4LQYA

Crystal structure of human enpp4 with amp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
total genus 127
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lqyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lqyA01
1ED8A 2W5VA 1ELXA 5GOVA 4CYRA 2G9YA 2W5TA 3BDGB 2VQRA 3WAYA 5IJQA 2W5XA 4CXUA 4N7TA 3SZYA 4LRAA 1ANJA 3NKNA 3WAVA 3T00A 3IDDA 4TN0A 3B5QA 4UOOA 3T02A 4YR1A 2GLQA 3BDFA 1URBA 4UPIA 3WBHA 1AJCA 4LREA 1ELZA 3LXQA 4UOPA 4ZG6A 1ZEDA 5LQQA 2ZKTA 5C66A 5L0BA 4LRDA 4GTZA 1E3CP 5K4PA 1K7HA 4KJGA 1E2SP 2D1GA 1KH7A 3NKMA 4UORA 4CYSA 4LR8A 3NKQA 5TJ3A 3UO0A 2GSOA 1SHQA 3TWZA 5KXAA 3BDGA 4LQYA 2W5QA 1P49A 4ZGAA 5DLVA 1KHLA 1ALHA 4UPLA 1O98A 3TG0A 2GSNA 1O99A 4CXKA 5L0EA 1KH4A 2GA3A 4KJDA 1EQJA 3M8YA 4GTYA 4ZG9A 1E33P 3WAWA 4ZG7A 4CXSA 1E1ZP 3MK2A 4FDJA 4KAVA 1B8JA 3UN2A 4GTWA 3BDHA 3NKOA 4KAYA 3MK1A 3NKRA 1AJAA 3OT9A 4LR2A 1HJKA 4LR7A 1ZEFA 2XRGA 4NWJA 5LRNA 1Y7AA 4NWXA 2QZUA 1KHJA 2IFYA 5LRMA 2RH6A 1EW9A 2XR9A 1FSUA 5EGEA 1KHNA 4UPKA 4LRCA 2IUCB 4LRFA 1KHKA 3M8ZA 2W8DA 3CMRA 4LR9A 4LRBA 5LIAA 3E2DA 3IGZB 1AJBA 3M7VA 1KH5A 1ALIA 5HRTA 1EJJA 4FDIA 3NKPA 4MIVA 3DYCA 3UNYA 2W8SA 1EI6A 5IJSA 1ZEBA 4QAXA 1AUKA 5DLTA 3WAXA 2GSUA 5INHA 1KH9A 3A52A 1ALJA 3NVLA 5AJ9A 5EGHA 1N2LA 4MHXA 5L0KA 1Y6VA 1ALKA 4MY4A 2W5SA 1HQAA 1HDHA 3MK0A 1URAA 3UN5A 1ED9A 3T01A 5GRRA 3TX0A 3ED4A 1N2KA 1EW2A 2ANHA 3KD8A 3Q3QA 1AJDA 2IUCA 2W5WA 3IGYB 2X98A 1SHNA 2W5RA 4GTXA 4B56A 3UN3A 5DLWA 3DPCA 4KM4A 4UPHA 3SZZA 3M8WA 1ANIA 1ELYA 1EW8A
chains in the Genus database with same CATH superfamily
3FHZA 1Y1WK 1SFOA 3I4NC 2A6HA 2NVYK 1TWAC 3LAJA 3S1QC 5M3MK 3K7AK 3SZYA 2NVQK 3M3YC 3OPFA 3RZOC 3HOZK 3H0GC 3WAVA 4XSXA 3HOUC 4TN0A 2B63K 5FJ8K 4A3LC 1YCLA 3BDFA 1WCMK 2YU9A 2XCQA 3BP3A 4OINA 1AJCA 4Q5SA 1O29A 1I6HC 3LXQA 1O25A 4A3IK 4LREA 4X6AC 3N0BA 5C66A 2P5MA 1IBAA 2JA7C 1IE0A 3ERED 1K7HA 4A3IC 4UORA 4CYSA 4LR8A 4BLBA 3UO0A 4A3EC 1Y1VC 3FKIC 4O2DA 4A3KC 1XXBA 4BY1C 1WCMA 1I3QA 1TWHA 1P49A 4ZGAA 2NVXK 1KHLA 1O98A 4GTEA 3S1NC 5M5WK 1KH4A 2GA3A 3BP8C 1XPPA 4KJDA 4C2MK 4G7ZA 2WB1L 4KMAA 4KAVA 1B8JA 5IYDK 4GTWA 3NKOA 1TWHK 2ZFZA 5C3EK 5TMFA 3MK1A 5IOTA 4KATA 5M5XK 1Y1VA 3FKIA 3HOUK 1I3QC 1TWHC 5C3EC 1SFOK 4LR7A 2WAQL 5LRNA 3S17K 2E2IC 2IFYA 2NVYA 3S16K 3GTJC 1FSUA 2R7ZC 4LRCA 2IUCB 4LRFA 1K83C 2W8DA 1WIHA 1EQRA 2PA8D 3HOYC 3M4OC 4OIQA 2R7ZK 3IGZB 1K83K 1DD5A 3A8IA 3TFHA 1Y1VK 1EH1A 3FKIK 4MIVA 3UNYA 1EI6A 1F9NA 2YU9K 2FQTA 5IJSA 1VH2A 4A3MC 3S14K 1WQFA 3A8KA 5EGHA 1N2LA 1ALKA 4MEXA 4MY4A 1I50C 1J6WA 2R7ZA 1URAA 2VUMA 5GRRA 1K83A 2CW0A 1EW2A 4GT9A 1O2FB 2NVQC 3S2HK 1AJDA 3GTQC 4BXXK 1TWCA 1SHNA 3GTPK 3UN3A 3S2HC 4WILA 3SZZA 1AB4A 3M8WA 3M4OK 5CJ9A 1XXAA 4QJVA 4ILDA 2PA8L 1O28A 4LK1A 3L4JA 4GTAA 3IPJA 3S2DK 2G9YA 2W5TA 3G4CA 4CYRA 3S16C 3I4MK 2W5XA 2KWAA 2VUMC 1B4BA 4A3MK 3GTLK 1J98A 4KN4A 3HOVK 3B5QA 4UOOA 1EK8A 2V6SA 1RU0A 3TTGA 1TWCC 2GAGC 4C3IC 3ADAC 5IYBC 2NVTK 4YG2A 3GTGA 5LQQA 4Q4ZA 5L0BA 1VLOA 1SMYA 1E3CP 4QIWL 1TWAK 4KJGA 1TWFA 3AD8C 1KH7A 3NKMA 3OREA 5FLMC 2GSOA 3FOFA 1J6XA 2NVXA 1L0WA 5KXAA 3BDGA 4LQYA 2W5QA 3N3YA 5DLVA 3GTQK 4BY7C 4YFKA 4X6AK 2ZUFA 3S17C 3PO2C 4CXKA 5L0EA 3PO3C 4KMHA 4G0UA 1IL2A 1XXCA 2E2JC 4A93C 4GTYA 4NOIA 2B63A 4OIOA 1E1ZP 1O26A 3MK2A 1USOA 3GTOK 4LJZA 4P5AA 5CHPA 2JA8K 1XZQA 1WOSA 2NVXC 3JSTA 5HL8A 4A3BK 2CFAB 2D6FC 4LR2A 3S1NK 1DCHA 4GTCA 2JA5C 4NWJA 4KN7A 1TWGA 4XLNA 2QZUA 1KHJA 5LRMA 5FLMK 2RH6A 1I6VA 1YNJA 1HQMA 4GTFA 3CMRA 4A3CC 5LIAA 3GTKA 3V4GA 5M5YK 2CFAA 4RMFA 1VRQC 1XZQB 1ALIA 1KH5A 5HRTA 3NKPA 4WJ3M 1I6HK 4BLAA 4QAXA 5DLTA 4A3DK 3M3YK 2GSUA 1JOEA 4KM9A 3H0GK 1ALJA 3NVLA 2R93A 4BY7K 5L0KA 1TWAA 4BBSC 4WJ4A 3PO2K 1WOOA 4LK0A 4XSZA 1GE9A 3S2DC 3CQZC 5TMCA 3L4KA 3S1MC 3UN5A 3I4MC 3HOXC 4BY1K 2JA5K 2PMZL 4MQ9A 2WAQD 4BBSK 5IOQA 1N2KA 3KD8A 1ZBSA 2RGRA 2IUCA 5JFEA 5C4JC 1PJ5A 5M3FK 1BS2A 5C44C 2E2HA 4KB2A 4B56A 5DLWA 5IORA 1ANIA 5IYBK 2NVTC 5D4DA 1EW8A 1ED8A 4BBRC 5IP7K 2R93C 2ZUEA 1O24A 3WAYA 4N7TA 2PMZD 1J6VA 4A3LK 4LRAA 1WCMC 3NKNA 5IYCC 4MEYA 1F93A 3S1QK 3WODA 1WOPA 1URBA 3RZOK 3A8JA 4G0WA 3GTJK 3HOXK 2BE5A 1IQ0A 4XCHA 4A3GC 4GZYA 2ZKTA 4GTBA 1TWFK 5C4XC 1I3QK 1SFOC 4FM9A 2P8TA 4XLPA 3HKZD 2D1GA 4A3FK 5TJ3A 3NKQA 2JA7K 1HI9A 3CQZK 4YFNA 3H3VD 3GTPA 1SHQA 4KM8A 3HOVC 4JK1A 3GTMC 4BKWA 2JA8C 1INNA 2R93K 2E2IA 1DCPA 2A69A 1BGWA 1YX2A 4C2MC 1O99A 3GTMK 3GTJA 4GFQA 3G4AA 3HOZC 5IYDC 1EQJA 3GEHA 3TFJA 4KMDA 3GTOA 1F7VA 1WORA 3WAWA 2JA7A 4ZG9A 4C45A 3HKZL 3I4NK 4FDJA 3NUHA 4KB4A 1VGXA 4KAYA 2Y0SL 4P5BA 2XCRB 2E2IK 4KARA 3GTPC 2E2HK 3NKRA 5C4XK 5IYCK 1AJAA 3GTMA 3OT9A 1JQWA 3QX3A 1HJKA 1ZEFA 2EBBA 3S15K 3AD7C 1R9TC 1ZQ1C 1EW9A 4BXXC 2XR9A 4A3KK 5EGEA 1KHNA 4AYBD 5JVOA 3OEPA 4OIPA 1KHKA 3M8ZA 3AD9C 4LRBA 1USMA 1DCOA 4G7HA 3GTOC 3E2DA 2JH3A 4Y52K 3GTQA 3RZDC 3M7VA 3S14C 4PAAA 3HOYK 4G7OA 2O5JA 3DYCA 1ZEBA 5C44K 1AUKA 5INHA 3LPXA 1ISEA 2JA6C 3A52A 3GTLA 2XCOA 4PABA 4AYBL 1R9TA 1Y6VA 2NVYC 1HQAA 4C3HK 2JA6K 3MK0A 4C3IK 3Q3QA 1TWGK 1B4AA 2W5RA 3N0CA 4GTXA 1ZXOA 4A3DC 4KM4A 3PO3K 4UPHA 2V6UA 2E2JK 4A93K 3AQPA 2WB1D 3S0XA 4Y52C 2W5VA 2JA6A 4KC6A 1ELXA 3BUEA 1TWFC 5GOVA 3GIRA 2Y3PA 3VA7A 1R9TK 3GTLC 2VQRA 3BDGB 5IOSA 5IJQA 4CXUA 1I50A 4A3FC 1IS1A 2V6TA 3MMLB 1ANJA 5C4JK 2R92K 1X31C 3T00A 3IDDA 3T02A 2PPBA 4YR1A 2GLQA 3RZDK 4UPIA 3HXAA 3WBHA 1PJ7A 1V5VA 1ELZA 4UOPA 1O2AA 4ZG6A 1ZEDA 2O5IA 1Y1WC 2W7VA 4FZBA 4GTZA 3HOWK 2A6EA 4AH6A 4LRDA 5K4PA 4GTLA 4DDQA 1ZYRA 1E2SP 1KQ4A 1G51A 1ZVUA 1I50K 1JVIA 1PJ6A 4KAWX 1O27A 1BJTA 1YNNA 3TWZA 3EQLA 4OIRA 1TWGC 4KMUA 1ALHA 4UPLA 3TG0A 2GSNA 1XZPA 4A3JC 3GTKK 3S15C 1EFWA 3GTGC 3S1MK 2R92C 3M8YA 1Y1WA 5IP9K 1WSVA 4C3JK 5E68A 3GSIA 4A3JK 2Y0SD 2PHCB 3GTKC 1E33P 4ZG7A 3GEIA 4CXSA 3UN2A 4P9SA 4A3EK 3GTGK 4G0VA 4A3BC 1C0AA 1XZPB 3TFIA 3BDHA 5IP9C 3AH5A 4J3NA 3S1RC 4KDDA 2XRGA 1Y7AA 4NWXA 4BBRK 5IP7C 4Y7NC 1TWCK 2FQOA 3H3VL 4UPKA 3CQZA 4KASA 3K7AC 1F7UA 2R92A 4LR9A 4C3HC 4YFXA 4QJVB 3HOWC 1BDFA 2B63C 2A68A 4LOWA 1AJBA 3AQOA 4A3CK 2E2HC 4FDIA 3GEEA 2W8SA 4C3JC 4A3GK 1WQGA 3LAPA 3WAXA 4LLGA 1KH9A 2JA5A 5AJ9A 4MHXA 3CAGA 1WSRA 2W5SA 2GAHC 1HDHA 4GTDA 3DXJA 3FOEA 3S1RK 3T01A 1ED9A 3TX0A 1WQHA 3H0GA 3ED4A 1IW7A 1O2BA 4M1XA 2ANHA 2VUMK 4QIWD 4Y7NK 2W5WA 3IGYB 1UV7A 2X98A 2YU9C 3DPCA 3GDZA 1VJEA 4ZH4A 5L46A 1ELYA 1EJJA
chains in the Genus database with same CATH topology
3FHZA 1SFOA 3LAJA 3SZYA 3OPFA 3WAVA 4TN0A 3BDFA 2YU9A 2XCQA 1AJCA 4LREA 1O29A 3LXQA 1O25A 3N0BA 5C66A 2P5MA 3ERED 1K7HA 4UORA 4CYSA 4LR8A 4BLBA 3UO0A 1XXBA 1WCMA 1I3QA 1TWHA 1P49A 4ZGAA 1KHLA 1O98A 4GTEA 1KH4A 2GA3A 4KJDA 4KMAA 4KAVA 1B8JA 4GTWA 3NKOA 2ZFZA 3MK1A 5IOTA 4KATA 1Y1VA 3FKIA 4LR7A 5LRNA 2IFYA 2NVYA 1FSUA 4LRCA 2IUCB 4LRFA 2W8DA 1WIHA 3IGZB 1DD5A 4MIVA 1EH1A 3UNYA 1EI6A 1F9NA 5IJSA 1WQFA 5EGHA 1N2LA 1ALKA 4MY4A 2R7ZA 1URAA 2VUMA 5GRRA 1K83A 1EW2A 4GT9A 1AJDA 1TWCA 1SHNA 3UN3A 3SZZA 1AB4A 3M8WA 5CJ9A 1XXAA 4ILDA 1O28A 3L4JA 4GTAA 4CYRA 2G9YA 2W5TA 3G4CA 2W5XA 2KWAA 1B4BA 3B5QA 4UOOA 1EK8A 4C3IC 3GTGA 5LQQA 5L0BA 1E3CP 4KJGA 1TWFA 1KH7A 3NKMA 3OREA 2GSOA 3FOFA 2NVXA 5KXAA 3BDGA 4LQYA 2W5QA 3N3YA 5DLVA 4CXKA 5L0EA 4KMHA 4G0UA 1XXCA 4GTYA 2B63A 1E1ZP 3MK2A 1O26A 4P5AA 5CHPA 2CFAB 4LR2A 4GTCA 4NWJA 1TWGA 2QZUA 1KHJA 5LRMA 2RH6A 4GTFA 3CMRA 5LIAA 3GTKA 3V4GA 2CFAA 1KH5A 1ALIA 5HRTA 3NKPA 4BLAA 4QAXA 5DLTA 2GSUA 4KM9A 1ALJA 3NVLA 2R93A 5L0KA 1TWAA 1GE9A 3L4KA 3UN5A 1N2KA 5IOQA 3KD8A 1ZBSA 2RGRA 2IUCA 5JFEA 2E2HA 4KB2A 4B56A 5DLWA 5IORA 1ANIA 1EW8A 1ED8A 3WAYA 4N7TA 4LRAA 3NKNA 1URBA 4G0WA 2ZKTA 4GTBA 4FM9A 2D1GA 5TJ3A 3NKQA 3GTPA 1SHQA 4KM8A 4BKWA 2E2IA 1BGWA 4C2MC 1O99A 3GTJA 4GFQA 3G4AA 1EQJA 4KMDA 3GTOA 4ZG9A 3WAWA 2JA7A 4FDJA 3NUHA 4KB4A 4KAYA 4P5BA 2XCRB 4KARA 3NKRA 1AJAA 3GTMA 3OT9A 3QX3A 1HJKA 1ZEFA 1EW9A 2XR9A 5EGEA 1KHNA 5JVOA 3OEPA 1KHKA 3M8ZA 4LRBA 3E2DA 2JH3A 3GTQA 3M7VA 3DYCA 1ZEBA 1AUKA 5INHA 3LPXA 1ISEA 3A52A 3GTLA 2XCOA 1Y6VA 1R9TA 1HQAA 3MK0A 3Q3QA 1B4AA 2W5RA 3N0CA 4GTXA 1ZXOA 4KM4A 4UPHA 3AQPA 3S0XA 2W5VA 2JA6A 4KC6A 1ELXA 3BUEA 5GOVA 3VA7A 2Y3PA 3BDGB 4CXUA 2VQRA 5IOSA 5IJQA 1I50A 1IS1A 3MMLB 1ANJA 3T00A 3IDDA 3T02A 4YR1A 2GLQA 4UPIA 3WBHA 1ELZA 4UOPA 1O2AA 4ZG6A 1ZEDA 4FZBA 4GTZA 4LRDA 5K4PA 4GTLA 4DDQA 1E2SP 1KQ4A 1ZVUA 4KAWX 1O27A 1BJTA 3TWZA 1ALHA 4UPLA 3TG0A 2GSNA 3M8YA 1Y1WA 1E33P 2PHCB 4ZG7A 4CXSA 3UN2A 4G0VA 3BDHA 3AH5A 4J3NA 4KDDA 2XRGA 1Y7AA 4NWXA 4UPKA 3CQZA 4KASA 2R92A 4LR9A 4C3HC 1AJBA 3AQOA 4FDIA 2W8SA 4C3JC 1WQGA 3LAPA 3WAXA 1KH9A 2JA5A 5AJ9A 4MHXA 3CAGA 2W5SA 1HDHA 4GTDA 3FOEA 1ED9A 3T01A 3TX0A 1WQHA 3H0GA 3ED4A 1O2BA 4M1XA 2ANHA 2W5WA 3IGYB 2X98A 3DPCA 1O24A 1ELYA 1EJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ED8 A;  2W5V A;  1ELX A;  5GOV A;  4CYR A;  2G9Y A;  2W5T A;  3BDG B;  2VQR A;  3WAY A;  5IJQ A;  2W5X A;  4CXU A;  4N7T A;  3SZY A;  4LRA A;  1ANJ A;  3NKN A;  3WAV A;  3T00 A;  3IDD A;  4TN0 A;  3B5Q A;  4UOO A;  3T02 A;  4YR1 A;  2GLQ A;  3BDF A;  1URB A;  4UPI A;  3WBH A;  1AJC A;  4LRE A;  1ELZ A;  3LXQ A;  4UOP A;  4ZG6 A;  1ZED A;  5LQQ A;  2ZKT A;  5C66 A;  5L0B A;  4LRD A;  4GTZ A;  1E3C P;  5K4P A;  1K7H A;  4KJG A;  1E2S P;  2D1G A;  1KH7 A;  3NKM A;  4UOR A;  4CYS A;  4LR8 A;  3NKQ A;  5TJ3 A;  3UO0 A;  2GSO A;  1SHQ A;  3TWZ A;  5KXA A;  3BDG A;  4LQY A;  2W5Q A;  1P49 A;  4ZGA A;  5DLV A;  1KHL A;  1ALH A;  4UPL A;  1O98 A;  3TG0 A;  2GSN A;  1O99 A;  4CXK A;  5L0E A;  1KH4 A;  2GA3 A;  4KJD A;  1EQJ A;  3M8Y A;  4GTY A;  4ZG9 A;  1E33 P;  3WAW A;  4ZG7 A;  4CXS A;  1E1Z P;  3MK2 A;  4FDJ A;  4KAV A;  1B8J A;  3UN2 A;  4GTW A;  3BDH A;  3NKO A;  4KAY A;  3MK1 A;  3NKR A;  1AJA A;  3OT9 A;  4LR2 A;  1HJK A;  4LR7 A;  1ZEF A;  2XRG A;  4NWJ A;  5LRN A;  1Y7A A;  4NWX A;  2QZU A;  1KHJ A;  2IFY A;  5LRM A;  2RH6 A;  1EW9 A;  2XR9 A;  1FSU A;  5EGE A;  1KHN A;  4UPK A;  4LRC A;  2IUC B;  4LRF A;  1KHK A;  3M8Z A;  2W8D A;  3CMR A;  4LR9 A;  4LRB A;  5LIA A;  3E2D A;  3IGZ B;  1AJB A;  3M7V A;  1KH5 A;  1ALI A;  5HRT A;  1EJJ A;  4FDI A;  3NKP A;  4MIV A;  3DYC A;  3UNY A;  2W8S A;  1EI6 A;  5IJS A;  1ZEB A;  4QAX A;  1AUK A;  5DLT A;  3WAX A;  2GSU A;  5INH A;  1KH9 A;  3A52 A;  1ALJ A;  3NVL A;  5AJ9 A;  5EGH A;  1N2L A;  4MHX A;  5L0K A;  1Y6V A;  1ALK A;  4MY4 A;  2W5S A;  1HQA A;  1HDH A;  3MK0 A;  1URA A;  3UN5 A;  1ED9 A;  3T01 A;  5GRR A;  3TX0 A;  3ED4 A;  1N2K A;  1EW2 A;  2ANH A;  3KD8 A;  3Q3Q A;  1AJD A;  2IUC A;  2W5W A;  3IGY B;  2X98 A;  1SHN A;  2W5R A;  4GTX A;  4B56 A;  3UN3 A;  5DLW A;  3DPC A;  4KM4 A;  4UPH A;  3SZZ A;  3M8W A;  1ANI A;  1ELY A;  1EW8 A; 
#chains in the Genus database with same CATH topology
 3FHZ A;  1Y1W K;  1SFO A;  3I4N C;  2A6H A;  2NVY K;  1TWA C;  3LAJ A;  3S1Q C;  5M3M K;  3K7A K;  3SZY A;  2NVQ K;  3M3Y C;  3OPF A;  3RZO C;  3HOZ K;  3H0G C;  3WAV A;  4XSX A;  3HOU C;  4TN0 A;  2B63 K;  5FJ8 K;  4A3L C;  1YCL A;  3BDF A;  1WCM K;  2YU9 A;  2XCQ A;  3BP3 A;  4OIN A;  1AJC A;  4Q5S A;  1O29 A;  1I6H C;  3LXQ A;  1O25 A;  4A3I K;  4LRE A;  4X6A C;  3N0B A;  5C66 A;  2P5M A;  1IBA A;  2JA7 C;  1IE0 A;  3ERE D;  1K7H A;  4A3I C;  4UOR A;  4CYS A;  4LR8 A;  4BLB A;  3UO0 A;  4A3E C;  1Y1V C;  3FKI C;  4O2D A;  4A3K C;  1XXB A;  4BY1 C;  1WCM A;  1I3Q A;  1TWH A;  1P49 A;  4ZGA A;  2NVX K;  1KHL A;  1O98 A;  4GTE A;  3S1N C;  5M5W K;  1KH4 A;  2GA3 A;  3BP8 C;  1XPP A;  4KJD A;  4C2M K;  4G7Z A;  2WB1 L;  4KMA A;  4KAV A;  1B8J A;  5IYD K;  4GTW A;  3NKO A;  1TWH K;  2ZFZ A;  5C3E K;  5TMF A;  3MK1 A;  5IOT A;  4KAT A;  5M5X K;  1Y1V A;  3FKI A;  3HOU K;  1I3Q C;  1TWH C;  5C3E C;  1SFO K;  4LR7 A;  2WAQ L;  5LRN A;  3S17 K;  2E2I C;  2IFY A;  2NVY A;  3S16 K;  3GTJ C;  1FSU A;  2R7Z C;  4LRC A;  2IUC B;  4LRF A;  1K83 C;  2W8D A;  1WIH A;  1EQR A;  2PA8 D;  3HOY C;  3M4O C;  4OIQ A;  2R7Z K;  3IGZ B;  1K83 K;  1DD5 A;  3A8I A;  3TFH A;  1Y1V K;  1EH1 A;  3FKI K;  4MIV A;  3UNY A;  1EI6 A;  1F9N A;  2YU9 K;  2FQT A;  5IJS A;  1VH2 A;  4A3M C;  3S14 K;  1WQF A;  3A8K A;  5EGH A;  1N2L A;  1ALK A;  4MEX A;  4MY4 A;  1I50 C;  1J6W A;  2R7Z A;  1URA A;  2VUM A;  5GRR A;  1K83 A;  2CW0 A;  1EW2 A;  4GT9 A;  1O2F B;  2NVQ C;  3S2H K;  1AJD A;  3GTQ C;  4BXX K;  1TWC A;  1SHN A;  3GTP K;  3UN3 A;  3S2H C;  4WIL A;  3SZZ A;  1AB4 A;  3M8W A;  3M4O K;  5CJ9 A;  1XXA A;  4QJV A;  4ILD A;  2PA8 L;  1O28 A;  4LK1 A;  3L4J A;  4GTA A;  3IPJ A;  3S2D K;  2G9Y A;  2W5T A;  3G4C A;  4CYR A;  3S16 C;  3I4M K;  2W5X A;  2KWA A;  2VUM C;  1B4B A;  4A3M K;  3GTL K;  1J98 A;  4KN4 A;  3HOV K;  3B5Q A;  4UOO A;  1EK8 A;  2V6S A;  1RU0 A;  3TTG A;  1TWC C;  2GAG C;  4C3I C;  3ADA C;  5IYB C;  2NVT K;  4YG2 A;  3GTG A;  5LQQ A;  4Q4Z A;  5L0B A;  1VLO A;  1SMY A;  1E3C P;  4QIW L;  1TWA K;  4KJG A;  1TWF A;  3AD8 C;  1KH7 A;  3NKM A;  3ORE A;  5FLM C;  2GSO A;  3FOF A;  1J6X A;  2NVX A;  1L0W A;  5KXA A;  3BDG A;  4LQY A;  2W5Q A;  3N3Y A;  5DLV A;  3GTQ K;  4BY7 C;  4YFK A;  4X6A K;  2ZUF A;  3S17 C;  3PO2 C;  4CXK A;  5L0E A;  3PO3 C;  4KMH A;  4G0U A;  1IL2 A;  1XXC A;  2E2J C;  4A93 C;  4GTY A;  4NOI A;  2B63 A;  4OIO A;  1E1Z P;  1O26 A;  3MK2 A;  1USO A;  3GTO K;  4LJZ A;  4P5A A;  5CHP A;  2JA8 K;  1XZQ A;  1WOS A;  2NVX C;  3JST A;  5HL8 A;  4A3B K;  2CFA B;  2D6F C;  4LR2 A;  3S1N K;  1DCH A;  4GTC A;  2JA5 C;  4NWJ A;  4KN7 A;  1TWG A;  4XLN A;  2QZU A;  1KHJ A;  5LRM A;  5FLM K;  2RH6 A;  1I6V A;  1YNJ A;  1HQM A;  4GTF A;  3CMR A;  4A3C C;  5LIA A;  3GTK A;  3V4G A;  5M5Y K;  2CFA A;  4RMF A;  1VRQ C;  1XZQ B;  1ALI A;  1KH5 A;  5HRT A;  3NKP A;  4WJ3 M;  1I6H K;  4BLA A;  4QAX A;  5DLT A;  4A3D K;  3M3Y K;  2GSU A;  1JOE A;  4KM9 A;  3H0G K;  1ALJ A;  3NVL A;  2R93 A;  4BY7 K;  5L0K A;  1TWA A;  4BBS C;  4WJ4 A;  3PO2 K;  1WOO A;  4LK0 A;  4XSZ A;  1GE9 A;  3S2D C;  3CQZ C;  5TMC A;  3L4K A;  3S1M C;  3UN5 A;  3I4M C;  3HOX C;  4BY1 K;  2JA5 K;  2PMZ L;  4MQ9 A;  2WAQ D;  4BBS K;  5IOQ A;  1N2K A;  3KD8 A;  1ZBS A;  2RGR A;  2IUC A;  5JFE A;  5C4J C;  1PJ5 A;  5M3F K;  1BS2 A;  5C44 C;  2E2H A;  4KB2 A;  4B56 A;  5DLW A;  5IOR A;  1ANI A;  5IYB K;  2NVT C;  5D4D A;  1EW8 A;  1ED8 A;  4BBR C;  5IP7 K;  2R93 C;  2ZUE A;  1O24 A;  3WAY A;  4N7T A;  2PMZ D;  1J6V A;  4A3L K;  4LRA A;  1WCM C;  3NKN A;  5IYC C;  4MEY A;  1F93 A;  3S1Q K;  3WOD A;  1WOP A;  1URB A;  3RZO K;  3A8J A;  4G0W A;  3GTJ K;  3HOX K;  2BE5 A;  1IQ0 A;  4XCH A;  4A3G C;  4GZY A;  2ZKT A;  4GTB A;  1TWF K;  5C4X C;  1I3Q K;  1SFO C;  4FM9 A;  2P8T A;  4XLP A;  3HKZ D;  2D1G A;  4A3F K;  5TJ3 A;  3NKQ A;  2JA7 K;  1HI9 A;  3CQZ K;  4YFN A;  3H3V D;  3GTP A;  1SHQ A;  4KM8 A;  3HOV C;  4JK1 A;  3GTM C;  4BKW A;  2JA8 C;  1INN A;  2R93 K;  2E2I A;  1DCP A;  2A69 A;  1BGW A;  1YX2 A;  4C2M C;  1O99 A;  3GTM K;  3GTJ A;  4GFQ A;  3G4A A;  3HOZ C;  5IYD C;  1EQJ A;  3GEH A;  3TFJ A;  4KMD A;  3GTO A;  1F7V A;  1WOR A;  3WAW A;  2JA7 A;  4ZG9 A;  4C45 A;  3HKZ L;  3I4N K;  4FDJ A;  3NUH A;  4KB4 A;  1VGX A;  4KAY A;  2Y0S L;  4P5B A;  2XCR B;  2E2I K;  4KAR A;  3GTP C;  2E2H K;  3NKR A;  5C4X K;  5IYC K;  1AJA A;  3GTM A;  3OT9 A;  1JQW A;  3QX3 A;  1HJK A;  1ZEF A;  2EBB A;  3S15 K;  3AD7 C;  1R9T C;  1ZQ1 C;  1EW9 A;  4BXX C;  2XR9 A;  4A3K K;  5EGE A;  1KHN A;  4AYB D;  5JVO A;  3OEP A;  4OIP A;  1KHK A;  3M8Z A;  3AD9 C;  4LRB A;  1USM A;  1DCO A;  4G7H A;  3GTO C;  3E2D A;  2JH3 A;  4Y52 K;  3GTQ A;  3RZD C;  3M7V A;  3S14 C;  4PAA A;  3HOY K;  4G7O A;  2O5J A;  3DYC A;  1ZEB A;  5C44 K;  1AUK A;  5INH A;  3LPX A;  1ISE A;  2JA6 C;  3A52 A;  3GTL A;  2XCO A;  4PAB A;  4AYB L;  1R9T A;  1Y6V A;  2NVY C;  1HQA A;  4C3H K;  2JA6 K;  3MK0 A;  4C3I K;  3Q3Q A;  1TWG K;  1B4A A;  2W5R A;  3N0C A;  4GTX A;  1ZXO A;  4A3D C;  4KM4 A;  3PO3 K;  4UPH A;  2V6U A;  2E2J K;  4A93 K;  3AQP A;  2WB1 D;  3S0X A;  4Y52 C;  2W5V A;  2JA6 A;  4KC6 A;  1ELX A;  3BUE A;  1TWF C;  5GOV A;  3GIR A;  2Y3P A;  3VA7 A;  1R9T K;  3GTL C;  2VQR A;  3BDG B;  5IOS A;  5IJQ A;  4CXU A;  1I50 A;  4A3F C;  1IS1 A;  2V6T A;  3MML B;  1ANJ A;  5C4J K;  2R92 K;  1X31 C;  3T00 A;  3IDD A;  3T02 A;  2PPB A;  4YR1 A;  2GLQ A;  3RZD K;  4UPI A;  3HXA A;  3WBH A;  1PJ7 A;  1V5V A;  1ELZ A;  4UOP A;  1O2A A;  4ZG6 A;  1ZED A;  2O5I A;  1Y1W C;  2W7V A;  4FZB A;  4GTZ A;  3HOW K;  2A6E A;  4AH6 A;  4LRD A;  5K4P A;  4GTL A;  4DDQ A;  1ZYR A;  1E2S P;  1KQ4 A;  1G51 A;  1ZVU A;  1I50 K;  1JVI A;  1PJ6 A;  4KAW X;  1O27 A;  1BJT A;  1YNN A;  3TWZ A;  3EQL A;  4OIR A;  1TWG C;  4KMU A;  1ALH A;  4UPL A;  3TG0 A;  2GSN A;  1XZP A;  4A3J C;  3GTK K;  3S15 C;  1EFW A;  3GTG C;  3S1M K;  2R92 C;  3M8Y A;  1Y1W A;  5IP9 K;  1WSV A;  4C3J K;  5E68 A;  3GSI A;  4A3J K;  2Y0S D;  2PHC B;  3GTK C;  1E33 P;  4ZG7 A;  3GEI A;  4CXS A;  3UN2 A;  4P9S A;  4A3E K;  3GTG K;  4G0V A;  4A3B C;  1C0A A;  1XZP B;  3TFI A;  3BDH A;  5IP9 C;  3AH5 A;  4J3N A;  3S1R C;  4KDD A;  2XRG A;  1Y7A A;  4NWX A;  4BBR K;  5IP7 C;  4Y7N C;  1TWC K;  2FQO A;  3H3V L;  4UPK A;  3CQZ A;  4KAS A;  3K7A C;  1F7U A;  2R92 A;  4LR9 A;  4C3H C;  4YFX A;  4QJV B;  3HOW C;  1BDF A;  2B63 C;  2A68 A;  4LOW A;  1AJB A;  3AQO A;  4A3C K;  2E2H C;  4FDI A;  3GEE A;  2W8S A;  4C3J C;  4A3G K;  1WQG A;  3LAP A;  3WAX A;  4LLG A;  1KH9 A;  2JA5 A;  5AJ9 A;  4MHX A;  3CAG A;  1WSR A;  2W5S A;  2GAH C;  1HDH A;  4GTD A;  3DXJ A;  3FOE A;  3S1R K;  3T01 A;  1ED9 A;  3TX0 A;  1WQH A;  3H0G A;  3ED4 A;  1IW7 A;  1O2B A;  4M1X A;  2ANH A;  2VUM K;  4QIW D;  4Y7N K;  2W5W A;  3IGY B;  1UV7 A;  2X98 A;  2YU9 C;  3DPC A;  3GDZ A;  1VJE A;  4ZH4 A;  5L46 A;  1ELY A;  1EJJ A; 
#chains in the Genus database with same CATH homology
 3FHZ A;  1SFO A;  3LAJ A;  3SZY A;  3OPF A;  3WAV A;  4TN0 A;  3BDF A;  2YU9 A;  2XCQ A;  1AJC A;  4LRE A;  1O29 A;  3LXQ A;  1O25 A;  3N0B A;  5C66 A;  2P5M A;  3ERE D;  1K7H A;  4UOR A;  4CYS A;  4LR8 A;  4BLB A;  3UO0 A;  1XXB A;  1WCM A;  1I3Q A;  1TWH A;  1P49 A;  4ZGA A;  1KHL A;  1O98 A;  4GTE A;  1KH4 A;  2GA3 A;  4KJD A;  4KMA A;  4KAV A;  1B8J A;  4GTW A;  3NKO A;  2ZFZ A;  3MK1 A;  5IOT A;  4KAT A;  1Y1V A;  3FKI A;  4LR7 A;  5LRN A;  2IFY A;  2NVY A;  1FSU A;  4LRC A;  2IUC B;  4LRF A;  2W8D A;  1WIH A;  3IGZ B;  1DD5 A;  4MIV A;  1EH1 A;  3UNY A;  1EI6 A;  1F9N A;  5IJS A;  1WQF A;  5EGH A;  1N2L A;  1ALK A;  4MY4 A;  2R7Z A;  1URA A;  2VUM A;  5GRR A;  1K83 A;  1EW2 A;  4GT9 A;  1AJD A;  1TWC A;  1SHN A;  3UN3 A;  3SZZ A;  1AB4 A;  3M8W A;  5CJ9 A;  1XXA A;  4ILD A;  1O28 A;  3L4J A;  4GTA A;  4CYR A;  2G9Y A;  2W5T A;  3G4C A;  2W5X A;  2KWA A;  1B4B A;  3B5Q A;  4UOO A;  1EK8 A;  4C3I C;  3GTG A;  5LQQ A;  5L0B A;  1E3C P;  4KJG A;  1TWF A;  1KH7 A;  3NKM A;  3ORE A;  2GSO A;  3FOF A;  2NVX A;  5KXA A;  3BDG A;  4LQY A;  2W5Q A;  3N3Y A;  5DLV A;  4CXK A;  5L0E A;  4KMH A;  4G0U A;  1XXC A;  4GTY A;  2B63 A;  1E1Z P;  3MK2 A;  1O26 A;  4P5A A;  5CHP A;  2CFA B;  4LR2 A;  4GTC A;  4NWJ A;  1TWG A;  2QZU A;  1KHJ A;  5LRM A;  2RH6 A;  4GTF A;  3CMR A;  5LIA A;  3GTK A;  3V4G A;  2CFA A;  1KH5 A;  1ALI A;  5HRT A;  3NKP A;  4BLA A;  4QAX A;  5DLT A;  2GSU A;  4KM9 A;  1ALJ A;  3NVL A;  2R93 A;  5L0K A;  1TWA A;  1GE9 A;  3L4K A;  3UN5 A;  1N2K A;  5IOQ A;  3KD8 A;  1ZBS A;  2RGR A;  2IUC A;  5JFE A;  2E2H A;  4KB2 A;  4B56 A;  5DLW A;  5IOR A;  1ANI A;  1EW8 A;  1ED8 A;  3WAY A;  4N7T A;  4LRA A;  3NKN A;  1URB A;  4G0W A;  2ZKT A;  4GTB A;  4FM9 A;  2D1G A;  5TJ3 A;  3NKQ A;  3GTP A;  1SHQ A;  4KM8 A;  4BKW A;  2E2I A;  1BGW A;  4C2M C;  1O99 A;  3GTJ A;  4GFQ A;  3G4A A;  1EQJ A;  4KMD A;  3GTO A;  4ZG9 A;  3WAW A;  2JA7 A;  4FDJ A;  3NUH A;  4KB4 A;  4KAY A;  4P5B A;  2XCR B;  4KAR A;  3NKR A;  1AJA A;  3GTM A;  3OT9 A;  3QX3 A;  1HJK A;  1ZEF A;  1EW9 A;  2XR9 A;  5EGE A;  1KHN A;  5JVO A;  3OEP A;  1KHK A;  3M8Z A;  4LRB A;  3E2D A;  2JH3 A;  3GTQ A;  3M7V A;  3DYC A;  1ZEB A;  1AUK A;  5INH A;  3LPX A;  1ISE A;  3A52 A;  3GTL A;  2XCO A;  1Y6V A;  1R9T A;  1HQA A;  3MK0 A;  3Q3Q A;  1B4A A;  2W5R A;  3N0C A;  4GTX A;  1ZXO A;  4KM4 A;  4UPH A;  3AQP A;  3S0X A;  2W5V A;  2JA6 A;  4KC6 A;  1ELX A;  3BUE A;  5GOV A;  3VA7 A;  2Y3P A;  3BDG B;  4CXU A;  2VQR A;  5IOS A;  5IJQ A;  1I50 A;  1IS1 A;  3MML B;  1ANJ A;  3T00 A;  3IDD A;  3T02 A;  4YR1 A;  2GLQ A;  4UPI A;  3WBH A;  1ELZ A;  4UOP A;  1O2A A;  4ZG6 A;  1ZED A;  4FZB A;  4GTZ A;  4LRD A;  5K4P A;  4GTL A;  4DDQ A;  1E2S P;  1KQ4 A;  1ZVU A;  4KAW X;  1O27 A;  1BJT A;  3TWZ A;  1ALH A;  4UPL A;  3TG0 A;  2GSN A;  3M8Y A;  1Y1W A;  1E33 P;  2PHC B;  4ZG7 A;  4CXS A;  3UN2 A;  4G0V A;  3BDH A;  3AH5 A;  4J3N A;  4KDD A;  2XRG A;  1Y7A A;  4NWX A;  4UPK A;  3CQZ A;  4KAS A;  2R92 A;  4LR9 A;  4C3H C;  1AJB A;  3AQO A;  4FDI A;  2W8S A;  4C3J C;  1WQG A;  3LAP A;  3WAX A;  1KH9 A;  2JA5 A;  5AJ9 A;  4MHX A;  3CAG A;  2W5S A;  1HDH A;  4GTD A;  3FOE A;  1ED9 A;  3T01 A;  3TX0 A;  1WQH A;  3H0G A;  3ED4 A;  1O2B A;  4M1X A;  2ANH A;  2W5W A;  3IGY B;  2X98 A;  3DPC A;  1O24 A;  1ELY A;  1EJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...