4LR7A

Phosphopentomutase s154a variant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 142
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr7A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr7A01
3MK1A 5LIAA 2W5VA 1B8JA 1AJAA 5LRMA 4LRBA 1KH9A 1KHKA 4UPKA 4ZGAA 1AJCA 1P49A 1E33P 1KHNA 5DLTA 5L0KA 1ELYA 3TWZA 2GA3A 2W5WA 3BDHA 4YR1A 4LR7A 4KJGA 1ALJA 4NWJA 1ZEDA 3TG0A 1URBA 4UPLA 3M8WA 1KH7A 4UOPA 2W5QA 3CMRA 4ZG6A 4UOOA 5K4PA 1HDHA 4LRCA 4KJDA 1SHNA 4KM4A 4N7TA 3A52A 4MHXA 2GLQA 5LRNA 3SZZA 1ALHA 3IGYB 1ALKA 1ANJA 2GSNA 1ED9A 4CXSA 2W8SA 1N2LA 1K7HA 4FDJA 1SHQA 4GTZA 1Y7AA 3MK0A 3WAXA 5IJSA 3UN5A 2X98A 5DLVA 5C66A 3B5QA 5GRRA 3UN2A 4FDIA 4CXUA 4QAXA 4LRAA 3T02A 1ZEBA 4LRDA 2XR9A 1EQJA 3NKPA 1HQAA 2IFYA 1HJKA 1E2SP 4ZG9A 2G9YA 2D1GA 4LR9A 4GTYA 2RH6A 1ALIA 2GSUA 1KH4A 4LQYA 5LQQA 1Y6VA 2IUCA 3MK2A 3OT9A 4GTWA 4KAYA 4LR8A 3E2DA 1ANIA 1ZEFA 1E1ZP 5L0BA 4LR2A 2W5SA 3NKMA 3Q3QA 4UORA 3DPCA 1EW8A 4NWXA 2ZKTA 3NKOA 1N2KA 4TN0A 5DLWA 3NKQA 3KD8A 4KAVA 3ED4A 5IJQA 3IGZB 3BDGB 5AJ9A 3WBHA 5INHA 1AJDA 3M7VA 1ED8A 1FSUA 4UPIA 1EJJA 3DYCA 3M8ZA 3WAWA 3NKRA 4LRFA 1KHLA 3BDFA 3UN3A 1O98A 2W5RA 3LXQA 5TJ3A 3IDDA 2W5TA 5KXAA 3UNYA 3T01A 4LREA 1E3CP 3M8YA 1ELXA 1ELZA 5EGHA 1O99A 1AJBA 2QZUA 3T00A 5L0EA 4MIVA 3UO0A 1EI6A 3WAVA 2VQRA 4MY4A 2XRGA 4B56A 2W8DA 4UPHA 5HRTA 1EW2A 3BDGA 3WAYA 3SZYA 5EGEA 4CXKA 2ANHA 3NKNA 1KHJA 5GOVA 1AUKA 3NVLA 4CYSA 4CYRA 1KH5A 4GTXA 2IUCB 2W5XA 4ZG7A 1URAA 3TX0A 1EW9A 2GSOA
chains in the Genus database with same CATH superfamily
3CGIA 2BXJA 3MEDA 1UMJA 4CT8A 2IY5B 4WBFA 4MKYA 1GXUA 1MSWD 5HQLA 3HZEA 1SC4B 1VQNS 2YQ0A 3KLIB 2ERRA 1FJGF 1YSJA 1GMWD 5KG3A 2JRSA 2XG8A 4IOBA 1UA0A 4ILRA 1BWVA 1JB0C 1KP6A 2OI2A 1RGVA 1ZA2B 3P8BB 1GH8A 4NWJA 4QW8A 2MKHA 3OVAA 4G3IA 3I9ZA 2EBGA 3GIJA 1U4BA 2PEHA 4JI4F 2RQMA 4I56A 3K59A 1QSLA 3DMJB 4DZDA 2WVFA 2HHHJ 3CMRA 2OMLA 3GYXB 2V34A 2X1GA 4LRCA 3TP2A 4A47A 2VV5A 2IM0A 5ETNA 3JAMY 5IS2A 2X1AA 2W9BA 4LF9J 1P27B 2E9TA 2CADA 1RKJA 1LW0A 1TK5A 3OFGA 1NK9A 2R8GA 3EJMA 4ANDA 4ZOSA 1M1HA 4EFAC 2RSQA 3FCWA 1B7YB 1RTHA 4PWUA 4RW6A 2AZ1A 2CDRB 4MMOA 4O3NA 1HWJA 3IBWA 3P4UB 4EGLA 1JLFA 5HBMB 4DF8A 1K7HA 4FDJA 4JUZA 2WONB 2ZBRA 3J80U 2CJQA 2O5DA 4IO1A 3U27A 3RW6A 2W1BA 1HWLA 4ED7A 5EX3A 1ZAWA 4WKRA 2IJNA 2HWTA 3BS9A 3UN5A 4CLSA 1Q7LB 1FHTA 1B0PA 4TYAA 1SV5A 4DLGA 2HVEA 3JTOA 5HLFB 5AJ3J 1XNRF 3TR5A 3NOCA 1IKYB 3IRXB 2XB2D 3GB0A 3C6TA 2KB2A 3VGVA 3HM9A 1N33F 2XR9A 1YVFA 3AXKA 3U7JA 3CCZA 3T1AA 4GKKF 4M94A 3OXGA 1ALHA 3PFOA 2MZJA 5I42B 2GGPA 5LQQA 2VJVA 1QDUB 2VASA 2EK1A 2CVIA 3GJRB 5EDWA 2E5IA 3CMES 1FJ7A 4GTWA 2UXCJ 4NWBA 1RHRB 3MECB 4F50A 8ATCB 2M9KA 3KG0A 3E2DA 1SC1B 3LGHA 2ZFHA 2RVJA 2LXIA 2LP4A 1LXNA 1WI6A 3DHWC 1UJ5A 2VONA 1QD1A 5A8KB 3NKMA 1ZAVA 3NLCA 3MI7X 3DLBA 1VRUA 4NLPA 2XEXA 4MIBA 2YNFA 3QWUA 1VQOS 2GNKA 3CMAS 2CWXA 2RE1A 4DL3A 2HZVA 1IKVB 2DIVA 1N6QA 3DC2A 4U8YA 1FX2A 2WK4A 5AJ9A 3MAQA 4JI0J 2O01C 3OXFA 3PYFA 2P6SA 1HNXF 2WB1D 3Q8YA 4CH0S 1TU0B 5F41A 5IV4A 5T7LA 1FFSB 4ETZA 4DR1J 3NNHA 4B9TA 4UOGA 1HBNA 2D9PA 3R5CA 3TAQA 3ZO7A 1L3VA 1E6YB 5F9LA 4B3TJ 1T7PA 3DOMA 3CJKB 4DV7J 2YH0A 3W9IA 4N5SA 4HTIA 2RRAA 1MN7A 2CPEA 4NCAA 4KE5A 2RHSB 1ZM3A 1N5YB 4A8XA 3LUYA 1F3VA 2DXEA 5D15A 4I7FA 1RAEB 4AD6A 3KJQB 4M5IA 3M8YA 4KH0B 2XC9A 5EHHA 7FDRA 2PMHA 2AJQA 2DRAA 2UU9F 4JI7F 2QV6A 3WIVA 3BH6B 1UWBB 1SH3A 3MEEA 3TQ1A 2VA3A 2D1CA 4G6VB 1UW4A 3GR0A 2UV8A 3IG1A 2Y1LB 2E1AA 3MMCA 4M5GA 3ILLA 3HXMA 1KRPA 5EGEA 4N47A 1I3OB 2C22A 5CD4A 2NS1B 2Y0BB 3ZXWA 4DPYA 1B0VA 3MM9B 2JH3A 2JVOA 4NLXA 4PR6A 1T3NA 5A76A 1VBZA 2EXUA 5JVGQ 3MTKA 1S12A 2P2CB 2DHXA 1WC3A 4LF1A 4ECVA 2M52A 5KFOA 2AJ1A 2VQFF 3RB4A 4CYSA 2ROGA 5ETSA 1KBRA 2UUBJ 1NHUA 1KH5A 1UZHA 2DNKA 1VOMA 1W2BR 2VG5B 2YKMB 1N6QB 1B8JA 1F9HA 1FDNA 3IWNC 1PKUA 4FPIA 1NDPA 1X0FA 3FEYB 2HQCA 3D6HB 1BHNA 1TTHB 1ZETA 4CH7A 1T9UA 3H98A 4HYKA 4DSEA 3TWZA 3TUJC 3QZ7A 4F36A 3H4BA 4BDPA 3DRPB 3BDHA 4OZ5A 1T95A 3DOKB 1MLAA 1V5IB 2ABYA 1ZPWX 4DL0C 1BC6A 1EETA 1RU2A 1WOOA 3CDWA 4PXBA 5D4NA 1CQNA 3LAKA 5DG9A 1WHXA 4CDIA 3S7RA 3M8WA 2C2NA 3SCJE 5HBMA 3HMJG 2BQ3A 1SL0A 1F6TA 2B9EA 2BE9B 2ZOGA 1U2FA 3TZXA 1I1GA 2DGSA 2Q79A 2N7CA 1FESA 3LQVA 1SJ4P 1B4SA 2RMLA 2UXDF 1SHNA 1BLUA 3R9LA 1DTTB 4CO3A 2WBRA 3VQSA 2DISA 5H9EK 4IKAA 1UWBA 2NXCA 1YZ6A 3CB4A 1NRKA 5KG0A 2GC8A 1I6JA 4O44B 1FXRA 1HQEA 3HHEA 4YR3A 3G6ES 4YMEA 2ANHA 2V4JB 1HI0P 2V2KA 1AUSL 1OY9A 4AXJA 2FVQA 1VDHA 2HBRB 2V8DA 2Z4PA 1GTEA 1Y10A 2P6TA 1BQNA 4XDCA 3DXSX 1HQ2A 4DCOB 2ACMA 2ZVSA 4ZIWA 2ZZMA 1ZAXA 2UZAA 2B4UA 1JJ2R 3MTJA 4RWWA 1YRTA 2ACYA 3JTNA 1MROA 2IM1A 2UUBF 4RL1A 4ED8A 5E5NA 3IWLA 4J9NA 4FF3A 4FXWA 4U96A 1T03B 2G9YA 3A3OB 1WG4A 2ZH1A 4ED6A 2Z8QA 4H4MA 4YR0A 1VR6A 2AGPA 4LQYA 3UD5A 1UW9A 1Y6VA 3PIPQ 5KG1A 2B7CB 2E5HA 2G4BA 4BWMA 4DQIA 2C2OB 4WFBQ 4RR5A 1JXVA 3CIZA 3TW0A 1C4CA 3EM1A 4B3SJ 3QIPB 3QRRA 2ZUGA 4S0MA 3UVJB 1XJWB 4PXDA 4E8UA 2OTLS 1JK9B 2A2DA 2ZKTA 1Y5NB 4Z37A 3J7YI 2MPUA 3KK1A 1IR0A 3CCUS 4WFXA 1JJHA 3ZNJ1 2YNIB 3DU5A 1UVNA 3QRPA 4OX6A 1FKOB 2CJAA 3Q83A 5KOXA 4J9PA 4OZLA 2RDJA 3PX6A 4EWTA 2LXFA 4ZPDA 2DD8S 4PQAA 3BM7A 1L5UA 5DZ6A 1QSYA 2R8KA 3P49B 1KVJA 4NWXA 4L3KA 5IM0B 5H9FK 4UPIA 4NLGA 4ZCMA 4DS5A 2GA7A 3QO9A 4G1QA 2C3UA 4X4SA 2XQCA 2ZBQA 4J9KA 4X4RA 1DRZA 4K50A 1RWKB 1E6VB 3N01A 5LMUJ 2C3MA 4RJVA 2GJFA 1B3TA 1YJNS 1LOUA 3IDDA 1SH2A 4PG8A 3D3CJ 1BQNB 1SJ1A 4JI5J 3J81j 2UUTA 3H0PA 5K14A 2JC1A 2VKRA 2W2MP 2LMIA 2XYHB 3MM5A 5ETPA 3KLHA 4R25A 2UVWA 2KZZA 1RHKB 3R3TA 3RAQA 2DPJA 4Y6IA 1QVFR 2AYMA 2W9AA 4R0JA 1SQGA 9RUBA 3GJSB 2HQDA 3FKBA 1N4LA 2DNQA 2OPQA 1VQ5S 1NEEA 3NAIA 4U7UD 3DHXA 1NLKL 4LQ3A 4PYAA 4Y2AA 2VH7A 3VAGA 1JLQB 5DDOC 3TOQA 4LFBJ 3MR2A 1W26A 2FJBB 4I1TA 2MB0B 2D9OA 3RYLA 2LA4A 1CJUA 3CPWR 4R8UA 3NKNA 3HZGA 4WYLA 1Q53A 5GOVA 3Q23A 3MPUB 4OYZA 3NRBA 1OS5A 2ILZA 1UVMA 3DRPA 2R2RA 1N36J 4QU6A 2KU7A 4WFZA 5KFDA 2AJ0A 4Q2LA 4DEZA 4X65F 1URAA 3KNAA 2HLUA 2UVRA 3OL9A 1MWZA 1X7VA 2FJDB 1MNEA 2HNYA 2XI3A 3ENVA 3I96A 1NJZA 4B3MJ 2DEIA 3T9NA 3BGOP 3SV4A 2FJVA 2ROPA 4DV1F 1MU2B 4OZ3A 4QJVA 3CT9A 4JI4J 2GVZA 2W5WA 1X5PA 3QAUA 4R5PA 3DRRA 3VAFA 3KUEA 2KXHA 3PHTA 2YWFA 3EICA 4C2MA 5F8LA 3KLFB 4LVNP 3KYLA 5H1SV 3SYZA 2QYCA 4XO0A 2QLJB 5K8NA 3LO3A 2A3JA 4UOPA 2XMVA 1REGX 3NWRA 5GAEI 5KFMA 2DO0A 3W8PA 2H5JB 3NMAA 3O6QA 2ZZTA 1RBOB 2CQ4A 1RE1B 1DQ8A 4OLPA 4W98A 3SIPB 1O5JA 7AT1B 2PC6A 2ZKUA 2XMWA 2XO7A 2MKCA 1NK4A 2UUCJ 5DRKA 5ETMA 1KD1T 4M95A 2RH3A 2JEGA 3BGRB 2E1RA 4LUBA 5LSRA 2QA4G 2AYGA 5CYQA 1B70B 1RAIB 2WOMA 1VMBA 3SBMA 1BUXA 4TVAB 3GJQB 3I5AA 4HACB 4KQZA 3VGTA 3Q8UA 2Y3YA 4P72A 2ZH5A 3KG1A 2J8AA 4H4MB 3T19A 3V6DA 1NPRA 2HGLA 2B9XA 4EO8A 1KWMA 1R0BG 3W2WB 4URSA 5HQ8A 4LFCF 1KQSR 3DRSB 2M88A 2DNLA 1HPZB 2LLZA 3JQJA 4WKYA 6FD1A 5DG7A 4WXWA 3ZZPA 1H72C 1LWEA 4X4VA 2N7YA 2YBVA 4OX9J 3Q0AA 4PZVA 2HNYB 2DXFA 2J9DE 2VFVA 1HJKA 4M1KA 4D3HA 4HTJA 1HNIA 1M0SA 1XNQF 2KYZA 1VYAA 1FKOA 3LA0A 3MXHP 4B3OA 1P6TA 4RW4A 2RF2B 5KFCA 4JBCA 2WCXA 3T6JA 4C8ZA 5L46A 3DLKA 4P75A 2AJ4A 1PCAA 1L3UA 2IDEA 4K2XA 2UV8G 4N8NA 2KFZA 1Y0HA 1VK3A 3ILOA 4LSNB 2KTQA 1DFDA 5J1EA 3FCVA 1REVB 3NKQA 3HSDA 2KM8B 4J9MA 1JLAA 3G82A 5K8OA 4N56A 2VA2A 2MQMA 2H4WB 2DGWA 3MM8B 1HNZF 2HQFA 1FSUA 1TV6A 2OEKA 2QO3A 2G13A 2V69A 1H6KX 2W4DA 3BGRA 3ET6A 4N77A 4O4GA 2VQFJ 2KT2A 2COLA 2HWIA 4LVOP 4DJBA 2XS5A 1QSSA 1GXLA 4TQRA 5EWFA 3PR4A 1HARA 2UXBJ 1F1BB 3PDNA 4PYDA 1PYTA 4O3PA 4GC6A 2FLLA 4RPFA 2RU9A 3M9NB 2AP6A 3W8GA 3OTOJ 1HR0F 4RZRA 1BQMA 2I9SA 1DY3A 2VG6A 3T01A 5B0FA 1R0CB 3MEGB 2HHWA 2H4YB 4PQUB 2F4FA 2NXJA 2ZC4A 4TY8A 5IOLA 3V6JA 1RHJB 2EG1A 2HMIB 1IUJA 1NDLA 5HRTA 3MCOA 1FVQA 2QL7B 4KGZB 4RW4B 5C2CA 4ZVRB 3CCSS 3C3LA 2PI4A 1S4EA 3DLKB 1A0OB 2YTCA 3EDQB 3SCIE 1XNRJ 4KHMA 4X84A 4Y28C 1CLFA 2GZOA 1R43A 5IT9U 1N0UA 2LQBA 3FCHA 4C7QA 5C5JA 3IRWP 3W1YC 1REVA 1VHIA 4ILMA 1WKLA 2IUCB 1RHUB 4J9UE 2ZH4A 4DR2J 1HQUB 1VBYA 3G82B 1WORA 3QATA 3PYDA 3RAXA 4LF6J 3R2CJ 5LIAA 1JLCB 1JQGA 4UPKA 2VZ9A 4B17A 1S6OA 4CNZA 3N79A 5F8MA 4YB1P 3IM8A 3M2VB 4MIAA 3QGGA 4LF5F 4LFBF 1WDDA 2FHOB 1LXJA 4KFBB 5AXLA 4CQ1A 3GV8B 4YR1A 4NZ0A 1W7WA 2DNOA 4B02A 4LSLA 5D0RA 3GILA 1RABB 3TEHB 1QTMA 2ZZNA 2BQRA 3QRQA 2CJKA 3DFEA 4DV0F 3P3DA 2QN6B 2XMMA 1FWKA 3BB5A 2K3KA 3C6TB 3DN9A 4QIWD 5CYQB 5JJBA 2W5TA 4PCQA 2VQEJ 1Q1KA 2LKZA 3NCRA 3PFEA 2ZH6A 4KV8A 3G96A 1YDLA 1IKWB 3I0SB 4RLEA 3HVRA 4OYPA 1HYSB 4UUXA 4RW7A 3FRYA 4BLGA 2YX1A 5HN0A 3Q86A 2MJNA 3ZTRA 5LJ3Y 3OSPA 2YWEA 1Y9OA 4ID8A 5D77A 3DGPB 4J9VA 4NXNF 4M8LA 4UY8T 1ALKA 2D7SA 1T02A 1FERA 5A8KA 2B8QA 3QBCA 3UPFA 1U7LA 3CD0A 1FJEB 1L3KA 2LU1A 1F5CA 2AX1A 2VC0A 4OI2A 5CCLA 3RTVA 3GG0A 1Y7AA 2FUG9 3J81U 1FKAF 2EFVA 2VIHA 2Q3PA 1YX2A 4I69A 4DV6J 1WEXA 3GCWP 2AW0A 3TNVA 4QWCA 1IKVA 4A8OA 3BGLA 5C66A 4X4QA 1X4CA 1R3NA 2K8GA 3UN2A 4FDIA 2K2PA 4Q7AA 3JSBA 3MFIA 1ZEBA 2L9NA 1EJ7L 2E7WA 4X62J 4P2MA 1PAEX 4ZDNA 1WDTA 4Y0FA 4ZS6A 1NDKA 2GAGC 2Q43A 4I4BA 2V2VA 8AT1B 2L9WA 2IVYA 4B3SF 1KH4A 3M8QA 1K1SA 1YG0A 5KFUA 2B5JB 2U1AA 3KJNB 1F2GA 5BXIA 1BGXT 3GFXA 3NS5A 3H5SA 2W4PA 3G86A 4PG6A 1FKPB 2RS8A 4P2FA 5CQGA 3KJVB 3UCGA 1VJQA 2XLIA 2BX6A 4ICLB 4EZ6A 2V67A 3NKOA 1NKBA 4JV5J 5DLWA 4DWIA 4EBEA 3NGRA 2XWXA 3PTWA 3ZTSA 3CC7S 1FNMA 1CULB 1PJ7A 2AHOB 1YZ7A 2MYFA 3MMJA 3NGKA 2PO4A 3H5YA 1YJTA 3SDEA 1MWQA 4K4YA 1FWLA 1C0TB 3HT3A 2DRBA 3DYCA 2CPZA 3ILJA 1T3OA 2VD3A 3CD7A 1IKXA 4I6YA 3HP6A 5A2QU 2HBZB 4YHHJ 4K4WA 4DN9A 4DU7A 1EQ0A 4Y2CA 3DOLB 2HW3A 4B08A 1RTZA 3LGMA 4LRFA 3CCVS 4DSFA 3H40A 4W4MA 1CEZA 1HW8A 2VG5A 2YKMA 4MK8A 2HSEB 4IFVB 5J2QB 2FLPA 2CG4A 2LVWA 3I56S 4PAAA 2E5JA 3RBZA 1KQFB 1YWXA 1FRKA 3NWGA 3RRGA 5EGHA 2HNDB 2EW9A 3D6TB 2XY7A 1FA0A 3UO0A 3PJ9A 1N8RT 5GAEU 3G2XA 1CJKA 2OPSA 3LANA 2QT7A 4F04B 3TI0A 1TK0A 3ITHA 4A8MP 5AXNA 4TLRA 1ZPVA 5HROB 3NCPA 3DLHA 5KG6A 2RU3A 4JI1J 4ECZA 4ZPCA 2B51A 3N5BA 3NMRA 5BYSA 2MZSA 3QPIA 3PW2A 1CJVB 1R8AA 2IA6A 1TKXB 2BBEA 3EGWB 3M1VB 4ZP9A 3KJVA 4ERDA 3W62A 2N4CA 2HRUA 4IRKA 5K20B 3EWGA 4QCLA 2GIRA 2B9YA 1S48A 1BXNA 3CVKA 4RW9B 2E5LF 1SH0A 4ZITA 3CD5A 3HKZD 4ZPVR 1X5TA 4NCGA 3TVYA 1KHKA 2LEPA 3IP0A 4LFCJ 4ZA1A 3CULA 2OP5A 4JI2J 1H7XA 2OFGX 5KG5A 3AHPA 1JLGB 3B82A 3PEJA 5CAAA 1S57A 4CLZA 1IQZA 3UD4P 3A8EA 5GADU 1QLNA 1RA6A 1IKWA 3I0SA 1M5SA 1VJWA 1HD0A 2HBYB 2JVRA 2QE5A 2ASJA 2ATLA 3TG0A 4HDHA 1S7HA 3B54A 3SSSA 3KLVA 1WG1A 2XSJA 2BACA 3GYGA 4TU7A 3AY0A 3GQCA 5J2QA 3RRKA 3BPSP 3BH7B 4F67A 3BO2A 2XS2A 2EC0A 1DTQB 1YRXA 3CJ2A 1J5EJ 3QT5A 1YTYA 3M8PB 1VQYA 1C1CB 2DR7A 2FHKA 2AF6A 2YKNB 1N32F 1F9FA 4YQWA 1Q8KA 1RYSA 3TA2A 4FBTA 2GSNA 1ED9A 4RKUC 4CXSA 1AW0A 4BC9A 1S9EB 3D0GE 5KFQA 2RUGA 1K9MT 4DR4F 2QC3A 2J8SA 3FUYA 2Z58B 4OYWA 2WTFA 1EP4B 2KT3A 2KHCA 1YJ9S 2AQ4A 2Y8YA 5DO2A 2O3DA 3M8QB 4HHUA 1HNZJ 3B5QA 5GAGI 1ZTWA 4GVLA 5C42A 2OELA 3M2RB 3QGPA 4F4ZA 1Q0NA 1SQEA 2EVZA 4FXVA 1PYSB 4OX7A 4U7UK 1E2SP 5J2NA 2UXBF 3IBFB 3QO9B 4CTAA 4KJIA 2KRRA 5HAOA 4X4UA 2D1GA 3MM7B 3CUNA 1GFWB 5FDLB 2YWHA 2CQIA 4ZVOB 2H3EB 1S1WB 4X64J 2KM8C 1DLOA 1S1UA 2C2MB 2G2OA 5LMNF 4IOCQ 3TAMA 1RTIB 4DV3F 2I1RA 4KKOA 2A10A 3MZIA 3KHGA 2MKJA 3JSMB 3HO1A 5DDQC 5INHA 1HNVA 4DL6A 1TVRA 1RT7B 1SUQB 2CJXB 4QIVA 1S49A 2HRYA 2IRYA 4G1PA 2J0WA 5IJQA 1DARA 1IVZA 1WWHA 1IXKA 3I82A 3E01A 2NUHA 2LECA 5E2QA 1ANIA 3G9CA 2YKAA 5CH7B 1WHVA 2F65A 2Y0SD 5F3TA 1HA1A 5C25B 5M2PA 5B0GA 2W9BB 1ZYQA 1R7IA 1ZOTA 4NYPA 2CPXA 1FRXA 5IFMA 4QYZJ 1ZS6A 5KXAA 4IG0B 4ZLPA 4ECTA 1VGYA 4OIXA 5E3CA 5ETLA 3SFUA 1U2CA 2GQQA 4O23A 3UD3P 4MFBA 3FBFA 1JLEB 3PYEA 5B0BA 3GIMA 1ELXA 3AJ2A 3B78A 1HBMB 1CJVA 3CDEA 1CS4A 1U0HB 4IRDA 1ZBTA 5L1IA 3DRRB 3HHNB 1L3TA 1DQAA 2B3TB 5G0RB 2R7XA 4NEYA 4A8KA 3NY0A 5F8JA 1OO0B 1VBXA 1EX8A 3VAMA 4C8OA 1XBWA 4M5NA 4GO7X 4DI6A 1VRTB 3MR7A 4ZLLA 2ZH7A 1KH9A 1Y00A 1J5EF 2VJUA 1WTFA 3MM9A 2BANB 1X4BA 3HSZA 3VV2B 5M2RA 1D9FA 2QMUB 1KR4A 1RT7A 1SUQA 4MH8A 5KFLA 3KFWX 2POKA 1WELA 2JSXA 3GTYX 4V1Ak 4ZPBA 3TX0A 1HMVA 3ZZ0A 1YRUA 5E3QA 3M8SA 1R8BA 1XR6A 3KHRA 2CRLA 1M5OC 2W5VA 2XLJA 4FS1A 4URGA 4ZGAA 1UTAA 3RR8A 1E33P 4XIUA 4JI8J 4KO0A 2J7UA 1A9NB 1VRUB 4OX8A 1GEHA 1KN6A 4DPOA 1DTQA 1GX6A 2W2QP 2M70A 5KFRA 1CBKA 4DL4A 3W2WA 3BZQA 2YX4A 4DBQA 4PRFA 3DRSA 3FBBA 3I4PA 4WFYA 4NLRA 2DGQA 2FYXA 5A6PA 2FZGB 3RUBL 3EVMA 2DCLA 3OSNA 1IBKJ 4K0KF 4NA1A 1K0TA 1HNWF 4UPLA 4YS2A 3KWMA 1HHTP 1S9GA 5E41A 2QA2A 1Q8LA 3EXCX 3Q8QB 1HBOA 4F7VA 3AD8C 4RU2A 1HBNB 1JLEA 5KFTA 2CNOB 2FIUA 2DXDA 4QPXA 1FF2A 3OV7A 3M8RA 3L3CA 2V50A 4OQJA 3H4DA 4KM4A 1KS2A 5J1NA 4CH1A 4RUBA 2DGVA 4NRTA 1D8YA 1RTDA 3BSAA 4F4KA 4K0KJ 4U95A 2HS3A 4YB6A 3D4JA 2HAFA 1N0VC 2YWKA 3BREA 3TUZC 4TQSA 2J0XA 1IJEB 2ALZA 1SJFA 1I94F 1TR0A 2OSQA 3LF0A 3UE2A 3HVTA 4O3OA 4ALZA 1Z4UA 1TMMA 3DU6A 1C2PA 1VRTA 2JDJA 5DLVA 2P5VA 1JLAB 3H20A 1WOSA 2GCFA 2F5GA 2WBMA 3P45B 3QLHA 3ZTOA 4JI5F 5T7LB 4LRDA 1S1UB 3ET6B 4O4GB 2E29A 1HMVB 3H2LA 3TAMB 2GJIA 2VFUA 3JSMA 4DFMA 1ZTTA 1UFWA 2KXFA 1U1LA 2DHGA 2GSUA 4P71A 2PMZD 4WWSA 1X9WA 4KR0B 3OFEA 2R7WA 4DCJB 3BSNA 3HLUA 1N34J 4RX6A 3W5ZA 4F0HA 2APOA 2UUCF 2HHVA 5ETRA 4O3RA 2GMLA 1ZM9A 3CDAA 1U6FA 4JB8B 3CCRS 4DFJA 4F25A 3T1YJ 2FVPA 4HDGA 1N2KA 4KBIA 2KJVA 2RD5C 4PG4A 5SZTA 2HS4A 4LF4F 1JWWA 4FYYB 2CQCA 1HI8A 5ETKA 5L9XA 3HHDA 1HFEL 5D78A 2Z56B 3HFVA 1AT1B 3I31A 1EETB 3D6MB 1NJXA 2PE8A 4K4SA 3U1MA 4ZVGA 2G2ZA 2LU2A 4NI2B 1S6UA 3DDKA 2V8VA 3F56A 3FRZA 2DR9A 1VQSA 5DS7A 3CTRA 3T9ZA 1RT3B 3K7RA 4DV6F 4RUCA 1X8DA 5U47A 4DR1F 3MAHA 3GE9A 3CIMA 3G6VA 3K57A 3T5LA 5SUHA 3JQMA 4C9DA 5DDRC 5FIIA 5CXTA 2W5RA 3LP1A 4OYBA 3TJAA 4GKJF 4AQYJ 4LSZB 5DGAA 3LH2S 2CAJA 3BN7A 3N4WA 3K58A 1YK9A 2NSCA 2PGCA 3W64A 3V6KA 2JWNA 5HJXA 5BYRA 3C2PA 2V4JA 4OI3A 3PIOQ 3G4SS 3M2UB 4BS2A 2ZH3A 1EI6A 2BANA 4MY4A 1UEVA 4ZN3A 2GHWA 3ISZA 2QSWA 4C0BA 2ZVIA 2HHPA 2FLOA 5A2QY 1LWCB 2H54B 3TVKA 1CG2A 1VS3A 3GG1A 1EKSA 4F2SA 2F63A 3GMGA 2FJAB 4C11B 5D3GA 3AD7C 3Q8VA 4J9RA 1CPZA 4CT9A 1D09B 2MQ8A 2Z30B 2JFKA 4F0MA 5F9NA 4LF5J 3TO8A 3EZOA 2NQPA 1NZAA 3RBDA 2OFHX 2V9WA 4JOUA 2GIQA 1Z2ZA 1T9WA 4H54A 1S79A 4Y34A 2IMWP 2MKIA 1EW9A 3AOCA 2M3DA 4G1IA 3Q8RB 2B4OA 1TKDA 3DCAA 5CYMA 4ECSA 3EGNA 3FNNA 3MCNA 4ED4A 1RXOB 1BMQB 1RT4A 1QAJA 1NBEB 4KGMA 3MAAB 3BKFA 4P73A 2Y9HA 2V8HA 3T5HA 5IJSA 1SJRA 3V2UC 3N28A 1ALJA 3CJRA 3VTIA 1LV5A 4KHPF 4JV1A 4AYBD 4UQGA 3Q8SB 1VQPS 1UEKA 4ECXA 3LP1B 1X4DA 1H7WA 1FK9A 1KHWA 2GVDA 4UQTA 4C97A 5L38A 4OZ2A 5DM7Q 1VC0A 2VKZG 2GX8A 2E9ZA 2BM1A 1PC4A 1TL1B 3LPYA 4X2BA 5K4PA 5A0YB 1E6VA 4LFAJ 1KVIA 3NGDA 5G4DA 1X4HA 4ES1A 3EVWA 2WHOA 2IJRA 3NXZA 1RBLA 2MGZB 3KUGA 1K8AT 4LT6A 4B9MA 2XGQA 3MM5B 2EFGA 1YQHA 4MJKA 5DJBA 4LF8F 3ZTPA 3KTQA 2CJYB 3GYNA 4MAKA 3VR1A 3C16B 4B9UA 2XNRA 2XHWA 3C14A 2KXNB 1OJ4A 2HVZA 3O44A 3CW2C 2A1BA 4EYIB 1SKWA 5KFPA 2HK3A 5JXSA 2CZVC 1MG7A 4O0IA 3F44A 2JEJA 2QZ8A 1FCAA 2DBBA 2MHNA 3FSXA 3HDSA 3OPKA 3R5GA 3OUYB 3KK3A 1Q78A 3QYYA 1JLQA 2ZH2A 1EQJA 2NSBA 2QIFA 5CYMB 1D0EA 3P5TL 1FEEA 3HJVA 2KRBA 2YQ3A 3CJQA 3L7OA 1RAHB 3MMBB 3W65A 4MT1A 5LMNJ 4DR5J 1HNIB 3M05A 1W2IA 2VICA 2LDIA 1FE0A 1Q8BA 2C28A 1ZEFA 1NK7A 1EKRA 1PC5A 1LFPA 1RB0A 1YJVA 3FC9A 2D41A 2MY7A 4OZNA 2KVIA 4DL7A 3E3XA 3ENAA 4CCHA 4C8KA 4UORA 1DZ5A 5D0HA 3J7ZT 4DX7A 2EK6A 3WX4A 2D69A 4OX9F 3UI3A 1I5OB 4XTTA 2P8IA 1TFWA 1CJKB 2OPSB 2XCPA 2ZDOA 3PRVA 2R7RA 3IC1A 3KUHA 1RLCL 5F0WA 2QYGA 1RHQB 3GIRA 4ZK7M 3BQ2A 1KQKA 4CYUB 1KLMA 1JLFB 5GADI 2MGZA 4R8UB 3C46A 4MYTA 3Q8PB 2BVZA 1KC8T 5HSPA 2RIJA 2H51B 2VG7B 1CVJA 4IG3A 2GQCA 2QMWA 5IQ6A 3C14B 4KRWA 5KFYA 4C3MA 2F40A 5BR8J 3LXQA 1R6VA 1FD2A 5KAKA 2ASDA 1V5VA 2EEYA 2QLWA 3CDUA 2WOMB 1TP7A 1KHVA 4LJMA 1WHWA 1VQ9S 1VK8A 1S9FA 4OZ1A 4HACA 4WE1A 4OJ3A 5KT4A 2ZE2A 4KGKA 3GJTB 2FB0A 4YY3J 1VQ8S 1MN9A 3ENQA 4K4UA 4NLVA 2XRGA 3VVTA 2ZWOA 2KG1A 4B56A 1IM4A 1S5ZA 2GFFA 2X3GA 1Q79A 2YWWA 4P10A 5K8PA 3DXBA 2OEMA 4FKXA 2QA1A 4Q43A 2MDAA 2PD1A 4B3TF 2RUSA 2XLKA 4LMZA 4LF9F 3VGSA 2BW7A 2C1EB 4CO1A 4ECUA 2VBWA 2WVEA 4CO5A 2B43A 2XZDB 2J6TA 4F3QA 1UJ6A 2ZOMA 2CQHA 3A8KA 3C6UB 4LBHA 1AXQA 2HEKA 4PEOA 4RU9A 3PZPA 4RUAA 2BKNA 3PO5A 3SFGA 3Q2TC 5LRMA 4PWDB 3FQKA 1SPBP 2XCAA 2BEFA 3RRHA 1ZH5A 3JSRA 1QM9A 4A8YA 3GFHA 1Y3KA 2B8PA 1LWXA 4A8WA 4WTOB 2CDQA 3IFEA 2UP1A 1HNWJ 1HPZA 4YP3A 3ELHA 3K5OA 1S7IA 3QNWB 4IG3B 4ZCKA 3CJSA 3K8VA 4ECQA 2Q6CA 5KFIA 4MTPA 3ZNUA 3FEZA 3KMSA 1UETA 2BJ3A 2CZ4A 2VODA 2BJDA 3JSYA 3VAIA 4ZHRB 4ZP8A 2BRLA 2FGCA 1DJ0A 4BWJA 4ZLJA 5KT2A 4C98A 3TEGA 4EBDA 1UVJA 2HZCA 4CTAB 1NJWA 5A8RB 2DY9A 4UOOA 2ZJQQ 2E7XA 5KT5A 4HLBA 2R2TA 1TQLA 2GMHA 2YPZA 4NMXA 4U6PA 4KJDA 5L1KA 3BDPA 2OSRA 2HFUA 3HCXA 2F8EX 4ZCLA 3QFWA 4OYAA 2ZOFA 4MKVA 4RW7B 3OQ2A 4LSNA 3T3FA 4OJHA 3V4IB 4N76A 4NXMJ 4ZJLA 2VFSA 4DR5F 1DAXA 4DN0A 2AZ3A 5D4OA 3ZFVA 4DMZA 2IVMA 4AE5A 2X98A 1FDBA 1WC4A 1Y11A 4ZLNA 1N88A 1RQ0A 3MR6A 2KZMA 2IBKA 2PN6A 4L76A 1I51B 1S59A 1UAWA 2AEFA 5EN1A 1UL3A 3H25A 2ZD1A 4V19J 3BGUA 1T0TV 1NK0A 1IBLJ 4A8FA 2IFYA 4ZG9A 2W4CA 1S6QA 1UFKA 4LR9A 1N54B 1TUWA 1WHYA 2RH6A 3PO4A 4F2RA 2J7KA 3PW0A 2DITA 2EFNA 1NPKA 1JNZB 1U1MA 3S6EA 2HYIB 1IJFB 3HHKA 1VCTA 4DU8A 2Y8WA 3MR3A 2DNNA 4DSJA 4KHPJ 4WYWA 2W2NP 3GU0A 1ZM4A 4WFNQ 4LR2A 2DB1A 1OPIA 3L7UA 4DOZA 1Q5YA 3PM9A 2Y1JA 2C2EA 1FRMA 4JP8A 4C8YA 3HHLD 3LP2A 2WSCC 3VQTA 2DT9A 3GFZA 3MMAA 4X62F 3CNQP 4OYOA 1A7GE 3HKWA 2C2DA 3EZUA 3KOAA 3ED4A 2JLFA 2QL5B 2MKSA 5IC6B 4KAVA 1OYDA 2YNHB 3MDFA 1AJDA 3M7VA 3ONQA 4UTGA 5IZHA 1FX4A 1M1GA 3V4IA 4LF7J 2A0FB 4WXOA 3CC2S 3QGHA 2J0SD 3NNAA 3MEKA 2QRRA 5F8HA 3TANA 2CQ0A 1U1KA 2AEMA 3AB4B 3IGNA 4L73A 1NZ8A 3CXCR 3VALA 4RW8B 2RQ4A 1S97A 1VQLS 2OEJA 3FVYA 1PJ5A 1RT6B 3MPWA 2BYCA 4KFBA 4M5KA 5AT1B 1WC1A 2FJWA 4PXCA 3W9HA 2W8LA 2XYPB 3DMJA 3SCKE 4CLTA 1B7FA 1JLBB 1JMTA 3AFGA 5AJ3F 1NK5A 1HI1A 4GC7A 5J2MB 1T9XA 3BDGA 1G6BA 1NK8A 5L0EA 3WAYA 3CEDA 3N6LA 4CIOA 1R8PA 5LMUF 4DSIA 3IR6B 2ZC3A 4OJGA 2SXLA 2UXDJ 1HBOB 2W8SA 3A8IA 4F8RA 2HFOA 5I3UB 2WONA 4DG1B 3QFHA 4EYHB 4GTXA 3SQOP 1TKXA 3M1VA 2QMXA 3IMQJ 4QIGA 4ZG7A 1RWPB 4OI4A 2ZHOA 1YJWS 1T05A 5HMXA 4K5SA 2KG0A 3ILIA 4LFAF 5CHCB 2MLXA 1AJCA 4PG5A 1Q16B 4NCGB 3PJXA 1NDCA 1ELYA 3NGUA 3O8WA 5LSOA 5LT5A 5IWAJ 2K3IA 3AAWB 2EFQA 4J37A 2RKIA 3N9UC 2J9DA 3QLHB 2KHDA 2HURA 1ZEDA 2R8JA 4IR1A 3TA1A 4NMLA 3TVZA 3ULHA 1YHQS 5K14B 4Y3CA 4Z7YA 5L8RC 1RA7A 3ENWA 4CO0A 3DDIA 1FJGJ 1PO6A 2OHDA 2KN4A 1DURA 2XZWA 1NSPA 1RWOB 5KFZA 1LW2B 2PT0A 2Q6BA 2PMWA 3R5DA 3VWSA 5J1PA 4K4TA 9ATCB 3G8QA 4FNIA 5K5MA 3US5A 1HD1A 2CUYA 1PAUB 4HI1A 1RWWB 2AU0A 3SZZA 1Y3JA 3LP0B 2JHEA 1CSJA 3I4HX 2OD6A 3R5AA 3I87A 4R0EA 2W25A 4RUHA 3ISND 3WZ0A 3CD6S 2QJ3A 1N2LA 2NXNA 5IWAF 3JAMU 5CZXA 2J6SA 1WC6A 4M5DA 2R7TA 2DNHA 4USVA 2X1BA 2UU9J 4JI7J 3WC0A 1VQ4S 4YDXA 4EU0A 4HI2A 3OJUA 2P9GA 2PEBA 2NPIA 1TL3A 2DK2A 3CO9A 1HWUA 4P2XA 4CO2A 4DR3J 2DVIA 1E3CP 2IDLA 2MZRA 2NXEA 2CQ1A 2CWKA 2VDHA 3MEDB 3MM6A 1JX4A 4OHWA 3FEXB 2QEXS 4H4KA 3IM9A 1RCOB 2J76E 2V63A 2ZWPA 1TK8A 1WNEA 3NKPA 1IKXB 2E9RX 3WDOA 5IT9Y 1X4EA 1DHMA 3DLEB 1U49A 4CLLA 3TRGA 1H74A 2V94A 2AYEA 2W24A 1DBDA 3ETMA 3QGIA 2EKYA 5J2NB 2QA4S 3KXDA 3MM7A 3MOJB 4NASA 2YVSA 4YN3B 2D3OR 4LR8A 4ELUA 1BWEA 1NXIA 4J9LA 2F3JA 4WZMA 1HBUA 1XNQJ 2IRXA 2W9CB 2V6AA 3C15B 4CP5A 1RHMB 1GAOA 1JLGA 1RCXB 1RAGB 1U02A 2W7AA 1RLDA 4KT0C 1XEZA 5E33A 2UUAJ 3HVAA 1FEHA 2JL9A 4DPTA 1H2UX 2M4MA 1X9MA 3UR0A 1RTHB 1TKZB 2LDYA 3KMQA 2B6AA 1OY6A 4I6AA 4YFUA 3WBHA 1ED8A 4AQYF 3CCTA 3NEKA 3CMQA 2XSJB 3H59A 4O3SA 3H5XA 1T9VA 1TAQA 2AV5A 1UJ4A 3V6DB 1S76D 2CQ2A 4NLUA 3N6NA 2DYAA 2IVFB 5C2GA 1WG5A 4WIIA 1SV5B 4CLWA 2YKQA 3DLGA 3TZZA 5AXMA 2O66A 5C25A 3AOBA 3M8PA 5TJ3A 5A8WA 5EGYA 3LALA 2FHMA 4MKBA 3WC2A 1JXEA 2Z2ZA 5GVQA 1SJQA 2FPHX 4FS2A 4KGVB 4EI2A 3QT7A 4JYAF 5HK4A 3S01A 5HMWA 3BR9A 1S9EA 1B64A 1WSRA 3UQSA 2GGPB 4DV5F 3RU0A 4DFPA 1RT1A 1BD6A 1ELZA 5HVHA 3EXYA 4WFAQ 2HHHF 1GK8A 3NOGA 1NKEA 1TAUA 3W3SA 4FYDA 2CJBA 1MWYA 2J7WA 1XTZA 4EBCA 3PW5A 4M5MA 3QWPA 2J5AA 5C42B 3SZYA 4Q5VA 4CXKA 3OTDA 1IBMJ 1WSVA 2CYYA 1U1QA 4ZIVA 4F4AA 1PGZA 1VQKS 4B9LA 2XSFA 1SC3B 4GVBA 1JXLA 4XPEA 1KQGB 1OY8A 5C24A 3AB2B 4DR6F 1O8BA 2LA6A 1UVIA 2VB6A 1APSA 4RWXA 4ED1A 2ZBCA 1K0VA 1LKZA 1KFDA 3D1HA 4OHXA 4DL2A 1Z2LA 2C3PA 4M5HA 2CG8A 3H5UA 4JI6F 4WCEQ 2YNGA 2BJ1A 2ROEA 3CJTA 3C16A 5DLTA 3PW7A 3M6VA 3AA8A 4OI0A 3CJKA 3DM2B 3LTOA 5DQGA 1YJUA 4ITSA 3LW5C 1NSQA 2CJ9A 4BCAA 4Q45A 4RNMA 3VAKA 1WTBA 1UWAA 3LOUA 2EPIA 5ETVA 2HS0A 4XPCA 1Y5IB 5ADZA 2XM3A 4USKA 1BQMB 1SXLA 3RB6A 2VBYA 5IV3A 1IR1A 1SQFA 3TX8A 2W5QA 4GKKJ 4OI1A 1IWGA 3WBZA 1RAOA 4W92B 2MLZA 3MEEB 3UCZP 2DHAA 1TL3B 5B09A 4PABA 3H2VE 2ZHAA 2YNIA 3BQ0A 4USWA 1URNA 2IYGA 2MZTA 1DLOB 4LQ9A 2Y1RI 3PKYA 4DUZJ 4PG7A 3WQPA 3NBPB 4DX6A 3B8HA 2ZUAA 3O2IA 3OR2A 3OTEA 1AUDA 2E1CA 4UY85 5IM0A 4GTZA 2B9WA 4IRCA 1VFJA 4UOCA 3U1LA 4GO5X 2FQQB 5E3PA 5LJ5Y 2RB7A 3O1LA 2RRNA 2XYGB 1HQUA 1RWXB 4AL7A 2ASLA 2EC2A 1LEOA 1JLCA 3EE3A 1HBUB 3THTA 1KLMB 2A6OA 3ETOA 2FVRA 4P7TA 4JI3J 1N5SA 1R8HA 2E7VA 1X0PA 1WF0A 1LFWA 2M7SA 3BF4A 3M2VA 3PR5B 1FXDA 4QBUA 4K4ZA 5L1LA 3UFCX 2H5IB 1YBUA 2FHJD 1RWMB 3DOKA 3CCES 1AFJA 1UPPA 2CA9A 4B3RJ 1H38A 3DM2A 3FJ2A 1WKJA 1Q95G 4KPCA 2LFVA 4IG0A 2IPOB 3K2YA 3M32B 4P9SA 5F8GA 1N48A 2IJFA 4WP3A 4MFBB 4ZVUB 2IM2A 5LSLA 2V4RA 4C4WA 5C7PA 2JFDA 1D9AA 1AYEA 1Y4ZB 1CS4B 3V4MA 3BO3A 4DV5J 5DLGA 3KLEA 1DTTA 4Z7CA 4DUYJ 1V6HA 4H4OA 1GMUA 2FY8A 3M30A 2CNKB 2KKHA 4O4RA 2V2QA 3X1LB 5HI7A 5HMYA 3OHBA 1HQEB 4NZ6A 3I5CA 4USMA 4ES3A 4P2SA 1FRIA 6AT1B 4ED0A 3ZZOA 1K47A 2XMJA 1C0UA 1NPPA 3R6GB 1WF1A 4J5OA 5GMEA 2UVUA 4NZ7A 3BDEA 4K5RA 2WVCA 2CNNB 3M8ZA 4UW2A 3W63A 4DPWA 3NP5A 1GQEA 1HWIA 1MU2A 5EX0A 4ZKAA 4F4WA 3R1HA 2DJWA 2FVSA 3HSJA 3PYGA 3QQCD 2UVVA 2WVDA 2BKOA 2C2KB 1RP5A 2V68A 1B0TA 3E8OA 5KFBA 1XC9A 2HIQA 3O3LA 1S1VA 4IQMA 4OV6A 3FBEA 2W7PA 3T00A 5DM6Q 2DGUA 2AEJA 1OYEA 1FDDA 1AROP 2DGXA 2W2PP 3BN4A 3N0VA 4UUWA 4CM0A 3DNCA 5C24B 1F60B 4X4NA 3MPDA 1U6ZA 1LW0B 2E44A 2BJEA 4O0NA 2OPPA 1OQ3A 3B6BA 2XMUA 4NLSA 3UVJA 1NB2A 4DUZF 2IHR1 2L08A 3IAM9 3F0NA 4U9RA 4WU2A 4DQQA 1FKPA 4DF4A 1VC5A 3MCMA 2H65B 2JLEA 3KG4A 4HT5A 2CNLB 4UZCA 1KDNA 4ICLA 2MKKA 1XMOJ 1U6BA 2HHUA 4I2QB 4ZP6A 1RU1A 4I2PA 3CC4S 4WK1A 1XMQJ 2RHQB 1D3WA 3QAEA 2FHJA 5ETOA 2F4VF 1ICEB 1LNQA 1G4CA 2G0IA 3GLJA 4IH7A 1GX5A 2YH1A 3M30B 5HLFA 1N32J 1RADB 3GR1A 3OFHA 4GMKA 4DUYF 4QQBA 4CI0B 5GAHI 1EQMA 1TUVA 2P9CA 3D68A 2XHCA 3LPEA 1KHNA 5L0KA 2CIMA 3K8WA 5DQHA 4M5LA 3G6YA 1C0UB 2OPRB 3L9ZA 2GO8A 1V3ZA 2BABA 2RDIA 3DDNA 3VZIA 1O6XA 5EWGA 1Q5VA 4NYZA 4ZMMA 3JB9k 3KLHB 4DR2F 5HVGA 5KT3A 4NI2A 2J0QD 2BDPA 3RBEA 1N5QA 2HHTA 1R27B 1TMJA 4ER8A 2HNDA 1JKHB 2Z0GA 1RT3A 3R97A 1DQ9A 1RT5A 2OPQB 5J1EB 2HQIA 3A1YG 2NCKL 4UF4A 3BGFA 3W5YA 4MHXA 3FDSA 2WW8A 3PRBA 2NR0A 3CJ8A 5A0YA 2J9CA 4P7VA 4DR7J 2I5JB 2RQKA 3PHEA 5LM7E 1X60A 3TUIC 2HFNA 2IMOA 4NEZA 3MM8A 2DO4A 4L75A 1UEUA 1TV6B 1M5KC 4MK9A 5KFFA 4ED3A 4DUTA 1VQMS 2ALYB 1HNXJ 1PIEA 1SKRA 1K1QA 3VZHA 3KKFA 4I2PB 4WPAA 3BSOA 1RAFB 1RT2B 1KTVA 3BR8A 5DETA 2JJ4D 2YNHA 3AJ1A 3UR3C 1VC6A 5F8NA 1LWCA 4OI6A 3TQEA 2MTLA 3OL7A 1PJ6A 1U47A 1HQAA 3JXOA 3VAJA 4J9OA 4DQPA 5CA5A 5KT6A 2G1DA 2VQEF 3D3BJ 1F5BA 3NS7B 1EIYB 3K5PA 3PKMA 3K17A 1ALIA 4DX5A 3AODA 3M4XA 4TU8A 3QT6A 5IQQA 3KLFA 4DQSA 3R6LB 3DKDA 2OJ3A 2A6MA 4P52A 4YEAA 2IAJA 5AE3A 3F41A 4NA2A 4NLDA 4YR2A 1NM2A 1WACA 3QT8A 3KHLA 3CJ5A 2HHQA 3HHLA 3IS9A 4WK3A 2HAIA 3K5MA 4DSLA 1WD6A 5DQIA 1FT8A 4ZCIA 1NO8A 1PILA 4NA3A 3VVUA 4UZBA 2RQCA 4ZVFA 2QLBB 5KFSA 2UUAF 3NG8A 4HR2A 2XI2A 2ZBIA 1TKTA 1TFYA 1RT5B 3CWJA 3LAMA 4ILLA 3OR1A 3SZ2A 3BDGB 3VHQA 3MR5A 2DHHA 3CE8A 4IO9Q 2AMCB 1VLOA 2V0NA 5D3GB 3OXLA 1CC8A 4Y2IA 4O3QA 3IWXA 4TKTA 3J7Z5 4IDKB 4LF8J 2IRUA 4Q0BA 1S1VB 1TL1A 1Q82T 2CQDA 2R7UA 3P5BP 2X3DA 2BM0A 2GHVC 4QYRA 2JC0A 1V9OA 3RBXA 3WAWA 2CQBA 1OPZA 5JVHQ 3J80Y 5F0UA 1NH7A 4BHQA 5L9NA 2MQQA 2BQUA 1AB8A 2H1YA 2KFNA 1TUGB 5FLXY 3OHAA 5J2PB 2FJXA 3T5JA 2Q1LA 3DI6A 4KC5A 8RUCA 2DGTA 4LREA 2HVHA 3UWTA 4F0KA 2E5GA 1F9EB 2EG2A 1OIAA 4FVMA 4QOTA 5GMKa 2ILYA 1O99A 3L7PA 1RK8A 4IQXA 4NLWA 5AE1A 1N34F 3OD2A 4J90A 1YBTA 1OQ6A 3PJWA 4URQU 5DLFA 4WIQA 1S1WA 3UDEA 1HYSA 3OUYA 1NSAA 2HZAA 3KK3B 3KNGA 2O1PA 4NOHA 1RTIA 3U1NA 3Q89A 3CJ4A 1FNOA 4C8MA 3R27A 1N5VA 3K89A 3D5MA 3OVBA 3K5LA 3FZBA 4ES2A 4JI2F 4CZCA 2L48A 2ZDPA 2DH9A 1HW9A 2HLTA 3TUPA 3EZ5A 2CZ9A 1GXTA 4LIWA 2VBXA 1SVDA 1M5PC 4IFYA 5H9FJ 2V8PA 3ZZRA 3MK1A 3NGTA 4LRBA 1CJTA 2DNRA 1MROB 4QIEA 5KFGA 2JEFA 1UZDA 4CLKA 5LL6d 1XMQF 2VOOA 3T6BA 4ENOA 2NPFA 3IGVA 3CCWA 4DPXA 3D66A 1KONA 2M0GB 2UUWA 1P8GA 5KFVA 4IDKA 4RO0A 1FTRA 1ZA1B 2N3LA 1W25A 4P74A 4TY9A 4ANEA 4NXMF 4OHYA 5HO4A 4OZJA 3DPCA 1M5HA 5GMDA 3UW1A 1TL5A 3OFFA 4YB7A 4FN5A 4CYUA 1KHJA 4C48A 4ZN1A 4PQUA 2FZCB 4C6AA 3DLEA 5I3QA 3GIIA 2F7VA 4KYZA 3O5TB 5CD4H 2IFXA 3DI6B 3DRXA 3KK1B 2AD9A 1QTNB 2N82B 2C2RA 2HMIA 1HDHA 4N7TA 2NLWA 5MAOA 2CPYA 2WW4A 2GLQA 5B0AA 2X51A 3HF5A 2BA9A 1IBCB 4Y2KA 1ANJA 1FVSA 3D0HE 2GJ2A 2GO9A 3BV8A 4X66J 1WI8A 2W9CA 3CJ0A 1U1PA 1UP1A 2HFSA 2OKQA 3OW2R 1X9SA 1SJ3P 1SHQA 3PX4A 3QJLA 4G1QB 1RAAB 4AL6A 5GAHU 4K59A 1YITS 5L39A 2RDDA 4FXDA 3A4TA 5D8HB 2RNEA 1ELOA 1J5OA 3G6XA 3MURP 4D3GA 2B6AB 5LXYA 3RB3A 1N52B 2KL8A 4OHVA 1VIXA 2VG7A 4PXEA 1AA1B 1V3SA 2E66A 3POTB 4IH5A 5B0DA 3OJSA 1FRHA 1P9YA 1QUPA 1F0XA 2WVBA 4LSLB 5BYQA 3TJ9A 4DX8H 3HD2A 4X4OA 1O0PA 2EI5A 2C42A 3OT9A 1IBMF 1FRLA 2GAHC 1SIZA 1PBUA 2R42A 4USIA 4C8NA 4KAYA 1WEZA 1HL6A 2HIYA 2OTJS 2GIFA 5L0BA 3MGJA 3BKTA 3KLGA 3TARA 2I8EA 1R0AB 2W5SA 3Q3QA 1G7CB 4RW6B 1EW8A 3KLIA 4KV8B 4WP8A 2MEWA 2QL9B 2VL1A 3HX9A 3OBIA 4FKYA 2ADCA 2R7VA 1IBLF 4MIWA 3V5RA 2FLNA 1P1TA 2FC9A 4JI0F 2RILA 4QR2A 3RAMA 2N3OA 3EPIA 4FF4A 1RTDB 1X31C 4ID5A 3D54A 5KFJA 3IGZB 2LXUA 4NRUA 4HKQA 1NUEA 4RBVA 4ZHRA 4YUDA 2CPFA 2NUUG 5KFXA 3EYZA 4FYWB 1IKYA 3TA0A 3HFZB 1XWLA 5KFEA 2DH8A 3HVTB 5D0GA 4WTYA 5A8RA 1VRQC 3M6WA 4USHA 1C1BB 3MOZA 2BE7D 4LF6F 2GVZB 2GW8A 2Z2MA 4ECYA 4B3MF 4KPYA 2KJWA 2EKNA 3THPA 1SI9A 5A6WA 2CQ3A 4DQRA 5A8WB 5THWA 3ISNC 1OWXA 4CNYA 3KDOA 2CXEA 4ZVTB 4FF1A 4AL5A 1N36F 2B0GA 4CO4A 2NYHA 1N56A 4N41A 4CLUA 3BYRA 4E98A 5ETTA 3A8JA 5E3RA 2VFTA 3PY8A 5KT7A 3C8YA 3HI9A 5IT0A 2YNFB 2GS8A 1HKAA 2V8GA 1YLXA 4DV0J 1RTJB 1EZZB 5KG7A 4E0DA 3AA9A 3BBBA 3MUMP 5J2MA 1CJTB 1VQ7S 5KFNA 4ZJOA 5DDPC 4E2FB 4AFFA 1D1UA 4ZVHA 3KLGB 3M9MB 1FRJA 4XAKA 2R2SA 3KHHA 1S6QB 4JI6J 4ZVSB 4K4XA 4JV2A 2JLGA 4QYZK 3FMBA 3MCSA 4FF2A 2W5XA 2HHSA 4DG1A 3I6PA 2FTRA 3AT1B 2DR6A 1AJAA 3HFKA 1XMBA 1LK5A 1S6PB 5DZ7A 4TU9A 4HH0A 3M6XA 1GTHA 4TXSA 4ELVA 5AE2A 5I4MA 3V81B 2A18A 4A8SA 3Q2SC 3DLLQ 2GHPA 2MZ1A 5KOWA 3HPOA 3H8YA 3W9JA 2Z2LA 4IFVA 1H73A 2HQGA 1WKKA 2WRMA 4DV4F 2C3OA 2W8KA 2YY3A 3NL0A 3P96A 3B4MA 3BSCA 4YY3F 2WAQD 4CRJA 1UCNA 3I55S 4DLEA 1FTCA 2JEIA 2RT3A 1RWUA 2HFZA 3DOMB 4ZJQA 1TVRB 3G87A 2OO4A 1U8SA 2B7BB 2F8MA 2VFRA 3I5BA 4NLOA 2FZKB 1KNZA 2CKWA 2B4VA 1RSCA 3NS6A 1OMSA 3OTCA 3QSIA 2WSEC 4AXIA 1U48A 3PRDA 5I3PA 2R7QA 4I6WA 4XK8C 2AT1B 1VISA 1Y5LB 3FMWA 4DV1J 1IM6A 3WAXA 1SCJB 3OLAA 4FDFA 4H4OB 3IAS9 4U8VA 4A48A 3IRXA 4A8QA 1LQ9A 3IG1B 3MMCB 1FFGB 4LRAA 2HPUA 4ZVPB 1R0AA 5BR8F 3A13A 3GIKA 2XY5A 3ZTQA 5KG2A 5I42A 1K73T 3AD9C 2CVEA 4Y65A 2HKEA 2G2YA 4PPZA 2JOQA 1X5SA 1NMEB 1FD8A 2QLFB 2ADBA 2HGMA 3MECA 5CYJA 2X7IA 4TY8B 3MUTP 1U0SA 3HJFA 1U0HA 3QJJA 3NKYA 4RW8A 4BBYA 2OLWA 3MHYA 3GSDA 3PNIA 2JNJA 1RT6A 4GRSA 2XY6A 4G65A 2XO6A 4EZ9A 6FDRA 4QU7A 1X4GA 3SXLA 2HRTA 3T41A 4KHRA 1IWAA 2BE2A 3C15A 4OFZA 1JLBA 2HG4A 2BOPA 2YKNA 4LBPA 1HR0J 2M8DB 4TN0A 4FNHA 1EARA 1GMWA 1SBRA 2EWHA 2FJEB 3AOAA 3L4BC 3OTBA 4HHHA 3TJ8A 5KFWA 1IBKF 3TYTA 3CCQS 4NE9C 1T9TA 1ZZFA 3Q22A 4Y00A 4RBTA 2G1HA 4F3MA 1ULRA 1E6YA 2HGNA 3KDNA 1H98A 4QW9A 4QPTA 2KT5A 3D7SB 4LF7F 3H2UB 1YJRA 3BKUA 3QIDA 4W90B 1D8ZA 3HK2A 4ELTA 3BDFA 1EAYC 3W60A 1O98A 3DLGB 2ZNZA 4KY3A 1IR2A 2KYXA 3JTPA 3LP0A 5K8MA 1CC7A 1U1RA 1UA1A 4F02A 4IOAQ 2CPDA 2LQ5A 4I7FB 1S1TB 3CF5Q 3I32A 4O44A 2DKOB 2ATCB 3I0RB 4C8LA 2MQPA 2OGUA 4M5DB 1VLYA 5HMZA 1IN0A 1U1NA 4YB5A 4FBUA 4FVCA 2D3O1 3OL6A 2QZUA 4QIFA 2OPRA 1R6YA 3T5KA 2VQRA 4A4JA 2W8DA 1XERA 2JZ5A 2I38A 5EUHA 3W2VA 1D9DA 4QWBA 3ZZZA 4I67A 4DV4J 4DV7F 1FXLA 2OAUA 4QWEA 1SC6A 4K8RA 5ITHA 4DR7F 3PW4A 1RACB 1LW2A 2ZH9A 1HNVB 4J9QA 4IR9A 1ACMB 2QLXA 2Z57B 2J6UA 3V6HA 3MPVA 1QAIA 3NVLA 2K1RB 1KLNA 4F26A 4GVBB 2XBPA 4LIRA 4DCPB 2DRDA 1Q8IA 2PFDA 1R8CA 4DV2F 1FJCA 2B56A 1KEKA 2X1FA 2MSSA 2ZJRQ 1NHKL 3R8YA 5D4PA 1G3OA 4C0OC 4DHVA 2C2ZB 1I94J 4ED5A 3MM6B 1F3FA 1KOOA 2G0CA 2XGPA 2PA8D 2QFIA 4U7CA 4ECWA 1FFWB 3NAHA 4L74A 5KFHA 3IBCB 2AJFE 4L72B 7FD1A 4OV1A 2WB4A 3C19A 5KTQA 1HHSA 4PWWA 1URBA 3S1TA 1H3DA 1TL7B 4NL5A 4PPDA 1KH7A 2AKWB 1S1TA 5FJ4A 4WE1B 3T1HJ 3DYAB 2V4QA 3E2EA 1N33J 4YDDB 3P6YC 4OJ1A 1RUSA 2D74B 3PXGa 1MW7A 4FYXB 2MXYA 2BMBA 2LCWA 5JMNA 4X64F 1F2HA 1H2VZ 4C3LA 2U2FA 3R7NB 3WIUA 1U45A 3ZC4A 1XR7A 2R8IA 2UXCF 3BPDA 3G8TA 2RS2A 1RBAA 1T11A 3ICLA 1M1KT 5D6GA 1EHWA 1PSDA 1WEYA 4C0HA 2QG9B 3SSQA 4KSEB 1A6LA 4BC7A 3GFYA 2GMJA 2XMTA 5DGBA 4RNOA 1TKZA 1S77D 3MK0A 1RWNB 1OSDA 1RZMA 1RI7A 1SB6A 1TKTB 1KOHA 3D28A 3DOLA 3EVOA 4HVZA 3VCDA 1UKUA 3HD1A 5CCMA 5F8IA 3G71S 4CXUA 1VQ6S 1NU4A 4CLFA 1NB7A 1KFSA 4QAXA 3T02A 4PWDA 4KO0B 3AH6A 1M5VC 3LGNA 4FZVA 2YXLA 2BOAA 4OYIA 1WOPA 3E51A 1WC0A 4B9NA 4Q0BB 1XK8A 1CJUB 3CDBA 1PYOB 3JS9A 3T1YF 1E1ZP 5EWEA 4DR4J 4K4VA 2AYBA 3D2WA 3KK2A 4FP9A 3M2UA 2XMAA 4WF9Q 1UFLA 1C4AA 1N5TA 3RGIA 4ZVEA 1NCLA 2AX0A 2HBQB 3BBCA 3ITHB 4OMFG 4RNFA 3I9V9 1B99A 4TLQA 2FC8A 1S1XA 1U1OA 4NLQA 4DSKA 4PUOB 1RKIA 3W61A 4DL5A 2LEAA 3ZZUA 4ANCA 3HT0A 2YNGB 2EFPA 3Q24A 1YBAA 4F3OA 1QUVA 4C11A 2MMYA 2XWYA 3D1OA 5HQMA 3GWCA 2ASYA 1JNRB 2MSTA 2RAQA 1FWPA 2VPXB 3AQOA 4JV0A 3HSGA 4EEYA 2BUNA 2FY1A 3CCLS 2BRKA 1NNDA 3EUNA 2VU5A 2I0XA 2D3UA 3QMQA 5T14A 1J5OB 2RRBA 3I0RA 5B0EA 1S0OA 1NK6A 2IC3B 4J7CA 3J7YU 2BJ8A 5HANA 3IN5A 1Q4RA 1QAXA 3GONA 2DY1A 3MD3A 4IYQA 3W2VB 2EFOA 3GP9A 4IFYB 4OLOA 4UT4A 2KO1A 4C3KA 1MMLA 2M2BA 2KI2A 2MHEA 2W01A 2FDNA 3EDRB 3OR2B 4HT7A 1FK9B 4I68A 3UNGC 2M5YA 3WX8A 4K7QA 5K9FA 4DV3J 3LWMA 3A12A 2K1RA 3EX7B 2BR0A 3WAVA 2MZQA 2PIIA 4GKJJ 4Q8FA 3A3NB 5KG4A 1AFIA 2ZJPQ 2H48B 4HH1A 4TN2A 2YKPA 3PEHA 4DS4A 1U26A 1S1XB 3R5BA 4PUOA 3SI8A 1RDRA 3MMAB 4Q8EA 3SEOA 3IR5B 3HVWA 3ADAC 2NYIA 2Q66A 5HATA 4CYRA 1TZ0A 5BJRA 2IIHA 2D3ZA 4I2QA 3PX0A 2EBEA 3NBPA 1YJ7A 3M32A 2GSOA 2KFYA 4HL9A 5HL7Q 2ZM6J 1N5YA 1X4AA 1YKWA 3THVA 2DTJA 3NCQA 4ZPTR 1HIYA 2VF3A 3DYAA 3HHLC 3U02A 2VPWB 3RR7A 4H4KC 2ZITA 1SKSA 2GA3A 1ZM2A 2DR5A 4KJGA 3MMBA 2HNZB 3QSYB 1UPMB 3W66A 1X5OA 1U09A 5IXUA 2K7JA 2LEBA 2F9DA 3VAHA 5D4LA 4QWAA 4OYMA 1NJYA 1F5AA 2CPIA 2QX0A 3AQPA 3POTA 3IO1A 3GPAA 4ETXA 5LXRA 5DG8A 4JI3F 4B9VA 2KH9A 3BBFA 1BE4A 2NREA 1Q86T 4L6V3 5B08A 2F4VJ 3IGYB 2FVCA 5HP1B 3FSIA 2L41A 2PI5A 2VC1A 3NGSA 4J91A 1S99A 1WJ9A 3FFIB 3VF0B 3W7BA 4YOEA 3MEGA 3JQKA 3FQLA 3TZYA 3TAPA 1XMOF 3L09A 4KGXB 2W2OP 2B4PA 4UOFA 4ZVQB 1RISA 3SMZA 2BZ2A 2MLYA 3W5XA 2XMKA 4AUKA 2R2UA 2Y1IA 2DCUB 5B0CA 2XS7A 3R5JB 3FZ2A 3IR7B 3RG6A 1LWEB 2G9OA 4ID5B 1NSKL 2DNPA 4X65J 1HLWA 3EGVA 2OPPB 4WJBA 1T94A 3CCJS 1T05B 1RT4B 4DPUA 3R1LA 2XNQA 1J27A 2NZ4A 4P6QA 4ZP7A 3S8SA 1FO1A 2V2ZA 4OL8A 2I2YA 1HBMA 1MMNA 2DPIA 1FE4A 1S4FA 2DH7A 4B3OB 2RF2A 2M8HA 2RKIB 3K5NA 2IUCA 2ZE2B 3DRYA 3EGZA 2V5HG 4I64A 4MYUA 1QE1B 5G0RA 5T41A 1PBAA 1NAQA 4EO6A 3NNCA 4F4YA 2BV3A 3B4DA 3D9BA 1JJ4A 4EK2A 2VBZA 2DR8A 2L3MA 3T1HF 2IC3A 2N4DA 4X4PA 5M2UA 2RJZA 3TZWA 3OLBA 2YKOA 2YX7A 3MD1A 2LYVA 4KIAA 2LQJA 1RTJA 4K2JA 2GQ2A 3RW7A 2MKYA 3C6UA 5D0EA 5KFAA 1UVKA 4CWBA 3SSRA 5HJYA 3OR1B 3OVSA 1YGYA 1VBKA 3SCLE 2L9DA 3PCOB 3J7A1 3HULA 1EJJA 3CJ3A 1G1XA 3X3UA 3QZ8A 1T03A 1RJJA 1JKHA 2CPJA 2DNZA 2R4FA 2OUGA 3RZAA 3NKRA 2H5EA 1KHLA 2OH2A 3UN3A 2E1MC 3BYPA 3G8SA 1TL4A 5IT4A 1QVGR 4TNOA 1HHQA 2I5JA 3SV3A 3CO0P 2HVDA 2IM3A 3UDLA 2VG6B 2B5JA 3UNYA 3ZZYA 3M9OB 1S6PA 3QIPA 1U2RA 2VUGA 1S9GB 3PACA 4XDDA 5KFKA 3D0IE 2AJ2A 3RJMB 3V81A 2KVQE 5J2PA 1XIQA 3D1QA 4CLYA 4MIVA 4Y2MA 3IA0A 3OL8A 2AWZA 3AJDA 1QY7A 2G0JA 2C3YA 4ECRA 3KJFB 2MQNA 2DEJA 4UOHA 2PDAA 1CULA 3C66A 2MQOA 2ZHBA 1T9YA 2LQ8A 4OZ0A 2BW2A 4B9SA 4F4XA 5ETQA 4DDFA 2E1PA 4LBIA 1AZSB 2PSZA 1P1LA 3QJPA 2BJ7A 1AUKA 1URRA 1L3SA 3PV8A 5F3ZA 2V9KA 1X4FA 2HNZA 4Q2MA 2Z2YB 2IAJB 4NLTA 1G2EA 3PG9A 3SQGA 1WF2A 2H9ZA 3HHLB 3IS9B 1P49A 1NH8A 2ZD1B 4USJC 2WSFC 1PG5B 1RT2A 5E0OA 5IC4B 3BJYA 2PA3A 4LR7A 4JI1F 1KTQA 1GT8A 2FGOA 4NXNJ 3A3PB 4IH6A 3FK4A 1U25A 4X66F 3UCUP 1JJCB 3SDEB 3PVXA 5HP1A 3FGVA 1EB0A 2P9EA 4WP9A 3UDVA 2VOPA 1C0TA 4DZ6A 3EMTA 2DNYA 3FFIA 5HROA 2AGOA 4OYXA 1RT1B 5E3AA 2R9LA 4ZG6A 3MF5A 1BQXA 1CQMA 2QSFA 1RYRA 4OHZA 3KLEB 2HQ3A 3LP2B 4FYVB 4QR0A 4CLPA 3H90A 1U8WA 1OSCA 1SKUB 2ZEJA 1Q7YT 1NJIT 3DGPA 2DGOA 4PKDB 4Q44A 3A52A 5LRNA 4QR1A 3UDCA 3L95X 4USTA 4X4TA 4DR6J 1KSPA 2HFVA 2K7KA 4RW9A 4DR3F 2XULA 3R7SB 1S0VA 4FPRA 2BKPA 2WZ1A 4NPOA 1R31A 1RWVB 2BE2B 2ZBPA 2YPYA 1VHFA 3GCXP 3BEGB 4DFKA 1SL2A 1Z1ZA 3M6UA 3BO4A 1Q81T 1R89A 4QZVB 3AXMA 4R5PB 4DV2J 3RB0A 1NHVA 2R7OA 3N5FA 4J9SA 1T8EA 5GRRA 2HK2A 1QE1A 3VGUA 4NYOA 1JIHA 1O51A 4M63A 2DHSA 4AT1B 3LWLA 4LF4J 5B7WA 3J81Y 5MLCV 2VPZB 1K44A 3SQGB 2OIHA 1ROFA 1SL1A 4JV5F 3J7AN 1LWFB 1WC5A 1FDAA 1RAJA 2PFFB 4YHHF 1KVKA 1LK7A 4GTYA 4ZPAA 1H2TZ 4WZQA 4MKAA 2YQ1A 1MMDA 5H9EJ 4EMDA 2YWGA 2CPHA 1NKCA 4JYAJ 1IQTA 3MK2A 5HVFA 2QGFB 4LF2A 1VI7A 2ZH8A 2KDOA 1FI4A 2JX2A 2MJUA 4M5JA 2I6WA 4Z2XA 3CSKA 2FD2A 2IBOA 2R3VA 4I0WA 2F9JA 1VIOA 5LOQA 1YIJS 3MPYA 4KH1B 3H42A 5JUMA 2OD4A 4RNNA 3K0JA 1SIWB 1BY9A 2CQGA 2CFXA 2NXUA 2MY8A 3GV7B 3CCMS 3JYTB 2IA0A 2K06A 3OTOF 1V3RA 1ITPA 3KD8A 1P9QC 3D6FB 2LQ9A 1EP4A 5GAGU 2VPYB 3BQ1A 5I3UA 2HHXA 4CM2A 1FNXH 4DXLA 2E5LJ 1M90T 3GSIA 4NCBA 4NX9A 5FD1A 3F73A 4HEA9 2DNMA 5RUBA 1KKHA 1XR5A 3MWBA 4ZPWR 4B3RF 2OMOA 2XZTB 4MK7A 4KB7A 2HVIA 3MAAA 1HWKA 1XQIA 3R2DJ 1XN9A 2F1FA 1H0HB 3WHIA 4KTQA 1C1CA 2J9EA 2ZM6F 3EPGA 1C1BA 2AGQA 5L1JA 1J2VA 2R8HA 2GVDB 2IYIA 4ATNA 3MUVP 3R7BB 4U67Q 4USUA 2QFJA 2BJ9A 3N6MA 1U24A 1AZSA 2XTJP 4V19X 4KKOB 1AJBA 3KK2B 1LWFA 3GZ7A 4RNHA 1UVLA 2F8HA 2A2CA 2GV1A 2CQPA 2O67A 5E7OB 1GMVA 5CABA 3FBCA 1YI2S 1S72S 2R7SA 4UPHA 5CZVA 1S0MA 5FLXU 4ED2A 1EW2A 3M2RA 4TYBA 2W7OA 2NZCA 2ZNYA 3IXQA 1TL7A 2DIUA 2QTWA 3FSYA 1GNKA 4L3NA 1Y7PA 4RBUA 3E01B 4EUVA 4N8OA 2AIRB 4A46A 3DGVA 2DNGA 3H7HB 4KAIA 1QAYA 3DLJA 4JI8F 2VHGA 1ZZNA 1S0NA 4IUFA 4WU3A 1TELA 4NLYA 3D67A 3MFHA 1WUUA 4HHJA 1S10A 5FDLA 3ZZTA 4QWDA 2HWHA 2VDIA 5AXKA 3GV5B 2MQLA 3JYTA 1QJHA
chains in the Genus database with same CATH topology
3MK1A 5LIAA 2W5VA 1B8JA 1AJAA 5LRMA 4LRBA 1KH9A 1KHKA 4UPKA 4ZGAA 1AJCA 1P49A 1E33P 1KHNA 5DLTA 5L0KA 1ELYA 3TWZA 2GA3A 2W5WA 3BDHA 4YR1A 4LR7A 4KJGA 1ALJA 4NWJA 1ZEDA 3TG0A 1URBA 4UPLA 3M8WA 1KH7A 4UOPA 2W5QA 3CMRA 4ZG6A 4UOOA 5K4PA 1HDHA 4LRCA 4KJDA 1SHNA 4KM4A 4N7TA 3A52A 4MHXA 2GLQA 5LRNA 3SZZA 1ALHA 3IGYB 1ALKA 1ANJA 2GSNA 1ED9A 4CXSA 2W8SA 1N2LA 1K7HA 4FDJA 1SHQA 4GTZA 1Y7AA 3MK0A 3WAXA 5IJSA 3UN5A 2X98A 5DLVA 5C66A 3B5QA 5GRRA 3UN2A 4FDIA 4CXUA 4QAXA 4LRAA 3T02A 1ZEBA 4LRDA 2XR9A 1EQJA 3NKPA 1HQAA 2IFYA 1HJKA 1E2SP 4ZG9A 2G9YA 2D1GA 4LR9A 4GTYA 2RH6A 1ALIA 2GSUA 1KH4A 4LQYA 5LQQA 1Y6VA 2IUCA 3MK2A 3OT9A 4GTWA 4KAYA 4LR8A 3E2DA 1ANIA 1ZEFA 1E1ZP 5L0BA 4LR2A 2W5SA 3NKMA 3Q3QA 4UORA 3DPCA 1EW8A 4NWXA 2ZKTA 3NKOA 1N2KA 4TN0A 5DLWA 3NKQA 3KD8A 4KAVA 3ED4A 5IJQA 3IGZB 3BDGB 5AJ9A 3WBHA 5INHA 1AJDA 3M7VA 1ED8A 1FSUA 4UPIA 1EJJA 3DYCA 3M8ZA 3WAWA 3NKRA 4LRFA 1KHLA 3BDFA 3UN3A 1O98A 2W5RA 3LXQA 5TJ3A 3IDDA 2W5TA 5KXAA 3UNYA 3T01A 4LREA 1E3CP 3M8YA 1ELXA 1ELZA 5EGHA 1O99A 1AJBA 2QZUA 3T00A 5L0EA 4MIVA 3UO0A 1EI6A 3WAVA 2VQRA 4MY4A 2XRGA 4B56A 2W8DA 4UPHA 5HRTA 1EW2A 3BDGA 3WAYA 3SZYA 5EGEA 4CXKA 2ANHA 3NKNA 1KHJA 5GOVA 1AUKA 3NVLA 4CYSA 4CYRA 1KH5A 4GTXA 2IUCB 2W5XA 4ZG7A 1URAA 3TX0A 1EW9A 2GSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MK1 A;  5LIA A;  2W5V A;  1B8J A;  1AJA A;  5LRM A;  4LRB A;  1KH9 A;  1KHK A;  4UPK A;  4ZGA A;  1AJC A;  1P49 A;  1E33 P;  1KHN A;  5DLT A;  5L0K A;  1ELY A;  3TWZ A;  2GA3 A;  2W5W A;  3BDH A;  4YR1 A;  4LR7 A;  4KJG A;  1ALJ A;  4NWJ A;  1ZED A;  3TG0 A;  1URB A;  4UPL A;  3M8W A;  1KH7 A;  4UOP A;  2W5Q A;  3CMR A;  4ZG6 A;  4UOO A;  5K4P A;  1HDH A;  4LRC A;  4KJD A;  1SHN A;  4KM4 A;  4N7T A;  3A52 A;  4MHX A;  2GLQ A;  5LRN A;  3SZZ A;  1ALH A;  3IGY B;  1ALK A;  1ANJ A;  2GSN A;  1ED9 A;  4CXS A;  2W8S A;  1N2L A;  1K7H A;  4FDJ A;  1SHQ A;  4GTZ A;  1Y7A A;  3MK0 A;  3WAX A;  5IJS A;  3UN5 A;  2X98 A;  5DLV A;  5C66 A;  3B5Q A;  5GRR A;  3UN2 A;  4FDI A;  4CXU A;  4QAX A;  4LRA A;  3T02 A;  1ZEB A;  4LRD A;  2XR9 A;  1EQJ A;  3NKP A;  1HQA A;  2IFY A;  1HJK A;  1E2S P;  4ZG9 A;  2G9Y A;  2D1G A;  4LR9 A;  4GTY A;  2RH6 A;  1ALI A;  2GSU A;  1KH4 A;  4LQY A;  5LQQ A;  1Y6V A;  2IUC A;  3MK2 A;  3OT9 A;  4GTW A;  4KAY A;  4LR8 A;  3E2D A;  1ANI A;  1ZEF A;  1E1Z P;  5L0B A;  4LR2 A;  2W5S A;  3NKM A;  3Q3Q A;  4UOR A;  3DPC A;  1EW8 A;  4NWX A;  2ZKT A;  3NKO A;  1N2K A;  4TN0 A;  5DLW A;  3NKQ A;  3KD8 A;  4KAV A;  3ED4 A;  5IJQ A;  3IGZ B;  3BDG B;  5AJ9 A;  3WBH A;  5INH A;  1AJD A;  3M7V A;  1ED8 A;  1FSU A;  4UPI A;  1EJJ A;  3DYC A;  3M8Z A;  3WAW A;  3NKR A;  4LRF A;  1KHL A;  3BDF A;  3UN3 A;  1O98 A;  2W5R A;  3LXQ A;  5TJ3 A;  3IDD A;  2W5T A;  5KXA A;  3UNY A;  3T01 A;  4LRE A;  1E3C P;  3M8Y A;  1ELX A;  1ELZ A;  5EGH A;  1O99 A;  1AJB A;  2QZU A;  3T00 A;  5L0E A;  4MIV A;  3UO0 A;  1EI6 A;  3WAV A;  2VQR A;  4MY4 A;  2XRG A;  4B56 A;  2W8D A;  4UPH A;  5HRT A;  1EW2 A;  3BDG A;  3WAY A;  3SZY A;  5EGE A;  4CXK A;  2ANH A;  3NKN A;  1KHJ A;  5GOV A;  1AUK A;  3NVL A;  4CYS A;  4CYR A;  1KH5 A;  4GTX A;  2IUC B;  2W5X A;  4ZG7 A;  1URA A;  3TX0 A;  1EW9 A;  2GSO A; 
#chains in the Genus database with same CATH topology
 3CGI A;  2BXJ A;  3MED A;  1UMJ A;  4CT8 A;  2IY5 B;  4WBF A;  4MKY A;  1GXU A;  1MSW D;  5HQL A;  3HZE A;  1SC4 B;  1VQN S;  2YQ0 A;  3KLI B;  2ERR A;  1FJG F;  1YSJ A;  1GMW D;  5KG3 A;  2JRS A;  2XG8 A;  4IOB A;  1UA0 A;  4ILR A;  1BWV A;  1JB0 C;  1KP6 A;  2OI2 A;  1RGV A;  1ZA2 B;  3P8B B;  1GH8 A;  4NWJ A;  4QW8 A;  2MKH A;  3OVA A;  4G3I A;  3I9Z A;  2EBG A;  3GIJ A;  1U4B A;  2PEH A;  4JI4 F;  2RQM A;  4I56 A;  3K59 A;  1QSL A;  3DMJ B;  4DZD A;  2WVF A;  2HHH J;  3CMR A;  2OML A;  3GYX B;  2V34 A;  2X1G A;  4LRC A;  3TP2 A;  4A47 A;  2VV5 A;  2IM0 A;  5ETN A;  3JAM Y;  5IS2 A;  2X1A A;  2W9B A;  4LF9 J;  1P27 B;  2E9T A;  2CAD A;  1RKJ A;  1LW0 A;  1TK5 A;  3OFG A;  1NK9 A;  2R8G A;  3EJM A;  4AND A;  4ZOS A;  1M1H A;  4EFA C;  2RSQ A;  3FCW A;  1B7Y B;  1RTH A;  4PWU A;  4RW6 A;  2AZ1 A;  2CDR B;  4MMO A;  4O3N A;  1HWJ A;  3IBW A;  3P4U B;  4EGL A;  1JLF A;  5HBM B;  4DF8 A;  1K7H A;  4FDJ A;  4JUZ A;  2WON B;  2ZBR A;  3J80 U;  2CJQ A;  2O5D A;  4IO1 A;  3U27 A;  3RW6 A;  2W1B A;  1HWL A;  4ED7 A;  5EX3 A;  1ZAW A;  4WKR A;  2IJN A;  2HWT A;  3BS9 A;  3UN5 A;  4CLS A;  1Q7L B;  1FHT A;  1B0P A;  4TYA A;  1SV5 A;  4DLG A;  2HVE A;  3JTO A;  5HLF B;  5AJ3 J;  1XNR F;  3TR5 A;  3NOC A;  1IKY B;  3IRX B;  2XB2 D;  3GB0 A;  3C6T A;  2KB2 A;  3VGV A;  3HM9 A;  1N33 F;  2XR9 A;  1YVF A;  3AXK A;  3U7J A;  3CCZ A;  3T1A A;  4GKK F;  4M94 A;  3OXG A;  1ALH A;  3PFO A;  2MZJ A;  5I42 B;  2GGP A;  5LQQ A;  2VJV A;  1QDU B;  2VAS A;  2EK1 A;  2CVI A;  3GJR B;  5EDW A;  2E5I A;  3CME S;  1FJ7 A;  4GTW A;  2UXC J;  4NWB A;  1RHR B;  3MEC B;  4F50 A;  8ATC B;  2M9K A;  3KG0 A;  3E2D A;  1SC1 B;  3LGH A;  2ZFH A;  2RVJ A;  2LXI A;  2LP4 A;  1LXN A;  1WI6 A;  3DHW C;  1UJ5 A;  2VON A;  1QD1 A;  5A8K B;  3NKM A;  1ZAV A;  3NLC A;  3MI7 X;  3DLB A;  1VRU A;  4NLP A;  2XEX A;  4MIB A;  2YNF A;  3QWU A;  1VQO S;  2GNK A;  3CMA S;  2CWX A;  2RE1 A;  4DL3 A;  2HZV A;  1IKV B;  2DIV A;  1N6Q A;  3DC2 A;  4U8Y A;  1FX2 A;  2WK4 A;  5AJ9 A;  3MAQ A;  4JI0 J;  2O01 C;  3OXF A;  3PYF A;  2P6S A;  1HNX F;  2WB1 D;  3Q8Y A;  4CH0 S;  1TU0 B;  5F41 A;  5IV4 A;  5T7L A;  1FFS B;  4ETZ A;  4DR1 J;  3NNH A;  4B9T A;  4UOG A;  1HBN A;  2D9P A;  3R5C A;  3TAQ A;  3ZO7 A;  1L3V A;  1E6Y B;  5F9L A;  4B3T J;  1T7P A;  3DOM A;  3CJK B;  4DV7 J;  2YH0 A;  3W9I A;  4N5S A;  4HTI A;  2RRA A;  1MN7 A;  2CPE A;  4NCA A;  4KE5 A;  2RHS B;  1ZM3 A;  1N5Y B;  4A8X A;  3LUY A;  1F3V A;  2DXE A;  5D15 A;  4I7F A;  1RAE B;  4AD6 A;  3KJQ B;  4M5I A;  3M8Y A;  4KH0 B;  2XC9 A;  5EHH A;  7FDR A;  2PMH A;  2AJQ A;  2DRA A;  2UU9 F;  4JI7 F;  2QV6 A;  3WIV A;  3BH6 B;  1UWB B;  1SH3 A;  3MEE A;  3TQ1 A;  2VA3 A;  2D1C A;  4G6V B;  1UW4 A;  3GR0 A;  2UV8 A;  3IG1 A;  2Y1L B;  2E1A A;  3MMC A;  4M5G A;  3ILL A;  3HXM A;  1KRP A;  5EGE A;  4N47 A;  1I3O B;  2C22 A;  5CD4 A;  2NS1 B;  2Y0B B;  3ZXW A;  4DPY A;  1B0V A;  3MM9 B;  2JH3 A;  2JVO A;  4NLX A;  4PR6 A;  1T3N A;  5A76 A;  1VBZ A;  2EXU A;  5JVG Q;  3MTK A;  1S12 A;  2P2C B;  2DHX A;  1WC3 A;  4LF1 A;  4ECV A;  2M52 A;  5KFO A;  2AJ1 A;  2VQF F;  3RB4 A;  4CYS A;  2ROG A;  5ETS A;  1KBR A;  2UUB J;  1NHU A;  1KH5 A;  1UZH A;  2DNK A;  1VOM A;  1W2B R;  2VG5 B;  2YKM B;  1N6Q B;  1B8J A;  1F9H A;  1FDN A;  3IWN C;  1PKU A;  4FPI A;  1NDP A;  1X0F A;  3FEY B;  2HQC A;  3D6H B;  1BHN A;  1TTH B;  1ZET A;  4CH7 A;  1T9U A;  3H98 A;  4HYK A;  4DSE A;  3TWZ A;  3TUJ C;  3QZ7 A;  4F36 A;  3H4B A;  4BDP A;  3DRP B;  3BDH A;  4OZ5 A;  1T95 A;  3DOK B;  1MLA A;  1V5I B;  2ABY A;  1ZPW X;  4DL0 C;  1BC6 A;  1EET A;  1RU2 A;  1WOO A;  3CDW A;  4PXB A;  5D4N A;  1CQN A;  3LAK A;  5DG9 A;  1WHX A;  4CDI A;  3S7R A;  3M8W A;  2C2N A;  3SCJ E;  5HBM A;  3HMJ G;  2BQ3 A;  1SL0 A;  1F6T A;  2B9E A;  2BE9 B;  2ZOG A;  1U2F A;  3TZX A;  1I1G A;  2DGS A;  2Q79 A;  2N7C A;  1FES A;  3LQV A;  1SJ4 P;  1B4S A;  2RML A;  2UXD F;  1SHN A;  1BLU A;  3R9L A;  1DTT B;  4CO3 A;  2WBR A;  3VQS A;  2DIS A;  5H9E K;  4IKA A;  1UWB A;  2NXC A;  1YZ6 A;  3CB4 A;  1NRK A;  5KG0 A;  2GC8 A;  1I6J A;  4O44 B;  1FXR A;  1HQE A;  3HHE A;  4YR3 A;  3G6E S;  4YME A;  2ANH A;  2V4J B;  1HI0 P;  2V2K A;  1AUS L;  1OY9 A;  4AXJ A;  2FVQ A;  1VDH A;  2HBR B;  2V8D A;  2Z4P A;  1GTE A;  1Y10 A;  2P6T A;  1BQN A;  4XDC A;  3DXS X;  1HQ2 A;  4DCO B;  2ACM A;  2ZVS A;  4ZIW A;  2ZZM A;  1ZAX A;  2UZA A;  2B4U A;  1JJ2 R;  3MTJ A;  4RWW A;  1YRT A;  2ACY A;  3JTN A;  1MRO A;  2IM1 A;  2UUB F;  4RL1 A;  4ED8 A;  5E5N A;  3IWL A;  4J9N A;  4FF3 A;  4FXW A;  4U96 A;  1T03 B;  2G9Y A;  3A3O B;  1WG4 A;  2ZH1 A;  4ED6 A;  2Z8Q A;  4H4M A;  4YR0 A;  1VR6 A;  2AGP A;  4LQY A;  3UD5 A;  1UW9 A;  1Y6V A;  3PIP Q;  5KG1 A;  2B7C B;  2E5H A;  2G4B A;  4BWM A;  4DQI A;  2C2O B;  4WFB Q;  4RR5 A;  1JXV A;  3CIZ A;  3TW0 A;  1C4C A;  3EM1 A;  4B3S J;  3QIP B;  3QRR A;  2ZUG A;  4S0M A;  3UVJ B;  1XJW B;  4PXD A;  4E8U A;  2OTL S;  1JK9 B;  2A2D A;  2ZKT A;  1Y5N B;  4Z37 A;  3J7Y I;  2MPU A;  3KK1 A;  1IR0 A;  3CCU S;  4WFX A;  1JJH A;  3ZNJ 1;  2YNI B;  3DU5 A;  1UVN A;  3QRP A;  4OX6 A;  1FKO B;  2CJA A;  3Q83 A;  5KOX A;  4J9P A;  4OZL A;  2RDJ A;  3PX6 A;  4EWT A;  2LXF A;  4ZPD A;  2DD8 S;  4PQA A;  3BM7 A;  1L5U A;  5DZ6 A;  1QSY A;  2R8K A;  3P49 B;  1KVJ A;  4NWX A;  4L3K A;  5IM0 B;  5H9F K;  4UPI A;  4NLG A;  4ZCM A;  4DS5 A;  2GA7 A;  3QO9 A;  4G1Q A;  2C3U A;  4X4S A;  2XQC A;  2ZBQ A;  4J9K A;  4X4R A;  1DRZ A;  4K50 A;  1RWK B;  1E6V B;  3N01 A;  5LMU J;  2C3M A;  4RJV A;  2GJF A;  1B3T A;  1YJN S;  1LOU A;  3IDD A;  1SH2 A;  4PG8 A;  3D3C J;  1BQN B;  1SJ1 A;  4JI5 J;  3J81 j;  2UUT A;  3H0P A;  5K14 A;  2JC1 A;  2VKR A;  2W2M P;  2LMI A;  2XYH B;  3MM5 A;  5ETP A;  3KLH A;  4R25 A;  2UVW A;  2KZZ A;  1RHK B;  3R3T A;  3RAQ A;  2DPJ A;  4Y6I A;  1QVF R;  2AYM A;  2W9A A;  4R0J A;  1SQG A;  9RUB A;  3GJS B;  2HQD A;  3FKB A;  1N4L A;  2DNQ A;  2OPQ A;  1VQ5 S;  1NEE A;  3NAI A;  4U7U D;  3DHX A;  1NLK L;  4LQ3 A;  4PYA A;  4Y2A A;  2VH7 A;  3VAG A;  1JLQ B;  5DDO C;  3TOQ A;  4LFB J;  3MR2 A;  1W26 A;  2FJB B;  4I1T A;  2MB0 B;  2D9O A;  3RYL A;  2LA4 A;  1CJU A;  3CPW R;  4R8U A;  3NKN A;  3HZG A;  4WYL A;  1Q53 A;  5GOV A;  3Q23 A;  3MPU B;  4OYZ A;  3NRB A;  1OS5 A;  2ILZ A;  1UVM A;  3DRP A;  2R2R A;  1N36 J;  4QU6 A;  2KU7 A;  4WFZ A;  5KFD A;  2AJ0 A;  4Q2L A;  4DEZ A;  4X65 F;  1URA A;  3KNA A;  2HLU A;  2UVR A;  3OL9 A;  1MWZ A;  1X7V A;  2FJD B;  1MNE A;  2HNY A;  2XI3 A;  3ENV A;  3I96 A;  1NJZ A;  4B3M J;  2DEI A;  3T9N A;  3BGO P;  3SV4 A;  2FJV A;  2ROP A;  4DV1 F;  1MU2 B;  4OZ3 A;  4QJV A;  3CT9 A;  4JI4 J;  2GVZ A;  2W5W A;  1X5P A;  3QAU A;  4R5P A;  3DRR A;  3VAF A;  3KUE A;  2KXH A;  3PHT A;  2YWF A;  3EIC A;  4C2M A;  5F8L A;  3KLF B;  4LVN P;  3KYL A;  5H1S V;  3SYZ A;  2QYC A;  4XO0 A;  2QLJ B;  5K8N A;  3LO3 A;  2A3J A;  4UOP A;  2XMV A;  1REG X;  3NWR A;  5GAE I;  5KFM A;  2DO0 A;  3W8P A;  2H5J B;  3NMA A;  3O6Q A;  2ZZT A;  1RBO B;  2CQ4 A;  1RE1 B;  1DQ8 A;  4OLP A;  4W98 A;  3SIP B;  1O5J A;  7AT1 B;  2PC6 A;  2ZKU A;  2XMW A;  2XO7 A;  2MKC A;  1NK4 A;  2UUC J;  5DRK A;  5ETM A;  1KD1 T;  4M95 A;  2RH3 A;  2JEG A;  3BGR B;  2E1R A;  4LUB A;  5LSR A;  2QA4 G;  2AYG A;  5CYQ A;  1B70 B;  1RAI B;  2WOM A;  1VMB A;  3SBM A;  1BUX A;  4TVA B;  3GJQ B;  3I5A A;  4HAC B;  4KQZ A;  3VGT A;  3Q8U A;  2Y3Y A;  4P72 A;  2ZH5 A;  3KG1 A;  2J8A A;  4H4M B;  3T19 A;  3V6D A;  1NPR A;  2HGL A;  2B9X A;  4EO8 A;  1KWM A;  1R0B G;  3W2W B;  4URS A;  5HQ8 A;  4LFC F;  1KQS R;  3DRS B;  2M88 A;  2DNL A;  1HPZ B;  2LLZ A;  3JQJ A;  4WKY A;  6FD1 A;  5DG7 A;  4WXW A;  3ZZP A;  1H72 C;  1LWE A;  4X4V A;  2N7Y A;  2YBV A;  4OX9 J;  3Q0A A;  4PZV A;  2HNY B;  2DXF A;  2J9D E;  2VFV A;  1HJK A;  4M1K A;  4D3H A;  4HTJ A;  1HNI A;  1M0S A;  1XNQ F;  2KYZ A;  1VYA A;  1FKO A;  3LA0 A;  3MXH P;  4B3O A;  1P6T A;  4RW4 A;  2RF2 B;  5KFC A;  4JBC A;  2WCX A;  3T6J A;  4C8Z A;  5L46 A;  3DLK A;  4P75 A;  2AJ4 A;  1PCA A;  1L3U A;  2IDE A;  4K2X A;  2UV8 G;  4N8N A;  2KFZ A;  1Y0H A;  1VK3 A;  3ILO A;  4LSN B;  2KTQ A;  1DFD A;  5J1E A;  3FCV A;  1REV B;  3NKQ A;  3HSD A;  2KM8 B;  4J9M A;  1JLA A;  3G82 A;  5K8O A;  4N56 A;  2VA2 A;  2MQM A;  2H4W B;  2DGW A;  3MM8 B;  1HNZ F;  2HQF A;  1FSU A;  1TV6 A;  2OEK A;  2QO3 A;  2G13 A;  2V69 A;  1H6K X;  2W4D A;  3BGR A;  3ET6 A;  4N77 A;  4O4G A;  2VQF J;  2KT2 A;  2COL A;  2HWI A;  4LVO P;  4DJB A;  2XS5 A;  1QSS A;  1GXL A;  4TQR A;  5EWF A;  3PR4 A;  1HAR A;  2UXB J;  1F1B B;  3PDN A;  4PYD A;  1PYT A;  4O3P A;  4GC6 A;  2FLL A;  4RPF A;  2RU9 A;  3M9N B;  2AP6 A;  3W8G A;  3OTO J;  1HR0 F;  4RZR A;  1BQM A;  2I9S A;  1DY3 A;  2VG6 A;  3T01 A;  5B0F A;  1R0C B;  3MEG B;  2HHW A;  2H4Y B;  4PQU B;  2F4F A;  2NXJ A;  2ZC4 A;  4TY8 A;  5IOL A;  3V6J A;  1RHJ B;  2EG1 A;  2HMI B;  1IUJ A;  1NDL A;  5HRT A;  3MCO A;  1FVQ A;  2QL7 B;  4KGZ B;  4RW4 B;  5C2C A;  4ZVR B;  3CCS S;  3C3L A;  2PI4 A;  1S4E A;  3DLK B;  1A0O B;  2YTC A;  3EDQ B;  3SCI E;  1XNR J;  4KHM A;  4X84 A;  4Y28 C;  1CLF A;  2GZO A;  1R43 A;  5IT9 U;  1N0U A;  2LQB A;  3FCH A;  4C7Q A;  5C5J A;  3IRW P;  3W1Y C;  1REV A;  1VHI A;  4ILM A;  1WKL A;  2IUC B;  1RHU B;  4J9U E;  2ZH4 A;  4DR2 J;  1HQU B;  1VBY A;  3G82 B;  1WOR A;  3QAT A;  3PYD A;  3RAX A;  4LF6 J;  3R2C J;  5LIA A;  1JLC B;  1JQG A;  4UPK A;  2VZ9 A;  4B17 A;  1S6O A;  4CNZ A;  3N79 A;  5F8M A;  4YB1 P;  3IM8 A;  3M2V B;  4MIA A;  3QGG A;  4LF5 F;  4LFB F;  1WDD A;  2FHO B;  1LXJ A;  4KFB B;  5AXL A;  4CQ1 A;  3GV8 B;  4YR1 A;  4NZ0 A;  1W7W A;  2DNO A;  4B02 A;  4LSL A;  5D0R A;  3GIL A;  1RAB B;  3TEH B;  1QTM A;  2ZZN A;  2BQR A;  3QRQ A;  2CJK A;  3DFE A;  4DV0 F;  3P3D A;  2QN6 B;  2XMM A;  1FWK A;  3BB5 A;  2K3K A;  3C6T B;  3DN9 A;  4QIW D;  5CYQ B;  5JJB A;  2W5T A;  4PCQ A;  2VQE J;  1Q1K A;  2LKZ A;  3NCR A;  3PFE A;  2ZH6 A;  4KV8 A;  3G96 A;  1YDL A;  1IKW B;  3I0S B;  4RLE A;  3HVR A;  4OYP A;  1HYS B;  4UUX A;  4RW7 A;  3FRY A;  4BLG A;  2YX1 A;  5HN0 A;  3Q86 A;  2MJN A;  3ZTR A;  5LJ3 Y;  3OSP A;  2YWE A;  1Y9O A;  4ID8 A;  5D77 A;  3DGP B;  4J9V A;  4NXN F;  4M8L A;  4UY8 T;  1ALK A;  2D7S A;  1T02 A;  1FER A;  5A8K A;  2B8Q A;  3QBC A;  3UPF A;  1U7L A;  3CD0 A;  1FJE B;  1L3K A;  2LU1 A;  1F5C A;  2AX1 A;  2VC0 A;  4OI2 A;  5CCL A;  3RTV A;  3GG0 A;  1Y7A A;  2FUG 9;  3J81 U;  1FKA F;  2EFV A;  2VIH A;  2Q3P A;  1YX2 A;  4I69 A;  4DV6 J;  1WEX A;  3GCW P;  2AW0 A;  3TNV A;  4QWC A;  1IKV A;  4A8O A;  3BGL A;  5C66 A;  4X4Q A;  1X4C A;  1R3N A;  2K8G A;  3UN2 A;  4FDI A;  2K2P A;  4Q7A A;  3JSB A;  3MFI A;  1ZEB A;  2L9N A;  1EJ7 L;  2E7W A;  4X62 J;  4P2M A;  1PAE X;  4ZDN A;  1WDT A;  4Y0F A;  4ZS6 A;  1NDK A;  2GAG C;  2Q43 A;  4I4B A;  2V2V A;  8AT1 B;  2L9W A;  2IVY A;  4B3S F;  1KH4 A;  3M8Q A;  1K1S A;  1YG0 A;  5KFU A;  2B5J B;  2U1A A;  3KJN B;  1F2G A;  5BXI A;  1BGX T;  3GFX A;  3NS5 A;  3H5S A;  2W4P A;  3G86 A;  4PG6 A;  1FKP B;  2RS8 A;  4P2F A;  5CQG A;  3KJV B;  3UCG A;  1VJQ A;  2XLI A;  2BX6 A;  4ICL B;  4EZ6 A;  2V67 A;  3NKO A;  1NKB A;  4JV5 J;  5DLW A;  4DWI A;  4EBE A;  3NGR A;  2XWX A;  3PTW A;  3ZTS A;  3CC7 S;  1FNM A;  1CUL B;  1PJ7 A;  2AHO B;  1YZ7 A;  2MYF A;  3MMJ A;  3NGK A;  2PO4 A;  3H5Y A;  1YJT A;  3SDE A;  1MWQ A;  4K4Y A;  1FWL A;  1C0T B;  3HT3 A;  2DRB A;  3DYC A;  2CPZ A;  3ILJ A;  1T3O A;  2VD3 A;  3CD7 A;  1IKX A;  4I6Y A;  3HP6 A;  5A2Q U;  2HBZ B;  4YHH J;  4K4W A;  4DN9 A;  4DU7 A;  1EQ0 A;  4Y2C A;  3DOL B;  2HW3 A;  4B08 A;  1RTZ A;  3LGM A;  4LRF A;  3CCV S;  4DSF A;  3H40 A;  4W4M A;  1CEZ A;  1HW8 A;  2VG5 A;  2YKM A;  4MK8 A;  2HSE B;  4IFV B;  5J2Q B;  2FLP A;  2CG4 A;  2LVW A;  3I56 S;  4PAA A;  2E5J A;  3RBZ A;  1KQF B;  1YWX A;  1FRK A;  3NWG A;  3RRG A;  5EGH A;  2HND B;  2EW9 A;  3D6T B;  2XY7 A;  1FA0 A;  3UO0 A;  3PJ9 A;  1N8R T;  5GAE U;  3G2X A;  1CJK A;  2OPS A;  3LAN A;  2QT7 A;  4F04 B;  3TI0 A;  1TK0 A;  3ITH A;  4A8M P;  5AXN A;  4TLR A;  1ZPV A;  5HRO B;  3NCP A;  3DLH A;  5KG6 A;  2RU3 A;  4JI1 J;  4ECZ A;  4ZPC A;  2B51 A;  3N5B A;  3NMR A;  5BYS A;  2MZS A;  3QPI A;  3PW2 A;  1CJV B;  1R8A A;  2IA6 A;  1TKX B;  2BBE A;  3EGW B;  3M1V B;  4ZP9 A;  3KJV A;  4ERD A;  3W62 A;  2N4C A;  2HRU A;  4IRK A;  5K20 B;  3EWG A;  4QCL A;  2GIR A;  2B9Y A;  1S48 A;  1BXN A;  3CVK A;  4RW9 B;  2E5L F;  1SH0 A;  4ZIT A;  3CD5 A;  3HKZ D;  4ZPV R;  1X5T A;  4NCG A;  3TVY A;  1KHK A;  2LEP A;  3IP0 A;  4LFC J;  4ZA1 A;  3CUL A;  2OP5 A;  4JI2 J;  1H7X A;  2OFG X;  5KG5 A;  3AHP A;  1JLG B;  3B82 A;  3PEJ A;  5CAA A;  1S57 A;  4CLZ A;  1IQZ A;  3UD4 P;  3A8E A;  5GAD U;  1QLN A;  1RA6 A;  1IKW A;  3I0S A;  1M5S A;  1VJW A;  1HD0 A;  2HBY B;  2JVR A;  2QE5 A;  2ASJ A;  2ATL A;  3TG0 A;  4HDH A;  1S7H A;  3B54 A;  3SSS A;  3KLV A;  1WG1 A;  2XSJ A;  2BAC A;  3GYG A;  4TU7 A;  3AY0 A;  3GQC A;  5J2Q A;  3RRK A;  3BPS P;  3BH7 B;  4F67 A;  3BO2 A;  2XS2 A;  2EC0 A;  1DTQ B;  1YRX A;  3CJ2 A;  1J5E J;  3QT5 A;  1YTY A;  3M8P B;  1VQY A;  1C1C B;  2DR7 A;  2FHK A;  2AF6 A;  2YKN B;  1N32 F;  1F9F A;  4YQW A;  1Q8K A;  1RYS A;  3TA2 A;  4FBT A;  2GSN A;  1ED9 A;  4RKU C;  4CXS A;  1AW0 A;  4BC9 A;  1S9E B;  3D0G E;  5KFQ A;  2RUG A;  1K9M T;  4DR4 F;  2QC3 A;  2J8S A;  3FUY A;  2Z58 B;  4OYW A;  2WTF A;  1EP4 B;  2KT3 A;  2KHC A;  1YJ9 S;  2AQ4 A;  2Y8Y A;  5DO2 A;  2O3D A;  3M8Q B;  4HHU A;  1HNZ J;  3B5Q A;  5GAG I;  1ZTW A;  4GVL A;  5C42 A;  2OEL A;  3M2R B;  3QGP A;  4F4Z A;  1Q0N A;  1SQE A;  2EVZ A;  4FXV A;  1PYS B;  4OX7 A;  4U7U K;  1E2S P;  5J2N A;  2UXB F;  3IBF B;  3QO9 B;  4CTA A;  4KJI A;  2KRR A;  5HAO A;  4X4U A;  2D1G A;  3MM7 B;  3CUN A;  1GFW B;  5FDL B;  2YWH A;  2CQI A;  4ZVO B;  2H3E B;  1S1W B;  4X64 J;  2KM8 C;  1DLO A;  1S1U A;  2C2M B;  2G2O A;  5LMN F;  4IOC Q;  3TAM A;  1RTI B;  4DV3 F;  2I1R A;  4KKO A;  2A10 A;  3MZI A;  3KHG A;  2MKJ A;  3JSM B;  3HO1 A;  5DDQ C;  5INH A;  1HNV A;  4DL6 A;  1TVR A;  1RT7 B;  1SUQ B;  2CJX B;  4QIV A;  1S49 A;  2HRY A;  2IRY A;  4G1P A;  2J0W A;  5IJQ A;  1DAR A;  1IVZ A;  1WWH A;  1IXK A;  3I82 A;  3E01 A;  2NUH A;  2LEC A;  5E2Q A;  1ANI A;  3G9C A;  2YKA A;  5CH7 B;  1WHV A;  2F65 A;  2Y0S D;  5F3T A;  1HA1 A;  5C25 B;  5M2P A;  5B0G A;  2W9B B;  1ZYQ A;  1R7I A;  1ZOT A;  4NYP A;  2CPX A;  1FRX A;  5IFM A;  4QYZ J;  1ZS6 A;  5KXA A;  4IG0 B;  4ZLP A;  4ECT A;  1VGY A;  4OIX A;  5E3C A;  5ETL A;  3SFU A;  1U2C A;  2GQQ A;  4O23 A;  3UD3 P;  4MFB A;  3FBF A;  1JLE B;  3PYE A;  5B0B A;  3GIM A;  1ELX A;  3AJ2 A;  3B78 A;  1HBM B;  1CJV A;  3CDE A;  1CS4 A;  1U0H B;  4IRD A;  1ZBT A;  5L1I A;  3DRR B;  3HHN B;  1L3T A;  1DQA A;  2B3T B;  5G0R B;  2R7X A;  4NEY A;  4A8K A;  3NY0 A;  5F8J A;  1OO0 B;  1VBX A;  1EX8 A;  3VAM A;  4C8O A;  1XBW A;  4M5N A;  4GO7 X;  4DI6 A;  1VRT B;  3MR7 A;  4ZLL A;  2ZH7 A;  1KH9 A;  1Y00 A;  1J5E F;  2VJU A;  1WTF A;  3MM9 A;  2BAN B;  1X4B A;  3HSZ A;  3VV2 B;  5M2R A;  1D9F A;  2QMU B;  1KR4 A;  1RT7 A;  1SUQ A;  4MH8 A;  5KFL A;  3KFW X;  2POK A;  1WEL A;  2JSX A;  3GTY X;  4V1A k;  4ZPB A;  3TX0 A;  1HMV A;  3ZZ0 A;  1YRU A;  5E3Q A;  3M8S A;  1R8B A;  1XR6 A;  3KHR A;  2CRL A;  1M5O C;  2W5V A;  2XLJ A;  4FS1 A;  4URG A;  4ZGA A;  1UTA A;  3RR8 A;  1E33 P;  4XIU A;  4JI8 J;  4KO0 A;  2J7U A;  1A9N B;  1VRU B;  4OX8 A;  1GEH A;  1KN6 A;  4DPO A;  1DTQ A;  1GX6 A;  2W2Q P;  2M70 A;  5KFR A;  1CBK A;  4DL4 A;  3W2W A;  3BZQ A;  2YX4 A;  4DBQ A;  4PRF A;  3DRS A;  3FBB A;  3I4P A;  4WFY A;  4NLR A;  2DGQ A;  2FYX A;  5A6P A;  2FZG B;  3RUB L;  3EVM A;  2DCL A;  3OSN A;  1IBK J;  4K0K F;  4NA1 A;  1K0T A;  1HNW F;  4UPL A;  4YS2 A;  3KWM A;  1HHT P;  1S9G A;  5E41 A;  2QA2 A;  1Q8L A;  3EXC X;  3Q8Q B;  1HBO A;  4F7V A;  3AD8 C;  4RU2 A;  1HBN B;  1JLE A;  5KFT A;  2CNO B;  2FIU A;  2DXD A;  4QPX A;  1FF2 A;  3OV7 A;  3M8R A;  3L3C A;  2V50 A;  4OQJ A;  3H4D A;  4KM4 A;  1KS2 A;  5J1N A;  4CH1 A;  4RUB A;  2DGV A;  4NRT A;  1D8Y A;  1RTD A;  3BSA A;  4F4K A;  4K0K J;  4U95 A;  2HS3 A;  4YB6 A;  3D4J A;  2HAF A;  1N0V C;  2YWK A;  3BRE A;  3TUZ C;  4TQS A;  2J0X A;  1IJE B;  2ALZ A;  1SJF A;  1I94 F;  1TR0 A;  2OSQ A;  3LF0 A;  3UE2 A;  3HVT A;  4O3O A;  4ALZ A;  1Z4U A;  1TMM A;  3DU6 A;  1C2P A;  1VRT A;  2JDJ A;  5DLV A;  2P5V A;  1JLA B;  3H20 A;  1WOS A;  2GCF A;  2F5G A;  2WBM A;  3P45 B;  3QLH A;  3ZTO A;  4JI5 F;  5T7L B;  4LRD A;  1S1U B;  3ET6 B;  4O4G B;  2E29 A;  1HMV B;  3H2L A;  3TAM B;  2GJI A;  2VFU A;  3JSM A;  4DFM A;  1ZTT A;  1UFW A;  2KXF A;  1U1L A;  2DHG A;  2GSU A;  4P71 A;  2PMZ D;  4WWS A;  1X9W A;  4KR0 B;  3OFE A;  2R7W A;  4DCJ B;  3BSN A;  3HLU A;  1N34 J;  4RX6 A;  3W5Z A;  4F0H A;  2APO A;  2UUC F;  2HHV A;  5ETR A;  4O3R A;  2GML A;  1ZM9 A;  3CDA A;  1U6F A;  4JB8 B;  3CCR S;  4DFJ A;  4F25 A;  3T1Y J;  2FVP A;  4HDG A;  1N2K A;  4KBI A;  2KJV A;  2RD5 C;  4PG4 A;  5SZT A;  2HS4 A;  4LF4 F;  1JWW A;  4FYY B;  2CQC A;  1HI8 A;  5ETK A;  5L9X A;  3HHD A;  1HFE L;  5D78 A;  2Z56 B;  3HFV A;  1AT1 B;  3I31 A;  1EET B;  3D6M B;  1NJX A;  2PE8 A;  4K4S A;  3U1M A;  4ZVG A;  2G2Z A;  2LU2 A;  4NI2 B;  1S6U A;  3DDK A;  2V8V A;  3F56 A;  3FRZ A;  2DR9 A;  1VQS A;  5DS7 A;  3CTR A;  3T9Z A;  1RT3 B;  3K7R A;  4DV6 F;  4RUC A;  1X8D A;  5U47 A;  4DR1 F;  3MAH A;  3GE9 A;  3CIM A;  3G6V A;  3K57 A;  3T5L A;  5SUH A;  3JQM A;  4C9D A;  5DDR C;  5FII A;  5CXT A;  2W5R A;  3LP1 A;  4OYB A;  3TJA A;  4GKJ F;  4AQY J;  4LSZ B;  5DGA A;  3LH2 S;  2CAJ A;  3BN7 A;  3N4W A;  3K58 A;  1YK9 A;  2NSC A;  2PGC A;  3W64 A;  3V6K A;  2JWN A;  5HJX A;  5BYR A;  3C2P A;  2V4J A;  4OI3 A;  3PIO Q;  3G4S S;  3M2U B;  4BS2 A;  2ZH3 A;  1EI6 A;  2BAN A;  4MY4 A;  1UEV A;  4ZN3 A;  2GHW A;  3ISZ A;  2QSW A;  4C0B A;  2ZVI A;  2HHP A;  2FLO A;  5A2Q Y;  1LWC B;  2H54 B;  3TVK A;  1CG2 A;  1VS3 A;  3GG1 A;  1EKS A;  4F2S A;  2F63 A;  3GMG A;  2FJA B;  4C11 B;  5D3G A;  3AD7 C;  3Q8V A;  4J9R A;  1CPZ A;  4CT9 A;  1D09 B;  2MQ8 A;  2Z30 B;  2JFK A;  4F0M A;  5F9N A;  4LF5 J;  3TO8 A;  3EZO A;  2NQP A;  1NZA A;  3RBD A;  2OFH X;  2V9W A;  4JOU A;  2GIQ A;  1Z2Z A;  1T9W A;  4H54 A;  1S79 A;  4Y34 A;  2IMW P;  2MKI A;  1EW9 A;  3AOC A;  2M3D A;  4G1I A;  3Q8R B;  2B4O A;  1TKD A;  3DCA A;  5CYM A;  4ECS A;  3EGN A;  3FNN A;  3MCN A;  4ED4 A;  1RXO B;  1BMQ B;  1RT4 A;  1QAJ A;  1NBE B;  4KGM A;  3MAA B;  3BKF A;  4P73 A;  2Y9H A;  2V8H A;  3T5H A;  5IJS A;  1SJR A;  3V2U C;  3N28 A;  1ALJ A;  3CJR A;  3VTI A;  1LV5 A;  4KHP F;  4JV1 A;  4AYB D;  4UQG A;  3Q8S B;  1VQP S;  1UEK A;  4ECX A;  3LP1 B;  1X4D A;  1H7W A;  1FK9 A;  1KHW A;  2GVD A;  4UQT A;  4C97 A;  5L38 A;  4OZ2 A;  5DM7 Q;  1VC0 A;  2VKZ G;  2GX8 A;  2E9Z A;  2BM1 A;  1PC4 A;  1TL1 B;  3LPY A;  4X2B A;  5K4P A;  5A0Y B;  1E6V A;  4LFA J;  1KVI A;  3NGD A;  5G4D A;  1X4H A;  4ES1 A;  3EVW A;  2WHO A;  2IJR A;  3NXZ A;  1RBL A;  2MGZ B;  3KUG A;  1K8A T;  4LT6 A;  4B9M A;  2XGQ A;  3MM5 B;  2EFG A;  1YQH A;  4MJK A;  5DJB A;  4LF8 F;  3ZTP A;  3KTQ A;  2CJY B;  3GYN A;  4MAK A;  3VR1 A;  3C16 B;  4B9U A;  2XNR A;  2XHW A;  3C14 A;  2KXN B;  1OJ4 A;  2HVZ A;  3O44 A;  3CW2 C;  2A1B A;  4EYI B;  1SKW A;  5KFP A;  2HK3 A;  5JXS A;  2CZV C;  1MG7 A;  4O0I A;  3F44 A;  2JEJ A;  2QZ8 A;  1FCA A;  2DBB A;  2MHN A;  3FSX A;  3HDS A;  3OPK A;  3R5G A;  3OUY B;  3KK3 A;  1Q78 A;  3QYY A;  1JLQ A;  2ZH2 A;  1EQJ A;  2NSB A;  2QIF A;  5CYM B;  1D0E A;  3P5T L;  1FEE A;  3HJV A;  2KRB A;  2YQ3 A;  3CJQ A;  3L7O A;  1RAH B;  3MMB B;  3W65 A;  4MT1 A;  5LMN J;  4DR5 J;  1HNI B;  3M05 A;  1W2I A;  2VIC A;  2LDI A;  1FE0 A;  1Q8B A;  2C28 A;  1ZEF A;  1NK7 A;  1EKR A;  1PC5 A;  1LFP A;  1RB0 A;  1YJV A;  3FC9 A;  2D41 A;  2MY7 A;  4OZN A;  2KVI A;  4DL7 A;  3E3X A;  3ENA A;  4CCH A;  4C8K A;  4UOR A;  1DZ5 A;  5D0H A;  3J7Z T;  4DX7 A;  2EK6 A;  3WX4 A;  2D69 A;  4OX9 F;  3UI3 A;  1I5O B;  4XTT A;  2P8I A;  1TFW A;  1CJK B;  2OPS B;  2XCP A;  2ZDO A;  3PRV A;  2R7R A;  3IC1 A;  3KUH A;  1RLC L;  5F0W A;  2QYG A;  1RHQ B;  3GIR A;  4ZK7 M;  3BQ2 A;  1KQK A;  4CYU B;  1KLM A;  1JLF B;  5GAD I;  2MGZ A;  4R8U B;  3C46 A;  4MYT A;  3Q8P B;  2BVZ A;  1KC8 T;  5HSP A;  2RIJ A;  2H51 B;  2VG7 B;  1CVJ A;  4IG3 A;  2GQC A;  2QMW A;  5IQ6 A;  3C14 B;  4KRW A;  5KFY A;  4C3M A;  2F40 A;  5BR8 J;  3LXQ A;  1R6V A;  1FD2 A;  5KAK A;  2ASD A;  1V5V A;  2EEY A;  2QLW A;  3CDU A;  2WOM B;  1TP7 A;  1KHV A;  4LJM A;  1WHW A;  1VQ9 S;  1VK8 A;  1S9F A;  4OZ1 A;  4HAC A;  4WE1 A;  4OJ3 A;  5KT4 A;  2ZE2 A;  4KGK A;  3GJT B;  2FB0 A;  4YY3 J;  1VQ8 S;  1MN9 A;  3ENQ A;  4K4U A;  4NLV A;  2XRG A;  3VVT A;  2ZWO A;  2KG1 A;  4B56 A;  1IM4 A;  1S5Z A;  2GFF A;  2X3G A;  1Q79 A;  2YWW A;  4P10 A;  5K8P A;  3DXB A;  2OEM A;  4FKX A;  2QA1 A;  4Q43 A;  2MDA A;  2PD1 A;  4B3T F;  2RUS A;  2XLK A;  4LMZ A;  4LF9 F;  3VGS A;  2BW7 A;  2C1E B;  4CO1 A;  4ECU A;  2VBW A;  2WVE A;  4CO5 A;  2B43 A;  2XZD B;  2J6T A;  4F3Q A;  1UJ6 A;  2ZOM A;  2CQH A;  3A8K A;  3C6U B;  4LBH A;  1AXQ A;  2HEK A;  4PEO A;  4RU9 A;  3PZP A;  4RUA A;  2BKN A;  3PO5 A;  3SFG A;  3Q2T C;  5LRM A;  4PWD B;  3FQK A;  1SPB P;  2XCA A;  2BEF A;  3RRH A;  1ZH5 A;  3JSR A;  1QM9 A;  4A8Y A;  3GFH A;  1Y3K A;  2B8P A;  1LWX A;  4A8W A;  4WTO B;  2CDQ A;  3IFE A;  2UP1 A;  1HNW J;  1HPZ A;  4YP3 A;  3ELH A;  3K5O A;  1S7I A;  3QNW B;  4IG3 B;  4ZCK A;  3CJS A;  3K8V A;  4ECQ A;  2Q6C A;  5KFI A;  4MTP A;  3ZNU A;  3FEZ A;  3KMS A;  1UET A;  2BJ3 A;  2CZ4 A;  2VOD A;  2BJD A;  3JSY A;  3VAI A;  4ZHR B;  4ZP8 A;  2BRL A;  2FGC A;  1DJ0 A;  4BWJ A;  4ZLJ A;  5KT2 A;  4C98 A;  3TEG A;  4EBD A;  1UVJ A;  2HZC A;  4CTA B;  1NJW A;  5A8R B;  2DY9 A;  4UOO A;  2ZJQ Q;  2E7X A;  5KT5 A;  4HLB A;  2R2T A;  1TQL A;  2GMH A;  2YPZ A;  4NMX A;  4U6P A;  4KJD A;  5L1K A;  3BDP A;  2OSR A;  2HFU A;  3HCX A;  2F8E X;  4ZCL A;  3QFW A;  4OYA A;  2ZOF A;  4MKV A;  4RW7 B;  3OQ2 A;  4LSN A;  3T3F A;  4OJH A;  3V4I B;  4N76 A;  4NXM J;  4ZJL A;  2VFS A;  4DR5 F;  1DAX A;  4DN0 A;  2AZ3 A;  5D4O A;  3ZFV A;  4DMZ A;  2IVM A;  4AE5 A;  2X98 A;  1FDB A;  1WC4 A;  1Y11 A;  4ZLN A;  1N88 A;  1RQ0 A;  3MR6 A;  2KZM A;  2IBK A;  2PN6 A;  4L76 A;  1I51 B;  1S59 A;  1UAW A;  2AEF A;  5EN1 A;  1UL3 A;  3H25 A;  2ZD1 A;  4V19 J;  3BGU A;  1T0T V;  1NK0 A;  1IBL J;  4A8F A;  2IFY A;  4ZG9 A;  2W4C A;  1S6Q A;  1UFK A;  4LR9 A;  1N54 B;  1TUW A;  1WHY A;  2RH6 A;  3PO4 A;  4F2R A;  2J7K A;  3PW0 A;  2DIT A;  2EFN A;  1NPK A;  1JNZ B;  1U1M A;  3S6E A;  2HYI B;  1IJF B;  3HHK A;  1VCT A;  4DU8 A;  2Y8W A;  3MR3 A;  2DNN A;  4DSJ A;  4KHP J;  4WYW A;  2W2N P;  3GU0 A;  1ZM4 A;  4WFN Q;  4LR2 A;  2DB1 A;  1OPI A;  3L7U A;  4DOZ A;  1Q5Y A;  3PM9 A;  2Y1J A;  2C2E A;  1FRM A;  4JP8 A;  4C8Y A;  3HHL D;  3LP2 A;  2WSC C;  3VQT A;  2DT9 A;  3GFZ A;  3MMA A;  4X62 F;  3CNQ P;  4OYO A;  1A7G E;  3HKW A;  2C2D A;  3EZU A;  3KOA A;  3ED4 A;  2JLF A;  2QL5 B;  2MKS A;  5IC6 B;  4KAV A;  1OYD A;  2YNH B;  3MDF A;  1AJD A;  3M7V A;  3ONQ A;  4UTG A;  5IZH A;  1FX4 A;  1M1G A;  3V4I A;  4LF7 J;  2A0F B;  4WXO A;  3CC2 S;  3QGH A;  2J0S D;  3NNA A;  3MEK A;  2QRR A;  5F8H A;  3TAN A;  2CQ0 A;  1U1K A;  2AEM A;  3AB4 B;  3IGN A;  4L73 A;  1NZ8 A;  3CXC R;  3VAL A;  4RW8 B;  2RQ4 A;  1S97 A;  1VQL S;  2OEJ A;  3FVY A;  1PJ5 A;  1RT6 B;  3MPW A;  2BYC A;  4KFB A;  4M5K A;  5AT1 B;  1WC1 A;  2FJW A;  4PXC A;  3W9H A;  2W8L A;  2XYP B;  3DMJ A;  3SCK E;  4CLT A;  1B7F A;  1JLB B;  1JMT A;  3AFG A;  5AJ3 F;  1NK5 A;  1HI1 A;  4GC7 A;  5J2M B;  1T9X A;  3BDG A;  1G6B A;  1NK8 A;  5L0E A;  3WAY A;  3CED A;  3N6L A;  4CIO A;  1R8P A;  5LMU F;  4DSI A;  3IR6 B;  2ZC3 A;  4OJG A;  2SXL A;  2UXD J;  1HBO B;  2W8S A;  3A8I A;  4F8R A;  2HFO A;  5I3U B;  2WON A;  4DG1 B;  3QFH A;  4EYH B;  4GTX A;  3SQO P;  1TKX A;  3M1V A;  2QMX A;  3IMQ J;  4QIG A;  4ZG7 A;  1RWP B;  4OI4 A;  2ZHO A;  1YJW S;  1T05 A;  5HMX A;  4K5S A;  2KG0 A;  3ILI A;  4LFA F;  5CHC B;  2MLX A;  1AJC A;  4PG5 A;  1Q16 B;  4NCG B;  3PJX A;  1NDC A;  1ELY A;  3NGU A;  3O8W A;  5LSO A;  5LT5 A;  5IWA J;  2K3I A;  3AAW B;  2EFQ A;  4J37 A;  2RKI A;  3N9U C;  2J9D A;  3QLH B;  2KHD A;  2HUR A;  1ZED A;  2R8J A;  4IR1 A;  3TA1 A;  4NML A;  3TVZ A;  3ULH A;  1YHQ S;  5K14 B;  4Y3C A;  4Z7Y A;  5L8R C;  1RA7 A;  3ENW A;  4CO0 A;  3DDI A;  1FJG J;  1PO6 A;  2OHD A;  2KN4 A;  1DUR A;  2XZW A;  1NSP A;  1RWO B;  5KFZ A;  1LW2 B;  2PT0 A;  2Q6B A;  2PMW A;  3R5D A;  3VWS A;  5J1P A;  4K4T A;  9ATC B;  3G8Q A;  4FNI A;  5K5M A;  3US5 A;  1HD1 A;  2CUY A;  1PAU B;  4HI1 A;  1RWW B;  2AU0 A;  3SZZ A;  1Y3J A;  3LP0 B;  2JHE A;  1CSJ A;  3I4H X;  2OD6 A;  3R5A A;  3I87 A;  4R0E A;  2W25 A;  4RUH A;  3ISN D;  3WZ0 A;  3CD6 S;  2QJ3 A;  1N2L A;  2NXN A;  5IWA F;  3JAM U;  5CZX A;  2J6S A;  1WC6 A;  4M5D A;  2R7T A;  2DNH A;  4USV A;  2X1B A;  2UU9 J;  4JI7 J;  3WC0 A;  1VQ4 S;  4YDX A;  4EU0 A;  4HI2 A;  3OJU A;  2P9G A;  2PEB A;  2NPI A;  1TL3 A;  2DK2 A;  3CO9 A;  1HWU A;  4P2X A;  4CO2 A;  4DR3 J;  2DVI A;  1E3C P;  2IDL A;  2MZR A;  2NXE A;  2CQ1 A;  2CWK A;  2VDH A;  3MED B;  3MM6 A;  1JX4 A;  4OHW A;  3FEX B;  2QEX S;  4H4K A;  3IM9 A;  1RCO B;  2J76 E;  2V63 A;  2ZWP A;  1TK8 A;  1WNE A;  3NKP A;  1IKX B;  2E9R X;  3WDO A;  5IT9 Y;  1X4E A;  1DHM A;  3DLE B;  1U49 A;  4CLL A;  3TRG A;  1H74 A;  2V94 A;  2AYE A;  2W24 A;  1DBD A;  3ETM A;  3QGI A;  2EKY A;  5J2N B;  2QA4 S;  3KXD A;  3MM7 A;  3MOJ B;  4NAS A;  2YVS A;  4YN3 B;  2D3O R;  4LR8 A;  4ELU A;  1BWE A;  1NXI A;  4J9L A;  2F3J A;  4WZM A;  1HBU A;  1XNQ J;  2IRX A;  2W9C B;  2V6A A;  3C15 B;  4CP5 A;  1RHM B;  1GAO A;  1JLG A;  1RCX B;  1RAG B;  1U02 A;  2W7A A;  1RLD A;  4KT0 C;  1XEZ A;  5E33 A;  2UUA J;  3HVA A;  1FEH A;  2JL9 A;  4DPT A;  1H2U X;  2M4M A;  1X9M A;  3UR0 A;  1RTH B;  1TKZ B;  2LDY A;  3KMQ A;  2B6A A;  1OY6 A;  4I6A A;  4YFU A;  3WBH A;  1ED8 A;  4AQY F;  3CCT A;  3NEK A;  3CMQ A;  2XSJ B;  3H59 A;  4O3S A;  3H5X A;  1T9V A;  1TAQ A;  2AV5 A;  1UJ4 A;  3V6D B;  1S76 D;  2CQ2 A;  4NLU A;  3N6N A;  2DYA A;  2IVF B;  5C2G A;  1WG5 A;  4WII A;  1SV5 B;  4CLW A;  2YKQ A;  3DLG A;  3TZZ A;  5AXM A;  2O66 A;  5C25 A;  3AOB A;  3M8P A;  5TJ3 A;  5A8W A;  5EGY A;  3LAL A;  2FHM A;  4MKB A;  3WC2 A;  1JXE A;  2Z2Z A;  5GVQ A;  1SJQ A;  2FPH X;  4FS2 A;  4KGV B;  4EI2 A;  3QT7 A;  4JYA F;  5HK4 A;  3S01 A;  5HMW A;  3BR9 A;  1S9E A;  1B64 A;  1WSR A;  3UQS A;  2GGP B;  4DV5 F;  3RU0 A;  4DFP A;  1RT1 A;  1BD6 A;  1ELZ A;  5HVH A;  3EXY A;  4WFA Q;  2HHH F;  1GK8 A;  3NOG A;  1NKE A;  1TAU A;  3W3S A;  4FYD A;  2CJB A;  1MWY A;  2J7W A;  1XTZ A;  4EBC A;  3PW5 A;  4M5M A;  3QWP A;  2J5A A;  5C42 B;  3SZY A;  4Q5V A;  4CXK A;  3OTD A;  1IBM J;  1WSV A;  2CYY A;  1U1Q A;  4ZIV A;  4F4A A;  1PGZ A;  1VQK S;  4B9L A;  2XSF A;  1SC3 B;  4GVB A;  1JXL A;  4XPE A;  1KQG B;  1OY8 A;  5C24 A;  3AB2 B;  4DR6 F;  1O8B A;  2LA6 A;  1UVI A;  2VB6 A;  1APS A;  4RWX A;  4ED1 A;  2ZBC A;  1K0V A;  1LKZ A;  1KFD A;  3D1H A;  4OHX A;  4DL2 A;  1Z2L A;  2C3P A;  4M5H A;  2CG8 A;  3H5U A;  4JI6 F;  4WCE Q;  2YNG A;  2BJ1 A;  2ROE A;  3CJT A;  3C16 A;  5DLT A;  3PW7 A;  3M6V A;  3AA8 A;  4OI0 A;  3CJK A;  3DM2 B;  3LTO A;  5DQG A;  1YJU A;  4ITS A;  3LW5 C;  1NSQ A;  2CJ9 A;  4BCA A;  4Q45 A;  4RNM A;  3VAK A;  1WTB A;  1UWA A;  3LOU A;  2EPI A;  5ETV A;  2HS0 A;  4XPC A;  1Y5I B;  5ADZ A;  2XM3 A;  4USK A;  1BQM B;  1SXL A;  3RB6 A;  2VBY A;  5IV3 A;  1IR1 A;  1SQF A;  3TX8 A;  2W5Q A;  4GKK J;  4OI1 A;  1IWG A;  3WBZ A;  1RAO A;  4W92 B;  2MLZ A;  3MEE B;  3UCZ P;  2DHA A;  1TL3 B;  5B09 A;  4PAB A;  3H2V E;  2ZHA A;  2YNI A;  3BQ0 A;  4USW A;  1URN A;  2IYG A;  2MZT A;  1DLO B;  4LQ9 A;  2Y1R I;  3PKY A;  4DUZ J;  4PG7 A;  3WQP A;  3NBP B;  4DX6 A;  3B8H A;  2ZUA A;  3O2I A;  3OR2 A;  3OTE A;  1AUD A;  2E1C A;  4UY8 5;  5IM0 A;  4GTZ A;  2B9W A;  4IRC A;  1VFJ A;  4UOC A;  3U1L A;  4GO5 X;  2FQQ B;  5E3P A;  5LJ5 Y;  2RB7 A;  3O1L A;  2RRN A;  2XYG B;  1HQU A;  1RWX B;  4AL7 A;  2ASL A;  2EC2 A;  1LEO A;  1JLC A;  3EE3 A;  1HBU B;  3THT A;  1KLM B;  2A6O A;  3ETO A;  2FVR A;  4P7T A;  4JI3 J;  1N5S A;  1R8H A;  2E7V A;  1X0P A;  1WF0 A;  1LFW A;  2M7S A;  3BF4 A;  3M2V A;  3PR5 B;  1FXD A;  4QBU A;  4K4Z A;  5L1L A;  3UFC X;  2H5I B;  1YBU A;  2FHJ D;  1RWM B;  3DOK A;  3CCE S;  1AFJ A;  1UPP A;  2CA9 A;  4B3R J;  1H38 A;  3DM2 A;  3FJ2 A;  1WKJ A;  1Q95 G;  4KPC A;  2LFV A;  4IG0 A;  2IPO B;  3K2Y A;  3M32 B;  4P9S A;  5F8G A;  1N48 A;  2IJF A;  4WP3 A;  4MFB B;  4ZVU B;  2IM2 A;  5LSL A;  2V4R A;  4C4W A;  5C7P A;  2JFD A;  1D9A A;  1AYE A;  1Y4Z B;  1CS4 B;  3V4M A;  3BO3 A;  4DV5 J;  5DLG A;  3KLE A;  1DTT A;  4Z7C A;  4DUY J;  1V6H A;  4H4O A;  1GMU A;  2FY8 A;  3M30 A;  2CNK B;  2KKH A;  4O4R A;  2V2Q A;  3X1L B;  5HI7 A;  5HMY A;  3OHB A;  1HQE B;  4NZ6 A;  3I5C A;  4USM A;  4ES3 A;  4P2S A;  1FRI A;  6AT1 B;  4ED0 A;  3ZZO A;  1K47 A;  2XMJ A;  1C0U A;  1NPP A;  3R6G B;  1WF1 A;  4J5O A;  5GME A;  2UVU A;  4NZ7 A;  3BDE A;  4K5R A;  2WVC A;  2CNN B;  3M8Z A;  4UW2 A;  3W63 A;  4DPW A;  3NP5 A;  1GQE A;  1HWI A;  1MU2 A;  5EX0 A;  4ZKA A;  4F4W A;  3R1H A;  2DJW A;  2FVS A;  3HSJ A;  3PYG A;  3QQC D;  2UVV A;  2WVD A;  2BKO A;  2C2K B;  1RP5 A;  2V68 A;  1B0T A;  3E8O A;  5KFB A;  1XC9 A;  2HIQ A;  3O3L A;  1S1V A;  4IQM A;  4OV6 A;  3FBE A;  2W7P A;  3T00 A;  5DM6 Q;  2DGU A;  2AEJ A;  1OYE A;  1FDD A;  1ARO P;  2DGX A;  2W2P P;  3BN4 A;  3N0V A;  4UUW A;  4CM0 A;  3DNC A;  5C24 B;  1F60 B;  4X4N A;  3MPD A;  1U6Z A;  1LW0 B;  2E44 A;  2BJE A;  4O0N A;  2OPP A;  1OQ3 A;  3B6B A;  2XMU A;  4NLS A;  3UVJ A;  1NB2 A;  4DUZ F;  2IHR 1;  2L08 A;  3IAM 9;  3F0N A;  4U9R A;  4WU2 A;  4DQQ A;  1FKP A;  4DF4 A;  1VC5 A;  3MCM A;  2H65 B;  2JLE A;  3KG4 A;  4HT5 A;  2CNL B;  4UZC A;  1KDN A;  4ICL A;  2MKK A;  1XMO J;  1U6B A;  2HHU A;  4I2Q B;  4ZP6 A;  1RU1 A;  4I2P A;  3CC4 S;  4WK1 A;  1XMQ J;  2RHQ B;  1D3W A;  3QAE A;  2FHJ A;  5ETO A;  2F4V F;  1ICE B;  1LNQ A;  1G4C A;  2G0I A;  3GLJ A;  4IH7 A;  1GX5 A;  2YH1 A;  3M30 B;  5HLF A;  1N32 J;  1RAD B;  3GR1 A;  3OFH A;  4GMK A;  4DUY F;  4QQB A;  4CI0 B;  5GAH I;  1EQM A;  1TUV A;  2P9C A;  3D68 A;  2XHC A;  3LPE A;  1KHN A;  5L0K A;  2CIM A;  3K8W A;  5DQH A;  4M5L A;  3G6Y A;  1C0U B;  2OPR B;  3L9Z A;  2GO8 A;  1V3Z A;  2BAB A;  2RDI A;  3DDN A;  3VZI A;  1O6X A;  5EWG A;  1Q5V A;  4NYZ A;  4ZMM A;  3JB9 k;  3KLH B;  4DR2 F;  5HVG A;  5KT3 A;  4NI2 A;  2J0Q D;  2BDP A;  3RBE A;  1N5Q A;  2HHT A;  1R27 B;  1TMJ A;  4ER8 A;  2HND A;  1JKH B;  2Z0G A;  1RT3 A;  3R97 A;  1DQ9 A;  1RT5 A;  2OPQ B;  5J1E B;  2HQI A;  3A1Y G;  2NCK L;  4UF4 A;  3BGF A;  3W5Y A;  4MHX A;  3FDS A;  2WW8 A;  3PRB A;  2NR0 A;  3CJ8 A;  5A0Y A;  2J9C A;  4P7V A;  4DR7 J;  2I5J B;  2RQK A;  3PHE A;  5LM7 E;  1X60 A;  3TUI C;  2HFN A;  2IMO A;  4NEZ A;  3MM8 A;  2DO4 A;  4L75 A;  1UEU A;  1TV6 B;  1M5K C;  4MK9 A;  5KFF A;  4ED3 A;  4DUT A;  1VQM S;  2ALY B;  1HNX J;  1PIE A;  1SKR A;  1K1Q A;  3VZH A;  3KKF A;  4I2P B;  4WPA A;  3BSO A;  1RAF B;  1RT2 B;  1KTV A;  3BR8 A;  5DET A;  2JJ4 D;  2YNH A;  3AJ1 A;  3UR3 C;  1VC6 A;  5F8N A;  1LWC A;  4OI6 A;  3TQE A;  2MTL A;  3OL7 A;  1PJ6 A;  1U47 A;  1HQA A;  3JXO A;  3VAJ A;  4J9O A;  4DQP A;  5CA5 A;  5KT6 A;  2G1D A;  2VQE F;  3D3B J;  1F5B A;  3NS7 B;  1EIY B;  3K5P A;  3PKM A;  3K17 A;  1ALI A;  4DX5 A;  3AOD A;  3M4X A;  4TU8 A;  3QT6 A;  5IQQ A;  3KLF A;  4DQS A;  3R6L B;  3DKD A;  2OJ3 A;  2A6M A;  4P52 A;  4YEA A;  2IAJ A;  5AE3 A;  3F41 A;  4NA2 A;  4NLD A;  4YR2 A;  1NM2 A;  1WAC A;  3QT8 A;  3KHL A;  3CJ5 A;  2HHQ A;  3HHL A;  3IS9 A;  4WK3 A;  2HAI A;  3K5M A;  4DSL A;  1WD6 A;  5DQI A;  1FT8 A;  4ZCI A;  1NO8 A;  1PIL A;  4NA3 A;  3VVU A;  4UZB A;  2RQC A;  4ZVF A;  2QLB B;  5KFS A;  2UUA F;  3NG8 A;  4HR2 A;  2XI2 A;  2ZBI A;  1TKT A;  1TFY A;  1RT5 B;  3CWJ A;  3LAM A;  4ILL A;  3OR1 A;  3SZ2 A;  3BDG B;  3VHQ A;  3MR5 A;  2DHH A;  3CE8 A;  4IO9 Q;  2AMC B;  1VLO A;  2V0N A;  5D3G B;  3OXL A;  1CC8 A;  4Y2I A;  4O3Q A;  3IWX A;  4TKT A;  3J7Z 5;  4IDK B;  4LF8 J;  2IRU A;  4Q0B A;  1S1V B;  1TL1 A;  1Q82 T;  2CQD A;  2R7U A;  3P5B P;  2X3D A;  2BM0 A;  2GHV C;  4QYR A;  2JC0 A;  1V9O A;  3RBX A;  3WAW A;  2CQB A;  1OPZ A;  5JVH Q;  3J80 Y;  5F0U A;  1NH7 A;  4BHQ A;  5L9N A;  2MQQ A;  2BQU A;  1AB8 A;  2H1Y A;  2KFN A;  1TUG B;  5FLX Y;  3OHA A;  5J2P B;  2FJX A;  3T5J A;  2Q1L A;  3DI6 A;  4KC5 A;  8RUC A;  2DGT A;  4LRE A;  2HVH A;  3UWT A;  4F0K A;  2E5G A;  1F9E B;  2EG2 A;  1OIA A;  4FVM A;  4QOT A;  5GMK a;  2ILY A;  1O99 A;  3L7P A;  1RK8 A;  4IQX A;  4NLW A;  5AE1 A;  1N34 F;  3OD2 A;  4J90 A;  1YBT A;  1OQ6 A;  3PJW A;  4URQ U;  5DLF A;  4WIQ A;  1S1W A;  3UDE A;  1HYS A;  3OUY A;  1NSA A;  2HZA A;  3KK3 B;  3KNG A;  2O1P A;  4NOH A;  1RTI A;  3U1N A;  3Q89 A;  3CJ4 A;  1FNO A;  4C8M A;  3R27 A;  1N5V A;  3K89 A;  3D5M A;  3OVB A;  3K5L A;  3FZB A;  4ES2 A;  4JI2 F;  4CZC A;  2L48 A;  2ZDP A;  2DH9 A;  1HW9 A;  2HLT A;  3TUP A;  3EZ5 A;  2CZ9 A;  1GXT A;  4LIW A;  2VBX A;  1SVD A;  1M5P C;  4IFY A;  5H9F J;  2V8P A;  3ZZR A;  3MK1 A;  3NGT A;  4LRB A;  1CJT A;  2DNR A;  1MRO B;  4QIE A;  5KFG A;  2JEF A;  1UZD A;  4CLK A;  5LL6 d;  1XMQ F;  2VOO A;  3T6B A;  4ENO A;  2NPF A;  3IGV A;  3CCW A;  4DPX A;  3D66 A;  1KON A;  2M0G B;  2UUW A;  1P8G A;  5KFV A;  4IDK A;  4RO0 A;  1FTR A;  1ZA1 B;  2N3L A;  1W25 A;  4P74 A;  4TY9 A;  4ANE A;  4NXM F;  4OHY A;  5HO4 A;  4OZJ A;  3DPC A;  1M5H A;  5GMD A;  3UW1 A;  1TL5 A;  3OFF A;  4YB7 A;  4FN5 A;  4CYU A;  1KHJ A;  4C48 A;  4ZN1 A;  4PQU A;  2FZC B;  4C6A A;  3DLE A;  5I3Q A;  3GII A;  2F7V A;  4KYZ A;  3O5T B;  5CD4 H;  2IFX A;  3DI6 B;  3DRX A;  3KK1 B;  2AD9 A;  1QTN B;  2N82 B;  2C2R A;  2HMI A;  1HDH A;  4N7T A;  2NLW A;  5MAO A;  2CPY A;  2WW4 A;  2GLQ A;  5B0A A;  2X51 A;  3HF5 A;  2BA9 A;  1IBC B;  4Y2K A;  1ANJ A;  1FVS A;  3D0H E;  2GJ2 A;  2GO9 A;  3BV8 A;  4X66 J;  1WI8 A;  2W9C A;  3CJ0 A;  1U1P A;  1UP1 A;  2HFS A;  2OKQ A;  3OW2 R;  1X9S A;  1SJ3 P;  1SHQ A;  3PX4 A;  3QJL A;  4G1Q B;  1RAA B;  4AL6 A;  5GAH U;  4K59 A;  1YIT S;  5L39 A;  2RDD A;  4FXD A;  3A4T A;  5D8H B;  2RNE A;  1ELO A;  1J5O A;  3G6X A;  3MUR P;  4D3G A;  2B6A B;  5LXY A;  3RB3 A;  1N52 B;  2KL8 A;  4OHV A;  1VIX A;  2VG7 A;  4PXE A;  1AA1 B;  1V3S A;  2E66 A;  3POT B;  4IH5 A;  5B0D A;  3OJS A;  1FRH A;  1P9Y A;  1QUP A;  1F0X A;  2WVB A;  4LSL B;  5BYQ A;  3TJ9 A;  4DX8 H;  3HD2 A;  4X4O A;  1O0P A;  2EI5 A;  2C42 A;  3OT9 A;  1IBM F;  1FRL A;  2GAH C;  1SIZ A;  1PBU A;  2R42 A;  4USI A;  4C8N A;  4KAY A;  1WEZ A;  1HL6 A;  2HIY A;  2OTJ S;  2GIF A;  5L0B A;  3MGJ A;  3BKT A;  3KLG A;  3TAR A;  2I8E A;  1R0A B;  2W5S A;  3Q3Q A;  1G7C B;  4RW6 B;  1EW8 A;  3KLI A;  4KV8 B;  4WP8 A;  2MEW A;  2QL9 B;  2VL1 A;  3HX9 A;  3OBI A;  4FKY A;  2ADC A;  2R7V A;  1IBL F;  4MIW A;  3V5R A;  2FLN A;  1P1T A;  2FC9 A;  4JI0 F;  2RIL A;  4QR2 A;  3RAM A;  2N3O A;  3EPI A;  4FF4 A;  1RTD B;  1X31 C;  4ID5 A;  3D54 A;  5KFJ A;  3IGZ B;  2LXU A;  4NRU A;  4HKQ A;  1NUE A;  4RBV A;  4ZHR A;  4YUD A;  2CPF A;  2NUU G;  5KFX A;  3EYZ A;  4FYW B;  1IKY A;  3TA0 A;  3HFZ B;  1XWL A;  5KFE A;  2DH8 A;  3HVT B;  5D0G A;  4WTY A;  5A8R A;  1VRQ C;  3M6W A;  4USH A;  1C1B B;  3MOZ A;  2BE7 D;  4LF6 F;  2GVZ B;  2GW8 A;  2Z2M A;  4ECY A;  4B3M F;  4KPY A;  2KJW A;  2EKN A;  3THP A;  1SI9 A;  5A6W A;  2CQ3 A;  4DQR A;  5A8W B;  5THW A;  3ISN C;  1OWX A;  4CNY A;  3KDO A;  2CXE A;  4ZVT B;  4FF1 A;  4AL5 A;  1N36 F;  2B0G A;  4CO4 A;  2NYH A;  1N56 A;  4N41 A;  4CLU A;  3BYR A;  4E98 A;  5ETT A;  3A8J A;  5E3R A;  2VFT A;  3PY8 A;  5KT7 A;  3C8Y A;  3HI9 A;  5IT0 A;  2YNF B;  2GS8 A;  1HKA A;  2V8G A;  1YLX A;  4DV0 J;  1RTJ B;  1EZZ B;  5KG7 A;  4E0D A;  3AA9 A;  3BBB A;  3MUM P;  5J2M A;  1CJT B;  1VQ7 S;  5KFN A;  4ZJO A;  5DDP C;  4E2F B;  4AFF A;  1D1U A;  4ZVH A;  3KLG B;  3M9M B;  1FRJ A;  4XAK A;  2R2S A;  3KHH A;  1S6Q B;  4JI6 J;  4ZVS B;  4K4X A;  4JV2 A;  2JLG A;  4QYZ K;  3FMB A;  3MCS A;  4FF2 A;  2W5X A;  2HHS A;  4DG1 A;  3I6P A;  2FTR A;  3AT1 B;  2DR6 A;  1AJA A;  3HFK A;  1XMB A;  1LK5 A;  1S6P B;  5DZ7 A;  4TU9 A;  4HH0 A;  3M6X A;  1GTH A;  4TXS A;  4ELV A;  5AE2 A;  5I4M A;  3V81 B;  2A18 A;  4A8S A;  3Q2S C;  3DLL Q;  2GHP A;  2MZ1 A;  5KOW A;  3HPO A;  3H8Y A;  3W9J A;  2Z2L A;  4IFV A;  1H73 A;  2HQG A;  1WKK A;  2WRM A;  4DV4 F;  2C3O A;  2W8K A;  2YY3 A;  3NL0 A;  3P96 A;  3B4M A;  3BSC A;  4YY3 F;  2WAQ D;  4CRJ A;  1UCN A;  3I55 S;  4DLE A;  1FTC A;  2JEI A;  2RT3 A;  1RWU A;  2HFZ A;  3DOM B;  4ZJQ A;  1TVR B;  3G87 A;  2OO4 A;  1U8S A;  2B7B B;  2F8M A;  2VFR A;  3I5B A;  4NLO A;  2FZK B;  1KNZ A;  2CKW A;  2B4V A;  1RSC A;  3NS6 A;  1OMS A;  3OTC A;  3QSI A;  2WSE C;  4AXI A;  1U48 A;  3PRD A;  5I3P A;  2R7Q A;  4I6W A;  4XK8 C;  2AT1 B;  1VIS A;  1Y5L B;  3FMW A;  4DV1 J;  1IM6 A;  3WAX A;  1SCJ B;  3OLA A;  4FDF A;  4H4O B;  3IAS 9;  4U8V A;  4A48 A;  3IRX A;  4A8Q A;  1LQ9 A;  3IG1 B;  3MMC B;  1FFG B;  4LRA A;  2HPU A;  4ZVP B;  1R0A A;  5BR8 F;  3A13 A;  3GIK A;  2XY5 A;  3ZTQ A;  5KG2 A;  5I42 A;  1K73 T;  3AD9 C;  2CVE A;  4Y65 A;  2HKE A;  2G2Y A;  4PPZ A;  2JOQ A;  1X5S A;  1NME B;  1FD8 A;  2QLF B;  2ADB A;  2HGM A;  3MEC A;  5CYJ A;  2X7I A;  4TY8 B;  3MUT P;  1U0S A;  3HJF A;  1U0H A;  3QJJ A;  3NKY A;  4RW8 A;  4BBY A;  2OLW A;  3MHY A;  3GSD A;  3PNI A;  2JNJ A;  1RT6 A;  4GRS A;  2XY6 A;  4G65 A;  2XO6 A;  4EZ9 A;  6FDR A;  4QU7 A;  1X4G A;  3SXL A;  2HRT A;  3T41 A;  4KHR A;  1IWA A;  2BE2 A;  3C15 A;  4OFZ A;  1JLB A;  2HG4 A;  2BOP A;  2YKN A;  4LBP A;  1HR0 J;  2M8D B;  4TN0 A;  4FNH A;  1EAR A;  1GMW A;  1SBR A;  2EWH A;  2FJE B;  3AOA A;  3L4B C;  3OTB A;  4HHH A;  3TJ8 A;  5KFW A;  1IBK F;  3TYT A;  3CCQ S;  4NE9 C;  1T9T A;  1ZZF A;  3Q22 A;  4Y00 A;  4RBT A;  2G1H A;  4F3M A;  1ULR A;  1E6Y A;  2HGN A;  3KDN A;  1H98 A;  4QW9 A;  4QPT A;  2KT5 A;  3D7S B;  4LF7 F;  3H2U B;  1YJR A;  3BKU A;  3QID A;  4W90 B;  1D8Z A;  3HK2 A;  4ELT A;  3BDF A;  1EAY C;  3W60 A;  1O98 A;  3DLG B;  2ZNZ A;  4KY3 A;  1IR2 A;  2KYX A;  3JTP A;  3LP0 A;  5K8M A;  1CC7 A;  1U1R A;  1UA1 A;  4F02 A;  4IOA Q;  2CPD A;  2LQ5 A;  4I7F B;  1S1T B;  3CF5 Q;  3I32 A;  4O44 A;  2DKO B;  2ATC B;  3I0R B;  4C8L A;  2MQP A;  2OGU A;  4M5D B;  1VLY A;  5HMZ A;  1IN0 A;  1U1N A;  4YB5 A;  4FBU A;  4FVC A;  2D3O 1;  3OL6 A;  2QZU A;  4QIF A;  2OPR A;  1R6Y A;  3T5K A;  2VQR A;  4A4J A;  2W8D A;  1XER A;  2JZ5 A;  2I38 A;  5EUH A;  3W2V A;  1D9D A;  4QWB A;  3ZZZ A;  4I67 A;  4DV4 J;  4DV7 F;  1FXL A;  2OAU A;  4QWE A;  1SC6 A;  4K8R A;  5ITH A;  4DR7 F;  3PW4 A;  1RAC B;  1LW2 A;  2ZH9 A;  1HNV B;  4J9Q A;  4IR9 A;  1ACM B;  2QLX A;  2Z57 B;  2J6U A;  3V6H A;  3MPV A;  1QAI A;  3NVL A;  2K1R B;  1KLN A;  4F26 A;  4GVB B;  2XBP A;  4LIR A;  4DCP B;  2DRD A;  1Q8I A;  2PFD A;  1R8C A;  4DV2 F;  1FJC A;  2B56 A;  1KEK A;  2X1F A;  2MSS A;  2ZJR Q;  1NHK L;  3R8Y A;  5D4P A;  1G3O A;  4C0O C;  4DHV A;  2C2Z B;  1I94 J;  4ED5 A;  3MM6 B;  1F3F A;  1KOO A;  2G0C A;  2XGP A;  2PA8 D;  2QFI A;  4U7C A;  4ECW A;  1FFW B;  3NAH A;  4L74 A;  5KFH A;  3IBC B;  2AJF E;  4L72 B;  7FD1 A;  4OV1 A;  2WB4 A;  3C19 A;  5KTQ A;  1HHS A;  4PWW A;  1URB A;  3S1T A;  1H3D A;  1TL7 B;  4NL5 A;  4PPD A;  1KH7 A;  2AKW B;  1S1T A;  5FJ4 A;  4WE1 B;  3T1H J;  3DYA B;  2V4Q A;  3E2E A;  1N33 J;  4YDD B;  3P6Y C;  4OJ1 A;  1RUS A;  2D74 B;  3PXG a;  1MW7 A;  4FYX B;  2MXY A;  2BMB A;  2LCW A;  5JMN A;  4X64 F;  1F2H A;  1H2V Z;  4C3L A;  2U2F A;  3R7N B;  3WIU A;  1U45 A;  3ZC4 A;  1XR7 A;  2R8I A;  2UXC F;  3BPD A;  3G8T A;  2RS2 A;  1RBA A;  1T11 A;  3ICL A;  1M1K T;  5D6G A;  1EHW A;  1PSD A;  1WEY A;  4C0H A;  2QG9 B;  3SSQ A;  4KSE B;  1A6L A;  4BC7 A;  3GFY A;  2GMJ A;  2XMT A;  5DGB A;  4RNO A;  1TKZ A;  1S77 D;  3MK0 A;  1RWN B;  1OSD A;  1RZM A;  1RI7 A;  1SB6 A;  1TKT B;  1KOH A;  3D28 A;  3DOL A;  3EVO A;  4HVZ A;  3VCD A;  1UKU A;  3HD1 A;  5CCM A;  5F8I A;  3G71 S;  4CXU A;  1VQ6 S;  1NU4 A;  4CLF A;  1NB7 A;  1KFS A;  4QAX A;  3T02 A;  4PWD A;  4KO0 B;  3AH6 A;  1M5V C;  3LGN A;  4FZV A;  2YXL A;  2BOA A;  4OYI A;  1WOP A;  3E51 A;  1WC0 A;  4B9N A;  4Q0B B;  1XK8 A;  1CJU B;  3CDB A;  1PYO B;  3JS9 A;  3T1Y F;  1E1Z P;  5EWE A;  4DR4 J;  4K4V A;  2AYB A;  3D2W A;  3KK2 A;  4FP9 A;  3M2U A;  2XMA A;  4WF9 Q;  1UFL A;  1C4A A;  1N5T A;  3RGI A;  4ZVE A;  1NCL A;  2AX0 A;  2HBQ B;  3BBC A;  3ITH B;  4OMF G;  4RNF A;  3I9V 9;  1B99 A;  4TLQ A;  2FC8 A;  1S1X A;  1U1O A;  4NLQ A;  4DSK A;  4PUO B;  1RKI A;  3W61 A;  4DL5 A;  2LEA A;  3ZZU A;  4ANC A;  3HT0 A;  2YNG B;  2EFP A;  3Q24 A;  1YBA A;  4F3O A;  1QUV A;  4C11 A;  2MMY A;  2XWY A;  3D1O A;  5HQM A;  3GWC A;  2ASY A;  1JNR B;  2MST A;  2RAQ A;  1FWP A;  2VPX B;  3AQO A;  4JV0 A;  3HSG A;  4EEY A;  2BUN A;  2FY1 A;  3CCL S;  2BRK A;  1NND A;  3EUN A;  2VU5 A;  2I0X A;  2D3U A;  3QMQ A;  5T14 A;  1J5O B;  2RRB A;  3I0R A;  5B0E A;  1S0O A;  1NK6 A;  2IC3 B;  4J7C A;  3J7Y U;  2BJ8 A;  5HAN A;  3IN5 A;  1Q4R A;  1QAX A;  3GON A;  2DY1 A;  3MD3 A;  4IYQ A;  3W2V B;  2EFO A;  3GP9 A;  4IFY B;  4OLO A;  4UT4 A;  2KO1 A;  4C3K A;  1MML A;  2M2B A;  2KI2 A;  2MHE A;  2W01 A;  2FDN A;  3EDR B;  3OR2 B;  4HT7 A;  1FK9 B;  4I68 A;  3UNG C;  2M5Y A;  3WX8 A;  4K7Q A;  5K9F A;  4DV3 J;  3LWM A;  3A12 A;  2K1R A;  3EX7 B;  2BR0 A;  3WAV A;  2MZQ A;  2PII A;  4GKJ J;  4Q8F A;  3A3N B;  5KG4 A;  1AFI A;  2ZJP Q;  2H48 B;  4HH1 A;  4TN2 A;  2YKP A;  3PEH A;  4DS4 A;  1U26 A;  1S1X B;  3R5B A;  4PUO A;  3SI8 A;  1RDR A;  3MMA B;  4Q8E A;  3SEO A;  3IR5 B;  3HVW A;  3ADA C;  2NYI A;  2Q66 A;  5HAT A;  4CYR A;  1TZ0 A;  5BJR A;  2IIH A;  2D3Z A;  4I2Q A;  3PX0 A;  2EBE A;  3NBP A;  1YJ7 A;  3M32 A;  2GSO A;  2KFY A;  4HL9 A;  5HL7 Q;  2ZM6 J;  1N5Y A;  1X4A A;  1YKW A;  3THV A;  2DTJ A;  3NCQ A;  4ZPT R;  1HIY A;  2VF3 A;  3DYA A;  3HHL C;  3U02 A;  2VPW B;  3RR7 A;  4H4K C;  2ZIT A;  1SKS A;  2GA3 A;  1ZM2 A;  2DR5 A;  4KJG A;  3MMB A;  2HNZ B;  3QSY B;  1UPM B;  3W66 A;  1X5O A;  1U09 A;  5IXU A;  2K7J A;  2LEB A;  2F9D A;  3VAH A;  5D4L A;  4QWA A;  4OYM A;  1NJY A;  1F5A A;  2CPI A;  2QX0 A;  3AQP A;  3POT A;  3IO1 A;  3GPA A;  4ETX A;  5LXR A;  5DG8 A;  4JI3 F;  4B9V A;  2KH9 A;  3BBF A;  1BE4 A;  2NRE A;  1Q86 T;  4L6V 3;  5B08 A;  2F4V J;  3IGY B;  2FVC A;  5HP1 B;  3FSI A;  2L41 A;  2PI5 A;  2VC1 A;  3NGS A;  4J91 A;  1S99 A;  1WJ9 A;  3FFI B;  3VF0 B;  3W7B A;  4YOE A;  3MEG A;  3JQK A;  3FQL A;  3TZY A;  3TAP A;  1XMO F;  3L09 A;  4KGX B;  2W2O P;  2B4P A;  4UOF A;  4ZVQ B;  1RIS A;  3SMZ A;  2BZ2 A;  2MLY A;  3W5X A;  2XMK A;  4AUK A;  2R2U A;  2Y1I A;  2DCU B;  5B0C A;  2XS7 A;  3R5J B;  3FZ2 A;  3IR7 B;  3RG6 A;  1LWE B;  2G9O A;  4ID5 B;  1NSK L;  2DNP A;  4X65 J;  1HLW A;  3EGV A;  2OPP B;  4WJB A;  1T94 A;  3CCJ S;  1T05 B;  1RT4 B;  4DPU A;  3R1L A;  2XNQ A;  1J27 A;  2NZ4 A;  4P6Q A;  4ZP7 A;  3S8S A;  1FO1 A;  2V2Z A;  4OL8 A;  2I2Y A;  1HBM A;  1MMN A;  2DPI A;  1FE4 A;  1S4F A;  2DH7 A;  4B3O B;  2RF2 A;  2M8H A;  2RKI B;  3K5N A;  2IUC A;  2ZE2 B;  3DRY A;  3EGZ A;  2V5H G;  4I64 A;  4MYU A;  1QE1 B;  5G0R A;  5T41 A;  1PBA A;  1NAQ A;  4EO6 A;  3NNC A;  4F4Y A;  2BV3 A;  3B4D A;  3D9B A;  1JJ4 A;  4EK2 A;  2VBZ A;  2DR8 A;  2L3M A;  3T1H F;  2IC3 A;  2N4D A;  4X4P A;  5M2U A;  2RJZ A;  3TZW A;  3OLB A;  2YKO A;  2YX7 A;  3MD1 A;  2LYV A;  4KIA A;  2LQJ A;  1RTJ A;  4K2J A;  2GQ2 A;  3RW7 A;  2MKY A;  3C6U A;  5D0E A;  5KFA A;  1UVK A;  4CWB A;  3SSR A;  5HJY A;  3OR1 B;  3OVS A;  1YGY A;  1VBK A;  3SCL E;  2L9D A;  3PCO B;  3J7A 1;  3HUL A;  1EJJ A;  3CJ3 A;  1G1X A;  3X3U A;  3QZ8 A;  1T03 A;  1RJJ A;  1JKH A;  2CPJ A;  2DNZ A;  2R4F A;  2OUG A;  3RZA A;  3NKR A;  2H5E A;  1KHL A;  2OH2 A;  3UN3 A;  2E1M C;  3BYP A;  3G8S A;  1TL4 A;  5IT4 A;  1QVG R;  4TNO A;  1HHQ A;  2I5J A;  3SV3 A;  3CO0 P;  2HVD A;  2IM3 A;  3UDL A;  2VG6 B;  2B5J A;  3UNY A;  3ZZY A;  3M9O B;  1S6P A;  3QIP A;  1U2R A;  2VUG A;  1S9G B;  3PAC A;  4XDD A;  5KFK A;  3D0I E;  2AJ2 A;  3RJM B;  3V81 A;  2KVQ E;  5J2P A;  1XIQ A;  3D1Q A;  4CLY A;  4MIV A;  4Y2M A;  3IA0 A;  3OL8 A;  2AWZ A;  3AJD A;  1QY7 A;  2G0J A;  2C3Y A;  4ECR A;  3KJF B;  2MQN A;  2DEJ A;  4UOH A;  2PDA A;  1CUL A;  3C66 A;  2MQO A;  2ZHB A;  1T9Y A;  2LQ8 A;  4OZ0 A;  2BW2 A;  4B9S A;  4F4X A;  5ETQ A;  4DDF A;  2E1P A;  4LBI A;  1AZS B;  2PSZ A;  1P1L A;  3QJP A;  2BJ7 A;  1AUK A;  1URR A;  1L3S A;  3PV8 A;  5F3Z A;  2V9K A;  1X4F A;  2HNZ A;  4Q2M A;  2Z2Y B;  2IAJ B;  4NLT A;  1G2E A;  3PG9 A;  3SQG A;  1WF2 A;  2H9Z A;  3HHL B;  3IS9 B;  1P49 A;  1NH8 A;  2ZD1 B;  4USJ C;  2WSF C;  1PG5 B;  1RT2 A;  5E0O A;  5IC4 B;  3BJY A;  2PA3 A;  4LR7 A;  4JI1 F;  1KTQ A;  1GT8 A;  2FGO A;  4NXN J;  3A3P B;  4IH6 A;  3FK4 A;  1U25 A;  4X66 F;  3UCU P;  1JJC B;  3SDE B;  3PVX A;  5HP1 A;  3FGV A;  1EB0 A;  2P9E A;  4WP9 A;  3UDV A;  2VOP A;  1C0T A;  4DZ6 A;  3EMT A;  2DNY A;  3FFI A;  5HRO A;  2AGO A;  4OYX A;  1RT1 B;  5E3A A;  2R9L A;  4ZG6 A;  3MF5 A;  1BQX A;  1CQM A;  2QSF A;  1RYR A;  4OHZ A;  3KLE B;  2HQ3 A;  3LP2 B;  4FYV B;  4QR0 A;  4CLP A;  3H90 A;  1U8W A;  1OSC A;  1SKU B;  2ZEJ A;  1Q7Y T;  1NJI T;  3DGP A;  2DGO A;  4PKD B;  4Q44 A;  3A52 A;  5LRN A;  4QR1 A;  3UDC A;  3L95 X;  4UST A;  4X4T A;  4DR6 J;  1KSP A;  2HFV A;  2K7K A;  4RW9 A;  4DR3 F;  2XUL A;  3R7S B;  1S0V A;  4FPR A;  2BKP A;  2WZ1 A;  4NPO A;  1R31 A;  1RWV B;  2BE2 B;  2ZBP A;  2YPY A;  1VHF A;  3GCX P;  3BEG B;  4DFK A;  1SL2 A;  1Z1Z A;  3M6U A;  3BO4 A;  1Q81 T;  1R89 A;  4QZV B;  3AXM A;  4R5P B;  4DV2 J;  3RB0 A;  1NHV A;  2R7O A;  3N5F A;  4J9S A;  1T8E A;  5GRR A;  2HK2 A;  1QE1 A;  3VGU A;  4NYO A;  1JIH A;  1O51 A;  4M63 A;  2DHS A;  4AT1 B;  3LWL A;  4LF4 J;  5B7W A;  3J81 Y;  5MLC V;  2VPZ B;  1K44 A;  3SQG B;  2OIH A;  1ROF A;  1SL1 A;  4JV5 F;  3J7A N;  1LWF B;  1WC5 A;  1FDA A;  1RAJ A;  2PFF B;  4YHH F;  1KVK A;  1LK7 A;  4GTY A;  4ZPA A;  1H2T Z;  4WZQ A;  4MKA A;  2YQ1 A;  1MMD A;  5H9E J;  4EMD A;  2YWG A;  2CPH A;  1NKC A;  4JYA J;  1IQT A;  3MK2 A;  5HVF A;  2QGF B;  4LF2 A;  1VI7 A;  2ZH8 A;  2KDO A;  1FI4 A;  2JX2 A;  2MJU A;  4M5J A;  2I6W A;  4Z2X A;  3CSK A;  2FD2 A;  2IBO A;  2R3V A;  4I0W A;  2F9J A;  1VIO A;  5LOQ A;  1YIJ S;  3MPY A;  4KH1 B;  3H42 A;  5JUM A;  2OD4 A;  4RNN A;  3K0J A;  1SIW B;  1BY9 A;  2CQG A;  2CFX A;  2NXU A;  2MY8 A;  3GV7 B;  3CCM S;  3JYT B;  2IA0 A;  2K06 A;  3OTO F;  1V3R A;  1ITP A;  3KD8 A;  1P9Q C;  3D6F B;  2LQ9 A;  1EP4 A;  5GAG U;  2VPY B;  3BQ1 A;  5I3U A;  2HHX A;  4CM2 A;  1FNX H;  4DXL A;  2E5L J;  1M90 T;  3GSI A;  4NCB A;  4NX9 A;  5FD1 A;  3F73 A;  4HEA 9;  2DNM A;  5RUB A;  1KKH A;  1XR5 A;  3MWB A;  4ZPW R;  4B3R F;  2OMO A;  2XZT B;  4MK7 A;  4KB7 A;  2HVI A;  3MAA A;  1HWK A;  1XQI A;  3R2D J;  1XN9 A;  2F1F A;  1H0H B;  3WHI A;  4KTQ A;  1C1C A;  2J9E A;  2ZM6 F;  3EPG A;  1C1B A;  2AGQ A;  5L1J A;  1J2V A;  2R8H A;  2GVD B;  2IYI A;  4ATN A;  3MUV P;  3R7B B;  4U67 Q;  4USU A;  2QFJ A;  2BJ9 A;  3N6M A;  1U24 A;  1AZS A;  2XTJ P;  4V19 X;  4KKO B;  1AJB A;  3KK2 B;  1LWF A;  3GZ7 A;  4RNH A;  1UVL A;  2F8H A;  2A2C A;  2GV1 A;  2CQP A;  2O67 A;  5E7O B;  1GMV A;  5CAB A;  3FBC A;  1YI2 S;  1S72 S;  2R7S A;  4UPH A;  5CZV A;  1S0M A;  5FLX U;  4ED2 A;  1EW2 A;  3M2R A;  4TYB A;  2W7O A;  2NZC A;  2ZNY A;  3IXQ A;  1TL7 A;  2DIU A;  2QTW A;  3FSY A;  1GNK A;  4L3N A;  1Y7P A;  4RBU A;  3E01 B;  4EUV A;  4N8O A;  2AIR B;  4A46 A;  3DGV A;  2DNG A;  3H7H B;  4KAI A;  1QAY A;  3DLJ A;  4JI8 F;  2VHG A;  1ZZN A;  1S0N A;  4IUF A;  4WU3 A;  1TEL A;  4NLY A;  3D67 A;  3MFH A;  1WUU A;  4HHJ A;  1S10 A;  5FDL A;  3ZZT A;  4QWD A;  2HWH A;  2VDI A;  5AXK A;  3GV5 B;  2MQL A;  3JYT A;  1QJH A; 
#chains in the Genus database with same CATH homology
 3MK1 A;  5LIA A;  2W5V A;  1B8J A;  1AJA A;  5LRM A;  4LRB A;  1KH9 A;  1KHK A;  4UPK A;  4ZGA A;  1AJC A;  1P49 A;  1E33 P;  1KHN A;  5DLT A;  5L0K A;  1ELY A;  3TWZ A;  2GA3 A;  2W5W A;  3BDH A;  4YR1 A;  4LR7 A;  4KJG A;  1ALJ A;  4NWJ A;  1ZED A;  3TG0 A;  1URB A;  4UPL A;  3M8W A;  1KH7 A;  4UOP A;  2W5Q A;  3CMR A;  4ZG6 A;  4UOO A;  5K4P A;  1HDH A;  4LRC A;  4KJD A;  1SHN A;  4KM4 A;  4N7T A;  3A52 A;  4MHX A;  2GLQ A;  5LRN A;  3SZZ A;  1ALH A;  3IGY B;  1ALK A;  1ANJ A;  2GSN A;  1ED9 A;  4CXS A;  2W8S A;  1N2L A;  1K7H A;  4FDJ A;  1SHQ A;  4GTZ A;  1Y7A A;  3MK0 A;  3WAX A;  5IJS A;  3UN5 A;  2X98 A;  5DLV A;  5C66 A;  3B5Q A;  5GRR A;  3UN2 A;  4FDI A;  4CXU A;  4QAX A;  4LRA A;  3T02 A;  1ZEB A;  4LRD A;  2XR9 A;  1EQJ A;  3NKP A;  1HQA A;  2IFY A;  1HJK A;  1E2S P;  4ZG9 A;  2G9Y A;  2D1G A;  4LR9 A;  4GTY A;  2RH6 A;  1ALI A;  2GSU A;  1KH4 A;  4LQY A;  5LQQ A;  1Y6V A;  2IUC A;  3MK2 A;  3OT9 A;  4GTW A;  4KAY A;  4LR8 A;  3E2D A;  1ANI A;  1ZEF A;  1E1Z P;  5L0B A;  4LR2 A;  2W5S A;  3NKM A;  3Q3Q A;  4UOR A;  3DPC A;  1EW8 A;  4NWX A;  2ZKT A;  3NKO A;  1N2K A;  4TN0 A;  5DLW A;  3NKQ A;  3KD8 A;  4KAV A;  3ED4 A;  5IJQ A;  3IGZ B;  3BDG B;  5AJ9 A;  3WBH A;  5INH A;  1AJD A;  3M7V A;  1ED8 A;  1FSU A;  4UPI A;  1EJJ A;  3DYC A;  3M8Z A;  3WAW A;  3NKR A;  4LRF A;  1KHL A;  3BDF A;  3UN3 A;  1O98 A;  2W5R A;  3LXQ A;  5TJ3 A;  3IDD A;  2W5T A;  5KXA A;  3UNY A;  3T01 A;  4LRE A;  1E3C P;  3M8Y A;  1ELX A;  1ELZ A;  5EGH A;  1O99 A;  1AJB A;  2QZU A;  3T00 A;  5L0E A;  4MIV A;  3UO0 A;  1EI6 A;  3WAV A;  2VQR A;  4MY4 A;  2XRG A;  4B56 A;  2W8D A;  4UPH A;  5HRT A;  1EW2 A;  3BDG A;  3WAY A;  3SZY A;  5EGE A;  4CXK A;  2ANH A;  3NKN A;  1KHJ A;  5GOV A;  1AUK A;  3NVL A;  4CYS A;  4CYR A;  1KH5 A;  4GTX A;  2IUC B;  2W5X A;  4ZG7 A;  1URA A;  3TX0 A;  1EW9 A;  2GSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...