4LR7A

Phosphopentomutase s154a variant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 142
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr7A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr7A01
4LR2A 3CMRA 2RH6A 5HRTA 1ED8A 1ALHA 4LR7A 3BDFA 3LXQA 4UORA 3UN2A 3NKPA 3NKMA 5GOVA 4ZG6A 3NKQA 4FDJA 3BDGA 3NKNA 4LQYA 2GSNA 3WBHA 5L0BA 4GTYA 5IJQA 4GTWA 1E2SP 1EW2A 3T02A 4GTZA 1ED9A 1AUKA 1AJBA 2W8DA 4CYRA 1KH4A 1KHLA 1KH7A 1URBA 3T00A 1ZEBA 1ALKA 3IGZB 3KD8A 4LRAA 1SHNA 1E1ZP 2IUCA 3M7VA 3TWZA 3E2DA 3WAXA 4UOPA 4QAXA 1HDHA 3MK1A 4ZG9A 3M8WA 3Q3QA 4UPKA 1E3CP 5LIAA 4FDIA 4NWXA 4MIVA 3UN3A 4LR9A 4NWJA 1KH5A 4LRBA 1E33P 4UPLA 4YR1A 3MK2A 5INHA 1AJAA 2W5WA 3A52A 4MY4A 5EGHA 2XR9A 1ANIA 2GSUA 1URAA 3IDDA 1ALJA 1Y6VA 2W5RA 3M8YA 2XRGA 1N2KA 3BDGB 1ELZA 4CXKA 1B8JA 1ALIA 3T01A 4LREA 2W8SA 4LRCA 2X98A 1N2LA 5KXAA 1SHQA 4LR8A 2G9YA 3WAWA 4CYSA 5L0KA 3SZYA 1O98A 5AJ9A 4LRDA 3UN5A 5LQQA 1KH9A 4KJGA 4CXUA 2IUCB 1FSUA 3NKOA 5EGEA 3BDHA 5GRRA 3TX0A 4UOOA 1ZEDA 2QZUA 4KAVA 4KM4A 3NKRA 4MHXA 3B5QA 1K7HA 1O99A 5TJ3A 3SZZA 2VQRA 3WAVA 3OT9A 1KHKA 1EW9A 1AJDA 3DPCA 1ZEFA 4TN0A 4B56A 2GA3A 1EQJA 4KJDA 4KAYA 1AJCA 1EJJA 1P49A 5DLVA 5IJSA 1ELYA 2W5QA 5DLTA 5K4PA 3UO0A 4CXSA 1EW8A 5LRNA 4UPHA 4N7TA 1EI6A 3MK0A 3TG0A 3M8ZA 3DYCA 3NVLA 5LRMA 3UNYA 1HQAA 1Y7AA 3ED4A 2W5TA 2GSOA 2IFYA 2W5XA 5DLWA 2ZKTA 1KHNA 2W5SA 4GTXA 3WAYA 1KHJA 3IGYB 2GLQA 4UPIA 5C66A 2W5VA 4LRFA 1ELXA 5L0EA 1ANJA 4ZGAA 2ANHA 4ZG7A 2D1GA 1HJKA
chains in the Genus database with same CATH superfamily
1U2RA 1FWLA 2CADA 2GAGC 4WWSA 4U7CA 5GOVA 2EPIA 4C3MA 2MGZA 1FD8A 3GSIA 5D0HA 4M5HA 1XQIA 2ILZA 2OPPB 3QWPA 2AKWB 3QFWA 4MKYA 3MAQA 3PRVA 1SIZA 2C3MA 3E2DA 4QAXA 3H20A 4AXJA 5K9FA 4DL0C 3MEKA 3FSIA 4B3TF 1X7VA 4C8ZA 1RTHA 1K44A 3E2EA 5LXYA 3BDGB 4A8KA 3RR8A 4EBCA 1ALIA 2KT5A 4IOCQ 1UVNA 5ETNA 2XY7A 2XZDB 1FCAA 3K59A 1J5EF 2I5JA 1EX8A 5ETVA 4HTIA 3L7UA 4IQMA 4ENOA 3BS9A 3ULHA 5CD4A 1NJXA 1OIAA 4N7TA 3GB0A 3TG0A 1EKSA 1KVIA 5CYMB 5DDOC 4F4KA 4RUHA 2VV5A 5ETLA 5CCLA 3ILJA 2VQFF 3AXKA 3N01A 2W2QP 3IR5B 3PW7A 1X9MA 1KNZA 2Y9HA 3HVAA 2MZRA 2IBOA 2VG6B 4ZG9A 3HT0A 2K3IA 2KJVA 2F9DA 4ZMMA 3CD5A 1P9YA 2AEMA 2UXBJ 3DRPA 2NXUA 2VKZG 2JL9A 4CXKA 2CPIA 2HBRB 1D9AA 1GT8A 1VQLS 4CLSA 3R7SB 1S57A 2IHR1 4MYTA 1VBXA 3A1YG 4DR3F 2O66A 2RUSA 2MSTA 2Z2LA 3HT3A 3M2VB 5KFAA 5I3QA 2FJEB 5DLVA 5D4OA 4C9DA 1JLBB 2ILYA 1RA6A 2RU9A 3KXDA 4P10A 2GV1A 4KE5A 2R42A 3NVLA 1DAXA 4N56A 4TU7A 2J7WA 4WKRA 1MROB 3D67A 2BR0A 2HZCA 1S9GB 3AB4B 5L1JA 4NA1A 4WJBA 4X4NA 4LR2A 4YY3J 1Y11A 2GHWA 4ECZA 1D8YA 1UKUA 5FDLB 2MHEA 2WSEC 4GC7A 3K0JA 3V2UC 5KT3A 3CCRS 1WSRA 5IWAF 1HMVB 2AQ4A 1JNRB 4OLPA 1O51A 2ZJPQ 2FLLA 3HHKA 3A3PB 1MSWD 2RDDA 4DV2F 1Q78A 4FDIA 1IVZA 1UWAA 1XC9A 1E33P 4HI2A 3T6JA 3CMES 2EFVA 1KQSR 1FX4A 2HAFA 3ISZA 2V8GA 2W8SA 3EWGA 1U1NA 3TVYA 1RADB 2NZCA 2EC0A 4WP8A 4K0KJ 4OHXA 1RBOB 3DLGA 4ELVA 2QSFA 3N6MA 3KK1A 1RT4B 4M5DA 2QA4S 2GGPB 1UL3A 3LF0A 3ZXWA 2RSQA 3HHDA 3MFHA 4BHQA 4USIA 1VRTA 2QN6B 3MOZA 4DPXA 1U49A 3CJ3A 2E9RX 2E7VA 4X2BA 4QJVA 5T7LA 2K1RB 2XHWA 1FJGF 1HWIA 2PMZD 4AQYJ 3BPSP 4NLWA 1ALKA 1H98A 1LK5A 3NWRA 1MG7A 4CNZA 4UPKA 5KFIA 4P74A 4RJVA 4WTOB 3K5MA 2MB0B 3T6BA 2JEGA 1XTZA 2HFSA 3SCIE 2LA6A 5AE1A 2HHTA 4G1PA 2NPFA 2UXCF 4K2XA 1TMJA 3SQGA 4OJGA 3J80Y 1HQEA 4LF4J 4AUKA 3MZIA 2W7AA 2DNNA 2JLFA 1XNQF 3EXYA 1N5YA 2W8LA 1HKAA 1D1UA 3LP2B 4LF6J 2ZC3A 3AXMA 4ZVFA 2KFZA 5DG7A 1CULB 2DGTA 1WHVA 4WIIA 4U95A 1PKUA 1HHSA 3Q8RB 4Y2KA 2W2OP 1SC6A 3CMRA 2JDJA 2DGUA 4DV5J 3FMWA 1GK8A 1U48A 3GJSB 2ZH5A 4UT4A 1HI1A 3CE8A 4U6PA 1RSCA 2AJFE 4NYOA 1VJWA 3RBDA 3CJTA 1QDUB 4ECRA 4PR6A 1E1ZP 4NZ7A 4QOTA 2N7CA 1YK9A 3AT1B 4PWWA 4MIVA 2UXDF 2V69A 3UWTA 2GQCA 4O3PA 2XI2A 1YWXA 2K2PA 3GFHA 3BBBA 4N5SA 3OTBA 4KKOA 1T11A 2HNZB 4HL9A 4G65A 2XWXA 3CJKB 1VRTB 2HQGA 3MTKA 2JC1A 1XMQJ 4XTTA 2VHGA 1TKZB 5THWA 3BM7A 5HL7Q 3MR3A 2ZZMA 2OP5A 3QMQA 4ELUA 2KDOA 1R6VA 3D5MA 4CIOA 4C4WA 4AYBD 3M8PA 4Q0BB 1FEHA 3K8WA 1R8AA 2MKIA 1XMOF 1Q5VA 1OPZA 4DCPB 2E1MC 1RBAA 1H7WA 2RILA 3J7YU 3MOJB 1EAYC 3UR0A 3IGYB 2KT3A 3UCZP 4X84A 1OYDA 4A8XA 2NUUG 2G1DA 1YZ7A 1UZDA 4ZKAA 3T5KA 5AT1B 3QQCD 1X9SA 5DZ6A 3V6KA 1ZZFA 2DH9A 2FGOA 4PXEA 4NE9C 3JSMA 4EGLA 1ZEBA 1H6KX 4XIUA 3MPWA 1FRLA 5GMEA 1HDHA 2N4DA 5EGHA 3C16A 2OEJA 3MURP 3IRWP 2W9AA 3OR1A 1RLCL 3R5JB 1O8BA 4RLEA 4FXDA 3W2VB 3W3SA 2W2MP 1VQ8S 2IUCB 4WF9Q 2BJ8A 2CPYA 3PHTA 2GMJA 2E5GA 2XG8A 2YTCA 1R8BA 3UO0A 2X1FA 4DSLA 1R31A 3QLHA 1WOSA 1E6VB 1SJQA 4HR2A 2WSCC 3G6VA 4IKAA 3ZO7A 5L9XA 1KHNA 4F0MA 2GIQA 2MLZA 4ECSA 1Q8KA 2YNGA 3P5BP 3QGPA 5J2NB 3JYTA 4KKOB 2PI4A 2EFPA 2LQJA 1JXLA 5RUBA 3IC1A 1LK7A 4DR4F 1A7GE 3ILOA 1QAIA 4Z2XA 4NLRA 2CJBA 4CYRA 3ZZUA 1JXVA 2C3YA 3BZQA 3NS7B 5IOLA 4DX8H 1VJQA 2E5JA 2DD8S 3IAM9 1E3CP 3V6DB 3M8RA 1S1TA 3D9BA 3HX9A 4I67A 4TU9A 2Y1RI 3R6LB 2W25A 4FF2A 2QO3A 5KXAA 1UVJA 4GO7X 1SKUB 2MMYA 1HWJA 3MM8B 4NI2A 4TNOA 4RW9B 1YVFA 3FK4A 4A8OA 1WKKA 1AUDA 2NQPA 2QLFB 3FDSA 4CO0A 3LW5C 2XYHB 3QJPA 1NO8A 5J2PB 1TMMA 4OHWA 1T9TA 2FGCA 1VRQC 3BSCA 4TLRA 4F2SA 2LMIA 2ZUAA 4AL7A 2BQ3A 2KXNB 3GZ7A 2CIMA 4ILMA 4O3NA 3NKQA 4J9MA 2MEWA 3NNHA 3KK3A 1HBMA 4I6WA 2D74B 1SJ3P 2K3KA 4DCJB 1DLOB 2Z58B 1SHNA 4F4ZA 4QZVB 5IC6B 5HMWA 5H9FJ 1JJHA 3JQMA 3K5PA 1I94J 2M4MA 1T03A 5A8WB 3FQLA 3FQKA 4HI1A 3VGSA 5DM7Q 2QLWA 1REVB 4H4MA 3PX0A 1L3UA 1H0HB 4TXSA 1NK4A 4L6V3 1OO0B 1WC4A 3N6LA 5TJ3A 4B9VA 5CCMA 3DOMB 1GNKA 4G6VB 3IBCB 4JI4F 5CZXA 3N5BA 3M2RB 3MEEA 2KXFA 2HVZA 4DX7A 3L7OA 1I3OB 3NOGA 2KRBA 4EBDA 3NBPA 2EK6A 3VZHA 1ZYQA 4P52A 3TUJC 1RKIA 4DL4A 3C46A 1H72C 4URSA 3AD8C 1X4EA 2HS4A 3NMAA 1UAWA 3PNIA 5BR8F 3T02A 2EG1A 2XQCA 1GTHA 3V4IB 3QRRA 1GAOA 2V2KA 2XNRA 1SL1A 1UVMA 1CJUA 4YB7A 4NLGA 5INHA 3FKBA 3LPYA 1WC0A 4ED7A 3D68A 1D9DA 1YIJS 2HFOA 1TTHB 5HROB 3HVWA 4RU2A 2WBMA 5DQGA 2VG7B 4LRDA 2PI5A 5L1KA 1NDCA 2FZGB 2JC0A 1P1TA 5A0YB 3VAFA 2N82B 4TN0A 1E6YA 1SH2A 5C5JA 2V4JA 3LAKA 4L73A 3MEGB 2YWEA 4DDFA 3T1YF 1WC3A 4MH8A 4USMA 1SJ4P 3M8ZA 2HQIA 4HTJA 1UJ6A 3ZZOA 5KAKA 4DN0A 4ZVHA 2GLQA 2F4VF 1YKWA 3UCGA 4YQWA 5J2MA 4K4ZA 2FHJA 2ZD1B 4Z7YA 2YKQA 4HH0A 4ZG7A 2D1GA 1Q8LA 5LMUF 3V5RA 5U47A 2B9WA 1FE4A 1LEOA 3Q83A 4M5IA 2F65A 4KIAA 5DGAA 1HNWF 1S49A 4ZPWR 1S9FA 1XNRJ 2OAUA 3U1NA 1W7WA 2VICA 4KBIA 3A8EA 4L3KA 2GJ2A 4UQTA 4BDPA 3EDQB 4LRCA 4QWAA 3VQTA 4WFBQ 1TR0A 2FIUA 4DV1J 4KR0B 3MUVP 2ZH7A 3SZ2A 1NBEB 1IM6A 1GMUA 1NSAA 3CPWR 3N4WA 2IJRA 1G4CA 3DRSA 3D7SB 3CCTA 3GV7B 3PFOA 3PRDA 1F5BA 2XZWA 4KGKA 1VYAA 1DFDA 2B6AB 3M8QA 5GAHI 1F6TA 3IA0A 2W5VA 2KYXA 2ANHA 1JLQB 5E3CA 2MQ8A 3G8TA 4GKKF 3DDNA 3RRGA 3IN5A 2H51B 1JLFB 2KVIA 2XMAA 5I42B 4JBCA 3W60A 2F1FA 1FJEB 4RBUA 1Q1KA 2BJ3A 3KD8A 2AJ1A 2HWIA 2DR7A 1JLCA 1HPZB 4PXDA 2B8PA 3KLIB 3DLEB 3Q22A 4MMOA 1TK8A 3NGSA 3P49B 5HI7A 3ET6B 2B4VA 2LQ9A 1KQGB 1N2KA 1Q8IA 3OUYA 1VQPS 4WXWA 4OZNA 4JI6J 3K57A 4J9UE 2ASYA 5D3GA 5GMDA 5EGYA 2KXHA 4UW2A 1TKTA 1X4DA 5EGEA 3BDHA 3VTIA 3LP0A 1HNIA 1XWLA 2HMIA 3UDEA 4F7VA 1NHUA 3RBXA 2HFUA 2Q79A 5IQ6A 1RACB 3D1HA 4WP3A 1N34F 3QFHA 2DTJA 3HF5A 3UDLA 3K17A 2YNFA 5LRMA 4IDKA 1HQUB 2RJZA 4OYMA 4EYHB 5DG9A 1VQ6S 2RD5C 4KT0C 2G0CA 3QBCA 3K7RA 4JV5F 2KH9A 1PYOB 3KG4A 1HW9A 3GSDA 1ALHA 2P5VA 3TP2A 1PO6A 4CT9A 4GVLA 3DHXA 4MFBB 4KB7A 2A1BA 3D6MB 3UW1A 1ZM2A 4XK8C 2XULA 2MSSA 4WE1B 4WZMA 1N48A 5EUHA 3MAAA 2NPIA 1U1LA 5L46A 4WP9A 2AYEA 3DMJB 1IBMJ 4XO0A 4OJHA 5EX3A 3J81U 2VBWA 3POTA 1X4CA 2XSJB 4LF5F 4O44A 1NJYA 4XPEA 2VZ9A 5K8NA 4CTAA 1MU2A 2WSFC 5GADI 2LU2A 3MEDB 4ZPDA 5KFJA 3IP0A 5J1EA 4BCAA 4Z37A 3NAHA 2HVHA 1R43A 2VF3A 3EGWB 5LQQA 4FKYA 4RL1A 4QIGA 4P2MA 3A3NB 1K73T 4JYAF 2ZOMA 1H38A 3US5A 4E0DA 1YQHA 1BLUA 4R5PA 4YS2A 4CO4A 1OS5A 2QL9B 2HBZB 3I56S 1VRUB 3BGRB 4FKXA 1JLCB 4ERDA 4H4OB 3OVSA 2XNQA 3LOUA 3HD2A 3DGPA 1VC5A 1MMDA 4CYUB 3GLJA 2P6TA 2DRDA 3Q23A 2HFZA 5KFCA 2EW9A 1N54B 4NLPA 2AJ2A 2V2ZA 1EW2A 5A2QY 3RB3A 4FS2A 1Q82T 4Q8EA 3O2IA 1NUEA 1SC3B 4NMLA 1H73A 4NCGB 1IN0A 3BN4A 1FWKA 1D3WA 1KH5A 1O5JA 2E44A 1TV6B 4ED2A 2EKNA 2Z2YB 1B8JA 3AD9C 3M2UA 2EFOA 4F8RA 5HVFA 5HLFB 1GMWD 4CWBA 1NMEB 2R7UA 4FBTA 2FLNA 3HI9A 1FWPA 3CWJA 2AWZA 4MIWA 4K5SA 2RU3A 3T1HF 1C4CA 2DKOB 2XSFA 5KFTA 2Q1LA 5C42B 3DI6B 2WB4A 1YJNS 4P7VA 3GFYA 1T02A 4A4JA 2H3EB 1VDHA 5CYJA 1XBWA 3MCMA 4CTAB 4URQU 4OI1A 3D3CJ 4M5LA 4FXWA 1U0HA 4LVOP 1CG2A 3NKNA 2HWTA 3OTOJ 1ZTTA 1OWXA 3ZZYA 1WWHA 3BDEA 2PA3A 1CPZA 4J7CA 2IDEA 2VDIA 4X4RA 1RTJB 3THPA 4UZCA 4ANDA 3PY8A 4WPAA 2IDLA 3LGMA 3KLEB 1WC1A 2DY9A 1URAA 3PW2A 2GAHC 1I5OB 5LSRA 1WSVA 2PGCA 1R89A 2ERRA 4CH0S 2HPUA 3RUBL 1FKOB 3HDSA 4J9PA 3MMAB 2F8HA 5DLFA 4F67A 2CPHA 4OX8A 4U8VA 4TQRA 3HHNB 2JEJA 1S6PB 5GRRA 3KYLA 1OSDA 3U1MA 5D15A 2XS5A 3OT9A 3M30A 4OZ1A 2YWKA 3GE9A 1G7CB 4ZVRB 1FTRA 2WCXA 2LXIA 4TYBA 3CC7S 4PUOA 3G4SS 4NXNJ 4MK7A 4ZCIA 1Z4UA 3DNCA 3U7JA 3RB4A 2M2BA 2GVZB 4DL2A 5B0AA 3UN2A 4C8KA 4LFBF 1VISA 2EBGA 1LWXA 1WKJA 1RB0A 2QLXA 3FEYB 2J5AA 3I31A 1U09A 1TL3B 1RT7B 5KOWA 4EUVA 3V6JA 4NYPA 2XR9A 1JJ2R 1YBUA 2LDIA 3LALA 3PVXA 1TL7A 4OIXA 4J90A 4EBEA 3CJ0A 5L1LA 1BWVA 4KYZA 3N28A 4Q5VA 2X98A 2GHVC 5IM0B 1LFPA 5K8PA 1V3ZA 3UD5A 4EZ9A 2Y8WA 4W92B 3UI3A 2GIRA 1WJ9A 3RRKA 3ZNJ1 3FGVA 1ZETA 3I4PA 2R4FA 5GAEI 2LYVA 3ISND 3C14A 3VGVA 3MD3A 3AJDA 4D3HA 4NEYA 2CQ1A 1TKXA 2W24A 2W5SA 1DTTB 3NG8A 1PILA 3DRXA 1YITS 4RNFA 3W2WB 3Q8PB 1YX2A 2XMWA 1TKDA 3PZPA 1U1RA 1RISA 4WK3A 3VAHA 2OJ3A 1GX5A 4WIQA 2IYGA 2HLUA 3MGJA 1QY7A 4DUYJ 2VC1A 4DF8A 3P4UB 1XR5A 3UN3A 4J5OA 4X64F 3K5OA 1CS4A 1K1QA 3RAXA 2AGOA 1X4BA 1SUQA 4C97A 4FZVA 1FESA 1XK8A 2M88A 3ZTOA 2D3ZA 3V81A 4MAKA 1KH9A 3CJ8A 3TQEA 1L3SA 4F04B 3TUIC 1CJTB 1YG0A 3LGNA 2W2PP 5LMNJ 3E01A 2LQ5A 3OTDA 3QAUA 3UDCA 1SCJB 4ED4A 3QIPB 2F8EX 4B3SJ 3QO9A 4DPTA 3KHRA 1IBKF 3P96A 1OMSA 1LNQA 1ELXA 2C2OB 3HVRA 2DNZA 1R0AB 1RT2A 2B5JA 3KMSA 3VCDA 2DT9A 3MM7A 1SVDA 2CWXA 5L0BA 5A76A 3IRXB 3QPIA 1N33J 4I2QA 3MR5A 1PSDA 3F73A 3ILLA 2BDPA 4J9OA 1AXQA 2ZBQA 1N32J 1WTFA 1BGXT 4DPUA 3R5GA 1ZBTA 5DM6Q 4B3MJ 4KFBB 4DU8A 1QSSA 2ZJQQ 1BQMB 1ZM3A 3CD6S 4NMXA 1KOOA 3OJUA 4RW8B 5BJRA 4NXMJ 2J6SA 4IFYA 4USKA 2YQ1A 1TP7A 2F9JA 4S0MA 4U8YA 4HACB 1KLMA 3J81Y 2JVRA 5KFGA 4DR5J 3NS6A 2VJUA 2OGUA 4KRWA 4DS5A 2HRYA 1JKHB 3DYAA 4ANCA 2OMLA 1X31C 3GWCA 3M32B 3M1VB 2QV6A 1SXLA 3HMJG 1N5VA 4V1Ak 1C1BA 2FYXA 1R0CB 3D1OA 3LAMA 4JI3F 1XJWB 2Q3PA 3Q8SB 4DL5A 2VD3A 5E0OA 4AD6A 2CPJA 1TVRA 2CJQA 1FRMA 1YBTA 1KH4A 2UUBJ 4ZVOB 2VFVA 3SSQA 4Q44A 2ZZTA 5HVGA 5HMZA 3TWZA 4PABA 4WCEQ 1X5TA 3AAWB 4F4XA 1VCTA 1VIOA 2EI5A 3ZFVA 1WD6A 2VDHA 1XERA 3CB4A 1D0EA 3B82A 3OFEA 1J2VA 2YKOA 1EP4B 4ZITA 2JFDA 3LUYA 3DLKA 1IR0A 2OPQA 1KSPA 4ZLLA 3QZ8A 3IGVA 1UFKA 1IBCB 2WONB 2J9CA 1NSKL 5MAOA 1MN9A 3ICLA 3FBBA 2LCWA 1PYSB 3BBCA 1GXUA 3Q86A 1G6BA 2CXEA 4ES3A 4UZBA 4LSZB 1U26A 1RT5B 1KHJA 2CJYB 5F9NA 2HIYA 1YBAA 3K2YA 1RCOB 2DXFA 1N6QB 3KUHA 1SBRA 4EI2A 1LWEA 3GJRB 3H5SA 2MQLA 3JS9A 3KJNB 3GYGA 2MKCA 1NJIT 3PKMA 3V6HA 4USUA 2OPRA 3HFKA 3LA0A 4U7UD 3MCOA 1FKPB 2WHOA 1HWUA 2EG2A 4Y2CA 2H4YB 3DHWC 5DG8A 4DR1J 5I4MA 4PAAA 4PQUA 4O3OA 4DR2F 2IIHA 3BKTA 4O4GB 3H2VE 1S97A 2B4PA 1L3TA 3MMCA 4JUZA 1T3NA 1TL1A 1LKZA 1S1UB 4JI1F 1X4HA 3QATA 1DARA 3H8YA 4G1QB 4EFAC 3BGUA 2RRNA 4C48A 2GO9A 5D4PA 4XDDA 2EXUA 3KG1A 2R9LA 3SMZA 3EX7B 4B9NA 2K8GA 2Z2ZA 1S0NA 2VQEJ 5KFZA 1PAEX 4OV6A 4NL5A 5M2RA 1ZM4A 3KFWX 1SJ1A 4A48A 1JXEA 3BYPA 3DU6A 2V6AA 2RS8A 1BQXA 4X4UA 4M94A 4IQXA 4KAIA 2QT7A 3TA2A 2V8VA 3DXBA 1UW9A 3D1QA 1T8EA 4E98A 3HHLC 1VQ4S 3NNAA 1SB6A 2VPYB 4YN3B 1N2LA 2YWWA 3CO9A 4PZVA 1XMBA 4OZ3A 1Y5NB 3R7BB 2XYGB 4X4TA 3HFVA 4Q45A 3VWSA 4DV4F 2Y1LB 5KFLA 1SPBP 2C3PA 2J76E 1SJRA 2MLXA 3DRYA 2CQDA 1KBRA 5AJ3F 3PX6A 4ZVTB 2VA3A 4CLUA 5SUHA 3QT7A 1KP6A 4OYXA 1EZZB 2GMLA 2GMHA 2HBQB 3MMCB 3G8QA 2RKIB 1Y5LB 1IQZA 3C6UA 5AXLA 1WOPA 2YWHA 1M5OC 3P6YC 1SH3A 2W9BB 2BV3A 2BYCA 4ED8A 3FSYA 2C3UA 2DO0A 4B9UA 3M8YA 5KG6A 3SFUA 2DVIA 4X66F 3RU0A 2WZ1A 4P71A 3THVA 2FLPA 3H25A 3EJMA 2A10A 2JJ4D 3PX4A 4L3NA 2R8GA 3WQPA 1HNXF 1LW0B 4ES1A 2OIHA 4UOOA 5LJ3Y 1U6ZA 1YJVA 2L48A 1JIHA 1PJ6A 3OBIA 4ELTA 2B4OA 2C2ZB 3Q8YA 5KT6A 4FYDA 3RJMB 1N32F 2E7XA 4F3OA 5HANA 5JUMA 1NPKA 5J2QA 2OEKA 3ILIA 1RDRA 1YJUA 3IMQJ 1ZZNA 1G3OA 3OV7A 4LMZA 2E1PA 2CQGA 2OTJS 3SDEB 4JI5J 4HLBA 1B7YB 4L75A 1T3OA 2EVZA 5IFMA 4RW6A 3HCXA 2MQOA 2BJ1A 4DV0J 3B6BA 3SCLE 3OTCA 3ZZRA 2HEKA 1NK0A 4OMFG 3NOCA 2LKZA 5ETQA 1HBNB 1P6TA 1QE1A 1S9EB 4FF1A 4MYUA 4MIBA 1IKXA 3QNWB 2LEPA 3EGZA 1CJKA 1UVIA 5ETKA 5FIIA 1NSQA 3DOKB 1JLAA 4B3OB 2ZNZA 1QAYA 4DR6F 4FNHA 1IKWB 3M6WA 3AOAA 3LWLA 3C6UB 1ELYA 2XCPA 4ICLB 3F41A 3MR6A 3KJFB 1ZTWA 3JTOA 3R1LA 1I6JA 5DLWA 5KG2A 1M5KC 3MPYA 2L3MA 4BS2A 2VFUA 2BZ2A 5IQQA 1X4AA 2LEBA 4YB5A 3JSRA 3M9MB 3P45B 2YPYA 2RH6A 4J91A 4GTYA 5F0WA 2HNDA 2MKSA 2YKMB 3D28A 2KRRA 2G13A 3W64A 1DHMA 4HT7A 5L8RC 3G82B 3JQJA 3TUPA 1NK7A 1KFDA 3X1LB 5E33A 1RHQB 2GVDA 3HD1A 2V0NA 1LV5A 2HZVA 3T5JA 4DV7F 2YX7A 3CW2C 2VODA 2OD6A 5G4DA 2DPJA 2Y3YA 3JAMU 2H4WB 1RTDA 2W9CB 2ZM6F 4ALZA 2CG8A 4DUZJ 5KG3A 3SZYA 1HFEL 1DURA 2XMKA 2ROGA 3C6TB 1EHWA 1SC1B 3OLAA 1T9YA 2MZTA 2ZBIA 3EZUA 4DJBA 2R2UA 3D6HB 4CLTA 1S1WB 2RQKA 3FCVA 1RT6A 5I3UA 4LF9F 2AT1B 3FBEA 1Q95G 4K4UA 1XIQA 1UJ4A 4KHPJ 2R7TA 2ZH1A 5KT5A 4PWDB 1IKYA 1T94A 2HRUA 2E7WA 2E5HA 4LR7A 1MWQA 1S6QA 1REGX 2FY8A 3FCHA 3PDNA 4ER8A 2MXYA 3TEGA 5DRKA 2EBEA 2V68A 4B9SA 5DLGA 1KHLA 3G6ES 1VIXA 2XCAA 3DU5A 2LXFA 3TJAA 1U4BA 1S77D 3S6EA 4OYWA 2WVFA 2Y0BB 4KV8A 3GIIA 1HBUA 1WOOA 2HG4A 2F63A 2E5LF 5KFVA 3NKYA 3MM6A 4GVBB 1ZM9A 2XLIA 3I0SA 3T5HA 2GCFA 1UA0A 2WOMA 2YNIA 3NP5A 3IS9A 2UUCF 3UD4P 2BE9B 5KT7A 1YDLA 5KFPA 2V4QA 2V5HG 4PEOA 4RW7B 1X5OA 1CC7A 5KTQA 4C11B 4ZCLA 4ZDNA 5CYQB 1XEZA 1BQNA 5BYSA 3CCUS 4M5KA 4DV3F 3J7A1 1N56A 3ETMA 4JV2A 1DQ8A 3OPKA 1FVQA 4GTXA 3HZGA 3W9JA 5D0GA 1GFWB 4LF7F 1VGYA 1S1XA 2BACA 4DZDA 2KU7A 2CJAA 2PD1A 1KH7A 3OFHA 2MZSA 5L39A 2BANB 1YHQS 1M90T 2G9OA 3WX8A 4PRFA 2X7IA 3CJ5A 4ED3A 2FJWA 2ZE2A 2DITA 1PGZA 1IQTA 1N0VC 1CJVA 3PJXA 3R97A 2BRKA 1UETA 4K8RA 3L3CA 4IOBA 4GKJJ 1ACMB 3MECA 5ETSA 2DHSA 2XLKA 4Y65A 1HWKA 4USJC 2HW3A 5AE2A 2YWFA 4YHHJ 4USHA 3BREA 4JI7F 3C15B 3P5TL 4D3GA 2W5QA 3O6QA 1EW8A 2ZVIA 1VK8A 4I2PA 2QL7B 2CVEA 5LL6d 4OV1A 3TANA 1S79A 2IAJB 2MPUA 4KV8B 1T9UA 4YDDB 2NXEA 1LWCB 3QSIA 6AT1B 4E2FB 4ED0A 3GG0A 2QFIA 2NZ4A 1B0PA 2U1AA 4ZP8A 4LIRA 1T05B 5ETOA 1QTNB 1F2HA 2VG5B 5AE3A 4MJKA 4DPWA 3MM5B 3H40A 4LFAJ 2XMTA 4NWXA 3CD0A 3I6PA 1N36F 4IG3A 4O3RA 3T41A 4ZA1A 1VBYA 1ULRA 3H5UA 3A8JA 4FF4A 2PSZA 4X62F 2XBPA 1HBOB 5AXNA 2J0WA 3W7BA 2RE1A 2BBEA 1RT1B 3AD7C 5FLXU 2P9EA 1C1CA 4J9LA 4CZCA 4PG5A 1EQJA 1X60A 4Y2IA 4HKQA 3DN9A 4RUCA 3CCJS 3IR6B 2CNOB 4CO3A 1NJWA 2XC9A 2HGLA 3C2PA 4HVZA 2MKJA 3KLGA 1HQAA 1KONA 2G2OA 1VQOS 1FK9A 3CCSS 4TU8A 4I68A 3T3FA 1F2GA 1VOMA 2D3O1 4UTGA 3FEZA 2N4CA 4EZ6A 4FPIA 5C24A 3UCUP 2OPSA 5G0RB 3KJVA 4DXLA 1IKVB 2LDYA 2POKA 4GTWA 2C2EA 2JRSA 3ISNC 2UV8G 1WI6A 1C0UA 2D9OA 5CH7B 3TRGA 2HYIB 2V9KA 4NRUA 1PBAA 2DGSA 3PEJA 1S99A 2HNYB 5F8LA 1GXTA 1SJFA 2DNQA 3I82A 2KFYA 2QGFB 4ZJLA 4DQRA 1GX6A 2JZ5A 3AH6A 3CDEA 3CDAA 4K4WA 2IC3A 5ADZA 4LQ9A 4CO5A 5HP1B 2HHHJ 4USVA 1HNVB 3M4XA 1R3NA 1HIYA 4YDXA 3BF4A 2C2NA 3H7HB 4M5NA 3TZZA 1CSJA 3LQVA 3Q2SC 3SZZA 2DR9A 3MM9B 1AZSB 5GMKa 3EPIA 3NMRA 5IJSA 3OR2A 5A8RA 2HQDA 2MZJA 4UOCA 2W5TA 1UPPA 3NGKA 4NZ0A 4L74A 4DU7A 1AYEA 1JLGB 3K8VA 3BO2A 4J37A 1URRA 2YKNB 1ED8A 5H9EJ 1RWMB 2HHXA 3R5CA 5B08A 1U7LA 2HRTA 2BX6A 3IGZB 3BQ2A 3CCVS 1H74A 2BOAA 4RW4A 2WB1D 2G2YA 1ZAXA 2IMOA 2PDAA 5EX0A 2GW8A 4DG1A 5A8KA 2OFHX 3HVTB 1DQ9A 5KOXA 4KJGA 2W4PA 4OL8A 1VLOA 4IUFA 3IWXA 3R7NB 1WC5A 2IY5B 2BXJA 4MK9A 3KJVB 3DPCA 1NZAA 2V67A 1N5SA 4KJDA 3DRRA 5EWEA 2F8MA 1RWPB 1JLEB 3NEKA 2CNKB 4CXSA 4FN5A 1VFJA 3VZIA 3JAMY 2CNNB 4KO0A 1HW8A 4EO8A 2R7OA 4MKVA 1IWGA 4DN9A 4F3MA 3BKFA 3H4BA 2UUAJ 2IC3B 3GP9A 3EPGA 1J27A 3GYNA 1VR6A 4RBTA 2Z0GA 1NK9A 1H3DA 1S6UA 1FKAF 4OX9J 1F5CA 3IM9A 2RRAA 2YKAA 2NSBA 3R6GB 1UWBA 4UOPA 1RCXB 1IBLJ 2ASLA 4HDGA 1KQKA 4OZ5A 4X65J 4OFZA 3LP1A 4Z7CA 3SV3A 4FVCA 3ITHA 2CG4A 4MKAA 2EWHA 2MGZB 4IH6A 4J9RA 5EHHA 2GJIA 4I64A 2ZHBA 1AB8A 2UU9J 5AJ9A 3PYDA 5GAGI 2IVYA 1LW2A 3PIOQ 1QSLA 1WG5A 1VQYA 4LBIA 4KHRA 3UE2A 3ZC4A 2MY7A 8ATCB 3UFCX 4DV6F 1RTHB 5C25A 2XMJA 1V3SA 2X1AA 4IFVA 3BJYA 1U02A 4LIWA 9ATCB 2AD9A 3M9OB 2VOPA 1WDDA 1VS3A 1RLDA 4UUXA 4ZVSB 4KGZB 3W5XA 3Q0AA 2JEFA 2I5JB 2NCKL 3GJTB 2V2QA 4DSFA 3ZTSA 4OJ1A 2XEXA 1LWFA 3OL7A 3EVWA 3GMGA 2QE5A 3JSYA 4DL7A 3O1LA 3Q2TC 1ELOA 5H1SV 4ZN1A 3TEHB 2DHGA 2W4DA 1BY9A 3WAXA 3HXMA 2HSEB 2V63A 1HR0J 4OYPA 3CCLS 4LFCF 2FZCB 3N79A 4DQSA 3MMBA 2B4UA 2A6MA 2GSUA 4NASA 2DBBA 3I96A 2BM1A 7FD1A 3BGLA 4WFYA 3RR7A 3WC0A 1HNZJ 3L09A 4HH1A 1N5QA 2C22A 4URGA 4NYZA 1F3VA 2VPWB 4LF8F 2QMUB 2EFNA 3T9ZA 3DRPB 2J6UA 1Q79A 1YJWS 1S72S 4DCOB 2SXLA 4QWDA 5LRNA 4USTA 5E3AA 2IFXA 1UZHA 1UWBB 2RDJA 4ECUA 2Z8QA 1FRJA 3LP1B 1WHYA 4LRFA 2FHOB 1EQMA 4OI3A 2FVRA 2HWHA 5CAAA 4I6AA 2ZOGA 1K1SA 3I0RA 2W8DA 2ATCB 4LRAA 3RAMA 2RF2A 2FHMA 1RAOA 2Z2MA 2Y0SD 3CMAS 5H9FK 3K89A 1RGVA 4B3RF 1EETA 3LWMA 1RAJA 2HLTA 2FY1A 4AE5A 2DNLA 3PIPQ 4NX9A 1WELA 4NLUA 3M6UA 4ZJQA 3OL8A 3I5CA 3IXQA 4W4MA 2VJVA 2DYAA 2IRUA 2ZEJA 2F7VA 4C6AA 2N3LA 4JI2J 4PPZA 4JI8F 3W66A 4PPDA 3BB5A 3GIKA 1S48A 4ZK7M 2AF6A 4DR7F 3BGOP 5F8JA 1RYRA 2ZOFA 2AJ4A 5HQLA 2FPHX 3W9HA 5SZTA 3MAHA 4C0HA 3KUEA 4XPCA 4ZLPA 3DLGB 1JJ4A 2J8AA 3KK1B 2BRLA 3Q8VA 4M5DB 1RT3A 1IJFB 2J0XA 2CJKA 3WIVA 2HHUA 5B0FA 5HMYA 3PW5A 4ED6A 2ACYA 4CH1A 2CNLB 3VF0B 3QGHA 1WACA 3IBFB 5KG5A 4R0JA 2CDRB 4CM2A 4NRTA 4P9SA 5BYQA 4HDHA 1HYSA 5T7LB 4HEA9 1OQ3A 2AYGA 1JNZB 1GMVA 2QYGA 2I8EA 3IG1A 1FEEA 4B9TA 4PXBA 1H2UX 1SHQA 1EQ0A 1O98A 4YUDA 2CQIA 2RDIA 2AU0A 2KL8A 1VHFA 3R1HA 2WVEA 3TA1A 2BE2A 3UVJA 6FD1A 3GONA 1SV5A 1FTCA 3CO0P 3OD2A 1RU1A 3GV5B 5GADU 4IRCA 3JSBA 4IG0A 2RF2B 3SQGB 1G2EA 1FFSB 2IJNA 1C0TA 1HQEB 3AA9A 1IUJA 2ATLA 1QD1A 4PYDA 5HAOA 3RYLA 1N5YB 3KK2A 1DTQA 2GIFA 2LP4A 1VQMS 3EGVA 3NKMA 4QYRA 3T19A 3KLFA 2ZHOA 3D0HE 3TAMA 4B17A 1Q7YT 1URBA 3T00A 1NSPA 3NCQA 2I38A 2X3DA 4FYXB 3DOLA 1KTVA 4ECQA 1AJAA 2MHNA 4MY4A 4A47A 1T9WA 1UEVA 3BN7A 4ID8A 3LTOA 1F3FA 2UV8A 4QIWD 1XR7A 5B0DA 2EK1A 1NKEA 1SH0A 2UVWA 2VPZB 2H48B 4BC9A 4LSNA 1UW4A 4NWBA 4I7FA 3G9CA 1V5IB 5HK4A 2UXBF 2GQQA 1S0OA 1VMBA 1RTZA 4IYQA 4GRSA 4F26A 3GV8B 4CRJA 4P6QA 3W62A 5IC4B 4JI0J 4ID5A 5DDQC 5E41A 2Q43A 4GO5X 3NNCA 4TY8A 1RTIA 3CXCR 2XZTB 1UFLA 3QT5A 3TNVA 1FXLA 2DCLA 2R8JA 3BSNA 3KOAA 3A12A 2A3JA 3CMQA 3M8PB 4V19X 1WEYA 2GFFA 4B3TJ 2DGOA 3IFEA 2JLEA 4IH5A 4UF4A 2MQQA 4MKBA 3G96A 2AGPA 1FXDA 3VGUA 4YY3F 2FD2A 3M8WA 3W65A 1HI0P 4DEZA 1H2TZ 2DY1A 1J5EJ 1RHKB 2AJ0A 3IDDA 1Y6VA 1NDPA 2MY8A 4CLLA 3HSJA 2G2ZA 4ZVUB 1S1VA 4ZVQB 3D3BJ 2IJFA 1OYEA 3G2XA 3JSMB 3O44A 5HJYA 4LSLA 2V2VA 1IJEB 4R8UA 2HVEA 1F0XA 2YNHA 4OZLA 4CNYA 2CAJA 1UA1A 3C16B 3OR1B 4P75A 4ED5A 5F9LA 2WRMA 1NHKL 1P49A 2M8HA 5EDWA 1A9NB 5K4PA 2B9XA 2QMXA 3GJQB 4K0KF 1IWAA 2VQFJ 5KFUA 3KUGA 3PTWA 2HGMA 2DCUB 3UR3C 2M5YA 4X4QA 2I2YA 2PFDA 1FDNA 3NAIA 2HVDA 2BE7D 3HZEA 1VQSA 3BO4A 1B70B 3QLHB 2RH3A 1WF1A 3CDBA 3OHBA 3DM2A 2CFXA 2XS2A 3TVKA 2YNGB 4X4SA 1YRTA 3SI8A 2HS3A 1AT1B 3DFEA 3JYTB 4USWA 2JHEA 1FA0A 4QPTA 4AQYF 3H42A 2ASDA 4DR3J 2F40A 4OI4A 4FYVB 2ADBA 2FVQA 1AROP 1RI7A 2RUGA 2QFJA 2BA9A 1KDNA 2HHVA 3MPUB 2DIVA 1SQGA 1V9OA 1WG1A 4HHUA 5K14A 2R8IA 3TO8A 1K8AT 3AODA 3I32A 2B9EA 3GR1A 3B5QA 1S1TB 3PCOB 2OSQA 1K0VA 2PE8A 3PO5A 3CT9A 4LF4F 1QAXA 1BMQB 3MK0A 1TZ0A 3UNYA 3K5NA 5KG1A 2FHJD 3CUNA 4QWCA 5IWAJ 3HM9A 4NI2B 2MQPA 5F8IA 1QUPA 5C66A 1ANJA 4LF6F 1RUSA 4LF2A 4WFAQ 1ROFA 1WHXA 2GZOA 4DV2J 4Q2LA 2RAQA 3CC4S 4FDFA 5GAEU 1ED9A 4YFUA 2DEIA 3KJQB 3FC9A 4R8UB 4YB6A 1YI2S 3NCRA 2R7SA 4ZHRA 3C3LA 3LPEA 1RAHB 4C98A 2XMMA 4DV5F 3CC2S 2QA2A 3QJJA 3KLHA 3VQSA 4X4PA 4GC6A 3SBMA 1Q86T 3MPDA 3PO4A 3TA0A 2GJFA 3KK3B 4DQPA 3HKWA 2ZH8A 1HBMB 3OHAA 4QYZK 4H54A 3IWNC 3NLCA 5JVGQ 3AQOA 2UP1A 1FO1A 4N47A 1O6XA 5HBMA 3R2DJ 1NLKL 2PT0A 4U67Q 2QLBB 4CH7A 2LU1A 4QW9A 1T03B 2HKEA 4CLKA 1XMQF 2AYBA 4JB8B 4ECXA 2OPPA 1FJGJ 4H4MB 2VFRA 2AJQA 4WU2A 2ZH4A 2KTQA 4W98A 2IA0A 2VH7A 4RNOA 3R27A 4WU3A 1MNEA 1FFWB 4A8YA 2DNOA 3OTEA 2JH3A 3MEEB 1TQLA 2PC6A 3BDGA 2QA4G 3G8SA 1FD2A 4OJ3A 2VC0A 3C19A 1WEZA 3RB0A 3NBPB 2B8QA 1LOUA 1VC0A 2UXCJ 2XGQA 3Q3QA 1KD1T 1X5SA 4C8MA 5CABA 2A6OA 4YR2A 3P8BB 4PG7A 2KZMA 2B3TB 1XNQJ 4NLDA 4K4YA 1F60B 1HD0A 2ROPA 4ZPAA 2MYFA 2FHKA 4U7UK 4UQGA 5CYMA 1CJUB 3AJ2A 1S0MA 1M5HA 3MD1A 2VQRA 1N5TA 2GO8A 1TUVA 2ASJA 1AJCA 2O3DA 2D41A 1FRIA 1V5VA 3O3LA 5KFMA 2R8HA 2UVUA 3DLBA 1U1OA 4QPXA 1BD6A 2PEBA 4QCLA 2VG6A 1DBDA 2ZBPA 2BM0A 5L9NA 3GILA 1RAEB 2XS7A 1E6YB 3ZZZA 1SI9A 2V4JB 2XO7A 2UXDJ 1EKRA 5HN0A 1Y3KA 5KFHA 3QRPA 3HJFA 2BQRA 3CCQS 1WTBA 2OFGX 4NCBA 4YB1P 2M7SA 2FTRA 3VAMA 5B09A 5J2MB 5E3RA 2N7YA 5C2CA 2HQ3A 3PW4A 3CEDA 4PG4A 1RHJB 1NEEA 3M2VA 4YR0A 3AQPA 4ETZA 2HK3A 2B9YA 1UP1A 1MLAA 3H5XA 2NYHA 1JLBA 4G3IA 4ZOSA 4QWEA 3LO3A 1QTMA 2B56A 1XMOJ 5KFKA 2LQ8A 4DMZA 1MROA 1Y10A 2OSRA 1S9GA 2KT2A 2ZH2A 1RAFB 1YTYA 1QVFR 3VAIA 2BJEA 2D3OR 2CDQA 5FDLA 2C2KB 4O23A 4K4VA 3F44A 5D8HB 1HMVA 1VQKS 1T9XA 2D3UA 3TW0A 4C8YA 3DC2A 1MW7A 5ETMA 2W5XA 1T7PA 1U6BA 4B9LA 4DLEA 2RRBA 1JX4A 3DRSB 4DL3A 1GXLA 4UOHA 1S6OA 4TVAB 2OD4A 5L1IA 2C42A 1WDTA 1QUVA 3M8QB 2KM8B 4O3SA 2X1GA 2K7JA 4J9QA 4DSJA 3VV2B 5L38A 1PC5A 1YRUA 2OH2A 2HGNA 1RT4A 2CWKA 4LQ3A 4LVNP 2RHQB 2GGPA 2QRRA 2V94A 2CA9A 2HFVA 2R7VA 2DNMA 3OXGA 1NPPA 2VASA 1KTQA 2I9SA 1I94F 1VQNS 3B8HA 2WW8A 2D69A 4F4WA 3WBZA 2P9CA 3WHIA 2K1RA 3OUYB 3F56A 4OQJA 1WNEA 2CPEA 2EEYA 5D3GB 1G1XA 2V8PA 2BUNA 1TKTB 4DR4J 4NCAA 4FBUA 3LP0B 3ZTPA 1HNIB 2OHDA 2ALYB 1UEUA 2HMIB 3BPDA 1NZ8A 1PIEA 1M1HA 1Y00A 1QSYA 4OI6A 2IVFB 1RAGB 1UVLA 2FVCA 2BKOA 1U2FA 2HK2A 2CPXA 4AL5A 3HHEA 3VVTA 2YNFB 2ZBCA 1SKRA 4IDKB 3H98A 2QG9B 3CVKA 2L08A 3GR0A 4MT1A 3MPVA 3CCZA 4RWXA 5D4LA 4DHVA 1JK9B 4K4XA 3LP2A 1V3RA 4ZJOA 2C1EB 2XWYA 3PW0A 4I56A 4TYAA 3T01A 5C7PA 1CULA 3MAAB 1TK5A 2E5IA 4WFZA 3POTB 1VHIA 4O44B 4A8QA 1AJDA 2R8KA 1MU2B 3J7AN 1SC4B 2DNPA 5J1EB 1CQMA 4F3QA 4RZRA 2H5EA 2H5JB 2LEAA 3QZ7A 1YLXA 1UEKA 2IPOB 2UUWA 3CNQP 5HQ8A 2CJXB 2KO1A 2B51A 1M0SA 2XY5A 3LXQA 3HSGA 4R5PB 3OXLA 3PYGA 1J5OA 1GTEA 4QQBA 4ZP9A 2HNZA 3S8SA 3CJKA 4QR1A 3M6VA 3SIPB 3B4DA 1KKHA 1VQ9S 1F9FA 2FC8A 3DGPB 3SYZA 4DBQA 5K8OA 3D4JA 4YR3A 2A2DA 4CLYA 1TKZA 1PJ7A 3ZTRA 5E3QA 2NLWA 1TAUA 4Q0BA 5DQHA 2J7KA 1UFWA 4JI4J 3D6FB 1XNRF 3QIDA 3UN5A 4DWIA 3TAPA 2YX4A 5K5MA 2YH0A 2YQ3A 1DY3A 3T9NA 5I3PA 4X4VA 1GEHA 3U27A 1RXOB 2W2NP 4M63A 5KG0A 4LBHA 2VPXB 1OY9A 2HURA 4DV1F 1FJ7A 3TAQA 3M2UB 1RWVB 1JB0C 2G0IA 1AW0A 3FSXA 2Z30B 5BR8J 2J0QD 3W5ZA 3G6XA 1U0SA 4EWTA 3QT6A 2ZVSA 2DRBA 1TUGB 2XY6A 4EO6A 3WBHA 1QM9A 1OSCA 3W2VA 5KFOA 2KG1A 5KFYA 4ED1A 4U9RA 2ABYA 4UY8T 1QJHA 2IUCA 3W9IA 1A6LA 1HHQA 3LANA 3CDWA 3W8GA 4MIAA 2VFTA 3MI7X 2VOOA 4Q2MA 1U0HB 3I9V9 3TR5A 3TOQA 1PG5B 1E6VA 4ZS6A 5C2GA 2AHOB 3T1YJ 4JV0A 2DNHA 1B64A 3PR5B 2EFGA 3RB6A 1J5OB 5J2NA 3EZOA 4JI6F 2F4VJ 2IM0A 3TVZA 3EXCX 1R8CA 1CC8A 3Q8UA 5LMUJ 3KHLA 2M70A 3MDFA 4QIFA 2CZ4A 1VQ5S 4TN2A 3SEOA 3BV8A 5BYRA 3P3DA 2E1CA 2HFNA 4R25A 3AA8A 3ZZPA 3V6DA 3UQSA 1HNWJ 2RNEA 3M30B 4DSKA 3NKPA 2NSCA 4FDJA 3BYRA 2O5DA 1R27B 5IZHA 4C8LA 4PUOB 1PCAA 1NM2A 1S7HA 3D66A 2L9WA 3MM8A 2Z4PA 4RW9A 2ZZNA 3EUNA 2J0SD 1O0PA 1QAJA 4CLWA 2O1PA 1V6HA 3EDRB 3ETOA 4LREA 1NK8A 3MTJA 1IBMF 5L0KA 5J2PA 3OVBA 3TX0A 2YWGA 4C0OC 1B3TA 1UCNA 4KM4A 1VK3A 1NH8A 5KFFA 1ZAWA 5FD1A 1ZEFA 1WHWA 4DOZA 2ZH6A 3I4HX 1TL7B 1F1BB 1U2CA 3ENAA 3MR7A 4GKKJ 3PACA 2FB0A 4KJIA 2MKYA 3RTVA 2E29A 2AZ3A 1NJZA 1FI4A 2YX1A 1LFWA 2DEJA 1DLOA 3CTRA 3R5AA 2R2SA 4A8SA 4K4SA 2HBYB 4BC7A 3AB2B 1SKSA 4P2XA 1S76D 5CHCB 3MUTP 4UUWA 3A13A 2M8DB 1X4GA 1Q8BA 5A8WA 5K8MA 3AOCA 2N3OA 1RK8A 3C14B 2L41A 3GIJA 5MLCV 1S5ZA 1B0VA 3ADAC 3PV8A 1REVA 4I6YA 4CP5A 1TKXB 5KT4A 2MJUA 4NWJA 2LVWA 4ES2A 4FNIA 2XI3A 3DOMA 5F8MA 3M2RA 4Y00A 4O3QA 1YJTA 2R2RA 1N52B 5B7WA 2M3DA 4ZP7A 3HFZB 4MTPA 2NXCA 3H90A 1L3KA 5CA5A 1N34J 2VB6A 2R7RA 1OJ4A 4Y3CA 2Q66A 5D4NA 4CO2A 3KMQA 9RUBA 3FZ2A 5KFRA 2ALZA 1CS4B 5KFSA 1TK0A 3PYEA 1SUQB 4JV1A 2ZHAA 7AT1B 2JNJA 1X8DA 4W90B 4JV5J 3V81B 4A8FA 3OXFA 4ETXA 2KKHA 3V4IA 4PG8A 2ZWOA 3M8SA 5F41A 4KGMA 4HHHA 3F0NA 4PWUA 1HJKA 4I0WA 4WKYA 5A2QU 1JQGA 4UORA 3VR1A 3E01B 3ZZTA 4LF5J 4WYLA 1WF2A 4DI6A 4V19J 5HROA 3NS5A 1EARA 2CUYA 3QO9B 1TL5A 2VG7A 4IO9Q 3SFGA 4WK1A 1RWUA 2CQCA 2P8IA 5A0YA 4NLYA 4UPLA 2MKKA 1RT2B 2B5JB 3OTOF 2DHAA 5JVHQ 4JYAJ 3MM7B 1FNXH 3MWBA 2COLA 5LJ5Y 4I2QB 3MEGA 3GCWP 4BWJA 1IXKA 3WZ0A 5LSLA 5GVQA 5KG4A 4ZLJA 3BR8A 3X3UA 3E8OA 2OELA 2QL5B 2ZD1A 3WAVA 4ZPVR 5CQGA 2LECA 4B56A 3NGRA 3IAS9 2LFVA 5AXKA 3DLLQ 3OQ2A 3GIRA 2HHWA 2PMHA 2DNRA 3SV4A 1WEXA 1F5AA 2DNYA 4IFYB 1SIWB 2MKHA 1KLMB 2P2CB 3FEXB 5F0UA 4NXNF 4KC5A 1YGYA 1X5PA 3DYAB 4F4YA 1W25A 1SL0A 1Y5IB 5ITHA 2I6WA 3BDPA 1C1BB 2GC8A 2OEMA 2XB2D 4N8NA 4PG6A 1ZH5A 2R3VA 3TZWA 4LRBA 3EVOA 3HHLD 5F8HA 2BQUA 4KHMA 1RWNB 1CLFA 3IM8A 2ACMA 4Q7AA 1TVRB 4WFXA 3TYTA 2VL1A 3T1HJ 3WAWA 1ZPWX 2B6AA 5KG7A 2GX8A 3CJ2A 3WDOA 3J7ZT 2I1RA 1S0VA 4RKUC 2J8SA 2KZZA 1JLQA 1C4AA 1VQ7S 3NRBA 3EE3A 1JLFA 3CCES 5I42A 2AP6A 2BKNA 1RAAB 1KR4A 2AMCB 3DLKB 1Y0HA 4O0NA 4RUAA 3KDOA 2RVJA 3NGDA 1RAIB 4UY85 3VVUA 1HPZA 2OPQB 4OZ0A 4F2RA 3KLIA 3DLEA 4K5RA 3M05A 3RBZA 3ET6A 5DO2A 5D6GA 1N4LA 3NY0A 2QX0A 4NOHA 2CPDA 2V34A 2QLJB 1WC6A 4FS1A 8RUCA 1F9HA 2NXNA 5J1PA 3HHLA 2ZH3A 3RGIA 3TUZC 2DXDA 2JX2A 4LBPA 4Y2MA 2FJDB 3N0VA 2A18A 3GTYX 4DQQA 1LWEB 4OX7A 4DUYF 3TI0A 1UVKA 3ENVA 2W1BA 2K06A 2BW2A 2ZJRQ 4QU6A 3W8PA 3WX4A 1ZA2B 5DGBA 2OPRB 1HQUA 3MXHP 2FJVA 1ITPA 4RPFA 4Y0FA 4DX5A 1U45A 4PQUB 2WTFA 2V8HA 4KY3A 4MFBA 2CVIA 3NCPA 3QGIA 2B0GA 4WE1A 1TL1B 4LFBJ 3R5BA 2MQNA 4RR5A 3IR7B 3G71S 4JOUA 3DMJA 2GA7A 5LMNF 4ZGAA 1P1LA 2PO4A 2XSJA 1D09B 2OI2A 2YH1A 4WZQA 3FZBA 5ETRA 4B3SF 2GSNA 2KM8C 3MEDA 4ZIWA 2VKRA 3QAEA 2JFKA 3CIMA 3ZZ0A 3S01A 2BW7A 4PYAA 3BH6B 1FNOA 4E8UA 2NYIA 3U02A 4YR1A 1N33F 3OL6A 1A0OB 1FERA 1HD1A 4CLPA 3ELHA 1VRUA 4DFJA 2W8KA 2C3OA 3BGRA 1RHRB 4H4OA 3W63A 3J81j 3M9NB 4B3MF 1RQ0A 2UUTA 3UNGC 4CYUA 1U1KA 1HHTP 2C2DA 1GQEA 2QYCA 3N6NA 4P73A 5D0RA 3HHLB 2GHPA 4Y28C 4OHZA 4NXMF 1FHTA 4PQAA 2ZNYA 3RG6A 2RQMA 4NCGA 2CPZA 4FPRA 4DR5F 2JWNA 1FVSA 3UDVA 1TV6A 3VAKA 2L9DA 3UPFA 2E1RA 1DRZA 2E9TA 4X64J 1RA7A 1HLWA 3OJSA 2CZ9A 3FBCA 4CI0B 4JP8A 1NCLA 5HLFA 4ZVEA 4WFNQ 3MK1A 1ZAVA 3TJ8A 1KC8T 2X51A 4WXOA 4MK8A 2XMUA 4TQSA 5HJXA 2MDAA 1KQFB 2XRGA 2GS8A 4FYYB 2UUBF 1N88A 1NNDA 4ZCKA 1FDAA 4ANEA 2HHSA 5C42A 3DI6A 3V4MA 3J7YI 1RZMA 4I4BA 2FVSA 2APOA 4N41A 4ZPCA 3H2UB 1IBKJ 2R7XA 1EIYB 3WC2A 5D78A 2FJAB 2UVRA 4UOFA 1YZ6A 1D8ZA 5GAGU 3MFIA 4OZJA 1RTJA 2J6TA 2CQBA 2XLJA 2HQFA 4NLOA 3NGTA 5HMXA 4DUTA 2B7CB 1U1PA 3QYYA 3KLEA 3PM9A 5E3PA 4YEAA 2IMWP 4DFKA 3GYXB 1FKOA 3MMAA 5J2QB 4GTZA 4DQIA 1S6PA 2Q6BA 3NXZA 5K20B 4LUBA 1X0FA 4M95A 4HHJA 5B0EA 4ITSA 5A6WA 4QU7A 1K47A 4RW6B 5LT5A 2AX1A 3KTQA 2YBVA 4DFPA 4OYAA 4DR1F 5DQIA 3KNGA 2GVZA 2Y1IA 4YP3A 2KYZA 1QE1B 1WKLA 3HO1A 4JI3J 1IKXB 4P2SA 1CJKB 1ZA1B 4QYZJ 1EI6A 3AOBA 3BR9A 5D0EA 4QWBA 3TZYA 1ZS6A 2DXEA 3KG0A 1Y9OA 3T1AA 1JLAB 4DF4A 1TL3A 1ZPVA 1RT7A 2BABA 3LGHA 3SCJE 4LJMA 5H9EK 1L5UA 1FDDA 5JMNA 2G0JA 2VQEF 3VGTA 5DETA 2JSXA 1IR2A 4IH7A 1VI7A 5IM0A 1YRXA 1NH7A 3J7Z5 4OHYA 3FVYA 1ANIA 1PAUB 4F02A 3FCWA 3MCSA 4OLOA 2BVZA 2PEHA 4DSEA 2MQMA 2UVVA 2XMVA 2PFFB 2RS2A 2HNDB 4I69A 1W2IA 3E3XA 4NLXA 5KFQA 2IRYA 6FDRA 2ZH9A 4KGXB 4O4RA 1DTTA 1XR6A 2GVDB 3HJVA 1WUUA 4OX6A 3W2WA 1O99A 2FDNA 1GMWA 5M2UA 1NKCA 2KN4A 4EEYA 1TFWA 4QW8A 4M5GA 4NA3A 1VLYA 1R8HA 1RTDB 3DCAA 1PJ5A 4LT6A 4TLQA 1YJRA 3R8YA 3BQ1A 2RMLA 2H54B 3D2WA 1URNA 3HK2A 1KHVA 2HZAA 3KHGA 4KTQA 3GIMA 1EJ7L 4N77A 1IM4A 2DH8A 3JXOA 4FP9A 3KDNA 2CRLA 2R7WA 1P8GA 1ICEB 1RT6B 5I3UB 3K5LA 2C2RA 1YSJA 7FDRA 2ZUGA 4DR2J 4OYZA 1IKYB 1LXJA 3PXGa 3EM1A 4JI1J 1S10A 4OYBA 1MWZA 1CJTA 1S6QB 3CF5Q 4NPOA 1MWYA 4ZP6A 1KRPA 2W01A 3QIPA 1CVJA 3HP6A 2IBKA 2DB1A 1SQEA 1FRHA 4DLGA 1HBUB 1R0AA 2RQ4A 3MM6B 1I51B 3I0SB 3SQOP 3D0IE 3IRXA 4KGVB 2WOMB 1RWWB 2YNIB 2ZDOA 3IS9B 4P2FA 1RBLA 4ZN3A 3PJ9A 2XHCA 3G6YA 3U1LA 2CQ0A 1NDLA 1NKBA 1FJCA 4KFBA 2DGQA 4J9NA 5KFEA 1M5VC 1BQMA 1BQNB 3NWGA 2E1AA 4BBYA 3FRYA 2G1HA 1X9WA 2QJ3A 3GCXP 4RW8A 1AFIA 1TFYA 4JI5F 3BQ0A 3KKFA 4HACA 1CEZA 1S4EA 4AXIA 4B08A 1GH8A 1S1XB 2H9ZA 1Y4ZB 4DV4J 3S7RA 1R7IA 4DV0F 2DR8A 5EWGA 1JKHA 1RWKB 1C2PA 3M32A 4K59A 3CSKA 3M1VA 3DDIA 2VUGA 4PKDB 4Q8FA 5AJ3J 3L9ZA 2B7BB 2VBXA 4GMKA 1MN7A 2V50A 3OFGA 3QRQA 1T0TV 2G4BA 2ZE2B 2X3GA 4XAKA 2X1BA 1WG4A 4OI0A 1CJVB 2ZWPA 3RZAA 2OKQA 1U6FA 2CPFA 2DGXA 4F50A 3ED4A 2LQBA 3MECB 3IO1A 2OMOA 2MJNA 3R5DA 5IT9U 2Q6CA 1BC6A 1T95A 1WF0A 3A4TA 4DPYA 3K58A 4I2PB 1EP4A 2M52A 5HATA 2JEIA 4DPOA 1AJBA 2CQ4A 4FYWB 4OZ2A 4X66J 1CQNA 1MMLA 4A46A 2NXJA 5ETPA 3JB9k 3BO3A 3N9UC 1HNXJ 3I5AA 2CQPA 1NPRA 1BXNA 2WONA 4UOGA 1Q0NA 4IR1A 3TQ1A 2G9YA 1B99A 5CZVA 3CULA 1RE1B 4K2JA 3CJSA 4YMEA 2XYPB 1RT5A 5M2PA 4L72B 3GPAA 3DXSX 4NLSA 4IG3B 1B0TA 4O0IA 5LOQA 1N6QA 4DUZF 1NU4A 1KVKA 3L95X 3IWLA 1KOHA 3ZTQA 3QSYB 4KPYA 2DNGA 2AGQA 1NB7A 3BKUA 2QZ8A 2BJ7A 1C1CB 1FKPA 4B9MA 3AFGA 2VONA 1K9MT 2KG0A 5HRTA 3IGNA 4KH0B 5F8GA 3BDFA 1SKWA 4KHPF 2XGPA 3DDKA 2IM2A 4O4GA 4ZVPB 3KLGB 1FRXA 2WVDA 3CJ4A 1KVJA 4ZIVA 1S1UA 2Z57B 3MR2A 1FK9B 5IXUA 3VAGA 3I5BA 4G1QA 1BE4A 2AEJA 4I1TA 1L3VA 5C24B 3R3TA 3TJ9A 2OPSB 3BGFA 5KFNA 4DR6J 2XM3A 1R6YA 1RHUB 1C0UB 2LA4A 3AJ1A 4CO1A 4RU9A 1BWEA 2AEFA 4OHVA 4MHXA 1K7HA 1Q53A 2RHSB 4OI2A 1JJCB 1NK6A 2W7PA 2FLOA 3KWMA 3BEGB 4A8MP 4KAYA 1IR1A 2W4CA 1Z2ZA 3OL9A 2YPZA 4EU0A 2ZBRA 3R9LA 1TUWA 1OPIA 4AT1B 3L7PA 2W7OA 3TX8A 4ATNA 2D1CA 3CJQA 2EC2A 5KFBA 3OR2B 3UD3P 5A8RB 4NEZA 4DV7J 4CQ1A 4PCQA 4K4TA 4F0HA 3D0GE 2RIJA 5AXMA 2BOPA 3N5FA 1RWXB 1FE0A 2ZM6J 3W1YC 4Y6IA 4IO1A 1P9QC 3A3OB 5IS2A 1VC6A 5LIAA 1R0BG 1NK5A 3SXLA 2EKYA 3KNAA 5F3ZA 2A0FB 2Z56B 2C2MB 4K7QA 4EYIB 1X0PA 3H5YA 1YJ7A 2ZDPA 3JTNA 4LR8A 4Q43A 2AV5A 2JVOA 4LF9J 4YOEA 4XDCA 3NKOA 1LQ9A 1VBZA 4KAVA 5DS7A 4RW4B 2DHHA 4ZPTR 3H59A 1K0TA 5HQMA 4DG1B 4GKJF 2DNKA 2RKIA 5A8KB 3FBFA 2GQ2A 2IFYA 4YHHF 5KFWA 3HPOA 1Z1ZA 3RRHA 2W9BA 1N8RT 4G1IA 2V4RA 3OSPA 3DRRB 1KWMA 3G86A 3QT8A 2ZFHA 2WAQD 4IRKA 2DH7A 3PYFA 2BJ9A 3O5TB 4KO0B 2E5LJ 1DJ0A 3FFIA 4EK2A 3FUYA 3JTPA 5JXSA 1LW0A 2IRXA 1Q7LB 4C7QA 2MLYA 3IBWA 2RT3A 2UUCJ 2FC9A 2BMBA 2DO4A 4C2MA 5LM7E 3EVMA 4WBFA 2VBZA 5KFDA 3C8YA 5T14A 2OTLS 2R2TA 4LFAF 5LXRA 1FSUA 2QEXS 2PA8D 3C66A 4DV3J 3SDEA 2NS1B 1NB2A 1APSA 3ITHB 2DGVA 2F3JA 2LLZA 4LF7J 2GA3A 4F25A 4U96A 4Y2AA 4CM0A 3EYZA 4NLTA 4UPHA 5T41A 1JWWA 3DYCA 3HLUA 1LW2B 2HS0A 4J9SA 4J9VA 2M0GB 2MZ1A 5J1NA 3E51A 1X4FA 5IT4A 3GFXA 2QTWA 5GAHU 1PYTA 1AA1B 4L76A 1HBNA 5C25B 2QMWA 4IFVB 1S9EA 2D9PA 3OVAA 3VALA 2RB7A 2BEFA 3SSSA 1OQ6A 3AHPA 4CLFA 5B0BA 5KT2A 3DOKA 1Q5YA 3DLJA 3OFFA 4B3OA 3B78A 2J9DA 5HVHA 3MK2A 1B4SA 1IKWA 2NR0A 1LWFB 1S59A 3FJ2A 3S1TA 1FFGB 4JI7J 4ICLA 3HSZA 5D77A 3BH7B 2MTLA 4P7TA 2QZUA 2D7SA 3FMBA 4TKTA 2ZITA 5ETTA 3KHHA 3MMBB 2VA2A 4OYOA 2HHHF 5FLXY 1EJJA 3FRZA 4B02A 2EFQA 3FFIB 5CXTA 2YKMA 1JMTA 2PIIA 3G82A 1Y7AA 1TU0B 2H1YA 1KLNA 3CCMS 1Q81T 3MUMP 5FJ4A 2AYMA 3HULA 2MZQA 5IV4A 4KQZA 4QR0A 1N36J 1Y7PA 1HL6A 2W9CA 4ECTA 1H2VZ 2M9KA 1RHMB 1S4FA 2VFSA 1RP5A 3W5YA 4WTYA 3L4BC 2CQHA 3LH2S 4X62J 4ILRA 3C6TA 3OLBA 1FT8A 1U1QA 2OUGA 2ZKUA 1U8SA 2J9DE 3BBFA 1S7IA 3BSAA 5F3TA 2KJWA 1S1WA 4NLVA 1BHNA 5IT9Y 1ELZA 4CT8A 4QIVA 3I0RB 3TARA 1KEKA 1H7XA 2IVMA 5HO4A 2VU5A 3Q24A 2WK4A 4CCHA 5DZ7A 4PWDA 4TY9A 4IRDA 3PRBA 5EN1A 1EETB 4M1KA 1QLNA 1Z2LA 4NLQA 1TELA 1NHVA 2HQCA 4ZVGA 2YKPA 5A6PA 2ADCA 2FJXA 2IM3A 5DJBA 2IA6A 1HQ2A 3HKZD 2GSOA 2ZKTA 3D6TB 5BXIA 3JQKA 5E5NA 5E7OB 5LSOA 4QR2A 1M1GA 3VAJA 4FXVA 3CDUA 2Y8YA 3PG9A 4LF1A 2L9NA 3RW6A 4HYKA 2CYYA 2O01C 1YJ9S 4ZG6A 2E66A 2CQ3A 4GVBA 3I87A 4H4KC 4ZLNA 4FVMA 3HSDA 2UUAF 4H4KA 1KFSA 2OLWA 3D54A 2YQ0A 2AZ1A 4LR9A 4F36A 1M5PC 2AW0A 1MMNA 3RW7A 4RW7A 2W5RA 1RT3B 4ECWA 1P27B 4OX9F 4C11A 1TAQA 2GNKA 1KS2A 1RABB 4M5MA 5CYQA 4DX6A 2DR5A 1IBLF 4WYWA 2KI2A 1CBKA 2VBYA 4X65F 3GQCA 2DK2A 4AL6A 2BKPA 3QGGA 1HYSB 3EICA 2KFNA 3VHQA 2UU9F 4EMDA 3IG1B 5B0GA 2R7QA 3ENQA 3RBEA 4RNMA 3RAQA 4KPCA 4F4AA 4NA2A 3DKDA 3MHYA 3ONQA 2J9EA 2BANA 3Q8QB 4X4OA 1B7FA 1M5SA 2BE2B 2H5IB 3UVJB 4CDIA 1NRKA 1SV5B 2V8DA 4BWMA 4LQYA 3Q89A 4BLGA 1NAQA 4IG0B 3I55S 1C0TB 1VBKA 2YVSA 3KLVA 1OY6A 3M7VA 1EB0A 2FQQB 3A8KA 2QIFA 3KK2B 1DTQB 2ZC4A 2W5WA 3A8IA 3C15A 3KLFB 2E9ZA 1U8WA 3QJLA 1XN9A 2CKWA 2QSWA 1FDBA 3MCNA 3TAMB 4C3KA 1HR0F 2HAIA 4DS4A 2HVIA 2V9WA 2IAJA 4RNNA 2RQCA 3NGUA 2WVBA 4KSEB 2QA1A 3DOLB 1U24A 4IR9A 3PJWA 1LWCA 1FNMA 4N8OA 1OY8A 3GU0A 1EW9A 5HSPA 1HNZF 2DJWA 2PMWA 4RNHA 3PR4A 4QIEA 1HA1A 4QBUA 2JOQA 1T05A 2J7UA 4ECYA 4LSNB 8AT1B 2CZVC 4I7FB 2VG5A 3R2CJ 4J9KA 3MM5A 5L0EA 3M6XA 4HT5A 1RWOB 4C0BA 1FF2A 4K50A 4DL6A 4ID5B 5IT0A 3MMJA 3W61A 1E2SP 2NREA 2FJBB 1AUKA 2HHQA 1HBOA 3CJRA 3B4MA 4RX6A 2A2CA 1SL2A 4TY8B 1RTIB 3H4DA 1D9FA 1AFJA 1RT1A 2KB2A 4CLZA 2F5GA 2O67A 2B43A 2DPIA 1N0UA 4OYIA 1KN6A 4C8OA 3T5LA 2P6SA 3DLHA 1S12A 4DV6J 1UMJA 4FF3A 2DHXA 4F0KA 2KHCA 3GG1A 2FZKB 1RKJA 1ZEDA 1WORA 3TZXA 4N76A 5EWFA 4DFMA 3H0PA 3PKYA 5G0RA 1IKVA 3ENWA 3G87A 1S1VB 1DZ5A 4ZCMA 2DISA 3PHEA 1T9VA 4LSLB 4ZPBA 2BJDA 4A8WA 3CD7A 2HNYA 3WIUA 4UPIA 4JI2F 2NUHA 3EZ5A 3QWUA 2YNHB 4C8NA 4LFCJ 1FXRA 2YXLA 2WVCA 1HI8A 4RO0A 3J80U 5HP1A 2P9GA 3AY0A 5DDPC 1HNVA 2JLGA 3EMTA 2ROEA 1DQAA 3O8WA 2UZAA 3PEHA 4PXCA 4RBVA 2OO4A 3I9ZA 4NZ6A 1FRKA 1TL4A 3BSOA 2FVPA 4RUBA 3MM9A 3NL0A 1AZSA 4LF8J 2DIUA 1U47A 1NDKA 3SCKE 1QVGR 2HHPA 2DGWA 1UTAA 5KFXA 1RJJA 3GFZA 4CXUA 2YY3A 3DM2B 3B54A 3OW2R 1W2BR 3NKRA 1JLGA 2IM1A 1NXIA 2XTJP 3SSRA 1F9EB 2YKNA 3CIZA 4P72A 4DSIA 1Q16B 5K14B 5F8NA 4ILLA 4KH1B 4C3LA 1U25A 4M5JA 1UPMB 4M8LA 1RYSA 4RWWA 3FNNA 4Y34A 3CGIA 2DRAA 1HWLA 3DGVA 4R0EA 5IJQA 5JJBA 4B3RJ 2CQ2A 1Y3JA 2HIQA 2I0XA 3HVTA 5IV3A 1RU2A 2QC3A 1SQFA 4DZ6A 1M1KT 1FX2A 4AFFA 1KHWA 1AUSL 3MF5A 2H65B 1W26A 2C28A 4IOAQ 3A52A 4ECVA 2WBRA 1ALJA 1JLEA 5B0CA 1ZOTA 2AX0A 5DDRC 2XO6A 2DR6A 4CYSA 4JI8J 3ZNUA 1I1GA 2U2FA 4ZHRB 2CJ9A 3THTA 4DR7J 1PC4A 1BUXA 1HARA 1Q4RA 3KLHB 1KHKA 1R8PA 3PFEA 3H2LA 1U1MA 2KHDA 2AIRB 3EGNA 2LXUA 3CCWA 5DLTA 2PN6A 2WW4A 2K7KA 2KVQE 2IYIA 1LXNA 2FUG9 3WAYA 3OSNA 1UJ5A 2VIHA 1PBUA 1WI8A 5E2QA 2Y1JA 5CD4H 4JI0F 5HBMB 2F4FA
chains in the Genus database with same CATH topology
4LR2A 3CMRA 2RH6A 5HRTA 1ED8A 1ALHA 4LR7A 3BDFA 3LXQA 4UORA 3UN2A 3NKPA 3NKMA 5GOVA 4ZG6A 3NKQA 4FDJA 3BDGA 3NKNA 4LQYA 2GSNA 3WBHA 5L0BA 4GTYA 5IJQA 4GTWA 1E2SP 1EW2A 3T02A 4GTZA 1ED9A 1AUKA 1AJBA 2W8DA 4CYRA 1KH4A 1KHLA 1KH7A 1URBA 3T00A 1ZEBA 1ALKA 3IGZB 3KD8A 4LRAA 1SHNA 1E1ZP 2IUCA 3M7VA 3TWZA 3E2DA 3WAXA 4UOPA 4QAXA 1HDHA 3MK1A 4ZG9A 3M8WA 3Q3QA 4UPKA 1E3CP 5LIAA 4FDIA 4NWXA 4MIVA 3UN3A 4LR9A 4NWJA 1KH5A 4LRBA 1E33P 4UPLA 4YR1A 3MK2A 5INHA 1AJAA 2W5WA 3A52A 4MY4A 5EGHA 2XR9A 1ANIA 2GSUA 1URAA 3IDDA 1ALJA 1Y6VA 2W5RA 3M8YA 2XRGA 1N2KA 3BDGB 1ELZA 4CXKA 1B8JA 1ALIA 3T01A 4LREA 2W8SA 4LRCA 2X98A 1N2LA 5KXAA 1SHQA 4LR8A 2G9YA 3WAWA 4CYSA 5L0KA 3SZYA 1O98A 5AJ9A 4LRDA 3UN5A 5LQQA 1KH9A 4KJGA 4CXUA 2IUCB 1FSUA 3NKOA 5EGEA 3BDHA 5GRRA 3TX0A 4UOOA 1ZEDA 2QZUA 4KAVA 4KM4A 3NKRA 4MHXA 3B5QA 1K7HA 1O99A 5TJ3A 3SZZA 2VQRA 3WAVA 3OT9A 1KHKA 1EW9A 1AJDA 3DPCA 1ZEFA 4TN0A 4B56A 2GA3A 1EQJA 4KJDA 4KAYA 1AJCA 1EJJA 1P49A 5DLVA 5IJSA 1ELYA 2W5QA 5DLTA 5K4PA 3UO0A 4CXSA 1EW8A 5LRNA 4UPHA 4N7TA 1EI6A 3MK0A 3TG0A 3M8ZA 3DYCA 3NVLA 5LRMA 3UNYA 1HQAA 1Y7AA 3ED4A 2W5TA 2GSOA 2IFYA 2W5XA 5DLWA 2ZKTA 1KHNA 2W5SA 4GTXA 3WAYA 1KHJA 3IGYB 2GLQA 4UPIA 5C66A 2W5VA 4LRFA 1ELXA 5L0EA 1ANJA 4ZGAA 2ANHA 4ZG7A 2D1GA 1HJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LR2 A;  3CMR A;  2RH6 A;  5HRT A;  1ED8 A;  1ALH A;  4LR7 A;  3BDF A;  3LXQ A;  4UOR A;  3UN2 A;  3NKP A;  3NKM A;  5GOV A;  4ZG6 A;  3NKQ A;  4FDJ A;  3BDG A;  3NKN A;  4LQY A;  2GSN A;  3WBH A;  5L0B A;  4GTY A;  5IJQ A;  4GTW A;  1E2S P;  1EW2 A;  3T02 A;  4GTZ A;  1ED9 A;  1AUK A;  1AJB A;  2W8D A;  4CYR A;  1KH4 A;  1KHL A;  1KH7 A;  1URB A;  3T00 A;  1ZEB A;  1ALK A;  3IGZ B;  3KD8 A;  4LRA A;  1SHN A;  1E1Z P;  2IUC A;  3M7V A;  3TWZ A;  3E2D A;  3WAX A;  4UOP A;  4QAX A;  1HDH A;  3MK1 A;  4ZG9 A;  3M8W A;  3Q3Q A;  4UPK A;  1E3C P;  5LIA A;  4FDI A;  4NWX A;  4MIV A;  3UN3 A;  4LR9 A;  4NWJ A;  1KH5 A;  4LRB A;  1E33 P;  4UPL A;  4YR1 A;  3MK2 A;  5INH A;  1AJA A;  2W5W A;  3A52 A;  4MY4 A;  5EGH A;  2XR9 A;  1ANI A;  2GSU A;  1URA A;  3IDD A;  1ALJ A;  1Y6V A;  2W5R A;  3M8Y A;  2XRG A;  1N2K A;  3BDG B;  1ELZ A;  4CXK A;  1B8J A;  1ALI A;  3T01 A;  4LRE A;  2W8S A;  4LRC A;  2X98 A;  1N2L A;  5KXA A;  1SHQ A;  4LR8 A;  2G9Y A;  3WAW A;  4CYS A;  5L0K A;  3SZY A;  1O98 A;  5AJ9 A;  4LRD A;  3UN5 A;  5LQQ A;  1KH9 A;  4KJG A;  4CXU A;  2IUC B;  1FSU A;  3NKO A;  5EGE A;  3BDH A;  5GRR A;  3TX0 A;  4UOO A;  1ZED A;  2QZU A;  4KAV A;  4KM4 A;  3NKR A;  4MHX A;  3B5Q A;  1K7H A;  1O99 A;  5TJ3 A;  3SZZ A;  2VQR A;  3WAV A;  3OT9 A;  1KHK A;  1EW9 A;  1AJD A;  3DPC A;  1ZEF A;  4TN0 A;  4B56 A;  2GA3 A;  1EQJ A;  4KJD A;  4KAY A;  1AJC A;  1EJJ A;  1P49 A;  5DLV A;  5IJS A;  1ELY A;  2W5Q A;  5DLT A;  5K4P A;  3UO0 A;  4CXS A;  1EW8 A;  5LRN A;  4UPH A;  4N7T A;  1EI6 A;  3MK0 A;  3TG0 A;  3M8Z A;  3DYC A;  3NVL A;  5LRM A;  3UNY A;  1HQA A;  1Y7A A;  3ED4 A;  2W5T A;  2GSO A;  2IFY A;  2W5X A;  5DLW A;  2ZKT A;  1KHN A;  2W5S A;  4GTX A;  3WAY A;  1KHJ A;  3IGY B;  2GLQ A;  4UPI A;  5C66 A;  2W5V A;  4LRF A;  1ELX A;  5L0E A;  1ANJ A;  4ZGA A;  2ANH A;  4ZG7 A;  2D1G A;  1HJK A; 
#chains in the Genus database with same CATH topology
 1U2R A;  1FWL A;  2CAD A;  2GAG C;  4WWS A;  4U7C A;  5GOV A;  2EPI A;  4C3M A;  2MGZ A;  1FD8 A;  3GSI A;  5D0H A;  4M5H A;  1XQI A;  2ILZ A;  2OPP B;  3QWP A;  2AKW B;  3QFW A;  4MKY A;  3MAQ A;  3PRV A;  1SIZ A;  2C3M A;  3E2D A;  4QAX A;  3H20 A;  4AXJ A;  5K9F A;  4DL0 C;  3MEK A;  3FSI A;  4B3T F;  1X7V A;  4C8Z A;  1RTH A;  1K44 A;  3E2E A;  5LXY A;  3BDG B;  4A8K A;  3RR8 A;  4EBC A;  1ALI A;  2KT5 A;  4IOC Q;  1UVN A;  5ETN A;  2XY7 A;  2XZD B;  1FCA A;  3K59 A;  1J5E F;  2I5J A;  1EX8 A;  5ETV A;  4HTI A;  3L7U A;  4IQM A;  4ENO A;  3BS9 A;  3ULH A;  5CD4 A;  1NJX A;  1OIA A;  4N7T A;  3GB0 A;  3TG0 A;  1EKS A;  1KVI A;  5CYM B;  5DDO C;  4F4K A;  4RUH A;  2VV5 A;  5ETL A;  5CCL A;  3ILJ A;  2VQF F;  3AXK A;  3N01 A;  2W2Q P;  3IR5 B;  3PW7 A;  1X9M A;  1KNZ A;  2Y9H A;  3HVA A;  2MZR A;  2IBO A;  2VG6 B;  4ZG9 A;  3HT0 A;  2K3I A;  2KJV A;  2F9D A;  4ZMM A;  3CD5 A;  1P9Y A;  2AEM A;  2UXB J;  3DRP A;  2NXU A;  2VKZ G;  2JL9 A;  4CXK A;  2CPI A;  2HBR B;  1D9A A;  1GT8 A;  1VQL S;  4CLS A;  3R7S B;  1S57 A;  2IHR 1;  4MYT A;  1VBX A;  3A1Y G;  4DR3 F;  2O66 A;  2RUS A;  2MST A;  2Z2L A;  3HT3 A;  3M2V B;  5KFA A;  5I3Q A;  2FJE B;  5DLV A;  5D4O A;  4C9D A;  1JLB B;  2ILY A;  1RA6 A;  2RU9 A;  3KXD A;  4P10 A;  2GV1 A;  4KE5 A;  2R42 A;  3NVL A;  1DAX A;  4N56 A;  4TU7 A;  2J7W A;  4WKR A;  1MRO B;  3D67 A;  2BR0 A;  2HZC A;  1S9G B;  3AB4 B;  5L1J A;  4NA1 A;  4WJB A;  4X4N A;  4LR2 A;  4YY3 J;  1Y11 A;  2GHW A;  4ECZ A;  1D8Y A;  1UKU A;  5FDL B;  2MHE A;  2WSE C;  4GC7 A;  3K0J A;  3V2U C;  5KT3 A;  3CCR S;  1WSR A;  5IWA F;  1HMV B;  2AQ4 A;  1JNR B;  4OLP A;  1O51 A;  2ZJP Q;  2FLL A;  3HHK A;  3A3P B;  1MSW D;  2RDD A;  4DV2 F;  1Q78 A;  4FDI A;  1IVZ A;  1UWA A;  1XC9 A;  1E33 P;  4HI2 A;  3T6J A;  3CME S;  2EFV A;  1KQS R;  1FX4 A;  2HAF A;  3ISZ A;  2V8G A;  2W8S A;  3EWG A;  1U1N A;  3TVY A;  1RAD B;  2NZC A;  2EC0 A;  4WP8 A;  4K0K J;  4OHX A;  1RBO B;  3DLG A;  4ELV A;  2QSF A;  3N6M A;  3KK1 A;  1RT4 B;  4M5D A;  2QA4 S;  2GGP B;  1UL3 A;  3LF0 A;  3ZXW A;  2RSQ A;  3HHD A;  3MFH A;  4BHQ A;  4USI A;  1VRT A;  2QN6 B;  3MOZ A;  4DPX A;  1U49 A;  3CJ3 A;  2E9R X;  2E7V A;  4X2B A;  4QJV A;  5T7L A;  2K1R B;  2XHW A;  1FJG F;  1HWI A;  2PMZ D;  4AQY J;  3BPS P;  4NLW A;  1ALK A;  1H98 A;  1LK5 A;  3NWR A;  1MG7 A;  4CNZ A;  4UPK A;  5KFI A;  4P74 A;  4RJV A;  4WTO B;  3K5M A;  2MB0 B;  3T6B A;  2JEG A;  1XTZ A;  2HFS A;  3SCI E;  2LA6 A;  5AE1 A;  2HHT A;  4G1P A;  2NPF A;  2UXC F;  4K2X A;  1TMJ A;  3SQG A;  4OJG A;  3J80 Y;  1HQE A;  4LF4 J;  4AUK A;  3MZI A;  2W7A A;  2DNN A;  2JLF A;  1XNQ F;  3EXY A;  1N5Y A;  2W8L A;  1HKA A;  1D1U A;  3LP2 B;  4LF6 J;  2ZC3 A;  3AXM A;  4ZVF A;  2KFZ A;  5DG7 A;  1CUL B;  2DGT A;  1WHV A;  4WII A;  4U95 A;  1PKU A;  1HHS A;  3Q8R B;  4Y2K A;  2W2O P;  1SC6 A;  3CMR A;  2JDJ A;  2DGU A;  4DV5 J;  3FMW A;  1GK8 A;  1U48 A;  3GJS B;  2ZH5 A;  4UT4 A;  1HI1 A;  3CE8 A;  4U6P A;  1RSC A;  2AJF E;  4NYO A;  1VJW A;  3RBD A;  3CJT A;  1QDU B;  4ECR A;  4PR6 A;  1E1Z P;  4NZ7 A;  4QOT A;  2N7C A;  1YK9 A;  3AT1 B;  4PWW A;  4MIV A;  2UXD F;  2V69 A;  3UWT A;  2GQC A;  4O3P A;  2XI2 A;  1YWX A;  2K2P A;  3GFH A;  3BBB A;  4N5S A;  3OTB A;  4KKO A;  1T11 A;  2HNZ B;  4HL9 A;  4G65 A;  2XWX A;  3CJK B;  1VRT B;  2HQG A;  3MTK A;  2JC1 A;  1XMQ J;  4XTT A;  2VHG A;  1TKZ B;  5THW A;  3BM7 A;  5HL7 Q;  3MR3 A;  2ZZM A;  2OP5 A;  3QMQ A;  4ELU A;  2KDO A;  1R6V A;  3D5M A;  4CIO A;  4C4W A;  4AYB D;  3M8P A;  4Q0B B;  1FEH A;  3K8W A;  1R8A A;  2MKI A;  1XMO F;  1Q5V A;  1OPZ A;  4DCP B;  2E1M C;  1RBA A;  1H7W A;  2RIL A;  3J7Y U;  3MOJ B;  1EAY C;  3UR0 A;  3IGY B;  2KT3 A;  3UCZ P;  4X84 A;  1OYD A;  4A8X A;  2NUU G;  2G1D A;  1YZ7 A;  1UZD A;  4ZKA A;  3T5K A;  5AT1 B;  3QQC D;  1X9S A;  5DZ6 A;  3V6K A;  1ZZF A;  2DH9 A;  2FGO A;  4PXE A;  4NE9 C;  3JSM A;  4EGL A;  1ZEB A;  1H6K X;  4XIU A;  3MPW A;  1FRL A;  5GME A;  1HDH A;  2N4D A;  5EGH A;  3C16 A;  2OEJ A;  3MUR P;  3IRW P;  2W9A A;  3OR1 A;  1RLC L;  3R5J B;  1O8B A;  4RLE A;  4FXD A;  3W2V B;  3W3S A;  2W2M P;  1VQ8 S;  2IUC B;  4WF9 Q;  2BJ8 A;  2CPY A;  3PHT A;  2GMJ A;  2E5G A;  2XG8 A;  2YTC A;  1R8B A;  3UO0 A;  2X1F A;  4DSL A;  1R31 A;  3QLH A;  1WOS A;  1E6V B;  1SJQ A;  4HR2 A;  2WSC C;  3G6V A;  4IKA A;  3ZO7 A;  5L9X A;  1KHN A;  4F0M A;  2GIQ A;  2MLZ A;  4ECS A;  1Q8K A;  2YNG A;  3P5B P;  3QGP A;  5J2N B;  3JYT A;  4KKO B;  2PI4 A;  2EFP A;  2LQJ A;  1JXL A;  5RUB A;  3IC1 A;  1LK7 A;  4DR4 F;  1A7G E;  3ILO A;  1QAI A;  4Z2X A;  4NLR A;  2CJB A;  4CYR A;  3ZZU A;  1JXV A;  2C3Y A;  3BZQ A;  3NS7 B;  5IOL A;  4DX8 H;  1VJQ A;  2E5J A;  2DD8 S;  3IAM 9;  1E3C P;  3V6D B;  3M8R A;  1S1T A;  3D9B A;  3HX9 A;  4I67 A;  4TU9 A;  2Y1R I;  3R6L B;  2W25 A;  4FF2 A;  2QO3 A;  5KXA A;  1UVJ A;  4GO7 X;  1SKU B;  2MMY A;  1HWJ A;  3MM8 B;  4NI2 A;  4TNO A;  4RW9 B;  1YVF A;  3FK4 A;  4A8O A;  1WKK A;  1AUD A;  2NQP A;  2QLF B;  3FDS A;  4CO0 A;  3LW5 C;  2XYH B;  3QJP A;  1NO8 A;  5J2P B;  1TMM A;  4OHW A;  1T9T A;  2FGC A;  1VRQ C;  3BSC A;  4TLR A;  4F2S A;  2LMI A;  2ZUA A;  4AL7 A;  2BQ3 A;  2KXN B;  3GZ7 A;  2CIM A;  4ILM A;  4O3N A;  3NKQ A;  4J9M A;  2MEW A;  3NNH A;  3KK3 A;  1HBM A;  4I6W A;  2D74 B;  1SJ3 P;  2K3K A;  4DCJ B;  1DLO B;  2Z58 B;  1SHN A;  4F4Z A;  4QZV B;  5IC6 B;  5HMW A;  5H9F J;  1JJH A;  3JQM A;  3K5P A;  1I94 J;  2M4M A;  1T03 A;  5A8W B;  3FQL A;  3FQK A;  4HI1 A;  3VGS A;  5DM7 Q;  2QLW A;  1REV B;  4H4M A;  3PX0 A;  1L3U A;  1H0H B;  4TXS A;  1NK4 A;  4L6V 3;  1OO0 B;  1WC4 A;  3N6L A;  5TJ3 A;  4B9V A;  5CCM A;  3DOM B;  1GNK A;  4G6V B;  3IBC B;  4JI4 F;  5CZX A;  3N5B A;  3M2R B;  3MEE A;  2KXF A;  2HVZ A;  4DX7 A;  3L7O A;  1I3O B;  3NOG A;  2KRB A;  4EBD A;  3NBP A;  2EK6 A;  3VZH A;  1ZYQ A;  4P52 A;  3TUJ C;  1RKI A;  4DL4 A;  3C46 A;  1H72 C;  4URS A;  3AD8 C;  1X4E A;  2HS4 A;  3NMA A;  1UAW A;  3PNI A;  5BR8 F;  3T02 A;  2EG1 A;  2XQC A;  1GTH A;  3V4I B;  3QRR A;  1GAO A;  2V2K A;  2XNR A;  1SL1 A;  1UVM A;  1CJU A;  4YB7 A;  4NLG A;  5INH A;  3FKB A;  3LPY A;  1WC0 A;  4ED7 A;  3D68 A;  1D9D A;  1YIJ S;  2HFO A;  1TTH B;  5HRO B;  3HVW A;  4RU2 A;  2WBM A;  5DQG A;  2VG7 B;  4LRD A;  2PI5 A;  5L1K A;  1NDC A;  2FZG B;  2JC0 A;  1P1T A;  5A0Y B;  3VAF A;  2N82 B;  4TN0 A;  1E6Y A;  1SH2 A;  5C5J A;  2V4J A;  3LAK A;  4L73 A;  3MEG B;  2YWE A;  4DDF A;  3T1Y F;  1WC3 A;  4MH8 A;  4USM A;  1SJ4 P;  3M8Z A;  2HQI A;  4HTJ A;  1UJ6 A;  3ZZO A;  5KAK A;  4DN0 A;  4ZVH A;  2GLQ A;  2F4V F;  1YKW A;  3UCG A;  4YQW A;  5J2M A;  4K4Z A;  2FHJ A;  2ZD1 B;  4Z7Y A;  2YKQ A;  4HH0 A;  4ZG7 A;  2D1G A;  1Q8L A;  5LMU F;  3V5R A;  5U47 A;  2B9W A;  1FE4 A;  1LEO A;  3Q83 A;  4M5I A;  2F65 A;  4KIA A;  5DGA A;  1HNW F;  1S49 A;  4ZPW R;  1S9F A;  1XNR J;  2OAU A;  3U1N A;  1W7W A;  2VIC A;  4KBI A;  3A8E A;  4L3K A;  2GJ2 A;  4UQT A;  4BDP A;  3EDQ B;  4LRC A;  4QWA A;  3VQT A;  4WFB Q;  1TR0 A;  2FIU A;  4DV1 J;  4KR0 B;  3MUV P;  2ZH7 A;  3SZ2 A;  1NBE B;  1IM6 A;  1GMU A;  1NSA A;  3CPW R;  3N4W A;  2IJR A;  1G4C A;  3DRS A;  3D7S B;  3CCT A;  3GV7 B;  3PFO A;  3PRD A;  1F5B A;  2XZW A;  4KGK A;  1VYA A;  1DFD A;  2B6A B;  3M8Q A;  5GAH I;  1F6T A;  3IA0 A;  2W5V A;  2KYX A;  2ANH A;  1JLQ B;  5E3C A;  2MQ8 A;  3G8T A;  4GKK F;  3DDN A;  3RRG A;  3IN5 A;  2H51 B;  1JLF B;  2KVI A;  2XMA A;  5I42 B;  4JBC A;  3W60 A;  2F1F A;  1FJE B;  4RBU A;  1Q1K A;  2BJ3 A;  3KD8 A;  2AJ1 A;  2HWI A;  2DR7 A;  1JLC A;  1HPZ B;  4PXD A;  2B8P A;  3KLI B;  3DLE B;  3Q22 A;  4MMO A;  1TK8 A;  3NGS A;  3P49 B;  5HI7 A;  3ET6 B;  2B4V A;  2LQ9 A;  1KQG B;  1N2K A;  1Q8I A;  3OUY A;  1VQP S;  4WXW A;  4OZN A;  4JI6 J;  3K57 A;  4J9U E;  2ASY A;  5D3G A;  5GMD A;  5EGY A;  2KXH A;  4UW2 A;  1TKT A;  1X4D A;  5EGE A;  3BDH A;  3VTI A;  3LP0 A;  1HNI A;  1XWL A;  2HMI A;  3UDE A;  4F7V A;  1NHU A;  3RBX A;  2HFU A;  2Q79 A;  5IQ6 A;  1RAC B;  3D1H A;  4WP3 A;  1N34 F;  3QFH A;  2DTJ A;  3HF5 A;  3UDL A;  3K17 A;  2YNF A;  5LRM A;  4IDK A;  1HQU B;  2RJZ A;  4OYM A;  4EYH B;  5DG9 A;  1VQ6 S;  2RD5 C;  4KT0 C;  2G0C A;  3QBC A;  3K7R A;  4JV5 F;  2KH9 A;  1PYO B;  3KG4 A;  1HW9 A;  3GSD A;  1ALH A;  2P5V A;  3TP2 A;  1PO6 A;  4CT9 A;  4GVL A;  3DHX A;  4MFB B;  4KB7 A;  2A1B A;  3D6M B;  3UW1 A;  1ZM2 A;  4XK8 C;  2XUL A;  2MSS A;  4WE1 B;  4WZM A;  1N48 A;  5EUH A;  3MAA A;  2NPI A;  1U1L A;  5L46 A;  4WP9 A;  2AYE A;  3DMJ B;  1IBM J;  4XO0 A;  4OJH A;  5EX3 A;  3J81 U;  2VBW A;  3POT A;  1X4C A;  2XSJ B;  4LF5 F;  4O44 A;  1NJY A;  4XPE A;  2VZ9 A;  5K8N A;  4CTA A;  1MU2 A;  2WSF C;  5GAD I;  2LU2 A;  3MED B;  4ZPD A;  5KFJ A;  3IP0 A;  5J1E A;  4BCA A;  4Z37 A;  3NAH A;  2HVH A;  1R43 A;  2VF3 A;  3EGW B;  5LQQ A;  4FKY A;  4RL1 A;  4QIG A;  4P2M A;  3A3N B;  1K73 T;  4JYA F;  2ZOM A;  1H38 A;  3US5 A;  4E0D A;  1YQH A;  1BLU A;  4R5P A;  4YS2 A;  4CO4 A;  1OS5 A;  2QL9 B;  2HBZ B;  3I56 S;  1VRU B;  3BGR B;  4FKX A;  1JLC B;  4ERD A;  4H4O B;  3OVS A;  2XNQ A;  3LOU A;  3HD2 A;  3DGP A;  1VC5 A;  1MMD A;  4CYU B;  3GLJ A;  2P6T A;  2DRD A;  3Q23 A;  2HFZ A;  5KFC A;  2EW9 A;  1N54 B;  4NLP A;  2AJ2 A;  2V2Z A;  1EW2 A;  5A2Q Y;  3RB3 A;  4FS2 A;  1Q82 T;  4Q8E A;  3O2I A;  1NUE A;  1SC3 B;  4NML A;  1H73 A;  4NCG B;  1IN0 A;  3BN4 A;  1FWK A;  1D3W A;  1KH5 A;  1O5J A;  2E44 A;  1TV6 B;  4ED2 A;  2EKN A;  2Z2Y B;  1B8J A;  3AD9 C;  3M2U A;  2EFO A;  4F8R A;  5HVF A;  5HLF B;  1GMW D;  4CWB A;  1NME B;  2R7U A;  4FBT A;  2FLN A;  3HI9 A;  1FWP A;  3CWJ A;  2AWZ A;  4MIW A;  4K5S A;  2RU3 A;  3T1H F;  1C4C A;  2DKO B;  2XSF A;  5KFT A;  2Q1L A;  5C42 B;  3DI6 B;  2WB4 A;  1YJN S;  4P7V A;  3GFY A;  1T02 A;  4A4J A;  2H3E B;  1VDH A;  5CYJ A;  1XBW A;  3MCM A;  4CTA B;  4URQ U;  4OI1 A;  3D3C J;  4M5L A;  4FXW A;  1U0H A;  4LVO P;  1CG2 A;  3NKN A;  2HWT A;  3OTO J;  1ZTT A;  1OWX A;  3ZZY A;  1WWH A;  3BDE A;  2PA3 A;  1CPZ A;  4J7C A;  2IDE A;  2VDI A;  4X4R A;  1RTJ B;  3THP A;  4UZC A;  4AND A;  3PY8 A;  4WPA A;  2IDL A;  3LGM A;  3KLE B;  1WC1 A;  2DY9 A;  1URA A;  3PW2 A;  2GAH C;  1I5O B;  5LSR A;  1WSV A;  2PGC A;  1R89 A;  2ERR A;  4CH0 S;  2HPU A;  3RUB L;  1FKO B;  3HDS A;  4J9P A;  3MMA B;  2F8H A;  5DLF A;  4F67 A;  2CPH A;  4OX8 A;  4U8V A;  4TQR A;  3HHN B;  2JEJ A;  1S6P B;  5GRR A;  3KYL A;  1OSD A;  3U1M A;  5D15 A;  2XS5 A;  3OT9 A;  3M30 A;  4OZ1 A;  2YWK A;  3GE9 A;  1G7C B;  4ZVR B;  1FTR A;  2WCX A;  2LXI A;  4TYB A;  3CC7 S;  4PUO A;  3G4S S;  4NXN J;  4MK7 A;  4ZCI A;  1Z4U A;  3DNC A;  3U7J A;  3RB4 A;  2M2B A;  2GVZ B;  4DL2 A;  5B0A A;  3UN2 A;  4C8K A;  4LFB F;  1VIS A;  2EBG A;  1LWX A;  1WKJ A;  1RB0 A;  2QLX A;  3FEY B;  2J5A A;  3I31 A;  1U09 A;  1TL3 B;  1RT7 B;  5KOW A;  4EUV A;  3V6J A;  4NYP A;  2XR9 A;  1JJ2 R;  1YBU A;  2LDI A;  3LAL A;  3PVX A;  1TL7 A;  4OIX A;  4J90 A;  4EBE A;  3CJ0 A;  5L1L A;  1BWV A;  4KYZ A;  3N28 A;  4Q5V A;  2X98 A;  2GHV C;  5IM0 B;  1LFP A;  5K8P A;  1V3Z A;  3UD5 A;  4EZ9 A;  2Y8W A;  4W92 B;  3UI3 A;  2GIR A;  1WJ9 A;  3RRK A;  3ZNJ 1;  3FGV A;  1ZET A;  3I4P A;  2R4F A;  5GAE I;  2LYV A;  3ISN D;  3C14 A;  3VGV A;  3MD3 A;  3AJD A;  4D3H A;  4NEY A;  2CQ1 A;  1TKX A;  2W24 A;  2W5S A;  1DTT B;  3NG8 A;  1PIL A;  3DRX A;  1YIT S;  4RNF A;  3W2W B;  3Q8P B;  1YX2 A;  2XMW A;  1TKD A;  3PZP A;  1U1R A;  1RIS A;  4WK3 A;  3VAH A;  2OJ3 A;  1GX5 A;  4WIQ A;  2IYG A;  2HLU A;  3MGJ A;  1QY7 A;  4DUY J;  2VC1 A;  4DF8 A;  3P4U B;  1XR5 A;  3UN3 A;  4J5O A;  4X64 F;  3K5O A;  1CS4 A;  1K1Q A;  3RAX A;  2AGO A;  1X4B A;  1SUQ A;  4C97 A;  4FZV A;  1FES A;  1XK8 A;  2M88 A;  3ZTO A;  2D3Z A;  3V81 A;  4MAK A;  1KH9 A;  3CJ8 A;  3TQE A;  1L3S A;  4F04 B;  3TUI C;  1CJT B;  1YG0 A;  3LGN A;  2W2P P;  5LMN J;  3E01 A;  2LQ5 A;  3OTD A;  3QAU A;  3UDC A;  1SCJ B;  4ED4 A;  3QIP B;  2F8E X;  4B3S J;  3QO9 A;  4DPT A;  3KHR A;  1IBK F;  3P96 A;  1OMS A;  1LNQ A;  1ELX A;  2C2O B;  3HVR A;  2DNZ A;  1R0A B;  1RT2 A;  2B5J A;  3KMS A;  3VCD A;  2DT9 A;  3MM7 A;  1SVD A;  2CWX A;  5L0B A;  5A76 A;  3IRX B;  3QPI A;  1N33 J;  4I2Q A;  3MR5 A;  1PSD A;  3F73 A;  3ILL A;  2BDP A;  4J9O A;  1AXQ A;  2ZBQ A;  1N32 J;  1WTF A;  1BGX T;  4DPU A;  3R5G A;  1ZBT A;  5DM6 Q;  4B3M J;  4KFB B;  4DU8 A;  1QSS A;  2ZJQ Q;  1BQM B;  1ZM3 A;  3CD6 S;  4NMX A;  1KOO A;  3OJU A;  4RW8 B;  5BJR A;  4NXM J;  2J6S A;  4IFY A;  4USK A;  2YQ1 A;  1TP7 A;  2F9J A;  4S0M A;  4U8Y A;  4HAC B;  1KLM A;  3J81 Y;  2JVR A;  5KFG A;  4DR5 J;  3NS6 A;  2VJU A;  2OGU A;  4KRW A;  4DS5 A;  2HRY A;  1JKH B;  3DYA A;  4ANC A;  2OML A;  1X31 C;  3GWC A;  3M32 B;  3M1V B;  2QV6 A;  1SXL A;  3HMJ G;  1N5V A;  4V1A k;  1C1B A;  2FYX A;  1R0C B;  3D1O A;  3LAM A;  4JI3 F;  1XJW B;  2Q3P A;  3Q8S B;  4DL5 A;  2VD3 A;  5E0O A;  4AD6 A;  2CPJ A;  1TVR A;  2CJQ A;  1FRM A;  1YBT A;  1KH4 A;  2UUB J;  4ZVO B;  2VFV A;  3SSQ A;  4Q44 A;  2ZZT A;  5HVG A;  5HMZ A;  3TWZ A;  4PAB A;  4WCE Q;  1X5T A;  3AAW B;  4F4X A;  1VCT A;  1VIO A;  2EI5 A;  3ZFV A;  1WD6 A;  2VDH A;  1XER A;  3CB4 A;  1D0E A;  3B82 A;  3OFE A;  1J2V A;  2YKO A;  1EP4 B;  4ZIT A;  2JFD A;  3LUY A;  3DLK A;  1IR0 A;  2OPQ A;  1KSP A;  4ZLL A;  3QZ8 A;  3IGV A;  1UFK A;  1IBC B;  2WON B;  2J9C A;  1NSK L;  5MAO A;  1MN9 A;  3ICL A;  3FBB A;  2LCW A;  1PYS B;  3BBC A;  1GXU A;  3Q86 A;  1G6B A;  2CXE A;  4ES3 A;  4UZB A;  4LSZ B;  1U26 A;  1RT5 B;  1KHJ A;  2CJY B;  5F9N A;  2HIY A;  1YBA A;  3K2Y A;  1RCO B;  2DXF A;  1N6Q B;  3KUH A;  1SBR A;  4EI2 A;  1LWE A;  3GJR B;  3H5S A;  2MQL A;  3JS9 A;  3KJN B;  3GYG A;  2MKC A;  1NJI T;  3PKM A;  3V6H A;  4USU A;  2OPR A;  3HFK A;  3LA0 A;  4U7U D;  3MCO A;  1FKP B;  2WHO A;  1HWU A;  2EG2 A;  4Y2C A;  2H4Y B;  3DHW C;  5DG8 A;  4DR1 J;  5I4M A;  4PAA A;  4PQU A;  4O3O A;  4DR2 F;  2IIH A;  3BKT A;  4O4G B;  3H2V E;  1S97 A;  2B4P A;  1L3T A;  3MMC A;  4JUZ A;  1T3N A;  1TL1 A;  1LKZ A;  1S1U B;  4JI1 F;  1X4H A;  3QAT A;  1DAR A;  3H8Y A;  4G1Q B;  4EFA C;  3BGU A;  2RRN A;  4C48 A;  2GO9 A;  5D4P A;  4XDD A;  2EXU A;  3KG1 A;  2R9L A;  3SMZ A;  3EX7 B;  4B9N A;  2K8G A;  2Z2Z A;  1S0N A;  2VQE J;  5KFZ A;  1PAE X;  4OV6 A;  4NL5 A;  5M2R A;  1ZM4 A;  3KFW X;  1SJ1 A;  4A48 A;  1JXE A;  3BYP A;  3DU6 A;  2V6A A;  2RS8 A;  1BQX A;  4X4U A;  4M94 A;  4IQX A;  4KAI A;  2QT7 A;  3TA2 A;  2V8V A;  3DXB A;  1UW9 A;  3D1Q A;  1T8E A;  4E98 A;  3HHL C;  1VQ4 S;  3NNA A;  1SB6 A;  2VPY B;  4YN3 B;  1N2L A;  2YWW A;  3CO9 A;  4PZV A;  1XMB A;  4OZ3 A;  1Y5N B;  3R7B B;  2XYG B;  4X4T A;  3HFV A;  4Q45 A;  3VWS A;  4DV4 F;  2Y1L B;  5KFL A;  1SPB P;  2C3P A;  2J76 E;  1SJR A;  2MLX A;  3DRY A;  2CQD A;  1KBR A;  5AJ3 F;  3PX6 A;  4ZVT B;  2VA3 A;  4CLU A;  5SUH A;  3QT7 A;  1KP6 A;  4OYX A;  1EZZ B;  2GML A;  2GMH A;  2HBQ B;  3MMC B;  3G8Q A;  2RKI B;  1Y5L B;  1IQZ A;  3C6U A;  5AXL A;  1WOP A;  2YWH A;  1M5O C;  3P6Y C;  1SH3 A;  2W9B B;  2BV3 A;  2BYC A;  4ED8 A;  3FSY A;  2C3U A;  2DO0 A;  4B9U A;  3M8Y A;  5KG6 A;  3SFU A;  2DVI A;  4X66 F;  3RU0 A;  2WZ1 A;  4P71 A;  3THV A;  2FLP A;  3H25 A;  3EJM A;  2A10 A;  2JJ4 D;  3PX4 A;  4L3N A;  2R8G A;  3WQP A;  1HNX F;  1LW0 B;  4ES1 A;  2OIH A;  4UOO A;  5LJ3 Y;  1U6Z A;  1YJV A;  2L48 A;  1JIH A;  1PJ6 A;  3OBI A;  4ELT A;  2B4O A;  2C2Z B;  3Q8Y A;  5KT6 A;  4FYD A;  3RJM B;  1N32 F;  2E7X A;  4F3O A;  5HAN A;  5JUM A;  1NPK A;  5J2Q A;  2OEK A;  3ILI A;  1RDR A;  1YJU A;  3IMQ J;  1ZZN A;  1G3O A;  3OV7 A;  4LMZ A;  2E1P A;  2CQG A;  2OTJ S;  3SDE B;  4JI5 J;  4HLB A;  1B7Y B;  4L75 A;  1T3O A;  2EVZ A;  5IFM A;  4RW6 A;  3HCX A;  2MQO A;  2BJ1 A;  4DV0 J;  3B6B A;  3SCL E;  3OTC A;  3ZZR A;  2HEK A;  1NK0 A;  4OMF G;  3NOC A;  2LKZ A;  5ETQ A;  1HBN B;  1P6T A;  1QE1 A;  1S9E B;  4FF1 A;  4MYU A;  4MIB A;  1IKX A;  3QNW B;  2LEP A;  3EGZ A;  1CJK A;  1UVI A;  5ETK A;  5FII A;  1NSQ A;  3DOK B;  1JLA A;  4B3O B;  2ZNZ A;  1QAY A;  4DR6 F;  4FNH A;  1IKW B;  3M6W A;  3AOA A;  3LWL A;  3C6U B;  1ELY A;  2XCP A;  4ICL B;  3F41 A;  3MR6 A;  3KJF B;  1ZTW A;  3JTO A;  3R1L A;  1I6J A;  5DLW A;  5KG2 A;  1M5K C;  3MPY A;  2L3M A;  4BS2 A;  2VFU A;  2BZ2 A;  5IQQ A;  1X4A A;  2LEB A;  4YB5 A;  3JSR A;  3M9M B;  3P45 B;  2YPY A;  2RH6 A;  4J91 A;  4GTY A;  5F0W A;  2HND A;  2MKS A;  2YKM B;  3D28 A;  2KRR A;  2G13 A;  3W64 A;  1DHM A;  4HT7 A;  5L8R C;  3G82 B;  3JQJ A;  3TUP A;  1NK7 A;  1KFD A;  3X1L B;  5E33 A;  1RHQ B;  2GVD A;  3HD1 A;  2V0N A;  1LV5 A;  2HZV A;  3T5J A;  4DV7 F;  2YX7 A;  3CW2 C;  2VOD A;  2OD6 A;  5G4D A;  2DPJ A;  2Y3Y A;  3JAM U;  2H4W B;  1RTD A;  2W9C B;  2ZM6 F;  4ALZ A;  2CG8 A;  4DUZ J;  5KG3 A;  3SZY A;  1HFE L;  1DUR A;  2XMK A;  2ROG A;  3C6T B;  1EHW A;  1SC1 B;  3OLA A;  1T9Y A;  2MZT A;  2ZBI A;  3EZU A;  4DJB A;  2R2U A;  3D6H B;  4CLT A;  1S1W B;  2RQK A;  3FCV A;  1RT6 A;  5I3U A;  4LF9 F;  2AT1 B;  3FBE A;  1Q95 G;  4K4U A;  1XIQ A;  1UJ4 A;  4KHP J;  2R7T A;  2ZH1 A;  5KT5 A;  4PWD B;  1IKY A;  1T94 A;  2HRU A;  2E7W A;  2E5H A;  4LR7 A;  1MWQ A;  1S6Q A;  1REG X;  2FY8 A;  3FCH A;  3PDN A;  4ER8 A;  2MXY A;  3TEG A;  5DRK A;  2EBE A;  2V68 A;  4B9S A;  5DLG A;  1KHL A;  3G6E S;  1VIX A;  2XCA A;  3DU5 A;  2LXF A;  3TJA A;  1U4B A;  1S77 D;  3S6E A;  4OYW A;  2WVF A;  2Y0B B;  4KV8 A;  3GII A;  1HBU A;  1WOO A;  2HG4 A;  2F63 A;  2E5L F;  5KFV A;  3NKY A;  3MM6 A;  4GVB B;  1ZM9 A;  2XLI A;  3I0S A;  3T5H A;  2GCF A;  1UA0 A;  2WOM A;  2YNI A;  3NP5 A;  3IS9 A;  2UUC F;  3UD4 P;  2BE9 B;  5KT7 A;  1YDL A;  5KFP A;  2V4Q A;  2V5H G;  4PEO A;  4RW7 B;  1X5O A;  1CC7 A;  5KTQ A;  4C11 B;  4ZCL A;  4ZDN A;  5CYQ B;  1XEZ A;  1BQN A;  5BYS A;  3CCU S;  4M5K A;  4DV3 F;  3J7A 1;  1N56 A;  3ETM A;  4JV2 A;  1DQ8 A;  3OPK A;  1FVQ A;  4GTX A;  3HZG A;  3W9J A;  5D0G A;  1GFW B;  4LF7 F;  1VGY A;  1S1X A;  2BAC A;  4DZD A;  2KU7 A;  2CJA A;  2PD1 A;  1KH7 A;  3OFH A;  2MZS A;  5L39 A;  2BAN B;  1YHQ S;  1M90 T;  2G9O A;  3WX8 A;  4PRF A;  2X7I A;  3CJ5 A;  4ED3 A;  2FJW A;  2ZE2 A;  2DIT A;  1PGZ A;  1IQT A;  1N0V C;  1CJV A;  3PJX A;  3R97 A;  2BRK A;  1UET A;  4K8R A;  3L3C A;  4IOB A;  4GKJ J;  1ACM B;  3MEC A;  5ETS A;  2DHS A;  2XLK A;  4Y65 A;  1HWK A;  4USJ C;  2HW3 A;  5AE2 A;  2YWF A;  4YHH J;  4USH A;  3BRE A;  4JI7 F;  3C15 B;  3P5T L;  4D3G A;  2W5Q A;  3O6Q A;  1EW8 A;  2ZVI A;  1VK8 A;  4I2P A;  2QL7 B;  2CVE A;  5LL6 d;  4OV1 A;  3TAN A;  1S79 A;  2IAJ B;  2MPU A;  4KV8 B;  1T9U A;  4YDD B;  2NXE A;  1LWC B;  3QSI A;  6AT1 B;  4E2F B;  4ED0 A;  3GG0 A;  2QFI A;  2NZ4 A;  1B0P A;  2U1A A;  4ZP8 A;  4LIR A;  1T05 B;  5ETO A;  1QTN B;  1F2H A;  2VG5 B;  5AE3 A;  4MJK A;  4DPW A;  3MM5 B;  3H40 A;  4LFA J;  2XMT A;  4NWX A;  3CD0 A;  3I6P A;  1N36 F;  4IG3 A;  4O3R A;  3T41 A;  4ZA1 A;  1VBY A;  1ULR A;  3H5U A;  3A8J A;  4FF4 A;  2PSZ A;  4X62 F;  2XBP A;  1HBO B;  5AXN A;  2J0W A;  3W7B A;  2RE1 A;  2BBE A;  1RT1 B;  3AD7 C;  5FLX U;  2P9E A;  1C1C A;  4J9L A;  4CZC A;  4PG5 A;  1EQJ A;  1X60 A;  4Y2I A;  4HKQ A;  3DN9 A;  4RUC A;  3CCJ S;  3IR6 B;  2CNO B;  4CO3 A;  1NJW A;  2XC9 A;  2HGL A;  3C2P A;  4HVZ A;  2MKJ A;  3KLG A;  1HQA A;  1KON A;  2G2O A;  1VQO S;  1FK9 A;  3CCS S;  4TU8 A;  4I68 A;  3T3F A;  1F2G A;  1VOM A;  2D3O 1;  4UTG A;  3FEZ A;  2N4C A;  4EZ6 A;  4FPI A;  5C24 A;  3UCU P;  2OPS A;  5G0R B;  3KJV A;  4DXL A;  1IKV B;  2LDY A;  2POK A;  4GTW A;  2C2E A;  2JRS A;  3ISN C;  2UV8 G;  1WI6 A;  1C0U A;  2D9O A;  5CH7 B;  3TRG A;  2HYI B;  2V9K A;  4NRU A;  1PBA A;  2DGS A;  3PEJ A;  1S99 A;  2HNY B;  5F8L A;  1GXT A;  1SJF A;  2DNQ A;  3I82 A;  2KFY A;  2QGF B;  4ZJL A;  4DQR A;  1GX6 A;  2JZ5 A;  3AH6 A;  3CDE A;  3CDA A;  4K4W A;  2IC3 A;  5ADZ A;  4LQ9 A;  4CO5 A;  5HP1 B;  2HHH J;  4USV A;  1HNV B;  3M4X A;  1R3N A;  1HIY A;  4YDX A;  3BF4 A;  2C2N A;  3H7H B;  4M5N A;  3TZZ A;  1CSJ A;  3LQV A;  3Q2S C;  3SZZ A;  2DR9 A;  3MM9 B;  1AZS B;  5GMK a;  3EPI A;  3NMR A;  5IJS A;  3OR2 A;  5A8R A;  2HQD A;  2MZJ A;  4UOC A;  2W5T A;  1UPP A;  3NGK A;  4NZ0 A;  4L74 A;  4DU7 A;  1AYE A;  1JLG B;  3K8V A;  3BO2 A;  4J37 A;  1URR A;  2YKN B;  1ED8 A;  5H9E J;  1RWM B;  2HHX A;  3R5C A;  5B08 A;  1U7L A;  2HRT A;  2BX6 A;  3IGZ B;  3BQ2 A;  3CCV S;  1H74 A;  2BOA A;  4RW4 A;  2WB1 D;  2G2Y A;  1ZAX A;  2IMO A;  2PDA A;  5EX0 A;  2GW8 A;  4DG1 A;  5A8K A;  2OFH X;  3HVT B;  1DQ9 A;  5KOX A;  4KJG A;  2W4P A;  4OL8 A;  1VLO A;  4IUF A;  3IWX A;  3R7N B;  1WC5 A;  2IY5 B;  2BXJ A;  4MK9 A;  3KJV B;  3DPC A;  1NZA A;  2V67 A;  1N5S A;  4KJD A;  3DRR A;  5EWE A;  2F8M A;  1RWP B;  1JLE B;  3NEK A;  2CNK B;  4CXS A;  4FN5 A;  1VFJ A;  3VZI A;  3JAM Y;  2CNN B;  4KO0 A;  1HW8 A;  4EO8 A;  2R7O A;  4MKV A;  1IWG A;  4DN9 A;  4F3M A;  3BKF A;  3H4B A;  2UUA J;  2IC3 B;  3GP9 A;  3EPG A;  1J27 A;  3GYN A;  1VR6 A;  4RBT A;  2Z0G A;  1NK9 A;  1H3D A;  1S6U A;  1FKA F;  4OX9 J;  1F5C A;  3IM9 A;  2RRA A;  2YKA A;  2NSB A;  3R6G B;  1UWB A;  4UOP A;  1RCX B;  1IBL J;  2ASL A;  4HDG A;  1KQK A;  4OZ5 A;  4X65 J;  4OFZ A;  3LP1 A;  4Z7C A;  3SV3 A;  4FVC A;  3ITH A;  2CG4 A;  4MKA A;  2EWH A;  2MGZ B;  4IH6 A;  4J9R A;  5EHH A;  2GJI A;  4I64 A;  2ZHB A;  1AB8 A;  2UU9 J;  5AJ9 A;  3PYD A;  5GAG I;  2IVY A;  1LW2 A;  3PIO Q;  1QSL A;  1WG5 A;  1VQY A;  4LBI A;  4KHR A;  3UE2 A;  3ZC4 A;  2MY7 A;  8ATC B;  3UFC X;  4DV6 F;  1RTH B;  5C25 A;  2XMJ A;  1V3S A;  2X1A A;  4IFV A;  3BJY A;  1U02 A;  4LIW A;  9ATC B;  2AD9 A;  3M9O B;  2VOP A;  1WDD A;  1VS3 A;  1RLD A;  4UUX A;  4ZVS B;  4KGZ B;  3W5X A;  3Q0A A;  2JEF A;  2I5J B;  2NCK L;  3GJT B;  2V2Q A;  4DSF A;  3ZTS A;  4OJ1 A;  2XEX A;  1LWF A;  3OL7 A;  3EVW A;  3GMG A;  2QE5 A;  3JSY A;  4DL7 A;  3O1L A;  3Q2T C;  1ELO A;  5H1S V;  4ZN1 A;  3TEH B;  2DHG A;  2W4D A;  1BY9 A;  3WAX A;  3HXM A;  2HSE B;  2V63 A;  1HR0 J;  4OYP A;  3CCL S;  4LFC F;  2FZC B;  3N79 A;  4DQS A;  3MMB A;  2B4U A;  2A6M A;  2GSU A;  4NAS A;  2DBB A;  3I96 A;  2BM1 A;  7FD1 A;  3BGL A;  4WFY A;  3RR7 A;  3WC0 A;  1HNZ J;  3L09 A;  4HH1 A;  1N5Q A;  2C22 A;  4URG A;  4NYZ A;  1F3V A;  2VPW B;  4LF8 F;  2QMU B;  2EFN A;  3T9Z A;  3DRP B;  2J6U A;  1Q79 A;  1YJW S;  1S72 S;  4DCO B;  2SXL A;  4QWD A;  5LRN A;  4UST A;  5E3A A;  2IFX A;  1UZH A;  1UWB B;  2RDJ A;  4ECU A;  2Z8Q A;  1FRJ A;  3LP1 B;  1WHY A;  4LRF A;  2FHO B;  1EQM A;  4OI3 A;  2FVR A;  2HWH A;  5CAA A;  4I6A A;  2ZOG A;  1K1S A;  3I0R A;  2W8D A;  2ATC B;  4LRA A;  3RAM A;  2RF2 A;  2FHM A;  1RAO A;  2Z2M A;  2Y0S D;  3CMA S;  5H9F K;  3K89 A;  1RGV A;  4B3R F;  1EET A;  3LWM A;  1RAJ A;  2HLT A;  2FY1 A;  4AE5 A;  2DNL A;  3PIP Q;  4NX9 A;  1WEL A;  4NLU A;  3M6U A;  4ZJQ A;  3OL8 A;  3I5C A;  3IXQ A;  4W4M A;  2VJV A;  2DYA A;  2IRU A;  2ZEJ A;  2F7V A;  4C6A A;  2N3L A;  4JI2 J;  4PPZ A;  4JI8 F;  3W66 A;  4PPD A;  3BB5 A;  3GIK A;  1S48 A;  4ZK7 M;  2AF6 A;  4DR7 F;  3BGO P;  5F8J A;  1RYR A;  2ZOF A;  2AJ4 A;  5HQL A;  2FPH X;  3W9H A;  5SZT A;  3MAH A;  4C0H A;  3KUE A;  4XPC A;  4ZLP A;  3DLG B;  1JJ4 A;  2J8A A;  3KK1 B;  2BRL A;  3Q8V A;  4M5D B;  1RT3 A;  1IJF B;  2J0X A;  2CJK A;  3WIV A;  2HHU A;  5B0F A;  5HMY A;  3PW5 A;  4ED6 A;  2ACY A;  4CH1 A;  2CNL B;  3VF0 B;  3QGH A;  1WAC A;  3IBF B;  5KG5 A;  4R0J A;  2CDR B;  4CM2 A;  4NRT A;  4P9S A;  5BYQ A;  4HDH A;  1HYS A;  5T7L B;  4HEA 9;  1OQ3 A;  2AYG A;  1JNZ B;  1GMV A;  2QYG A;  2I8E A;  3IG1 A;  1FEE A;  4B9T A;  4PXB A;  1H2U X;  1SHQ A;  1EQ0 A;  1O98 A;  4YUD A;  2CQI A;  2RDI A;  2AU0 A;  2KL8 A;  1VHF A;  3R1H A;  2WVE A;  3TA1 A;  2BE2 A;  3UVJ A;  6FD1 A;  3GON A;  1SV5 A;  1FTC A;  3CO0 P;  3OD2 A;  1RU1 A;  3GV5 B;  5GAD U;  4IRC A;  3JSB A;  4IG0 A;  2RF2 B;  3SQG B;  1G2E A;  1FFS B;  2IJN A;  1C0T A;  1HQE B;  3AA9 A;  1IUJ A;  2ATL A;  1QD1 A;  4PYD A;  5HAO A;  3RYL A;  1N5Y B;  3KK2 A;  1DTQ A;  2GIF A;  2LP4 A;  1VQM S;  3EGV A;  3NKM A;  4QYR A;  3T19 A;  3KLF A;  2ZHO A;  3D0H E;  3TAM A;  4B17 A;  1Q7Y T;  1URB A;  3T00 A;  1NSP A;  3NCQ A;  2I38 A;  2X3D A;  4FYX B;  3DOL A;  1KTV A;  4ECQ A;  1AJA A;  2MHN A;  4MY4 A;  4A47 A;  1T9W A;  1UEV A;  3BN7 A;  4ID8 A;  3LTO A;  1F3F A;  2UV8 A;  4QIW D;  1XR7 A;  5B0D A;  2EK1 A;  1NKE A;  1SH0 A;  2UVW A;  2VPZ B;  2H48 B;  4BC9 A;  4LSN A;  1UW4 A;  4NWB A;  4I7F A;  3G9C A;  1V5I B;  5HK4 A;  2UXB F;  2GQQ A;  1S0O A;  1VMB A;  1RTZ A;  4IYQ A;  4GRS A;  4F26 A;  3GV8 B;  4CRJ A;  4P6Q A;  3W62 A;  5IC4 B;  4JI0 J;  4ID5 A;  5DDQ C;  5E41 A;  2Q43 A;  4GO5 X;  3NNC A;  4TY8 A;  1RTI A;  3CXC R;  2XZT B;  1UFL A;  3QT5 A;  3TNV A;  1FXL A;  2DCL A;  2R8J A;  3BSN A;  3KOA A;  3A12 A;  2A3J A;  3CMQ A;  3M8P B;  4V19 X;  1WEY A;  2GFF A;  4B3T J;  2DGO A;  3IFE A;  2JLE A;  4IH5 A;  4UF4 A;  2MQQ A;  4MKB A;  3G96 A;  2AGP A;  1FXD A;  3VGU A;  4YY3 F;  2FD2 A;  3M8W A;  3W65 A;  1HI0 P;  4DEZ A;  1H2T Z;  2DY1 A;  1J5E J;  1RHK B;  2AJ0 A;  3IDD A;  1Y6V A;  1NDP A;  2MY8 A;  4CLL A;  3HSJ A;  2G2Z A;  4ZVU B;  1S1V A;  4ZVQ B;  3D3B J;  2IJF A;  1OYE A;  3G2X A;  3JSM B;  3O44 A;  5HJY A;  4LSL A;  2V2V A;  1IJE B;  4R8U A;  2HVE A;  1F0X A;  2YNH A;  4OZL A;  4CNY A;  2CAJ A;  1UA1 A;  3C16 B;  3OR1 B;  4P75 A;  4ED5 A;  5F9L A;  2WRM A;  1NHK L;  1P49 A;  2M8H A;  5EDW A;  1A9N B;  5K4P A;  2B9X A;  2QMX A;  3GJQ B;  4K0K F;  1IWA A;  2VQF J;  5KFU A;  3KUG A;  3PTW A;  2HGM A;  2DCU B;  3UR3 C;  2M5Y A;  4X4Q A;  2I2Y A;  2PFD A;  1FDN A;  3NAI A;  2HVD A;  2BE7 D;  3HZE A;  1VQS A;  3BO4 A;  1B70 B;  3QLH B;  2RH3 A;  1WF1 A;  3CDB A;  3OHB A;  3DM2 A;  2CFX A;  2XS2 A;  3TVK A;  2YNG B;  4X4S A;  1YRT A;  3SI8 A;  2HS3 A;  1AT1 B;  3DFE A;  3JYT B;  4USW A;  2JHE A;  1FA0 A;  4QPT A;  4AQY F;  3H42 A;  2ASD A;  4DR3 J;  2F40 A;  4OI4 A;  4FYV B;  2ADB A;  2FVQ A;  1ARO P;  1RI7 A;  2RUG A;  2QFJ A;  2BA9 A;  1KDN A;  2HHV A;  3MPU B;  2DIV A;  1SQG A;  1V9O A;  1WG1 A;  4HHU A;  5K14 A;  2R8I A;  3TO8 A;  1K8A T;  3AOD A;  3I32 A;  2B9E A;  3GR1 A;  3B5Q A;  1S1T B;  3PCO B;  2OSQ A;  1K0V A;  2PE8 A;  3PO5 A;  3CT9 A;  4LF4 F;  1QAX A;  1BMQ B;  3MK0 A;  1TZ0 A;  3UNY A;  3K5N A;  5KG1 A;  2FHJ D;  3CUN A;  4QWC A;  5IWA J;  3HM9 A;  4NI2 B;  2MQP A;  5F8I A;  1QUP A;  5C66 A;  1ANJ A;  4LF6 F;  1RUS A;  4LF2 A;  4WFA Q;  1ROF A;  1WHX A;  2GZO A;  4DV2 J;  4Q2L A;  2RAQ A;  3CC4 S;  4FDF A;  5GAE U;  1ED9 A;  4YFU A;  2DEI A;  3KJQ B;  3FC9 A;  4R8U B;  4YB6 A;  1YI2 S;  3NCR A;  2R7S A;  4ZHR A;  3C3L A;  3LPE A;  1RAH B;  4C98 A;  2XMM A;  4DV5 F;  3CC2 S;  2QA2 A;  3QJJ A;  3KLH A;  3VQS A;  4X4P A;  4GC6 A;  3SBM A;  1Q86 T;  3MPD A;  3PO4 A;  3TA0 A;  2GJF A;  3KK3 B;  4DQP A;  3HKW A;  2ZH8 A;  1HBM B;  3OHA A;  4QYZ K;  4H54 A;  3IWN C;  3NLC A;  5JVG Q;  3AQO A;  2UP1 A;  1FO1 A;  4N47 A;  1O6X A;  5HBM A;  3R2D J;  1NLK L;  2PT0 A;  4U67 Q;  2QLB B;  4CH7 A;  2LU1 A;  4QW9 A;  1T03 B;  2HKE A;  4CLK A;  1XMQ F;  2AYB A;  4JB8 B;  4ECX A;  2OPP A;  1FJG J;  4H4M B;  2VFR A;  2AJQ A;  4WU2 A;  2ZH4 A;  2KTQ A;  4W98 A;  2IA0 A;  2VH7 A;  4RNO A;  3R27 A;  4WU3 A;  1MNE A;  1FFW B;  4A8Y A;  2DNO A;  3OTE A;  2JH3 A;  3MEE B;  1TQL A;  2PC6 A;  3BDG A;  2QA4 G;  3G8S A;  1FD2 A;  4OJ3 A;  2VC0 A;  3C19 A;  1WEZ A;  3RB0 A;  3NBP B;  2B8Q A;  1LOU A;  1VC0 A;  2UXC J;  2XGQ A;  3Q3Q A;  1KD1 T;  1X5S A;  4C8M A;  5CAB A;  2A6O A;  4YR2 A;  3P8B B;  4PG7 A;  2KZM A;  2B3T B;  1XNQ J;  4NLD A;  4K4Y A;  1F60 B;  1HD0 A;  2ROP A;  4ZPA A;  2MYF A;  2FHK A;  4U7U K;  4UQG A;  5CYM A;  1CJU B;  3AJ2 A;  1S0M A;  1M5H A;  3MD1 A;  2VQR A;  1N5T A;  2GO8 A;  1TUV A;  2ASJ A;  1AJC A;  2O3D A;  2D41 A;  1FRI A;  1V5V A;  3O3L A;  5KFM A;  2R8H A;  2UVU A;  3DLB A;  1U1O A;  4QPX A;  1BD6 A;  2PEB A;  4QCL A;  2VG6 A;  1DBD A;  2ZBP A;  2BM0 A;  5L9N A;  3GIL A;  1RAE B;  2XS7 A;  1E6Y B;  3ZZZ A;  1SI9 A;  2V4J B;  2XO7 A;  2UXD J;  1EKR A;  5HN0 A;  1Y3K A;  5KFH A;  3QRP A;  3HJF A;  2BQR A;  3CCQ S;  1WTB A;  2OFG X;  4NCB A;  4YB1 P;  2M7S A;  2FTR A;  3VAM A;  5B09 A;  5J2M B;  5E3R A;  2N7Y A;  5C2C A;  2HQ3 A;  3PW4 A;  3CED A;  4PG4 A;  1RHJ B;  1NEE A;  3M2V A;  4YR0 A;  3AQP A;  4ETZ A;  2HK3 A;  2B9Y A;  1UP1 A;  1MLA A;  3H5X A;  2NYH A;  1JLB A;  4G3I A;  4ZOS A;  4QWE A;  3LO3 A;  1QTM A;  2B56 A;  1XMO J;  5KFK A;  2LQ8 A;  4DMZ A;  1MRO A;  1Y10 A;  2OSR A;  1S9G A;  2KT2 A;  2ZH2 A;  1RAF B;  1YTY A;  1QVF R;  3VAI A;  2BJE A;  2D3O R;  2CDQ A;  5FDL A;  2C2K B;  4O23 A;  4K4V A;  3F44 A;  5D8H B;  1HMV A;  1VQK S;  1T9X A;  2D3U A;  3TW0 A;  4C8Y A;  3DC2 A;  1MW7 A;  5ETM A;  2W5X A;  1T7P A;  1U6B A;  4B9L A;  4DLE A;  2RRB A;  1JX4 A;  3DRS B;  4DL3 A;  1GXL A;  4UOH A;  1S6O A;  4TVA B;  2OD4 A;  5L1I A;  2C42 A;  1WDT A;  1QUV A;  3M8Q B;  2KM8 B;  4O3S A;  2X1G A;  2K7J A;  4J9Q A;  4DSJ A;  3VV2 B;  5L38 A;  1PC5 A;  1YRU A;  2OH2 A;  2HGN A;  1RT4 A;  2CWK A;  4LQ3 A;  4LVN P;  2RHQ B;  2GGP A;  2QRR A;  2V94 A;  2CA9 A;  2HFV A;  2R7V A;  2DNM A;  3OXG A;  1NPP A;  2VAS A;  1KTQ A;  2I9S A;  1I94 F;  1VQN S;  3B8H A;  2WW8 A;  2D69 A;  4F4W A;  3WBZ A;  2P9C A;  3WHI A;  2K1R A;  3OUY B;  3F56 A;  4OQJ A;  1WNE A;  2CPE A;  2EEY A;  5D3G B;  1G1X A;  2V8P A;  2BUN A;  1TKT B;  4DR4 J;  4NCA A;  4FBU A;  3LP0 B;  3ZTP A;  1HNI B;  2OHD A;  2ALY B;  1UEU A;  2HMI B;  3BPD A;  1NZ8 A;  1PIE A;  1M1H A;  1Y00 A;  1QSY A;  4OI6 A;  2IVF B;  1RAG B;  1UVL A;  2FVC A;  2BKO A;  1U2F A;  2HK2 A;  2CPX A;  4AL5 A;  3HHE A;  3VVT A;  2YNF B;  2ZBC A;  1SKR A;  4IDK B;  3H98 A;  2QG9 B;  3CVK A;  2L08 A;  3GR0 A;  4MT1 A;  3MPV A;  3CCZ A;  4RWX A;  5D4L A;  4DHV A;  1JK9 B;  4K4X A;  3LP2 A;  1V3R A;  4ZJO A;  2C1E B;  2XWY A;  3PW0 A;  4I56 A;  4TYA A;  3T01 A;  5C7P A;  1CUL A;  3MAA B;  1TK5 A;  2E5I A;  4WFZ A;  3POT B;  1VHI A;  4O44 B;  4A8Q A;  1AJD A;  2R8K A;  1MU2 B;  3J7A N;  1SC4 B;  2DNP A;  5J1E B;  1CQM A;  4F3Q A;  4RZR A;  2H5E A;  2H5J B;  2LEA A;  3QZ7 A;  1YLX A;  1UEK A;  2IPO B;  2UUW A;  3CNQ P;  5HQ8 A;  2CJX B;  2KO1 A;  2B51 A;  1M0S A;  2XY5 A;  3LXQ A;  3HSG A;  4R5P B;  3OXL A;  3PYG A;  1J5O A;  1GTE A;  4QQB A;  4ZP9 A;  2HNZ A;  3S8S A;  3CJK A;  4QR1 A;  3M6V A;  3SIP B;  3B4D A;  1KKH A;  1VQ9 S;  1F9F A;  2FC8 A;  3DGP B;  3SYZ A;  4DBQ A;  5K8O A;  3D4J A;  4YR3 A;  2A2D A;  4CLY A;  1TKZ A;  1PJ7 A;  3ZTR A;  5E3Q A;  2NLW A;  1TAU A;  4Q0B A;  5DQH A;  2J7K A;  1UFW A;  4JI4 J;  3D6F B;  1XNR F;  3QID A;  3UN5 A;  4DWI A;  3TAP A;  2YX4 A;  5K5M A;  2YH0 A;  2YQ3 A;  1DY3 A;  3T9N A;  5I3P A;  4X4V A;  1GEH A;  3U27 A;  1RXO B;  2W2N P;  4M63 A;  5KG0 A;  4LBH A;  2VPX B;  1OY9 A;  2HUR A;  4DV1 F;  1FJ7 A;  3TAQ A;  3M2U B;  1RWV B;  1JB0 C;  2G0I A;  1AW0 A;  3FSX A;  2Z30 B;  5BR8 J;  2J0Q D;  3W5Z A;  3G6X A;  1U0S A;  4EWT A;  3QT6 A;  2ZVS A;  2DRB A;  1TUG B;  2XY6 A;  4EO6 A;  3WBH A;  1QM9 A;  1OSC A;  3W2V A;  5KFO A;  2KG1 A;  5KFY A;  4ED1 A;  4U9R A;  2ABY A;  4UY8 T;  1QJH A;  2IUC A;  3W9I A;  1A6L A;  1HHQ A;  3LAN A;  3CDW A;  3W8G A;  4MIA A;  2VFT A;  3MI7 X;  2VOO A;  4Q2M A;  1U0H B;  3I9V 9;  3TR5 A;  3TOQ A;  1PG5 B;  1E6V A;  4ZS6 A;  5C2G A;  2AHO B;  3T1Y J;  4JV0 A;  2DNH A;  1B64 A;  3PR5 B;  2EFG A;  3RB6 A;  1J5O B;  5J2N A;  3EZO A;  4JI6 F;  2F4V J;  2IM0 A;  3TVZ A;  3EXC X;  1R8C A;  1CC8 A;  3Q8U A;  5LMU J;  3KHL A;  2M70 A;  3MDF A;  4QIF A;  2CZ4 A;  1VQ5 S;  4TN2 A;  3SEO A;  3BV8 A;  5BYR A;  3P3D A;  2E1C A;  2HFN A;  4R25 A;  3AA8 A;  3ZZP A;  3V6D A;  3UQS A;  1HNW J;  2RNE A;  3M30 B;  4DSK A;  3NKP A;  2NSC A;  4FDJ A;  3BYR A;  2O5D A;  1R27 B;  5IZH A;  4C8L A;  4PUO B;  1PCA A;  1NM2 A;  1S7H A;  3D66 A;  2L9W A;  3MM8 A;  2Z4P A;  4RW9 A;  2ZZN A;  3EUN A;  2J0S D;  1O0P A;  1QAJ A;  4CLW A;  2O1P A;  1V6H A;  3EDR B;  3ETO A;  4LRE A;  1NK8 A;  3MTJ A;  1IBM F;  5L0K A;  5J2P A;  3OVB A;  3TX0 A;  2YWG A;  4C0O C;  1B3T A;  1UCN A;  4KM4 A;  1VK3 A;  1NH8 A;  5KFF A;  1ZAW A;  5FD1 A;  1ZEF A;  1WHW A;  4DOZ A;  2ZH6 A;  3I4H X;  1TL7 B;  1F1B B;  1U2C A;  3ENA A;  3MR7 A;  4GKK J;  3PAC A;  2FB0 A;  4KJI A;  2MKY A;  3RTV A;  2E29 A;  2AZ3 A;  1NJZ A;  1FI4 A;  2YX1 A;  1LFW A;  2DEJ A;  1DLO A;  3CTR A;  3R5A A;  2R2S A;  4A8S A;  4K4S A;  2HBY B;  4BC7 A;  3AB2 B;  1SKS A;  4P2X A;  1S76 D;  5CHC B;  3MUT P;  4UUW A;  3A13 A;  2M8D B;  1X4G A;  1Q8B A;  5A8W A;  5K8M A;  3AOC A;  2N3O A;  1RK8 A;  3C14 B;  2L41 A;  3GIJ A;  5MLC V;  1S5Z A;  1B0V A;  3ADA C;  3PV8 A;  1REV A;  4I6Y A;  4CP5 A;  1TKX B;  5KT4 A;  2MJU A;  4NWJ A;  2LVW A;  4ES2 A;  4FNI A;  2XI3 A;  3DOM A;  5F8M A;  3M2R A;  4Y00 A;  4O3Q A;  1YJT A;  2R2R A;  1N52 B;  5B7W A;  2M3D A;  4ZP7 A;  3HFZ B;  4MTP A;  2NXC A;  3H90 A;  1L3K A;  5CA5 A;  1N34 J;  2VB6 A;  2R7R A;  1OJ4 A;  4Y3C A;  2Q66 A;  5D4N A;  4CO2 A;  3KMQ A;  9RUB A;  3FZ2 A;  5KFR A;  2ALZ A;  1CS4 B;  5KFS A;  1TK0 A;  3PYE A;  1SUQ B;  4JV1 A;  2ZHA A;  7AT1 B;  2JNJ A;  1X8D A;  4W90 B;  4JV5 J;  3V81 B;  4A8F A;  3OXF A;  4ETX A;  2KKH A;  3V4I A;  4PG8 A;  2ZWO A;  3M8S A;  5F41 A;  4KGM A;  4HHH A;  3F0N A;  4PWU A;  1HJK A;  4I0W A;  4WKY A;  5A2Q U;  1JQG A;  4UOR A;  3VR1 A;  3E01 B;  3ZZT A;  4LF5 J;  4WYL A;  1WF2 A;  4DI6 A;  4V19 J;  5HRO A;  3NS5 A;  1EAR A;  2CUY A;  3QO9 B;  1TL5 A;  2VG7 A;  4IO9 Q;  3SFG A;  4WK1 A;  1RWU A;  2CQC A;  2P8I A;  5A0Y A;  4NLY A;  4UPL A;  2MKK A;  1RT2 B;  2B5J B;  3OTO F;  2DHA A;  5JVH Q;  4JYA J;  3MM7 B;  1FNX H;  3MWB A;  2COL A;  5LJ5 Y;  4I2Q B;  3MEG A;  3GCW P;  4BWJ A;  1IXK A;  3WZ0 A;  5LSL A;  5GVQ A;  5KG4 A;  4ZLJ A;  3BR8 A;  3X3U A;  3E8O A;  2OEL A;  2QL5 B;  2ZD1 A;  3WAV A;  4ZPV R;  5CQG A;  2LEC A;  4B56 A;  3NGR A;  3IAS 9;  2LFV A;  5AXK A;  3DLL Q;  3OQ2 A;  3GIR A;  2HHW A;  2PMH A;  2DNR A;  3SV4 A;  1WEX A;  1F5A A;  2DNY A;  4IFY B;  1SIW B;  2MKH A;  1KLM B;  2P2C B;  3FEX B;  5F0U A;  4NXN F;  4KC5 A;  1YGY A;  1X5P A;  3DYA B;  4F4Y A;  1W25 A;  1SL0 A;  1Y5I B;  5ITH A;  2I6W A;  3BDP A;  1C1B B;  2GC8 A;  2OEM A;  2XB2 D;  4N8N A;  4PG6 A;  1ZH5 A;  2R3V A;  3TZW A;  4LRB A;  3EVO A;  3HHL D;  5F8H A;  2BQU A;  4KHM A;  1RWN B;  1CLF A;  3IM8 A;  2ACM A;  4Q7A A;  1TVR B;  4WFX A;  3TYT A;  2VL1 A;  3T1H J;  3WAW A;  1ZPW X;  2B6A A;  5KG7 A;  2GX8 A;  3CJ2 A;  3WDO A;  3J7Z T;  2I1R A;  1S0V A;  4RKU C;  2J8S A;  2KZZ A;  1JLQ A;  1C4A A;  1VQ7 S;  3NRB A;  3EE3 A;  1JLF A;  3CCE S;  5I42 A;  2AP6 A;  2BKN A;  1RAA B;  1KR4 A;  2AMC B;  3DLK B;  1Y0H A;  4O0N A;  4RUA A;  3KDO A;  2RVJ A;  3NGD A;  1RAI B;  4UY8 5;  3VVU A;  1HPZ A;  2OPQ B;  4OZ0 A;  4F2R A;  3KLI A;  3DLE A;  4K5R A;  3M05 A;  3RBZ A;  3ET6 A;  5DO2 A;  5D6G A;  1N4L A;  3NY0 A;  2QX0 A;  4NOH A;  2CPD A;  2V34 A;  2QLJ B;  1WC6 A;  4FS1 A;  8RUC A;  1F9H A;  2NXN A;  5J1P A;  3HHL A;  2ZH3 A;  3RGI A;  3TUZ C;  2DXD A;  2JX2 A;  4LBP A;  4Y2M A;  2FJD B;  3N0V A;  2A18 A;  3GTY X;  4DQQ A;  1LWE B;  4OX7 A;  4DUY F;  3TI0 A;  1UVK A;  3ENV A;  2W1B A;  2K06 A;  2BW2 A;  2ZJR Q;  4QU6 A;  3W8P A;  3WX4 A;  1ZA2 B;  5DGB A;  2OPR B;  1HQU A;  3MXH P;  2FJV A;  1ITP A;  4RPF A;  4Y0F A;  4DX5 A;  1U45 A;  4PQU B;  2WTF A;  2V8H A;  4KY3 A;  4MFB A;  2CVI A;  3NCP A;  3QGI A;  2B0G A;  4WE1 A;  1TL1 B;  4LFB J;  3R5B A;  2MQN A;  4RR5 A;  3IR7 B;  3G71 S;  4JOU A;  3DMJ A;  2GA7 A;  5LMN F;  4ZGA A;  1P1L A;  2PO4 A;  2XSJ A;  1D09 B;  2OI2 A;  2YH1 A;  4WZQ A;  3FZB A;  5ETR A;  4B3S F;  2GSN A;  2KM8 C;  3MED A;  4ZIW A;  2VKR A;  3QAE A;  2JFK A;  3CIM A;  3ZZ0 A;  3S01 A;  2BW7 A;  4PYA A;  3BH6 B;  1FNO A;  4E8U A;  2NYI A;  3U02 A;  4YR1 A;  1N33 F;  3OL6 A;  1A0O B;  1FER A;  1HD1 A;  4CLP A;  3ELH A;  1VRU A;  4DFJ A;  2W8K A;  2C3O A;  3BGR A;  1RHR B;  4H4O A;  3W63 A;  3J81 j;  3M9N B;  4B3M F;  1RQ0 A;  2UUT A;  3UNG C;  4CYU A;  1U1K A;  1HHT P;  2C2D A;  1GQE A;  2QYC A;  3N6N A;  4P73 A;  5D0R A;  3HHL B;  2GHP A;  4Y28 C;  4OHZ A;  4NXM F;  1FHT A;  4PQA A;  2ZNY A;  3RG6 A;  2RQM A;  4NCG A;  2CPZ A;  4FPR A;  4DR5 F;  2JWN A;  1FVS A;  3UDV A;  1TV6 A;  3VAK A;  2L9D A;  3UPF A;  2E1R A;  1DRZ A;  2E9T A;  4X64 J;  1RA7 A;  1HLW A;  3OJS A;  2CZ9 A;  3FBC A;  4CI0 B;  4JP8 A;  1NCL A;  5HLF A;  4ZVE A;  4WFN Q;  3MK1 A;  1ZAV A;  3TJ8 A;  1KC8 T;  2X51 A;  4WXO A;  4MK8 A;  2XMU A;  4TQS A;  5HJX A;  2MDA A;  1KQF B;  2XRG A;  2GS8 A;  4FYY B;  2UUB F;  1N88 A;  1NND A;  4ZCK A;  1FDA A;  4ANE A;  2HHS A;  5C42 A;  3DI6 A;  3V4M A;  3J7Y I;  1RZM A;  4I4B A;  2FVS A;  2APO A;  4N41 A;  4ZPC A;  3H2U B;  1IBK J;  2R7X A;  1EIY B;  3WC2 A;  5D78 A;  2FJA B;  2UVR A;  4UOF A;  1YZ6 A;  1D8Z A;  5GAG U;  3MFI A;  4OZJ A;  1RTJ A;  2J6T A;  2CQB A;  2XLJ A;  2HQF A;  4NLO A;  3NGT A;  5HMX A;  4DUT A;  2B7C B;  1U1P A;  3QYY A;  3KLE A;  3PM9 A;  5E3P A;  4YEA A;  2IMW P;  4DFK A;  3GYX B;  1FKO A;  3MMA A;  5J2Q B;  4GTZ A;  4DQI A;  1S6P A;  2Q6B A;  3NXZ A;  5K20 B;  4LUB A;  1X0F A;  4M95 A;  4HHJ A;  5B0E A;  4ITS A;  5A6W A;  4QU7 A;  1K47 A;  4RW6 B;  5LT5 A;  2AX1 A;  3KTQ A;  2YBV A;  4DFP A;  4OYA A;  4DR1 F;  5DQI A;  3KNG A;  2GVZ A;  2Y1I A;  4YP3 A;  2KYZ A;  1QE1 B;  1WKL A;  3HO1 A;  4JI3 J;  1IKX B;  4P2S A;  1CJK B;  1ZA1 B;  4QYZ J;  1EI6 A;  3AOB A;  3BR9 A;  5D0E A;  4QWB A;  3TZY A;  1ZS6 A;  2DXE A;  3KG0 A;  1Y9O A;  3T1A A;  1JLA B;  4DF4 A;  1TL3 A;  1ZPV A;  1RT7 A;  2BAB A;  3LGH A;  3SCJ E;  4LJM A;  5H9E K;  1L5U A;  1FDD A;  5JMN A;  2G0J A;  2VQE F;  3VGT A;  5DET A;  2JSX A;  1IR2 A;  4IH7 A;  1VI7 A;  5IM0 A;  1YRX A;  1NH7 A;  3J7Z 5;  4OHY A;  3FVY A;  1ANI A;  1PAU B;  4F02 A;  3FCW A;  3MCS A;  4OLO A;  2BVZ A;  2PEH A;  4DSE A;  2MQM A;  2UVV A;  2XMV A;  2PFF B;  2RS2 A;  2HND B;  4I69 A;  1W2I A;  3E3X A;  4NLX A;  5KFQ A;  2IRY A;  6FDR A;  2ZH9 A;  4KGX B;  4O4R A;  1DTT A;  1XR6 A;  2GVD B;  3HJV A;  1WUU A;  4OX6 A;  3W2W A;  1O99 A;  2FDN A;  1GMW A;  5M2U A;  1NKC A;  2KN4 A;  4EEY A;  1TFW A;  4QW8 A;  4M5G A;  4NA3 A;  1VLY A;  1R8H A;  1RTD B;  3DCA A;  1PJ5 A;  4LT6 A;  4TLQ A;  1YJR A;  3R8Y A;  3BQ1 A;  2RML A;  2H54 B;  3D2W A;  1URN A;  3HK2 A;  1KHV A;  2HZA A;  3KHG A;  4KTQ A;  3GIM A;  1EJ7 L;  4N77 A;  1IM4 A;  2DH8 A;  3JXO A;  4FP9 A;  3KDN A;  2CRL A;  2R7W A;  1P8G A;  1ICE B;  1RT6 B;  5I3U B;  3K5L A;  2C2R A;  1YSJ A;  7FDR A;  2ZUG A;  4DR2 J;  4OYZ A;  1IKY B;  1LXJ A;  3PXG a;  3EM1 A;  4JI1 J;  1S10 A;  4OYB A;  1MWZ A;  1CJT A;  1S6Q B;  3CF5 Q;  4NPO A;  1MWY A;  4ZP6 A;  1KRP A;  2W01 A;  3QIP A;  1CVJ A;  3HP6 A;  2IBK A;  2DB1 A;  1SQE A;  1FRH A;  4DLG A;  1HBU B;  1R0A A;  2RQ4 A;  3MM6 B;  1I51 B;  3I0S B;  3SQO P;  3D0I E;  3IRX A;  4KGV B;  2WOM B;  1RWW B;  2YNI B;  2ZDO A;  3IS9 B;  4P2F A;  1RBL A;  4ZN3 A;  3PJ9 A;  2XHC A;  3G6Y A;  3U1L A;  2CQ0 A;  1NDL A;  1NKB A;  1FJC A;  4KFB A;  2DGQ A;  4J9N A;  5KFE A;  1M5V C;  1BQM A;  1BQN B;  3NWG A;  2E1A A;  4BBY A;  3FRY A;  2G1H A;  1X9W A;  2QJ3 A;  3GCX P;  4RW8 A;  1AFI A;  1TFY A;  4JI5 F;  3BQ0 A;  3KKF A;  4HAC A;  1CEZ A;  1S4E A;  4AXI A;  4B08 A;  1GH8 A;  1S1X B;  2H9Z A;  1Y4Z B;  4DV4 J;  3S7R A;  1R7I A;  4DV0 F;  2DR8 A;  5EWG A;  1JKH A;  1RWK B;  1C2P A;  3M32 A;  4K59 A;  3CSK A;  3M1V A;  3DDI A;  2VUG A;  4PKD B;  4Q8F A;  5AJ3 J;  3L9Z A;  2B7B B;  2VBX A;  4GMK A;  1MN7 A;  2V50 A;  3OFG A;  3QRQ A;  1T0T V;  2G4B A;  2ZE2 B;  2X3G A;  4XAK A;  2X1B A;  1WG4 A;  4OI0 A;  1CJV B;  2ZWP A;  3RZA A;  2OKQ A;  1U6F A;  2CPF A;  2DGX A;  4F50 A;  3ED4 A;  2LQB A;  3MEC B;  3IO1 A;  2OMO A;  2MJN A;  3R5D A;  5IT9 U;  2Q6C A;  1BC6 A;  1T95 A;  1WF0 A;  3A4T A;  4DPY A;  3K58 A;  4I2P B;  1EP4 A;  2M52 A;  5HAT A;  2JEI A;  4DPO A;  1AJB A;  2CQ4 A;  4FYW B;  4OZ2 A;  4X66 J;  1CQN A;  1MML A;  4A46 A;  2NXJ A;  5ETP A;  3JB9 k;  3BO3 A;  3N9U C;  1HNX J;  3I5A A;  2CQP A;  1NPR A;  1BXN A;  2WON A;  4UOG A;  1Q0N A;  4IR1 A;  3TQ1 A;  2G9Y A;  1B99 A;  5CZV A;  3CUL A;  1RE1 B;  4K2J A;  3CJS A;  4YME A;  2XYP B;  1RT5 A;  5M2P A;  4L72 B;  3GPA A;  3DXS X;  4NLS A;  4IG3 B;  1B0T A;  4O0I A;  5LOQ A;  1N6Q A;  4DUZ F;  1NU4 A;  1KVK A;  3L95 X;  3IWL A;  1KOH A;  3ZTQ A;  3QSY B;  4KPY A;  2DNG A;  2AGQ A;  1NB7 A;  3BKU A;  2QZ8 A;  2BJ7 A;  1C1C B;  1FKP A;  4B9M A;  3AFG A;  2VON A;  1K9M T;  2KG0 A;  5HRT A;  3IGN A;  4KH0 B;  5F8G A;  3BDF A;  1SKW A;  4KHP F;  2XGP A;  3DDK A;  2IM2 A;  4O4G A;  4ZVP B;  3KLG B;  1FRX A;  2WVD A;  3CJ4 A;  1KVJ A;  4ZIV A;  1S1U A;  2Z57 B;  3MR2 A;  1FK9 B;  5IXU A;  3VAG A;  3I5B A;  4G1Q A;  1BE4 A;  2AEJ A;  4I1T A;  1L3V A;  5C24 B;  3R3T A;  3TJ9 A;  2OPS B;  3BGF A;  5KFN A;  4DR6 J;  2XM3 A;  1R6Y A;  1RHU B;  1C0U B;  2LA4 A;  3AJ1 A;  4CO1 A;  4RU9 A;  1BWE A;  2AEF A;  4OHV A;  4MHX A;  1K7H A;  1Q53 A;  2RHS B;  4OI2 A;  1JJC B;  1NK6 A;  2W7P A;  2FLO A;  3KWM A;  3BEG B;  4A8M P;  4KAY A;  1IR1 A;  2W4C A;  1Z2Z A;  3OL9 A;  2YPZ A;  4EU0 A;  2ZBR A;  3R9L A;  1TUW A;  1OPI A;  4AT1 B;  3L7P A;  2W7O A;  3TX8 A;  4ATN A;  2D1C A;  3CJQ A;  2EC2 A;  5KFB A;  3OR2 B;  3UD3 P;  5A8R B;  4NEZ A;  4DV7 J;  4CQ1 A;  4PCQ A;  4K4T A;  4F0H A;  3D0G E;  2RIJ A;  5AXM A;  2BOP A;  3N5F A;  1RWX B;  1FE0 A;  2ZM6 J;  3W1Y C;  4Y6I A;  4IO1 A;  1P9Q C;  3A3O B;  5IS2 A;  1VC6 A;  5LIA A;  1R0B G;  1NK5 A;  3SXL A;  2EKY A;  3KNA A;  5F3Z A;  2A0F B;  2Z56 B;  2C2M B;  4K7Q A;  4EYI B;  1X0P A;  3H5Y A;  1YJ7 A;  2ZDP A;  3JTN A;  4LR8 A;  4Q43 A;  2AV5 A;  2JVO A;  4LF9 J;  4YOE A;  4XDC A;  3NKO A;  1LQ9 A;  1VBZ A;  4KAV A;  5DS7 A;  4RW4 B;  2DHH A;  4ZPT R;  3H59 A;  1K0T A;  5HQM A;  4DG1 B;  4GKJ F;  2DNK A;  2RKI A;  5A8K B;  3FBF A;  2GQ2 A;  2IFY A;  4YHH F;  5KFW A;  3HPO A;  1Z1Z A;  3RRH A;  2W9B A;  1N8R T;  4G1I A;  2V4R A;  3OSP A;  3DRR B;  1KWM A;  3G86 A;  3QT8 A;  2ZFH A;  2WAQ D;  4IRK A;  2DH7 A;  3PYF A;  2BJ9 A;  3O5T B;  4KO0 B;  2E5L J;  1DJ0 A;  3FFI A;  4EK2 A;  3FUY A;  3JTP A;  5JXS A;  1LW0 A;  2IRX A;  1Q7L B;  4C7Q A;  2MLY A;  3IBW A;  2RT3 A;  2UUC J;  2FC9 A;  2BMB A;  2DO4 A;  4C2M A;  5LM7 E;  3EVM A;  4WBF A;  2VBZ A;  5KFD A;  3C8Y A;  5T14 A;  2OTL S;  2R2T A;  4LFA F;  5LXR A;  1FSU A;  2QEX S;  2PA8 D;  3C66 A;  4DV3 J;  3SDE A;  2NS1 B;  1NB2 A;  1APS A;  3ITH B;  2DGV A;  2F3J A;  2LLZ A;  4LF7 J;  2GA3 A;  4F25 A;  4U96 A;  4Y2A A;  4CM0 A;  3EYZ A;  4NLT A;  4UPH A;  5T41 A;  1JWW A;  3DYC A;  3HLU A;  1LW2 B;  2HS0 A;  4J9S A;  4J9V A;  2M0G B;  2MZ1 A;  5J1N A;  3E51 A;  1X4F A;  5IT4 A;  3GFX A;  2QTW A;  5GAH U;  1PYT A;  1AA1 B;  4L76 A;  1HBN A;  5C25 B;  2QMW A;  4IFV B;  1S9E A;  2D9P A;  3OVA A;  3VAL A;  2RB7 A;  2BEF A;  3SSS A;  1OQ6 A;  3AHP A;  4CLF A;  5B0B A;  5KT2 A;  3DOK A;  1Q5Y A;  3DLJ A;  3OFF A;  4B3O A;  3B78 A;  2J9D A;  5HVH A;  3MK2 A;  1B4S A;  1IKW A;  2NR0 A;  1LWF B;  1S59 A;  3FJ2 A;  3S1T A;  1FFG B;  4JI7 J;  4ICL A;  3HSZ A;  5D77 A;  3BH7 B;  2MTL A;  4P7T A;  2QZU A;  2D7S A;  3FMB A;  4TKT A;  2ZIT A;  5ETT A;  3KHH A;  3MMB B;  2VA2 A;  4OYO A;  2HHH F;  5FLX Y;  1EJJ A;  3FRZ A;  4B02 A;  2EFQ A;  3FFI B;  5CXT A;  2YKM A;  1JMT A;  2PII A;  3G82 A;  1Y7A A;  1TU0 B;  2H1Y A;  1KLN A;  3CCM S;  1Q81 T;  3MUM P;  5FJ4 A;  2AYM A;  3HUL A;  2MZQ A;  5IV4 A;  4KQZ A;  4QR0 A;  1N36 J;  1Y7P A;  1HL6 A;  2W9C A;  4ECT A;  1H2V Z;  2M9K A;  1RHM B;  1S4F A;  2VFS A;  1RP5 A;  3W5Y A;  4WTY A;  3L4B C;  2CQH A;  3LH2 S;  4X62 J;  4ILR A;  3C6T A;  3OLB A;  1FT8 A;  1U1Q A;  2OUG A;  2ZKU A;  1U8S A;  2J9D E;  3BBF A;  1S7I A;  3BSA A;  5F3T A;  2KJW A;  1S1W A;  4NLV A;  1BHN A;  5IT9 Y;  1ELZ A;  4CT8 A;  4QIV A;  3I0R B;  3TAR A;  1KEK A;  1H7X A;  2IVM A;  5HO4 A;  2VU5 A;  3Q24 A;  2WK4 A;  4CCH A;  5DZ7 A;  4PWD A;  4TY9 A;  4IRD A;  3PRB A;  5EN1 A;  1EET B;  4M1K A;  1QLN A;  1Z2L A;  4NLQ A;  1TEL A;  1NHV A;  2HQC A;  4ZVG A;  2YKP A;  5A6P A;  2ADC A;  2FJX A;  2IM3 A;  5DJB A;  2IA6 A;  1HQ2 A;  3HKZ D;  2GSO A;  2ZKT A;  3D6T B;  5BXI A;  3JQK A;  5E5N A;  5E7O B;  5LSO A;  4QR2 A;  1M1G A;  3VAJ A;  4FXV A;  3CDU A;  2Y8Y A;  3PG9 A;  4LF1 A;  2L9N A;  3RW6 A;  4HYK A;  2CYY A;  2O01 C;  1YJ9 S;  4ZG6 A;  2E66 A;  2CQ3 A;  4GVB A;  3I87 A;  4H4K C;  4ZLN A;  4FVM A;  3HSD A;  2UUA F;  4H4K A;  1KFS A;  2OLW A;  3D54 A;  2YQ0 A;  2AZ1 A;  4LR9 A;  4F36 A;  1M5P C;  2AW0 A;  1MMN A;  3RW7 A;  4RW7 A;  2W5R A;  1RT3 B;  4ECW A;  1P27 B;  4OX9 F;  4C11 A;  1TAQ A;  2GNK A;  1KS2 A;  1RAB B;  4M5M A;  5CYQ A;  4DX6 A;  2DR5 A;  1IBL F;  4WYW A;  2KI2 A;  1CBK A;  2VBY A;  4X65 F;  3GQC A;  2DK2 A;  4AL6 A;  2BKP A;  3QGG A;  1HYS B;  3EIC A;  2KFN A;  3VHQ A;  2UU9 F;  4EMD A;  3IG1 B;  5B0G A;  2R7Q A;  3ENQ A;  3RBE A;  4RNM A;  3RAQ A;  4KPC A;  4F4A A;  4NA2 A;  3DKD A;  3MHY A;  3ONQ A;  2J9E A;  2BAN A;  3Q8Q B;  4X4O A;  1B7F A;  1M5S A;  2BE2 B;  2H5I B;  3UVJ B;  4CDI A;  1NRK A;  1SV5 B;  2V8D A;  4BWM A;  4LQY A;  3Q89 A;  4BLG A;  1NAQ A;  4IG0 B;  3I55 S;  1C0T B;  1VBK A;  2YVS A;  3KLV A;  1OY6 A;  3M7V A;  1EB0 A;  2FQQ B;  3A8K A;  2QIF A;  3KK2 B;  1DTQ B;  2ZC4 A;  2W5W A;  3A8I A;  3C15 A;  3KLF B;  2E9Z A;  1U8W A;  3QJL A;  1XN9 A;  2CKW A;  2QSW A;  1FDB A;  3MCN A;  3TAM B;  4C3K A;  1HR0 F;  2HAI A;  4DS4 A;  2HVI A;  2V9W A;  2IAJ A;  4RNN A;  2RQC A;  3NGU A;  2WVB A;  4KSE B;  2QA1 A;  3DOL B;  1U24 A;  4IR9 A;  3PJW A;  1LWC A;  1FNM A;  4N8O A;  1OY8 A;  3GU0 A;  1EW9 A;  5HSP A;  1HNZ F;  2DJW A;  2PMW A;  4RNH A;  3PR4 A;  4QIE A;  1HA1 A;  4QBU A;  2JOQ A;  1T05 A;  2J7U A;  4ECY A;  4LSN B;  8AT1 B;  2CZV C;  4I7F B;  2VG5 A;  3R2C J;  4J9K A;  3MM5 A;  5L0E A;  3M6X A;  4HT5 A;  1RWO B;  4C0B A;  1FF2 A;  4K50 A;  4DL6 A;  4ID5 B;  5IT0 A;  3MMJ A;  3W61 A;  1E2S P;  2NRE A;  2FJB B;  1AUK A;  2HHQ A;  1HBO A;  3CJR A;  3B4M A;  4RX6 A;  2A2C A;  1SL2 A;  4TY8 B;  1RTI B;  3H4D A;  1D9F A;  1AFJ A;  1RT1 A;  2KB2 A;  4CLZ A;  2F5G A;  2O67 A;  2B43 A;  2DPI A;  1N0U A;  4OYI A;  1KN6 A;  4C8O A;  3T5L A;  2P6S A;  3DLH A;  1S12 A;  4DV6 J;  1UMJ A;  4FF3 A;  2DHX A;  4F0K A;  2KHC A;  3GG1 A;  2FZK B;  1RKJ A;  1ZED A;  1WOR A;  3TZX A;  4N76 A;  5EWF A;  4DFM A;  3H0P A;  3PKY A;  5G0R A;  1IKV A;  3ENW A;  3G87 A;  1S1V B;  1DZ5 A;  4ZCM A;  2DIS A;  3PHE A;  1T9V A;  4LSL B;  4ZPB A;  2BJD A;  4A8W A;  3CD7 A;  2HNY A;  3WIU A;  4UPI A;  4JI2 F;  2NUH A;  3EZ5 A;  3QWU A;  2YNH B;  4C8N A;  4LFC J;  1FXR A;  2YXL A;  2WVC A;  1HI8 A;  4RO0 A;  3J80 U;  5HP1 A;  2P9G A;  3AY0 A;  5DDP C;  1HNV A;  2JLG A;  3EMT A;  2ROE A;  1DQA A;  3O8W A;  2UZA A;  3PEH A;  4PXC A;  4RBV A;  2OO4 A;  3I9Z A;  4NZ6 A;  1FRK A;  1TL4 A;  3BSO A;  2FVP A;  4RUB A;  3MM9 A;  3NL0 A;  1AZS A;  4LF8 J;  2DIU A;  1U47 A;  1NDK A;  3SCK E;  1QVG R;  2HHP A;  2DGW A;  1UTA A;  5KFX A;  1RJJ A;  3GFZ A;  4CXU A;  2YY3 A;  3DM2 B;  3B54 A;  3OW2 R;  1W2B R;  3NKR A;  1JLG A;  2IM1 A;  1NXI A;  2XTJ P;  3SSR A;  1F9E B;  2YKN A;  3CIZ A;  4P72 A;  4DSI A;  1Q16 B;  5K14 B;  5F8N A;  4ILL A;  4KH1 B;  4C3L A;  1U25 A;  4M5J A;  1UPM B;  4M8L A;  1RYS A;  4RWW A;  3FNN A;  4Y34 A;  3CGI A;  2DRA A;  1HWL A;  3DGV A;  4R0E A;  5IJQ A;  5JJB A;  4B3R J;  2CQ2 A;  1Y3J A;  2HIQ A;  2I0X A;  3HVT A;  5IV3 A;  1RU2 A;  2QC3 A;  1SQF A;  4DZ6 A;  1M1K T;  1FX2 A;  4AFF A;  1KHW A;  1AUS L;  3MF5 A;  2H65 B;  1W26 A;  2C28 A;  4IOA Q;  3A52 A;  4ECV A;  2WBR A;  1ALJ A;  1JLE A;  5B0C A;  1ZOT A;  2AX0 A;  5DDR C;  2XO6 A;  2DR6 A;  4CYS A;  4JI8 J;  3ZNU A;  1I1G A;  2U2F A;  4ZHR B;  2CJ9 A;  3THT A;  4DR7 J;  1PC4 A;  1BUX A;  1HAR A;  1Q4R A;  3KLH B;  1KHK A;  1R8P A;  3PFE A;  3H2L A;  1U1M A;  2KHD A;  2AIR B;  3EGN A;  2LXU A;  3CCW A;  5DLT A;  2PN6 A;  2WW4 A;  2K7K A;  2KVQ E;  2IYI A;  1LXN A;  2FUG 9;  3WAY A;  3OSN A;  1UJ5 A;  2VIH A;  1PBU A;  1WI8 A;  5E2Q A;  2Y1J A;  5CD4 H;  4JI0 F;  5HBM B;  2F4F A; 
#chains in the Genus database with same CATH homology
 4LR2 A;  3CMR A;  2RH6 A;  5HRT A;  1ED8 A;  1ALH A;  4LR7 A;  3BDF A;  3LXQ A;  4UOR A;  3UN2 A;  3NKP A;  3NKM A;  5GOV A;  4ZG6 A;  3NKQ A;  4FDJ A;  3BDG A;  3NKN A;  4LQY A;  2GSN A;  3WBH A;  5L0B A;  4GTY A;  5IJQ A;  4GTW A;  1E2S P;  1EW2 A;  3T02 A;  4GTZ A;  1ED9 A;  1AUK A;  1AJB A;  2W8D A;  4CYR A;  1KH4 A;  1KHL A;  1KH7 A;  1URB A;  3T00 A;  1ZEB A;  1ALK A;  3IGZ B;  3KD8 A;  4LRA A;  1SHN A;  1E1Z P;  2IUC A;  3M7V A;  3TWZ A;  3E2D A;  3WAX A;  4UOP A;  4QAX A;  1HDH A;  3MK1 A;  4ZG9 A;  3M8W A;  3Q3Q A;  4UPK A;  1E3C P;  5LIA A;  4FDI A;  4NWX A;  4MIV A;  3UN3 A;  4LR9 A;  4NWJ A;  1KH5 A;  4LRB A;  1E33 P;  4UPL A;  4YR1 A;  3MK2 A;  5INH A;  1AJA A;  2W5W A;  3A52 A;  4MY4 A;  5EGH A;  2XR9 A;  1ANI A;  2GSU A;  1URA A;  3IDD A;  1ALJ A;  1Y6V A;  2W5R A;  3M8Y A;  2XRG A;  1N2K A;  3BDG B;  1ELZ A;  4CXK A;  1B8J A;  1ALI A;  3T01 A;  4LRE A;  2W8S A;  4LRC A;  2X98 A;  1N2L A;  5KXA A;  1SHQ A;  4LR8 A;  2G9Y A;  3WAW A;  4CYS A;  5L0K A;  3SZY A;  1O98 A;  5AJ9 A;  4LRD A;  3UN5 A;  5LQQ A;  1KH9 A;  4KJG A;  4CXU A;  2IUC B;  1FSU A;  3NKO A;  5EGE A;  3BDH A;  5GRR A;  3TX0 A;  4UOO A;  1ZED A;  2QZU A;  4KAV A;  4KM4 A;  3NKR A;  4MHX A;  3B5Q A;  1K7H A;  1O99 A;  5TJ3 A;  3SZZ A;  2VQR A;  3WAV A;  3OT9 A;  1KHK A;  1EW9 A;  1AJD A;  3DPC A;  1ZEF A;  4TN0 A;  4B56 A;  2GA3 A;  1EQJ A;  4KJD A;  4KAY A;  1AJC A;  1EJJ A;  1P49 A;  5DLV A;  5IJS A;  1ELY A;  2W5Q A;  5DLT A;  5K4P A;  3UO0 A;  4CXS A;  1EW8 A;  5LRN A;  4UPH A;  4N7T A;  1EI6 A;  3MK0 A;  3TG0 A;  3M8Z A;  3DYC A;  3NVL A;  5LRM A;  3UNY A;  1HQA A;  1Y7A A;  3ED4 A;  2W5T A;  2GSO A;  2IFY A;  2W5X A;  5DLW A;  2ZKT A;  1KHN A;  2W5S A;  4GTX A;  3WAY A;  1KHJ A;  3IGY B;  2GLQ A;  4UPI A;  5C66 A;  2W5V A;  4LRF A;  1ELX A;  5L0E A;  1ANJ A;  4ZGA A;  2ANH A;  4ZG7 A;  2D1G A;  1HJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...