A;  2VUM A;  3GTM A;  2W8D A;  4KB4 A;  3AQO A;  5IOR A;  4G0U A;  1TWF A;  3E2D A;  1KHK A;  3OEP A;  1EW2 A;  1AJD A;  4FDJ A;  4NWX A;  5CJ9 A;  3CQZ A;  5IOS A;  5DLV A;  2JH3 A;  3ED4 A;  1HQA A;  2G9Y A;  4ZG9 A;  3T00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...