4LQYA

Crystal structure of human enpp4 with amp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lqyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lqyA01
1N2LA 3WAVA 3NKRA 1AJAA 1EI6A 1O98A 1FSUA 4KAVA 4FDIA 1KH7A 1ZEFA 1KHNA 3BDHA 3BDGA 1E2SP 4LR9A 3M7VA 4LR8A 5LIAA 1HQAA 2GA3A 4YR1A 2QZUA 2X98A 2W8SA 5GOVA 1ALJA 4N7TA 1K7HA 3M8ZA 4KAYA 2ANHA 3BDFA 2W5SA 1ZEDA 1AJBA 4MHXA 2RH6A 4QAXA 3T00A 3IGYB 2G9YA 5IJSA 3UN5A 3BDGB 5DLVA 1P49A 3E2DA 3UN2A 5L0EA 5INHA 1ELZA 2IUCB 3SZYA 5GRRA 3NVLA 4UPIA 1KHKA 4LQYA 4MY4A 3TX0A 5DLTA 4ZG7A 3NKQA 1Y7AA 2XRGA 1B8JA 4UPHA 3SZZA 1EJJA 2W5RA 4LRCA 1ELYA 4CXUA 1ANIA 4LR7A 2XR9A 3UNYA 3MK1A 3NKNA 4LR2A 1ELXA 1KHJA 4LREA 5DLWA 1KH4A 4CYRA 1ALHA 4UOPA 5L0BA 3WAXA 3NKPA 4UORA 3DPCA 3WAYA 1E1ZP 5C66A 1EW2A 4LRFA 5TJ3A 5HRTA 1AJDA 1ED8A 1URAA 2D1GA 4MIVA 1AUKA 4LRAA 4GTYA 5AJ9A 1KH5A 1ED9A 3LXQA 1O99A 5K4PA 2W5QA 3ED4A 3WAWA 4FDJA 1N2KA 1SHNA 2ZKTA 5L0KA 5LQQA 4B56A 1URBA 4CXSA 2W5VA 3CMRA 4TN0A 3M8YA 1EW9A 4CYSA 2W5WA 4UPLA 4UOOA 1SHQA 3IGZB 4GTWA 4UPKA 2GSOA 5LRNA 4ZG9A 3Q3QA 1ALKA 2VQRA 3M8WA 4LRBA 1E33P 4KJGA 4NWXA 1KHLA 2W5XA 3MK0A 1HJKA 2GLQA 3UO0A 2W8DA 2GSNA 1AJCA 4NWJA 4CXKA 3KD8A 3UN3A 3MK2A 4LRDA 5EGHA 1EW8A 4ZGAA 5IJQA 3OT9A 1ANJA 1Y6VA 2IFYA 3DYCA 4GTXA 1ALIA 3B5QA 4ZG6A 1HDHA 1ZEBA 5LRMA 1E3CP 5EGEA 3NKMA 3NKOA 1EQJA 2IUCA 3TG0A 2GSUA 4KJDA 3TWZA 3T02A 4KM4A 5KXAA 3A52A 3IDDA 3T01A 3WBHA 1KH9A 4GTZA 2W5TA
chains in the Genus database with same CATH superfamily
2JA7C 3FKIA 3A8JA 3N0CA 4A3MC 1YNNA 4MEXA 1O2FB 2O5IA 1I6VA 1TWAA 5M3FK 2RGRA 1FSUA 3S17K 3I4NC 1XXAA 1R9TA 3HOWK 1KH7A 2W7VA 3BDGA 1E2SP 4LR9A 1PJ6A 3AQPA 2R92K 3OREA 4A3FC 2WB1D 4MQ9A 5JVOA 2JA5C 4OIRA 3GTGC 1V5VA 4FM9A 4A3EK 3HOYC 1SFOC 1EFWA 1ALJA 1K7HA 2ANHA 1AJBA 1EQRA 5DLVA 4GZYA 5IOSA 2NVXC 4KMAA 4Y7NK 1TWAK 5GRRA 4A93C 4G7HA 3H0GK 1ZXOA 1TWCA 4C3JC 1VJEA 4GTBA 4OIQA 4ZG7A 3S16K 3I4MC 1Y7AA 2XRGA 2ZUEA 1BGWA 1I50A 3SZZA 3GTOK 4A3GK 5IYCC 4KB2A 4A3LK 4LR7A 2XR9A 3UNYA 1USMA 3NKNA 1ELXA 4LREA 1KHJA 4KB4A 5DLWA 1Y1WC 5L0BA 4UORA 4KN7A 4LK1A 3WAYA 1VRQC 4C2MC 5FLMK 4KN4A 1DD5A 1ED8A 1KQ4A 1I3QK 1KH5A 4C3IK 2VUMA 2A6HA 3ED4A 3FKIC 3LAPA 5IYBK 2E2IA 1ZYRA 1HQMA 4M1XA 5L0KA 2NVQK 1INNA 3FHZA 2PPBA 3CMRA 4TN0A 1R9TC 4ZH4A 1USOA 4CYSA 2W5WA 3S1MC 4QJVA 1K83K 4AYBD 5C4XK 4A3JK 2GSOA 4KMDA 4BLAA 3Q3QA 1ALKA 2R93K 4LRBA 3CQZA 2R7ZK 4G0WA 3A8KA 2W5XA 4OINA 1WCMK 2ZFZA 2NVYK 3HOZK 3K7AK 5IYDK 3UN3A 3GTJK 1X31C 2Y0SD 2E2IK 1ANJA 1IL2A 3PO3K 3GTMK 4ZG6A 3IPJA 4NOIA 3S14C 1ZEBA 3GTGA 2B63A 2GSUA 4KJDA 1F9NA 1TWCC 3T02A 1TWHA 2E2JC 4X6AK 4A3BC 1I50C 4O2DA 3T01A 1O2AA 2JA7K 4GTZA 3AD9C 3V4GA 5M5XK 3LAJA 4RMFA 4A3MK 3GTPA 3NKRA 3I4NK 4KMHA 1O98A 2NVTC 1ISEA 1J6XA 3HOXC 3HOUC 2VUMC 2WAQD 1VH2A 3S2HC 2V6TA 3MMLB 4A3FK 3GTGK 2JA5K 3HOYK 1IE0A 1SFOK 4G0UA 2W8SA 3GEEA 3H3VD 3M8ZA 4KAYA 3BDFA 2W5SA 4MHXA 3HXAA 2NVXK 2G9YA 1P49A 1WORA 1EK8A 4A93K 3CQZC 2GAHC 2PHCB 3ADAC 4C3JK 3I4MK 3LPXA 1XPPA 5IORA 4YG2A 4A3DC 3TX0A 5IYCK 2P8TA 4AYBL 5CHPA 4UPHA 2W5RA 1L0WA 5FJ8K 5C44C 1Y1WK 1ANIA 2BE5A 4CYRA 4LR2A 5TMCA 1XZPA 2B63C 4QIWD 1IS1A 4C2MK 3GSIA 3GEIA 3GTLA 1TWHC 3S1NC 5C66A 1UV7A 5TJ3A 1AJDA 5JFEA 1URAA 3NUHA 3FOEA 2D1GA 4MIVA 3FKIK 5IOTA 4GTYA 3RZOC 2JA8C 3LXQA 3GTPC 3WAWA 4BKWA 1N2KA 3S15C 2ZKTA 1R9TK 4GT9A 1URBA 3S1MK 2W5VA 3M8YA 3TFIA 4UOOA 3AD7C 3IGZB 4XCHA 4GTWA 1WQGA 3S1QC 1O28A 1VGXA 3FOFA 3M8WA 5IP9C 2PA8D 1JVIA 4YFXA 1HJKA 2GLQA 4YFNA 2W8DA 2GSNA 1AJCA 4NWJA 3KD8A 4A3CC 5EGHA 3S14K 2YU9A 5IJQA 2JA6C 1XZPB 3G4AA 1TWCK 4XSZA 4XSXA 1E3CP 5LRMA 3NKMA 4BBSC 2E2JK 2O5JA 3NKOA 4XLNA 3PO2C 4A3BK 3TWZA 1I50K 4MEYA 1JQWA 4BXXC 4BBRC 4KM4A 5KXAA 5IP7C 1GE9A 3IDDA 2XCOA 4LJZA 2EBBA 4XLPA 2JH3A 1N2LA 4P5AA 3GTLC 4YFKA 2NVTK 3HOXK 1AJAA 3HOUK 1O2BA 4FZBA 3GTKC 3GTQA 2VUMK 4Q4ZA 4BY1C 3S2HK 4FDIA 1ZEFA 1KHNA 3BDHA 4LR8A 5LIAA 1HQAA 2GA3A 4KDDA 1YCLA 2WB1L 4YR1A 3HOVC 3S2DC 2QZUA 3QX3A 5M5YK 3BP3A 4QAXA 1J6VA 5IJSA 3CQZK 3UN5A 3GDZA 3E2DA 3ERED 3S1RC 1WSRA 1Y1VA 1ZQ1C 4G7OA 4GTDA 4A3KC 2XCRB 4KM8A 3BUEA 1IBAA 4KMUA 3NVLA 4A3DK 3N0BA 1I6HC 1KHKA 1XXCA 4MY4A 2GAGC 1VLOA 1ZVUA 1O25A 5C44K 2YU9C 1B8JA 5C3EC 5C4JC 2B63K 1TWGA 1ELYA 4CXUA 2FQOA 4BY7C 1IW7A 1B4BA 1TWHK 1SMYA 4C3HC 3M3YC 3S1NK 4UOPA 4WILA 2KWAA 1WSVA 3DPCA 1DCHA 1EH1A 2CFAA 1EW2A 1WIHA 5HRTA 3RZOK 2JA8K 4KARA 4WJ3M 1TWFC 4GTFA 1AUKA 4PABA 3GTPK 4LRAA 4P5BA 1O99A 4PAAA 3S15K 2JA6A 2CW0A 3EQLA 1SHNA 3AH5A 5LQQA 4B56A 4Y52C 3GTQC 1BJTA 4CXSA 3GIRA 2A68A 4UPLA 1PJ5A 2D6FC 3S1QK 1SHQA 4UPKA 3JSTA 4AH6A 3VA7A 5IP9K 3G4CA 5LRNA 4ZG9A 1YNJA 4ILDA 5TMFA 2VQRA 3N3YA 1J6WA 4NWXA 3GEHA 1KHLA 1AB4A 2Y3PA 3GTKA 3MK0A 4A3CK 3UO0A 2E2HC 3AD8C 4J3NA 4CXKA 1HI9A 1ZBSA 2Y0SL 2JA6K 3MK2A 4OIOA 4GTEA 2FQTA 3H0GA 1Y1VC 1WQFA 5D4DA 4A3IC 3OT9A 3DYCA 2PMZD 3M4OC 4BBSK 1ALIA 3B5QA 1HDHA 3PO2K 2V6SA 1IQ0A 4KATA 5EGEA 4BXXK 2V6UA 4BBRK 1EQJA 3GTOA 2IUCA 2CFAB 5IP7K 4GTCA 1BDFA 1C0AA 3A52A 3RZDC 1O26A 1TWGC 3WBHA 1KH9A 3GTLK 2W5TA 2A6EA 1WOSA 1I3QA 3HKZD 1XZQB 3TFHA 3GTKK 3WAVA 1EI6A 1WQHA 4BY1K 3L4KA 5M3MK 4KAVA 2WAQL 3S0XA 3S17C 3HOWC 3M7VA 3HOVK 3S2DK 1JOEA 3A8IA 1K83A 1BS2A 4JK1A 3L4JA 4KAWX 2X98A 4GTAA 2P5MA 3H3VL 1J98A 2R92C 5IOQA 5GOVA 2R93A 4N7TA 3T00A 4A3EC 2R7ZA 1TWFA 1ZEDA 2RH6A 3S1RK 1WCMA 3IGYB 2NVYA 3BDGB 5L0EA 4A3KK 3UN2A 4P9SA 5INHA 3GTJA 1ELZA 1I6HK 2IUCB 3SZYA 3GTMA 4UPIA 4Y7NC 1F93A 4LOWA 1TWAC 3TFJA 2YU9K 4LQYA 1F7UA 2A69A 5C3EK 4LK0A 5C4JK 5DLTA 3NKQA 3H0GC 3TTGA 4BY7K 1WOPA 1EJJA 3S16C 4C3HK 3M3YK 4LRCA 4OIPA 4QIWL 3MK1A 3GTOC 1KH4A 4A3GC 1ALHA 2JA7A 4A3LC 3WAXA 3DXJA 3NKPA 1YX2A 4BLBA 1E1ZP 1TWFK 2E2HA 4LRFA 3OPFA 5FLMC 1F7VA 5AJ9A 4Q5SA 4GTLA 1ED9A 5K4PA 1I3QC 2W5QA 3BP8C 4FDJA 2PMZL 1DCPA 3GTQK 4Y52K 4C3IC 1O29A 4DDQA 5IYBC 2JA5A 2ZUFA 1EW9A 3OEPA 2NVQC 5L46A 1SFOA 3WODA 2XCQA 4G7ZA 4WJ4A 1K83C 4G0VA 1B4AA 5C4XC 4A3JC 4C45A 4KC6A 1O27A 5CJ9A 3HKZL 2PA8L 2NVXA 1E33P 4KJGA 2E2HK 1O24A 4KASA 2R93C 5M5WK 1PJ7A 1WOOA 2R7ZC 3AQOA 4KM9A 1WCMC 1Y1VK 4A3IK 1RU0A 5HL8A 4GFQA 4QJVB 5E68A 1DCOA 2NVYC 3M4OK 3HOZC 4LRDA 3K7AC 5IYDC 1EW8A 4ZGAA 2IFYA 1Y6VA 3GTJC 1XXBA 4GTXA 1XZQA 2E2IC 3PO3C 3GTMC 3TG0A 1Y1WA 2R92A 3RZDK 1TWGK 1G51A 4X6AC 4LLGA 3CAGA
chains in the Genus database with same CATH topology
3FKIA 3N0CA 1TWAA 2RGRA 1FSUA 1XXAA 1R9TA 1KH7A 3BDGA 1E2SP 4LR9A 3AQPA 3OREA 5JVOA 4FM9A 1ALJA 1K7HA 2ANHA 1AJBA 5DLVA 5IOSA 4KMAA 5GRRA 1ZXOA 1TWCA 4GTBA 4C3JC 4ZG7A 1Y7AA 2XRGA 1BGWA 1I50A 3SZZA 4KB2A 4LR7A 2XR9A 3UNYA 3NKNA 1ELXA 4LREA 1KHJA 4KB4A 5DLWA 5L0BA 4UORA 3WAYA 4C2MC 1DD5A 1ED8A 1KQ4A 1KH5A 2VUMA 3ED4A 3LAPA 2E2IA 4M1XA 5L0KA 3FHZA 3CMRA 4TN0A 4CYSA 2W5WA 2GSOA 4KMDA 4BLAA 3Q3QA 1ALKA 4LRBA 3CQZA 4G0WA 2W5XA 2ZFZA 3UN3A 1ANJA 4ZG6A 1ZEBA 3GTGA 2B63A 2GSUA 4KJDA 1F9NA 3T02A 1TWHA 3T01A 1O2AA 4GTZA 3V4GA 3LAJA 3GTPA 3NKRA 4KMHA 1O98A 1ISEA 3MMLB 4G0UA 2W8SA 3M8ZA 4KAYA 3BDFA 2W5SA 4MHXA 2G9YA 1P49A 1EK8A 2PHCB 3LPXA 5IORA 3TX0A 5CHPA 4UPHA 2W5RA 1ANIA 4CYRA 4LR2A 1IS1A 3GTLA 5C66A 5TJ3A 1AJDA 5JFEA 1URAA 3NUHA 3FOEA 2D1GA 4MIVA 4GTYA 5IOTA 3LXQA 3WAWA 4BKWA 1N2KA 2ZKTA 4GT9A 1URBA 2W5VA 3M8YA 4UOOA 3IGZB 4GTWA 1WQGA 1O28A 3FOFA 3M8WA 1HJKA 2GLQA 2W8DA 2GSNA 1AJCA 4NWJA 3KD8A 5EGHA 2YU9A 5IJQA 3G4AA 5LRMA 1E3CP 3NKMA 3NKOA 3TWZA 4KM4A 5KXAA 1GE9A 3IDDA 2XCOA 2JH3A 1N2LA 4P5AA 1AJAA 1O2BA 4FZBA 3GTQA 4FDIA 1ZEFA 1KHNA 3BDHA 4LR8A 5LIAA 1HQAA 2GA3A 4KDDA 4YR1A 2QZUA 3QX3A 4QAXA 5IJSA 3UN5A 3E2DA 3ERED 1Y1VA 4GTDA 2XCRB 4KM8A 3BUEA 3NVLA 3N0BA 1KHKA 1XXCA 4MY4A 1ZVUA 1O25A 1B8JA 1TWGA 1ELYA 4CXUA 1B4BA 4C3HC 4UOPA 2KWAA 3DPCA 2CFAA 1EH1A 1EW2A 1WIHA 5HRTA 4KARA 4GTFA 1AUKA 4LRAA 4P5BA 1O99A 2JA6A 1SHNA 3AH5A 5LQQA 4B56A 1BJTA 4CXSA 4UPLA 1SHQA 4UPKA 3VA7A 3G4CA 5LRNA 4ZG9A 4ILDA 2VQRA 3N3YA 4NWXA 1KHLA 1AB4A 2Y3PA 3GTKA 3MK0A 3UO0A 4J3NA 4CXKA 1ZBSA 3MK2A 4GTEA 3H0GA 1WQFA 3OT9A 3DYCA 1ALIA 3B5QA 1HDHA 4KATA 5EGEA 1EQJA 2IUCA 3GTOA 2CFAB 4GTCA 3A52A 1O26A 3WBHA 1KH9A 2W5TA 1I3QA 3WAVA 1EI6A 1WQHA 3L4KA 4KAVA 3S0XA 3M7VA 1K83A 3L4JA 4KAWX 2X98A 4GTAA 2P5MA 5IOQA 5GOVA 2R93A 4N7TA 2R7ZA 3T00A 1ZEDA 1TWFA 2RH6A 1WCMA 3IGYB 2NVYA 3BDGB 5L0EA 3UN2A 5INHA 3GTJA 1ELZA 2IUCB 3SZYA 3GTMA 4UPIA 4LQYA 5DLTA 3NKQA 1EJJA 4LRCA 3MK1A 1KH4A 1ALHA 2JA7A 3WAXA 3NKPA 4BLBA 1E1ZP 2E2HA 4LRFA 3OPFA 5AJ9A 4GTLA 1ED9A 5K4PA 2W5QA 4FDJA 4C3IC 1O29A 4DDQA 2JA5A 1EW9A 3OEPA 1SFOA 2XCQA 4G0VA 1B4AA 4KC6A 1O27A 5CJ9A 2NVXA 1E33P 4KJGA 1O24A 4KASA 3AQOA 4KM9A 4GFQA 4LRDA 1EW8A 4ZGAA 2IFYA 1Y6VA 1XXBA 4GTXA 3TG0A 1Y1WA 2R92A 3CAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2L A;  3WAV A;  3NKR A;  1AJA A;  1EI6 A;  1O98 A;  1FSU A;  4KAV A;  4FDI A;  1KH7 A;  1ZEF A;  1KHN A;  3BDH A;  3BDG A;  1E2S P;  4LR9 A;  3M7V A;  4LR8 A;  5LIA A;  1HQA A;  2GA3 A;  4YR1 A;  2QZU A;  2X98 A;  2W8S A;  5GOV A;  1ALJ A;  4N7T A;  1K7H A;  3M8Z A;  4KAY A;  2ANH A;  3BDF A;  2W5S A;  1ZED A;  1AJB A;  4MHX A;  2RH6 A;  4QAX A;  3T00 A;  3IGY B;  2G9Y A;  5IJS A;  3UN5 A;  3BDG B;  5DLV A;  1P49 A;  3E2D A;  3UN2 A;  5L0E A;  5INH A;  1ELZ A;  2IUC B;  3SZY A;  5GRR A;  3NVL A;  4UPI A;  1KHK A;  4LQY A;  4MY4 A;  3TX0 A;  5DLT A;  4ZG7 A;  3NKQ A;  1Y7A A;  2XRG A;  1B8J A;  4UPH A;  3SZZ A;  1EJJ A;  2W5R A;  4LRC A;  1ELY A;  4CXU A;  1ANI A;  4LR7 A;  2XR9 A;  3UNY A;  3MK1 A;  3NKN A;  4LR2 A;  1ELX A;  1KHJ A;  4LRE A;  5DLW A;  1KH4 A;  4CYR A;  1ALH A;  4UOP A;  5L0B A;  3WAX A;  3NKP A;  4UOR A;  3DPC A;  3WAY A;  1E1Z P;  5C66 A;  1EW2 A;  4LRF A;  5TJ3 A;  5HRT A;  1AJD A;  1ED8 A;  1URA A;  2D1G A;  4MIV A;  1AUK A;  4LRA A;  4GTY A;  5AJ9 A;  1KH5 A;  1ED9 A;  3LXQ A;  1O99 A;  5K4P A;  2W5Q A;  3ED4 A;  3WAW A;  4FDJ A;  1N2K A;  1SHN A;  2ZKT A;  5L0K A;  5LQQ A;  4B56 A;  1URB A;  4CXS A;  2W5V A;  3CMR A;  4TN0 A;  3M8Y A;  1EW9 A;  4CYS A;  2W5W A;  4UPL A;  4UOO A;  1SHQ A;  3IGZ B;  4GTW A;  4UPK A;  2GSO A;  5LRN A;  4ZG9 A;  3Q3Q A;  1ALK A;  2VQR A;  3M8W A;  4LRB A;  1E33 P;  4KJG A;  4NWX A;  1KHL A;  2W5X A;  3MK0 A;  1HJK A;  2GLQ A;  3UO0 A;  2W8D A;  2GSN A;  1AJC A;  4NWJ A;  4CXK A;  3KD8 A;  3UN3 A;  3MK2 A;  4LRD A;  5EGH A;  1EW8 A;  4ZGA A;  5IJQ A;  3OT9 A;  1ANJ A;  1Y6V A;  2IFY A;  3DYC A;  4GTX A;  1ALI A;  3B5Q A;  4ZG6 A;  1HDH A;  1ZEB A;  5LRM A;  1E3C P;  5EGE A;  3NKM A;  3NKO A;  1EQJ A;  2IUC A;  3TG0 A;  2GSU A;  4KJD A;  3TWZ A;  3T02 A;  4KM4 A;  5KXA A;  3A52 A;  3IDD A;  3T01 A;  3WBH A;  1KH9 A;  4GTZ A;  2W5T A; 
#chains in the Genus database with same CATH topology
 2JA7 C;  3FKI A;  3A8J A;  3N0C A;  4A3M C;  1YNN A;  4MEX A;  1O2F B;  2O5I A;  1I6V A;  1TWA A;  5M3F K;  2RGR A;  1FSU A;  3S17 K;  3I4N C;  1XXA A;  1R9T A;  3HOW K;  1KH7 A;  2W7V A;  3BDG A;  1E2S P;  4LR9 A;  1PJ6 A;  3AQP A;  2R92 K;  3ORE A;  4A3F C;  2WB1 D;  4MQ9 A;  5JVO A;  2JA5 C;  4OIR A;  3GTG C;  1V5V A;  4FM9 A;  4A3E K;  3HOY C;  1SFO C;  1EFW A;  1ALJ A;  1K7H A;  2ANH A;  1AJB A;  1EQR A;  5DLV A;  4GZY A;  5IOS A;  2NVX C;  4KMA A;  4Y7N K;  1TWA K;  5GRR A;  4A93 C;  4G7H A;  3H0G K;  1ZXO A;  1TWC A;  4C3J C;  1VJE A;  4GTB A;  4OIQ A;  4ZG7 A;  3S16 K;  3I4M C;  1Y7A A;  2XRG A;  2ZUE A;  1BGW A;  1I50 A;  3SZZ A;  3GTO K;  4A3G K;  5IYC C;  4KB2 A;  4A3L K;  4LR7 A;  2XR9 A;  3UNY A;  1USM A;  3NKN A;  1ELX A;  4LRE A;  1KHJ A;  4KB4 A;  5DLW A;  1Y1W C;  5L0B A;  4UOR A;  4KN7 A;  4LK1 A;  3WAY A;  1VRQ C;  4C2M C;  5FLM K;  4KN4 A;  1DD5 A;  1ED8 A;  1KQ4 A;  1I3Q K;  1KH5 A;  4C3I K;  2VUM A;  2A6H A;  3ED4 A;  3FKI C;  3LAP A;  5IYB K;  2E2I A;  1ZYR A;  1HQM A;  4M1X A;  5L0K A;  2NVQ K;  1INN A;  3FHZ A;  2PPB A;  3CMR A;  4TN0 A;  1R9T C;  4ZH4 A;  1USO A;  4CYS A;  2W5W A;  3S1M C;  4QJV A;  1K83 K;  4AYB D;  5C4X K;  4A3J K;  2GSO A;  4KMD A;  4BLA A;  3Q3Q A;  1ALK A;  2R93 K;  4LRB A;  3CQZ A;  2R7Z K;  4G0W A;  3A8K A;  2W5X A;  4OIN A;  1WCM K;  2ZFZ A;  2NVY K;  3HOZ K;  3K7A K;  5IYD K;  3UN3 A;  3GTJ K;  1X31 C;  2Y0S D;  2E2I K;  1ANJ A;  1IL2 A;  3PO3 K;  3GTM K;  4ZG6 A;  3IPJ A;  4NOI A;  3S14 C;  1ZEB A;  3GTG A;  2B63 A;  2GSU A;  4KJD A;  1F9N A;  1TWC C;  3T02 A;  1TWH A;  2E2J C;  4X6A K;  4A3B C;  1I50 C;  4O2D A;  3T01 A;  1O2A A;  2JA7 K;  4GTZ A;  3AD9 C;  3V4G A;  5M5X K;  3LAJ A;  4RMF A;  4A3M K;  3GTP A;  3NKR A;  3I4N K;  4KMH A;  1O98 A;  2NVT C;  1ISE A;  1J6X A;  3HOX C;  3HOU C;  2VUM C;  2WAQ D;  1VH2 A;  3S2H C;  2V6T A;  3MML B;  4A3F K;  3GTG K;  2JA5 K;  3HOY K;  1IE0 A;  1SFO K;  4G0U A;  2W8S A;  3GEE A;  3H3V D;  3M8Z A;  4KAY A;  3BDF A;  2W5S A;  4MHX A;  3HXA A;  2NVX K;  2G9Y A;  1P49 A;  1WOR A;  1EK8 A;  4A93 K;  3CQZ C;  2GAH C;  2PHC B;  3ADA C;  4C3J K;  3I4M K;  3LPX A;  1XPP A;  5IOR A;  4YG2 A;  4A3D C;  3TX0 A;  5IYC K;  2P8T A;  4AYB L;  5CHP A;  4UPH A;  2W5R A;  1L0W A;  5FJ8 K;  5C44 C;  1Y1W K;  1ANI A;  2BE5 A;  4CYR A;  4LR2 A;  5TMC A;  1XZP A;  2B63 C;  4QIW D;  1IS1 A;  4C2M K;  3GSI A;  3GEI A;  3GTL A;  1TWH C;  3S1N C;  5C66 A;  1UV7 A;  5TJ3 A;  1AJD A;  5JFE A;  1URA A;  3NUH A;  3FOE A;  2D1G A;  4MIV A;  3FKI K;  5IOT A;  4GTY A;  3RZO C;  2JA8 C;  3LXQ A;  3GTP C;  3WAW A;  4BKW A;  1N2K A;  3S15 C;  2ZKT A;  1R9T K;  4GT9 A;  1URB A;  3S1M K;  2W5V A;  3M8Y A;  3TFI A;  4UOO A;  3AD7 C;  3IGZ B;  4XCH A;  4GTW A;  1WQG A;  3S1Q C;  1O28 A;  1VGX A;  3FOF A;  3M8W A;  5IP9 C;  2PA8 D;  1JVI A;  4YFX A;  1HJK A;  2GLQ A;  4YFN A;  2W8D A;  2GSN A;  1AJC A;  4NWJ A;  3KD8 A;  4A3C C;  5EGH A;  3S14 K;  2YU9 A;  5IJQ A;  2JA6 C;  1XZP B;  3G4A A;  1TWC K;  4XSZ A;  4XSX A;  1E3C P;  5LRM A;  3NKM A;  4BBS C;  2E2J K;  2O5J A;  3NKO A;  4XLN A;  3PO2 C;  4A3B K;  3TWZ A;  1I50 K;  4MEY A;  1JQW A;  4BXX C;  4BBR C;  4KM4 A;  5KXA A;  5IP7 C;  1GE9 A;  3IDD A;  2XCO A;  4LJZ A;  2EBB A;  4XLP A;  2JH3 A;  1N2L A;  4P5A A;  3GTL C;  4YFK A;  2NVT K;  3HOX K;  1AJA A;  3HOU K;  1O2B A;  4FZB A;  3GTK C;  3GTQ A;  2VUM K;  4Q4Z A;  4BY1 C;  3S2H K;  4FDI A;  1ZEF A;  1KHN A;  3BDH A;  4LR8 A;  5LIA A;  1HQA A;  2GA3 A;  4KDD A;  1YCL A;  2WB1 L;  4YR1 A;  3HOV C;  3S2D C;  2QZU A;  3QX3 A;  5M5Y K;  3BP3 A;  4QAX A;  1J6V A;  5IJS A;  3CQZ K;  3UN5 A;  3GDZ A;  3E2D A;  3ERE D;  3S1R C;  1WSR A;  1Y1V A;  1ZQ1 C;  4G7O A;  4GTD A;  4A3K C;  2XCR B;  4KM8 A;  3BUE A;  1IBA A;  4KMU A;  3NVL A;  4A3D K;  3N0B A;  1I6H C;  1KHK A;  1XXC A;  4MY4 A;  2GAG C;  1VLO A;  1ZVU A;  1O25 A;  5C44 K;  2YU9 C;  1B8J A;  5C3E C;  5C4J C;  2B63 K;  1TWG A;  1ELY A;  4CXU A;  2FQO A;  4BY7 C;  1IW7 A;  1B4B A;  1TWH K;  1SMY A;  4C3H C;  3M3Y C;  3S1N K;  4UOP A;  4WIL A;  2KWA A;  1WSV A;  3DPC A;  1DCH A;  1EH1 A;  2CFA A;  1EW2 A;  1WIH A;  5HRT A;  3RZO K;  2JA8 K;  4KAR A;  4WJ3 M;  1TWF C;  4GTF A;  1AUK A;  4PAB A;  3GTP K;  4LRA A;  4P5B A;  1O99 A;  4PAA A;  3S15 K;  2JA6 A;  2CW0 A;  3EQL A;  1SHN A;  3AH5 A;  5LQQ A;  4B56 A;  4Y52 C;  3GTQ C;  1BJT A;  4CXS A;  3GIR A;  2A68 A;  4UPL A;  1PJ5 A;  2D6F C;  3S1Q K;  1SHQ A;  4UPK A;  3JST A;  4AH6 A;  3VA7 A;  5IP9 K;  3G4C A;  5LRN A;  4ZG9 A;  1YNJ A;  4ILD A;  5TMF A;  2VQR A;  3N3Y A;  1J6W A;  4NWX A;  3GEH A;  1KHL A;  1AB4 A;  2Y3P A;  3GTK A;  3MK0 A;  4A3C K;  3UO0 A;  2E2H C;  3AD8 C;  4J3N A;  4CXK A;  1HI9 A;  1ZBS A;  2Y0S L;  2JA6 K;  3MK2 A;  4OIO A;  4GTE A;  2FQT A;  3H0G A;  1Y1V C;  1WQF A;  5D4D A;  4A3I C;  3OT9 A;  3DYC A;  2PMZ D;  3M4O C;  4BBS K;  1ALI A;  3B5Q A;  1HDH A;  3PO2 K;  2V6S A;  1IQ0 A;  4KAT A;  5EGE A;  4BXX K;  2V6U A;  4BBR K;  1EQJ A;  3GTO A;  2IUC A;  2CFA B;  5IP7 K;  4GTC A;  1BDF A;  1C0A A;  3A52 A;  3RZD C;  1O26 A;  1TWG C;  3WBH A;  1KH9 A;  3GTL K;  2W5T A;  2A6E A;  1WOS A;  1I3Q A;  3HKZ D;  1XZQ B;  3TFH A;  3GTK K;  3WAV A;  1EI6 A;  1WQH A;  4BY1 K;  3L4K A;  5M3M K;  4KAV A;  2WAQ L;  3S0X A;  3S17 C;  3HOW C;  3M7V A;  3HOV K;  3S2D K;  1JOE A;  3A8I A;  1K83 A;  1BS2 A;  4JK1 A;  3L4J A;  4KAW X;  2X98 A;  4GTA A;  2P5M A;  3H3V L;  1J98 A;  2R92 C;  5IOQ A;  5GOV A;  2R93 A;  4N7T A;  3T00 A;  4A3E C;  2R7Z A;  1TWF A;  1ZED A;  2RH6 A;  3S1R K;  1WCM A;  3IGY B;  2NVY A;  3BDG B;  5L0E A;  4A3K K;  3UN2 A;  4P9S A;  5INH A;  3GTJ A;  1ELZ A;  1I6H K;  2IUC B;  3SZY A;  3GTM A;  4UPI A;  4Y7N C;  1F93 A;  4LOW A;  1TWA C;  3TFJ A;  2YU9 K;  4LQY A;  1F7U A;  2A69 A;  5C3E K;  4LK0 A;  5C4J K;  5DLT A;  3NKQ A;  3H0G C;  3TTG A;  4BY7 K;  1WOP A;  1EJJ A;  3S16 C;  4C3H K;  3M3Y K;  4LRC A;  4OIP A;  4QIW L;  3MK1 A;  3GTO C;  1KH4 A;  4A3G C;  1ALH A;  2JA7 A;  4A3L C;  3WAX A;  3DXJ A;  3NKP A;  1YX2 A;  4BLB A;  1E1Z P;  1TWF K;  2E2H A;  4LRF A;  3OPF A;  5FLM C;  1F7V A;  5AJ9 A;  4Q5S A;  4GTL A;  1ED9 A;  5K4P A;  1I3Q C;  2W5Q A;  3BP8 C;  4FDJ A;  2PMZ L;  1DCP A;  3GTQ K;  4Y52 K;  4C3I C;  1O29 A;  4DDQ A;  5IYB C;  2JA5 A;  2ZUF A;  1EW9 A;  3OEP A;  2NVQ C;  5L46 A;  1SFO A;  3WOD A;  2XCQ A;  4G7Z A;  4WJ4 A;  1K83 C;  4G0V A;  1B4A A;  5C4X C;  4A3J C;  4C45 A;  4KC6 A;  1O27 A;  5CJ9 A;  3HKZ L;  2PA8 L;  2NVX A;  1E33 P;  4KJG A;  2E2H K;  1O24 A;  4KAS A;  2R93 C;  5M5W K;  1PJ7 A;  1WOO A;  2R7Z C;  3AQO A;  4KM9 A;  1WCM C;  1Y1V K;  4A3I K;  1RU0 A;  5HL8 A;  4GFQ A;  4QJV B;  5E68 A;  1DCO A;  2NVY C;  3M4O K;  3HOZ C;  4LRD A;  3K7A C;  5IYD C;  1EW8 A;  4ZGA A;  2IFY A;  1Y6V A;  3GTJ C;  1XXB A;  4GTX A;  1XZQ A;  2E2I C;  3PO3 C;  3GTM C;  3TG0 A;  1Y1W A;  2R92 A;  3RZD K;  1TWG K;  1G51 A;  4X6A C;  4LLG A;  3CAG A; 
#chains in the Genus database with same CATH homology
 3FKI A;  3N0C A;  1TWA A;  2RGR A;  1FSU A;  1XXA A;  1R9T A;  1KH7 A;  3BDG A;  1E2S P;  4LR9 A;  3AQP A;  3ORE A;  5JVO A;  4FM9 A;  1ALJ A;  1K7H A;  2ANH A;  1AJB A;  5DLV A;  5IOS A;  4KMA A;  5GRR A;  1ZXO A;  1TWC A;  4GTB A;  4C3J C;  4ZG7 A;  1Y7A A;  2XRG A;  1BGW A;  1I50 A;  3SZZ A;  4KB2 A;  4LR7 A;  2XR9 A;  3UNY A;  3NKN A;  1ELX A;  4LRE A;  1KHJ A;  4KB4 A;  5DLW A;  5L0B A;  4UOR A;  3WAY A;  4C2M C;  1DD5 A;  1ED8 A;  1KQ4 A;  1KH5 A;  2VUM A;  3ED4 A;  3LAP A;  2E2I A;  4M1X A;  5L0K A;  3FHZ A;  3CMR A;  4TN0 A;  4CYS A;  2W5W A;  2GSO A;  4KMD A;  4BLA A;  3Q3Q A;  1ALK A;  4LRB A;  3CQZ A;  4G0W A;  2W5X A;  2ZFZ A;  3UN3 A;  1ANJ A;  4ZG6 A;  1ZEB A;  3GTG A;  2B63 A;  2GSU A;  4KJD A;  1F9N A;  3T02 A;  1TWH A;  3T01 A;  1O2A A;  4GTZ A;  3V4G A;  3LAJ A;  3GTP A;  3NKR A;  4KMH A;  1O98 A;  1ISE A;  3MML B;  4G0U A;  2W8S A;  3M8Z A;  4KAY A;  3BDF A;  2W5S A;  4MHX A;  2G9Y A;  1P49 A;  1EK8 A;  2PHC B;  3LPX A;  5IOR A;  3TX0 A;  5CHP A;  4UPH A;  2W5R A;  1ANI A;  4CYR A;  4LR2 A;  1IS1 A;  3GTL A;  5C66 A;  5TJ3 A;  1AJD A;  5JFE A;  1URA A;  3NUH A;  3FOE A;  2D1G A;  4MIV A;  4GTY A;  5IOT A;  3LXQ A;  3WAW A;  4BKW A;  1N2K A;  2ZKT A;  4GT9 A;  1URB A;  2W5V A;  3M8Y A;  4UOO A;  3IGZ B;  4GTW A;  1WQG A;  1O28 A;  3FOF A;  3M8W A;  1HJK A;  2GLQ A;  2W8D A;  2GSN A;  1AJC A;  4NWJ A;  3KD8 A;  5EGH A;  2YU9 A;  5IJQ A;  3G4A A;  5LRM A;  1E3C P;  3NKM A;  3NKO A;  3TWZ A;  4KM4 A;  5KXA A;  1GE9 A;  3IDD A;  2XCO A;  2JH3 A;  1N2L A;  4P5A A;  1AJA A;  1O2B A;  4FZB A;  3GTQ A;  4FDI A;  1ZEF A;  1KHN A;  3BDH A;  4LR8 A;  5LIA A;  1HQA A;  2GA3 A;  4KDD A;  4YR1 A;  2QZU A;  3QX3 A;  4QAX A;  5IJS A;  3UN5 A;  3E2D A;  3ERE D;  1Y1V A;  4GTD A;  2XCR B;  4KM8 A;  3BUE A;  3NVL A;  3N0B A;  1KHK A;  1XXC A;  4MY4 A;  1ZVU A;  1O25 A;  1B8J A;  1TWG A;  1ELY A;  4CXU A;  1B4B A;  4C3H C;  4UOP A;  2KWA A;  3DPC A;  2CFA A;  1EH1 A;  1EW2 A;  1WIH A;  5HRT A;  4KAR A;  4GTF A;  1AUK A;  4LRA A;  4P5B A;  1O99 A;  2JA6 A;  1SHN A;  3AH5 A;  5LQQ A;  4B56 A;  1BJT A;  4CXS A;  4UPL A;  1SHQ A;  4UPK A;  3VA7 A;  3G4C A;  5LRN A;  4ZG9 A;  4ILD A;  2VQR A;  3N3Y A;  4NWX A;  1KHL A;  1AB4 A;  2Y3P A;  3GTK A;  3MK0 A;  3UO0 A;  4J3N A;  4CXK A;  1ZBS A;  3MK2 A;  4GTE A;  3H0G A;  1WQF A;  3OT9 A;  3DYC A;  1ALI A;  3B5Q A;  1HDH A;  4KAT A;  5EGE A;  1EQJ A;  2IUC A;  3GTO A;  2CFA B;  4GTC A;  3A52 A;  1O26 A;  3WBH A;  1KH9 A;  2W5T A;  1I3Q A;  3WAV A;  1EI6 A;  1WQH A;  3L4K A;  4KAV A;  3S0X A;  3M7V A;  1K83 A;  3L4J A;  4KAW X;  2X98 A;  4GTA A;  2P5M A;  5IOQ A;  5GOV A;  2R93 A;  4N7T A;  2R7Z A;  3T00 A;  1ZED A;  1TWF A;  2RH6 A;  1WCM A;  3IGY B;  2NVY A;  3BDG B;  5L0E A;  3UN2 A;  5INH A;  3GTJ A;  1ELZ A;  2IUC B;  3SZY A;  3GTM A;  4UPI A;  4LQY A;  5DLT A;  3NKQ A;  1EJJ A;  4LRC A;  3MK1 A;  1KH4 A;  1ALH A;  2JA7 A;  3WAX A;  3NKP A;  4BLB A;  1E1Z P;  2E2H A;  4LRF A;  3OPF A;  5AJ9 A;  4GTL A;  1ED9 A;  5K4P A;  2W5Q A;  4FDJ A;  4C3I C;  1O29 A;  4DDQ A;  2JA5 A;  1EW9 A;  3OEP A;  1SFO A;  2XCQ A;  4G0V A;  1B4A A;  4KC6 A;  1O27 A;  5CJ9 A;  2NVX A;  1E33 P;  4KJG A;  1O24 A;  4KAS A;  3AQO A;  4KM9 A;  4GFQ A;  4LRD A;  1EW8 A;  4ZGA A;  2IFY A;  1Y6V A;  1XXB A;  4GTX A;  3TG0 A;  1Y1W A;  2R92 A;  3CAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...