4LQYA

Crystal structure of human enpp4 with amp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
total genus 127
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lqyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lqyA01
3T02A 3M8WA 4CYRA 4UOPA 5LQQA 4KAVA 3B5QA 4CXSA 1KH7A 2IFYA 3OT9A 5L0BA 4UPLA 3IDDA 3Q3QA 4QAXA 1EW8A 1E1ZP 3BDGA 3NKPA 4KM4A 1P49A 5IJQA 1ALHA 4MY4A 3NKMA 4UORA 4LR8A 1ZEDA 1EW2A 1SHQA 4LRFA 2W5RA 3M8ZA 3NVLA 3T01A 1KHLA 4ZGAA 3KD8A 1ZEFA 4LRBA 3UN5A 4LRAA 2GLQA 1N2LA 4YR1A 2GA3A 2G9YA 2QZUA 2IUCB 1AJAA 1AJBA 1ZEBA 1HDHA 3CMRA 3IGZB 1B8JA 4B56A 4UOOA 1ANJA 5DLTA 3WBHA 3ED4A 2GSUA 2W5XA 1E3CP 2XR9A 3UO0A 3BDGB 4UPHA 5C66A 4ZG6A 1ELZA 3A52A 2IUCA 3UNYA 4LREA 5TJ3A 2GSOA 4GTWA 4LRDA 1KHJA 3M7VA 5INHA 5DLVA 5GRRA 1ELXA 4N7TA 2X98A 3NKRA 3UN3A 4CXKA 1ALJA 4GTXA 4KJDA 5LIAA 2ANHA 3BDFA 3MK0A 3WAVA 3WAWA 1ALIA 4UPIA 4GTYA 2W5WA 1AUKA 3NKOA 2GSNA 1ELYA 3UN2A 3M8YA 1KHNA 5EGEA 1O98A 5L0KA 2D1GA 4NWXA 4GTZA 5IJSA 4LR9A 1SHNA 1AJDA 1N2KA 4ZG7A 5EGHA 3MK1A 2W8DA 5DLWA 1HQAA 3TWZA 4FDJA 3TG0A 4LQYA 1EI6A 1KH9A 1EW9A 1URAA 4FDIA 3DPCA 4LRCA 3WAYA 3E2DA 1EJJA 1KH4A 1E33P 4MIVA 1Y7AA 3WAXA 1URBA 1E2SP 3NKNA 5HRTA 1ANIA 2XRGA 5L0EA 1KHKA 5GOVA 4KAYA 2VQRA 3LXQA 3SZZA 1O99A 1FSUA 4KJGA 4LR2A 2ZKTA 1Y6VA 3NKQA 3DYCA 5K4PA 1HJKA 3MK2A 4MHXA 4UPKA 2W5QA 1AJCA 5KXAA 2W8SA 2RH6A 1ED9A 5LRNA 4LR7A 3T00A 5LRMA 2W5VA 1KH5A 4CYSA 4TN0A 3IGYB 2W5SA 4NWJA 1ALKA 2W5TA 1ED8A 3SZYA 5AJ9A 3TX0A 1EQJA 4CXUA 4ZG9A 1K7HA 3BDHA
chains in the Genus database with same CATH superfamily
4GTLA 3HOXK 3M8WA 2NVXA 1Y1WA 3HOYK 3HOUK 1TWGK 4XSXA 1X31C 4A3JK 1SFOC 2VUMA 1AB4A 1YX2A 4GTFA 3GTOA 3NKPA 2NVXK 1WOOA 1I50K 3RZOC 3N3YA 3RZDK 2W5RA 1O2FB 3FKIC 4ZGAA 1XPPA 3TFHA 2O5JA 2B63C 3BUEA 3FKIK 3S2HK 3H0GA 2D6FC 1N2LA 4YR1A 1WOPA 1UV7A 1AJAA 1AJBA 4B56A 1WSRA 3CMRA 1B8JA 5C4JK 3GTGA 3OEPA 5DLTA 2W5XA 2BE5A 3FKIA 2R7ZA 4LLGA 2P8TA 5M3MK 5IYCC 5C4JC 2PA8D 1GE9A 2IUCA 4A3DK 2GSOA 2KWAA 1I6VA 3GTGK 1R9TA 5INHA 5GRRA 3V4GA 4N7TA 2JA8K 4KJDA 1PJ6A 2JA7C 3HXAA 3BDFA 1INNA 1EH1A 1PJ7A 1SFOA 2VUMC 3NKOA 5IP9C 3NUHA 1IBAA 1USMA 2JA6K 2PPBA 3S1RK 2NVQC 2R93A 2D1GA 1DCHA 4YG2A 1VJEA 3AH5A 2VUMK 4GTZA 5IP9K 1WQFA 3S1QK 4A3LC 4ZG7A 1N2KA 4YFXA 5EGHA 4BY1K 2W8DA 4KASA 3FOEA 1V5VA 3I4MC 3TWZA 4FDJA 3S15K 3TG0A 2R92K 4BBRK 4A3LK 4FDIA 4XCHA 4A3EC 3CQZC 1KH4A 4MIVA 3S2DC 3GTMC 3WAXA 4C2MK 5C44K 5HRTA 1ANIA 3GTKA 2R92A 4A93C 1TWFA 4A3BK 3S14C 3SZZA 2R7ZC 1O99A 1Y6VA 3WODA 3HKZD 5K4PA 1HJKA 3G4CA 4G0UA 4BXXK 1SMYA 2WB1L 2W5QA 2W8SA 5LRNA 1F9NA 3T00A 4BKWA 2W5VA 3LAPA 4KB2A 1Y1VA 3HOXC 4TN0A 3MMLB 3H3VD 4P5AA 2W5SA 3IPJA 1O29A 1L0WA 3A8KA 4GTDA 3PO3K 3SZYA 2E2HK 4KARA 2PHCB 2V6SA 1TWGC 4UOPA 4GTBA 4KAVA 4Q4ZA 5IOSA 2E2HC 1KH7A 1ZBSA 2IFYA 5L0BA 1EK8A 4KB4A 3GTPA 3Q3QA 4G7HA 4A3MK 2YU9C 3BDGA 4OIQA 3CQZA 5CJ9A 2NVQK 1XZQB 1XZPA 4A3MC 2YU9K 4KM4A 4MY4A 1O2BA 1R9TK 1Y1WK 3DXJA 4LR8A 2WAQD 4J3NA 1F93A 3HOWC 1TWAA 3NVLA 2GAGC 3T01A 3S1NC 1J6XA 4G0WA 4MEYA 3GTPK 5CHPA 4LRAA 1USOA 3TFIA 2ZUFA 1G51A 4O2DA 1ZYRA 2IUCB 4UOOA 3IGZB 3I4NK 3GTPC 1EFWA 3PO2K 4A3FC 4A3DC 2XR9A 2PMZL 4C3HC 3M3YC 4XSZA 1ELZA 2E2IK 2Y0SL 4BY7C 4KMDA 3UNYA 1KQ4A 2JA7K 4GTWA 1XXAA 3S17K 1PJ5A 4ZH4A 5IP7C 5JFEA 4KN7A 5IYBC 5LIAA 4BLBA 4X6AC 4P5BA 1O28A 4QJVA 5HL8A 2NVTC 3ADAC 3UN2A 5L46A 3M8YA 4P9SA 4KDDA 2NVTK 1J6WA 4WILA 4A3JC 4BY1C 1SHNA 4WJ4A 4KM8A 4QIWD 3K7AK 1RU0A 3I4MK 3AQPA 1ZXOA 1TWHC 5IYDK 3ERED 1O26A 1TWHK 5D4DA 5IYDC 1EI6A 4C2MC 4LRCA 3K7AC 3HOZK 3WAYA 3AD7C 3E2DA 1E33P 5C44C 1I50C 4KC6A 3RZOK 1Y1WC 1Y7AA 4AH6A 1ZQ1C 1O27A 1URBA 1E2SP 4LJZA 1TWHA 3HOWK 1WORA 5L0EA 2VQRA 1JVIA 3GTOK 4MQ9A 1K83K 4A3KK 3S2HC 1TWFC 1J98A 4WJ3M 4JK1A 1VRQC 3GTJC 5IYCK 4GFQA 1TWFK 3HOVK 4UPKA 1AJCA 2ZFZA 5M5WK 3S1MC 4BLAA 4KMAA 4QIWL 3S16K 4AYBL 1BDFA 4NWJA 4C3IK 4OIPA 1ED8A 4ZG9A 5AJ9A 1EQJA 4CXUA 2PA8L 1WCMK 1IW7A 3A8JA 1XXBA 2A6HA 4C3JK 4C45A 5IP7K 2JA8C 2A6EA 1YNNA 5LQQA 3GEIA 3OPFA 4CXSA 4C3JC 1IE0A 4BBSK 3OT9A 4UPLA 2EBBA 4QAXA 1TWGA 1EW8A 1E1ZP 4QJVB 1ALHA 5M3FK 2GAHC 4XLNA 1BGWA 3NKMA 1ZVUA 3M4OC 1HQMA 1EW2A 5C4XC 4LRFA 1JQWA 3S0XA 1KHLA 5IOTA 3KD8A 1ZEFA 4LRBA 3I4NC 4OINA 1F7VA 1IS1A 3UN5A 2A68A 1I6HC 4DDQA 4A3EK 2GA3A 1Y1VK 2G9YA 2QZUA 1I6HK 1ZEBA 5E68A 1ANJA 3WBHA 3S2DK 2GSUA 2PMZD 2FQTA 5C66A 1I3QA 2E2IC 4ZG6A 4GTCA 2CFAA 4GTEA 5IOQA 5FLMC 4A93K 4BY7K 3AQOA 3GTQK 3A52A 5TJ3A 4LREA 4LRDA 1XXCA 4KAWX 5IYBK 3GTKK 3EQLA 1DCOA 1YCLA 2E2HA 3HOVC 3NKRA 2WAQL 4GTXA 3GTKC 3GTQA 2ANHA 4CXKA 2E2JC 3WAVA 3QX3A 3G4AA 3PO3C 1ALIA 2R93K 4KN4A 2W5WA 1AUKA 1F7UA 4ILDA 4LK1A 2P5MA 1ELYA 3OREA 3L4KA 3GTLC 4OIRA 1KHNA 5EGEA 1O98A 5TMFA 1SFOK 4A3IC 2R93C 4LR9A 3L4JA 3MK1A 2Y0SD 4PAAA 3RZDC 1IL2A 3AD8C 4LQYA 3GTLA 1KH9A 3S1NK 1URAA 1WQGA 1XZPB 1XZQA 4Q5SA 1WCMA 4G7OA 1EJJA 3GTOC 1R9TC 2B63K 2V6UA 4Y7NC 2O5IA 2NVYK 3NKNA 3GEEA 4Y7NK 4Y52C 3HKZL 1KHKA 5GOVA 4A3FK 3LXQA 3LAJA 2E2IA 4GZYA 1WQHA 3NKQA 1K83A 4A3GC 2JA6A 3TTGA 3FOFA 5KXAA 4C3HK 2RH6A 2FQOA 5FLMK 2JA5C 3GTGC 2CW0A 3S17C 3GTQC 4AYBD 1KH5A 4CYSA 1BS2A 3N0CA 1J6VA 5M5XK 3TX0A 1IQ0A 3A8IA 1O2AA 3T02A 3BDHA 5IJSA 4CYRA 4LOWA 4FZBA 3GDZA 2E2JK 2JA5A 5FJ8K 3B5QA 3HOUC 5IORA 4G7ZA 3BP3A 3S1RC 3S1QC 3IDDA 3GSIA 3GTLK 1TWAK 3AD9C 4A3IK 1P49A 3M4OK 2XCRB 3FHZA 3H0GC 5IJQA 1WSVA 3GTMK 4UORA 1WOSA 1ZEDA 1B4AA 3H0GK 2B63A 1SHQA 3HOZC 1DCPA 3CQZK 3S15C 3M8ZA 2NVYA 1TWAC 4BBRC 3CAGA 2RGRA 2XCOA 1VLOA 4KMHA 2JH3A 2GLQA 4A3BC 3GTJA 3S14K 1K83C 4A3KC 1TWCA 1HDHA 3ED4A 1VGXA 1E3CP 3UO0A 2NVYC 3BDGB 1ISEA 4UPHA 3N0BA 2W7VA 3S1MK 4A3CC 3GTJK 2YU9A 4KATA 4BXXC 2ZUEA 1TWCK 1KHJA 1I50A 3UN3A 1JOEA 3M7VA 4YFNA 5DLVA 1I3QC 1ELXA 2X98A 2XCQA 4A3CK 1I3QK 1O25A 3HOYC 3MK0A 1TWCC 4GT9A 4GTAA 2JA5K 3WAWA 4UPIA 4GTYA 3S16C 1WCMC 1HI9A 2GSNA 4C3IC 1YNJA 1B4BA 2NVXC 5L0KA 4NWXA 4BBSC 1DD5A 2WB1D 1AJDA 5C3EK 3TFJA 3LPXA 4YFKA 5TMCA 5C3EC 5DLWA 3GTMA 2Y3PA 4M1XA 1HQAA 1ALJA 2V6TA 1VH2A 1EW9A 2JA7A 3DPCA 3GEHA 4OIOA 4G0VA 5JVOA 4Y52K 5C4XK 4XLPA 4KM9A 4RMFA 1C0AA 3PO2C 2R92C 4FM9A 3M3YK 2XRGA 4KAYA 4A3GK 2CFAB 4MEXA 2A69A 4PABA 1FSUA 4KJGA 1Y1VC 4LR2A 3JSTA 2R7ZK 2ZKTA 5M5YK 3DYCA 1O24A 3MK2A 4MHXA 3GIRA 4KMUA 1BJTA 1ED9A 1WIHA 1EQRA 4NOIA 4LR7A 5LRMA 3H3VL 3IGYB 4LK0A 1ALKA 2W5TA 3BP8C 2JA6C 3VA7A 1K7HA 4X6AK
chains in the Genus database with same CATH topology
4GTLA 3M8WA 2NVXA 1Y1WA 2VUMA 1AB4A 4GTFA 3GTOA 3NKPA 3N3YA 2W5RA 4ZGAA 3BUEA 3H0GA 1N2LA 4YR1A 1AJAA 1AJBA 4B56A 3CMRA 1B8JA 3GTGA 3OEPA 5DLTA 2W5XA 3FKIA 2R7ZA 1GE9A 2IUCA 2GSOA 2KWAA 1R9TA 5INHA 5GRRA 3V4GA 4N7TA 4KJDA 3BDFA 1EH1A 1SFOA 3NKOA 3NUHA 2R93A 2D1GA 3AH5A 4GTZA 1WQFA 4ZG7A 1N2KA 5EGHA 2W8DA 4KASA 3FOEA 3TWZA 4FDJA 3TG0A 4FDIA 1KH4A 4MIVA 3WAXA 5HRTA 1ANIA 3GTKA 2R92A 1TWFA 3SZZA 1O99A 1Y6VA 5K4PA 1HJKA 3G4CA 4G0UA 2W5QA 2W8SA 5LRNA 1F9NA 4BKWA 3T00A 2W5VA 3LAPA 4KB2A 1Y1VA 4TN0A 3MMLB 4P5AA 2W5SA 1O29A 4GTDA 3SZYA 4KARA 2PHCB 4UOPA 4GTBA 4KAVA 5IOSA 1KH7A 1ZBSA 2IFYA 5L0BA 1EK8A 4KB4A 3GTPA 3Q3QA 3BDGA 3CQZA 5CJ9A 4KM4A 4MY4A 1O2BA 4LR8A 4J3NA 1TWAA 3NVLA 3T01A 4G0WA 5CHPA 4LRAA 2IUCB 4UOOA 3IGZB 2XR9A 4C3HC 1ELZA 4KMDA 3UNYA 1KQ4A 4GTWA 1XXAA 5JFEA 5LIAA 4BLBA 4P5BA 1O28A 3UN2A 3M8YA 4KDDA 1SHNA 4KM8A 3AQPA 1ZXOA 3ERED 1O26A 1EI6A 4C2MC 4LRCA 3WAYA 3E2DA 1E33P 4KC6A 1Y7AA 1O27A 1URBA 1E2SP 1TWHA 5L0EA 2VQRA 4GFQA 4UPKA 1AJCA 2ZFZA 4BLAA 4KMAA 4NWJA 1ED8A 4ZG9A 5AJ9A 1EQJA 4CXUA 1XXBA 5LQQA 3OPFA 4CXSA 4C3JC 3OT9A 4UPLA 4QAXA 1TWGA 1EW8A 1E1ZP 1ALHA 3NKMA 1BGWA 1ZVUA 1EW2A 4LRFA 3S0XA 1KHLA 5IOTA 3KD8A 1ZEFA 4LRBA 1IS1A 3UN5A 4DDQA 2GA3A 2G9YA 2QZUA 1ZEBA 1ANJA 3WBHA 2GSUA 5C66A 1I3QA 4ZG6A 4GTCA 2CFAA 4GTEA 5IOQA 3AQOA 3A52A 5TJ3A 4LREA 4LRDA 1XXCA 4KAWX 3NKRA 3UN3A 2E2HA 4CXKA 1ALJA 4GTXA 3GTQA 2ANHA 3WAVA 3QX3A 3G4AA 1ALIA 2W5WA 1AUKA 4ILDA 2P5MA 1ELYA 3OREA 3L4KA 1KHNA 5EGEA 1O98A 4LR9A 3L4JA 3MK1A 4LQYA 3GTLA 1KH9A 1URAA 1WQGA 1WCMA 1EJJA 3NKNA 1KHKA 5GOVA 3LXQA 3LAJA 2E2IA 1WQHA 3NKQA 1K83A 2JA6A 3FOFA 5KXAA 2RH6A 1KH5A 4CYSA 3N0CA 3TX0A 3BDHA 3T02A 1O2AA 5IJSA 4CYRA 4FZBA 2JA5A 3B5QA 5IORA 3IDDA 1P49A 5IJQA 2XCRB 3FHZA 4UORA 1ZEDA 1B4AA 1SHQA 2B63A 3M8ZA 2NVYA 3CAGA 2RGRA 2XCOA 4KMHA 2JH3A 2GLQA 3GTJA 1TWCA 1HDHA 3ED4A 1E3CP 3UO0A 3BDGB 4UPHA 1ISEA 3N0BA 2YU9A 4KATA 1KHJA 1I50A 3M7VA 5DLVA 1ELXA 2X98A 2XCQA 1O25A 3MK0A 4GT9A 4GTAA 3WAWA 4UPIA 4GTYA 2GSNA 4C3IC 1B4BA 5L0KA 4NWXA 1DD5A 1AJDA 3LPXA 5DLWA 3GTMA 2Y3PA 4M1XA 1HQAA 1EW9A 2JA7A 3DPCA 4G0VA 5JVOA 4KM9A 4FM9A 2XRGA 4KAYA 2CFAB 1FSUA 4KJGA 4LR2A 2ZKTA 3DYCA 1O24A 3MK2A 4MHXA 1BJTA 1ED9A 1WIHA 4LR7A 5LRMA 3IGYB 1ALKA 2W5TA 3VA7A 1K7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T02 A;  3M8W A;  4CYR A;  4UOP A;  5LQQ A;  4KAV A;  3B5Q A;  4CXS A;  1KH7 A;  2IFY A;  3OT9 A;  5L0B A;  4UPL A;  3IDD A;  3Q3Q A;  4QAX A;  1EW8 A;  1E1Z P;  3BDG A;  3NKP A;  4KM4 A;  1P49 A;  5IJQ A;  1ALH A;  4MY4 A;  3NKM A;  4UOR A;  4LR8 A;  1ZED A;  1EW2 A;  1SHQ A;  4LRF A;  2W5R A;  3M8Z A;  3NVL A;  3T01 A;  1KHL A;  4ZGA A;  3KD8 A;  1ZEF A;  4LRB A;  3UN5 A;  4LRA A;  2GLQ A;  1N2L A;  4YR1 A;  2GA3 A;  2G9Y A;  2QZU A;  2IUC B;  1AJA A;  1AJB A;  1ZEB A;  1HDH A;  3CMR A;  3IGZ B;  1B8J A;  4B56 A;  4UOO A;  1ANJ A;  5DLT A;  3WBH A;  3ED4 A;  2GSU A;  2W5X A;  1E3C P;  2XR9 A;  3UO0 A;  3BDG B;  4UPH A;  5C66 A;  4ZG6 A;  1ELZ A;  3A52 A;  2IUC A;  3UNY A;  4LRE A;  5TJ3 A;  2GSO A;  4GTW A;  4LRD A;  1KHJ A;  3M7V A;  5INH A;  5DLV A;  5GRR A;  1ELX A;  4N7T A;  2X98 A;  3NKR A;  3UN3 A;  4CXK A;  1ALJ A;  4GTX A;  4KJD A;  5LIA A;  2ANH A;  3BDF A;  3MK0 A;  3WAV A;  3WAW A;  1ALI A;  4UPI A;  4GTY A;  2W5W A;  1AUK A;  3NKO A;  2GSN A;  1ELY A;  3UN2 A;  3M8Y A;  1KHN A;  5EGE A;  1O98 A;  5L0K A;  2D1G A;  4NWX A;  4GTZ A;  5IJS A;  4LR9 A;  1SHN A;  1AJD A;  1N2K A;  4ZG7 A;  5EGH A;  3MK1 A;  2W8D A;  5DLW A;  1HQA A;  3TWZ A;  4FDJ A;  3TG0 A;  4LQY A;  1EI6 A;  1KH9 A;  1EW9 A;  1URA A;  4FDI A;  3DPC A;  4LRC A;  3WAY A;  3E2D A;  1EJJ A;  1KH4 A;  1E33 P;  4MIV A;  1Y7A A;  3WAX A;  1URB A;  1E2S P;  3NKN A;  5HRT A;  1ANI A;  2XRG A;  5L0E A;  1KHK A;  5GOV A;  4KAY A;  2VQR A;  3LXQ A;  3SZZ A;  1O99 A;  1FSU A;  4KJG A;  4LR2 A;  2ZKT A;  1Y6V A;  3NKQ A;  3DYC A;  5K4P A;  1HJK A;  3MK2 A;  4MHX A;  4UPK A;  2W5Q A;  1AJC A;  5KXA A;  2W8S A;  2RH6 A;  1ED9 A;  5LRN A;  4LR7 A;  3T00 A;  5LRM A;  2W5V A;  1KH5 A;  4CYS A;  4TN0 A;  3IGY B;  2W5S A;  4NWJ A;  1ALK A;  2W5T A;  1ED8 A;  3SZY A;  5AJ9 A;  3TX0 A;  1EQJ A;  4CXU A;  4ZG9 A;  1K7H A;  3BDH A; 
#chains in the Genus database with same CATH topology
 4GTL A;  3HOX K;  3M8W A;  2NVX A;  1Y1W A;  3HOY K;  3HOU K;  1TWG K;  4XSX A;  1X31 C;  4A3J K;  1SFO C;  2VUM A;  1AB4 A;  1YX2 A;  4GTF A;  3GTO A;  3NKP A;  2NVX K;  1WOO A;  1I50 K;  3RZO C;  3N3Y A;  3RZD K;  2W5R A;  1O2F B;  3FKI C;  4ZGA A;  1XPP A;  3TFH A;  2O5J A;  2B63 C;  3BUE A;  3FKI K;  3S2H K;  3H0G A;  2D6F C;  1N2L A;  4YR1 A;  1WOP A;  1UV7 A;  1AJA A;  1AJB A;  4B56 A;  1WSR A;  3CMR A;  1B8J A;  5C4J K;  3GTG A;  3OEP A;  5DLT A;  2W5X A;  2BE5 A;  3FKI A;  2R7Z A;  4LLG A;  2P8T A;  5M3M K;  5IYC C;  5C4J C;  2PA8 D;  1GE9 A;  2IUC A;  4A3D K;  2GSO A;  2KWA A;  1I6V A;  3GTG K;  1R9T A;  5INH A;  5GRR A;  3V4G A;  4N7T A;  2JA8 K;  4KJD A;  1PJ6 A;  2JA7 C;  3HXA A;  3BDF A;  1INN A;  1EH1 A;  1PJ7 A;  1SFO A;  2VUM C;  3NKO A;  5IP9 C;  3NUH A;  1IBA A;  1USM A;  2JA6 K;  2PPB A;  3S1R K;  2NVQ C;  2R93 A;  2D1G A;  1DCH A;  4YG2 A;  1VJE A;  3AH5 A;  2VUM K;  4GTZ A;  5IP9 K;  1WQF A;  3S1Q K;  4A3L C;  4ZG7 A;  1N2K A;  4YFX A;  5EGH A;  4BY1 K;  2W8D A;  4KAS A;  3FOE A;  1V5V A;  3I4M C;  3TWZ A;  4FDJ A;  3S15 K;  3TG0 A;  2R92 K;  4BBR K;  4A3L K;  4FDI A;  4XCH A;  4A3E C;  3CQZ C;  1KH4 A;  4MIV A;  3S2D C;  3GTM C;  3WAX A;  4C2M K;  5C44 K;  5HRT A;  1ANI A;  3GTK A;  2R92 A;  4A93 C;  1TWF A;  4A3B K;  3S14 C;  3SZZ A;  2R7Z C;  1O99 A;  1Y6V A;  3WOD A;  3HKZ D;  5K4P A;  1HJK A;  3G4C A;  4G0U A;  4BXX K;  1SMY A;  2WB1 L;  2W5Q A;  2W8S A;  5LRN A;  1F9N A;  3T00 A;  4BKW A;  2W5V A;  3LAP A;  4KB2 A;  1Y1V A;  3HOX C;  4TN0 A;  3MML B;  3H3V D;  4P5A A;  2W5S A;  3IPJ A;  1O29 A;  1L0W A;  3A8K A;  4GTD A;  3PO3 K;  3SZY A;  2E2H K;  4KAR A;  2PHC B;  2V6S A;  1TWG C;  4UOP A;  4GTB A;  4KAV A;  4Q4Z A;  5IOS A;  2E2H C;  1KH7 A;  1ZBS A;  2IFY A;  5L0B A;  1EK8 A;  4KB4 A;  3GTP A;  3Q3Q A;  4G7H A;  4A3M K;  2YU9 C;  3BDG A;  4OIQ A;  3CQZ A;  5CJ9 A;  2NVQ K;  1XZQ B;  1XZP A;  4A3M C;  2YU9 K;  4KM4 A;  4MY4 A;  1O2B A;  1R9T K;  1Y1W K;  3DXJ A;  4LR8 A;  2WAQ D;  4J3N A;  1F93 A;  3HOW C;  1TWA A;  3NVL A;  2GAG C;  3T01 A;  3S1N C;  1J6X A;  4G0W A;  4MEY A;  3GTP K;  5CHP A;  4LRA A;  1USO A;  3TFI A;  2ZUF A;  1G51 A;  4O2D A;  1ZYR A;  2IUC B;  4UOO A;  3IGZ B;  3I4N K;  3GTP C;  1EFW A;  3PO2 K;  4A3F C;  4A3D C;  2XR9 A;  2PMZ L;  4C3H C;  3M3Y C;  4XSZ A;  1ELZ A;  2E2I K;  2Y0S L;  4BY7 C;  4KMD A;  3UNY A;  1KQ4 A;  2JA7 K;  4GTW A;  1XXA A;  3S17 K;  1PJ5 A;  4ZH4 A;  5IP7 C;  5JFE A;  4KN7 A;  5IYB C;  5LIA A;  4BLB A;  4X6A C;  4P5B A;  1O28 A;  4QJV A;  5HL8 A;  2NVT C;  3ADA C;  3UN2 A;  5L46 A;  3M8Y A;  4P9S A;  4KDD A;  2NVT K;  1J6W A;  4WIL A;  4A3J C;  4BY1 C;  1SHN A;  4WJ4 A;  4KM8 A;  4QIW D;  3K7A K;  1RU0 A;  3I4M K;  3AQP A;  1ZXO A;  1TWH C;  5IYD K;  3ERE D;  1O26 A;  1TWH K;  5D4D A;  5IYD C;  1EI6 A;  4C2M C;  4LRC A;  3K7A C;  3HOZ K;  3WAY A;  3AD7 C;  3E2D A;  1E33 P;  5C44 C;  1I50 C;  4KC6 A;  3RZO K;  1Y1W C;  1Y7A A;  4AH6 A;  1ZQ1 C;  1O27 A;  1URB A;  1E2S P;  4LJZ A;  1TWH A;  3HOW K;  1WOR A;  5L0E A;  2VQR A;  1JVI A;  3GTO K;  4MQ9 A;  1K83 K;  4A3K K;  3S2H C;  1TWF C;  1J98 A;  4WJ3 M;  4JK1 A;  1VRQ C;  3GTJ C;  5IYC K;  4GFQ A;  1TWF K;  3HOV K;  4UPK A;  1AJC A;  2ZFZ A;  5M5W K;  3S1M C;  4BLA A;  4KMA A;  4QIW L;  3S16 K;  4AYB L;  1BDF A;  4NWJ A;  4C3I K;  4OIP A;  1ED8 A;  4ZG9 A;  5AJ9 A;  1EQJ A;  4CXU A;  2PA8 L;  1WCM K;  1IW7 A;  3A8J A;  1XXB A;  2A6H A;  4C3J K;  4C45 A;  5IP7 K;  2JA8 C;  2A6E A;  1YNN A;  5LQQ A;  3GEI A;  3OPF A;  4CXS A;  4C3J C;  1IE0 A;  4BBS K;  3OT9 A;  4UPL A;  2EBB A;  4QAX A;  1TWG A;  1EW8 A;  1E1Z P;  4QJV B;  1ALH A;  5M3F K;  2GAH C;  4XLN A;  1BGW A;  3NKM A;  1ZVU A;  3M4O C;  1HQM A;  1EW2 A;  5C4X C;  4LRF A;  1JQW A;  3S0X A;  1KHL A;  5IOT A;  3KD8 A;  1ZEF A;  4LRB A;  3I4N C;  4OIN A;  1F7V A;  1IS1 A;  3UN5 A;  2A68 A;  1I6H C;  4DDQ A;  4A3E K;  2GA3 A;  1Y1V K;  2G9Y A;  2QZU A;  1I6H K;  1ZEB A;  5E68 A;  1ANJ A;  3WBH A;  3S2D K;  2GSU A;  2PMZ D;  2FQT A;  5C66 A;  1I3Q A;  2E2I C;  4ZG6 A;  4GTC A;  2CFA A;  4GTE A;  5IOQ A;  5FLM C;  4A93 K;  4BY7 K;  3AQO A;  3GTQ K;  3A52 A;  5TJ3 A;  4LRE A;  4LRD A;  1XXC A;  4KAW X;  5IYB K;  3GTK K;  3EQL A;  1DCO A;  1YCL A;  2E2H A;  3HOV C;  3NKR A;  2WAQ L;  4GTX A;  3GTK C;  3GTQ A;  2ANH A;  4CXK A;  2E2J C;  3WAV A;  3QX3 A;  3G4A A;  3PO3 C;  1ALI A;  2R93 K;  4KN4 A;  2W5W A;  1AUK A;  1F7U A;  4ILD A;  4LK1 A;  2P5M A;  1ELY A;  3ORE A;  3L4K A;  3GTL C;  4OIR A;  1KHN A;  5EGE A;  1O98 A;  5TMF A;  1SFO K;  4A3I C;  2R93 C;  4LR9 A;  3L4J A;  3MK1 A;  2Y0S D;  4PAA A;  3RZD C;  1IL2 A;  3AD8 C;  4LQY A;  3GTL A;  1KH9 A;  3S1N K;  1URA A;  1WQG A;  1XZP B;  1XZQ A;  4Q5S A;  1WCM A;  4G7O A;  1EJJ A;  3GTO C;  1R9T C;  2B63 K;  2V6U A;  4Y7N C;  2O5I A;  2NVY K;  3NKN A;  3GEE A;  4Y7N K;  4Y52 C;  3HKZ L;  1KHK A;  5GOV A;  4A3F K;  3LXQ A;  3LAJ A;  2E2I A;  4GZY A;  1WQH A;  3NKQ A;  1K83 A;  4A3G C;  2JA6 A;  3TTG A;  3FOF A;  5KXA A;  4C3H K;  2RH6 A;  2FQO A;  5FLM K;  2JA5 C;  3GTG C;  2CW0 A;  3S17 C;  3GTQ C;  4AYB D;  1KH5 A;  4CYS A;  1BS2 A;  3N0C A;  1J6V A;  5M5X K;  3TX0 A;  1IQ0 A;  3A8I A;  1O2A A;  3T02 A;  3BDH A;  5IJS A;  4CYR A;  4LOW A;  4FZB A;  3GDZ A;  2E2J K;  2JA5 A;  5FJ8 K;  3B5Q A;  3HOU C;  5IOR A;  4G7Z A;  3BP3 A;  3S1R C;  3S1Q C;  3IDD A;  3GSI A;  3GTL K;  1TWA K;  3AD9 C;  4A3I K;  1P49 A;  3M4O K;  2XCR B;  3FHZ A;  3H0G C;  5IJQ A;  1WSV A;  3GTM K;  4UOR A;  1WOS A;  1ZED A;  1B4A A;  3H0G K;  2B63 A;  1SHQ A;  3HOZ C;  1DCP A;  3CQZ K;  3S15 C;  3M8Z A;  2NVY A;  1TWA C;  4BBR C;  3CAG A;  2RGR A;  2XCO A;  1VLO A;  4KMH A;  2JH3 A;  2GLQ A;  4A3B C;  3GTJ A;  3S14 K;  1K83 C;  4A3K C;  1TWC A;  1HDH A;  3ED4 A;  1VGX A;  1E3C P;  3UO0 A;  2NVY C;  3BDG B;  1ISE A;  4UPH A;  3N0B A;  2W7V A;  3S1M K;  4A3C C;  3GTJ K;  2YU9 A;  4KAT A;  4BXX C;  2ZUE A;  1TWC K;  1KHJ A;  1I50 A;  3UN3 A;  1JOE A;  3M7V A;  4YFN A;  5DLV A;  1I3Q C;  1ELX A;  2X98 A;  2XCQ A;  4A3C K;  1I3Q K;  1O25 A;  3HOY C;  3MK0 A;  1TWC C;  4GT9 A;  4GTA A;  2JA5 K;  3WAW A;  4UPI A;  4GTY A;  3S16 C;  1WCM C;  1HI9 A;  2GSN A;  4C3I C;  1YNJ A;  1B4B A;  2NVX C;  5L0K A;  4NWX A;  4BBS C;  1DD5 A;  2WB1 D;  1AJD A;  5C3E K;  3TFJ A;  3LPX A;  4YFK A;  5TMC A;  5C3E C;  5DLW A;  3GTM A;  2Y3P A;  4M1X A;  1HQA A;  1ALJ A;  2V6T A;  1VH2 A;  1EW9 A;  2JA7 A;  3DPC A;  3GEH A;  4OIO A;  4G0V A;  5JVO A;  4Y52 K;  5C4X K;  4XLP A;  4KM9 A;  4RMF A;  1C0A A;  3PO2 C;  2R92 C;  4FM9 A;  3M3Y K;  2XRG A;  4KAY A;  4A3G K;  2CFA B;  4MEX A;  2A69 A;  4PAB A;  1FSU A;  4KJG A;  1Y1V C;  4LR2 A;  3JST A;  2R7Z K;  2ZKT A;  5M5Y K;  3DYC A;  1O24 A;  3MK2 A;  4MHX A;  3GIR A;  4KMU A;  1BJT A;  1ED9 A;  1WIH A;  1EQR A;  4NOI A;  4LR7 A;  5LRM A;  3H3V L;  3IGY B;  4LK0 A;  1ALK A;  2W5T A;  3BP8 C;  2JA6 C;  3VA7 A;  1K7H A;  4X6A K; 
#chains in the Genus database with same CATH homology
 4GTL A;  3M8W A;  2NVX A;  1Y1W A;  2VUM A;  1AB4 A;  4GTF A;  3GTO A;  3NKP A;  3N3Y A;  2W5R A;  4ZGA A;  3BUE A;  3H0G A;  1N2L A;  4YR1 A;  1AJA A;  1AJB A;  4B56 A;  3CMR A;  1B8J A;  3GTG A;  3OEP A;  5DLT A;  2W5X A;  3FKI A;  2R7Z A;  1GE9 A;  2IUC A;  2GSO A;  2KWA A;  1R9T A;  5INH A;  5GRR A;  3V4G A;  4N7T A;  4KJD A;  3BDF A;  1EH1 A;  1SFO A;  3NKO A;  3NUH A;  2R93 A;  2D1G A;  3AH5 A;  4GTZ A;  1WQF A;  4ZG7 A;  1N2K A;  5EGH A;  2W8D A;  4KAS A;  3FOE A;  3TWZ A;  4FDJ A;  3TG0 A;  4FDI A;  1KH4 A;  4MIV A;  3WAX A;  5HRT A;  1ANI A;  3GTK A;  2R92 A;  1TWF A;  3SZZ A;  1O99 A;  1Y6V A;  5K4P A;  1HJK A;  3G4C A;  4G0U A;  2W5Q A;  2W8S A;  5LRN A;  1F9N A;  4BKW A;  3T00 A;  2W5V A;  3LAP A;  4KB2 A;  1Y1V A;  4TN0 A;  3MML B;  4P5A A;  2W5S A;  1O29 A;  4GTD A;  3SZY A;  4KAR A;  2PHC B;  4UOP A;  4GTB A;  4KAV A;  5IOS A;  1KH7 A;  1ZBS A;  2IFY A;  5L0B A;  1EK8 A;  4KB4 A;  3GTP A;  3Q3Q A;  3BDG A;  3CQZ A;  5CJ9 A;  4KM4 A;  4MY4 A;  1O2B A;  4LR8 A;  4J3N A;  1TWA A;  3NVL A;  3T01 A;  4G0W A;  5CHP A;  4LRA A;  2IUC B;  4UOO A;  3IGZ B;  2XR9 A;  4C3H C;  1ELZ A;  4KMD A;  3UNY A;  1KQ4 A;  4GTW A;  1XXA A;  5JFE A;  5LIA A;  4BLB A;  4P5B A;  1O28 A;  3UN2 A;  3M8Y A;  4KDD A;  1SHN A;  4KM8 A;  3AQP A;  1ZXO A;  3ERE D;  1O26 A;  1EI6 A;  4C2M C;  4LRC A;  3WAY A;  3E2D A;  1E33 P;  4KC6 A;  1Y7A A;  1O27 A;  1URB A;  1E2S P;  1TWH A;  5L0E A;  2VQR A;  4GFQ A;  4UPK A;  1AJC A;  2ZFZ A;  4BLA A;  4KMA A;  4NWJ A;  1ED8 A;  4ZG9 A;  5AJ9 A;  1EQJ A;  4CXU A;  1XXB A;  5LQQ A;  3OPF A;  4CXS A;  4C3J C;  3OT9 A;  4UPL A;  4QAX A;  1TWG A;  1EW8 A;  1E1Z P;  1ALH A;  3NKM A;  1BGW A;  1ZVU A;  1EW2 A;  4LRF A;  3S0X A;  1KHL A;  5IOT A;  3KD8 A;  1ZEF A;  4LRB A;  1IS1 A;  3UN5 A;  4DDQ A;  2GA3 A;  2G9Y A;  2QZU A;  1ZEB A;  1ANJ A;  3WBH A;  2GSU A;  5C66 A;  1I3Q A;  4ZG6 A;  4GTC A;  2CFA A;  4GTE A;  5IOQ A;  3AQO A;  3A52 A;  5TJ3 A;  4LRE A;  4LRD A;  1XXC A;  4KAW X;  3NKR A;  3UN3 A;  2E2H A;  4CXK A;  1ALJ A;  4GTX A;  3GTQ A;  2ANH A;  3WAV A;  3QX3 A;  3G4A A;  1ALI A;  2W5W A;  1AUK A;  4ILD A;  2P5M A;  1ELY A;  3ORE A;  3L4K A;  1KHN A;  5EGE A;  1O98 A;  4LR9 A;  3L4J A;  3MK1 A;  4LQY A;  3GTL A;  1KH9 A;  1URA A;  1WQG A;  1WCM A;  1EJJ A;  3NKN A;  1KHK A;  5GOV A;  3LXQ A;  3LAJ A;  2E2I A;  1WQH A;  3NKQ A;  1K83 A;  2JA6 A;  3FOF A;  5KXA A;  2RH6 A;  1KH5 A;  4CYS A;  3N0C A;  3TX0 A;  3BDH A;  3T02 A;  1O2A A;  5IJS A;  4CYR A;  4FZB A;  2JA5 A;  3B5Q A;  5IOR A;  3IDD A;  1P49 A;  5IJQ A;  2XCR B;  3FHZ A;  4UOR A;  1ZED A;  1B4A A;  1SHQ A;  2B63 A;  3M8Z A;  2NVY A;  3CAG A;  2RGR A;  2XCO A;  4KMH A;  2JH3 A;  2GLQ A;  3GTJ A;  1TWC A;  1HDH A;  3ED4 A;  1E3C P;  3UO0 A;  3BDG B;  4UPH A;  1ISE A;  3N0B A;  2YU9 A;  4KAT A;  1KHJ A;  1I50 A;  3M7V A;  5DLV A;  1ELX A;  2X98 A;  2XCQ A;  1O25 A;  3MK0 A;  4GT9 A;  4GTA A;  3WAW A;  4UPI A;  4GTY A;  2GSN A;  4C3I C;  1B4B A;  5L0K A;  4NWX A;  1DD5 A;  1AJD A;  3LPX A;  5DLW A;  3GTM A;  2Y3P A;  4M1X A;  1HQA A;  1EW9 A;  2JA7 A;  3DPC A;  4G0V A;  5JVO A;  4KM9 A;  4FM9 A;  2XRG A;  4KAY A;  2CFA B;  1FSU A;  4KJG A;  4LR2 A;  2ZKT A;  3DYC A;  1O24 A;  3MK2 A;  4MHX A;  1BJT A;  1ED9 A;  1WIH A;  4LR7 A;  5LRM A;  3IGY B;  1ALK A;  2W5T A;  3VA7 A;  1K7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...