4LR7A

Phosphopentomutase s154a variant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 142
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr7A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr7A01
1Y6VA 3MK2A 5DLVA 1KHJA 2RH6A 1KHKA 3Q3QA 1AJAA 4B56A 5GRRA 4KJDA 4MY4A 4GTZA 4UPHA 5DLTA 1ALKA 4LQYA 3T00A 3BDFA 3NVLA 1AUKA 2W5VA 3DPCA 4QAXA 4FDIA 1EW2A 3T01A 3UN3A 1Y7AA 4NWXA 2ZKTA 2VQRA 1ELXA 4KAVA 1URAA 1KH7A 4CXSA 4LR8A 5C66A 1FSUA 3ED4A 4N7TA 2GLQA 1N2LA 1HQAA 3WAVA 3NKQA 1ZEFA 3SZYA 3IGYB 1KHNA 2QZUA 3BDHA 2GSUA 2IUCB 3IDDA 3UN2A 4ZG9A 5HRTA 5GOVA 4CYSA 5IJSA 1P49A 1EI6A 3T02A 3M8WA 1SHNA 3BDGA 1ZEDA 4LR2A 1E33P 4LRCA 5LQQA 1URBA 1ALHA 4UORA 5IJQA 1KH9A 3NKPA 3WAYA 1ED9A 3IGZB 1ANIA 2W8DA 2GSNA 4KJGA 4GTYA 3MK0A 4CYRA 3E2DA 2IFYA 1ANJA 3CMRA 4GTWA 3TG0A 2W5QA 2W5RA 3UO0A 1O98A 4CXKA 2W5SA 4KM4A 5TJ3A 1E1ZP 2G9YA 1ELYA 1ZEBA 2D1GA 2XRGA 3LXQA 5INHA 4ZGAA 1ALJA 1O99A 3B5QA 4UPLA 3NKNA 3UN5A 5K4PA 2IUCA 2W5TA 1AJBA 1KHLA 4LRBA 1KH5A 5EGEA 5DLWA 1ELZA 4KAYA 4CXUA 4UPIA 1N2KA 5LIAA 2W8SA 2X98A 3M8YA 3M8ZA 4LR9A 2W5XA 3BDGB 1E2SP 4LRFA 4ZG6A 4ZG7A 1SHQA 5LRNA 3SZZA 3MK1A 5L0KA 4NWJA 3A52A 1ALIA 4LRDA 3NKOA 1K7HA 5EGHA 1EJJA 1EQJA 1AJDA 1EW9A 5L0EA 4LR7A 3TWZA 1AJCA 4LRAA 1HJKA 3DYCA 1EW8A 4MIVA 5KXAA 4FDJA 1ED8A 5L0BA 1HDHA 2W5WA 4UOOA 4TN0A 3OT9A 1B8JA 4UOPA 3KD8A 2ANHA 3TX0A 2GSOA 1E3CP 3NKMA 4MHXA 5AJ9A 4YR1A 4LREA 3UNYA 4UPKA 1KH4A 3WBHA 3WAWA 2GA3A 3M7VA 3WAXA 3NKRA 2XR9A 5LRMA 4GTXA
chains in the Genus database with same CATH superfamily
1CULB 2XMVA 1P8GA 3NG8A 2RAQA 3CCTA 4OYMA 2K2PA 5M2UA 2Z2MA 3N28A 4ZOSA 4Y28C 4B02A 2HIQA 2DVIA 1LWFA 1IR1A 4EO6A 1UL3A 3EGNA 4L73A 2V8HA 1YG0A 1D8YA 3DOMB 1LFWA 1VR6A 2FY8A 2C3OA 1SQGA 3BQ2A 1NPKA 3KWMA 1D0EA 2CKWA 1WEXA 1UCNA 2WOMB 5KFLA 1VBYA 1HPZB 3H2LA 4CWBA 4IDKB 1IBMF 4P2FA 2E5LF 3UVJB 3RU0A 3FGVA 2I1RA 1N5SA 1FKOB 5L0KA 1V3RA 2WW8A 5AXLA 2YX4A 2NUHA 1GTEA 2YPYA 4FXWA 4PG4A 1NO8A 3RBEA 4WXOA 1FX4A 2B6AB 4DR1J 3R5DA 2ZBPA 2HK3A 6FD1A 3WIVA 1IKXB 5KFHA 3KK3B 2XCPA 3HHLB 3NLCA 3GQCA 1RP5A 3U1MA 2FLNA 4DSKA 1RYRA 4JI7F 4LF7F 3T5HA 4L3NA 2O01C 4AL6A 2NXNA 3J7ZT 4CLWA 4LRCA 4CO5A 1NSKL 1VBZA 3VAGA 1HYSA 3IGNA 1RBAA 4M5IA 5L9NA 2IYGA 1YZ6A 4Y3CA 3QLHA 2W4DA 4FF4A 3NNHA 3TZWA 2HRUA 3CJQA 2KKHA 1U6FA 3C3LA 3GR1A 4BC7A 3D6FB 4J7CA 3CB4A 5IS2A 1EX8A 4KAYA 1RTHA 2QSWA 4JV5F 3ELHA 4FKXA 4Q0BB 1C1CB 5GADI 3M4XA 1I6JA 1MWZA 2QSFA 3DYCA 1PYOB 4CO0A 4IR9A 1IKYA 5LT5A 3KLVA 4ID8A 1R27B 2GSOA 4FF3A 2WB4A 3Q8VA 3NGRA 5J2MB 5SZTA 1TKTB 2ZH2A 1Y5NB 2ILZA 4NLWA 1RAFB 1S48A 5IM0A 2ADCA 4WFXA 2UXDJ 4QBUA 4PPZA 3CJ5A 2JNJA 1UW9A 1JLQA 5KG3A 5JVHQ 4LF6J 2KG0A 1T7PA 2XY7A 3W2VB 2PIIA 1WWHA 3PR5B 1HNXF 1PJ5A 3IN5A 3IDDA 5FD1A 2ROEA 1RTDA 4R0EA 1JJCB 3EDRB 1K73T 1R8PA 1TUGB 1VCTA 2WK4A 1AFJA 2DGWA 4MTPA 4U7CA 1C4AA 3POTB 1REVB 2XYHB 3RAMA 2IPOB 4PWUA 4P10A 1NKEA 2YH0A 1FTRA 2NS1B 1S6QA 5DG8A 4KPCA 5KFGA 3E51A 5FDLA 3A8EA 4NZ0A 2WB1D 3I0RA 3GJTB 1ZA1B 3CEDA 1BQXA 2XZWA 4Y2KA 2A18A 4CZCA 1VJWA 2J6TA 3EGVA 2HNYB 4FDJA 4WFNQ 4MYUA 2HFOA 3PW2A 3A3OB 3MAHA 5B0AA 2JFKA 3OR1A 2IC3B 2QLJB 1B99A 3PJXA 4A8WA 2OPQA 4JI6J 4JI4J 5KFFA 1U47A 2VJVA 2W9CA 1Q1KA 3C19A 3FBEA 1C1BB 4QYRA 3SSSA 2MSSA 3M2VB 4X64F 1TK8A 5D3GB 2YNFA 2CADA 3HO1A 2ZDPA 4C11B 2COLA 4MK7A 2CZVC 2FGOA 4QPXA 4ANEA 4K4UA 3ZTOA 2HWHA 2NUUG 3RYLA 3NAHA 4NCGB 3BKTA 4B9VA 2CDRB 3UPFA 1VHFA 3OL8A 3QRQA 2B8QA 2GHVC 3H2UB 5K8OA 5L1KA 5DZ6A 1U0HA 3PVXA 5B08A 3BGUA 4IO9Q 4EU0A 4B3RJ 3P6YC 2RHQB 2J76E 1KHLA 5CYJA 4LQ9A 2XYGB 4DCJB 4DPOA 3VV2B 4Z7CA 3RBXA 1JIHA 4TXSA 1UW4A 1XC9A 5K20B 2PI5A 2QA1A 4I6YA 3KLIA 4JI0F 1CS4B 2EFPA 1VHIA 3PG9A 3MPWA 4NA2A 4DHVA 1ZTWA 1U6ZA 1YRXA 4PG6A 5HN0A 4WE1B 2MHNA 2CQ3A 3DM2A 3NS6A 3KDOA 4K4XA 3SSRA 2KO1A 4LR8A 2V8VA 1RYSA 4DV3J 4KC5A 4KGMA 2GLQA 2CPHA 2RUSA 4CLTA 2PFFB 5F8JA 1S99A 3MM9B 4ED6A 1MMNA 3W5ZA 2CZ9A 1H98A 1K9MT 2O67A 1UZDA 1NCLA 5GVQA 2CPJA 2EG1A 4I6AA 4JI8F 1LW0B 2A0FB 2RNEA 1LWCB 1RBLA 2EFQA 5L1LA 3T5KA 4J9PA 3PTWA 3C16A 1NJXA 3VGUA 3L3CA 2J6UA 5A6PA 4H54A 1VFJA 5A8RB 3G6VA 1XNQF 4WWSA 4DV0F 4B3MF 1EARA 3DHXA 1X9SA 3I0SB 1S9GB 2KYXA 1F5AA 4CO3A 3LP2B 1KQFB 1EQJA 2YKAA 4K5RA 1RXOB 5HMXA 3TVZA 2ZBCA 4A8FA 1N34J 1NB2A 3LP0A 2AJ1A 1OMSA 2QMWA 1CBKA 2Z2LA 3MEDA 2RIJA 3WIUA 1KKHA 4PQAA 1NBEB 4OLPA 4DUTA 3DGVA 4L76A 3JTOA 1UVMA 3BBCA 3CDUA 2W9AA 1VQNS 1YHQS 3HLUA 3R1LA 1B64A 2D3ZA 1WEZA 1X4HA 1TU0B 2BEFA 1OYDA 3H5UA 3I5AA 3QMQA 4F0KA 4ES3A 1CJVA 4PRFA 3KLEA 2ZD1A 2JVRA 4JI1J 1GH8A 2HMIA 3DLKA 3KUEA 3GFYA 3FCWA 3QFWA 1KOOA 2OFGX 3O5TB 3PX6A 1ANIA 3DOKA 2ZE2A 2HBYB 1VQLS 3TVKA 2ASLA 4I56A 2NYIA 2HS4A 3M8QB 3AOAA 4K4VA 2UP1A 2U2FA 2BABA 3TJAA 2CPXA 1G1XA 1SPBP 1HLWA 4WK1A 2DHXA 2ASJA 1JXVA 2YH1A 2F4FA 5GADU 3GP9A 1FWKA 5HJYA 3A8KA 2B56A 1UJ4A 2ANHA 3AXKA 3IP0A 3E01A 1F9FA 1SQFA 4EBCA 1RTZA 1T9WA 4B3TF 1IBLF 4UQGA 2GGPB 1SC4B 3AQPA 3PX4A 2CPEA 3EDQB 1TFYA 3OTBA 4MK8A 1S9EA 3R5CA 3SFGA 2MY7A 2ZOMA 2H3EB 4IO1A 2N82B 1L3VA 4OI4A 4P72A 4DL5A 4Y2MA 2QFJA 2RUGA 2KDOA 1QAXA 3PW0A 3E2DA 4C98A 1R0CB 3KK1B 2XWYA 1IJEB 5TJ3A 1BWEA 3DXBA 2JSXA 3PACA 3I87A 4OYAA 1MN7A 2XBPA 2AGOA 2W7AA 1NJWA 3K2YA 4LRBA 2HHTA 3JAMY 5H9FK 5E3QA 4TNOA 3N01A 4NRTA 3KHLA 1WUUA 3H59A 3SXLA 1KRPA 5JVGQ 3SV4A 2V67A 1KEKA 4K8RA 5DG7A 2B4VA 3QIPB 4O3QA 3NKRA 5L39A 4I0WA 1UZHA 3H25A 1UA1A 4ZVRB 4O3RA 3Q8SB 2GHWA 1UKUA 1L5UA 4HKQA 3S8SA 3CC2S 3GIRA 5E7OB 2DR9A 2JC0A 1EB0A 1P1LA 3F73A 2OTJS 3MAAA 1H6KX 1BLUA 3CD5A 2MJNA 1RT2A 2H48B 5A0YB 3B4MA 3MPUB 3HHKA 3OQ2A 3C6UA 5B0CA 5L1JA 4FDFA 3PM9A 3W63A 5LMNJ 1FRIA 2KRRA 3D0GE 4ID5B 2MB0B 3MEGB 3T9NA 1S97A 1Q0NA 1T3NA 2R8JA 4HTJA 2EC2A 2W5QA 4CXKA 2DXDA 4Q2LA 1WHXA 3NRBA 3GPAA 4G3IA 4ECTA 1HR0F 1L3TA 3MD3A 3ZTPA 3RBDA 4Z2XA 1AJDA 4CTAB 4CLFA 3IXQA 1Q79A 1EW8A 2Y8WA 2W4PA 3CCSS 1Q7YT 4OYPA 1VBXA 3N9UC 3GIMA 2CJAA 3G82B 2NLWA 1WDTA 1EP4A 4X4QA 4YOEA 1AFIA 4ECQA 3KJFB 4ZVFA 4PZVA 2I5JA 2RS8A 3O3LA 3MM6A 2J7KA 2B43A 2Q6BA 2V69A 2BE2A 2K7KA 4NYZA 3OFGA 3BDHA 5I4MA 4HTIA 3MECA 4OZ5A 4DLGA 4HACB 1BC6A 1CULA 3Q8QB 4C4WA 3O6QA 2W8LA 1TAQA 4PXCA 1NPPA 1HNIA 5JMNA 1FFGB 3HD2A 3NNAA 4R5PB 4J90A 3LWLA 1RAOA 4CNYA 3EVOA 4ER8A 3UN5A 2HHQA 2F8EX 3Q83A 3FQLA 2HZVA 2XWXA 4OL8A 3SCIE 1U1OA 1ZBTA 2VPWB 2G0IA 4ERDA 2AWZA 2M88A 2CQ0A 2WOMA 1MN9A 4U7UK 1HPZA 2DH8A 3DRPB 2YWFA 4IDKA 3UVJA 2ZEJA 3OTEA 2CNOB 5IV4A 1FKOA 5DRKA 3OJSA 2KFYA 4KGXB 2BR0A 3H8YA 5HSPA 3K17A 4YMEA 2ZOFA 2VL1A 2CNLB 2XS7A 2AX0A 4ZLJA 3KDNA 2Z58B 2HBQB 2DR8A 3MCNA 4HHJA 3D7SB 3CPWR 2R7UA 3CC4S 1IKXA 4O44B 1NU4A 3KK3A 2CQ4A 5D4NA 4ELUA 3NGUA 3IRWP 3CDEA 4DV2F 3NKPA 3VAFA 1SJFA 3HT0A 1X5PA 4LSNB 5IZHA 5GMDA 1IKWB 5D0RA 1ROFA 4AXIA 4K4SA 4L3KA 1R8CA 3A4TA 2CQCA 4NEYA 1YBTA 3AY0A 3OL6A 4JB8B 2FJWA 3EJMA 4IQMA 4KGKA 5EX3A 5IWAF 3RUBL 2KM8B 1QTNB 3GLJA 1NSAA 3V6HA 2V9WA 2QC3A 1R3NA 3I96A 2LCWA 1T9XA 2UVWA 1SJ3P 4BC9A 2OI2A 2DGUA 1R8BA 3Q3QA 1H38A 2GCFA 4Q0BA 4CLKA 3MZIA 2F4VF 1C1CA 2VIHA 4KO0B 4C7QA 3PXGa 1ZM3A 2BJ8A 3PEJA 3OV7A 3IFEA 4B08A 2X1BA 5J2MA 1TKTA 2UUTA 1X5TA 4RUCA 2V2VA 1OY6A 1XBWA 4RU2A 1XERA 2LXFA 3W2VA 5C42B 3FRZA 1ALJA 3B5QA 1C0TB 2KH9A 3BDEA 4K4TA 2VV5A 3PHTA 3NY0A 3CJTA 3N5BA 3TW0A 3QJLA 4M5KA 2OEKA 1EQ0A 3SZZA 1SC1B 4ALZA 3POTA 1REVA 3FNNA 1MROB 2C2KB 4A8YA 1T9VA 1XNRJ 3UFCX 3KLGB 3MUVP 2F63A 4XO0A 1RE1B 2OLWA 4MKBA 4UZCA 1SJQA 5DQIA 3T9ZA 1B0TA 2HQCA 3NMAA 2LU1A 2E5IA 2JOQA 2KRBA 4PWDB 3DLBA 4OX9F 3G86A 1B7YB 1MMLA 1GXTA 2FVQA 1RKIA 4GKJF 4OI1A 2WSEC 2BX6A 2IC3A 3T02A 1A9NB 4PXDA 1WOSA 2WVEA 4FF1A 2GIFA 5A6WA 2FHJD 4HT5A 3ISND 4OYOA 4WKYA 4CLSA 2F3JA 4AL7A 3RTVA 1C1BA 3H20A 3MOJB 3MFIA 5KT5A 2VH7A 4DU8A 5D3GA 4MJKA 5IV3A 4C11A 3IR5B 2CJKA 2VZ9A 4RO0A 2D1CA 2BE9B 4W92B 4NCGA 3PRDA 3WZ0A 3ZZZA 4QWCA 1JLAB 1WG5A 3FDSA 4XDCA 2VBXA 3I9ZA 4ZG7A 2MZQA 3WX8A 2OEMA 3P5TL 1PBAA 1WI8A 1M5HA 3US5A 4PXBA 2DJWA 3RJMB 1U1QA 1T05A 3PW7A 4CO4A 3K5PA 4IKAA 2B8PA 1CPZA 3N6LA 3LGNA 4F04B 5M2PA 4OI6A 1D09B 3VAJA 2XTJP 1NK0A 1HBUA 3BBFA 4OHYA 1KR4A 5CYQB 1RT7B 4JI2J 4QZVB 1BD6A 4UUWA 4PG7A 1YK9A 2ZH1A 2CG4A 5HMYA 3T5JA 3D1QA 5DM6Q 3CF5Q 5H9FJ 4DPTA 1CS4A 2ZM6F 2HVHA 4LF4J 3UCGA 3CCRS 3ILLA 3T6BA 1FJ7A 1GT8A 4WE1A 3QQCD 3ETMA 1RAHB 4WIQA 2LP4A 2X3DA 4ZJQA 2F9JA 2H1YA 2B7CB 3FC9A 3IBFB 1ZEBA 1QJHA 3PFOA 4DR1F 2AHOB 1U2CA 1PIEA 2VD3A 1FCAA 4ZJOA 4DV6F 1SL2A 2F65A 4N47A 3IWNC 2RF2B 4R0JA 2HRTA 1NUEA 4LSZB 5HVFA 1FXDA 2GO9A 4NWJA 3UDCA 3GYNA 1RA6A 5GMKa 2MZ1A 2OKQA 2GW8A 5DETA 4M8LA 3MM7A 5L0EA 1LW0A 2RS2A 1VS3A 3KG4A 5GAGI 1LWCA 1IKVB 2WVFA 2ZJQQ 4MHXA 3DRXA 4JUZA 4CYUB 3W9IA 1RUSA 2ADBA 5A8RA 2GQQA 1VQYA 4ZVPB 3VZIA 2M2BA 1R6VA 4GTZA 4ILLA 1S9GA 1F9EB 3DU6A 3MTJA 2FJDB 3NNCA 2YXLA 1AXQA 3C66A 2KHCA 1FRLA 4CLZA 2H5JB 3QGGA 4OMFG 8ATCB 3BO4A 5KFCA 1CC7A 1AUDA 1TKXB 4DQRA 5G0RA 4D3HA 4U8VA 2R7WA 3HMJG 1HD1A 4KKOA 3IAS9 2DCUB 4M5DB 3RB0A 2H9ZA 2ZUGA 4ED1A 2E9TA 4ZKAA 1O99A 2E5GA 2WSCC 2YKMB 1N5QA 3BR8A 2K8GA 3GE9A 2UXDF 4NL5A 3I56S 2KFZA 3GV8B 5F0WA 4L74A 1QAJA 2XMKA 5B0BA 3AAWB 1MWYA 2JL9A 4DWIA 4ZVSB 4U8YA 3BYPA 3SZ2A 2CA9A 2D3O1 3M8QA 4GVLA 4OQJA 5F41A 1R8AA 3M9MB 4Q5VA 2MQOA 1T02A 4WYLA 1JXEA 4OI3A 4DV7J 2AGPA 4ED4A 2UVVA 1FRHA 4WFAQ 1FWLA 3R97A 4ZN1A 2IAJB 4Q8EA 4QW9A 3FEYB 1FRKA 2HQ3A 1Q5VA 4TY9A 4DJBA 5EGYA 2WONA 3G8QA 2RSQA 2GGPA 2J7WA 1JLCB 1OQ6A 4DQSA 2FDNA 3HSDA 4ECSA 2KVIA 2GIRA 4NX9A 3MEEB 4JI6F 4JI4F 4YY3F 3W7BA 5KT7A 2AYEA 1RWVB 1X4GA 3CTRA 1FKPB 3T19A 2OJ3A 1RSCA 3ZZRA 2R7RA 3H5XA 2VG7B 3BQ0A 3UE2A 1SQEA 4UTGA 3I31A 4AQYJ 1HQEB 1HW9A 4CDIA 2PA8D 4ED8A 2AD9A 2F5GA 3PDNA 4LFCF 1JLFB 3MUTP 1YTYA 4WP9A 4USTA 4JI3J 2EBGA 3BDFA 1J5EJ 1XTZA 4C2MA 4P7TA 2DEIA 1JJ2R 1U49A 2LQ9A 3AA8A 3ET6B 2D9PA 1NDCA 4BS2A 2HGMA 1S79A 2I0XA 2QGFB 3OW2R 1FD8A 3OLAA 1EQMA 3ENQA 4EK2A 2DTJA 3QT6A 5D0HA 2N3OA 2MKYA 1HBNB 5A2QY 2BJ1A 3D1HA 5J2NB 1V3ZA 3BDPA 3PIPQ 1WDDA 1TUVA 4O0NA 3UO0A 1N33F 1QVFR 1BUXA 5C24B 1TAUA 2O3DA 5INHA 2PEBA 5A0YA 1HD0A 4F4ZA 1U26A 3QT7A 3KNAA 1KONA 3JB9k 1S1WA 3R5BA 2MQNA 4E0DA 2LEAA 4WK3A 5HL7Q 5MAOA 4ID5A 2NXJA 2HNDB 3MEGA 4I69A 1IR2A 4F4XA 4OYXA 2DGQA 3NWRA 5FJ4A 3S6EA 3FFIB 3ICLA 5DLVA 1YBAA 3SMZA 4DCPB 4ZLLA 3TAMB 3HFVA 1P9YA 2NZ4A 1Y9OA 3MGJA 4QIVA 4CTAA 5AE1A 2RRNA 3JAMU 4NA1A 4QJVA 4KV8B 5E0OA 3E3XA 4EFAC 1RB0A 4A8OA 3G82A 2ZNYA 2WVCA 3BB5A 2Q1LA 2MXYA 1X9MA 1QM9A 2IJNA 4N5SA 1SVDA 4ZVEA 4ELTA 1HBMB 3IA0A 4KHPJ 1CEZA 1RACB 1N34F 3C14B 5HMZA 4JI5J 3RR8A 2DITA 3UW1A 6AT1B 2E7WA 1KS2A 4HACA 2Z2ZA 1N2KA 3ZZ0A 4WTYA 4J9VA 3J80Y 1KD1T 2WBRA 5ETQA 4L75A 1HQ2A 1SH2A 4ZPBA 1Q8BA 3JQKA 1QSYA 3K5MA 3VVTA 5GAGU 4R5PA 3MM8A 3QYYA 2HZAA 2IM0A 4JI1F 3GYXB 5CCLA 4CIOA 1KFSA 1QVGR 1KHJA 4ANDA 4DR2F 3QATA 1QUVA 1FDNA 3KXDA 2HPUA 3PFEA 4C3MA 4M5GA 1KWMA 1X4BA 1S7HA 2QJ3A 4I67A 3MWBA 1RLCL 4RWXA 3B8HA 3ZZUA 3DRPA 1EKRA 1P1TA 1V5IB 1TVRB 1KP6A 5MLCV 5CZXA 3VWSA 1XMBA 3ZNUA 1ED9A 1SH0A 1SUQB 5BYSA 4MT1A 2BJ7A 2IFYA 4C9DA 5HBMB 3QAUA 2PMZD 4DR5J 1TL5A 3AA9A 2DB1A 5CQGA 1RAIB 4ZGAA 3OFFA 1JLBB 3SCJE 3R6GB 2RT3A 4ETZA 1UWAA 4AD6A 4R8UB 3UDVA 2GQCA 4PCQA 4O44A 2VQFF 1KTQA 2KYZA 4YN3B 4OX8A 1ALIA 5FLXU 2B7BB 4RPFA 1WD6A 1I1GA 1EW9A 4OZ3A 1VIOA 1IKWA 1FFWB 2C2MB 3PYFA 4U67Q 2K3IA 4X4RA 4I2PB 3K0JA 3GB0A 2WVDA 3HSGA 3AD8C 5M2RA 4M5MA 4K0KJ 1RDRA 1J5OA 3NEKA 2AP6A 4ATNA 2UU9F 1DLOB 1X7VA 1WORA 1ZPVA 1K47A 1UWBA 1RAGB 4K50A 2AU0A 4KQZA 1Q16B 2ZOGA 3PX0A 3M6XA 2CNKB 4O4RA 1AT1B 4J9LA 1X4CA 2ZVSA 1SIZA 1VQ6S 4FYYB 3BKUA 3FBFA 4KO0A 3L95X 3IAM9 5I3UA 4NOHA 2E5JA 1N5YB 1F6TA 3NS7B 2M52A 1NXIA 1X5SA 1DTTB 2CAJA 3NCRA 1LWFB 2C2NA 4RZRA 4NI2B 2KZZA 3UR3C 2VFVA 2GA7A 2WHOA 5B0DA 3MOZA 3JXOA 3CIMA 1PG5B 1JNRB 1NAQA 2AZ3A 3PRVA 2C3YA 3VR1A 4DR3F 4A47A 2GQ2A 4DZ6A 1VK8A 2MZJA 2VICA 1U45A 2CWXA 3BBBA 5C42A 2FJBB 3DKDA 3CJKB 4FPRA 1HWIA 1RI7A 5LMNF 2Q66A 2BQ3A 1N0UA 4JV0A 1Q8KA 3UCUP 4NPOA 3J7AN 1F5BA 3UD4P 4C97A 1SKWA 5DO2A 3W65A 1ELXA 1RU1A 1MROA 2DNYA 4X65J 3KLGA 1YJUA 5KT3A 4ZIWA 2IUCB 2DEJA 4DV1F 1F3VA 4WU3A 3M8WA 3H42A 4M63A 3OL9A 5E2QA 4PWDA 4EMDA 4EGLA 4CLYA 2NXUA 3ZFVA 4M5NA 1ANJA 5ADZA 2ACYA 4KM4A 2EFOA 2GJIA 2BV3A 2RB7A 3NKNA 2I38A 4N41A 2OELA 4X4NA 1KH5A 3MMBA 2J8SA 2J9CA 1UMJA 1WF0A 1Y5LB 3Q0AA 5G4DA 4J9MA 5EGHA 1HYSB 4CH0S 3D3BJ 3CUNA 4YHHJ 4TN0A 2SXLA 4PEOA 3PW4A 3CCMS 3WBHA 2BYCA 2E1RA 4NXMF 2XLJA 3HXMA 2FPHX 1HHSA 3ZZTA 2B4PA 4G1PA 1JLAA 4DN0A 2YKOA 1YJNS 3HKZD 2AF6A 3CO9A 1XMOJ 1OPZA 3A1YG 5B0FA 3HHEA 5K5MA 1AUSL 4OHZA 4U95A 1QSSA 2GVDA 3TRGA 4F50A 3OXFA 3P45B 1WJ9A 1IR0A 4U7UD 1C0UB 1VQ8S 3TUIC 1K44A 2A6MA 2YQ1A 2W8DA 5CYQA 4F4AA 1SBRA 1R6YA 1RT7A 4ZIVA 1JLQB 4QR2A 5L38A 4C48A 2DRDA 4MKAA 2V9KA 2J0XA 4PAAA 2KJVA 1M5PC 3R5AA 2W25A 3QBCA 1UJ5A 3MK1A 1EJ7L 4DEZA 4WCEQ 3SI8A 4OZ2A 2EBEA 1LNQA 2JLEA 3K7RA 1VC6A 4F3QA 4PUOB 2VG6A 4A8KA 3MMCB 2R7VA 5HROA 1R43A 3DLEB 2C3PA 3ILIA 1S6QB 2I6WA 2KL8A 2Q3PA 2ZUAA 1ZM2A 1NNDA 5FDLB 5KOXA 3Q2SC 3I0RB 3N0VA 4GO5X 2RF2A 2I2YA 1IXKA 2UXCF 5DQGA 1GTHA 1LWEB 5IC4B 3K58A 2OIHA 2OD6A 2GFFA 4KR0B 4MIAA 2YKNA 2CRLA 3S01A 1G7CB 4ILRA 4QWDA 3CD7A 3EZ5A 1OQ3A 3M1VB 3M8PB 3OR1B 4CYUA 5DLGA 4ZVQB 5EWFA 1ZEDA 2JFDA 2MDAA 4K4YA 1KHVA 5BXIA 1KBRA 3FCHA 4NXNF 1F60B 1NHUA 2XMUA 3CSKA 2CJYB 2HURA 4OZLA 1H2TZ 5IT9U 1GXUA 4OI0A 3R2CJ 4DL6A 4NCBA 4JYAF 1TKXA 3QWUA 3W1YC 2W5XA 4OJ3A 4DUYJ 5KG6A 4YB5A 1URNA 2HVZA 4M5DA 2ALYB 1JJHA 1U0HB 3VGSA 4XIUA 1EKSA 3I4PA 1RA7A 4IRDA 3W64A 1LK5A 3TX0A 2O1PA 1IBCB 2QA2A 4XPEA 1RT5B 2YKMA 4ICLB 5ETKA 2CQ2A 1N5VA 2ZITA 1SB6A 1R0BG 2PC6A 3MFHA 2YVSA 4WP8A 3T01A 3LQVA 1ZS6A 3D0HE 1YWXA 1M5OC 1VC0A 4PQUB 2H54B 4IRKA 2FHJA 1GNKA 4ED7A 2GSUA 2MGZA 2M5YA 3BN7A 2Z57B 3B54A 2AT1B 2DNLA 5KFMA 3HVAA 3CDAA 4TU8A 1OSDA 4BWMA 4CRJA 1XNRF 1FE0A 2G9YA 5KAKA 3FSXA 4ECZA 4LF8J 1B3TA 2IAJA 4OI2A 2HW3A 5BR8F 1I94J 4KHRA 5B09A 1TUWA 2LVWA 1T8EA 4F4YA 3ILJA 1KFDA 2LLZA 4F8RA 1JLCA 4P7VA 4L6V3 2WTFA 3GMGA 2D3UA 4K2JA 3W9HA 2BMBA 2FC9A 3QSIA 2ZHBA 1Q86T 2MQ8A 3A3PB 3DNCA 1FDDA 2BRLA 4DQPA 2KZMA 2HHWA 4XDDA 2V34A 1FKPA 3IS9B 4TQRA 2UUAJ 4UPHA 2OH2A 4YQWA 1AUKA 3W5YA 3BSAA 3OXLA 4OYZA 2FJEB 4X4SA 2P9GA 2HZCA 2MKSA 4ZLPA 1RT4B 4UUXA 5AXKA 1HQEA 3QNWB 2GNKA 1ZEFA 2V4RA 4KH1B 5F9NA 2D3OR 1RHKB 4OHXA 2LECA 3R1HA 3R8YA 4DSEA 4F4KA 2B9WA 3VGVA 1S72S 2ZBQA 4JP8A 4X62F 4E98A 1H73A 2HKEA 4QWAA 5CA5A 4EYHB 3H0PA 1CVJA 3KLEB 4NLUA 4WFZA 1NHKL 3VALA 5DLFA 4HL9A 3F41A 3V6DB 1K1SA 1HBNA 5HI7A 4RW8B 5CABA 5J2NA 4EZ6A 4V19J 4QYZK 3HX9A 3J81j 1JLEB 2LXUA 4WKRA 3DOKB 1RCOB 2ZE2B 3FJ2A 2ROPA 2FVSA 4HLBA 1QY7A 2C3UA 2FD2A 1N54B 2X7IA 3QGIA 4NZ7A 1N56A 5C24A 2YPZA 5H1SV 2VQEF 1N5TA 4I6WA 3GV7B 1S1UB 3UCZP 2UUCF 1YGYA 2PO4A 5DLTA 5KFPA 1YBUA 3VF0B 2D69A 1NH7A 4OYIA 4EWTA 1S6UA 1AYEA 1LXNA 2P6SA 4N7TA 2XSJB 4DQQA 3VCDA 5E41A 4RBUA 2CFXA 3QRRA 1XEZA 2ZWOA 2HSEB 3E01B 1LWXA 5KFJA 3TAMA 4W4MA 3ZTQA 4ZVUB 4ZVHA 1OJ4A 7FDRA 4CO1A 5E3PA 4AUKA 1U25A 4EZ9A 2EFGA 3RB6A 2ZH6A 2J7UA 1WC4A 1ZETA 4KV8A 1Q8IA 2PFDA 4WXWA 2CPFA 2IJRA 1RWMB 1H7XA 5AJ3J 2ZVIA 2Q43A 1HBMA 1UEKA 1UFLA 2CJ9A 2R8KA 4UT4A 4LVNP 1JXLA 2YWWA 3C14A 4N76A 5DJBA 4O23A 2V8GA 3NGDA 4NYPA 1KNZA 4BDPA 1F2GA 4PWWA 2QRRA 3BQ1A 4LBIA 2ZDOA 4DUZF 2RQMA 3EZUA 1Y7PA 3V6JA 2ZH4A 3DRRB 4RU9A 4ZPCA 3LAKA 1Y7AA 1ELOA 3U27A 2GV1A 1S4EA 2G0CA 1RHJB 1N32F 3KOAA 3E8OA 2U1AA 1DQAA 2E1CA 2GC8A 3PY8A 4CP5A 1S0MA 1KH9A 4XAKA 3IGZB 4GC7A 1DAXA 3W8GA 3V2UC 2IVMA 2FGCA 1X5OA 1HNWF 2N3LA 1TVRA 4LT6A 1N52B 4B9SA 4ZG6A 1NEEA 3OTOF 1K7HA 4DV7F 5HATA 1OS5A 1SUQA 4LR7A 4DL3A 4KH0B 5HBMA 1GEHA 4C0OC 2PD1A 6FDRA 3SV3A 1B8JA 1JLBA 3WAXA 4NLPA 1RTJB 4R8UA 2E7XA 5KFYA 5EX0A 2C2OB 4A8QA 3I82A 5B0EA 2X51A 1ICEB 1ULRA 4ITSA 2ZH8A 3ENVA 4RNFA 1JX4A 1A6LA 3KJNB 1IBMJ 2E5LJ 2QZUA 4I2PA 1VQ7S 1N4LA 2KXFA 1WF1A 4ZPWR 1RHUB 3T1YJ 4DS5A 3AXMA 3WQPA 1SKUB 4USHA 4CYRA 3V81B 4IR1A 3ONQA 1M5SA 4GTWA 3MM6B 1DLOA 5ETOA 1B4SA 2J6SA 2HFUA 4ZPAA 2FZKB 3MECB 4FZVA 2GX8A 5KT4A 5HP1B 4CLPA 1LK7A 4Q2MA 4JI7J 1AJCA 3BKFA 4OHWA 3AJ2A 1HNIB 3VTIA 1N5YA 2OMLA 3TYTA 1FEHA 1DTTA 1R89A 1DHMA 2V50A 3NWGA 3M8SA 4NI2A 4KJDA 2RD5C 3I4HX 4B3SF 3GIKA 3LOUA 2RU9A 4HHHA 3RB3A 2IRUA 2UUWA 4H4KC 2RU3A 3C6TB 1HMVA 5KT6A 1VRUB 4TYAA 2HS3A 2B3TB 1FXRA 3IGVA 3UN2A 1B0PA 4JV5J 1F2HA 3CJKA 2DIVA 1URBA 1RGVA 3OVSA 4DFKA 4HHUA 1ZM9A 5F3ZA 3OUYA 3MCOA 2VDIA 2W5RA 1ELYA 4XTTA 1N6QB 1WHYA 1GAOA 2IUCA 1FKAF 2XLIA 1BHNA 4PXEA 2RKIB 2E66A 2C3MA 2E1AA 2IFXA 1WHVA 3P96A 3SCKE 3JSRA 1WELA 2AYMA 5J1NA 5E33A 4C8NA 3EVWA 2JHEA 4RL1A 3BGLA 1YRTA 1KOHA 4RX6A 9RUBA 3WAWA 2KU7A 2DNOA 3BH7B 3ZZYA 3FVYA 1RABB 3WC2A 4KHPF 1MWQA 3ZTSA 2VG5B 3S1TA 4ZN3A 2VBYA 1X8DA 5E3AA 3WAVA 3SZYA 1T11A 3RG6A 4ZG9A 2Z56B 4UQTA 1YI2S 5IJSA 1UVNA 2A1BA 4LF9J 3SYZA 2APOA 2EW9A 1ALHA 2IM1A 2CPDA 3NOGA 4NLQA 3THVA 2K3KA 1XQIA 4R25A 5IOLA 5IFMA 3LW5C 2VOPA 1U48A 2W5SA 1X0FA 4P73A 5EWGA 2HHUA 4UOGA 2ZBRA 2EK6A 3K57A 1RTIB 3KUGA 3D5MA 1C0UA 4MFBB 4W90B 4X64J 3TA0A 5LMUF 2DGOA 4QIWD 3TAPA 4UZBA 1Y10A 1UPMB 3D0IE 4O3SA 4RBVA 1Q7LB 2WZ1A 2GIQA 3HSZA 2YNHB 4DL4A 1YLXA 3RAXA 1FT8A 4LVOP 4ZPVR 2QL5B 2C2RA 4FXDA 2A2CA 3R27A 3THPA 5ETSA 1G4CA 4PUOA 3AODA 3O1LA 3MMCA 4DQIA 4JV2A 1V6HA 4ZA1A 2JEGA 3M2UB 3DLEA 3BSOA 3LTOA 2FLOA 5A76A 2Y3YA 4MYTA 4QYZJ 3PNIA 4O3NA 2AJ2A 3QT8A 2Z8QA 5AXNA 3EGWB 1LWEA 4RNHA 4DPXA 3AD9C 3TA2A 1DQ9A 1J27A 4JI0J 4HDHA 2HHSA 2C1EB 1U4BA 3GG0A 2FTRA 2CQBA 4NLSA 3M1VA 3M8PA 1FVQA 2OGUA 1D1UA 3G87A 2VONA 1EZZB 1HI8A 3Q2TC 1FERA 2RH3A 3D6HB 2J0WA 1BQNA 1RT6B 2ERRA 4BLGA 2WSFC 4PG5A 3JQJA 2VFSA 3BN4A 2BANB 3HI9A 5E3CA 4JI8J 1KSPA 5HLFB 3GIJA 4P9SA 1RZMA 3HKWA 1ALKA 3WDOA 3Q89A 4MMOA 4I4BA 3DLHA 1T05B 1XNQJ 4DV0J 4B3MJ 1P49A 1PKUA 3IRXA 3HK2A 2MKKA 1RT5A 4ICLA 5H9EK 4IQXA 1F3FA 2A10A 1NZAA 2KN4A 4DX7A 3MCSA 2I8EA 1HBUB 2GSNA 3AOBA 3D28A 3ZC4A 2YQ0A 5L8RC 3R9LA 2BBEA 4USMA 2FLPA 1XR7A 4PQUA 4O0IA 4TVAB 2BQRA 2N7CA 1RKJA 2AYBA 4U96A 1JWWA 2W2NP 4C8ZA 2XULA 3LGMA 4YEAA 2DISA 3VAIA 3CXCR 2ZC3A 2QYGA 3HVWA 1Z4UA 2ZZNA 2FC8A 3W60A 4X65F 2G2YA 4V1Ak 1B7FA 2P5VA 4P2SA 1R0AB 4B9NA 1T03B 3TA1A 3KFWX 3SIPB 5KFUA 2CJBA 2M8DB 3R7BB 1BWVA 1WEYA 5KFTA 2D74B 4NWXA 4KGZB 1NKCA 4KAVA 3MM7B 5F8NA 1Y3KA 2V0NA 2DH9A 1FJGJ 5AXMA 2C22A 2VFRA 2DXEA 5F0UA 1U2FA 4F25A 5A8KB 3H5SA 3G96A 1WHWA 3IS9A 5J1EA 1T95A 3L09A 2EG2A 3IWXA 2R2UA 3DGPB 1NK9A 2MTLA 4DX5A 4YHHF 4KJIA 1HARA 1VI7A 1RCXB 1XMQF 1JMTA 1RT4A 4DS4A 3OTDA 3KJQB 2HVIA 2EI5A 5HAOA 1WACA 3PJ9A 1NK8A 5DGAA 1IBLJ 4GO7X 2M9KA 4X4PA 4LRFA 5G0RB 2OFHX 1WNEA 4KKOB 4WPAA 4H4MA 1YITS 4WZMA 1B70B 4E2FB 4EYIB 2G1HA 1VQ5S 4IH5A 2NCKL 4RR5A 4RW6B 2HHPA 2AQ4A 3V6DA 2C2DA 2ILYA 1SCJB 3AD7C 4RW8A 4HR2A 4KYZA 2AYGA 4C0BA 4ZVGA 3LF0A 3HP6A 1TFWA 1JLEA 3OFHA 1FJEB 3GV5B 2C2ZB 1YJ9S 2CVIA 2HQIA 1UP1A 2WVBA 3NS5A 3FSYA 4LR2A 1E33P 1S1UA 1YJVA 3T1HJ 2W2OP 3R7NB 4F3OA 5F8HA 4QWEA 1HNZF 4NLYA 4QWBA 3ITHB 3MPVA 3KK2B 3CVKA 1ZZFA 2XSJA 2ZJRQ 4WFYA 4OYWA 2P8IA 4ZCLA 2J9EA 1G3OA 2L48A 4IRCA 2AJQA 2QIFA 3SDEB 4DPYA 1REGX 4CH7A 2WONB 4DZDA 2FHMA 1IWAA 3IR6B 1BE4A 2B4OA 1LW2B 2JWNA 4FPIA 2B9XA 3BSNA 2IJFA 1NSQA 1RJJA 2JVOA 1U1RA 4TKTA 1S1VB 3U1NA 2UVRA 1CJKB 4DBQA 4Q8FA 1HR0J 4YR2A 7AT1B 2FHOB 1PJ7A 1LQ9A 3CNQP 4P2XA 3BGFA 1K1QA 1H2UX 4NRUA 1M5KC 4DUYF 1OY9A 3DRRA 2KG1A 2M8HA 2M4MA 1N88A 4RUBA 5KFVA 4GKKF 3GSIA 1N36F 2D1GA 4DG1A 3F0NA 1S0OA 2UXBJ 2X3GA 2MQLA 2GHPA 3D2WA 4YR0A 5LRNA 4URGA 2BKNA 4DR7J 3IM9A 3BZQA 3EWGA 4C6AA 1QE1A 4KRWA 4ZITA 1NK7A 4LF5F 5LSRA 2YBVA 2HHVA 4IG3B 1OO0B 3WX4A 2FIUA 2DRBA 2KXNB 2HEKA 1GMVA 4ZMMA 1S1WB 1N0VC 2XY6A 3H4BA 2DNPA 1NK4A 1KQKA 2HLTA 3PW5A 1FESA 4P2MA 1I5OB 4CXSA 1HI0P 3HPOA 4LFAJ 3ED4A 3NCPA 1X31C 2J9DE 2R8GA 1M1GA 1WTFA 2O5DA 3P5BP 4RJVA 3EUNA 2QL7B 2LEPA 2DHSA 1RTJA 4Y2IA 3IG1B 1WC5A 2CJXB 3IBWA 4M94A 4S0MA 3LPYA 2E29A 5D4LA 4CM0A 2QV6A 2R9LA 1ZA2B 1N48A 3CGIA 1FXLA 4EEYA 1CQMA 4F0HA 3D6TB 2IM3A 1HBOB 5LL6d 1E6VB 2DCLA 3NAIA 2V68A 2HVDA 3V81A 4J5OA 1JLGA 2QT7A 2CVEA 2W9BA 4X4VA 5FLXY 2DXFA 1YDLA 3KG0A 4NLGA 4USWA 5CD4H 3A8JA 2YY3A 5HP1A 1AZSB 3IO1A 4PG8A 5KFEA 4TU9A 1MSWD 4DSLA 4NCAA 1T94A 2HQFA 2YWKA 3JSYA 2DNKA 1HQAA 3A8IA 1KHNA 2JEJA 3UI3A 4RUAA 3MM8B 2YQ3A 5IT0A 3UWTA 1UJ6A 1FRXA 3R5JB 5LXRA 5IWAJ 4W98A 2Y1LB 1NJIT 4URSA 3MR2A 2FHKA 3C6TA 2HAIA 2P6TA 1VRUA 2R8IA 4UPLA 1W25A 1F9HA 4QIFA 4M5HA 2G1DA 3T5LA 2NYHA 4HDGA 2F4VJ 3SBMA 3M30A 3OTCA 1ZAWA 2NR0A 3TZXA 3CD6S 3CMAS 2HVEA 2DH7A 4LF2A 4ED3A 5J1PA 3C15B 4LFBF 2HFVA 3MHYA 1N6QA 5H9EJ 2MY8A 3LGHA 1VLOA 1M90T 1EIYB 1PILA 5DQHA 1JK9B 4X4TA 2CQHA 3W5XA 2YKQA 2RKIA 1NM2A 2K06A 2XY5A 4QAXA 3J7A1 3QGHA 2IM2A 1R8HA 5KFIA 4DV4J 1K0TA 1VQ4S 2CYYA 5HRTA 2PA3A 3TJ8A 4ZPDA 2FUG9 4CQ1A 1A7GE 4NEZA 1O6XA 1O8BA 4HI2A 3ZZPA 4G65A 1J5OB 3G4SS 4FBTA 4F3MA 4CI0B 1NHVA 3CJSA 4KHMA 2R7TA 2VG5A 5KFBA 4YP3A 3LXQA 2XI3A 2V94A 1UWBB 4O3PA 1FNMA 4OJGA 4CLLA 3TUJC 4NLXA 2ZHAA 4DDFA 4FVMA 3RRKA 3KNGA 5K14B 4FNHA 1VBKA 4Q43A 4OX9J 2L08A 2OPSB 4A48A 1EHWA 2HHHF 3PYGA 4AXJA 3AFGA 1RWPB 1SH3A 4GKJJ 2DYAA 2IMOA 5I3UB 2D9OA 3FBCA 4JOUA 2NSBA 2RQ4A 2XHWA 3QRPA 4RLEA 4EBEA 4FVCA 2Y1IA 1RTIA 2MKCA 3IC1A 1DTQA 1SV5A 4MFBA 2WBMA 1TL4A 3GFHA 2OAUA 5F8MA 1S77D 3P4UB 1RT3A 1T9TA 2VU5A 1FSUA 5CD4A 1S6PA 2PGCA 3W2WB 2ALZA 3FKBA 4I7FB 1ZTTA 1CC8A 2CQPA 4BWJA 2YNHA 3N6MA 3PZPA 1IBKF 2UUBF 1S49A 4OIXA 2W7PA 1F0XA 5HANA 5BJRA 1LKZA 1UPPA 1UAWA 3M2UA 3M32B 2A3JA 1GX5A 2RDJA 1FD2A 2XNQA 4PYDA 1NKBA 4NMXA 4ZP7A 2MKJA 2LFVA 3EXCX 3GFXA 2CUYA 4ECYA 2H51B 2PE8A 3I5BA 5D6GA 2BJDA 2VPYB 1EJJA 1E6YB 5I3PA 2C42A 2ZJPQ 2EFNA 4ANCA 2QLWA 2AGQA 4B9LA 2ZM6J 4YS2A 1URRA 2POKA 4ZVOB 2Y1JA 3M6VA 3T1YF 3MMBB 1TV6B 1VISA 1GX6A 2A6OA 2R7XA 2R8HA 5KG5A 1HWKA 3NMRA 2E9ZA 3BO3A 1U1PA 1CSJA 3V5RA 1RT6A 4DV6J 1V5VA 3MDFA 2EC0A 4CYSA 2BANA 3TZYA 4EUVA 2KI2A 2V4JB 2GMLA 3EVMA 2GJFA 5HLFA 3RAQA 1HL6A 2F7VA 2DGVA 5K8NA 3CMRA 4USUA 1FNXH 2WAQD 1YJWS 3SFUA 1RADB 3VQTA 2GVDB 3GG1A 3HT3A 1PC5A 4ECUA 5CXTA 5KG1A 1RWOB 4TLQA 2MPUA 5GAEI 4ZCKA 4AE5A 5IT9Y 2I9SA 2XMTA 4KT0C 2YNGB 3OR2B 1Q53A 2DO4A 4F2SA 2ABYA 4UOOA 1VRTB 4ILMA 1E3CP 4WIIA 2MZTA 3KMQA 3L7PA 4HVZA 1WKLA 5KT2A 1QD1A 5IT4A 2EEYA 3R5GA 2FZGB 5IQ6A 3W8PA 2DR5A 2CIMA 3HULA 3FSIA 3I9V9 4MKYA 1FRMA 5ETRA 1D9DA 1YX2A 3VAMA 1SC6A 1PJ6A 4RKUC 3MUMP 1U09A 5D0GA 4P52A 1R0AA 1T03A 2VG6B 3CCZA 5HROB 9ATCB 4J9KA 4X4UA 1IUJA 2KB2A 4HH1A 3QGPA 4KBIA 3CJ2A 3H5YA 3N4WA 3FQKA 3HVRA 2H65B 2ROGA 2NSCA 2YKNB 1Y5IB 4ZHRA 1HQUB 2HG4A 2VA3A 5DLWA 2NREA 5A8KA 4UY85 1EETB 3DMJA 3CDBA 2QL9B 3DGPA 2ASYA 4MIVA 5GMEA 5D4PA 1HDHA 4DR6J 2R7OA 3HSJA 5EN1A 4DL2A 3O44A 5HQMA 4C8MA 2DR7A 2GVZA 2HFSA 2AV5A 2GAGC 4Y65A 3OHAA 4LF9F 2F9DA 3ZXWA 1K0VA 2BOPA 1HNVB 4DXLA 2PT0A 4CT8A 5KTQA 1OIAA 2VFTA 2BVZA 2DPJA 3OD2A 1PSDA 1RWXB 2YWGA 4YY3J 3PO4A 2L41A 2L9WA 1QLNA 1FJCA 1PBUA 3Q8PB 4RW6A 2RRAA 2HQGA 3BDGA 2OSQA 5D77A 2QZ8A 2VFUA 1SJRA 3H2VE 2H4WB 1SIWB 2W2PP 2VDHA 5JJBA 3MR7A 3NCQA 3UD3P 1UETA 1SC3B 4WFBQ 1APSA 4LF6F 2OMOA 4LFCJ 4ZLNA 4ECRA 4C8YA 1TMJA 1PC4A 3RBZA 3K8VA 5C2GA 1FK9B 2MGZB 1XJWB 2VJUA 1U8WA 3M8YA 2FVRA 3QZ8A 3OLBA 3TX8A 1LV5A 2CPZA 1YKWA 3DC2A 4J9NA 3ITHA 2OPPA 3KK2A 4GRSA 4A8MP 2HK2A 2ZH3A 1PGZA 1FDBA 4QQBA 1CQNA 2B51A 1MW7A 3CDWA 2XMAA 3BS9A 4RW4A 3SDEA 2DHGA 5KFAA 1N33J 1TL1B 5EDWA 3NGTA 2VPXB 1LW2A 1FI4A 4LIWA 3JTPA 8AT1B 2DIUA 1U6BA 2BE7D 2V4QA 3CJ4A 3DYAA 1S0NA 2V8DA 1S1VA 2IA6A 1SL1A 1M1KT 4H4OA 1CJKA 2VPZB 1ZH5A 2XGPA 3AB2B 1F5CA 3WHIA 5C2CA 3CCVS 4URQU 4OZ0A 4CXUA 3V4MA 3LP1B 1H74A 2L9NA 4TU7A 5DM7Q 3EM1A 1IJFB 2HRYA 2IBKA 1KLMB 2EKNA 3MM5B 4KE5A 2OPRB 2DGTA 4N56A 4B3RF 1IVZA 2W8KA 4WJBA 4CH1A 2MEWA 1S10A 2L3MA 5K9FA 4B56A 2DGSA 2Q79A 4B3OB 3NL0A 1I51B 3MMAB 2PN6A 4CT9A 3PEHA 1X4EA 1ZAVA 3NKQA 3QO9A 2FLLA 2ZC4A 2WRMA 5BYQA 5THWA 1VK3A 4QR1A 1IM6A 4IG3A 4Y6IA 2CZ4A 3TI0A 4Y00A 3VGTA 4DSIA 1OWXA 1NDLA 1U1LA 5U47A 3MTKA 2ZH9A 1T9YA 4IFYB 1O98A 4I64A 3MXHP 2JX2A 3QT5A 4G6VB 4ETXA 3M6WA 4HH0A 4DV3F 4GMKA 3CJ3A 4DR2J 5DGBA 2QTWA 2DT9A 5GAEU 3HD1A 5E3RA 3IG1A 4LRAA 4DV5J 4M95A 1FJGF 3PJWA 5F8GA 1Q4RA 4DMZA 1D9FA 2AZ1A 5D8HB 1VMBA 2LEBA 5T14A 1CJTB 1S0VA 1H0HB 5F8LA 1HBOA 2VASA 1V9OA 2JJ4D 5I42B 2ZBIA 4ED2A 1E6VA 2H5IB 3J81U 2OO4A 4FDIA 2GZOA 2QEXS 1SI9A 2UV8G 1KH7A 3LA0A 1TMMA 2BW2A 4Q7AA 1JJ4A 1VYAA 3K8WA 3NGSA 3DDNA 2VQFJ 2RE1A 1DZ5A 3TNVA 2MLYA 3TEGA 1AZSA 2XMJA 4FBUA 2YNIB 3R3TA 2EKYA 1VQPS 4AFFA 4DOZA 3RW7A 3N79A 2HFZA 1FF2A 4ZK7M 3BGRA 1MLAA 2QO3A 2YX7A 2UU9J 2AEMA 5HO4A 2B5JB 1U0SA 1BMQB 2EVZA 2V2QA 1G6BA 4IH6A 1W2BR 3RZAA 3GTYX 4NE9C 1RBOB 1AA1B 2K1RB 4D3GA 3T1HF 2ZNZA 3ENAA 1TZ0A 3H90A 2VQRA 1NMEB 4OX7A 3C2PA 3IBCB 2HGNA 1BY9A 3C15A 3CCJS 2RMLA 3QWPA 3CT9A 1GMWD 2AW0A 1VQOS 1CG2A 3LANA 4IG0B 1H2VZ 2XMWA 1Y3JA 4DR3J 2BJ3A 4OJHA 4ZP6A 3OL7A 2J0QD 2Y0BB 2HYIB 2BZ2A 3THTA 2R7QA 1XR6A 1FFSB 2XZDB 5C25B 4UPIA 5KFOA 4M1KA 1IWGA 4X2BA 2BRKA 3HFKA 5ETVA 2J9DA 2YWEA 4OHVA 2OEJA 1S59A 1C4CA 3P8BB 2XYPB 4RNMA 1MNEA 4DV1J 3AQOA 3B82A 4LREA 1CJUB 3M7VA 2N4DA 4I2QB 5KFRA 3SSQA 2LA6A 3W66A 5K14A 3TQEA 2W4CA 5LXYA 3EX7B 2IIHA 2OPSA 3R7SB 2E1MC 2P2CB 1TK5A 2JZ5A 4TY8B 1DFDA 1NK5A 2FJXA 2MYFA 2UXBF 2FJVA 4ENOA 3KHRA 4YR3A 1YJTA 3BO2A 4HT7A 3BM7A 2JEIA 3TARA 3CIZA 3KLHA 4IYQA 4DR7F 3TP2A 1U2RA 4B17A 3GZ7A 4FYDA 3SCLE 1RWUA 1ACMB 3AJ1A 4NXMJ 3AOCA 1HMVB 3W2WA 3DLGB 1VIXA 5K4PA 4G1QB 4OX6A 4I7FA 3LUYA 1FHTA 1HHQA 2Y1RI 1NJZA 3VAKA 1U1MA 3Q8UA 3TWZA 2E9RX 1QUPA 4LFAF 3OUYB 1ITPA 2YX1A 4DPUA 1BQMB 3Q24A 3KTQA 7FD1A 3OXGA 5L9XA 3DOMA 4IFVB 3M05A 3CD0A 2BOAA 3MK2A 3M32A 3RR7A 1LOUA 3EPGA 2LU2A 2F40A 3GSDA 2DD8S 1E6YA 1HKAA 1N8RT 4FS1A 4EO8A 4ZS6A 2KT2A 3QZ7A 3ISZA 5GOVA 3M2RB 3Q86A 3EMTA 4UW2A 1A0OB 1TV6A 3HM9A 5C7PA 1DURA 2IMWP 2QFIA 2N4CA 3CO0P 2MKHA 4LIRA 4BBYA 2B6AA 1RQ0A 2FJAB 5T7LB 1V3SA 3BPDA 2QLFB 4F67A 2VC1A 2UXCJ 5AE3A 3AB4B 2IDEA 3HHLA 3KJVB 2V4JA 3HFZB 5LJ3Y 4C3LA 2CPIA 3TJ9A 2XZTB 3BGOP 2QMXA 1YVFA 1PO6A 1RWWB 4YR1A 2HLUA 2IRYA 1S9FA 4NXNJ 2LKZA 1O0PA 4P74A 4GVBB 1P6TA 2MHEA 1UFWA 2B0GA 2YNGA 3OR2A 1S76D 4OJ1A 3FCVA 1JKHB 2ACMA 3BV8A 2ZWPA 1VRTA 3I55S 4JYAJ 3NBPB 2VUGA 5D4OA 4KFBB 2E5HA 1WKKA 2XS2A 4IOCQ 4DR4J 5I3QA 3D9BA 4WU2A 4DFPA 5D0EA 3JSBA 1VQSA 3JSMB 2PMHA 1PAUB 2QLXA 1S7IA 1RWKB 2LMIA 1W2IA 4LR9A 3VQSA 1SHQA 3G6YA 1X0PA 1KHWA 1OPIA 5ITHA 1FO1A 4Q45A 3PV8A 1UVJA 3PYDA 4DV4F 1FVSA 3FZBA 2H5EA 3U02A 3TUPA 4UOFA 1HQUA 5RUBA 3GJRB 1Y6VA 5D78A 2DNZA 3L7OA 2RHSB 3Q22A 3X3UA 1K8AT 1EETA 4NLRA 3G71S 2BUNA 5HQ8A 3NGKA 4HI1A 1YJRA 1U8SA 3UDEA 1TP7A 1BQNB 1OSCA 3PCOB 5LJ5Y 5BR8J 3SQGB 1Z1ZA 5L46A 3LO3A 2VKZG 2AX1A 1GQEA 2P9EA 2V5HG 4KY3A 1RT1B 1HNVA 4YDXA 1P27B 2HNYA 2BQUA 2CQIA 1Z2LA 2MKIA 3HHLC 4DN9A 4USKA 2LXIA 1OY8A 1ELZA 3FEXB 1TL7B 4B9UA 3IRXB 5ETLA 3M2VA 2JC1A 2ZH7A 5L1IA 1S12A 5ETNA 1FWPA 4JBCA 3J7YI 4OZ1A 4RW9B 2H4YB 3G8TA 1ED8A 3AJDA 3O8WA 3CCES 4DSFA 5A8WB 3T1AA 4OZJA 2R42A 3H40A 2XEXA 1YQHA 1FK9A 3N5FA 3KKFA 1XIQA 3HDSA 4E8UA 2ZFHA 4KB7A 3G2XA 1S57A 4RW7B 4X62J 1EW2A 2ASDA 2MQQA 3MEKA 3I5CA 4ZDNA 5C66A 1HW8A 2W2QP 5B0GA 3MPDA 2LQBA 3V6KA 3Q8RB 2VB6A 4XPCA 3QFHA 2BJEA 4YB6A 1WKJA 2DY1A 1VGYA 1IM4A 2YWHA 1TL1A 2VQEJ 3OJUA 4PYAA 3WC0A 1KDNA 4F7VA 2GMHA 4L72B 4ES2A 2UUCJ 3ETOA 1NZ8A 3IWLA 4O3OA 5J1EB 1TL3B 2QLBB 2QX0A 1KN6A 4K7QA 3BREA 2K7JA 1Q81T 4C3KA 3X1LB 2VBZA 2DNHA 2RQCA 1KVJA 4F4WA 4RWWA 1NRKA 3RB4A 3B6BA 5DZ7A 3MM9A 4Y2AA 2V63A 4ED0A 3LP1A 3DRSB 2DBBA 4X66J 5DG9A 2XG8A 5KFZA 3CJRA 4H4MB 3FRYA 5KG0A 3IGYB 3FMWA 1KLMA 3MM5A 2OPRA 4KTQA 3I0SA 4AL5A 2OTLS 3QPIA 2EPIA 3LP2A 1S1TB 4B3OA 4DF4A 4X4OA 4U6PA 5FIIA 3MMAA 4J9QA 3DHWC 1SL0A 3GWCA 3OVBA 4MIWA 4A8XA 4K59A 4JI2F 4HYKA 2DO0A 5IXUA 2ZZTA 4ZPTR 4DUZJ 3LPEA 4QIGA 2GJ2A 3L4BC 2P9CA 2DHHA 1PYTA 5LIAA 1XN9A 3SQOP 4LF4F 2OP5A 1L3SA 1HWJA 2G0JA 5ETMA 1N32J 2OSRA 2R2TA 4IFYA 3HF5A 4U9RA 5AJ9A 2IRXA 1S1XB 3OSPA 4QR0A 3GFZA 1XWLA 1AB8A 2E1PA 4Q44A 2DNNA 1WSVA 5KFQA 3ZZOA 2HNZB 3K59A 3NVLA 2W5VA 1UFKA 4LBPA 2X1GA 4OLOA 3KLFB 1T3OA 1N2LA 4C8LA 3MR6A 1Q78A 3AT1B 1HNWJ 1ZM4A 2BM1A 1TKDA 5KG7A 2R4FA 1U02A 1CJTA 2F1FA 3OTOJ 1VQ9S 3I32A 3D67A 5IJQA 2RILA 5I42A 1X4DA 5J2QB 3PR4A 4DR6F 5KFNA 4NZ6A 3B78A 3QJPA 1VDHA 3CMQA 1XR5A 1QAYA 3D3CJ 1Y00A 2RJZA 2IVFB 5CAAA 3H98A 2BXJA 4OZNA 4NLDA 4N8NA 4WZQA 3P3DA 4FKYA 2MLZA 2YNIA 3NXZA 3E2EA 2QYCA 2W5WA 1CLFA 1PAEX 3B4DA 1WG1A 5F8IA 4DG1B 4GTXA 2G13A 2FVPA 5AE2A 4J9OA 1GMUA 3FEZA 4H4KA 1Q82T 4MY4A 4CO2A 1SKSA 3KK1A 3L7UA 3OSNA 2B5JA 1ZPWX 4ES1A 5AT1B 2XGQA 4ECXA 3PRBA 1M1HA 1QE1B 3J7Z5 3JS9A 3TZZA 2YKPA 2M7SA 1SHNA 1QSLA 2K1RA 3MR3A 3K89A 2HGLA 4NLVA 2W1BA 3GCXP 4WP3A 3VHQA 1LXJA 1TK0A 1I3OB 5GAHI 2XRGA 1FX2A 3MF5A 3QIPA 1HI1A 3DOLB 5CCMA 4QU7A 1FE4A 3M9NB 5LSLA 2MLXA 1BGXT 4WTOB 4UY8T 4B3SJ 3CCLS 1WC6A 4FP9A 4O4GB 3EYZA 4P75A 3CWJA 4XK8C 4IG0A 3J7YU 2LYVA 4FXVA 1X9WA 1W7WA 4RUHA 3D54A 3O2IA 2B9YA 1TKZB 1QDUB 4I68A 3BSCA 2NPIA 4C8KA 3PHEA 2IHR1 1WC0A 5BYRA 4NA3A 1AJAA 3TEHB 5C25A 3TUZC 5GRRA 2DGXA 2AMCB 1MU2B 4PR6A 3NP5A 2A2DA 3K5NA 1TTHB 2LQ8A 4FF2A 4DX6A 4M5LA 4F02A 2L9DA 1URAA 3G6ES 4FYXB 1D3WA 1SJ1A 5DDOC 2LDIA 5JUMA 1RAEB 4AQYF 1L3UA 2ZZMA 5KOWA 1YJ7A 1JLGB 3C8YA 1CJUA 2W9BB 1SXLA 2DHAA 2GS8A 4I2QA 1H72C 3KHHA 2MZSA 1VRQC 2J5AA 4JI3F 4FN5A 1X60A 3BYRA 5KG4A 1R7IA 4TY8A 1J5EF 4C0HA 3IMQJ 5CHCB 4ZCIA 4LF7J 2KT5A 3BH6B 2DPIA 1BXNA 2XSFA 5CYMB 2IVYA 2AEJA 4IOBA 2DRAA 1NDPA 3MI7X 3VVUA 4K4ZA 1GFWB 2XC9A 2HAFA 1LEOA 2BKPA 2XMMA 2V8PA 3A13A 1W26A 3NKYA 3TO8A 4WYWA 4LSLB 2HFNA 4I1TA 3PO5A 2W7OA 4DPWA 3DI6B 5F9LA 4Y34A 3OPKA 2DK2A 3UNYA 3GU0A 3DLGA 2CG8A 4G1QA 4A8SA 3GJSB 2CQDA 3OBIA 3DPCA 2J8AA 4C8OA 1WOPA 2AKWB 3M30B 2XS5A 3JQMA 4CM2A 5CZVA 2HQDA 2HIYA 1BQMA 4UF4A 5HVHA 1FNOA 1EI6A 4IFVA 3KMSA 4ELVA 3D4JA 3DFEA 4J9SA 3K5LA 5LMUJ 4B9TA 3PKYA 4UORA 5J2PB 3WAYA 2FYXA 1VJQA 1U7LA 3MK0A 2AJ0A 4DV5F 3QSYB 3Q8YA 2BW7A 2R7SA 2XO6A 4KPYA 1X4AA 3GJQB 1HNXJ 3M2RA 1MMDA 2BDPA 2X98A 3M8ZA 1X4FA 1GXLA 5B7WA 3G8SA 1KTVA 1QAIA 4MK9A 3R6LB 5L0BA 2UVUA 5T7LA 1NLKL 4DF8A 3CMES 3G6XA 1Q5YA 4JI5F 1IQTA 2E44A 4V19X 3IR7B 3L9ZA 1UEVA 3BEGB 2G4BA 1KHKA 2X1AA 3CULA 3UR0A 2MZRA 4MIBA 3KJVA 1C2PA 4LSNA 4ECWA 4AT1B 2CJQA 2RDDA 1IN0A 4DL0C 1GMWA 4LUBA 3EPIA 5HMWA 2ZH5A 3ADAC 3DU5A 2ATCB 4J37A 2R3VA 4ED5A 1DTQB 1SV5B 4GVBA 3RW6A 1HWUA 1UVLA 3M8RA 2VA2A 1KVKA 3F56A 4QW8A 2MJUA 3HVTB 1RT3B 3M9OB 1JKHA 3V4IB 4LBHA 1S6PB 1UVIA 3JYTB 4AYBD 3HCXA 1WC3A 3NBPA 3SEOA 4KFBA 3ZTRA 2C2EA 4CLUA 4LMZA 2CWKA 5EUHA 1DRZA 2Z2YB 3TR5A 2OD4A 5HQLA 1HA1A 2JRSA 3Q23A 4DR5F 3DN9A 3W9JA 4ECVA 2XR9A 4DX8H 2KVQE 4J91A 3JSMA 4NYOA 3QIDA 1XK8A 4KSEB 2W2MP 5K8MA 3LALA 3GYGA 4ZP8A 4FS2A 5KG2A 3IM8A 2J0SD 4DI6A 2OUGA 3ENWA 3FMBA 1KLNA 1WTBA 1FRJA 1B0VA 2LQJA 1DJ0A 2QG9B 2PDAA 3KHGA 1C0TA 2C28A 2IBOA 4TLRA 2E7VA 2RVJA 4KIAA 2KJWA 4MKVA 2N7YA 4K0KF 2BJ9A 3RGIA 4DCOB 4Z37A 1UA0A 3BF4A 3F44A 3MR5A 2JEFA 5GAHU 1DY3A 2FY1A 3PYEA 1O51A 2W5TA 3SQGA 2X1FA 2G2OA 2WW4A 2DNQA 3CCQS 1RK8A 1RHMB 3A12A 1RT1A 1Q95G 5KFKA 1YIJS 3OFEA 3PIOQ 2VBWA 2RDIA 5IQQA 5ETTA 4MH8A 4OYBA 4LF1A 5EHHA 1SJ4P 3CC7S 3OHBA 3KYLA 4OV6A 4USIA 1TL7A 3U1LA 4K4WA 3GONA 4LQYA 4WF9Q 1XMQJ 4Y0FA 3QLHB 4RW9A 3M6UA 2VC0A 3MPYA 5A8WA 2KM8C 3CE8A 1RTHB 3FK4A 3BJYA 3N6NA 5LQQA 4UOCA 1ZOTA 1NDKA 3KG1A 2VHGA 4GTYA 4RW7A 4FYWB 3GR0A 2CNNB 1IKYB 4M5JA 4RNNA 1WG4A 2XO7A 2XB2D 3MAQA 3FZ2A 4ZJLA 3QJJA 1JB0C 3HZGA 5IM0B 3GILA 1WC1A 2PMWA 2M70A 2IY5B 5KFXA 2KFNA 5EWEA 4Z7YA 1E2SP 4ZVTB 4EI2A 4JV1A 3H4DA 4FYVB 1HWLA 1RWNB 4PPDA 3CCUS 3LWMA 5KXAA 2AEFA 1HIYA 2XI2A 3OT9A 1RTDB 2EK1A 2Z0GA 4ZHRB 2QE5A 1GK8A 5LOQA 4OFZA 4NLOA 4MAKA 2DNGA 2FZCB 2KXHA 1HNZJ 3DMJB 3UN3A 3FBBA 1TL3A 1HHTP 1FDAA 2MMYA 2HWTA 5JXSA 2G2ZA 1G2EA 3HJFA 2FQQB 2YTCA 4UOHA 2F8HA 2KT3A 3EZOA 2GVZB 4P71A 1WI6A 3VAHA 4B3TJ 3RRHA 3DRSA 3DLLQ 1Y0HA 1XMOF 2IA0A 4YFUA 3HHDA 2JH3A 2EWHA 1IKVA 2CPYA 4J9RA 1OYEA 4CNZA 2OPQB 4DSJA 2LA4A 4J9UE 4USJC 3UDLA 2VF3A 2W9CB 3BDGB 1NPRA 3FUYA 1S1TA 2Z4PA 2Z30B 2HBRB 2YNFB 3W62A 2XNRA 3EGZA 3CJ0A 5F3TA 1YRUA 1O5JA 2NXCA 4ZP9A 3KD8A 2VKRA 1JQGA 2GA3A 3EE3A 2BM0A 2V2KA 2G9OA 2QA4S 4LJMA 4F26A 2DNRA 1KVIA 1U1NA 4GC6A 1VQMS 4EBDA 3MURP 4DR4F 1U24A 3WBZA 4GKKJ 1N36J 2NZCA 2BACA 3ZO7A 4IUFA 4HEA9 3GCWP 1DARA 3HJVA 3MD1A 2OPPB 1VLYA 3TANA 2XLKA 1S1XA 1L3KA 2IDLA 4KAIA 2CQGA 2FB0A 4F0MA 1IQZA 4KJGA 4LQ3A 2HNZA 4RW4B 3DRYA 1D9AA 3TG0A 4LF5J 1YSJA 3C46A 1H3DA 3KLIB 3OVAA 3KLFA 1KC8T 5DDQC 3DXSX 4F2RA 1UVKA 5EGEA 2Q6CA 3DYAB 3MMJA 1NK6A 2MQMA 2W01A 3DM2B 1RHRB 2RQKA 2B4UA 5J2QA 3I6PA 2GO8A 2D7SA 4H4OB 2LQ5A 4YB7A 2PSZA 1YZ7A 2DY9A 2ATLA 1JNZB 1NB7A 4TYBA 1U1KA 2RH6A 4X84A 3UQSA 3BR9A 3AHPA 1DQ8A 1M5VC 2DR6A 5HVGA 2Y9HA 3C16B 1NSPA 3MEEA 1S4FA 3D1OA 2V2ZA 3J81Y 1M0SA 1UEUA 1RAAB 1DBDA 2B9EA 1RISA 3CJ8A 4CCHA 4YB1P 2VG7A 5HK4A 3T6JA 2JDJA 4G1IA 1PYSB 3LP0B 1T9UA 3D66A 3MEDB 4K5SA 1JLFA 1TR0A 4RNOA 1LFPA 3VZHA 3QO9B 1AJBA 5HJXA 2NQPA 1VOMA 4K2XA 1NJYA 1EAYC 3ET6A 3NKOA 2CXEA 2BKOA 1CJVB 3MCMA 2ZD1B 4IOAQ 3UNGC 3K5OA 3NKMA 3GIIA 2M0GB 2HMIB 3DOLA 3DLKB 4Y2CA 4TQSA 5LRMA 4LF8F 1P9QC 3HHNB 4NASA 1I94F 2OHDA 2HWIA 4O4GA 4NMLA 3T00A 1S5ZA 3S7RA 4FNIA 1VC5A 2ZKTA 2XHCA 3NOCA 1KQSR 3CW2C 4P6QA 1TKZA 5CH7B 3AH6A 2WCXA 2NPFA 3DLJA 4QCLA 4DL7A 2HBZB 2R2SA 3ISNC 2HNDA 1HFEL 3R2DJ 1MU2A 3TVYA 2RRBA 3KUHA 3LAMA 3U7JA 2UUAF 3ULHA 1S6OA 2VOOA 2GMJA 2AIRB 4BHQA 4ZCMA 4LFBJ 8RUCA 5LSOA 5IC6B 2QMUB 3FFIA 2FVCA 4N77A 2CQ1A 1J2VA 5ETPA 3G9CA 3W3SA 3D68A 4X66F 3BPSP 4DV2J 1NH8A 4LRDA 4A4JA 3W61A 4TN2A 1FA0A 3T41A 4QIEA 5KFDA 2MQPA 4PABA 2KTQA 1S9EB 5T41A 1UTAA 4UPKA 5CYMA 2ZKUA 2XM3A 1AW0A 1D8ZA 1SKRA 1WOOA 3BGRB 3DCAA 2NXEA 3QAEA 2JLFA 1T0TV 1WF2A 1Y4ZB 3LH2S 2W24A 4LSLA 2O66A 5A2QU 2EXUA 2JLGA 4N8OA 3HZEA 3PKMA 2HHXA 4WBFA 1RU2A 3DI6A 1FEEA 2D41A 4BCAA 1FTCA 1AROP 1PCAA 3H7HB 3ZNJ1 2HHHJ 1TQLA 2ZHOA 2LDYA 1WSRA 2F8MA 4DLEA 3D6MB 4A46A 2Y0SD 1TELA 2UV8A 3TAQA 3DDKA 2BA9A 4NLTA 3RRGA 5DS7A 2UZAA 1E1ZP 2GAHC 3HHLD 5K8PA 2PEHA 3ILOA 2PI4A 4QOTA 1Z2ZA 2CDQA 4YUDA 4QU6A 3A52A 5J2PA 1H7WA 5DDRC 3MAAB 1Y11A 2V6AA 1RT2B 4USVA 4B9MA 2M3DA 1VQKS 3C6UB 1RHQB 1QTMA 2QN6B 4DFJA 1IBKJ 2UUBJ 3EICA 5AJ3F 4OV1A 1ZYQA 1KQGB 5E5NA 2DKOB 5KFWA 2KHDA 3DDIA 1RLDA 3TQ1A 1MG7A 4PKDB 2QA4G 1ZAXA 4DU7A 2Y8YA 5KFSA 2IYIA 4QPTA 1R31A 3TOQA 2MSTA 3T3FA 3J80U 3JTNA 2VODA 1EP4B 3A3NB 2HS0A 4YDDB 3EXYA 2I5JB 3CCWA 2EFVA 5LM7E 5C5JA 2W8SA 3UD5A 2XCAA 1F1BB 3P49B 2AJ4A 2R2RA 4NWBA 3KLHB 1RAJA 5SUHA 4IH7A 4F36A 4RBTA 1HJKA 2DNMA 2AJFE 2BE2B 3HVTA 4UOPA 4KGVB 2XQCA 5DDPC 1ZZNA 3V4IA 1KH4A 4DFMA 5D15A 1Q8LA 3JYTA
chains in the Genus database with same CATH topology
1Y6VA 3MK2A 5DLVA 1KHJA 2RH6A 1KHKA 3Q3QA 1AJAA 4B56A 5GRRA 4KJDA 4MY4A 4GTZA 4UPHA 5DLTA 1ALKA 4LQYA 3T00A 3BDFA 3NVLA 1AUKA 2W5VA 3DPCA 4QAXA 4FDIA 1EW2A 3T01A 3UN3A 1Y7AA 4NWXA 2ZKTA 2VQRA 1ELXA 4KAVA 1URAA 1KH7A 4CXSA 4LR8A 5C66A 1FSUA 3ED4A 4N7TA 2GLQA 1N2LA 1HQAA 3WAVA 3NKQA 1ZEFA 3SZYA 3IGYB 1KHNA 2QZUA 3BDHA 2GSUA 2IUCB 3IDDA 3UN2A 4ZG9A 5HRTA 5GOVA 4CYSA 5IJSA 1P49A 1EI6A 3T02A 3M8WA 1SHNA 3BDGA 1ZEDA 4LR2A 1E33P 4LRCA 5LQQA 1URBA 1ALHA 4UORA 5IJQA 1KH9A 3NKPA 3WAYA 1ED9A 3IGZB 1ANIA 2W8DA 2GSNA 4KJGA 4GTYA 3MK0A 4CYRA 3E2DA 2IFYA 1ANJA 3CMRA 4GTWA 3TG0A 2W5QA 2W5RA 3UO0A 1O98A 4CXKA 2W5SA 4KM4A 5TJ3A 1E1ZP 2G9YA 1ELYA 1ZEBA 2D1GA 2XRGA 3LXQA 5INHA 4ZGAA 1ALJA 1O99A 3B5QA 4UPLA 3NKNA 3UN5A 5K4PA 2IUCA 2W5TA 1AJBA 1KHLA 4LRBA 1KH5A 5EGEA 5DLWA 1ELZA 4KAYA 4CXUA 4UPIA 1N2KA 5LIAA 2W8SA 2X98A 3M8YA 3M8ZA 4LR9A 2W5XA 3BDGB 1E2SP 4LRFA 4ZG6A 4ZG7A 1SHQA 5LRNA 3SZZA 3MK1A 5L0KA 4NWJA 3A52A 1ALIA 4LRDA 3NKOA 1K7HA 5EGHA 1EJJA 1EQJA 1AJDA 1EW9A 5L0EA 4LR7A 3TWZA 1AJCA 4LRAA 1HJKA 3DYCA 1EW8A 4MIVA 5KXAA 4FDJA 1ED8A 5L0BA 1HDHA 2W5WA 4UOOA 4TN0A 3OT9A 1B8JA 4UOPA 3KD8A 2ANHA 3TX0A 2GSOA 1E3CP 3NKMA 4MHXA 5AJ9A 4YR1A 4LREA 3UNYA 4UPKA 1KH4A 3WBHA 3WAWA 2GA3A 3M7VA 3WAXA 3NKRA 2XR9A 5LRMA 4GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6V A;  3MK2 A;  5DLV A;  1KHJ A;  2RH6 A;  1KHK A;  3Q3Q A;  1AJA A;  4B56 A;  5GRR A;  4KJD A;  4MY4 A;  4GTZ A;  4UPH A;  5DLT A;  1ALK A;  4LQY A;  3T00 A;  3BDF A;  3NVL A;  1AUK A;  2W5V A;  3DPC A;  4QAX A;  4FDI A;  1EW2 A;  3T01 A;  3UN3 A;  1Y7A A;  4NWX A;  2ZKT A;  2VQR A;  1ELX A;  4KAV A;  1URA A;  1KH7 A;  4CXS A;  4LR8 A;  5C66 A;  1FSU A;  3ED4 A;  4N7T A;  2GLQ A;  1N2L A;  1HQA A;  3WAV A;  3NKQ A;  1ZEF A;  3SZY A;  3IGY B;  1KHN A;  2QZU A;  3BDH A;  2GSU A;  2IUC B;  3IDD A;  3UN2 A;  4ZG9 A;  5HRT A;  5GOV A;  4CYS A;  5IJS A;  1P49 A;  1EI6 A;  3T02 A;  3M8W A;  1SHN A;  3BDG A;  1ZED A;  4LR2 A;  1E33 P;  4LRC A;  5LQQ A;  1URB A;  1ALH A;  4UOR A;  5IJQ A;  1KH9 A;  3NKP A;  3WAY A;  1ED9 A;  3IGZ B;  1ANI A;  2W8D A;  2GSN A;  4KJG A;  4GTY A;  3MK0 A;  4CYR A;  3E2D A;  2IFY A;  1ANJ A;  3CMR A;  4GTW A;  3TG0 A;  2W5Q A;  2W5R A;  3UO0 A;  1O98 A;  4CXK A;  2W5S A;  4KM4 A;  5TJ3 A;  1E1Z P;  2G9Y A;  1ELY A;  1ZEB A;  2D1G A;  2XRG A;  3LXQ A;  5INH A;  4ZGA A;  1ALJ A;  1O99 A;  3B5Q A;  4UPL A;  3NKN A;  3UN5 A;  5K4P A;  2IUC A;  2W5T A;  1AJB A;  1KHL A;  4LRB A;  1KH5 A;  5EGE A;  5DLW A;  1ELZ A;  4KAY A;  4CXU A;  4UPI A;  1N2K A;  5LIA A;  2W8S A;  2X98 A;  3M8Y A;  3M8Z A;  4LR9 A;  2W5X A;  3BDG B;  1E2S P;  4LRF A;  4ZG6 A;  4ZG7 A;  1SHQ A;  5LRN A;  3SZZ A;  3MK1 A;  5L0K A;  4NWJ A;  3A52 A;  1ALI A;  4LRD A;  3NKO A;  1K7H A;  5EGH A;  1EJJ A;  1EQJ A;  1AJD A;  1EW9 A;  5L0E A;  4LR7 A;  3TWZ A;  1AJC A;  4LRA A;  1HJK A;  3DYC A;  1EW8 A;  4MIV A;  5KXA A;  4FDJ A;  1ED8 A;  5L0B A;  1HDH A;  2W5W A;  4UOO A;  4TN0 A;  3OT9 A;  1B8J A;  4UOP A;  3KD8 A;  2ANH A;  3TX0 A;  2GSO A;  1E3C P;  3NKM A;  4MHX A;  5AJ9 A;  4YR1 A;  4LRE A;  3UNY A;  4UPK A;  1KH4 A;  3WBH A;  3WAW A;  2GA3 A;  3M7V A;  3WAX A;  3NKR A;  2XR9 A;  5LRM A;  4GTX A; 
#chains in the Genus database with same CATH topology
 1CUL B;  2XMV A;  1P8G A;  3NG8 A;  2RAQ A;  3CCT A;  4OYM A;  2K2P A;  5M2U A;  2Z2M A;  3N28 A;  4ZOS A;  4Y28 C;  4B02 A;  2HIQ A;  2DVI A;  1LWF A;  1IR1 A;  4EO6 A;  1UL3 A;  3EGN A;  4L73 A;  2V8H A;  1YG0 A;  1D8Y A;  3DOM B;  1LFW A;  1VR6 A;  2FY8 A;  2C3O A;  1SQG A;  3BQ2 A;  1NPK A;  3KWM A;  1D0E A;  2CKW A;  1WEX A;  1UCN A;  2WOM B;  5KFL A;  1VBY A;  1HPZ B;  3H2L A;  4CWB A;  4IDK B;  1IBM F;  4P2F A;  2E5L F;  3UVJ B;  3RU0 A;  3FGV A;  2I1R A;  1N5S A;  1FKO B;  5L0K A;  1V3R A;  2WW8 A;  5AXL A;  2YX4 A;  2NUH A;  1GTE A;  2YPY A;  4FXW A;  4PG4 A;  1NO8 A;  3RBE A;  4WXO A;  1FX4 A;  2B6A B;  4DR1 J;  3R5D A;  2ZBP A;  2HK3 A;  6FD1 A;  3WIV A;  1IKX B;  5KFH A;  3KK3 B;  2XCP A;  3HHL B;  3NLC A;  3GQC A;  1RP5 A;  3U1M A;  2FLN A;  4DSK A;  1RYR A;  4JI7 F;  4LF7 F;  3T5H A;  4L3N A;  2O01 C;  4AL6 A;  2NXN A;  3J7Z T;  4CLW A;  4LRC A;  4CO5 A;  1NSK L;  1VBZ A;  3VAG A;  1HYS A;  3IGN A;  1RBA A;  4M5I A;  5L9N A;  2IYG A;  1YZ6 A;  4Y3C A;  3QLH A;  2W4D A;  4FF4 A;  3NNH A;  3TZW A;  2HRU A;  3CJQ A;  2KKH A;  1U6F A;  3C3L A;  3GR1 A;  4BC7 A;  3D6F B;  4J7C A;  3CB4 A;  5IS2 A;  1EX8 A;  4KAY A;  1RTH A;  2QSW A;  4JV5 F;  3ELH A;  4FKX A;  4Q0B B;  1C1C B;  5GAD I;  3M4X A;  1I6J A;  1MWZ A;  2QSF A;  3DYC A;  1PYO B;  4CO0 A;  4IR9 A;  1IKY A;  5LT5 A;  3KLV A;  4ID8 A;  1R27 B;  2GSO A;  4FF3 A;  2WB4 A;  3Q8V A;  3NGR A;  5J2M B;  5SZT A;  1TKT B;  2ZH2 A;  1Y5N B;  2ILZ A;  4NLW A;  1RAF B;  1S48 A;  5IM0 A;  2ADC A;  4WFX A;  2UXD J;  4QBU A;  4PPZ A;  3CJ5 A;  2JNJ A;  1UW9 A;  1JLQ A;  5KG3 A;  5JVH Q;  4LF6 J;  2KG0 A;  1T7P A;  2XY7 A;  3W2V B;  2PII A;  1WWH A;  3PR5 B;  1HNX F;  1PJ5 A;  3IN5 A;  3IDD A;  5FD1 A;  2ROE A;  1RTD A;  4R0E A;  1JJC B;  3EDR B;  1K73 T;  1R8P A;  1TUG B;  1VCT A;  2WK4 A;  1AFJ A;  2DGW A;  4MTP A;  4U7C A;  1C4A A;  3POT B;  1REV B;  2XYH B;  3RAM A;  2IPO B;  4PWU A;  4P10 A;  1NKE A;  2YH0 A;  1FTR A;  2NS1 B;  1S6Q A;  5DG8 A;  4KPC A;  5KFG A;  3E51 A;  5FDL A;  3A8E A;  4NZ0 A;  2WB1 D;  3I0R A;  3GJT B;  1ZA1 B;  3CED A;  1BQX A;  2XZW A;  4Y2K A;  2A18 A;  4CZC A;  1VJW A;  2J6T A;  3EGV A;  2HNY B;  4FDJ A;  4WFN Q;  4MYU A;  2HFO A;  3PW2 A;  3A3O B;  3MAH A;  5B0A A;  2JFK A;  3OR1 A;  2IC3 B;  2QLJ B;  1B99 A;  3PJX A;  4A8W A;  2OPQ A;  4JI6 J;  4JI4 J;  5KFF A;  1U47 A;  2VJV A;  2W9C A;  1Q1K A;  3C19 A;  3FBE A;  1C1B B;  4QYR A;  3SSS A;  2MSS A;  3M2V B;  4X64 F;  1TK8 A;  5D3G B;  2YNF A;  2CAD A;  3HO1 A;  2ZDP A;  4C11 B;  2COL A;  4MK7 A;  2CZV C;  2FGO A;  4QPX A;  4ANE A;  4K4U A;  3ZTO A;  2HWH A;  2NUU G;  3RYL A;  3NAH A;  4NCG B;  3BKT A;  4B9V A;  2CDR B;  3UPF A;  1VHF A;  3OL8 A;  3QRQ A;  2B8Q A;  2GHV C;  3H2U B;  5K8O A;  5L1K A;  5DZ6 A;  1U0H A;  3PVX A;  5B08 A;  3BGU A;  4IO9 Q;  4EU0 A;  4B3R J;  3P6Y C;  2RHQ B;  2J76 E;  1KHL A;  5CYJ A;  4LQ9 A;  2XYG B;  4DCJ B;  4DPO A;  3VV2 B;  4Z7C A;  3RBX A;  1JIH A;  4TXS A;  1UW4 A;  1XC9 A;  5K20 B;  2PI5 A;  2QA1 A;  4I6Y A;  3KLI A;  4JI0 F;  1CS4 B;  2EFP A;  1VHI A;  3PG9 A;  3MPW A;  4NA2 A;  4DHV A;  1ZTW A;  1U6Z A;  1YRX A;  4PG6 A;  5HN0 A;  4WE1 B;  2MHN A;  2CQ3 A;  3DM2 A;  3NS6 A;  3KDO A;  4K4X A;  3SSR A;  2KO1 A;  4LR8 A;  2V8V A;  1RYS A;  4DV3 J;  4KC5 A;  4KGM A;  2GLQ A;  2CPH A;  2RUS A;  4CLT A;  2PFF B;  5F8J A;  1S99 A;  3MM9 B;  4ED6 A;  1MMN A;  3W5Z A;  2CZ9 A;  1H98 A;  1K9M T;  2O67 A;  1UZD A;  1NCL A;  5GVQ A;  2CPJ A;  2EG1 A;  4I6A A;  4JI8 F;  1LW0 B;  2A0F B;  2RNE A;  1LWC B;  1RBL A;  2EFQ A;  5L1L A;  3T5K A;  4J9P A;  3PTW A;  3C16 A;  1NJX A;  3VGU A;  3L3C A;  2J6U A;  5A6P A;  4H54 A;  1VFJ A;  5A8R B;  3G6V A;  1XNQ F;  4WWS A;  4DV0 F;  4B3M F;  1EAR A;  3DHX A;  1X9S A;  3I0S B;  1S9G B;  2KYX A;  1F5A A;  4CO3 A;  3LP2 B;  1KQF B;  1EQJ A;  2YKA A;  4K5R A;  1RXO B;  5HMX A;  3TVZ A;  2ZBC A;  4A8F A;  1N34 J;  1NB2 A;  3LP0 A;  2AJ1 A;  1OMS A;  2QMW A;  1CBK A;  2Z2L A;  3MED A;  2RIJ A;  3WIU A;  1KKH A;  4PQA A;  1NBE B;  4OLP A;  4DUT A;  3DGV A;  4L76 A;  3JTO A;  1UVM A;  3BBC A;  3CDU A;  2W9A A;  1VQN S;  1YHQ S;  3HLU A;  3R1L A;  1B64 A;  2D3Z A;  1WEZ A;  1X4H A;  1TU0 B;  2BEF A;  1OYD A;  3H5U A;  3I5A A;  3QMQ A;  4F0K A;  4ES3 A;  1CJV A;  4PRF A;  3KLE A;  2ZD1 A;  2JVR A;  4JI1 J;  1GH8 A;  2HMI A;  3DLK A;  3KUE A;  3GFY A;  3FCW A;  3QFW A;  1KOO A;  2OFG X;  3O5T B;  3PX6 A;  1ANI A;  3DOK A;  2ZE2 A;  2HBY B;  1VQL S;  3TVK A;  2ASL A;  4I56 A;  2NYI A;  2HS4 A;  3M8Q B;  3AOA A;  4K4V A;  2UP1 A;  2U2F A;  2BAB A;  3TJA A;  2CPX A;  1G1X A;  1SPB P;  1HLW A;  4WK1 A;  2DHX A;  2ASJ A;  1JXV A;  2YH1 A;  2F4F A;  5GAD U;  3GP9 A;  1FWK A;  5HJY A;  3A8K A;  2B56 A;  1UJ4 A;  2ANH A;  3AXK A;  3IP0 A;  3E01 A;  1F9F A;  1SQF A;  4EBC A;  1RTZ A;  1T9W A;  4B3T F;  1IBL F;  4UQG A;  2GGP B;  1SC4 B;  3AQP A;  3PX4 A;  2CPE A;  3EDQ B;  1TFY A;  3OTB A;  4MK8 A;  1S9E A;  3R5C A;  3SFG A;  2MY7 A;  2ZOM A;  2H3E B;  4IO1 A;  2N82 B;  1L3V A;  4OI4 A;  4P72 A;  4DL5 A;  4Y2M A;  2QFJ A;  2RUG A;  2KDO A;  1QAX A;  3PW0 A;  3E2D A;  4C98 A;  1R0C B;  3KK1 B;  2XWY A;  1IJE B;  5TJ3 A;  1BWE A;  3DXB A;  2JSX A;  3PAC A;  3I87 A;  4OYA A;  1MN7 A;  2XBP A;  2AGO A;  2W7A A;  1NJW A;  3K2Y A;  4LRB A;  2HHT A;  3JAM Y;  5H9F K;  5E3Q A;  4TNO A;  3N01 A;  4NRT A;  3KHL A;  1WUU A;  3H59 A;  3SXL A;  1KRP A;  5JVG Q;  3SV4 A;  2V67 A;  1KEK A;  4K8R A;  5DG7 A;  2B4V A;  3QIP B;  4O3Q A;  3NKR A;  5L39 A;  4I0W A;  1UZH A;  3H25 A;  1UA1 A;  4ZVR B;  4O3R A;  3Q8S B;  2GHW A;  1UKU A;  1L5U A;  4HKQ A;  3S8S A;  3CC2 S;  3GIR A;  5E7O B;  2DR9 A;  2JC0 A;  1EB0 A;  1P1L A;  3F73 A;  2OTJ S;  3MAA A;  1H6K X;  1BLU A;  3CD5 A;  2MJN A;  1RT2 A;  2H48 B;  5A0Y B;  3B4M A;  3MPU B;  3HHK A;  3OQ2 A;  3C6U A;  5B0C A;  5L1J A;  4FDF A;  3PM9 A;  3W63 A;  5LMN J;  1FRI A;  2KRR A;  3D0G E;  4ID5 B;  2MB0 B;  3MEG B;  3T9N A;  1S97 A;  1Q0N A;  1T3N A;  2R8J A;  4HTJ A;  2EC2 A;  2W5Q A;  4CXK A;  2DXD A;  4Q2L A;  1WHX A;  3NRB A;  3GPA A;  4G3I A;  4ECT A;  1HR0 F;  1L3T A;  3MD3 A;  3ZTP A;  3RBD A;  4Z2X A;  1AJD A;  4CTA B;  4CLF A;  3IXQ A;  1Q79 A;  1EW8 A;  2Y8W A;  2W4P A;  3CCS S;  1Q7Y T;  4OYP A;  1VBX A;  3N9U C;  3GIM A;  2CJA A;  3G82 B;  2NLW A;  1WDT A;  1EP4 A;  4X4Q A;  4YOE A;  1AFI A;  4ECQ A;  3KJF B;  4ZVF A;  4PZV A;  2I5J A;  2RS8 A;  3O3L A;  3MM6 A;  2J7K A;  2B43 A;  2Q6B A;  2V69 A;  2BE2 A;  2K7K A;  4NYZ A;  3OFG A;  3BDH A;  5I4M A;  4HTI A;  3MEC A;  4OZ5 A;  4DLG A;  4HAC B;  1BC6 A;  1CUL A;  3Q8Q B;  4C4W A;  3O6Q A;  2W8L A;  1TAQ A;  4PXC A;  1NPP A;  1HNI A;  5JMN A;  1FFG B;  3HD2 A;  3NNA A;  4R5P B;  4J90 A;  3LWL A;  1RAO A;  4CNY A;  3EVO A;  4ER8 A;  3UN5 A;  2HHQ A;  2F8E X;  3Q83 A;  3FQL A;  2HZV A;  2XWX A;  4OL8 A;  3SCI E;  1U1O A;  1ZBT A;  2VPW B;  2G0I A;  4ERD A;  2AWZ A;  2M88 A;  2CQ0 A;  2WOM A;  1MN9 A;  4U7U K;  1HPZ A;  2DH8 A;  3DRP B;  2YWF A;  4IDK A;  3UVJ A;  2ZEJ A;  3OTE A;  2CNO B;  5IV4 A;  1FKO A;  5DRK A;  3OJS A;  2KFY A;  4KGX B;  2BR0 A;  3H8Y A;  5HSP A;  3K17 A;  4YME A;  2ZOF A;  2VL1 A;  2CNL B;  2XS7 A;  2AX0 A;  4ZLJ A;  3KDN A;  2Z58 B;  2HBQ B;  2DR8 A;  3MCN A;  4HHJ A;  3D7S B;  3CPW R;  2R7U A;  3CC4 S;  1IKX A;  4O44 B;  1NU4 A;  3KK3 A;  2CQ4 A;  5D4N A;  4ELU A;  3NGU A;  3IRW P;  3CDE A;  4DV2 F;  3NKP A;  3VAF A;  1SJF A;  3HT0 A;  1X5P A;  4LSN B;  5IZH A;  5GMD A;  1IKW B;  5D0R A;  1ROF A;  4AXI A;  4K4S A;  4L3K A;  1R8C A;  3A4T A;  2CQC A;  4NEY A;  1YBT A;  3AY0 A;  3OL6 A;  4JB8 B;  2FJW A;  3EJM A;  4IQM A;  4KGK A;  5EX3 A;  5IWA F;  3RUB L;  2KM8 B;  1QTN B;  3GLJ A;  1NSA A;  3V6H A;  2V9W A;  2QC3 A;  1R3N A;  3I96 A;  2LCW A;  1T9X A;  2UVW A;  1SJ3 P;  4BC9 A;  2OI2 A;  2DGU A;  1R8B A;  3Q3Q A;  1H38 A;  2GCF A;  4Q0B A;  4CLK A;  3MZI A;  2F4V F;  1C1C A;  2VIH A;  4KO0 B;  4C7Q A;  3PXG a;  1ZM3 A;  2BJ8 A;  3PEJ A;  3OV7 A;  3IFE A;  4B08 A;  2X1B A;  5J2M A;  1TKT A;  2UUT A;  1X5T A;  4RUC A;  2V2V A;  1OY6 A;  1XBW A;  4RU2 A;  1XER A;  2LXF A;  3W2V A;  5C42 B;  3FRZ A;  1ALJ A;  3B5Q A;  1C0T B;  2KH9 A;  3BDE A;  4K4T A;  2VV5 A;  3PHT A;  3NY0 A;  3CJT A;  3N5B A;  3TW0 A;  3QJL A;  4M5K A;  2OEK A;  1EQ0 A;  3SZZ A;  1SC1 B;  4ALZ A;  3POT A;  1REV A;  3FNN A;  1MRO B;  2C2K B;  4A8Y A;  1T9V A;  1XNR J;  3UFC X;  3KLG B;  3MUV P;  2F63 A;  4XO0 A;  1RE1 B;  2OLW A;  4MKB A;  4UZC A;  1SJQ A;  5DQI A;  3T9Z A;  1B0T A;  2HQC A;  3NMA A;  2LU1 A;  2E5I A;  2JOQ A;  2KRB A;  4PWD B;  3DLB A;  4OX9 F;  3G86 A;  1B7Y B;  1MML A;  1GXT A;  2FVQ A;  1RKI A;  4GKJ F;  4OI1 A;  2WSE C;  2BX6 A;  2IC3 A;  3T02 A;  1A9N B;  4PXD A;  1WOS A;  2WVE A;  4FF1 A;  2GIF A;  5A6W A;  2FHJ D;  4HT5 A;  3ISN D;  4OYO A;  4WKY A;  4CLS A;  2F3J A;  4AL7 A;  3RTV A;  1C1B A;  3H20 A;  3MOJ B;  3MFI A;  5KT5 A;  2VH7 A;  4DU8 A;  5D3G A;  4MJK A;  5IV3 A;  4C11 A;  3IR5 B;  2CJK A;  2VZ9 A;  4RO0 A;  2D1C A;  2BE9 B;  4W92 B;  4NCG A;  3PRD A;  3WZ0 A;  3ZZZ A;  4QWC A;  1JLA B;  1WG5 A;  3FDS A;  4XDC A;  2VBX A;  3I9Z A;  4ZG7 A;  2MZQ A;  3WX8 A;  2OEM A;  3P5T L;  1PBA A;  1WI8 A;  1M5H A;  3US5 A;  4PXB A;  2DJW A;  3RJM B;  1U1Q A;  1T05 A;  3PW7 A;  4CO4 A;  3K5P A;  4IKA A;  2B8P A;  1CPZ A;  3N6L A;  3LGN A;  4F04 B;  5M2P A;  4OI6 A;  1D09 B;  3VAJ A;  2XTJ P;  1NK0 A;  1HBU A;  3BBF A;  4OHY A;  1KR4 A;  5CYQ B;  1RT7 B;  4JI2 J;  4QZV B;  1BD6 A;  4UUW A;  4PG7 A;  1YK9 A;  2ZH1 A;  2CG4 A;  5HMY A;  3T5J A;  3D1Q A;  5DM6 Q;  3CF5 Q;  5H9F J;  4DPT A;  1CS4 A;  2ZM6 F;  2HVH A;  4LF4 J;  3UCG A;  3CCR S;  3ILL A;  3T6B A;  1FJ7 A;  1GT8 A;  4WE1 A;  3QQC D;  3ETM A;  1RAH B;  4WIQ A;  2LP4 A;  2X3D A;  4ZJQ A;  2F9J A;  2H1Y A;  2B7C B;  3FC9 A;  3IBF B;  1ZEB A;  1QJH A;  3PFO A;  4DR1 F;  2AHO B;  1U2C A;  1PIE A;  2VD3 A;  1FCA A;  4ZJO A;  4DV6 F;  1SL2 A;  2F65 A;  4N47 A;  3IWN C;  2RF2 B;  4R0J A;  2HRT A;  1NUE A;  4LSZ B;  5HVF A;  1FXD A;  2GO9 A;  4NWJ A;  3UDC A;  3GYN A;  1RA6 A;  5GMK a;  2MZ1 A;  2OKQ A;  2GW8 A;  5DET A;  4M8L A;  3MM7 A;  5L0E A;  1LW0 A;  2RS2 A;  1VS3 A;  3KG4 A;  5GAG I;  1LWC A;  1IKV B;  2WVF A;  2ZJQ Q;  4MHX A;  3DRX A;  4JUZ A;  4CYU B;  3W9I A;  1RUS A;  2ADB A;  5A8R A;  2GQQ A;  1VQY A;  4ZVP B;  3VZI A;  2M2B A;  1R6V A;  4GTZ A;  4ILL A;  1S9G A;  1F9E B;  3DU6 A;  3MTJ A;  2FJD B;  3NNC A;  2YXL A;  1AXQ A;  3C66 A;  2KHC A;  1FRL A;  4CLZ A;  2H5J B;  3QGG A;  4OMF G;  8ATC B;  3BO4 A;  5KFC A;  1CC7 A;  1AUD A;  1TKX B;  4DQR A;  5G0R A;  4D3H A;  4U8V A;  2R7W A;  3HMJ G;  1HD1 A;  4KKO A;  3IAS 9;  2DCU B;  4M5D B;  3RB0 A;  2H9Z A;  2ZUG A;  4ED1 A;  2E9T A;  4ZKA A;  1O99 A;  2E5G A;  2WSC C;  2YKM B;  1N5Q A;  3BR8 A;  2K8G A;  3GE9 A;  2UXD F;  4NL5 A;  3I56 S;  2KFZ A;  3GV8 B;  5F0W A;  4L74 A;  1QAJ A;  2XMK A;  5B0B A;  3AAW B;  1MWY A;  2JL9 A;  4DWI A;  4ZVS B;  4U8Y A;  3BYP A;  3SZ2 A;  2CA9 A;  2D3O 1;  3M8Q A;  4GVL A;  4OQJ A;  5F41 A;  1R8A A;  3M9M B;  4Q5V A;  2MQO A;  1T02 A;  4WYL A;  1JXE A;  4OI3 A;  4DV7 J;  2AGP A;  4ED4 A;  2UVV A;  1FRH A;  4WFA Q;  1FWL A;  3R97 A;  4ZN1 A;  2IAJ B;  4Q8E A;  4QW9 A;  3FEY B;  1FRK A;  2HQ3 A;  1Q5V A;  4TY9 A;  4DJB A;  5EGY A;  2WON A;  3G8Q A;  2RSQ A;  2GGP A;  2J7W A;  1JLC B;  1OQ6 A;  4DQS A;  2FDN A;  3HSD A;  4ECS A;  2KVI A;  2GIR A;  4NX9 A;  3MEE B;  4JI6 F;  4JI4 F;  4YY3 F;  3W7B A;  5KT7 A;  2AYE A;  1RWV B;  1X4G A;  3CTR A;  1FKP B;  3T19 A;  2OJ3 A;  1RSC A;  3ZZR A;  2R7R A;  3H5X A;  2VG7 B;  3BQ0 A;  3UE2 A;  1SQE A;  4UTG A;  3I31 A;  4AQY J;  1HQE B;  1HW9 A;  4CDI A;  2PA8 D;  4ED8 A;  2AD9 A;  2F5G A;  3PDN A;  4LFC F;  1JLF B;  3MUT P;  1YTY A;  4WP9 A;  4UST A;  4JI3 J;  2EBG A;  3BDF A;  1J5E J;  1XTZ A;  4C2M A;  4P7T A;  2DEI A;  1JJ2 R;  1U49 A;  2LQ9 A;  3AA8 A;  3ET6 B;  2D9P A;  1NDC A;  4BS2 A;  2HGM A;  1S79 A;  2I0X A;  2QGF B;  3OW2 R;  1FD8 A;  3OLA A;  1EQM A;  3ENQ A;  4EK2 A;  2DTJ A;  3QT6 A;  5D0H A;  2N3O A;  2MKY A;  1HBN B;  5A2Q Y;  2BJ1 A;  3D1H A;  5J2N B;  1V3Z A;  3BDP A;  3PIP Q;  1WDD A;  1TUV A;  4O0N A;  3UO0 A;  1N33 F;  1QVF R;  1BUX A;  5C24 B;  1TAU A;  2O3D A;  5INH A;  2PEB A;  5A0Y A;  1HD0 A;  4F4Z A;  1U26 A;  3QT7 A;  3KNA A;  1KON A;  3JB9 k;  1S1W A;  3R5B A;  2MQN A;  4E0D A;  2LEA A;  4WK3 A;  5HL7 Q;  5MAO A;  4ID5 A;  2NXJ A;  2HND B;  3MEG A;  4I69 A;  1IR2 A;  4F4X A;  4OYX A;  2DGQ A;  3NWR A;  5FJ4 A;  3S6E A;  3FFI B;  3ICL A;  5DLV A;  1YBA A;  3SMZ A;  4DCP B;  4ZLL A;  3TAM B;  3HFV A;  1P9Y A;  2NZ4 A;  1Y9O A;  3MGJ A;  4QIV A;  4CTA A;  5AE1 A;  2RRN A;  3JAM U;  4NA1 A;  4QJV A;  4KV8 B;  5E0O A;  3E3X A;  4EFA C;  1RB0 A;  4A8O A;  3G82 A;  2ZNY A;  2WVC A;  3BB5 A;  2Q1L A;  2MXY A;  1X9M A;  1QM9 A;  2IJN A;  4N5S A;  1SVD A;  4ZVE A;  4ELT A;  1HBM B;  3IA0 A;  4KHP J;  1CEZ A;  1RAC B;  1N34 F;  3C14 B;  5HMZ A;  4JI5 J;  3RR8 A;  2DIT A;  3UW1 A;  6AT1 B;  2E7W A;  1KS2 A;  4HAC A;  2Z2Z A;  1N2K A;  3ZZ0 A;  4WTY A;  4J9V A;  3J80 Y;  1KD1 T;  2WBR A;  5ETQ A;  4L75 A;  1HQ2 A;  1SH2 A;  4ZPB A;  1Q8B A;  3JQK A;  1QSY A;  3K5M A;  3VVT A;  5GAG U;  4R5P A;  3MM8 A;  3QYY A;  2HZA A;  2IM0 A;  4JI1 F;  3GYX B;  5CCL A;  4CIO A;  1KFS A;  1QVG R;  1KHJ A;  4AND A;  4DR2 F;  3QAT A;  1QUV A;  1FDN A;  3KXD A;  2HPU A;  3PFE A;  4C3M A;  4M5G A;  1KWM A;  1X4B A;  1S7H A;  2QJ3 A;  4I67 A;  3MWB A;  1RLC L;  4RWX A;  3B8H A;  3ZZU A;  3DRP A;  1EKR A;  1P1T A;  1V5I B;  1TVR B;  1KP6 A;  5MLC V;  5CZX A;  3VWS A;  1XMB A;  3ZNU A;  1ED9 A;  1SH0 A;  1SUQ B;  5BYS A;  4MT1 A;  2BJ7 A;  2IFY A;  4C9D A;  5HBM B;  3QAU A;  2PMZ D;  4DR5 J;  1TL5 A;  3AA9 A;  2DB1 A;  5CQG A;  1RAI B;  4ZGA A;  3OFF A;  1JLB B;  3SCJ E;  3R6G B;  2RT3 A;  4ETZ A;  1UWA A;  4AD6 A;  4R8U B;  3UDV A;  2GQC A;  4PCQ A;  4O44 A;  2VQF F;  1KTQ A;  2KYZ A;  4YN3 B;  4OX8 A;  1ALI A;  5FLX U;  2B7B B;  4RPF A;  1WD6 A;  1I1G A;  1EW9 A;  4OZ3 A;  1VIO A;  1IKW A;  1FFW B;  2C2M B;  3PYF A;  4U67 Q;  2K3I A;  4X4R A;  4I2P B;  3K0J A;  3GB0 A;  2WVD A;  3HSG A;  3AD8 C;  5M2R A;  4M5M A;  4K0K J;  1RDR A;  1J5O A;  3NEK A;  2AP6 A;  4ATN A;  2UU9 F;  1DLO B;  1X7V A;  1WOR A;  1ZPV A;  1K47 A;  1UWB A;  1RAG B;  4K50 A;  2AU0 A;  4KQZ A;  1Q16 B;  2ZOG A;  3PX0 A;  3M6X A;  2CNK B;  4O4R A;  1AT1 B;  4J9L A;  1X4C A;  2ZVS A;  1SIZ A;  1VQ6 S;  4FYY B;  3BKU A;  3FBF A;  4KO0 A;  3L95 X;  3IAM 9;  5I3U A;  4NOH A;  2E5J A;  1N5Y B;  1F6T A;  3NS7 B;  2M52 A;  1NXI A;  1X5S A;  1DTT B;  2CAJ A;  3NCR A;  1LWF B;  2C2N A;  4RZR A;  4NI2 B;  2KZZ A;  3UR3 C;  2VFV A;  2GA7 A;  2WHO A;  5B0D A;  3MOZ A;  3JXO A;  3CIM A;  1PG5 B;  1JNR B;  1NAQ A;  2AZ3 A;  3PRV A;  2C3Y A;  3VR1 A;  4DR3 F;  4A47 A;  2GQ2 A;  4DZ6 A;  1VK8 A;  2MZJ A;  2VIC A;  1U45 A;  2CWX A;  3BBB A;  5C42 A;  2FJB B;  3DKD A;  3CJK B;  4FPR A;  1HWI A;  1RI7 A;  5LMN F;  2Q66 A;  2BQ3 A;  1N0U A;  4JV0 A;  1Q8K A;  3UCU P;  4NPO A;  3J7A N;  1F5B A;  3UD4 P;  4C97 A;  1SKW A;  5DO2 A;  3W65 A;  1ELX A;  1RU1 A;  1MRO A;  2DNY A;  4X65 J;  3KLG A;  1YJU A;  5KT3 A;  4ZIW A;  2IUC B;  2DEJ A;  4DV1 F;  1F3V A;  4WU3 A;  3M8W A;  3H42 A;  4M63 A;  3OL9 A;  5E2Q A;  4PWD A;  4EMD A;  4EGL A;  4CLY A;  2NXU A;  3ZFV A;  4M5N A;  1ANJ A;  5ADZ A;  2ACY A;  4KM4 A;  2EFO A;  2GJI A;  2BV3 A;  2RB7 A;  3NKN A;  2I38 A;  4N41 A;  2OEL A;  4X4N A;  1KH5 A;  3MMB A;  2J8S A;  2J9C A;  1UMJ A;  1WF0 A;  1Y5L B;  3Q0A A;  5G4D A;  4J9M A;  5EGH A;  1HYS B;  4CH0 S;  3D3B J;  3CUN A;  4YHH J;  4TN0 A;  2SXL A;  4PEO A;  3PW4 A;  3CCM S;  3WBH A;  2BYC A;  2E1R A;  4NXM F;  2XLJ A;  3HXM A;  2FPH X;  1HHS A;  3ZZT A;  2B4P A;  4G1P A;  1JLA A;  4DN0 A;  2YKO A;  1YJN S;  3HKZ D;  2AF6 A;  3CO9 A;  1XMO J;  1OPZ A;  3A1Y G;  5B0F A;  3HHE A;  5K5M A;  1AUS L;  4OHZ A;  4U95 A;  1QSS A;  2GVD A;  3TRG A;  4F50 A;  3OXF A;  3P45 B;  1WJ9 A;  1IR0 A;  4U7U D;  1C0U B;  1VQ8 S;  3TUI C;  1K44 A;  2A6M A;  2YQ1 A;  2W8D A;  5CYQ A;  4F4A A;  1SBR A;  1R6Y A;  1RT7 A;  4ZIV A;  1JLQ B;  4QR2 A;  5L38 A;  4C48 A;  2DRD A;  4MKA A;  2V9K A;  2J0X A;  4PAA A;  2KJV A;  1M5P C;  3R5A A;  2W25 A;  3QBC A;  1UJ5 A;  3MK1 A;  1EJ7 L;  4DEZ A;  4WCE Q;  3SI8 A;  4OZ2 A;  2EBE A;  1LNQ A;  2JLE A;  3K7R A;  1VC6 A;  4F3Q A;  4PUO B;  2VG6 A;  4A8K A;  3MMC B;  2R7V A;  5HRO A;  1R43 A;  3DLE B;  2C3P A;  3ILI A;  1S6Q B;  2I6W A;  2KL8 A;  2Q3P A;  2ZUA A;  1ZM2 A;  1NND A;  5FDL B;  5KOX A;  3Q2S C;  3I0R B;  3N0V A;  4GO5 X;  2RF2 A;  2I2Y A;  1IXK A;  2UXC F;  5DQG A;  1GTH A;  1LWE B;  5IC4 B;  3K58 A;  2OIH A;  2OD6 A;  2GFF A;  4KR0 B;  4MIA A;  2YKN A;  2CRL A;  3S01 A;  1G7C B;  4ILR A;  4QWD A;  3CD7 A;  3EZ5 A;  1OQ3 A;  3M1V B;  3M8P B;  3OR1 B;  4CYU A;  5DLG A;  4ZVQ B;  5EWF A;  1ZED A;  2JFD A;  2MDA A;  4K4Y A;  1KHV A;  5BXI A;  1KBR A;  3FCH A;  4NXN F;  1F60 B;  1NHU A;  2XMU A;  3CSK A;  2CJY B;  2HUR A;  4OZL A;  1H2T Z;  5IT9 U;  1GXU A;  4OI0 A;  3R2C J;  4DL6 A;  4NCB A;  4JYA F;  1TKX A;  3QWU A;  3W1Y C;  2W5X A;  4OJ3 A;  4DUY J;  5KG6 A;  4YB5 A;  1URN A;  2HVZ A;  4M5D A;  2ALY B;  1JJH A;  1U0H B;  3VGS A;  4XIU A;  1EKS A;  3I4P A;  1RA7 A;  4IRD A;  3W64 A;  1LK5 A;  3TX0 A;  2O1P A;  1IBC B;  2QA2 A;  4XPE A;  1RT5 B;  2YKM A;  4ICL B;  5ETK A;  2CQ2 A;  1N5V A;  2ZIT A;  1SB6 A;  1R0B G;  2PC6 A;  3MFH A;  2YVS A;  4WP8 A;  3T01 A;  3LQV A;  1ZS6 A;  3D0H E;  1YWX A;  1M5O C;  1VC0 A;  4PQU B;  2H54 B;  4IRK A;  2FHJ A;  1GNK A;  4ED7 A;  2GSU A;  2MGZ A;  2M5Y A;  3BN7 A;  2Z57 B;  3B54 A;  2AT1 B;  2DNL A;  5KFM A;  3HVA A;  3CDA A;  4TU8 A;  1OSD A;  4BWM A;  4CRJ A;  1XNR F;  1FE0 A;  2G9Y A;  5KAK A;  3FSX A;  4ECZ A;  4LF8 J;  1B3T A;  2IAJ A;  4OI2 A;  2HW3 A;  5BR8 F;  1I94 J;  4KHR A;  5B09 A;  1TUW A;  2LVW A;  1T8E A;  4F4Y A;  3ILJ A;  1KFD A;  2LLZ A;  4F8R A;  1JLC A;  4P7V A;  4L6V 3;  2WTF A;  3GMG A;  2D3U A;  4K2J A;  3W9H A;  2BMB A;  2FC9 A;  3QSI A;  2ZHB A;  1Q86 T;  2MQ8 A;  3A3P B;  3DNC A;  1FDD A;  2BRL A;  4DQP A;  2KZM A;  2HHW A;  4XDD A;  2V34 A;  1FKP A;  3IS9 B;  4TQR A;  2UUA J;  4UPH A;  2OH2 A;  4YQW A;  1AUK A;  3W5Y A;  3BSA A;  3OXL A;  4OYZ A;  2FJE B;  4X4S A;  2P9G A;  2HZC A;  2MKS A;  4ZLP A;  1RT4 B;  4UUX A;  5AXK A;  1HQE A;  3QNW B;  2GNK A;  1ZEF A;  2V4R A;  4KH1 B;  5F9N A;  2D3O R;  1RHK B;  4OHX A;  2LEC A;  3R1H A;  3R8Y A;  4DSE A;  4F4K A;  2B9W A;  3VGV A;  1S72 S;  2ZBQ A;  4JP8 A;  4X62 F;  4E98 A;  1H73 A;  2HKE A;  4QWA A;  5CA5 A;  4EYH B;  3H0P A;  1CVJ A;  3KLE B;  4NLU A;  4WFZ A;  1NHK L;  3VAL A;  5DLF A;  4HL9 A;  3F41 A;  3V6D B;  1K1S A;  1HBN A;  5HI7 A;  4RW8 B;  5CAB A;  5J2N A;  4EZ6 A;  4V19 J;  4QYZ K;  3HX9 A;  3J81 j;  1JLE B;  2LXU A;  4WKR A;  3DOK B;  1RCO B;  2ZE2 B;  3FJ2 A;  2ROP A;  2FVS A;  4HLB A;  1QY7 A;  2C3U A;  2FD2 A;  1N54 B;  2X7I A;  3QGI A;  4NZ7 A;  1N56 A;  5C24 A;  2YPZ A;  5H1S V;  2VQE F;  1N5T A;  4I6W A;  3GV7 B;  1S1U B;  3UCZ P;  2UUC F;  1YGY A;  2PO4 A;  5DLT A;  5KFP A;  1YBU A;  3VF0 B;  2D69 A;  1NH7 A;  4OYI A;  4EWT A;  1S6U A;  1AYE A;  1LXN A;  2P6S A;  4N7T A;  2XSJ B;  4DQQ A;  3VCD A;  5E41 A;  4RBU A;  2CFX A;  3QRR A;  1XEZ A;  2ZWO A;  2HSE B;  3E01 B;  1LWX A;  5KFJ A;  3TAM A;  4W4M A;  3ZTQ A;  4ZVU B;  4ZVH A;  1OJ4 A;  7FDR A;  4CO1 A;  5E3P A;  4AUK A;  1U25 A;  4EZ9 A;  2EFG A;  3RB6 A;  2ZH6 A;  2J7U A;  1WC4 A;  1ZET A;  4KV8 A;  1Q8I A;  2PFD A;  4WXW A;  2CPF A;  2IJR A;  1RWM B;  1H7X A;  5AJ3 J;  2ZVI A;  2Q43 A;  1HBM A;  1UEK A;  1UFL A;  2CJ9 A;  2R8K A;  4UT4 A;  4LVN P;  1JXL A;  2YWW A;  3C14 A;  4N76 A;  5DJB A;  4O23 A;  2V8G A;  3NGD A;  4NYP A;  1KNZ A;  4BDP A;  1F2G A;  4PWW A;  2QRR A;  3BQ1 A;  4LBI A;  2ZDO A;  4DUZ F;  2RQM A;  3EZU A;  1Y7P A;  3V6J A;  2ZH4 A;  3DRR B;  4RU9 A;  4ZPC A;  3LAK A;  1Y7A A;  1ELO A;  3U27 A;  2GV1 A;  1S4E A;  2G0C A;  1RHJ B;  1N32 F;  3KOA A;  3E8O A;  2U1A A;  1DQA A;  2E1C A;  2GC8 A;  3PY8 A;  4CP5 A;  1S0M A;  1KH9 A;  4XAK A;  3IGZ B;  4GC7 A;  1DAX A;  3W8G A;  3V2U C;  2IVM A;  2FGC A;  1X5O A;  1HNW F;  2N3L A;  1TVR A;  4LT6 A;  1N52 B;  4B9S A;  4ZG6 A;  1NEE A;  3OTO F;  1K7H A;  4DV7 F;  5HAT A;  1OS5 A;  1SUQ A;  4LR7 A;  4DL3 A;  4KH0 B;  5HBM A;  1GEH A;  4C0O C;  2PD1 A;  6FDR A;  3SV3 A;  1B8J A;  1JLB A;  3WAX A;  4NLP A;  1RTJ B;  4R8U A;  2E7X A;  5KFY A;  5EX0 A;  2C2O B;  4A8Q A;  3I82 A;  5B0E A;  2X51 A;  1ICE B;  1ULR A;  4ITS A;  2ZH8 A;  3ENV A;  4RNF A;  1JX4 A;  1A6L A;  3KJN B;  1IBM J;  2E5L J;  2QZU A;  4I2P A;  1VQ7 S;  1N4L A;  2KXF A;  1WF1 A;  4ZPW R;  1RHU B;  3T1Y J;  4DS5 A;  3AXM A;  3WQP A;  1SKU B;  4USH A;  4CYR A;  3V81 B;  4IR1 A;  3ONQ A;  1M5S A;  4GTW A;  3MM6 B;  1DLO A;  5ETO A;  1B4S A;  2J6S A;  2HFU A;  4ZPA A;  2FZK B;  3MEC B;  4FZV A;  2GX8 A;  5KT4 A;  5HP1 B;  4CLP A;  1LK7 A;  4Q2M A;  4JI7 J;  1AJC A;  3BKF A;  4OHW A;  3AJ2 A;  1HNI B;  3VTI A;  1N5Y A;  2OML A;  3TYT A;  1FEH A;  1DTT A;  1R89 A;  1DHM A;  2V50 A;  3NWG A;  3M8S A;  4NI2 A;  4KJD A;  2RD5 C;  3I4H X;  4B3S F;  3GIK A;  3LOU A;  2RU9 A;  4HHH A;  3RB3 A;  2IRU A;  2UUW A;  4H4K C;  2RU3 A;  3C6T B;  1HMV A;  5KT6 A;  1VRU B;  4TYA A;  2HS3 A;  2B3T B;  1FXR A;  3IGV A;  3UN2 A;  1B0P A;  4JV5 J;  1F2H A;  3CJK A;  2DIV A;  1URB A;  1RGV A;  3OVS A;  4DFK A;  4HHU A;  1ZM9 A;  5F3Z A;  3OUY A;  3MCO A;  2VDI A;  2W5R A;  1ELY A;  4XTT A;  1N6Q B;  1WHY A;  1GAO A;  2IUC A;  1FKA F;  2XLI A;  1BHN A;  4PXE A;  2RKI B;  2E66 A;  2C3M A;  2E1A A;  2IFX A;  1WHV A;  3P96 A;  3SCK E;  3JSR A;  1WEL A;  2AYM A;  5J1N A;  5E33 A;  4C8N A;  3EVW A;  2JHE A;  4RL1 A;  3BGL A;  1YRT A;  1KOH A;  4RX6 A;  9RUB A;  3WAW A;  2KU7 A;  2DNO A;  3BH7 B;  3ZZY A;  3FVY A;  1RAB B;  3WC2 A;  4KHP F;  1MWQ A;  3ZTS A;  2VG5 B;  3S1T A;  4ZN3 A;  2VBY A;  1X8D A;  5E3A A;  3WAV A;  3SZY A;  1T11 A;  3RG6 A;  4ZG9 A;  2Z56 B;  4UQT A;  1YI2 S;  5IJS A;  1UVN A;  2A1B A;  4LF9 J;  3SYZ A;  2APO A;  2EW9 A;  1ALH A;  2IM1 A;  2CPD A;  3NOG A;  4NLQ A;  3THV A;  2K3K A;  1XQI A;  4R25 A;  5IOL A;  5IFM A;  3LW5 C;  2VOP A;  1U48 A;  2W5S A;  1X0F A;  4P73 A;  5EWG A;  2HHU A;  4UOG A;  2ZBR A;  2EK6 A;  3K57 A;  1RTI B;  3KUG A;  3D5M A;  1C0U A;  4MFB B;  4W90 B;  4X64 J;  3TA0 A;  5LMU F;  2DGO A;  4QIW D;  3TAP A;  4UZB A;  1Y10 A;  1UPM B;  3D0I E;  4O3S A;  4RBV A;  1Q7L B;  2WZ1 A;  2GIQ A;  3HSZ A;  2YNH B;  4DL4 A;  1YLX A;  3RAX A;  1FT8 A;  4LVO P;  4ZPV R;  2QL5 B;  2C2R A;  4FXD A;  2A2C A;  3R27 A;  3THP A;  5ETS A;  1G4C A;  4PUO A;  3AOD A;  3O1L A;  3MMC A;  4DQI A;  4JV2 A;  1V6H A;  4ZA1 A;  2JEG A;  3M2U B;  3DLE A;  3BSO A;  3LTO A;  2FLO A;  5A76 A;  2Y3Y A;  4MYT A;  4QYZ J;  3PNI A;  4O3N A;  2AJ2 A;  3QT8 A;  2Z8Q A;  5AXN A;  3EGW B;  1LWE A;  4RNH A;  4DPX A;  3AD9 C;  3TA2 A;  1DQ9 A;  1J27 A;  4JI0 J;  4HDH A;  2HHS A;  2C1E B;  1U4B A;  3GG0 A;  2FTR A;  2CQB A;  4NLS A;  3M1V A;  3M8P A;  1FVQ A;  2OGU A;  1D1U A;  3G87 A;  2VON A;  1EZZ B;  1HI8 A;  3Q2T C;  1FER A;  2RH3 A;  3D6H B;  2J0W A;  1BQN A;  1RT6 B;  2ERR A;  4BLG A;  2WSF C;  4PG5 A;  3JQJ A;  2VFS A;  3BN4 A;  2BAN B;  3HI9 A;  5E3C A;  4JI8 J;  1KSP A;  5HLF B;  3GIJ A;  4P9S A;  1RZM A;  3HKW A;  1ALK A;  3WDO A;  3Q89 A;  4MMO A;  4I4B A;  3DLH A;  1T05 B;  1XNQ J;  4DV0 J;  4B3M J;  1P49 A;  1PKU A;  3IRX A;  3HK2 A;  2MKK A;  1RT5 A;  4ICL A;  5H9E K;  4IQX A;  1F3F A;  2A10 A;  1NZA A;  2KN4 A;  4DX7 A;  3MCS A;  2I8E A;  1HBU B;  2GSN A;  3AOB A;  3D28 A;  3ZC4 A;  2YQ0 A;  5L8R C;  3R9L A;  2BBE A;  4USM A;  2FLP A;  1XR7 A;  4PQU A;  4O0I A;  4TVA B;  2BQR A;  2N7C A;  1RKJ A;  2AYB A;  4U96 A;  1JWW A;  2W2N P;  4C8Z A;  2XUL A;  3LGM A;  4YEA A;  2DIS A;  3VAI A;  3CXC R;  2ZC3 A;  2QYG A;  3HVW A;  1Z4U A;  2ZZN A;  2FC8 A;  3W60 A;  4X65 F;  2G2Y A;  4V1A k;  1B7F A;  2P5V A;  4P2S A;  1R0A B;  4B9N A;  1T03 B;  3TA1 A;  3KFW X;  3SIP B;  5KFU A;  2CJB A;  2M8D B;  3R7B B;  1BWV A;  1WEY A;  5KFT A;  2D74 B;  4NWX A;  4KGZ B;  1NKC A;  4KAV A;  3MM7 B;  5F8N A;  1Y3K A;  2V0N A;  2DH9 A;  1FJG J;  5AXM A;  2C22 A;  2VFR A;  2DXE A;  5F0U A;  1U2F A;  4F25 A;  5A8K B;  3H5S A;  3G96 A;  1WHW A;  3IS9 A;  5J1E A;  1T95 A;  3L09 A;  2EG2 A;  3IWX A;  2R2U A;  3DGP B;  1NK9 A;  2MTL A;  4DX5 A;  4YHH F;  4KJI A;  1HAR A;  1VI7 A;  1RCX B;  1XMQ F;  1JMT A;  1RT4 A;  4DS4 A;  3OTD A;  3KJQ B;  2HVI A;  2EI5 A;  5HAO A;  1WAC A;  3PJ9 A;  1NK8 A;  5DGA A;  1IBL J;  4GO7 X;  2M9K A;  4X4P A;  4LRF A;  5G0R B;  2OFH X;  1WNE A;  4KKO B;  4WPA A;  4H4M A;  1YIT S;  4WZM A;  1B70 B;  4E2F B;  4EYI B;  2G1H A;  1VQ5 S;  4IH5 A;  2NCK L;  4RR5 A;  4RW6 B;  2HHP A;  2AQ4 A;  3V6D A;  2C2D A;  2ILY A;  1SCJ B;  3AD7 C;  4RW8 A;  4HR2 A;  4KYZ A;  2AYG A;  4C0B A;  4ZVG A;  3LF0 A;  3HP6 A;  1TFW A;  1JLE A;  3OFH A;  1FJE B;  3GV5 B;  2C2Z B;  1YJ9 S;  2CVI A;  2HQI A;  1UP1 A;  2WVB A;  3NS5 A;  3FSY A;  4LR2 A;  1E33 P;  1S1U A;  1YJV A;  3T1H J;  2W2O P;  3R7N B;  4F3O A;  5F8H A;  4QWE A;  1HNZ F;  4NLY A;  4QWB A;  3ITH B;  3MPV A;  3KK2 B;  3CVK A;  1ZZF A;  2XSJ A;  2ZJR Q;  4WFY A;  4OYW A;  2P8I A;  4ZCL A;  2J9E A;  1G3O A;  2L48 A;  4IRC A;  2AJQ A;  2QIF A;  3SDE B;  4DPY A;  1REG X;  4CH7 A;  2WON B;  4DZD A;  2FHM A;  1IWA A;  3IR6 B;  1BE4 A;  2B4O A;  1LW2 B;  2JWN A;  4FPI A;  2B9X A;  3BSN A;  2IJF A;  1NSQ A;  1RJJ A;  2JVO A;  1U1R A;  4TKT A;  1S1V B;  3U1N A;  2UVR A;  1CJK B;  4DBQ A;  4Q8F A;  1HR0 J;  4YR2 A;  7AT1 B;  2FHO B;  1PJ7 A;  1LQ9 A;  3CNQ P;  4P2X A;  3BGF A;  1K1Q A;  1H2U X;  4NRU A;  1M5K C;  4DUY F;  1OY9 A;  3DRR A;  2KG1 A;  2M8H A;  2M4M A;  1N88 A;  4RUB A;  5KFV A;  4GKK F;  3GSI A;  1N36 F;  2D1G A;  4DG1 A;  3F0N A;  1S0O A;  2UXB J;  2X3G A;  2MQL A;  2GHP A;  3D2W A;  4YR0 A;  5LRN A;  4URG A;  2BKN A;  4DR7 J;  3IM9 A;  3BZQ A;  3EWG A;  4C6A A;  1QE1 A;  4KRW A;  4ZIT A;  1NK7 A;  4LF5 F;  5LSR A;  2YBV A;  2HHV A;  4IG3 B;  1OO0 B;  3WX4 A;  2FIU A;  2DRB A;  2KXN B;  2HEK A;  1GMV A;  4ZMM A;  1S1W B;  1N0V C;  2XY6 A;  3H4B A;  2DNP A;  1NK4 A;  1KQK A;  2HLT A;  3PW5 A;  1FES A;  4P2M A;  1I5O B;  4CXS A;  1HI0 P;  3HPO A;  4LFA J;  3ED4 A;  3NCP A;  1X31 C;  2J9D E;  2R8G A;  1M1G A;  1WTF A;  2O5D A;  3P5B P;  4RJV A;  3EUN A;  2QL7 B;  2LEP A;  2DHS A;  1RTJ A;  4Y2I A;  3IG1 B;  1WC5 A;  2CJX B;  3IBW A;  4M94 A;  4S0M A;  3LPY A;  2E29 A;  5D4L A;  4CM0 A;  2QV6 A;  2R9L A;  1ZA2 B;  1N48 A;  3CGI A;  1FXL A;  4EEY A;  1CQM A;  4F0H A;  3D6T B;  2IM3 A;  1HBO B;  5LL6 d;  1E6V B;  2DCL A;  3NAI A;  2V68 A;  2HVD A;  3V81 A;  4J5O A;  1JLG A;  2QT7 A;  2CVE A;  2W9B A;  4X4V A;  5FLX Y;  2DXF A;  1YDL A;  3KG0 A;  4NLG A;  4USW A;  5CD4 H;  3A8J A;  2YY3 A;  5HP1 A;  1AZS B;  3IO1 A;  4PG8 A;  5KFE A;  4TU9 A;  1MSW D;  4DSL A;  4NCA A;  1T94 A;  2HQF A;  2YWK A;  3JSY A;  2DNK A;  1HQA A;  3A8I A;  1KHN A;  2JEJ A;  3UI3 A;  4RUA A;  3MM8 B;  2YQ3 A;  5IT0 A;  3UWT A;  1UJ6 A;  1FRX A;  3R5J B;  5LXR A;  5IWA J;  4W98 A;  2Y1L B;  1NJI T;  4URS A;  3MR2 A;  2FHK A;  3C6T A;  2HAI A;  2P6T A;  1VRU A;  2R8I A;  4UPL A;  1W25 A;  1F9H A;  4QIF A;  4M5H A;  2G1D A;  3T5L A;  2NYH A;  4HDG A;  2F4V J;  3SBM A;  3M30 A;  3OTC A;  1ZAW A;  2NR0 A;  3TZX A;  3CD6 S;  3CMA S;  2HVE A;  2DH7 A;  4LF2 A;  4ED3 A;  5J1P A;  3C15 B;  4LFB F;  2HFV A;  3MHY A;  1N6Q A;  5H9E J;  2MY8 A;  3LGH A;  1VLO A;  1M90 T;  1EIY B;  1PIL A;  5DQH A;  1JK9 B;  4X4T A;  2CQH A;  3W5X A;  2YKQ A;  2RKI A;  1NM2 A;  2K06 A;  2XY5 A;  4QAX A;  3J7A 1;  3QGH A;  2IM2 A;  1R8H A;  5KFI A;  4DV4 J;  1K0T A;  1VQ4 S;  2CYY A;  5HRT A;  2PA3 A;  3TJ8 A;  4ZPD A;  2FUG 9;  4CQ1 A;  1A7G E;  4NEZ A;  1O6X A;  1O8B A;  4HI2 A;  3ZZP A;  4G65 A;  1J5O B;  3G4S S;  4FBT A;  4F3M A;  4CI0 B;  1NHV A;  3CJS A;  4KHM A;  2R7T A;  2VG5 A;  5KFB A;  4YP3 A;  3LXQ A;  2XI3 A;  2V94 A;  1UWB B;  4O3P A;  1FNM A;  4OJG A;  4CLL A;  3TUJ C;  4NLX A;  2ZHA A;  4DDF A;  4FVM A;  3RRK A;  3KNG A;  5K14 B;  4FNH A;  1VBK A;  4Q43 A;  4OX9 J;  2L08 A;  2OPS B;  4A48 A;  1EHW A;  2HHH F;  3PYG A;  4AXJ A;  3AFG A;  1RWP B;  1SH3 A;  4GKJ J;  2DYA A;  2IMO A;  5I3U B;  2D9O A;  3FBC A;  4JOU A;  2NSB A;  2RQ4 A;  2XHW A;  3QRP A;  4RLE A;  4EBE A;  4FVC A;  2Y1I A;  1RTI A;  2MKC A;  3IC1 A;  1DTQ A;  1SV5 A;  4MFB A;  2WBM A;  1TL4 A;  3GFH A;  2OAU A;  5F8M A;  1S77 D;  3P4U B;  1RT3 A;  1T9T A;  2VU5 A;  1FSU A;  5CD4 A;  1S6P A;  2PGC A;  3W2W B;  2ALZ A;  3FKB A;  4I7F B;  1ZTT A;  1CC8 A;  2CQP A;  4BWJ A;  2YNH A;  3N6M A;  3PZP A;  1IBK F;  2UUB F;  1S49 A;  4OIX A;  2W7P A;  1F0X A;  5HAN A;  5BJR A;  1LKZ A;  1UPP A;  1UAW A;  3M2U A;  3M32 B;  2A3J A;  1GX5 A;  2RDJ A;  1FD2 A;  2XNQ A;  4PYD A;  1NKB A;  4NMX A;  4ZP7 A;  2MKJ A;  2LFV A;  3EXC X;  3GFX A;  2CUY A;  4ECY A;  2H51 B;  2PE8 A;  3I5B A;  5D6G A;  2BJD A;  2VPY B;  1EJJ A;  1E6Y B;  5I3P A;  2C42 A;  2ZJP Q;  2EFN A;  4ANC A;  2QLW A;  2AGQ A;  4B9L A;  2ZM6 J;  4YS2 A;  1URR A;  2POK A;  4ZVO B;  2Y1J A;  3M6V A;  3T1Y F;  3MMB B;  1TV6 B;  1VIS A;  1GX6 A;  2A6O A;  2R7X A;  2R8H A;  5KG5 A;  1HWK A;  3NMR A;  2E9Z A;  3BO3 A;  1U1P A;  1CSJ A;  3V5R A;  1RT6 A;  4DV6 J;  1V5V A;  3MDF A;  2EC0 A;  4CYS A;  2BAN A;  3TZY A;  4EUV A;  2KI2 A;  2V4J B;  2GML A;  3EVM A;  2GJF A;  5HLF A;  3RAQ A;  1HL6 A;  2F7V A;  2DGV A;  5K8N A;  3CMR A;  4USU A;  1FNX H;  2WAQ D;  1YJW S;  3SFU A;  1RAD B;  3VQT A;  2GVD B;  3GG1 A;  3HT3 A;  1PC5 A;  4ECU A;  5CXT A;  5KG1 A;  1RWO B;  4TLQ A;  2MPU A;  5GAE I;  4ZCK A;  4AE5 A;  5IT9 Y;  2I9S A;  2XMT A;  4KT0 C;  2YNG B;  3OR2 B;  1Q53 A;  2DO4 A;  4F2S A;  2ABY A;  4UOO A;  1VRT B;  4ILM A;  1E3C P;  4WII A;  2MZT A;  3KMQ A;  3L7P A;  4HVZ A;  1WKL A;  5KT2 A;  1QD1 A;  5IT4 A;  2EEY A;  3R5G A;  2FZG B;  5IQ6 A;  3W8P A;  2DR5 A;  2CIM A;  3HUL A;  3FSI A;  3I9V 9;  4MKY A;  1FRM A;  5ETR A;  1D9D A;  1YX2 A;  3VAM A;  1SC6 A;  1PJ6 A;  4RKU C;  3MUM P;  1U09 A;  5D0G A;  4P52 A;  1R0A A;  1T03 A;  2VG6 B;  3CCZ A;  5HRO B;  9ATC B;  4J9K A;  4X4U A;  1IUJ A;  2KB2 A;  4HH1 A;  3QGP A;  4KBI A;  3CJ2 A;  3H5Y A;  3N4W A;  3FQK A;  3HVR A;  2H65 B;  2ROG A;  2NSC A;  2YKN B;  1Y5I B;  4ZHR A;  1HQU B;  2HG4 A;  2VA3 A;  5DLW A;  2NRE A;  5A8K A;  4UY8 5;  1EET B;  3DMJ A;  3CDB A;  2QL9 B;  3DGP A;  2ASY A;  4MIV A;  5GME A;  5D4P A;  1HDH A;  4DR6 J;  2R7O A;  3HSJ A;  5EN1 A;  4DL2 A;  3O44 A;  5HQM A;  4C8M A;  2DR7 A;  2GVZ A;  2HFS A;  2AV5 A;  2GAG C;  4Y65 A;  3OHA A;  4LF9 F;  2F9D A;  3ZXW A;  1K0V A;  2BOP A;  1HNV B;  4DXL A;  2PT0 A;  4CT8 A;  5KTQ A;  1OIA A;  2VFT A;  2BVZ A;  2DPJ A;  3OD2 A;  1PSD A;  1RWX B;  2YWG A;  4YY3 J;  3PO4 A;  2L41 A;  2L9W A;  1QLN A;  1FJC A;  1PBU A;  3Q8P B;  4RW6 A;  2RRA A;  2HQG A;  3BDG A;  2OSQ A;  5D77 A;  2QZ8 A;  2VFU A;  1SJR A;  3H2V E;  2H4W B;  1SIW B;  2W2P P;  2VDH A;  5JJB A;  3MR7 A;  3NCQ A;  3UD3 P;  1UET A;  1SC3 B;  4WFB Q;  1APS A;  4LF6 F;  2OMO A;  4LFC J;  4ZLN A;  4ECR A;  4C8Y A;  1TMJ A;  1PC4 A;  3RBZ A;  3K8V A;  5C2G A;  1FK9 B;  2MGZ B;  1XJW B;  2VJU A;  1U8W A;  3M8Y A;  2FVR A;  3QZ8 A;  3OLB A;  3TX8 A;  1LV5 A;  2CPZ A;  1YKW A;  3DC2 A;  4J9N A;  3ITH A;  2OPP A;  3KK2 A;  4GRS A;  4A8M P;  2HK2 A;  2ZH3 A;  1PGZ A;  1FDB A;  4QQB A;  1CQN A;  2B51 A;  1MW7 A;  3CDW A;  2XMA A;  3BS9 A;  4RW4 A;  3SDE A;  2DHG A;  5KFA A;  1N33 J;  1TL1 B;  5EDW A;  3NGT A;  2VPX B;  1LW2 A;  1FI4 A;  4LIW A;  3JTP A;  8AT1 B;  2DIU A;  1U6B A;  2BE7 D;  2V4Q A;  3CJ4 A;  3DYA A;  1S0N A;  2V8D A;  1S1V A;  2IA6 A;  1SL1 A;  1M1K T;  4H4O A;  1CJK A;  2VPZ B;  1ZH5 A;  2XGP A;  3AB2 B;  1F5C A;  3WHI A;  5C2C A;  3CCV S;  4URQ U;  4OZ0 A;  4CXU A;  3V4M A;  3LP1 B;  1H74 A;  2L9N A;  4TU7 A;  5DM7 Q;  3EM1 A;  1IJF B;  2HRY A;  2IBK A;  1KLM B;  2EKN A;  3MM5 B;  4KE5 A;  2OPR B;  2DGT A;  4N56 A;  4B3R F;  1IVZ A;  2W8K A;  4WJB A;  4CH1 A;  2MEW A;  1S10 A;  2L3M A;  5K9F A;  4B56 A;  2DGS A;  2Q79 A;  4B3O B;  3NL0 A;  1I51 B;  3MMA B;  2PN6 A;  4CT9 A;  3PEH A;  1X4E A;  1ZAV A;  3NKQ A;  3QO9 A;  2FLL A;  2ZC4 A;  2WRM A;  5BYQ A;  5THW A;  1VK3 A;  4QR1 A;  1IM6 A;  4IG3 A;  4Y6I A;  2CZ4 A;  3TI0 A;  4Y00 A;  3VGT A;  4DSI A;  1OWX A;  1NDL A;  1U1L A;  5U47 A;  3MTK A;  2ZH9 A;  1T9Y A;  4IFY B;  1O98 A;  4I64 A;  3MXH P;  2JX2 A;  3QT5 A;  4G6V B;  4ETX A;  3M6W A;  4HH0 A;  4DV3 F;  4GMK A;  3CJ3 A;  4DR2 J;  5DGB A;  2QTW A;  2DT9 A;  5GAE U;  3HD1 A;  5E3R A;  3IG1 A;  4LRA A;  4DV5 J;  4M95 A;  1FJG F;  3PJW A;  5F8G A;  1Q4R A;  4DMZ A;  1D9F A;  2AZ1 A;  5D8H B;  1VMB A;  2LEB A;  5T14 A;  1CJT B;  1S0V A;  1H0H B;  5F8L A;  1HBO A;  2VAS A;  1V9O A;  2JJ4 D;  5I42 B;  2ZBI A;  4ED2 A;  1E6V A;  2H5I B;  3J81 U;  2OO4 A;  4FDI A;  2GZO A;  2QEX S;  1SI9 A;  2UV8 G;  1KH7 A;  3LA0 A;  1TMM A;  2BW2 A;  4Q7A A;  1JJ4 A;  1VYA A;  3K8W A;  3NGS A;  3DDN A;  2VQF J;  2RE1 A;  1DZ5 A;  3TNV A;  2MLY A;  3TEG A;  1AZS A;  2XMJ A;  4FBU A;  2YNI B;  3R3T A;  2EKY A;  1VQP S;  4AFF A;  4DOZ A;  3RW7 A;  3N79 A;  2HFZ A;  1FF2 A;  4ZK7 M;  3BGR A;  1MLA A;  2QO3 A;  2YX7 A;  2UU9 J;  2AEM A;  5HO4 A;  2B5J B;  1U0S A;  1BMQ B;  2EVZ A;  2V2Q A;  1G6B A;  4IH6 A;  1W2B R;  3RZA A;  3GTY X;  4NE9 C;  1RBO B;  1AA1 B;  2K1R B;  4D3G A;  3T1H F;  2ZNZ A;  3ENA A;  1TZ0 A;  3H90 A;  2VQR A;  1NME B;  4OX7 A;  3C2P A;  3IBC B;  2HGN A;  1BY9 A;  3C15 A;  3CCJ S;  2RML A;  3QWP A;  3CT9 A;  1GMW D;  2AW0 A;  1VQO S;  1CG2 A;  3LAN A;  4IG0 B;  1H2V Z;  2XMW A;  1Y3J A;  4DR3 J;  2BJ3 A;  4OJH A;  4ZP6 A;  3OL7 A;  2J0Q D;  2Y0B B;  2HYI B;  2BZ2 A;  3THT A;  2R7Q A;  1XR6 A;  1FFS B;  2XZD B;  5C25 B;  4UPI A;  5KFO A;  4M1K A;  1IWG A;  4X2B A;  2BRK A;  3HFK A;  5ETV A;  2J9D A;  2YWE A;  4OHV A;  2OEJ A;  1S59 A;  1C4C A;  3P8B B;  2XYP B;  4RNM A;  1MNE A;  4DV1 J;  3AQO A;  3B82 A;  4LRE A;  1CJU B;  3M7V A;  2N4D A;  4I2Q B;  5KFR A;  3SSQ A;  2LA6 A;  3W66 A;  5K14 A;  3TQE A;  2W4C A;  5LXY A;  3EX7 B;  2IIH A;  2OPS A;  3R7S B;  2E1M C;  2P2C B;  1TK5 A;  2JZ5 A;  4TY8 B;  1DFD A;  1NK5 A;  2FJX A;  2MYF A;  2UXB F;  2FJV A;  4ENO A;  3KHR A;  4YR3 A;  1YJT A;  3BO2 A;  4HT7 A;  3BM7 A;  2JEI A;  3TAR A;  3CIZ A;  3KLH A;  4IYQ A;  4DR7 F;  3TP2 A;  1U2R A;  4B17 A;  3GZ7 A;  4FYD A;  3SCL E;  1RWU A;  1ACM B;  3AJ1 A;  4NXM J;  3AOC A;  1HMV B;  3W2W A;  3DLG B;  1VIX A;  5K4P A;  4G1Q B;  4OX6 A;  4I7F A;  3LUY A;  1FHT A;  1HHQ A;  2Y1R I;  1NJZ A;  3VAK A;  1U1M A;  3Q8U A;  3TWZ A;  2E9R X;  1QUP A;  4LFA F;  3OUY B;  1ITP A;  2YX1 A;  4DPU A;  1BQM B;  3Q24 A;  3KTQ A;  7FD1 A;  3OXG A;  5L9X A;  3DOM A;  4IFV B;  3M05 A;  3CD0 A;  2BOA A;  3MK2 A;  3M32 A;  3RR7 A;  1LOU A;  3EPG A;  2LU2 A;  2F40 A;  3GSD A;  2DD8 S;  1E6Y A;  1HKA A;  1N8R T;  4FS1 A;  4EO8 A;  4ZS6 A;  2KT2 A;  3QZ7 A;  3ISZ A;  5GOV A;  3M2R B;  3Q86 A;  3EMT A;  4UW2 A;  1A0O B;  1TV6 A;  3HM9 A;  5C7P A;  1DUR A;  2IMW P;  2QFI A;  2N4C A;  3CO0 P;  2MKH A;  4LIR A;  4BBY A;  2B6A A;  1RQ0 A;  2FJA B;  5T7L B;  1V3S A;  3BPD A;  2QLF B;  4F67 A;  2VC1 A;  2UXC J;  5AE3 A;  3AB4 B;  2IDE A;  3HHL A;  3KJV B;  2V4J A;  3HFZ B;  5LJ3 Y;  4C3L A;  2CPI A;  3TJ9 A;  2XZT B;  3BGO P;  2QMX A;  1YVF A;  1PO6 A;  1RWW B;  4YR1 A;  2HLU A;  2IRY A;  1S9F A;  4NXN J;  2LKZ A;  1O0P A;  4P74 A;  4GVB B;  1P6T A;  2MHE A;  1UFW A;  2B0G A;  2YNG A;  3OR2 A;  1S76 D;  4OJ1 A;  3FCV A;  1JKH B;  2ACM A;  3BV8 A;  2ZWP A;  1VRT A;  3I55 S;  4JYA J;  3NBP B;  2VUG A;  5D4O A;  4KFB B;  2E5H A;  1WKK A;  2XS2 A;  4IOC Q;  4DR4 J;  5I3Q A;  3D9B A;  4WU2 A;  4DFP A;  5D0E A;  3JSB A;  1VQS A;  3JSM B;  2PMH A;  1PAU B;  2QLX A;  1S7I A;  1RWK B;  2LMI A;  1W2I A;  4LR9 A;  3VQS A;  1SHQ A;  3G6Y A;  1X0P A;  1KHW A;  1OPI A;  5ITH A;  1FO1 A;  4Q45 A;  3PV8 A;  1UVJ A;  3PYD A;  4DV4 F;  1FVS A;  3FZB A;  2H5E A;  3U02 A;  3TUP A;  4UOF A;  1HQU A;  5RUB A;  3GJR B;  1Y6V A;  5D78 A;  2DNZ A;  3L7O A;  2RHS B;  3Q22 A;  3X3U A;  1K8A T;  1EET A;  4NLR A;  3G71 S;  2BUN A;  5HQ8 A;  3NGK A;  4HI1 A;  1YJR A;  1U8S A;  3UDE A;  1TP7 A;  1BQN B;  1OSC A;  3PCO B;  5LJ5 Y;  5BR8 J;  3SQG B;  1Z1Z A;  5L46 A;  3LO3 A;  2VKZ G;  2AX1 A;  1GQE A;  2P9E A;  2V5H G;  4KY3 A;  1RT1 B;  1HNV A;  4YDX A;  1P27 B;  2HNY A;  2BQU A;  2CQI A;  1Z2L A;  2MKI A;  3HHL C;  4DN9 A;  4USK A;  2LXI A;  1OY8 A;  1ELZ A;  3FEX B;  1TL7 B;  4B9U A;  3IRX B;  5ETL A;  3M2V A;  2JC1 A;  2ZH7 A;  5L1I A;  1S12 A;  5ETN A;  1FWP A;  4JBC A;  3J7Y I;  4OZ1 A;  4RW9 B;  2H4Y B;  3G8T A;  1ED8 A;  3AJD A;  3O8W A;  3CCE S;  4DSF A;  5A8W B;  3T1A A;  4OZJ A;  2R42 A;  3H40 A;  2XEX A;  1YQH A;  1FK9 A;  3N5F A;  3KKF A;  1XIQ A;  3HDS A;  4E8U A;  2ZFH A;  4KB7 A;  3G2X A;  1S57 A;  4RW7 B;  4X62 J;  1EW2 A;  2ASD A;  2MQQ A;  3MEK A;  3I5C A;  4ZDN A;  5C66 A;  1HW8 A;  2W2Q P;  5B0G A;  3MPD A;  2LQB A;  3V6K A;  3Q8R B;  2VB6 A;  4XPC A;  3QFH A;  2BJE A;  4YB6 A;  1WKJ A;  2DY1 A;  1VGY A;  1IM4 A;  2YWH A;  1TL1 A;  2VQE J;  3OJU A;  4PYA A;  3WC0 A;  1KDN A;  4F7V A;  2GMH A;  4L72 B;  4ES2 A;  2UUC J;  3ETO A;  1NZ8 A;  3IWL A;  4O3O A;  5J1E B;  1TL3 B;  2QLB B;  2QX0 A;  1KN6 A;  4K7Q A;  3BRE A;  2K7J A;  1Q81 T;  4C3K A;  3X1L B;  2VBZ A;  2DNH A;  2RQC A;  1KVJ A;  4F4W A;  4RWW A;  1NRK A;  3RB4 A;  3B6B A;  5DZ7 A;  3MM9 A;  4Y2A A;  2V63 A;  4ED0 A;  3LP1 A;  3DRS B;  2DBB A;  4X66 J;  5DG9 A;  2XG8 A;  5KFZ A;  3CJR A;  4H4M B;  3FRY A;  5KG0 A;  3IGY B;  3FMW A;  1KLM A;  3MM5 A;  2OPR A;  4KTQ A;  3I0S A;  4AL5 A;  2OTL S;  3QPI A;  2EPI A;  3LP2 A;  1S1T B;  4B3O A;  4DF4 A;  4X4O A;  4U6P A;  5FII A;  3MMA A;  4J9Q A;  3DHW C;  1SL0 A;  3GWC A;  3OVB A;  4MIW A;  4A8X A;  4K59 A;  4JI2 F;  4HYK A;  2DO0 A;  5IXU A;  2ZZT A;  4ZPT R;  4DUZ J;  3LPE A;  4QIG A;  2GJ2 A;  3L4B C;  2P9C A;  2DHH A;  1PYT A;  5LIA A;  1XN9 A;  3SQO P;  4LF4 F;  2OP5 A;  1L3S A;  1HWJ A;  2G0J A;  5ETM A;  1N32 J;  2OSR A;  2R2T A;  4IFY A;  3HF5 A;  4U9R A;  5AJ9 A;  2IRX A;  1S1X B;  3OSP A;  4QR0 A;  3GFZ A;  1XWL A;  1AB8 A;  2E1P A;  4Q44 A;  2DNN A;  1WSV A;  5KFQ A;  3ZZO A;  2HNZ B;  3K59 A;  3NVL A;  2W5V A;  1UFK A;  4LBP A;  2X1G A;  4OLO A;  3KLF B;  1T3O A;  1N2L A;  4C8L A;  3MR6 A;  1Q78 A;  3AT1 B;  1HNW J;  1ZM4 A;  2BM1 A;  1TKD A;  5KG7 A;  2R4F A;  1U02 A;  1CJT A;  2F1F A;  3OTO J;  1VQ9 S;  3I32 A;  3D67 A;  5IJQ A;  2RIL A;  5I42 A;  1X4D A;  5J2Q B;  3PR4 A;  4DR6 F;  5KFN A;  4NZ6 A;  3B78 A;  3QJP A;  1VDH A;  3CMQ A;  1XR5 A;  1QAY A;  3D3C J;  1Y00 A;  2RJZ A;  2IVF B;  5CAA A;  3H98 A;  2BXJ A;  4OZN A;  4NLD A;  4N8N A;  4WZQ A;  3P3D A;  4FKY A;  2MLZ A;  2YNI A;  3NXZ A;  3E2E A;  2QYC A;  2W5W A;  1CLF A;  1PAE X;  3B4D A;  1WG1 A;  5F8I A;  4DG1 B;  4GTX A;  2G13 A;  2FVP A;  5AE2 A;  4J9O A;  1GMU A;  3FEZ A;  4H4K A;  1Q82 T;  4MY4 A;  4CO2 A;  1SKS A;  3KK1 A;  3L7U A;  3OSN A;  2B5J A;  1ZPW X;  4ES1 A;  5AT1 B;  2XGQ A;  4ECX A;  3PRB A;  1M1H A;  1QE1 B;  3J7Z 5;  3JS9 A;  3TZZ A;  2YKP A;  2M7S A;  1SHN A;  1QSL A;  2K1R A;  3MR3 A;  3K89 A;  2HGL A;  4NLV A;  2W1B A;  3GCX P;  4WP3 A;  3VHQ A;  1LXJ A;  1TK0 A;  1I3O B;  5GAH I;  2XRG A;  1FX2 A;  3MF5 A;  3QIP A;  1HI1 A;  3DOL B;  5CCM A;  4QU7 A;  1FE4 A;  3M9N B;  5LSL A;  2MLX A;  1BGX T;  4WTO B;  4UY8 T;  4B3S J;  3CCL S;  1WC6 A;  4FP9 A;  4O4G B;  3EYZ A;  4P75 A;  3CWJ A;  4XK8 C;  4IG0 A;  3J7Y U;  2LYV A;  4FXV A;  1X9W A;  1W7W A;  4RUH A;  3D54 A;  3O2I A;  2B9Y A;  1TKZ B;  1QDU B;  4I68 A;  3BSC A;  2NPI A;  4C8K A;  3PHE A;  2IHR 1;  1WC0 A;  5BYR A;  4NA3 A;  1AJA A;  3TEH B;  5C25 A;  3TUZ C;  5GRR A;  2DGX A;  2AMC B;  1MU2 B;  4PR6 A;  3NP5 A;  2A2D A;  3K5N A;  1TTH B;  2LQ8 A;  4FF2 A;  4DX6 A;  4M5L A;  4F02 A;  2L9D A;  1URA A;  3G6E S;  4FYX B;  1D3W A;  1SJ1 A;  5DDO C;  2LDI A;  5JUM A;  1RAE B;  4AQY F;  1L3U A;  2ZZM A;  5KOW A;  1YJ7 A;  1JLG B;  3C8Y A;  1CJU A;  2W9B B;  1SXL A;  2DHA A;  2GS8 A;  4I2Q A;  1H72 C;  3KHH A;  2MZS A;  1VRQ C;  2J5A A;  4JI3 F;  4FN5 A;  1X60 A;  3BYR A;  5KG4 A;  1R7I A;  4TY8 A;  1J5E F;  4C0H A;  3IMQ J;  5CHC B;  4ZCI A;  4LF7 J;  2KT5 A;  3BH6 B;  2DPI A;  1BXN A;  2XSF A;  5CYM B;  2IVY A;  2AEJ A;  4IOB A;  2DRA A;  1NDP A;  3MI7 X;  3VVU A;  4K4Z A;  1GFW B;  2XC9 A;  2HAF A;  1LEO A;  2BKP A;  2XMM A;  2V8P A;  3A13 A;  1W26 A;  3NKY A;  3TO8 A;  4WYW A;  4LSL B;  2HFN A;  4I1T A;  3PO5 A;  2W7O A;  4DPW A;  3DI6 B;  5F9L A;  4Y34 A;  3OPK A;  2DK2 A;  3UNY A;  3GU0 A;  3DLG A;  2CG8 A;  4G1Q A;  4A8S A;  3GJS B;  2CQD A;  3OBI A;  3DPC A;  2J8A A;  4C8O A;  1WOP A;  2AKW B;  3M30 B;  2XS5 A;  3JQM A;  4CM2 A;  5CZV A;  2HQD A;  2HIY A;  1BQM A;  4UF4 A;  5HVH A;  1FNO A;  1EI6 A;  4IFV A;  3KMS A;  4ELV A;  3D4J A;  3DFE A;  4J9S A;  3K5L A;  5LMU J;  4B9T A;  3PKY A;  4UOR A;  5J2P B;  3WAY A;  2FYX A;  1VJQ A;  1U7L A;  3MK0 A;  2AJ0 A;  4DV5 F;  3QSY B;  3Q8Y A;  2BW7 A;  2R7S A;  2XO6 A;  4KPY A;  1X4A A;  3GJQ B;  1HNX J;  3M2R A;  1MMD A;  2BDP A;  2X98 A;  3M8Z A;  1X4F A;  1GXL A;  5B7W A;  3G8S A;  1KTV A;  1QAI A;  4MK9 A;  3R6L B;  5L0B A;  2UVU A;  5T7L A;  1NLK L;  4DF8 A;  3CME S;  3G6X A;  1Q5Y A;  4JI5 F;  1IQT A;  2E44 A;  4V19 X;  3IR7 B;  3L9Z A;  1UEV A;  3BEG B;  2G4B A;  1KHK A;  2X1A A;  3CUL A;  3UR0 A;  2MZR A;  4MIB A;  3KJV A;  1C2P A;  4LSN A;  4ECW A;  4AT1 B;  2CJQ A;  2RDD A;  1IN0 A;  4DL0 C;  1GMW A;  4LUB A;  3EPI A;  5HMW A;  2ZH5 A;  3ADA C;  3DU5 A;  2ATC B;  4J37 A;  2R3V A;  4ED5 A;  1DTQ B;  1SV5 B;  4GVB A;  3RW6 A;  1HWU A;  1UVL A;  3M8R A;  2VA2 A;  1KVK A;  3F56 A;  4QW8 A;  2MJU A;  3HVT B;  1RT3 B;  3M9O B;  1JKH A;  3V4I B;  4LBH A;  1S6P B;  1UVI A;  3JYT B;  4AYB D;  3HCX A;  1WC3 A;  3NBP A;  3SEO A;  4KFB A;  3ZTR A;  2C2E A;  4CLU A;  4LMZ A;  2CWK A;  5EUH A;  1DRZ A;  2Z2Y B;  3TR5 A;  2OD4 A;  5HQL A;  1HA1 A;  2JRS A;  3Q23 A;  4DR5 F;  3DN9 A;  3W9J A;  4ECV A;  2XR9 A;  4DX8 H;  2KVQ E;  4J91 A;  3JSM A;  4NYO A;  3QID A;  1XK8 A;  4KSE B;  2W2M P;  5K8M A;  3LAL A;  3GYG A;  4ZP8 A;  4FS2 A;  5KG2 A;  3IM8 A;  2J0S D;  4DI6 A;  2OUG A;  3ENW A;  3FMB A;  1KLN A;  1WTB A;  1FRJ A;  1B0V A;  2LQJ A;  1DJ0 A;  2QG9 B;  2PDA A;  3KHG A;  1C0T A;  2C28 A;  2IBO A;  4TLR A;  2E7V A;  2RVJ A;  4KIA A;  2KJW A;  4MKV A;  2N7Y A;  4K0K F;  2BJ9 A;  3RGI A;  4DCO B;  4Z37 A;  1UA0 A;  3BF4 A;  3F44 A;  3MR5 A;  2JEF A;  5GAH U;  1DY3 A;  2FY1 A;  3PYE A;  1O51 A;  2W5T A;  3SQG A;  2X1F A;  2G2O A;  2WW4 A;  2DNQ A;  3CCQ S;  1RK8 A;  1RHM B;  3A12 A;  1RT1 A;  1Q95 G;  5KFK A;  1YIJ S;  3OFE A;  3PIO Q;  2VBW A;  2RDI A;  5IQQ A;  5ETT A;  4MH8 A;  4OYB A;  4LF1 A;  5EHH A;  1SJ4 P;  3CC7 S;  3OHB A;  3KYL A;  4OV6 A;  4USI A;  1TL7 A;  3U1L A;  4K4W A;  3GON A;  4LQY A;  4WF9 Q;  1XMQ J;  4Y0F A;  3QLH B;  4RW9 A;  3M6U A;  2VC0 A;  3MPY A;  5A8W A;  2KM8 C;  3CE8 A;  1RTH B;  3FK4 A;  3BJY A;  3N6N A;  5LQQ A;  4UOC A;  1ZOT A;  1NDK A;  3KG1 A;  2VHG A;  4GTY A;  4RW7 A;  4FYW B;  3GR0 A;  2CNN B;  1IKY B;  4M5J A;  4RNN A;  1WG4 A;  2XO7 A;  2XB2 D;  3MAQ A;  3FZ2 A;  4ZJL A;  3QJJ A;  1JB0 C;  3HZG A;  5IM0 B;  3GIL A;  1WC1 A;  2PMW A;  2M70 A;  2IY5 B;  5KFX A;  2KFN A;  5EWE A;  4Z7Y A;  1E2S P;  4ZVT B;  4EI2 A;  4JV1 A;  3H4D A;  4FYV B;  1HWL A;  1RWN B;  4PPD A;  3CCU S;  3LWM A;  5KXA A;  2AEF A;  1HIY A;  2XI2 A;  3OT9 A;  1RTD B;  2EK1 A;  2Z0G A;  4ZHR B;  2QE5 A;  1GK8 A;  5LOQ A;  4OFZ A;  4NLO A;  4MAK A;  2DNG A;  2FZC B;  2KXH A;  1HNZ J;  3DMJ B;  3UN3 A;  3FBB A;  1TL3 A;  1HHT P;  1FDA A;  2MMY A;  2HWT A;  5JXS A;  2G2Z A;  1G2E A;  3HJF A;  2FQQ B;  2YTC A;  4UOH A;  2F8H A;  2KT3 A;  3EZO A;  2GVZ B;  4P71 A;  1WI6 A;  3VAH A;  4B3T J;  3RRH A;  3DRS A;  3DLL Q;  1Y0H A;  1XMO F;  2IA0 A;  4YFU A;  3HHD A;  2JH3 A;  2EWH A;  1IKV A;  2CPY A;  4J9R A;  1OYE A;  4CNZ A;  2OPQ B;  4DSJ A;  2LA4 A;  4J9U E;  4USJ C;  3UDL A;  2VF3 A;  2W9C B;  3BDG B;  1NPR A;  3FUY A;  1S1T A;  2Z4P A;  2Z30 B;  2HBR B;  2YNF B;  3W62 A;  2XNR A;  3EGZ A;  3CJ0 A;  5F3T A;  1YRU A;  1O5J A;  2NXC A;  4ZP9 A;  3KD8 A;  2VKR A;  1JQG A;  2GA3 A;  3EE3 A;  2BM0 A;  2V2K A;  2G9O A;  2QA4 S;  4LJM A;  4F26 A;  2DNR A;  1KVI A;  1U1N A;  4GC6 A;  1VQM S;  4EBD A;  3MUR P;  4DR4 F;  1U24 A;  3WBZ A;  4GKK J;  1N36 J;  2NZC A;  2BAC A;  3ZO7 A;  4IUF A;  4HEA 9;  3GCW P;  1DAR A;  3HJV A;  3MD1 A;  2OPP B;  1VLY A;  3TAN A;  2XLK A;  1S1X A;  1L3K A;  2IDL A;  4KAI A;  2CQG A;  2FB0 A;  4F0M A;  1IQZ A;  4KJG A;  4LQ3 A;  2HNZ A;  4RW4 B;  3DRY A;  1D9A A;  3TG0 A;  4LF5 J;  1YSJ A;  3C46 A;  1H3D A;  3KLI B;  3OVA A;  3KLF A;  1KC8 T;  5DDQ C;  3DXS X;  4F2R A;  1UVK A;  5EGE A;  2Q6C A;  3DYA B;  3MMJ A;  1NK6 A;  2MQM A;  2W01 A;  3DM2 B;  1RHR B;  2RQK A;  2B4U A;  5J2Q A;  3I6P A;  2GO8 A;  2D7S A;  4H4O B;  2LQ5 A;  4YB7 A;  2PSZ A;  1YZ7 A;  2DY9 A;  2ATL A;  1JNZ B;  1NB7 A;  4TYB A;  1U1K A;  2RH6 A;  4X84 A;  3UQS A;  3BR9 A;  3AHP A;  1DQ8 A;  1M5V C;  2DR6 A;  5HVG A;  2Y9H A;  3C16 B;  1NSP A;  3MEE A;  1S4F A;  3D1O A;  2V2Z A;  3J81 Y;  1M0S A;  1UEU A;  1RAA B;  1DBD A;  2B9E A;  1RIS A;  3CJ8 A;  4CCH A;  4YB1 P;  2VG7 A;  5HK4 A;  3T6J A;  2JDJ A;  4G1I A;  1PYS B;  3LP0 B;  1T9U A;  3D66 A;  3MED B;  4K5S A;  1JLF A;  1TR0 A;  4RNO A;  1LFP A;  3VZH A;  3QO9 B;  1AJB A;  5HJX A;  2NQP A;  1VOM A;  4K2X A;  1NJY A;  1EAY C;  3ET6 A;  3NKO A;  2CXE A;  2BKO A;  1CJV B;  3MCM A;  2ZD1 B;  4IOA Q;  3UNG C;  3K5O A;  3NKM A;  3GII A;  2M0G B;  2HMI B;  3DOL A;  3DLK B;  4Y2C A;  4TQS A;  5LRM A;  4LF8 F;  1P9Q C;  3HHN B;  4NAS A;  1I94 F;  2OHD A;  2HWI A;  4O4G A;  4NML A;  3T00 A;  1S5Z A;  3S7R A;  4FNI A;  1VC5 A;  2ZKT A;  2XHC A;  3NOC A;  1KQS R;  3CW2 C;  4P6Q A;  1TKZ A;  5CH7 B;  3AH6 A;  2WCX A;  2NPF A;  3DLJ A;  4QCL A;  4DL7 A;  2HBZ B;  2R2S A;  3ISN C;  2HND A;  1HFE L;  3R2D J;  1MU2 A;  3TVY A;  2RRB A;  3KUH A;  3LAM A;  3U7J A;  2UUA F;  3ULH A;  1S6O A;  2VOO A;  2GMJ A;  2AIR B;  4BHQ A;  4ZCM A;  4LFB J;  8RUC A;  5LSO A;  5IC6 B;  2QMU B;  3FFI A;  2FVC A;  4N77 A;  2CQ1 A;  1J2V A;  5ETP A;  3G9C A;  3W3S A;  3D68 A;  4X66 F;  3BPS P;  4DV2 J;  1NH8 A;  4LRD A;  4A4J A;  3W61 A;  4TN2 A;  1FA0 A;  3T41 A;  4QIE A;  5KFD A;  2MQP A;  4PAB A;  2KTQ A;  1S9E B;  5T41 A;  1UTA A;  4UPK A;  5CYM A;  2ZKU A;  2XM3 A;  1AW0 A;  1D8Z A;  1SKR A;  1WOO A;  3BGR B;  3DCA A;  2NXE A;  3QAE A;  2JLF A;  1T0T V;  1WF2 A;  1Y4Z B;  3LH2 S;  2W24 A;  4LSL A;  2O66 A;  5A2Q U;  2EXU A;  2JLG A;  4N8O A;  3HZE A;  3PKM A;  2HHX A;  4WBF A;  1RU2 A;  3DI6 A;  1FEE A;  2D41 A;  4BCA A;  1FTC A;  1ARO P;  1PCA A;  3H7H B;  3ZNJ 1;  2HHH J;  1TQL A;  2ZHO A;  2LDY A;  1WSR A;  2F8M A;  4DLE A;  3D6M B;  4A46 A;  2Y0S D;  1TEL A;  2UV8 A;  3TAQ A;  3DDK A;  2BA9 A;  4NLT A;  3RRG A;  5DS7 A;  2UZA A;  1E1Z P;  2GAH C;  3HHL D;  5K8P A;  2PEH A;  3ILO A;  2PI4 A;  4QOT A;  1Z2Z A;  2CDQ A;  4YUD A;  4QU6 A;  3A52 A;  5J2P A;  1H7W A;  5DDR C;  3MAA B;  1Y11 A;  2V6A A;  1RT2 B;  4USV A;  4B9M A;  2M3D A;  1VQK S;  3C6U B;  1RHQ B;  1QTM A;  2QN6 B;  4DFJ A;  1IBK J;  2UUB J;  3EIC A;  5AJ3 F;  4OV1 A;  1ZYQ A;  1KQG B;  5E5N A;  2DKO B;  5KFW A;  2KHD A;  3DDI A;  1RLD A;  3TQ1 A;  1MG7 A;  4PKD B;  2QA4 G;  1ZAX A;  4DU7 A;  2Y8Y A;  5KFS A;  2IYI A;  4QPT A;  1R31 A;  3TOQ A;  2MST A;  3T3F A;  3J80 U;  3JTN A;  2VOD A;  1EP4 B;  3A3N B;  2HS0 A;  4YDD B;  3EXY A;  2I5J B;  3CCW A;  2EFV A;  5LM7 E;  5C5J A;  2W8S A;  3UD5 A;  2XCA A;  1F1B B;  3P49 B;  2AJ4 A;  2R2R A;  4NWB A;  3KLH B;  1RAJ A;  5SUH A;  4IH7 A;  4F36 A;  4RBT A;  1HJK A;  2DNM A;  2AJF E;  2BE2 B;  3HVT A;  4UOP A;  4KGV B;  2XQC A;  5DDP C;  1ZZN A;  3V4I A;  1KH4 A;  4DFM A;  5D15 A;  1Q8L A;  3JYT A; 
#chains in the Genus database with same CATH homology
 1Y6V A;  3MK2 A;  5DLV A;  1KHJ A;  2RH6 A;  1KHK A;  3Q3Q A;  1AJA A;  4B56 A;  5GRR A;  4KJD A;  4MY4 A;  4GTZ A;  4UPH A;  5DLT A;  1ALK A;  4LQY A;  3T00 A;  3BDF A;  3NVL A;  1AUK A;  2W5V A;  3DPC A;  4QAX A;  4FDI A;  1EW2 A;  3T01 A;  3UN3 A;  1Y7A A;  4NWX A;  2ZKT A;  2VQR A;  1ELX A;  4KAV A;  1URA A;  1KH7 A;  4CXS A;  4LR8 A;  5C66 A;  1FSU A;  3ED4 A;  4N7T A;  2GLQ A;  1N2L A;  1HQA A;  3WAV A;  3NKQ A;  1ZEF A;  3SZY A;  3IGY B;  1KHN A;  2QZU A;  3BDH A;  2GSU A;  2IUC B;  3IDD A;  3UN2 A;  4ZG9 A;  5HRT A;  5GOV A;  4CYS A;  5IJS A;  1P49 A;  1EI6 A;  3T02 A;  3M8W A;  1SHN A;  3BDG A;  1ZED A;  4LR2 A;  1E33 P;  4LRC A;  5LQQ A;  1URB A;  1ALH A;  4UOR A;  5IJQ A;  1KH9 A;  3NKP A;  3WAY A;  1ED9 A;  3IGZ B;  1ANI A;  2W8D A;  2GSN A;  4KJG A;  4GTY A;  3MK0 A;  4CYR A;  3E2D A;  2IFY A;  1ANJ A;  3CMR A;  4GTW A;  3TG0 A;  2W5Q A;  2W5R A;  3UO0 A;  1O98 A;  4CXK A;  2W5S A;  4KM4 A;  5TJ3 A;  1E1Z P;  2G9Y A;  1ELY A;  1ZEB A;  2D1G A;  2XRG A;  3LXQ A;  5INH A;  4ZGA A;  1ALJ A;  1O99 A;  3B5Q A;  4UPL A;  3NKN A;  3UN5 A;  5K4P A;  2IUC A;  2W5T A;  1AJB A;  1KHL A;  4LRB A;  1KH5 A;  5EGE A;  5DLW A;  1ELZ A;  4KAY A;  4CXU A;  4UPI A;  1N2K A;  5LIA A;  2W8S A;  2X98 A;  3M8Y A;  3M8Z A;  4LR9 A;  2W5X A;  3BDG B;  1E2S P;  4LRF A;  4ZG6 A;  4ZG7 A;  1SHQ A;  5LRN A;  3SZZ A;  3MK1 A;  5L0K A;  4NWJ A;  3A52 A;  1ALI A;  4LRD A;  3NKO A;  1K7H A;  5EGH A;  1EJJ A;  1EQJ A;  1AJD A;  1EW9 A;  5L0E A;  4LR7 A;  3TWZ A;  1AJC A;  4LRA A;  1HJK A;  3DYC A;  1EW8 A;  4MIV A;  5KXA A;  4FDJ A;  1ED8 A;  5L0B A;  1HDH A;  2W5W A;  4UOO A;  4TN0 A;  3OT9 A;  1B8J A;  4UOP A;  3KD8 A;  2ANH A;  3TX0 A;  2GSO A;  1E3C P;  3NKM A;  4MHX A;  5AJ9 A;  4YR1 A;  4LRE A;  3UNY A;  4UPK A;  1KH4 A;  3WBH A;  3WAW A;  2GA3 A;  3M7V A;  3WAX A;  3NKR A;  2XR9 A;  5LRM A;  4GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...