4LR7A

Phosphopentomutase s154a variant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
total genus 142
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr7A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr7A01
1K7HA 1O99A 1EI6A 2QZUA 3WAWA 4ZGAA 1KHNA 1ALIA 1KHJA 1EJJA 3ED4A 1HDHA 4UPLA 4MHXA 1E1ZP 5IJSA 5DLTA 1Y7AA 3WAXA 4LRCA 3MK1A 1ED9A 5C66A 1URBA 4LRDA 4ZG7A 1N2KA 5L0KA 1SHNA 5L0EA 3UNYA 1SHQA 1KHKA 1EQJA 1Y6VA 3CMRA 4GTWA 4CXSA 3BDFA 3UN3A 4KM4A 5DLWA 2W5QA 4LRFA 3UN5A 1HQAA 3IGZB 4FDIA 5LRMA 1ZEBA 4CXKA 4ZG9A 2GSUA 5LIAA 3BDGA 2GSOA 3M8WA 4MY4A 3WBHA 1B8JA 2W5WA 1ALJA 2GLQA 1FSUA 3SZZA 1ELYA 1HJKA 5EGHA 3WAYA 4TN0A 3T01A 1ED8A 1ALHA 2ANHA 3A52A 1N2LA 4KAYA 4GTZA 3UN2A 1KHLA 1KH7A 3BDGB 3DYCA 5HRTA 5AJ9A 5K4PA 2W5XA 4YR1A 5DLVA 5GOVA 1E3CP 3BDHA 1AJDA 4LR9A 1EW9A 4UPIA 3M7VA 3T00A 2W5VA 1ZEDA 4FDJA 4UOOA 4LQYA 3OT9A 4LRBA 4UORA 4KJGA 3TX0A 2D1GA 1O98A 3M8YA 5GRRA 4B56A 5INHA 4LR7A 1KH5A 3E2DA 3UO0A 2X98A 3NKPA 5IJQA 4MIVA 2XRGA 3MK2A 3NKMA 3TWZA 2GA3A 5TJ3A 2W5SA 2W5TA 2IFYA 3LXQA 4UPHA 3T02A 3NKNA 1AJCA 5KXAA 1E2SP 4NWJA 1E33P 3MK0A 1EW8A 4GTXA 2VQRA 4NWXA 1ELXA 5EGEA 2W8DA 3B5QA 1ANJA 4UOPA 4UPKA 1ZEFA 4N7TA 4LRAA 3NKOA 3NKQA 4QAXA 4LR8A 2G9YA 2ZKTA 3IGYB 3TG0A 1ELZA 3NKRA 2RH6A 3M8ZA 2XR9A 5LRNA 4LREA 4KAVA 2IUCA 3IDDA 2GSNA 3KD8A 1URAA 3DPCA 5L0BA 1KH4A 4LR2A 4ZG6A 4CXUA 2W5RA 4CYSA 3SZYA 2W8SA 1EW2A 3Q3QA 1AJBA 1ALKA 4GTYA 1KH9A 2IUCB 1ANIA 1AUKA 1AJAA 1P49A 3NVLA 4KJDA 4CYRA 5LQQA 3WAVA
chains in the Genus database with same CATH superfamily
1T9WA 1NRKA 1HYSA 2JFKA 1FE4A 5J1NA 5F0WA 5EN1A 2OGUA 2EC2A 1P9YA 1GXUA 1RWPB 5IJSA 5J2PB 1S1XB 1IR2A 4LF5J 1UEUA 5IFMA 3M4XA 4DV3F 1ZAWA 4CT9A 2MJNA 1FXDA 2MKSA 4LF1A 1GTHA 5E2QA 5L38A 5LXRA 1RT6A 1AB8A 3HO1A 4PG4A 3M8SA 2IDLA 4HYKA 3OPKA 2I9SA 3FJ2A 5DLVA 4ZVOB 1K47A 1S76D 2ILZA 3ZO7A 4IOCQ 2DGXA 5JXSA 5F8HA 4V19J 2ZJPQ 3VV2B 2EFGA 4KJGA 1W2BR 2VODA 2B56A 3E2DA 2VPZB 2XLIA 1YDLA 2GA3A 1LWEA 4YDXA 1VIXA 2C2MB 5T7LA 4TKTA 2AGOA 2IRUA 1FKAF 1ZETA 3IRXB 4UOPA 1L5UA 2D3ZA 4OI3A 2RB7A 5I3UA 2JC0A 5IV3A 4X65J 5LMUF 1NNDA 2UXCF 3CD6S 1R0AB 1U49A 5ETVA 4ED4A 4F0MA 4LT6A 5KFRA 1ALKA 4M5LA 2CNLB 4KGXB 2ATLA 3JSMB 3DRYA 3O2IA 1U8SA 3TAMB 2B43A 3JS9A 2XMJA 4DL4A 1NK0A 1U1OA 3HHEA 4LRFA 2CJKA 3BQ1A 2EG2A 4DV2F 4L6V3 3KKFA 1BD6A 2PN6A 4DV5J 5B0BA 3QSYB 4CTAA 5JVHQ 2QA4G 3AD8C 2DR9A 3PRDA 1AJDA 2VFUA 2HS0A 3K89A 1UWBA 4RW7A 1T94A 2E5GA 4CDIA 2A3JA 4PUOB 1QY7A 2XMVA 1T9XA 2OSQA 4DOZA 2IFYA 2BJ9A 4RBTA 3PO5A 2ADBA 2FD2A 4CRJA 2DO0A 1RHRB 5EGEA 2V8HA 2LQBA 2NQPA 3AJ2A 2UUBJ 5AJ3J 2AJFE 4OX6A 5KFZA 1GT8A 1SC4B 2R2SA 2FY1A 1OIAA 1OY8A 2VQEJ 2GIFA 5F3ZA 2QGFB 1O99A 2LDIA 1T0TV 3H0PA 4M1KA 3TAQA 3RR7A 1RT2A 2Y1JA 3WC0A 1M1HA 1CULA 1S6QB 3UQSA 1WF1A 2A2DA 4J90A 3MOJB 3ITHA 2FVSA 3OBIA 4RW9A 4ZN3A 3QT5A 3DYCA 2E44A 3IC1A 4NLDA 3Q8YA 5BYSA 2J9DE 2HFOA 4ZJQA 3M2VB 4ZPAA 4DV0J 3NL0A 2FHJD 2VJVA 1NK4A 3BR8A 1JKHA 2AEJA 2J9CA 2ZVIA 2L08A 2KH9A 5E7OB 4GVBB 1DTTB 2G2OA 3HJVA 5KFVA 3CIMA 3Q8RB 1KDNA 4OZ2A 3TUJC 2J8AA 3SCJE 2Z2MA 2J8SA 3G71S 1OY9A 2R8KA 3V81A 4ZJOA 2DTJA 3ENWA 2FGOA 1Z1ZA 1JWWA 3V6JA 1FRJA 1BWEA 3Q89A 1VQYA 2IVFB 4JI2J 1EKSA 3DLHA 4DFKA 5HMWA 2DITA 3HCXA 4KT0C 1TL7A 1S1WA 4MJKA 1X8DA 4O44B 3JQKA 2VDHA 5DGBA 2LDYA 1X5OA 1UL3A 2UUAJ 1U1RA 1ALJA 1S7HA 1S77D 1PYSB 5C25B 3PFOA 3MMBB 4RNMA 4DV4J 3A4TA 4B3TF 3BS9A 3AQOA 2OUGA 3BDHA 3LPYA 2LA4A 5A8KA 3FK4A 4TU8A 4IFVA 2OPRB 3S01A 1WKLA 1U25A 4CO3A 2MJUA 3NCQA 2KI2A 3UE2A 1CG2A 1WEYA 1HWJA 2OPQB 3KLHB 1I3OB 3BZQA 3PKYA 3HFVA 1LW0A 3DPCA 1S6UA 1P1TA 3CMQA 2GZOA 2QLXA 1KNZA 4RUHA 4Y00A 1RHMB 3AXMA 3D54A 4FNIA 1KHJA 1RB0A 4DV1F 3BO4A 5LM7E 1KS2A 1ZZNA 3G82B 2MSTA 4NEYA 3BYPA 2XHCA 2KRRA 4XTTA 1RZMA 3CJ3A 1MU2A 3KJVA 2OP5A 5L1LA 3HZEA 3WBHA 2JSXA 4MIBA 2JLGA 3WAYA 2IYIA 3J81Y 1ZM3A 3POTA 3QIPB 1WG4A 3G4SS 2N4DA 2IAJA 2YKAA 3Q22A 2XZWA 1TV6A 1DTQA 3R5JB 1Q5YA 1YJ7A 4LF5F 1LK7A 2V2ZA 1X9WA 1WKKA 4LQYA 2G4BA 1HR0J 2M70A 1SQGA 2XRGA 1UJ6A 2MMYA 2OEMA 4K4WA 4K50A 1ZM9A 2WVBA 4NWJA 3UVJA 1X4EA 4K5SA 3R5DA 2DNYA 2NXNA 2C1EB 4C0OC 2XMUA 3G8SA 4MK9A 3TG0A 4TLRA 4I2PB 2M5YA 1JJHA 3TQ1A 2NXJA 1IVZA 1P1LA 3Q8VA 4DU7A 2WHOA 4LVOP 1YHQS 3MMAB 2YKNB 4NA2A 4PKDB 3K8WA 2FJBB 3KFWX 3TJ9A 1YJWS 2HK3A 2FLLA 2BUNA 3LW5C 3PW5A 5ETPA 3IGZB 3MFIA 2GVZB 5BXIA 3JSBA 3CJ5A 5E33A 1VK3A 2D74B 5KG5A 5B0DA 1FNXH 4LFCJ 4GTZA 2LLZA 5CYJA 4RKUC 3D6FB 2UU9J 5KFFA 5HJYA 3PFEA 3M1VB 2CPDA 3QJLA 1Q86T 4M5HA 2K7JA 1N0VC 3DOMA 4NZ7A 3ZTPA 4J37A 3DGPB 2COLA 4OYOA 3TP2A 3AA9A 4J9VA 3OVSA 2MQQA 2QA4S 3FEXB 2ZM6J 3EVOA 4J9OA 4WFNQ 4DUZJ 5IT9Y 3D66A 5G0RB 4EBEA 2ZNZA 3W61A 5BR8F 3I5CA 4YY3J 1HNIB 2B6AA 3OR1A 5CABA 1HLWA 2VOOA 1VISA 5J1EA 3ILIA 1OSDA 4DX7A 4RO0A 1JMTA 2XC9A 4ANCA 1N5VA 3AY0A 4I7FA 5E0OA 2X7IA 2IM2A 3KLIB 1FJGJ 3DLKB 2BMBA 3PM9A 1B8JA 2GLQA 1GEHA 4DL2A 2C3OA 3HMJG 1KKHA 2ZEJA 1C0TB 1SJ1A 4EBCA 2ZH1A 2QL9B 2H5IB 3ILLA 1KSPA 5K14B 3A8KA 3PCOB 1PBUA 2W2MP 3IWNC 4ZVTB 1GAOA 1TUWA 1QM9A 1VBKA 4NRTA 4KSEB 2CA9A 5IJQA 3QAUA 1GXLA 3L95X 4JP8A 5GMEA 3IS9A 1N36J 4KGZB 1HL6A 4WFYA 2K7KA 4G65A 3R3TA 2UUCF 3G96A 3WZ0A 4IG0A 3RTVA 4DCOB 2D7SA 2F65A 2YX1A 4P2SA 3TJAA 2PE8A 1MG7A 3NOGA 2VONA 1XQIA 3WC2A 4ECTA 1XMOJ 1EJ7L 4P75A 5DG7A 4GTWA 3IWLA 4QWBA 4HLBA 1DAXA 4DLEA 1YZ7A 1K1SA 1HJKA 4J9SA 2O01C 2CQ1A 3PR4A 3J7ZT 4QPTA 3M2UB 1RA7A 5FLXU 2BA9A 4U8YA 4RW8A 2HNDB 4X4SA 1FFGB 3VR1A 5HBMA 1QTMA 3FKBA 4QWAA 1BXNA 2AF6A 4EUVA 3TR5A 3QZ7A 1N32F 3BBCA 1DQ8A 2B51A 2XMWA 3CCZA 5ADZA 5K8OA 4ZP7A 4Q0BB 1AJCA 3B4MA 2CQPA 3LF0A 4XIUA 1BQNA 4DV7F 1KVIA 4DL5A 3IGYB 2K2PA 1T95A 4ZMMA 3FEZA 2MGZB 4GRSA 4ZPCA 3BPDA 5LMNF 1WNEA 4UW2A 4ETZA 2DK2A 4L3KA 2IVMA 4MKVA 3BH7B 2DNGA 1EJJA 1SBRA 3P3DA 1P6TA 3NGRA 2MXYA 2FLPA 2DNQA 4OYBA 4HTJA 2M2BA 1NU4A 1RTJB 4Q2MA 1S59A 4Z37A 1N52B 2EC0A 5A0YA 3E51A 2YKPA 2OH2A 4OJ1A 3KLGB 1IBLF 2ZE2B 3EZ5A 3D6TB 4X84A 1SQFA 5D4OA 4KHPF 2XG8A 3C46A 2H4YB 2ZH3A 2R3VA 2IM0A 2OSRA 2V9KA 3FMWA 4X4NA 3CCVS 3C16A 5K8MA 4NCGB 4OYAA 1WC1A 1RTIB 1L3KA 1LW2B 1X5PA 5D0HA 2J7WA 2OELA 5F8NA 3KJNB 1R27B 5L9NA 2HZVA 4ERDA 1WC4A 4M5GA 4Y65A 3DHWC 4CO2A 1FK9A 4C8LA 4F25A 4ILLA 4U96A 1BGXT 2XSJA 5EHHA 2N7CA 4DPUA 3KK3B 4GO7X 1FEHA 1X7VA 4KBIA 3OTOF 3HHLB 2AIRB 2VFSA 2HK2A 4QJVA 3LTOA 3WAWA 2YNIA 1HWUA 1TELA 1U6ZA 1QSLA 1FTCA 3HULA 1YVFA 5DETA 3MK1A 3N6LA 2ZBRA 3UNYA 3PW2A 5KFKA 4DR5J 4E2FB 4ITSA 1HW8A 1CQMA 3CDAA 2CNOB 3OHAA 5LSLA 4DX8H 2KYXA 3HJFA 3QBCA 2CQDA 4R0JA 2GHPA 4MFBA 3HPOA 2R2RA 4N76A 2WZ1A 4WCEQ 1SVDA 1HWKA 4FYDA 2BR0A 4ENOA 3MEGA 4WXWA 3T5JA 5DLFA 2MQPA 2F4VJ 1TK5A 5LT5A 4CQ1A 2W2QP 3M32A 5B09A 4NYZA 1PO6A 4FXVA 3CIZA 4CYUA 3MK0A 1NSKL 1NKEA 3GIJA 3GFZA 4NPOA 2EBGA 3GMGA 2MY8A 2VU5A 1HQEA 3FCVA 2RVJA 3SCKE 4U95A 1Y10A 4U7UD 3ZC4A 2XWYA 3S8SA 1CJVA 2HNZA 4TU9A 3BKTA 3K5MA 2M88A 1YGYA 3PIPQ 1DJ0A 1ZAVA 2P6SA 2W25A 2RS8A 4C48A 3DLBA 3CCJS 3MFHA 4C7QA 3LOUA 1RTDB 3HLUA 2QJ3A 1TKDA 1RCXB 5KOXA 3V6KA 4BC7A 3BH6B 1YRTA 1NMEB 5D4NA 3SI8A 2XMKA 3IR5B 2RDDA 5SUHA 2KFZA 1GK8A 3MM7A 4WPAA 3EPIA 3E8OA 2Z30B 3PRVA 5CCMA 3IFEA 3QJPA 4DLGA 3OL9A 2Q1LA 3PJ9A 3X1LB 2OMOA 1OYEA 3D1HA 2VICA 4ZHRB 2NR0A 4C3KA 4PRFA 1RU2A 1Q0NA 4YMEA 3CDBA 2JNJA 3VAMA 2N4CA 4X4OA 3MCSA 2JH3A 3R7NB 1TFYA 1XNQJ 5LRNA 5C2GA 3DLLQ 1K0VA 4DR7F 1S1VA 4A48A 4LR2A 2HWIA 1EZZB 1N33F 2IVYA 2MHNA 2RMLA 2HHHF 3OLBA 1PYTA 4N47A 3BREA 2QZUA 1IJFB 4C8OA 2A0FB 4USTA 2E9TA 4YB1P 1JJ2R 4Y28C 1NKCA 1NK5A 3SZ2A 2YNFB 4OIXA 2IY5B 1TKZB 3GR1A 2HPUA 2VG6A 2LKZA 1PGZA 1KHKA 4NLPA 4DEZA 2WVEA 3PNIA 1FKOB 2HRYA 3KLFA 4TYBA 4YP3A 1FRXA 1ZS6A 3GIRA 3T01A 4JYAF 4LSLA 4QWCA 2NS1B 2BANA 4FPRA 3CJ0A 1WD6A 3J7A1 2RNEA 2HHQA 3HSDA 1XMQF 2FIUA 3G8TA 5IXUA 2E9ZA 1URNA 4HT7A 2C2EA 1BQMB 4B56A 4PQUB 3ISZA 4LF8J 3VAIA 6FD1A 3ENAA 2KTQA 1C0UB 3OL8A 3T6BA 1AT1B 2X1FA 2AJQA 4N8NA 4X4VA 2BJ1A 3V2UC 4MK8A 4LR8A 4HHJA 5G4DA 4JI4F 5CYMB 1TKXB 1WJ9A 4CLKA 2ZWOA 4M5DA 3NOCA 2KXHA 4DR2F 1EP4A 3TVZA 3WAVA 5B08A 3C14B 5FDLB 5L8RC 1FWKA 2ZZMA 3MMCA 1URBA 5L0KA 3FEYB 2UVRA 4K2XA 1AUDA 1DARA 1VQLS 2IIHA 5AXNA 4NL5A 2V69A 1HBOA 1JXLA 3EGNA 2DGSA 3R27A 4B3OA 3BO3A 2RDJA 5EWFA 1J5EJ 3OVAA 3CPWR 3I32A 1E6YB 2ZJQQ 1KVKA 2M0GB 3ZTRA 1F6TA 3KJQB 4U7UK 5KG3A 1UMJA 4R5PB 4RW6A 5DRKA 4ZA1A 3D6HB 3AAWB 1WORA 3N79A 1B99A 1TK0A 2W5TA 2QO3A 2KHCA 4EO6A 4UPKA 3NG8A 2HMIA 1VQNS 2BKOA 4ELVA 3JTNA 2DPIA 2Z2LA 1NK7A 4DSLA 3SSQA 2MQLA 1Z4UA 1SPBP 1MROB 4P6QA 1VBYA 4OFZA 1KH9A 4PCQA 3NVLA 1TVRA 4KJDA 2JRSA 2VUGA 1HA1A 5A8RB 2KXNB 2MYFA 5E3PA 2OFGX 3T19A 4X4TA 1IKXB 2C2RA 3UI3A 2C2NA 7FDRA 5L0EA 3QIDA 5GMDA 1HNWJ 4FKXA 3H25A 3MEEA 1CJUB 1RKJA 5DGAA 5AT1B 4C98A 1S1XA 2HVHA 1M5VC 2GQQA 2IA0A 2CQIA 1EHWA 4I69A 4U9RA 3RBZA 4RWWA 2HSEB 3I56S 4QYRA 2G2ZA 1VMBA 2HVZA 1VC5A 1RAOA 1Y00A 4WFZA 2B5JA 4NXNJ 1LOUA 4FF4A 3J81j 2UXDJ 1SC1B 2W01A 2H5EA 3DM2A 1KQGB 4ES2A 3E3XA 3DGVA 2DR6A 3SV4A 4AE5A 3VALA 1PKUA 2OTLS 1VI7A 3NWGA 1R7IA 2BJ7A 5J2NB 3W8GA 4IYQA 5D0EA 3NKYA 5L9XA 2NZ4A 4KGKA 5DJBA 3MM8B 2AX1A 1J27A 3KK2A 2ALZA 3KTQA 1FESA 4DV6J 3C2PA 5L39A 4J9KA 4FXWA 3PW4A 3ZZUA 4JBCA 1KN6A 2W4PA 4FYXB 5HQMA 3H4DA 5MAOA 4PYDA 5LSOA 2XO6A 3GSIA 3K59A 2KVIA 4B3RJ 2BQUA 3DOKB 2RHSB 2KYZA 4USKA 1CJTB 4ED2A 4ZJLA 4DR1J 3R1LA 3UD5A 4IQMA 2ZH4A 3QGPA 1TTHB 2C28A 4J9MA 3FZBA 2XZDB 4JI7F 5A2QU 2VG5B 4JB8B 4HEA9 3SDEB 2PGCA 3QO9B 1AW0A 2J0SD 3UR3C 1RWUA 3EDQB 2R42A 2BVZA 2UV8G 5LSRA 1PC5A 3N01A 3QGIA 2PMZD 3N6MA 4WTYA 2DNLA 2JX2A 3CUNA 2JEJA 2HIYA 2DO4A 5D0GA 2ALYB 3Q86A 3V4IB 3NWRA 3RZAA 3U27A 3EMTA 3KHGA 2R8GA 4ECUA 4EYHB 5DG8A 1N0UA 1NK9A 4PXBA 2FHJA 4DBQA 3OJUA 2E5LF 2V63A 3MTJA 3GYGA 2JDJA 5I4MA 3EE3A 4DSEA 3MPVA 5HP1B 3CCTA 2ZC4A 1FE0A 1NSAA 2ZJRQ 3D5MA 1S6QA 1DLOB 2W5XA 2GO8A 1SIWB 1Y7PA 1MN7A 1U2CA 2DJWA 1QE1B 2VBWA 3P5TL 2XO7A 2KRBA 2XLJA 1RK8A 3TO8A 3NEKA 1EW8A 4TY8A 2KFYA 3MMJA 3W65A 1DTTA 4FS2A 3DN9A 1LWXA 4ELTA 2BE2B 4RR5A 1KLMA 4DZ6A 4OHVA 4M5KA 4UOCA 2W2OP 4I6YA 3M2RA 3UWTA 2WTFA 3O1LA 1HNXJ 2MKYA 4QYZJ 4NXMJ 4NLTA 1V3SA 1YJ9S 1H0HB 4ZVRB 1XERA 2D9OA 1RT3B 2AHOB 4YB5A 3KOAA 4CO4A 3PACA 4PXDA 2Q6BA 3DLEB 4ZP8A 1U02A 1ZBTA 4I0WA 2MPUA 2QG9B 4WFBQ 2DRAA 2GIQA 2B0GA 4P73A 3GYXB 1T03B 5H9EJ 4B3SF 5KFMA 3LWMA 1IN0A 1FWLA 1NDPA 1IKWA 2BKPA 2CIMA 1G3OA 2HVIA 1OMSA 1AFIA 2A6OA 1SC3B 3IG1A 5IM0A 1EETA 2Q79A 4Y2AA 4FF3A 1SL1A 4KFBB 3M8ZA 1JLQA 4WZQA 4ZPBA 4P74A 2BJDA 3HVTB 2OPQA 4QR0A 4KKOA 2BEFA 1RWMB 4B9UA 1Q8KA 1RSCA 3ED4A 2DNRA 1F9FA 1R31A 4WF9Q 1WI8A 2LVWA 1IJEB 4XDDA 4ID5A 5GADI 4HKQA 4Y2CA 1OQ3A 3BYRA 3GJRB 3R2CJ 2V9WA 3D7SB 3M8QB 2RF2A 3US5A 4USWA 4E0DA 1MSWD 1AFJA 3CJSA 5H1SV 1NB2A 2ZBPA 4LFAJ 3HHLC 4NLRA 1S9GA 1TFWA 3OUYA 2AJ2A 1RQ0A 2U2FA 4MTPA 4FYVB 4B9MA 4B9SA 4Q5VA 3DLGB 1T3NA 1U1MA 2V8PA 4BC9A 3U1LA 1FKPB 4B9NA 5DM6Q 4HACA 5KFBA 3VAKA 3CMAS 1M5PC 2HQGA 4TNOA 2QFIA 2D1CA 2GSNA 3KUGA 3CJ2A 3BBBA 3IAM9 1YZ6A 2L3MA 2EFNA 1FHTA 1ZM4A 5LQQA 2RUSA 4OX9J 1EI6A 3H20A 1F5AA 5DLTA 3M9MB 3MR7A 2YKNA 2JHEA 4LUBA 1WC5A 3M6WA 1N5TA 3E2EA 5LRMA 2EW9A 1RT4B 4ZKAA 1IWGA 4QZVB 5LOQA 2GAHC 1M0SA 1ZH5A 4OZ0A 4OLPA 5ETSA 5E5NA 2V8VA 4GMKA 4EZ6A 1RT5B 4BWMA 2CG8A 3ILOA 3G8QA 4FF2A 2RKIB 3MR5A 2KKHA 4RW4A 2HFVA 2MTLA 1K0TA 3E01B 2DEJA 2HEKA 1D9AA 1TAQA 1Q7YT 3CC4S 2FYXA 4HR2A 1IKYB 1ZPVA 4DJBA 1T05A 2HHSA 2VD3A 1CS4A 3NKPA 2AYEA 1PJ5A 2F5GA 2MZJA 1FT8A 1U45A 1RP5A 4CLZA 2L9DA 3SMZA 1OYDA 1N56A 1GX6A 5HN0A 2XGPA 2KM8B 3BKFA 4K0KJ 4LF4J 3DGPA 4UOGA 3JAMY 4ATNA 1KWMA 1RA6A 3OTEA 4QU7A 1XEZA 3DI6A 1AJAA 2IBOA 5B0FA 5DS7A 1R6YA 2UVVA 2DGVA 5C42A 3EGVA 4OQJA 3W60A 5HI7A 4WYLA 4J9LA 4USHA 1BMQB 3MM9B 4U67Q 2RJZA 2J76E 3IGVA 3I4HX 1FNMA 1KHVA 1PJ7A 4JI3J 3IWXA 3KLIA 4PQAA 4WFXA 3BJYA 3PW7A 2E7XA 2XS2A 3DMJA 2YWHA 4P52A 5DG9A 4UORA 4ZIWA 2ROGA 1HPZB 1HWLA 4Q8EA 4CO0A 3PW0A 4KIAA 2DHSA 4B08A 3Q24A 5K8NA 4ED6A 2BE7D 1KEKA 1S1TB 2HHTA 1HBMA 3MUVP 1HQ2A 1GMWD 3DRPB 2NXCA 3RB6A 4Y6IA 2ILYA 1ELOA 3NKOA 1TU0B 4V19X 1RAFB 2JLFA 1JK9B 4L3NA 3LUYA 4X64F 1RHJB 4QWEA 1VRTA 2XNRA 1FRKA 2ZITA 4JI0J 1VYAA 1S4FA 3VZHA 2QRRA 5GADU 3HT3A 2X3DA 5KFSA 1FJEB 2NYHA 1RYRA 1SJFA 2UP1A 4NI2A 1ULRA 2RHQB 2W4CA 2DY1A 1UP1A 3LPEA 4J7CA 4K5RA 5IT9U 1RCOB 2P9EA 1MMLA 1Z2LA 2ZDPA 3V6DB 3GIIA 2CFXA 2XYPB 4AUKA 5GAEI 4QIFA 5I42A 3UW1A 1NSQA 1KQSR 3MR2A 3TX0A 3VVUA 4FXDA 1KH5A 2CDRB 1Q81T 2FJEB 5KAKA 5KG0A 3ISND 4LF9J 1GMUA 2GJFA 3J7YU 2MQ8A 3HKZD 3RG6A 1H2TZ 1N4LA 1IBCB 2YQ0A 3IGNA 4CLWA 2V4QA 2W2PP 2CPFA 4CT8A 2FJDB 3FSXA 4WK1A 4BCAA 4NASA 1A9NB 1HNVA 2RQCA 1E6VB 3ET6B 4X62J 2MGZA 1MNEA 4F4YA 3B4DA 1HFEL 3Q8QB 3MM5B 2VBYA 5KOWA 2HGMA 4CM0A 2JVOA 1JLBA 2F1FA 1L3TA 3WIVA 1G6BA 3BDGA 3BGFA 1F60B 5A6PA 2QL5B 3CJ8A 4FKYA 3CC2S 3MUMP 2JZ5A 5ETRA 1LXJA 2OD6A 2MKHA 3QT6A 3F73A 1RTJA 5K4PA 3IM8A 1ZTWA 1XK8A 4NLUA 2B9XA 3C6UB 2HURA 3JYTB 1J2VA 2V8GA 4LR7A 3LP2A 2EK1A 1PIEA 3EICA 4YHHJ 4FYWB 4OI6A 4J5OA 3QQCD 1LW2A 3PVXA 2AGPA 4LRAA 3T1YF 4FDFA 5A8WB 4GVLA 4DFMA 1CQNA 2E7VA 2L48A 3TA1A 2ZOGA 4F26A 2C3MA 2YX4A 1FCAA 1SB6A 3BF4A 1NEEA 1GNKA 4Z7CA 1TKTB 3KK3A 2FGCA 4M5IA 5M2PA 3W7BA 4RNFA 3DYAB 2W7PA 4HTIA 2LXFA 4EMDA 4WP9A 2EPIA 3UN3A 4KM4A 2I5JA 1K73T 1WDTA 3H4BA 4DL6A 3PKMA 4LF7F 2IBKA 3IO1A 3HP6A 3A52A 2V0NA 3NGDA 2FVQA 2JFDA 1TAUA 4D3GA 3T6JA 2CZ9A 4OMFG 5KG4A 1WHYA 3C19A 4LR9A 3FBBA 2V4JB 1ZEDA 2DNOA 2LEPA 4H4MA 1UVKA 1KP6A 1CBKA 1REVA 2NXEA 3CCQS 4DV3J 3GZ7A 3MECA 1EQ0A 1GFWB 3OQ2A 4OHYA 4WBFA 2DNKA 3A1YG 1OPZA 2XY6A 3MR3A 3DDKA 2MZ1A 2G9YA 3V6HA 1FX2A 1JLAB 2IUCA 3NRBA 4A8MP 4H4KC 2ZC3A 2O3DA 3DRRB 4QOTA 1HBNA 3IM9A 3AH6A 3UDLA 1LWCB 4C4WA 4QW9A 2W24A 3R6GB 1QLNA 3LP1B 3I31A 2KJVA 3EVMA 4ZCIA 3QGHA 2HZCA 4KAIA 4A8SA 4DR3F 2EVZA 1UW4A 4AFFA 5IWAF 1BHNA 1HBUB 1U1NA 2BKNA 3W3SA 4A4JA 5LMUJ 3T5LA 1VR6A 3VAHA 2UXCJ 5L46A 1TK8A 2D3O1 3RB0A 4NE9C 2HHUA 1ICEB 4B17A 5GAEU 4PWDB 2HHXA 2WSCC 1TL3B 4MYUA 2OTJS 1B3TA 4LF2A 3NKMA 1YBUA 4I67A 2CZVC 1XR5A 2W4DA 4F3OA 2CQHA 3I0RB 4XPCA 2AV5A 1WEZA 2ZBIA 1X0PA 2QA2A 3NNCA 4DV2J 1C1BB 4GTXA 2XMAA 2VOPA 1S57A 4LBHA 1W2IA 5ETOA 1HMVB 3H59A 3I0SA 4KRWA 2FC8A 2B9YA 3DRSA 3IDDA 1URAA 1UJ5A 1NH8A 3HDSA 1LQ9A 2AYGA 3NNAA 2R8JA 1WSRA 4Y3CA 3KMSA 3CWJA 3D2WA 3TYTA 2QFJA 5HVGA 1IR0A 1UVIA 5D78A 4KH1B 1KOOA 3W9HA 3QT7A 2LQ8A 1SHQA 5KT4A 1UWAA 3I55S 3UN5A 1W25A 1UFKA 1NKBA 4OYZA 4I2QA 4TQRA 1PSDA 2GGPA 3MXHP 2G0IA 3TOQA 4F4WA 3CB4A 3GCXP 1IBMF 1YTYA 4EYIB 2ZZNA 3G6ES 3GSDA 4OHWA 1XN9A 2Y8WA 1RT6B 3P4UB 4MIWA 1QAYA 3TUIC 2LU1A 1SH2A 1FX4A 1FRHA 4JI6J 3QZ8A 5LJ5Y 3Q8SB 5ETMA 5D0RA 3D28A 1BQMA 3S6EA 3BGOP 3IRWP 2DHGA 1LWEB 1XBWA 2FZCB 2JL9A 3H8YA 4A46A 1B7YB 5T7LB 3KHLA 2DY9A 1FD8A 4OZLA 1U6FA 2LQJA 3T3FA 3AD7C 1RHKB 3GG0A 3HHKA 5DDPC 4OV1A 2W5RA 2M4MA 4JV5F 2KO1A 5I3UB 4LMZA 3D9BA 2HVEA 4ILMA 3AODA 3D0GE 4URQU 3M30B 3EVWA 3H98A 4HT5A 1X60A 3CD7A 5DQIA 2MQOA 2M8HA 4LRCA 4A8XA 5DLWA 2BV3A 2L9NA 2LQ5A 1YRUA 2IMOA 1NO8A 4IO9Q 4YR0A 3MHYA 1WI6A 3ZTOA 2V2QA 1I51B 1NJXA 3LP0A 2GX8A 2IC3B 4O3OA 2OFHX 2GQCA 1VQ9S 2G1HA 4FVCA 1X4FA 2RU9A 4CTAB 4TQSA 4LRBA 4IFYB 3MCMA 4ZCMA 3TRGA 5GAGI 1UPMB 4RW7B 1NDCA 2CJ9A 3W66A 5CD4A 3M6XA 1APSA 1TL1A 1WKJA 1O6XA 3D6MB 3NS5A 1Y9OA 2JWNA 4DUTA 4ED5A 4F0HA 4HHHA 1A7GE 1KVJA 1PAUB 4N8OA 4O3QA 4OI2A 4UUXA 4WTOB 4ILRA 3FCWA 5T14A 2V2VA 1VC0A 2Y3YA 5HATA 3HFKA 4DSFA 3J80Y 1RT2B 1IKXA 4KGVB 3THPA 1CULB 1CJUA 1LNQA 2MKIA 3RBEA 2ZFHA 3QRRA 1RABB 1E3CP 1S9EA 1TMJA 1NBEB 3D4JA 4YDDB 4DV1J 3SSRA 1X4CA 5HMXA 1U2RA 2O67A 1R8PA 4PYAA 3H2VE 3N4WA 4O3SA 1IKVA 1XWLA 3QFWA 2CQ2A 3VGVA 4C0BA 3ETOA 4IO1A 1C4AA 3DC2A 3LANA 3GONA 1TQLA 3A8IA 1T9UA 4DL3A 4O3NA 2CG4A 3PV8A 1ZA2B 3VQSA 4IR9A 2FY8A 2KJWA 3V81B 2HFNA 1VRUA 1TZ0A 3H5SA 4LBPA 1FVQA 4DDFA 2YWGA 2J0WA 4LF6F 3MM8A 2MHEA 2KM8C 3OFEA 2R9LA 4OI1A 2EI5A 3P45B 4EGLA 5CCLA 3MAAA 1S1WB 1UA0A 5I3QA 1NCLA 1HW9A 3KK1A 1FA0A 4DQIA 3PRBA 1KTQA 3FBFA 5HK4A 4OYMA 4RNOA 3MD3A 1VGYA 1VK8A 5E3AA 1FFWB 3TA2A 4YR2A 2W9CA 2R7TA 3B6BA 4NRUA 3CJKB 2QLFB 2GVDA 5D15A 4RBUA 5A76A 1RLDA 2QEXS 4EWTA 3AA8A 2XNQA 4IOAQ 4DZDA 2YWEA 1VRQC 5A8KB 1R8BA 4K4UA 4MK7A 5B0AA 4PWWA 2AEFA 4IFVB 2HZAA 3W2WB 4USVA 4IRCA 4F2SA 3HX9A 3ZFVA 3SDEA 1CVJA 1YJNS 4ICLB 3QO9A 4WWSA 1Y3JA 4K4SA 1LFPA 1H2UX 2H65B 3AB4B 5BJRA 2Q6CA 4Y2MA 3I82A 2HRUA 3DDIA 4LJMA 2EFOA 2BM1A 2ZH5A 3NY0A 1HIYA 3F44A 4QAXA 1VJQA 4ANEA 3CCLS 2HS3A 3VAFA 1VQMS 2BACA 1XNRF 1REGX 1YITS 2YBVA 2FJVA 5KFHA 1JLEA 3V4IA 3BQ2A 3BDFA 9ATCB 2LA6A 4K4YA 3CT9A 1M5OC 5LIAA 5AE2A 1GTEA 4KHRA 2D9PA 4O3PA 1SJRA 1MU2B 3KJVB 1J5OA 3KUEA 2HHWA 1QUVA 5BR8J 4WXOA 4B9LA 2X1BA 2IAJB 3FBCA 5KFDA 1X4GA 2DGOA 2DYAA 2LQ9A 2HQIA 1DTQB 4UOOA 3H5XA 1DLOA 3PJWA 1P27B 3RBDA 4EO8A 5D3GB 1B0PA 4L75A 1LWFA 3B54A 1UJ4A 2E9RX 1DQ9A 1NUEA 1QE1A 1EAYC 2HVDA 3PDNA 3H2LA 4BS2A 1IWAA 2BBEA 2QMUB 2FVRA 1X5TA 4QWDA 2ZBQA 2VASA 3QPIA 4JI6F 5AE3A 3PY8A 3UVJB 2Y0SD 4X4QA 3AOAA 3K57A 3OXLA 4GTYA 3OTBA 3C66A 2CJXB 1U47A 3U1NA 2W8LA 2W7AA 1IM6A 2OPPA 1U1LA 4PPDA 1AROP 3N9UC 1HI0P 3TUPA 1R0CB 3OFHA 2RRAA 5B0CA 1S1UB 1OQ6A 1RU1A 2VC0A 1SC6A 2YY3A 4LSNA 2BRLA 5IT0A 1N88A 2DCLA 2UUCJ 1KFDA 1RI7A 2AKWB 5D4LA 2EBEA 1WF2A 2O5DA 2CKWA 1SCJB 3FMBA 2QZ8A 4C8NA 4DQSA 1YQHA 3MD1A 2CQ3A 3KNGA 3KDOA 3SBMA 2DR7A 2EWHA 3SCLE 4ZVFA 1UAWA 5H9FJ 2B4VA 3MEKA 3QLHA 3QRQA 3DOMB 2Z2ZA 3GILA 3OFFA 3THTA 4HI1A 2RUGA 4KAVA 1NJWA 3R97A 4KGMA 1O0PA 3CW2C 2Y1LB 4JUZA 4QBUA 1T7PA 3ZTQA 2B4OA 1HNZJ 3GIMA 1N32J 3ZNJ1 2PMWA 4OZNA 1VQPS 1GX5A 2RQKA 3KMQA 1IQTA 2B6AB 3OR1B 2VFTA 4EU0A 5U47A 3BQ0A 4K4ZA 5J1EB 5IC6B 4Q7AA 3NGUA 4DV7J 4OYPA 3G86A 1AYEA 5HO4A 4I7FB 3MPWA 3M8PA 3GLJA 1X0FA 5LMNJ 5AJ9A 3HZGA 1OJ4A 2HFSA 2YWKA 4DCJB 2VG7A 3JSYA 2BW2A 2Y0BB 1T8EA 2CPHA 2V4RA 2CPEA 4BLGA 1Q8LA 3DLGA 4DR4F 2I2YA 2F40A 1O8BA 1BC6A 4M63A 1SJ4P 1K1QA 1U8WA 1TL5A 2XI2A 4KC5A 1WC3A 2XB2D 4PWUA 3TUZC 1IBLJ 4OZJA 2DBBA 2GJIA 4ECSA 4KHPJ 3GIKA 3GCWP 3IN5A 4CH7A 1D9FA 1RWVB 1P49A 4IG0B 5HROB 4JI8F 2HW3A 1KHNA 2AZ1A 1QTNB 4BBYA 3A8JA 5KFPA 3WAXA 3NAHA 2WB4A 3P96A 4GKJF 2RQ4A 2BJ3A 2RU3A 4A8FA 2AJ0A 1S0OA 1YX2A 2AYMA 3KLEB 2GFFA 1N5QA 4Z7YA 3DOLB 1GXTA 2R2UA 2AP6A 3FQLA 1NJZA 1VQOS 1P9QC 3OTOJ 4KPCA 3EZOA 6AT1B 3OV7A 4K59A 3UD3P 2YNGA 3R6LB 2N3OA 4RW8B 5CAAA 4K4VA 2OAUA 5HBMB 3CJQA 3NNHA 2PC6A 1RLCL 3H90A 3FGVA 2OIHA 1IKYA 3PIOQ 2WB1D 2BJ8A 2B7CB 2DH8A 2XR9A 2DIUA 4ES3A 1BQNB 1U7LA 4USUA 1FDNA 2CJQA 1WUUA 3H5YA 1RT7B 2EG1A 2FJWA 5CH7B 2E29A 4M94A 1HDHA 1S72S 3C6TA 2LXUA 4IDKA 2ATCB 4RL1A 1ZAXA 4A8QA 4FYYB 2F7VA 4QU6A 3R7SB 1I6JA 1FO1A 1SH0A 1S0NA 1B7FA 4NCBA 1ELYA 1F5BA 3HK2A 1IQZA 1HQUA 3MM9A 4CO1A 3A12A 5F8GA 5B7WA 1UZDA 1GMWA 1VFJA 3IBCB 3MEDA 4RLEA 2G9OA 4HHUA 3MUTP 4WIQA 4YEAA 1U2FA 3OTCA 4KHMA 3C16B 2BABA 2CYYA 3TQEA 1I5OB 1HPZA 1ZM2A 4YUDA 3TI0A 2U1AA 4M5JA 2DR5A 4OV6A 4C97A 1RWWB 2AJ4A 3BKUA 1PCAA 1FK9B 2NYIA 3R8YA 5J1PA 1IXKA 2BYCA 2XWXA 1L3UA 4HH1A 1X5SA 1JJ4A 4DX5A 3PO4A 1D9DA 1WC0A 3VCDA 3UFCX 2HWHA 2CQBA 1Y5IB 3HF5A 2DD8S 4IH6A 3ICLA 2Y9HA 2AD9A 1FDBA 2CPIA 2ZHAA 1X4AA 5IZHA 3U1MA 3G9CA 1S0MA 1WEXA 1KRPA 3SSSA 2BX6A 4DR7J 3JAMU 2DXDA 1N33J 5KFJA 4Y34A 7FD1A 2VF3A 4I6WA 2HHHJ 3BN7A 2XMTA 3BO2A 1I94F 1U09A 4G1QB 4OI4A 1JNZB 5HSPA 4MFBB 1R8HA 4DG1A 1V3ZA 1YK9A 4X66F 3FRYA 2ASYA 2NPFA 3MEGB 2QV6A 4ED3A 4CH0S 2VIHA 2VA3A 3A3NB 4JYAJ 1OSCA 3M32B 1Q7LB 2D69A 2OPSA 3ENQA 4DF4A 1W26A 1VQ8S 5KG1A 3SEOA 4CYUB 1FTRA 4CLYA 3CCMS 1XMQJ 4URSA 1SUQA 4HDGA 2FDNA 3HVWA 2YPZA 2XI3A 2WVDA 2LYVA 2Q43A 1XIQA 3GJQB 4J9RA 4CNZA 1SKSA 2WBMA 5EX0A 1CJVB 4X4RA 3G2XA 4UQTA 1FF2A 2D3OR 3L7UA 4P71A 1Q8IA 1HQAA 3GTYX 3C3LA 3AJ1A 4Q44A 1DQAA 4AQYF 5EWEA 5JMNA 2WRMA 2ZD1B 3MOZA 1H74A 1HNZF 1M90T 4JI4J 3R5AA 5KFUA 1U26A 1D1UA 1RAEB 4EEYA 4DR2J 1FRIA 5KT3A 3AXKA 3NCRA 4IH7A 2BDPA 3EYZA 4G3IA 1KBRA 1B4SA 1NJIT 1S6PB 4MH8A 4W90B 2V2KA 2XQCA 3MM7B 2X1GA 4A8KA 2POKA 5J2QA 4Y2IA 1RWNB 3QSIA 2ZNYA 1JNRB 2CQCA 4FF1A 2F4FA 4WE1A 2RAQA 4ZVHA 3W62A 2QIFA 2UV8A 3MPUB 3P5BP 2K1RB 3LGNA 2XSFA 4IRKA 4AXIA 4GC7A 1T9TA 1S1VB 2VZ9A 4LIWA 2W2NP 3CTRA 1QAXA 1KOHA 2ZH9A 1JLGB 2YKMB 5GMKa 2KT2A 2WK4A 4QIWD 1TKTA 4P7TA 2W5QA 4OLOA 3GG1A 2VG6B 3RBXA 3KLFB 5DQGA 2HBZB 2PEBA 5KFGA 5L1IA 5JJBA 5ETQA 2FVPA 2BANB 1X9SA 2Z4PA 4ECXA 1O51A 1D09B 2DNHA 1ZTTA 2DR8A 4OI0A 3TWZA 3BGRA 2X51A 2WCXA 3SXLA 5F0UA 1U1PA 2AW0A 4GO5X 1JLFA 3N5FA 1U0HB 1ELXA 4ECYA 3I9V9 2P9GA 1URRA 2ZOFA 2DCUB 2QYCA 4ZVPB 3EUNA 4UQGA 3RAQA 4M5DB 1CJKA 3IA0A 2W9BB 2IDEA 5HMYA 2PD1A 3ZZZA 1N48A 1EIYB 4C11A 1KHWA 1VBXA 3HHLD 1VDHA 3MMCB 5KT6A 1VQSA 1IBKF 2GCFA 3TJ8A 5F41A 3FZ2A 3PX6A 2N3LA 4Q45A 2WONB 3R1HA 2NPIA 2D3UA 3ADAC 2FC9A 4B3OB 2OJ3A 4F36A 4UTGA 2HAFA 2Z8QA 5CZVA 2FJXA 1UCNA 3TANA 1HKAA 2QC3A 2DIVA 3L7OA 4UOFA 4U8VA 5FJ4A 4BHQA 2QYGA 5CHCB 5HVFA 1KLNA 3NKNA 2J6TA 4RW6B 2YPYA 2WW4A 3N6NA 4NLYA 3I5AA 2DVIA 6FDRA 2PMHA 1D3WA 2IM3A 1KH4A 2HMIB 3V5RA 2C2DA 3MM6A 4USJC 1H7WA 2A10A 3TZWA 4JI7J 3RB4A 3J7Z5 5GAHI 3M8RA 1Z2ZA 4ED7A 4F4AA 1RAIB 4UT4A 2GSUA 1MW7A 4N41A 2RS2A 4O4GB 4QR2A 2DH9A 3MEEB 2ZUAA 3KXDA 3K5OA 1KHLA 2QA1A 1RWXB 2AT1B 5A2QY 2NLWA 1XR6A 4QCLA 3SFGA 4TXSA 3JQMA 2KXFA 4O4RA 2VPYB 3UDVA 1FD2A 4R0EA 3SYZA 2E5LJ 4ZVQB 2B5JB 2J9DA 5F8MA 3VGSA 3Q2TC 5KXAA 3AOCA 3CXCR 2E1MC 2I1RA 1M5KC 2VQRA 1RTHB 3DM2B 1BQXA 1Q8BA 4OYXA 2J6SA 2CWKA 5KFNA 4DPYA 2DRDA 2M9KA 3FQKA 5CXTA 5J2MB 1WSVA 1H2VZ 2QL7B 3OR2B 2QT7A 2XZTB 2IJRA 2Z56B 2QLBB 1ALIA 3KK2B 2H51B 2PA3A 3MURP 3AT1B 1SJQA 4KO0B 3M30A 1RACB 4TU7A 2PI4A 1X9MA 1UVLA 2DXFA 4XAKA 3PX4A 4ZN1A 2XM3A 4ED1A 1F3FA 2XMMA 4I56A 3LO3A 3H5UA 2VQFF 1NPPA 1Y4ZB 4OYWA 3Q8UA 2RT3A 1C1CB 4E8UA 4KPYA 2IC3A 2FLOA 2E5HA 2X98A 2E66A 2VPXB 2MQMA 2WOMA 1RISA 1ITPA 4IFYA 1N5SA 3OLAA 2XYHB 2GQ2A 3MI7X 3T1HF 1RT1A 1WG5A 5F8JA 3NBPB 1ELZA 4RU2A 4NZ0A 1Q79A 5KFQA 4B3SJ 2NZCA 4F8RA 1M1KT 1KD1T 4CXUA 3CVKA 1VBZA 2UVWA 1AJBA 3ISNC 2DNZA 4R8UA 4MKBA 2G13A 3FNNA 3W2VB 1MWQA 2ERRA 3ZZYA 2A2CA 4F4XA 5KFWA 3BGUA 1DY3A 2C2KB 2FHKA 2B3TB 2MSSA 1N2KA 2E1RA 1JXEA 2OO4A 2HAIA 5GVQA 1N5YA 2GSOA 3TW0A 2VL1A 1HHSA 1S4EA 2RSQA 3NXZA 2NUHA 2M3DA 2VB6A 2Z0GA 3IR7B 4C0HA 3DNCA 1QVGR 2ABYA 4RNNA 4MYTA 3B82A 5FD1A 4UY8T 2D1GA 4FP9A 4PEOA 2HHPA 1AZSA 1B0TA 2NXUA 3KG1A 5CYQB 4DFJA 2Z58B 3M05A 4ZS6A 4ZLPA 4DCPB 3TVKA 1UA1A 2VPWB 1VLYA 4LSZB 4DR6J 3MR6A 3L4BC 1QSSA 1ZEFA 1R6VA 1M5HA 2OHDA 3C15B 3JQJA 4TY8B 5KFCA 2CVEA 3SZYA 3JTOA 4P9SA 2EFPA 2W7OA 3FFIB 1RAJA 1KLMB 5J2PA 1SL0A 4KYZA 4AL5A 2UXBF 3GU0A 4UUWA 2CJYB 2E5IA 4LVNP 3M2RB 5GAHU 2R7VA 2PDAA 2HS4A 1BLUA 4B9VA 3ZNUA 4DI6A 3OFGA 2VDIA 2L41A 4PXCA 1YRXA 4F04B 1PJ6A 2J0QD 2R7RA 3HSZA 1F2GA 2HQCA 1RADB 2FQQB 4FBUA 1Y5NB 4ER8A 2HNYB 4DU8A 1FI4A 2V5HG 3TVYA 3GFXA 1Y3KA 2GJ2A 3CJKA 2GMLA 3D3BJ 3RW6A 3W5XA 3IRXA 2P9CA 4DL0C 3T02A 4U7CA 2DGQA 2RIJA 1IKWB 3HFZB 1VQ7S 5C2CA 3IBFB 4NMXA 3J80U 3A13A 4S0MA 2W8KA 1EX8A 3CDUA 1JXVA 4OJHA 1WOPA 2CPXA 1R0AA 1ZZFA 1NXIA 3KG0A 3OVBA 4DFPA 2J6UA 3IG1B 3KD8A 3TZXA 5IM0B 3W2WA 4ELUA 1EETB 3JSMA 3FSYA 1XC9A 1SKWA 4ICLA 3FRZA 3TAMA 1JLQB 4IUFA 2UUTA 4ZVSB 3SIPB 4CZCA 4KKOB 1JX4A 1K44A 1RBOB 4DN9A 2AEMA 1NK6A 3R2DJ 4CXSA 1SL2A 4N56A 1WELA 4CP5A 1SH3A 2AWZA 3NMAA 2FVCA 1EB0A 4Q2LA 4ID5B 3HT0A 2LECA 2W5WA 3OW2R 1WOSA 5EGHA 2RF2B 3RRHA 1YLXA 4G1PA 1Q82T 1UW9A 4QR1A 3NGSA 2Y8YA 5HRTA 2GIRA 2KT3A 2PIIA 3UDCA 1S9GB 4O23A 4PUOA 2HGNA 3OUYB 1YIJS 4FDJA 4LFBF 3BSNA 2MB0B 2MZQA 1IUJA 1NSPA 3WDOA 3GB0A 3NAIA 2QN6B 5D3GA 4UZCA 1F0XA 1ROFA 2ZBCA 2HLUA 1HHQA 4HACB 1HARA 1HI8A 4CYRA 1H38A 1VQ5S 3D3CJ 3OJSA 4KY3A 1HD0A 5IQQA 4ED8A 3KG4A 3WQPA 3WX4A 4ZLNA 1S1UA 4DQPA 1Q16B 3CC7S 4OL8A 2VBZA 1WDDA 2QTWA 3M2VA 3RUBL 3ZTSA 3LGHA 4F02A 4X65F 4X64J 4ETXA 3TEGA 1WOOA 3OT9A 4GVBA 4UY85 2KHDA 3T5HA 4RW4B 3KYLA 4NA3A 1P8GA 1NJYA 2DB1A 3DU5A 2ASLA 4UPHA 1T05B 1CS4B 2AQ4A 1RTZA 3ZZ0A 1TMMA 4WK3A 3NGKA 2CNKB 2KN4A 1JB0C 2R8IA 2H1YA 2IRYA 2FZKB 1GQEA 3VQTA 4DV5F 4AL7A 3LQVA 3VZIA 1FERA 4O44A 4DS5A 2V6AA 3CJRA 3RAMA 3DI6B 1KFSA 4NOHA 1KQKA 5C42B 1Y6VA 2RD5C 4F3QA 5C25A 3ETMA 1FRMA 3MMBA 2RH3A 1ALHA 4B9TA 1D0EA 2CVIA 2FJAB 2G0CA 4ZITA 2PSZA 5AJ3F 2UUBF 3T41A 2DHAA 1Q78A 4H4OB 2OPRA 3EWGA 1YKWA 4Q43A 3T00A 4EBDA 3ZZRA 2CRLA 3LAMA 3PHTA 2VQEF 2JOQA 5KFYA 2EEYA 3DMJB 5BYQA 3ENVA 5B0EA 3OSPA 4C8YA 3QATA 3ZZOA 1S48A 2W5SA 3BV8A 1SKRA 3LWLA 2AX0A 1BWVA 3KLHA 4RJVA 3PTWA 1L3VA 1G2EA 3B5QA 3MGJA 1HBMB 2P5VA 1MLAA 3GJTB 2JJ4D 1QJHA 4IG3B 4QIVA 4MKAA 3DCAA 1EW2A 1F1BB 1YJVA 2YXLA 4DR6F 4DV0F 3G82A 2NCKL 1RE1B 2ZZTA 1E1ZP 4OHZA 3QWPA 5DLGA 5HROA 3FC9A 1HI1A 1VRTB 5DO2A 4G1IA 3QIPA 3KJFB 1T9YA 3M9OB 2VC1A 4R25A 2GW8A 3K5LA 4CLLA 1FXLA 3T1YJ 4OYIA 2KG0A 1C4CA 3PYEA 3D1OA 1UFLA 5K8PA 2IPOB 4NI2B 2GO9A 4P2MA 3KLEA 2J5AA 3DOLA 3BR9A 3GWCA 1F2HA 5KT2A 4IOBA 1V5IB 3G6VA 5I42B 2ZH2A 3TX8A 8ATCB 1VLOA 4JI2F 3MPYA 1S49A 2PFDA 3UPFA 2BM0A 3N5BA 4C6AA 3OD2A 4LF7J 4I2PA 3NCPA 2JLEA 4CNYA 2DT9A 2UUAF 4ZPVR 3NKQA 2MZSA 3MMAA 5HMZA 1N8RT 3AD9C 1EKRA 2CJAA 4DV4F 3VAJA 4WKRA 2KFNA 4F0KA 4HH0A 1HNVB 3VTIA 2UZAA 4DS4A 2Z57B 2GVZA 5K9FA 2VHGA 5C66A 1NZAA 2CQ0A 3GJSB 2N82B 1YBTA 1RT7A 5MLCV 2WSEC 2VH7A 3HXMA 1U4BA 3EGZA 1R0BG 1CEZA 2OEKA 4PXEA 1JLBB 2OD4A 2HRTA 3BDGB 1UTAA 5CQGA 3GPAA 2KZMA 3AJDA 2MQNA 3M1VA 1ZA1B 1GMVA 4F7VA 2KT5A 3J81U 1WHXA 2FHMA 3M8YA 2PI5A 2UVUA 5INHA 3SFUA 4CM2A 1Q53A 1YJUA 1T02A 2IJNA 5ETNA 4HVZA 4DR3J 4MIAA 4DQRA 4K4XA 5IWAJ 2FHOB 2O1PA 1E33P 3LP2B 2MDAA 1Y5LB 5G0RA 4F3MA 7AT1B 4YOEA 2OMLA 1HNIA 2JEIA 3FDSA 4RPFA 2R2TA 5HLFB 2Z2YB 2FTRA 4ZGAA 4P10A 2OLWA 4WU2A 4X2BA 3DLKA 2CAJA 2B9WA 1HR0F 2HBYB 5I3PA 2KG1A 4FDIA 1M5SA 1UVNA 2L9WA 5EDWA 3CJ4A 1C0TA 4XDCA 2I5JB 1VOMA 2HWTA 5K14A 5K20B 1KH7A 1JJCB 1MN9A 3NGTA 3PYDA 4ECRA 3SQGB 3IXQA 3MDFA 2LMIA 2IYGA 1WACA 4PABA 3Q8PB 4G1QA 5KFTA 4QW8A 4J9UE 3BGLA 4LQ9A 4H4MB 1WWHA 4WKYA 1FFSB 1REVB 4WYWA 1S0VA 1IBMJ 3CDWA 3MECB 1NHVA 4DMZA 2GAGC 3O44A 3CDEA 2LU2A 4LFCF 1F9EB 2LEAA 2IUCB 2UU9F 5DDRC 3ONQA 1WHVA 3DRXA 1HBNB 3W9IA 4UPLA 3HD1A 2NSBA 4MHXA 4H54A 2K3KA 5JUMA 2XULA 4IQXA 2YQ3A 1YJTA 2HHVA 3M2UA 5ETTA 1KTVA 3BM7A 4C2MA 2QLJB 3IP0A 2HNDA 4PPZA 2MZTA 4P7VA 1NLKL 2ZM6F 2GHVC 4C8ZA 4KR0B 4JV5J 4F4ZA 2JVRA 2ZD1A 4DUZF 3ZZPA 1XMBA 3I6PA 2MEWA 1JLCB 3BEGB 2MKJA 1V3RA 4YY3F 4DF8A 1BE4A 1XJWB 3CO0P 1MWYA 2YH1A 1A6LA 5M2RA 1O98A 4DUYJ 4Q0BA 3UO0A 1VS3A 1YJRA 5BYRA 3LH2S 3LXQA 1S6PA 2C2ZB 3CULA 4DSIA 4ALZA 1FJGF 5IQ6A 4AXJA 3N28A 8RUCA 1BUXA 2RQMA 2YWWA 1MWZA 4QIGA 5B0GA 4F2RA 1Q95G 3DFEA 3I0SB 2F8MA 3DRSB 1R43A 1VHIA 3BSAA 1MMNA 2K1RA 1GH8A 4FPIA 4CIOA 1K8AT 2EXUA 3HVRA 3D0IE 1B0VA 3JXOA 4WP8A 3R7BB 1RUSA 4K8RA 2DHHA 1JLGA 2CADA 2YKMA 4ZG9A 3KLGA 2ZE2A 4O3RA 2MLYA 3CF5Q 2ACMA 4CH1A 3EX7B 1X4HA 3L3CA 1N36F 2K06A 2R7QA 5L1JA 4QYZK 3M6VA 4I2QB 2YTCA 5E41A 3PX0A 2GGPB 1KQFB 3G6XA 4KV8B 2X1AA 4NCGA 2MKKA 1RTIA 1QD1A 2I6WA 5F9LA 2V34A 3RU0A 8AT1B 3OSNA 2MKCA 3NLCA 4Q8FA 1XMOF 3DKDA 1N6QB 1E2SP 4Y2KA 2HYIB 5H9EK 2W1BA 1U48A 3SCIE 3DLJA 2GC8A 1H7XA 3ZXWA 2N7YA 3P49B 3WX8A 3HHLA 1U0HA 3M9NB 4TN2A 2W8SA 2Q3PA 2NSCA 4FNHA 5K5MA 4L74A 4FZVA 1IR1A 4NLGA 3Q23A 5ITHA 2YX7A 4J91A 1F5CA 1LK5A 2QX0A 1Q5VA 4A8YA 1EQJA 1K9MT 4QPXA 3RAXA 2V68A 4Y0FA 3P6YC 2C3UA 1NPKA 3UCGA 2C3PA 2W9BA 4MY4A 4W92B 1RGVA 4AYBD 4DPWA 4JV2A 3T1AA 4NEZA 4C3MA 2YWFA 3PHEA 1YBAA 2IA6A 3EDRB 3LP0B 4LF6J 3Q0AA 2V67A 2WONA 4CLUA 2B7BB 3F41A 1FVSA 2YNHB 4MIVA 3TARA 4DWIA 1SKUB 3PYFA 1TL1B 3MZIA 2J0XA 2ZKTA 2ZHBA 3R5CA 3BB5A 2QMXA 1PG5B 1RDRA 1N34J 3UD4P 3FSIA 4KH0B 4KE5A 3CD5A 1XTZA 2ZH7A 5ETKA 3O8WA 2O66A 4GKKJ 1RTDA 3QT8A 3SV3A 4QIEA 5KG6A 3CO9A 1NH7A 2DNNA 2FLNA 2H48B 2P6TA 3U7JA 2CJBA 3M8WA 2DGWA 2IHR1 2R7WA 1SV5B 1WF0A 1LKZA 3HM9A 3GP9A 2AJ1A 3KUHA 2HGLA 2VJUA 2FUG9 2IMWP 4RX6A 4O4GA 1VJWA 4P72A 3QAEA 4CLPA 3T9NA 4YN3B 2RE1A 3HI9A 4NLQA 4ZHRA 4X4PA 5AXKA 1XNRJ 2BQRA 2E7WA 2XHWA 1S9EB 1DRZA 3AHPA 2IFXA 4DPTA 3GV8B 3BSOA 3BDPA 1Q4RA 3AFGA 5AE1A 5C24B 1VQ4S 1IKVB 4DR5F 3BN4A 1HYSB 1RTHA 4IKAA 1FRLA 3UR0A 3D67A 1FJCA 2A1BA 5KFEA 4JV0A 5CA5A 1WC6A 2YNFA 5D6GA 4YR3A 1TKZA 4JV1A 5LJ3Y 4LBIA 2E1AA 2E1PA 4NLSA 5J2MA 1FKOA 4WIIA 1VRUB 3OR2A 4ES1A 2VA2A 2F4VF 5C5JA 4ZP9A 2EKYA 4O0NA 4ID8A 4KO0A 1DZ5A 4A8WA 2ZDOA 2ZWPA 5F3TA 1S7IA 4F67A 3MAAB 1RBLA 3KK1B 1UPPA 1OPIA 4PQUA 3DDNA 2HLTA 3W8PA 4NZ6A 2W5VA 2JEFA 3OL6A 1C0UA 2W9CB 3JB9k 5SZTA 1RAGB 4B3MJ 1SJ3P 3U02A 2GVDB 1C1CA 2M7SA 5IT4A 2CDQA 2ROEA 2KL8A 4K7QA 4FS1A 5CYMA 1TKXA 1YSJA 2HFZA 4CCHA 1PC4A 1V5VA 3PEJA 4X4UA 2ZUGA 5F8IA 4EI2A 4DUYF 2VBXA 4W4MA 2GMHA 2DNPA 2XY7A 5HANA 2ZH6A 2HQFA 3C14A 5FDLA 3NBPA 4L72B 1T9VA 4USMA 3CD0A 1OS5A 1VQKS 3W2VA 2PT0A 1RBAA 1IM4A 4WZMA 5DQHA 1ZEBA 3CSKA 4KB7A 1JLEB 5HJXA 3B78A 4DPXA 1HD1A 1E6YA 1UWBB 3PJXA 3PR5B 1XNQF 4YR1A 4J9NA 5HAOA 2RILA 4R5PA 1J5OB 3K8VA 2WBRA 1CSJA 2M52A 3WIUA 2J7KA 2BQ3A 1OO0B 2A18A 4YB6A 1NM2A 2MLZA 2YQ1A 4DSKA 2X3GA 4RUBA 2ACYA 4LIRA 1F3VA 3ILJA 2V50A 2F9DA 5CYQA 4EK2A 2XBPA 1LWFB 2XEXA 3R5GA 1MROA 3CNQP 4N7TA 3X3UA 1QVFR 4I68A 3T5KA 3L7PA 1RAAB 1VC6A 1HHTP 5A8RA 3QMQA 3WHIA 4ZG6A 1FDDA 2V94A 1AUKA 3C15A 3PYGA 1R3NA 3JSRA 3EPGA 4DR4J 5T41A 3FFIA 3S7RA 3MCNA 4HL9A 4YFUA 4LF8F 3ITHB 1KR4A 3ZZTA 2OPPB 3FCHA 4RW9B 2ASDA 1HWIA 4Z2XA 4XO0A 4ZIVA 2KU7A 2RDIA 3O5TB 1S6OA 2CPJA 2ANHA 4LSNB 4DHVA 2ADCA 3H7HB 1JKHB 2P8IA 4AL6A 2I38A 5GOVA 3GR0A 4JI8J 4PG8A 2BRKA 5IS2A 3SQOP 3NP5A 4WP3A 4JOUA 2CUYA 1AXQA 5EUHA 2AZ3A 1RJJA 4GKJJ 2HNYA 1U24A 1S12A 2OI2A 3QJJA 3S1TA 1G7CB 2QSWA 5J2NA 2I0XA 4J9QA 1S5ZA 2C42A 2GMJA 1ACMB 5C7PA 2PFFB 1RKIA 2IJFA 3OTDA 3QLHB 3JTPA 3D1QA 3VGUA 3T9ZA 2ZOMA 4NLVA 5M2UA 3RW7A 1UVJA 2LXIA 3RRKA 2QE5A 4JI5J 1J5EF 3OHBA 1TL7B 2M8DB 2B9EA 2ROPA 3EXCX 3LGMA 4ZVGA 2LP4A 5EWGA 1UVMA 3CMRA 1CC7A 3V4MA 3R9LA 5KFOA 1N34F 4PG6A 4NX9A 3DOKA 1UEKA 4TN0A 1CJTA 3ELHA 2GNKA 4KJIA 3K5NA 3CMES 4NWBA 1X4DA 5KTQA 4GKKF 3K7RA 3M8PB 1C2PA 2VKZG 3M7VA 1X31C 4TVAB 1CLFA 4H4KA 2VG5A 5GRRA 3VVTA 5HQLA 2VG7B 5KG7A 5CZXA 3PG9A 2F63A 3MK2A 3BDEA 1VHFA 4UZBA 4M95A 2YH0A 5IOLA 2AU0A 4D3HA 4OJ3A 2RRBA 1LW0B 2DGTA 1HNWF 4NWXA 3F0NA 5IC4B 2F8HA 5DDOC 2EKNA 4PR6A 1F9HA 2ZKUA 5D4PA 2CNNB 4A47A 1UEVA 1S79A 3HVAA 4I64A 5KFLA 4NCAA 3W63A 3J7YI 2EFQA 4XK8C 1B64A 4DN0A 3O6QA 2PEHA 4CO5A 1CPZA 3LAKA 3DU6A 1FNOA 4NXNF 3TZZA 1AA1B 1Y7AA 2H9ZA 4LRDA 9RUBA 5AXLA 5HP1A 4TYAA 2UXDF 5LXYA 4K4TA 3POTB 2BJEA 3PEHA 3I87A 1TV6B 5KT5A 4OZ1A 1NHUA 1T11A 1X4BA 4BWJA 2HG4A 5GAGU 5E3CA 2B8QA 2E5JA 3EM1A 4K2JA 2F8EX 4JI1J 1YG0A 4P2FA 4PG7A 2DXEA 5EX3A 5ETLA 1LXNA 1S99A 1ZYQA 1PAEX 5CD4H 3NS7B 1ZOTA 4DV6F 3QNWB 2YNGB 3M6UA 4DQQA 2AGQA 5TJ3A 4IH5A 1WTBA 3EZUA 4FBTA 2DGUA 1TUVA 2BZ2A 2AYBA 3W9JA 2BE2A 1U6BA 3IBWA 2HFUA 1TUGB 4E98A 4B3MF 1VQ6S 4ZPWR 2HBQB 1NAQA 1I94J 3QRPA 2IRXA 4B3RF 4CYSA 4MMOA 4RUAA 3HKWA 3DXBA 3W64A 4RBVA 1NDKA 4DR1F 2K3IA 3TNVA 2GA7A 1RT3A 3CEDA 4X66J 3W5ZA 2B4PA 2YKOA 4OHXA 3I96A 3DLEA 3AB2B 2G2YA 4F4KA 1V6HA 1RHQB 3C6TB 3I5BA 4IDKB 2I8EA 3MCOA 1T03A 1QAJA 1ED8A 1QUPA 4OJGA 2F3JA 4ZPTR 2BOPA 2OEJA 2WSFC 4I6AA 2W9AA 1HQUB 2WW8A 4MT1A 4BDPA 4CLTA 2H3EB 4ZVEA 2ZVSA 4ED0A 3MEDB 4H4OA 1N54B 5HL7Q 2HQ3A 4G6VB 4RU9A 5E3QA 4AQYJ 3UDEA 4KFBA 3CCES 3AOBA 1SXLA 2KB2A 2RRNA 1R8AA 2HBRB 3HVTA 1U1QA 4YB7A 2RH6A 1T3OA 1QAIA 5FLXY 1WTFA 5KFIA 2DKOB 3D68A 3TAPA 2G1DA 3THVA 2PA8D 2G0JA 1FEEA 4IG3A 5L1KA 3MAQA 3GQCA 2VFRA 1LV5A 2CQGA 3M8QA 2H54B 4A8OA 4DX6A 2K8GA 5KFAA 3LA0A 1D8YA 1FSUA 3UNGC 4L73A 1A0OB 2XGQA 3QWUA 2D41A 3UN2A 3FUYA 2R4FA 3NMRA 1M1GA 3DHXA 2XCPA 2E1CA 4C8MA 3RYLA 4W98A 3N0VA 1HNXF 3CGIA 2R7SA 4NXMF 3CJTA 3IS9B 1FKPA 3J7AN 4DG1B 3ULHA 2J7UA 2R7XA 3HD2A 1FJ7A 4IRDA 5HQ8A 2W8DA 4XPEA 4DL7A 4ECZA 1QSYA 2C2OB 3NS6A 2WVFA 5AXMA 4NMLA 4ECQA 2OPSB 2XS5A 1RAHB 1V9OA 3EJMA 4ZP6A 2R7UA 1SUQB 1B70B 4C9DA 4YQWA 3EGWB 1RT4A 3CE8A 3VWSA 1PBAA 2CZ4A 4ZG7A 3TEHB 1LFWA 2NUUG 1NK8A 2DRBA 1RT5A 3H40A 3GV7B 4JI5F 2ZHOA 2RKIA 2BW7A 1JIHA 2GS8A 2VKRA 2J9EA 2DEIA 3C8YA 2Y1RI 3E01A 2XS7A 1H72C 1OY6A 4HI2A 3VGTA 3QFHA 5A6WA 3OL7A 4DXLA 2YVSA 1IBKJ 5J2QB 3F56A 1ANJA 4ECWA 3NKRA 4CLFA 4LFAF 4EZ9A 2OKQA 3QGGA 2MLXA 2AMCB 5D8HB 3K5PA 2LCWA 3K17A 2QSFA 4WE1B 3H2UB 1G1XA 4LQ3A 1DHMA 1ANIA 2KDOA 4CWBA 2B4UA 4NYPA 5IV4A 2VFVA 4TLQA 3CCWA 1NZ8A 3HSGA 3LALA 5HLFA 4HDHA 4DSJA 5A0YB 2KVQE 3EXYA 3I9ZA 3HHDA 3MTKA 4NA1A 3K58A 1WHWA 3SZZA 2H4WB 4KAYA 1UZHA 4UF4A 4N5SA 1TL4A 3TZYA 3D0HE 1NB7A 2YKQA 3QYYA 2VV5A 3L09A 1Q1KA 1S1TA 2NREA 4OX9F 1PYOB 2DH7A 3SQGA 1NDLA 1YWXA 3DRPA 4L76A 3OXGA 3RR8A 1RWKB 4JI1F 2XSJB 4ZVUB 1U0SA 3BGRB 2LEBA 2ASJA 1JLFB 4V1Ak 5L0BA 2YNIB 3G87A 4AD6A 3UCZP 2BOAA 1EARA 4I1TA 3K0JA 1RWOB 4NYOA 3VF0B 1ED9A 1SI9A 1CJKB 5D77A 5JVGQ 3V6DA 4M5MA 4C11B 4ZCKA 5EGYA 5DM7Q 1W7WA 4K0KF 4LF4F 4TY9A 2HIQA 3KWMA 3VAGA 4WJBA 5FIIA 3IR6B 4UPIA 4NLOA 2IM1A 1I1GA 2ZH8A 1OWXA 1SQEA 4F50A 4WFAQ 2C3YA 1JLCA 2GHWA 5KT7A 3MPDA 4PZVA 3RJMB 1HQEB 2B8PA 3I4PA 4NLXA 5RUBA 2DISA 3RB3A 1JQGA 2BE9B 2Q66A 2HNZB 1E6VA 3ET6A 4JI3F 2VQFJ 3P8BB 5F8LA 1G4CA 3H42A 2UUWA 1YI2S 3MM5A 4RWXA 1DFDA 1R8CA 3MWBA 1K7HA 3GFYA 4C3LA 4EFAC 5E3RA 3MM6B 2EFVA 5KFXA 4IR1A 4ECVA 5THWA 3KLVA 1TR0A 4OZ3A 3PZPA 1FDAA 1CC8A 3UCUP 3T1HJ 2GV1A 2FZGB 4DPOA 4P2XA 1L3SA 1ZPWX 3WBZA 4QQBA 2DHXA 3W1YC 3W5YA 3TA0A 3A8EA 1N2LA 4I4BA 3MF5A 4O0IA 3C6UA 3JYTA 4PAAA 3AQPA 4B02A 3R5BA 5DZ7A 4M8LA 3KNAA 1VCTA 2EK6A 4KV8A 4YS2A 3DXSX 2XCAA 2CPZA 2FB0A 1R89A 4JI0F 1SIZA 2HQDA 1PILA 5A8WA 1S10A 2DPJA 2F9JA 2FPHX 2XLKA 4ZLLA 3Q2SC 2DNMA 4LREA 4OX7A 1N6QA 4ZPDA 3O3LA 1DURA 2APOA 3Q3QA 5H9FK 4AT1B 3DYAA 5F9NA 3GV5B 2XTJP 1NHKL 3PXGa 2MZRA 1WG1A 1H98A 3KHHA 2LFVA 3A3OB 3VHQA 1TP7A 4USIA 3L9ZA 1VIOA 4LSLB 3G6YA 1KC8T 4RNHA 4LF9F 4CLSA 4URGA 1BY9A 4WU3A 2KZZA 1RHUB 4C8KA 3KHRA 2R8HA 5KG2A 4ZDNA 4OZ5A 2CXEA 2V4JA 2BXJA 3Q83A 2XYGB 2UXBJ 3MAHA 4RZRA 1XR7A 3CCSS 1LEOA 2PO4A 1U1KA 1Y0HA 4X62F 1H73A 1Y11A 1RYSA 2QLWA 2XY5A 2C22A 5DZ6A 2H5JB 3BBFA 3IMQJ 4CI0B 1JLAA 3HHNB 2WOMB 2YNHA 1S97A 2HKEA 3HSJA 1NPRA 3BPSP 3CCUS 1EP4B 2CWXA 3DRRA 2CQ4A 1RXOB 3BSCA 2JEGA 1RT1B 1LWCA 3RGIA 4NLWA 3FVYA 3B8HA 3LP1A 2V8DA 3A3PB 1AUSL 4MKYA 2WVCA 5HVHA 4J9PA 4R8UB 3OXFA 4B3TJ 4RUCA 1H6KX 1FWPA 1HBOB 1HBUA 1SHNA 2P2CB 2WAQD 4CXKA 1H3DA 4YHHF 2QMWA 3IAS9 4KTQA 2CPYA 4MAKA 3GFHA 4PG5A 4N77A 2R7OA 4OX8A 4ZK7M 1N5YB 4PWDA 1SV5A 3CCRS 1UKUA 4UOHA 1EW9A 1QDUB 1KONA 1TL3A 1UFWA 1D8ZA 4FVMA 2JC1A 3FBEA 1MMDA 1O5JA 2Y1IA 4KQZA 5LL6d 3I0RA 4U6PA 1FXRA 3K2YA 1C1BA 3GYNA 3RRGA 2SXLA 3KDNA 1AZSB 2A6MA 4ZOSA 4GC6A 1HMVA 4M5NA 1DBDA 3GE9A 1TVRB 1S9FA 1UETA 5C24A 4FN5A 2MY7A 4ZLJA 4LFBJ 5DDQC 4ANDA 1EQMA 4ZCLA
chains in the Genus database with same CATH topology
1K7HA 1O99A 1EI6A 2QZUA 3WAWA 4ZGAA 1KHNA 1ALIA 1KHJA 1EJJA 3ED4A 1HDHA 4UPLA 4MHXA 1E1ZP 5IJSA 5DLTA 1Y7AA 3WAXA 4LRCA 3MK1A 1ED9A 5C66A 1URBA 4LRDA 4ZG7A 1N2KA 5L0KA 1SHNA 5L0EA 3UNYA 1SHQA 1KHKA 1EQJA 1Y6VA 3CMRA 4GTWA 4CXSA 3BDFA 3UN3A 4KM4A 5DLWA 2W5QA 4LRFA 3UN5A 1HQAA 3IGZB 4FDIA 5LRMA 1ZEBA 4CXKA 4ZG9A 2GSUA 5LIAA 3BDGA 2GSOA 3M8WA 4MY4A 3WBHA 1B8JA 2W5WA 1ALJA 2GLQA 1FSUA 3SZZA 1ELYA 1HJKA 5EGHA 3WAYA 4TN0A 3T01A 1ED8A 1ALHA 2ANHA 3A52A 1N2LA 4KAYA 4GTZA 3UN2A 1KHLA 1KH7A 3BDGB 3DYCA 5HRTA 5AJ9A 5K4PA 2W5XA 4YR1A 5DLVA 5GOVA 1E3CP 3BDHA 1AJDA 4LR9A 1EW9A 4UPIA 3M7VA 3T00A 2W5VA 1ZEDA 4FDJA 4UOOA 4LQYA 3OT9A 4LRBA 4UORA 4KJGA 3TX0A 2D1GA 1O98A 3M8YA 5GRRA 4B56A 5INHA 4LR7A 1KH5A 3E2DA 3UO0A 2X98A 3NKPA 5IJQA 4MIVA 2XRGA 3MK2A 3NKMA 3TWZA 2GA3A 5TJ3A 2W5SA 2W5TA 2IFYA 3LXQA 4UPHA 3T02A 3NKNA 1AJCA 5KXAA 1E2SP 4NWJA 1E33P 3MK0A 1EW8A 4GTXA 2VQRA 4NWXA 1ELXA 5EGEA 2W8DA 3B5QA 1ANJA 4UOPA 4UPKA 1ZEFA 4N7TA 4LRAA 3NKOA 3NKQA 4QAXA 4LR8A 2G9YA 2ZKTA 3IGYB 3TG0A 1ELZA 3NKRA 2RH6A 3M8ZA 2XR9A 5LRNA 4LREA 4KAVA 2IUCA 3IDDA 2GSNA 3KD8A 1URAA 3DPCA 5L0BA 1KH4A 4LR2A 4ZG6A 4CXUA 2W5RA 4CYSA 3SZYA 2W8SA 1EW2A 3Q3QA 1AJBA 1ALKA 4GTYA 1KH9A 2IUCB 1ANIA 1AUKA 1AJAA 1P49A 3NVLA 4KJDA 4CYRA 5LQQA 3WAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7H A;  1O99 A;  1EI6 A;  2QZU A;  3WAW A;  4ZGA A;  1KHN A;  1ALI A;  1KHJ A;  1EJJ A;  3ED4 A;  1HDH A;  4UPL A;  4MHX A;  1E1Z P;  5IJS A;  5DLT A;  1Y7A A;  3WAX A;  4LRC A;  3MK1 A;  1ED9 A;  5C66 A;  1URB A;  4LRD A;  4ZG7 A;  1N2K A;  5L0K A;  1SHN A;  5L0E A;  3UNY A;  1SHQ A;  1KHK A;  1EQJ A;  1Y6V A;  3CMR A;  4GTW A;  4CXS A;  3BDF A;  3UN3 A;  4KM4 A;  5DLW A;  2W5Q A;  4LRF A;  3UN5 A;  1HQA A;  3IGZ B;  4FDI A;  5LRM A;  1ZEB A;  4CXK A;  4ZG9 A;  2GSU A;  5LIA A;  3BDG A;  2GSO A;  3M8W A;  4MY4 A;  3WBH A;  1B8J A;  2W5W A;  1ALJ A;  2GLQ A;  1FSU A;  3SZZ A;  1ELY A;  1HJK A;  5EGH A;  3WAY A;  4TN0 A;  3T01 A;  1ED8 A;  1ALH A;  2ANH A;  3A52 A;  1N2L A;  4KAY A;  4GTZ A;  3UN2 A;  1KHL A;  1KH7 A;  3BDG B;  3DYC A;  5HRT A;  5AJ9 A;  5K4P A;  2W5X A;  4YR1 A;  5DLV A;  5GOV A;  1E3C P;  3BDH A;  1AJD A;  4LR9 A;  1EW9 A;  4UPI A;  3M7V A;  3T00 A;  2W5V A;  1ZED A;  4FDJ A;  4UOO A;  4LQY A;  3OT9 A;  4LRB A;  4UOR A;  4KJG A;  3TX0 A;  2D1G A;  1O98 A;  3M8Y A;  5GRR A;  4B56 A;  5INH A;  4LR7 A;  1KH5 A;  3E2D A;  3UO0 A;  2X98 A;  3NKP A;  5IJQ A;  4MIV A;  2XRG A;  3MK2 A;  3NKM A;  3TWZ A;  2GA3 A;  5TJ3 A;  2W5S A;  2W5T A;  2IFY A;  3LXQ A;  4UPH A;  3T02 A;  3NKN A;  1AJC A;  5KXA A;  1E2S P;  4NWJ A;  1E33 P;  3MK0 A;  1EW8 A;  4GTX A;  2VQR A;  4NWX A;  1ELX A;  5EGE A;  2W8D A;  3B5Q A;  1ANJ A;  4UOP A;  4UPK A;  1ZEF A;  4N7T A;  4LRA A;  3NKO A;  3NKQ A;  4QAX A;  4LR8 A;  2G9Y A;  2ZKT A;  3IGY B;  3TG0 A;  1ELZ A;  3NKR A;  2RH6 A;  3M8Z A;  2XR9 A;  5LRN A;  4LRE A;  4KAV A;  2IUC A;  3IDD A;  2GSN A;  3KD8 A;  1URA A;  3DPC A;  5L0B A;  1KH4 A;  4LR2 A;  4ZG6 A;  4CXU A;  2W5R A;  4CYS A;  3SZY A;  2W8S A;  1EW2 A;  3Q3Q A;  1AJB A;  1ALK A;  4GTY A;  1KH9 A;  2IUC B;  1ANI A;  1AUK A;  1AJA A;  1P49 A;  3NVL A;  4KJD A;  4CYR A;  5LQQ A;  3WAV A; 
#chains in the Genus database with same CATH topology
 1T9W A;  1NRK A;  1HYS A;  2JFK A;  1FE4 A;  5J1N A;  5F0W A;  5EN1 A;  2OGU A;  2EC2 A;  1P9Y A;  1GXU A;  1RWP B;  5IJS A;  5J2P B;  1S1X B;  1IR2 A;  4LF5 J;  1UEU A;  5IFM A;  3M4X A;  4DV3 F;  1ZAW A;  4CT9 A;  2MJN A;  1FXD A;  2MKS A;  4LF1 A;  1GTH A;  5E2Q A;  5L38 A;  5LXR A;  1RT6 A;  1AB8 A;  3HO1 A;  4PG4 A;  3M8S A;  2IDL A;  4HYK A;  3OPK A;  2I9S A;  3FJ2 A;  5DLV A;  4ZVO B;  1K47 A;  1S76 D;  2ILZ A;  3ZO7 A;  4IOC Q;  2DGX A;  5JXS A;  5F8H A;  4V19 J;  2ZJP Q;  3VV2 B;  2EFG A;  4KJG A;  1W2B R;  2VOD A;  2B56 A;  3E2D A;  2VPZ B;  2XLI A;  1YDL A;  2GA3 A;  1LWE A;  4YDX A;  1VIX A;  2C2M B;  5T7L A;  4TKT A;  2AGO A;  2IRU A;  1FKA F;  1ZET A;  3IRX B;  4UOP A;  1L5U A;  2D3Z A;  4OI3 A;  2RB7 A;  5I3U A;  2JC0 A;  5IV3 A;  4X65 J;  5LMU F;  1NND A;  2UXC F;  3CD6 S;  1R0A B;  1U49 A;  5ETV A;  4ED4 A;  4F0M A;  4LT6 A;  5KFR A;  1ALK A;  4M5L A;  2CNL B;  4KGX B;  2ATL A;  3JSM B;  3DRY A;  3O2I A;  1U8S A;  3TAM B;  2B43 A;  3JS9 A;  2XMJ A;  4DL4 A;  1NK0 A;  1U1O A;  3HHE A;  4LRF A;  2CJK A;  3BQ1 A;  2EG2 A;  4DV2 F;  4L6V 3;  3KKF A;  1BD6 A;  2PN6 A;  4DV5 J;  5B0B A;  3QSY B;  4CTA A;  5JVH Q;  2QA4 G;  3AD8 C;  2DR9 A;  3PRD A;  1AJD A;  2VFU A;  2HS0 A;  3K89 A;  1UWB A;  4RW7 A;  1T94 A;  2E5G A;  4CDI A;  2A3J A;  4PUO B;  1QY7 A;  2XMV A;  1T9X A;  2OSQ A;  4DOZ A;  2IFY A;  2BJ9 A;  4RBT A;  3PO5 A;  2ADB A;  2FD2 A;  4CRJ A;  2DO0 A;  1RHR B;  5EGE A;  2V8H A;  2LQB A;  2NQP A;  3AJ2 A;  2UUB J;  5AJ3 J;  2AJF E;  4OX6 A;  5KFZ A;  1GT8 A;  1SC4 B;  2R2S A;  2FY1 A;  1OIA A;  1OY8 A;  2VQE J;  2GIF A;  5F3Z A;  2QGF B;  1O99 A;  2LDI A;  1T0T V;  3H0P A;  4M1K A;  3TAQ A;  3RR7 A;  1RT2 A;  2Y1J A;  3WC0 A;  1M1H A;  1CUL A;  1S6Q B;  3UQS A;  1WF1 A;  2A2D A;  4J90 A;  3MOJ B;  3ITH A;  2FVS A;  3OBI A;  4RW9 A;  4ZN3 A;  3QT5 A;  3DYC A;  2E44 A;  3IC1 A;  4NLD A;  3Q8Y A;  5BYS A;  2J9D E;  2HFO A;  4ZJQ A;  3M2V B;  4ZPA A;  4DV0 J;  3NL0 A;  2FHJ D;  2VJV A;  1NK4 A;  3BR8 A;  1JKH A;  2AEJ A;  2J9C A;  2ZVI A;  2L08 A;  2KH9 A;  5E7O B;  4GVB B;  1DTT B;  2G2O A;  3HJV A;  5KFV A;  3CIM A;  3Q8R B;  1KDN A;  4OZ2 A;  3TUJ C;  2J8A A;  3SCJ E;  2Z2M A;  2J8S A;  3G71 S;  1OY9 A;  2R8K A;  3V81 A;  4ZJO A;  2DTJ A;  3ENW A;  2FGO A;  1Z1Z A;  1JWW A;  3V6J A;  1FRJ A;  1BWE A;  3Q89 A;  1VQY A;  2IVF B;  4JI2 J;  1EKS A;  3DLH A;  4DFK A;  5HMW A;  2DIT A;  3HCX A;  4KT0 C;  1TL7 A;  1S1W A;  4MJK A;  1X8D A;  4O44 B;  3JQK A;  2VDH A;  5DGB A;  2LDY A;  1X5O A;  1UL3 A;  2UUA J;  1U1R A;  1ALJ A;  1S7H A;  1S77 D;  1PYS B;  5C25 B;  3PFO A;  3MMB B;  4RNM A;  4DV4 J;  3A4T A;  4B3T F;  3BS9 A;  3AQO A;  2OUG A;  3BDH A;  3LPY A;  2LA4 A;  5A8K A;  3FK4 A;  4TU8 A;  4IFV A;  2OPR B;  3S01 A;  1WKL A;  1U25 A;  4CO3 A;  2MJU A;  3NCQ A;  2KI2 A;  3UE2 A;  1CG2 A;  1WEY A;  1HWJ A;  2OPQ B;  3KLH B;  1I3O B;  3BZQ A;  3PKY A;  3HFV A;  1LW0 A;  3DPC A;  1S6U A;  1P1T A;  3CMQ A;  2GZO A;  2QLX A;  1KNZ A;  4RUH A;  4Y00 A;  1RHM B;  3AXM A;  3D54 A;  4FNI A;  1KHJ A;  1RB0 A;  4DV1 F;  3BO4 A;  5LM7 E;  1KS2 A;  1ZZN A;  3G82 B;  2MST A;  4NEY A;  3BYP A;  2XHC A;  2KRR A;  4XTT A;  1RZM A;  3CJ3 A;  1MU2 A;  3KJV A;  2OP5 A;  5L1L A;  3HZE A;  3WBH A;  2JSX A;  4MIB A;  2JLG A;  3WAY A;  2IYI A;  3J81 Y;  1ZM3 A;  3POT A;  3QIP B;  1WG4 A;  3G4S S;  2N4D A;  2IAJ A;  2YKA A;  3Q22 A;  2XZW A;  1TV6 A;  1DTQ A;  3R5J B;  1Q5Y A;  1YJ7 A;  4LF5 F;  1LK7 A;  2V2Z A;  1X9W A;  1WKK A;  4LQY A;  2G4B A;  1HR0 J;  2M70 A;  1SQG A;  2XRG A;  1UJ6 A;  2MMY A;  2OEM A;  4K4W A;  4K50 A;  1ZM9 A;  2WVB A;  4NWJ A;  3UVJ A;  1X4E A;  4K5S A;  3R5D A;  2DNY A;  2NXN A;  2C1E B;  4C0O C;  2XMU A;  3G8S A;  4MK9 A;  3TG0 A;  4TLR A;  4I2P B;  2M5Y A;  1JJH A;  3TQ1 A;  2NXJ A;  1IVZ A;  1P1L A;  3Q8V A;  4DU7 A;  2WHO A;  4LVO P;  1YHQ S;  3MMA B;  2YKN B;  4NA2 A;  4PKD B;  3K8W A;  2FJB B;  3KFW X;  3TJ9 A;  1YJW S;  2HK3 A;  2FLL A;  2BUN A;  3LW5 C;  3PW5 A;  5ETP A;  3IGZ B;  3MFI A;  2GVZ B;  5BXI A;  3JSB A;  3CJ5 A;  5E33 A;  1VK3 A;  2D74 B;  5KG5 A;  5B0D A;  1FNX H;  4LFC J;  4GTZ A;  2LLZ A;  5CYJ A;  4RKU C;  3D6F B;  2UU9 J;  5KFF A;  5HJY A;  3PFE A;  3M1V B;  2CPD A;  3QJL A;  1Q86 T;  4M5H A;  2K7J A;  1N0V C;  3DOM A;  4NZ7 A;  3ZTP A;  4J37 A;  3DGP B;  2COL A;  4OYO A;  3TP2 A;  3AA9 A;  4J9V A;  3OVS A;  2MQQ A;  2QA4 S;  3FEX B;  2ZM6 J;  3EVO A;  4J9O A;  4WFN Q;  4DUZ J;  5IT9 Y;  3D66 A;  5G0R B;  4EBE A;  2ZNZ A;  3W61 A;  5BR8 F;  3I5C A;  4YY3 J;  1HNI B;  2B6A A;  3OR1 A;  5CAB A;  1HLW A;  2VOO A;  1VIS A;  5J1E A;  3ILI A;  1OSD A;  4DX7 A;  4RO0 A;  1JMT A;  2XC9 A;  4ANC A;  1N5V A;  3AY0 A;  4I7F A;  5E0O A;  2X7I A;  2IM2 A;  3KLI B;  1FJG J;  3DLK B;  2BMB A;  3PM9 A;  1B8J A;  2GLQ A;  1GEH A;  4DL2 A;  2C3O A;  3HMJ G;  1KKH A;  2ZEJ A;  1C0T B;  1SJ1 A;  4EBC A;  2ZH1 A;  2QL9 B;  2H5I B;  3ILL A;  1KSP A;  5K14 B;  3A8K A;  3PCO B;  1PBU A;  2W2M P;  3IWN C;  4ZVT B;  1GAO A;  1TUW A;  1QM9 A;  1VBK A;  4NRT A;  4KSE B;  2CA9 A;  5IJQ A;  3QAU A;  1GXL A;  3L95 X;  4JP8 A;  5GME A;  3IS9 A;  1N36 J;  4KGZ B;  1HL6 A;  4WFY A;  2K7K A;  4G65 A;  3R3T A;  2UUC F;  3G96 A;  3WZ0 A;  4IG0 A;  3RTV A;  4DCO B;  2D7S A;  2F65 A;  2YX1 A;  4P2S A;  3TJA A;  2PE8 A;  1MG7 A;  3NOG A;  2VON A;  1XQI A;  3WC2 A;  4ECT A;  1XMO J;  1EJ7 L;  4P75 A;  5DG7 A;  4GTW A;  3IWL A;  4QWB A;  4HLB A;  1DAX A;  4DLE A;  1YZ7 A;  1K1S A;  1HJK A;  4J9S A;  2O01 C;  2CQ1 A;  3PR4 A;  3J7Z T;  4QPT A;  3M2U B;  1RA7 A;  5FLX U;  2BA9 A;  4U8Y A;  4RW8 A;  2HND B;  4X4S A;  1FFG B;  3VR1 A;  5HBM A;  1QTM A;  3FKB A;  4QWA A;  1BXN A;  2AF6 A;  4EUV A;  3TR5 A;  3QZ7 A;  1N32 F;  3BBC A;  1DQ8 A;  2B51 A;  2XMW A;  3CCZ A;  5ADZ A;  5K8O A;  4ZP7 A;  4Q0B B;  1AJC A;  3B4M A;  2CQP A;  3LF0 A;  4XIU A;  1BQN A;  4DV7 F;  1KVI A;  4DL5 A;  3IGY B;  2K2P A;  1T95 A;  4ZMM A;  3FEZ A;  2MGZ B;  4GRS A;  4ZPC A;  3BPD A;  5LMN F;  1WNE A;  4UW2 A;  4ETZ A;  2DK2 A;  4L3K A;  2IVM A;  4MKV A;  3BH7 B;  2DNG A;  1EJJ A;  1SBR A;  3P3D A;  1P6T A;  3NGR A;  2MXY A;  2FLP A;  2DNQ A;  4OYB A;  4HTJ A;  2M2B A;  1NU4 A;  1RTJ B;  4Q2M A;  1S59 A;  4Z37 A;  1N52 B;  2EC0 A;  5A0Y A;  3E51 A;  2YKP A;  2OH2 A;  4OJ1 A;  3KLG B;  1IBL F;  2ZE2 B;  3EZ5 A;  3D6T B;  4X84 A;  1SQF A;  5D4O A;  4KHP F;  2XG8 A;  3C46 A;  2H4Y B;  2ZH3 A;  2R3V A;  2IM0 A;  2OSR A;  2V9K A;  3FMW A;  4X4N A;  3CCV S;  3C16 A;  5K8M A;  4NCG B;  4OYA A;  1WC1 A;  1RTI B;  1L3K A;  1LW2 B;  1X5P A;  5D0H A;  2J7W A;  2OEL A;  5F8N A;  3KJN B;  1R27 B;  5L9N A;  2HZV A;  4ERD A;  1WC4 A;  4M5G A;  4Y65 A;  3DHW C;  4CO2 A;  1FK9 A;  4C8L A;  4F25 A;  4ILL A;  4U96 A;  1BGX T;  2XSJ A;  5EHH A;  2N7C A;  4DPU A;  3KK3 B;  4GO7 X;  1FEH A;  1X7V A;  4KBI A;  3OTO F;  3HHL B;  2AIR B;  2VFS A;  2HK2 A;  4QJV A;  3LTO A;  3WAW A;  2YNI A;  1HWU A;  1TEL A;  1U6Z A;  1QSL A;  1FTC A;  3HUL A;  1YVF A;  5DET A;  3MK1 A;  3N6L A;  2ZBR A;  3UNY A;  3PW2 A;  5KFK A;  4DR5 J;  4E2F B;  4ITS A;  1HW8 A;  1CQM A;  3CDA A;  2CNO B;  3OHA A;  5LSL A;  4DX8 H;  2KYX A;  3HJF A;  3QBC A;  2CQD A;  4R0J A;  2GHP A;  4MFB A;  3HPO A;  2R2R A;  4N76 A;  2WZ1 A;  4WCE Q;  1SVD A;  1HWK A;  4FYD A;  2BR0 A;  4ENO A;  3MEG A;  4WXW A;  3T5J A;  5DLF A;  2MQP A;  2F4V J;  1TK5 A;  5LT5 A;  4CQ1 A;  2W2Q P;  3M32 A;  5B09 A;  4NYZ A;  1PO6 A;  4FXV A;  3CIZ A;  4CYU A;  3MK0 A;  1NSK L;  1NKE A;  3GIJ A;  3GFZ A;  4NPO A;  2EBG A;  3GMG A;  2MY8 A;  2VU5 A;  1HQE A;  3FCV A;  2RVJ A;  3SCK E;  4U95 A;  1Y10 A;  4U7U D;  3ZC4 A;  2XWY A;  3S8S A;  1CJV A;  2HNZ A;  4TU9 A;  3BKT A;  3K5M A;  2M88 A;  1YGY A;  3PIP Q;  1DJ0 A;  1ZAV A;  2P6S A;  2W25 A;  2RS8 A;  4C48 A;  3DLB A;  3CCJ S;  3MFH A;  4C7Q A;  3LOU A;  1RTD B;  3HLU A;  2QJ3 A;  1TKD A;  1RCX B;  5KOX A;  3V6K A;  4BC7 A;  3BH6 B;  1YRT A;  1NME B;  5D4N A;  3SI8 A;  2XMK A;  3IR5 B;  2RDD A;  5SUH A;  2KFZ A;  1GK8 A;  3MM7 A;  4WPA A;  3EPI A;  3E8O A;  2Z30 B;  3PRV A;  5CCM A;  3IFE A;  3QJP A;  4DLG A;  3OL9 A;  2Q1L A;  3PJ9 A;  3X1L B;  2OMO A;  1OYE A;  3D1H A;  2VIC A;  4ZHR B;  2NR0 A;  4C3K A;  4PRF A;  1RU2 A;  1Q0N A;  4YME A;  3CDB A;  2JNJ A;  3VAM A;  2N4C A;  4X4O A;  3MCS A;  2JH3 A;  3R7N B;  1TFY A;  1XNQ J;  5LRN A;  5C2G A;  3DLL Q;  1K0V A;  4DR7 F;  1S1V A;  4A48 A;  4LR2 A;  2HWI A;  1EZZ B;  1N33 F;  2IVY A;  2MHN A;  2RML A;  2HHH F;  3OLB A;  1PYT A;  4N47 A;  3BRE A;  2QZU A;  1IJF B;  4C8O A;  2A0F B;  4UST A;  2E9T A;  4YB1 P;  1JJ2 R;  4Y28 C;  1NKC A;  1NK5 A;  3SZ2 A;  2YNF B;  4OIX A;  2IY5 B;  1TKZ B;  3GR1 A;  2HPU A;  2VG6 A;  2LKZ A;  1PGZ A;  1KHK A;  4NLP A;  4DEZ A;  2WVE A;  3PNI A;  1FKO B;  2HRY A;  3KLF A;  4TYB A;  4YP3 A;  1FRX A;  1ZS6 A;  3GIR A;  3T01 A;  4JYA F;  4LSL A;  4QWC A;  2NS1 B;  2BAN A;  4FPR A;  3CJ0 A;  1WD6 A;  3J7A 1;  2RNE A;  2HHQ A;  3HSD A;  1XMQ F;  2FIU A;  3G8T A;  5IXU A;  2E9Z A;  1URN A;  4HT7 A;  2C2E A;  1BQM B;  4B56 A;  4PQU B;  3ISZ A;  4LF8 J;  3VAI A;  6FD1 A;  3ENA A;  2KTQ A;  1C0U B;  3OL8 A;  3T6B A;  1AT1 B;  2X1F A;  2AJQ A;  4N8N A;  4X4V A;  2BJ1 A;  3V2U C;  4MK8 A;  4LR8 A;  4HHJ A;  5G4D A;  4JI4 F;  5CYM B;  1TKX B;  1WJ9 A;  4CLK A;  2ZWO A;  4M5D A;  3NOC A;  2KXH A;  4DR2 F;  1EP4 A;  3TVZ A;  3WAV A;  5B08 A;  3C14 B;  5FDL B;  5L8R C;  1FWK A;  2ZZM A;  3MMC A;  1URB A;  5L0K A;  3FEY B;  2UVR A;  4K2X A;  1AUD A;  1DAR A;  1VQL S;  2IIH A;  5AXN A;  4NL5 A;  2V69 A;  1HBO A;  1JXL A;  3EGN A;  2DGS A;  3R27 A;  4B3O A;  3BO3 A;  2RDJ A;  5EWF A;  1J5E J;  3OVA A;  3CPW R;  3I32 A;  1E6Y B;  2ZJQ Q;  1KVK A;  2M0G B;  3ZTR A;  1F6T A;  3KJQ B;  4U7U K;  5KG3 A;  1UMJ A;  4R5P B;  4RW6 A;  5DRK A;  4ZA1 A;  3D6H B;  3AAW B;  1WOR A;  3N79 A;  1B99 A;  1TK0 A;  2W5T A;  2QO3 A;  2KHC A;  4EO6 A;  4UPK A;  3NG8 A;  2HMI A;  1VQN S;  2BKO A;  4ELV A;  3JTN A;  2DPI A;  2Z2L A;  1NK7 A;  4DSL A;  3SSQ A;  2MQL A;  1Z4U A;  1SPB P;  1MRO B;  4P6Q A;  1VBY A;  4OFZ A;  1KH9 A;  4PCQ A;  3NVL A;  1TVR A;  4KJD A;  2JRS A;  2VUG A;  1HA1 A;  5A8R B;  2KXN B;  2MYF A;  5E3P A;  2OFG X;  3T19 A;  4X4T A;  1IKX B;  2C2R A;  3UI3 A;  2C2N A;  7FDR A;  5L0E A;  3QID A;  5GMD A;  1HNW J;  4FKX A;  3H25 A;  3MEE A;  1CJU B;  1RKJ A;  5DGA A;  5AT1 B;  4C98 A;  1S1X A;  2HVH A;  1M5V C;  2GQQ A;  2IA0 A;  2CQI A;  1EHW A;  4I69 A;  4U9R A;  3RBZ A;  4RWW A;  2HSE B;  3I56 S;  4QYR A;  2G2Z A;  1VMB A;  2HVZ A;  1VC5 A;  1RAO A;  1Y00 A;  4WFZ A;  2B5J A;  4NXN J;  1LOU A;  4FF4 A;  3J81 j;  2UXD J;  1SC1 B;  2W01 A;  2H5E A;  3DM2 A;  1KQG B;  4ES2 A;  3E3X A;  3DGV A;  2DR6 A;  3SV4 A;  4AE5 A;  3VAL A;  1PKU A;  2OTL S;  1VI7 A;  3NWG A;  1R7I A;  2BJ7 A;  5J2N B;  3W8G A;  4IYQ A;  5D0E A;  3NKY A;  5L9X A;  2NZ4 A;  4KGK A;  5DJB A;  3MM8 B;  2AX1 A;  1J27 A;  3KK2 A;  2ALZ A;  3KTQ A;  1FES A;  4DV6 J;  3C2P A;  5L39 A;  4J9K A;  4FXW A;  3PW4 A;  3ZZU A;  4JBC A;  1KN6 A;  2W4P A;  4FYX B;  5HQM A;  3H4D A;  5MAO A;  4PYD A;  5LSO A;  2XO6 A;  3GSI A;  3K59 A;  2KVI A;  4B3R J;  2BQU A;  3DOK B;  2RHS B;  2KYZ A;  4USK A;  1CJT B;  4ED2 A;  4ZJL A;  4DR1 J;  3R1L A;  3UD5 A;  4IQM A;  2ZH4 A;  3QGP A;  1TTH B;  2C28 A;  4J9M A;  3FZB A;  2XZD B;  4JI7 F;  5A2Q U;  2VG5 B;  4JB8 B;  4HEA 9;  3SDE B;  2PGC A;  3QO9 B;  1AW0 A;  2J0S D;  3UR3 C;  1RWU A;  3EDQ B;  2R42 A;  2BVZ A;  2UV8 G;  5LSR A;  1PC5 A;  3N01 A;  3QGI A;  2PMZ D;  3N6M A;  4WTY A;  2DNL A;  2JX2 A;  3CUN A;  2JEJ A;  2HIY A;  2DO4 A;  5D0G A;  2ALY B;  3Q86 A;  3V4I B;  3NWR A;  3RZA A;  3U27 A;  3EMT A;  3KHG A;  2R8G A;  4ECU A;  4EYH B;  5DG8 A;  1N0U A;  1NK9 A;  4PXB A;  2FHJ A;  4DBQ A;  3OJU A;  2E5L F;  2V63 A;  3MTJ A;  3GYG A;  2JDJ A;  5I4M A;  3EE3 A;  4DSE A;  3MPV A;  5HP1 B;  3CCT A;  2ZC4 A;  1FE0 A;  1NSA A;  2ZJR Q;  3D5M A;  1S6Q A;  1DLO B;  2W5X A;  2GO8 A;  1SIW B;  1Y7P A;  1MN7 A;  1U2C A;  2DJW A;  1QE1 B;  2VBW A;  3P5T L;  2XO7 A;  2KRB A;  2XLJ A;  1RK8 A;  3TO8 A;  3NEK A;  1EW8 A;  4TY8 A;  2KFY A;  3MMJ A;  3W65 A;  1DTT A;  4FS2 A;  3DN9 A;  1LWX A;  4ELT A;  2BE2 B;  4RR5 A;  1KLM A;  4DZ6 A;  4OHV A;  4M5K A;  4UOC A;  2W2O P;  4I6Y A;  3M2R A;  3UWT A;  2WTF A;  3O1L A;  1HNX J;  2MKY A;  4QYZ J;  4NXM J;  4NLT A;  1V3S A;  1YJ9 S;  1H0H B;  4ZVR B;  1XER A;  2D9O A;  1RT3 B;  2AHO B;  4YB5 A;  3KOA A;  4CO4 A;  3PAC A;  4PXD A;  2Q6B A;  3DLE B;  4ZP8 A;  1U02 A;  1ZBT A;  4I0W A;  2MPU A;  2QG9 B;  4WFB Q;  2DRA A;  2GIQ A;  2B0G A;  4P73 A;  3GYX B;  1T03 B;  5H9E J;  4B3S F;  5KFM A;  3LWM A;  1IN0 A;  1FWL A;  1NDP A;  1IKW A;  2BKP A;  2CIM A;  1G3O A;  2HVI A;  1OMS A;  1AFI A;  2A6O A;  1SC3 B;  3IG1 A;  5IM0 A;  1EET A;  2Q79 A;  4Y2A A;  4FF3 A;  1SL1 A;  4KFB B;  3M8Z A;  1JLQ A;  4WZQ A;  4ZPB A;  4P74 A;  2BJD A;  3HVT B;  2OPQ A;  4QR0 A;  4KKO A;  2BEF A;  1RWM B;  4B9U A;  1Q8K A;  1RSC A;  3ED4 A;  2DNR A;  1F9F A;  1R31 A;  4WF9 Q;  1WI8 A;  2LVW A;  1IJE B;  4XDD A;  4ID5 A;  5GAD I;  4HKQ A;  4Y2C A;  1OQ3 A;  3BYR A;  3GJR B;  3R2C J;  2V9W A;  3D7S B;  3M8Q B;  2RF2 A;  3US5 A;  4USW A;  4E0D A;  1MSW D;  1AFJ A;  3CJS A;  5H1S V;  1NB2 A;  2ZBP A;  4LFA J;  3HHL C;  4NLR A;  1S9G A;  1TFW A;  3OUY A;  2AJ2 A;  1RQ0 A;  2U2F A;  4MTP A;  4FYV B;  4B9M A;  4B9S A;  4Q5V A;  3DLG B;  1T3N A;  1U1M A;  2V8P A;  4BC9 A;  3U1L A;  1FKP B;  4B9N A;  5DM6 Q;  4HAC A;  5KFB A;  3VAK A;  3CMA S;  1M5P C;  2HQG A;  4TNO A;  2QFI A;  2D1C A;  2GSN A;  3KUG A;  3CJ2 A;  3BBB A;  3IAM 9;  1YZ6 A;  2L3M A;  2EFN A;  1FHT A;  1ZM4 A;  5LQQ A;  2RUS A;  4OX9 J;  1EI6 A;  3H20 A;  1F5A A;  5DLT A;  3M9M B;  3MR7 A;  2YKN A;  2JHE A;  4LUB A;  1WC5 A;  3M6W A;  1N5T A;  3E2E A;  5LRM A;  2EW9 A;  1RT4 B;  4ZKA A;  1IWG A;  4QZV B;  5LOQ A;  2GAH C;  1M0S A;  1ZH5 A;  4OZ0 A;  4OLP A;  5ETS A;  5E5N A;  2V8V A;  4GMK A;  4EZ6 A;  1RT5 B;  4BWM A;  2CG8 A;  3ILO A;  3G8Q A;  4FF2 A;  2RKI B;  3MR5 A;  2KKH A;  4RW4 A;  2HFV A;  2MTL A;  1K0T A;  3E01 B;  2DEJ A;  2HEK A;  1D9A A;  1TAQ A;  1Q7Y T;  3CC4 S;  2FYX A;  4HR2 A;  1IKY B;  1ZPV A;  4DJB A;  1T05 A;  2HHS A;  2VD3 A;  1CS4 A;  3NKP A;  2AYE A;  1PJ5 A;  2F5G A;  2MZJ A;  1FT8 A;  1U45 A;  1RP5 A;  4CLZ A;  2L9D A;  3SMZ A;  1OYD A;  1N56 A;  1GX6 A;  5HN0 A;  2XGP A;  2KM8 B;  3BKF A;  4K0K J;  4LF4 J;  3DGP A;  4UOG A;  3JAM Y;  4ATN A;  1KWM A;  1RA6 A;  3OTE A;  4QU7 A;  1XEZ A;  3DI6 A;  1AJA A;  2IBO A;  5B0F A;  5DS7 A;  1R6Y A;  2UVV A;  2DGV A;  5C42 A;  3EGV A;  4OQJ A;  3W60 A;  5HI7 A;  4WYL A;  4J9L A;  4USH A;  1BMQ B;  3MM9 B;  4U67 Q;  2RJZ A;  2J76 E;  3IGV A;  3I4H X;  1FNM A;  1KHV A;  1PJ7 A;  4JI3 J;  3IWX A;  3KLI A;  4PQA A;  4WFX A;  3BJY A;  3PW7 A;  2E7X A;  2XS2 A;  3DMJ A;  2YWH A;  4P52 A;  5DG9 A;  4UOR A;  4ZIW A;  2ROG A;  1HPZ B;  1HWL A;  4Q8E A;  4CO0 A;  3PW0 A;  4KIA A;  2DHS A;  4B08 A;  3Q24 A;  5K8N A;  4ED6 A;  2BE7 D;  1KEK A;  1S1T B;  2HHT A;  1HBM A;  3MUV P;  1HQ2 A;  1GMW D;  3DRP B;  2NXC A;  3RB6 A;  4Y6I A;  2ILY A;  1ELO A;  3NKO A;  1TU0 B;  4V19 X;  1RAF B;  2JLF A;  1JK9 B;  4L3N A;  3LUY A;  4X64 F;  1RHJ B;  4QWE A;  1VRT A;  2XNR A;  1FRK A;  2ZIT A;  4JI0 J;  1VYA A;  1S4F A;  3VZH A;  2QRR A;  5GAD U;  3HT3 A;  2X3D A;  5KFS A;  1FJE B;  2NYH A;  1RYR A;  1SJF A;  2UP1 A;  4NI2 A;  1ULR A;  2RHQ B;  2W4C A;  2DY1 A;  1UP1 A;  3LPE A;  4J7C A;  4K5R A;  5IT9 U;  1RCO B;  2P9E A;  1MML A;  1Z2L A;  2ZDP A;  3V6D B;  3GII A;  2CFX A;  2XYP B;  4AUK A;  5GAE I;  4QIF A;  5I42 A;  3UW1 A;  1NSQ A;  1KQS R;  3MR2 A;  3TX0 A;  3VVU A;  4FXD A;  1KH5 A;  2CDR B;  1Q81 T;  2FJE B;  5KAK A;  5KG0 A;  3ISN D;  4LF9 J;  1GMU A;  2GJF A;  3J7Y U;  2MQ8 A;  3HKZ D;  3RG6 A;  1H2T Z;  1N4L A;  1IBC B;  2YQ0 A;  3IGN A;  4CLW A;  2V4Q A;  2W2P P;  2CPF A;  4CT8 A;  2FJD B;  3FSX A;  4WK1 A;  4BCA A;  4NAS A;  1A9N B;  1HNV A;  2RQC A;  1E6V B;  3ET6 B;  4X62 J;  2MGZ A;  1MNE A;  4F4Y A;  3B4D A;  1HFE L;  3Q8Q B;  3MM5 B;  2VBY A;  5KOW A;  2HGM A;  4CM0 A;  2JVO A;  1JLB A;  2F1F A;  1L3T A;  3WIV A;  1G6B A;  3BDG A;  3BGF A;  1F60 B;  5A6P A;  2QL5 B;  3CJ8 A;  4FKY A;  3CC2 S;  3MUM P;  2JZ5 A;  5ETR A;  1LXJ A;  2OD6 A;  2MKH A;  3QT6 A;  3F73 A;  1RTJ A;  5K4P A;  3IM8 A;  1ZTW A;  1XK8 A;  4NLU A;  2B9X A;  3C6U B;  2HUR A;  3JYT B;  1J2V A;  2V8G A;  4LR7 A;  3LP2 A;  2EK1 A;  1PIE A;  3EIC A;  4YHH J;  4FYW B;  4OI6 A;  4J5O A;  3QQC D;  1LW2 A;  3PVX A;  2AGP A;  4LRA A;  3T1Y F;  4FDF A;  5A8W B;  4GVL A;  4DFM A;  1CQN A;  2E7V A;  2L48 A;  3TA1 A;  2ZOG A;  4F26 A;  2C3M A;  2YX4 A;  1FCA A;  1SB6 A;  3BF4 A;  1NEE A;  1GNK A;  4Z7C A;  1TKT B;  3KK3 A;  2FGC A;  4M5I A;  5M2P A;  3W7B A;  4RNF A;  3DYA B;  2W7P A;  4HTI A;  2LXF A;  4EMD A;  4WP9 A;  2EPI A;  3UN3 A;  4KM4 A;  2I5J A;  1K73 T;  1WDT A;  3H4B A;  4DL6 A;  3PKM A;  4LF7 F;  2IBK A;  3IO1 A;  3HP6 A;  3A52 A;  2V0N A;  3NGD A;  2FVQ A;  2JFD A;  1TAU A;  4D3G A;  3T6J A;  2CZ9 A;  4OMF G;  5KG4 A;  1WHY A;  3C19 A;  4LR9 A;  3FBB A;  2V4J B;  1ZED A;  2DNO A;  2LEP A;  4H4M A;  1UVK A;  1KP6 A;  1CBK A;  1REV A;  2NXE A;  3CCQ S;  4DV3 J;  3GZ7 A;  3MEC A;  1EQ0 A;  1GFW B;  3OQ2 A;  4OHY A;  4WBF A;  2DNK A;  3A1Y G;  1OPZ A;  2XY6 A;  3MR3 A;  3DDK A;  2MZ1 A;  2G9Y A;  3V6H A;  1FX2 A;  1JLA B;  2IUC A;  3NRB A;  4A8M P;  4H4K C;  2ZC3 A;  2O3D A;  3DRR B;  4QOT A;  1HBN A;  3IM9 A;  3AH6 A;  3UDL A;  1LWC B;  4C4W A;  4QW9 A;  2W24 A;  3R6G B;  1QLN A;  3LP1 B;  3I31 A;  2KJV A;  3EVM A;  4ZCI A;  3QGH A;  2HZC A;  4KAI A;  4A8S A;  4DR3 F;  2EVZ A;  1UW4 A;  4AFF A;  5IWA F;  1BHN A;  1HBU B;  1U1N A;  2BKN A;  3W3S A;  4A4J A;  5LMU J;  3T5L A;  1VR6 A;  3VAH A;  2UXC J;  5L46 A;  1TK8 A;  2D3O 1;  3RB0 A;  4NE9 C;  2HHU A;  1ICE B;  4B17 A;  5GAE U;  4PWD B;  2HHX A;  2WSC C;  1TL3 B;  4MYU A;  2OTJ S;  1B3T A;  4LF2 A;  3NKM A;  1YBU A;  4I67 A;  2CZV C;  1XR5 A;  2W4D A;  4F3O A;  2CQH A;  3I0R B;  4XPC A;  2AV5 A;  1WEZ A;  2ZBI A;  1X0P A;  2QA2 A;  3NNC A;  4DV2 J;  1C1B B;  4GTX A;  2XMA A;  2VOP A;  1S57 A;  4LBH A;  1W2I A;  5ETO A;  1HMV B;  3H59 A;  3I0S A;  4KRW A;  2FC8 A;  2B9Y A;  3DRS A;  3IDD A;  1URA A;  1UJ5 A;  1NH8 A;  3HDS A;  1LQ9 A;  2AYG A;  3NNA A;  2R8J A;  1WSR A;  4Y3C A;  3KMS A;  3CWJ A;  3D2W A;  3TYT A;  2QFJ A;  5HVG A;  1IR0 A;  1UVI A;  5D78 A;  4KH1 B;  1KOO A;  3W9H A;  3QT7 A;  2LQ8 A;  1SHQ A;  5KT4 A;  1UWA A;  3I55 S;  3UN5 A;  1W25 A;  1UFK A;  1NKB A;  4OYZ A;  4I2Q A;  4TQR A;  1PSD A;  2GGP A;  3MXH P;  2G0I A;  3TOQ A;  4F4W A;  3CB4 A;  3GCX P;  1IBM F;  1YTY A;  4EYI B;  2ZZN A;  3G6E S;  3GSD A;  4OHW A;  1XN9 A;  2Y8W A;  1RT6 B;  3P4U B;  4MIW A;  1QAY A;  3TUI C;  2LU1 A;  1SH2 A;  1FX4 A;  1FRH A;  4JI6 J;  3QZ8 A;  5LJ5 Y;  3Q8S B;  5ETM A;  5D0R A;  3D28 A;  1BQM A;  3S6E A;  3BGO P;  3IRW P;  2DHG A;  1LWE B;  1XBW A;  2FZC B;  2JL9 A;  3H8Y A;  4A46 A;  1B7Y B;  5T7L B;  3KHL A;  2DY9 A;  1FD8 A;  4OZL A;  1U6F A;  2LQJ A;  3T3F A;  3AD7 C;  1RHK B;  3GG0 A;  3HHK A;  5DDP C;  4OV1 A;  2W5R A;  2M4M A;  4JV5 F;  2KO1 A;  5I3U B;  4LMZ A;  3D9B A;  2HVE A;  4ILM A;  3AOD A;  3D0G E;  4URQ U;  3M30 B;  3EVW A;  3H98 A;  4HT5 A;  1X60 A;  3CD7 A;  5DQI A;  2MQO A;  2M8H A;  4LRC A;  4A8X A;  5DLW A;  2BV3 A;  2L9N A;  2LQ5 A;  1YRU A;  2IMO A;  1NO8 A;  4IO9 Q;  4YR0 A;  3MHY A;  1WI6 A;  3ZTO A;  2V2Q A;  1I51 B;  1NJX A;  3LP0 A;  2GX8 A;  2IC3 B;  4O3O A;  2OFH X;  2GQC A;  1VQ9 S;  2G1H A;  4FVC A;  1X4F A;  2RU9 A;  4CTA B;  4TQS A;  4LRB A;  4IFY B;  3MCM A;  4ZCM A;  3TRG A;  5GAG I;  1UPM B;  4RW7 B;  1NDC A;  2CJ9 A;  3W66 A;  5CD4 A;  3M6X A;  1APS A;  1TL1 A;  1WKJ A;  1O6X A;  3D6M B;  3NS5 A;  1Y9O A;  2JWN A;  4DUT A;  4ED5 A;  4F0H A;  4HHH A;  1A7G E;  1KVJ A;  1PAU B;  4N8O A;  4O3Q A;  4OI2 A;  4UUX A;  4WTO B;  4ILR A;  3FCW A;  5T14 A;  2V2V A;  1VC0 A;  2Y3Y A;  5HAT A;  3HFK A;  4DSF A;  3J80 Y;  1RT2 B;  1IKX A;  4KGV B;  3THP A;  1CUL B;  1CJU A;  1LNQ A;  2MKI A;  3RBE A;  2ZFH A;  3QRR A;  1RAB B;  1E3C P;  1S9E A;  1TMJ A;  1NBE B;  3D4J A;  4YDD B;  4DV1 J;  3SSR A;  1X4C A;  5HMX A;  1U2R A;  2O67 A;  1R8P A;  4PYA A;  3H2V E;  3N4W A;  4O3S A;  1IKV A;  1XWL A;  3QFW A;  2CQ2 A;  3VGV A;  4C0B A;  3ETO A;  4IO1 A;  1C4A A;  3DC2 A;  3LAN A;  3GON A;  1TQL A;  3A8I A;  1T9U A;  4DL3 A;  4O3N A;  2CG4 A;  3PV8 A;  1ZA2 B;  3VQS A;  4IR9 A;  2FY8 A;  2KJW A;  3V81 B;  2HFN A;  1VRU A;  1TZ0 A;  3H5S A;  4LBP A;  1FVQ A;  4DDF A;  2YWG A;  2J0W A;  4LF6 F;  3MM8 A;  2MHE A;  2KM8 C;  3OFE A;  2R9L A;  4OI1 A;  2EI5 A;  3P45 B;  4EGL A;  5CCL A;  3MAA A;  1S1W B;  1UA0 A;  5I3Q A;  1NCL A;  1HW9 A;  3KK1 A;  1FA0 A;  4DQI A;  3PRB A;  1KTQ A;  3FBF A;  5HK4 A;  4OYM A;  4RNO A;  3MD3 A;  1VGY A;  1VK8 A;  5E3A A;  1FFW B;  3TA2 A;  4YR2 A;  2W9C A;  2R7T A;  3B6B A;  4NRU A;  3CJK B;  2QLF B;  2GVD A;  5D15 A;  4RBU A;  5A76 A;  1RLD A;  2QEX S;  4EWT A;  3AA8 A;  2XNQ A;  4IOA Q;  4DZD A;  2YWE A;  1VRQ C;  5A8K B;  1R8B A;  4K4U A;  4MK7 A;  5B0A A;  4PWW A;  2AEF A;  4IFV B;  2HZA A;  3W2W B;  4USV A;  4IRC A;  4F2S A;  3HX9 A;  3ZFV A;  3SDE A;  1CVJ A;  1YJN S;  4ICL B;  3QO9 A;  4WWS A;  1Y3J A;  4K4S A;  1LFP A;  1H2U X;  2H65 B;  3AB4 B;  5BJR A;  2Q6C A;  4Y2M A;  3I82 A;  2HRU A;  3DDI A;  4LJM A;  2EFO A;  2BM1 A;  2ZH5 A;  3NY0 A;  1HIY A;  3F44 A;  4QAX A;  1VJQ A;  4ANE A;  3CCL S;  2HS3 A;  3VAF A;  1VQM S;  2BAC A;  1XNR F;  1REG X;  1YIT S;  2YBV A;  2FJV A;  5KFH A;  1JLE A;  3V4I A;  3BQ2 A;  3BDF A;  9ATC B;  2LA6 A;  4K4Y A;  3CT9 A;  1M5O C;  5LIA A;  5AE2 A;  1GTE A;  4KHR A;  2D9P A;  4O3P A;  1SJR A;  1MU2 B;  3KJV B;  1J5O A;  3KUE A;  2HHW A;  1QUV A;  5BR8 J;  4WXO A;  4B9L A;  2X1B A;  2IAJ B;  3FBC A;  5KFD A;  1X4G A;  2DGO A;  2DYA A;  2LQ9 A;  2HQI A;  1DTQ B;  4UOO A;  3H5X A;  1DLO A;  3PJW A;  1P27 B;  3RBD A;  4EO8 A;  5D3G B;  1B0P A;  4L75 A;  1LWF A;  3B54 A;  1UJ4 A;  2E9R X;  1DQ9 A;  1NUE A;  1QE1 A;  1EAY C;  2HVD A;  3PDN A;  3H2L A;  4BS2 A;  1IWA A;  2BBE A;  2QMU B;  2FVR A;  1X5T A;  4QWD A;  2ZBQ A;  2VAS A;  3QPI A;  4JI6 F;  5AE3 A;  3PY8 A;  3UVJ B;  2Y0S D;  4X4Q A;  3AOA A;  3K57 A;  3OXL A;  4GTY A;  3OTB A;  3C66 A;  2CJX B;  1U47 A;  3U1N A;  2W8L A;  2W7A A;  1IM6 A;  2OPP A;  1U1L A;  4PPD A;  1ARO P;  3N9U C;  1HI0 P;  3TUP A;  1R0C B;  3OFH A;  2RRA A;  5B0C A;  1S1U B;  1OQ6 A;  1RU1 A;  2VC0 A;  1SC6 A;  2YY3 A;  4LSN A;  2BRL A;  5IT0 A;  1N88 A;  2DCL A;  2UUC J;  1KFD A;  1RI7 A;  2AKW B;  5D4L A;  2EBE A;  1WF2 A;  2O5D A;  2CKW A;  1SCJ B;  3FMB A;  2QZ8 A;  4C8N A;  4DQS A;  1YQH A;  3MD1 A;  2CQ3 A;  3KNG A;  3KDO A;  3SBM A;  2DR7 A;  2EWH A;  3SCL E;  4ZVF A;  1UAW A;  5H9F J;  2B4V A;  3MEK A;  3QLH A;  3QRQ A;  3DOM B;  2Z2Z A;  3GIL A;  3OFF A;  3THT A;  4HI1 A;  2RUG A;  4KAV A;  1NJW A;  3R97 A;  4KGM A;  1O0P A;  3CW2 C;  2Y1L B;  4JUZ A;  4QBU A;  1T7P A;  3ZTQ A;  2B4O A;  1HNZ J;  3GIM A;  1N32 J;  3ZNJ 1;  2PMW A;  4OZN A;  1VQP S;  1GX5 A;  2RQK A;  3KMQ A;  1IQT A;  2B6A B;  3OR1 B;  2VFT A;  4EU0 A;  5U47 A;  3BQ0 A;  4K4Z A;  5J1E B;  5IC6 B;  4Q7A A;  3NGU A;  4DV7 J;  4OYP A;  3G86 A;  1AYE A;  5HO4 A;  4I7F B;  3MPW A;  3M8P A;  3GLJ A;  1X0F A;  5LMN J;  5AJ9 A;  3HZG A;  1OJ4 A;  2HFS A;  2YWK A;  4DCJ B;  2VG7 A;  3JSY A;  2BW2 A;  2Y0B B;  1T8E A;  2CPH A;  2V4R A;  2CPE A;  4BLG A;  1Q8L A;  3DLG A;  4DR4 F;  2I2Y A;  2F40 A;  1O8B A;  1BC6 A;  4M63 A;  1SJ4 P;  1K1Q A;  1U8W A;  1TL5 A;  2XI2 A;  4KC5 A;  1WC3 A;  2XB2 D;  4PWU A;  3TUZ C;  1IBL J;  4OZJ A;  2DBB A;  2GJI A;  4ECS A;  4KHP J;  3GIK A;  3GCW P;  3IN5 A;  4CH7 A;  1D9F A;  1RWV B;  1P49 A;  4IG0 B;  5HRO B;  4JI8 F;  2HW3 A;  1KHN A;  2AZ1 A;  1QTN B;  4BBY A;  3A8J A;  5KFP A;  3WAX A;  3NAH A;  2WB4 A;  3P96 A;  4GKJ F;  2RQ4 A;  2BJ3 A;  2RU3 A;  4A8F A;  2AJ0 A;  1S0O A;  1YX2 A;  2AYM A;  3KLE B;  2GFF A;  1N5Q A;  4Z7Y A;  3DOL B;  1GXT A;  2R2U A;  2AP6 A;  3FQL A;  1NJZ A;  1VQO S;  1P9Q C;  3OTO J;  4KPC A;  3EZO A;  6AT1 B;  3OV7 A;  4K59 A;  3UD3 P;  2YNG A;  3R6L B;  2N3O A;  4RW8 B;  5CAA A;  4K4V A;  2OAU A;  5HBM B;  3CJQ A;  3NNH A;  2PC6 A;  1RLC L;  3H90 A;  3FGV A;  2OIH A;  1IKY A;  3PIO Q;  2WB1 D;  2BJ8 A;  2B7C B;  2DH8 A;  2XR9 A;  2DIU A;  4ES3 A;  1BQN B;  1U7L A;  4USU A;  1FDN A;  2CJQ A;  1WUU A;  3H5Y A;  1RT7 B;  2EG1 A;  2FJW A;  5CH7 B;  2E29 A;  4M94 A;  1HDH A;  1S72 S;  3C6T A;  2LXU A;  4IDK A;  2ATC B;  4RL1 A;  1ZAX A;  4A8Q A;  4FYY B;  2F7V A;  4QU6 A;  3R7S B;  1I6J A;  1FO1 A;  1SH0 A;  1S0N A;  1B7F A;  4NCB A;  1ELY A;  1F5B A;  3HK2 A;  1IQZ A;  1HQU A;  3MM9 A;  4CO1 A;  3A12 A;  5F8G A;  5B7W A;  1UZD A;  1GMW A;  1VFJ A;  3IBC B;  3MED A;  4RLE A;  2G9O A;  4HHU A;  3MUT P;  4WIQ A;  4YEA A;  1U2F A;  3OTC A;  4KHM A;  3C16 B;  2BAB A;  2CYY A;  3TQE A;  1I5O B;  1HPZ A;  1ZM2 A;  4YUD A;  3TI0 A;  2U1A A;  4M5J A;  2DR5 A;  4OV6 A;  4C97 A;  1RWW B;  2AJ4 A;  3BKU A;  1PCA A;  1FK9 B;  2NYI A;  3R8Y A;  5J1P A;  1IXK A;  2BYC A;  2XWX A;  1L3U A;  4HH1 A;  1X5S A;  1JJ4 A;  4DX5 A;  3PO4 A;  1D9D A;  1WC0 A;  3VCD A;  3UFC X;  2HWH A;  2CQB A;  1Y5I B;  3HF5 A;  2DD8 S;  4IH6 A;  3ICL A;  2Y9H A;  2AD9 A;  1FDB A;  2CPI A;  2ZHA A;  1X4A A;  5IZH A;  3U1M A;  3G9C A;  1S0M A;  1WEX A;  1KRP A;  3SSS A;  2BX6 A;  4DR7 J;  3JAM U;  2DXD A;  1N33 J;  5KFJ A;  4Y34 A;  7FD1 A;  2VF3 A;  4I6W A;  2HHH J;  3BN7 A;  2XMT A;  3BO2 A;  1I94 F;  1U09 A;  4G1Q B;  4OI4 A;  1JNZ B;  5HSP A;  4MFB B;  1R8H A;  4DG1 A;  1V3Z A;  1YK9 A;  4X66 F;  3FRY A;  2ASY A;  2NPF A;  3MEG B;  2QV6 A;  4ED3 A;  4CH0 S;  2VIH A;  2VA3 A;  3A3N B;  4JYA J;  1OSC A;  3M32 B;  1Q7L B;  2D69 A;  2OPS A;  3ENQ A;  4DF4 A;  1W26 A;  1VQ8 S;  5KG1 A;  3SEO A;  4CYU B;  1FTR A;  4CLY A;  3CCM S;  1XMQ J;  4URS A;  1SUQ A;  4HDG A;  2FDN A;  3HVW A;  2YPZ A;  2XI3 A;  2WVD A;  2LYV A;  2Q43 A;  1XIQ A;  3GJQ B;  4J9R A;  4CNZ A;  1SKS A;  2WBM A;  5EX0 A;  1CJV B;  4X4R A;  3G2X A;  4UQT A;  1FF2 A;  2D3O R;  3L7U A;  4P71 A;  1Q8I A;  1HQA A;  3GTY X;  3C3L A;  3AJ1 A;  4Q44 A;  1DQA A;  4AQY F;  5EWE A;  5JMN A;  2WRM A;  2ZD1 B;  3MOZ A;  1H74 A;  1HNZ F;  1M90 T;  4JI4 J;  3R5A A;  5KFU A;  1U26 A;  1D1U A;  1RAE B;  4EEY A;  4DR2 J;  1FRI A;  5KT3 A;  3AXK A;  3NCR A;  4IH7 A;  2BDP A;  3EYZ A;  4G3I A;  1KBR A;  1B4S A;  1NJI T;  1S6P B;  4MH8 A;  4W90 B;  2V2K A;  2XQC A;  3MM7 B;  2X1G A;  4A8K A;  2POK A;  5J2Q A;  4Y2I A;  1RWN B;  3QSI A;  2ZNY A;  1JNR B;  2CQC A;  4FF1 A;  2F4F A;  4WE1 A;  2RAQ A;  4ZVH A;  3W62 A;  2QIF A;  2UV8 A;  3MPU B;  3P5B P;  2K1R B;  3LGN A;  2XSF A;  4IRK A;  4AXI A;  4GC7 A;  1T9T A;  1S1V B;  2VZ9 A;  4LIW A;  2W2N P;  3CTR A;  1QAX A;  1KOH A;  2ZH9 A;  1JLG B;  2YKM B;  5GMK a;  2KT2 A;  2WK4 A;  4QIW D;  1TKT A;  4P7T A;  2W5Q A;  4OLO A;  3GG1 A;  2VG6 B;  3RBX A;  3KLF B;  5DQG A;  2HBZ B;  2PEB A;  5KFG A;  5L1I A;  5JJB A;  5ETQ A;  2FVP A;  2BAN B;  1X9S A;  2Z4P A;  4ECX A;  1O51 A;  1D09 B;  2DNH A;  1ZTT A;  2DR8 A;  4OI0 A;  3TWZ A;  3BGR A;  2X51 A;  2WCX A;  3SXL A;  5F0U A;  1U1P A;  2AW0 A;  4GO5 X;  1JLF A;  3N5F A;  1U0H B;  1ELX A;  4ECY A;  3I9V 9;  2P9G A;  1URR A;  2ZOF A;  2DCU B;  2QYC A;  4ZVP B;  3EUN A;  4UQG A;  3RAQ A;  4M5D B;  1CJK A;  3IA0 A;  2W9B B;  2IDE A;  5HMY A;  2PD1 A;  3ZZZ A;  1N48 A;  1EIY B;  4C11 A;  1KHW A;  1VBX A;  3HHL D;  1VDH A;  3MMC B;  5KT6 A;  1VQS A;  1IBK F;  2GCF A;  3TJ8 A;  5F41 A;  3FZ2 A;  3PX6 A;  2N3L A;  4Q45 A;  2WON B;  3R1H A;  2NPI A;  2D3U A;  3ADA C;  2FC9 A;  4B3O B;  2OJ3 A;  4F36 A;  4UTG A;  2HAF A;  2Z8Q A;  5CZV A;  2FJX A;  1UCN A;  3TAN A;  1HKA A;  2QC3 A;  2DIV A;  3L7O A;  4UOF A;  4U8V A;  5FJ4 A;  4BHQ A;  2QYG A;  5CHC B;  5HVF A;  1KLN A;  3NKN A;  2J6T A;  4RW6 B;  2YPY A;  2WW4 A;  3N6N A;  4NLY A;  3I5A A;  2DVI A;  6FDR A;  2PMH A;  1D3W A;  2IM3 A;  1KH4 A;  2HMI B;  3V5R A;  2C2D A;  3MM6 A;  4USJ C;  1H7W A;  2A10 A;  3TZW A;  4JI7 J;  3RB4 A;  3J7Z 5;  5GAH I;  3M8R A;  1Z2Z A;  4ED7 A;  4F4A A;  1RAI B;  4UT4 A;  2GSU A;  1MW7 A;  4N41 A;  2RS2 A;  4O4G B;  4QR2 A;  2DH9 A;  3MEE B;  2ZUA A;  3KXD A;  3K5O A;  1KHL A;  2QA1 A;  1RWX B;  2AT1 B;  5A2Q Y;  2NLW A;  1XR6 A;  4QCL A;  3SFG A;  4TXS A;  3JQM A;  2KXF A;  4O4R A;  2VPY B;  3UDV A;  1FD2 A;  4R0E A;  3SYZ A;  2E5L J;  4ZVQ B;  2B5J B;  2J9D A;  5F8M A;  3VGS A;  3Q2T C;  5KXA A;  3AOC A;  3CXC R;  2E1M C;  2I1R A;  1M5K C;  2VQR A;  1RTH B;  3DM2 B;  1BQX A;  1Q8B A;  4OYX A;  2J6S A;  2CWK A;  5KFN A;  4DPY A;  2DRD A;  2M9K A;  3FQK A;  5CXT A;  5J2M B;  1WSV A;  1H2V Z;  2QL7 B;  3OR2 B;  2QT7 A;  2XZT B;  2IJR A;  2Z56 B;  2QLB B;  1ALI A;  3KK2 B;  2H51 B;  2PA3 A;  3MUR P;  3AT1 B;  1SJQ A;  4KO0 B;  3M30 A;  1RAC B;  4TU7 A;  2PI4 A;  1X9M A;  1UVL A;  2DXF A;  4XAK A;  3PX4 A;  4ZN1 A;  2XM3 A;  4ED1 A;  1F3F A;  2XMM A;  4I56 A;  3LO3 A;  3H5U A;  2VQF F;  1NPP A;  1Y4Z B;  4OYW A;  3Q8U A;  2RT3 A;  1C1C B;  4E8U A;  4KPY A;  2IC3 A;  2FLO A;  2E5H A;  2X98 A;  2E66 A;  2VPX B;  2MQM A;  2WOM A;  1RIS A;  1ITP A;  4IFY A;  1N5S A;  3OLA A;  2XYH B;  2GQ2 A;  3MI7 X;  3T1H F;  1RT1 A;  1WG5 A;  5F8J A;  3NBP B;  1ELZ A;  4RU2 A;  4NZ0 A;  1Q79 A;  5KFQ A;  4B3S J;  2NZC A;  4F8R A;  1M1K T;  1KD1 T;  4CXU A;  3CVK A;  1VBZ A;  2UVW A;  1AJB A;  3ISN C;  2DNZ A;  4R8U A;  4MKB A;  2G13 A;  3FNN A;  3W2V B;  1MWQ A;  2ERR A;  3ZZY A;  2A2C A;  4F4X A;  5KFW A;  3BGU A;  1DY3 A;  2C2K B;  2FHK A;  2B3T B;  2MSS A;  1N2K A;  2E1R A;  1JXE A;  2OO4 A;  2HAI A;  5GVQ A;  1N5Y A;  2GSO A;  3TW0 A;  2VL1 A;  1HHS A;  1S4E A;  2RSQ A;  3NXZ A;  2NUH A;  2M3D A;  2VB6 A;  2Z0G A;  3IR7 B;  4C0H A;  3DNC A;  1QVG R;  2ABY A;  4RNN A;  4MYT A;  3B82 A;  5FD1 A;  4UY8 T;  2D1G A;  4FP9 A;  4PEO A;  2HHP A;  1AZS A;  1B0T A;  2NXU A;  3KG1 A;  5CYQ B;  4DFJ A;  2Z58 B;  3M05 A;  4ZS6 A;  4ZLP A;  4DCP B;  3TVK A;  1UA1 A;  2VPW B;  1VLY A;  4LSZ B;  4DR6 J;  3MR6 A;  3L4B C;  1QSS A;  1ZEF A;  1R6V A;  1M5H A;  2OHD A;  3C15 B;  3JQJ A;  4TY8 B;  5KFC A;  2CVE A;  3SZY A;  3JTO A;  4P9S A;  2EFP A;  2W7O A;  3FFI B;  1RAJ A;  1KLM B;  5J2P A;  1SL0 A;  4KYZ A;  4AL5 A;  2UXB F;  3GU0 A;  4UUW A;  2CJY B;  2E5I A;  4LVN P;  3M2R B;  5GAH U;  2R7V A;  2PDA A;  2HS4 A;  1BLU A;  4B9V A;  3ZNU A;  4DI6 A;  3OFG A;  2VDI A;  2L41 A;  4PXC A;  1YRX A;  4F04 B;  1PJ6 A;  2J0Q D;  2R7R A;  3HSZ A;  1F2G A;  2HQC A;  1RAD B;  2FQQ B;  4FBU A;  1Y5N B;  4ER8 A;  2HNY B;  4DU8 A;  1FI4 A;  2V5H G;  3TVY A;  3GFX A;  1Y3K A;  2GJ2 A;  3CJK A;  2GML A;  3D3B J;  3RW6 A;  3W5X A;  3IRX A;  2P9C A;  4DL0 C;  3T02 A;  4U7C A;  2DGQ A;  2RIJ A;  1IKW B;  3HFZ B;  1VQ7 S;  5C2C A;  3IBF B;  4NMX A;  3J80 U;  3A13 A;  4S0M A;  2W8K A;  1EX8 A;  3CDU A;  1JXV A;  4OJH A;  1WOP A;  2CPX A;  1R0A A;  1ZZF A;  1NXI A;  3KG0 A;  3OVB A;  4DFP A;  2J6U A;  3IG1 B;  3KD8 A;  3TZX A;  5IM0 B;  3W2W A;  4ELU A;  1EET B;  3JSM A;  3FSY A;  1XC9 A;  1SKW A;  4ICL A;  3FRZ A;  3TAM A;  1JLQ B;  4IUF A;  2UUT A;  4ZVS B;  3SIP B;  4CZC A;  4KKO B;  1JX4 A;  1K44 A;  1RBO B;  4DN9 A;  2AEM A;  1NK6 A;  3R2D J;  4CXS A;  1SL2 A;  4N56 A;  1WEL A;  4CP5 A;  1SH3 A;  2AWZ A;  3NMA A;  2FVC A;  1EB0 A;  4Q2L A;  4ID5 B;  3HT0 A;  2LEC A;  2W5W A;  3OW2 R;  1WOS A;  5EGH A;  2RF2 B;  3RRH A;  1YLX A;  4G1P A;  1Q82 T;  1UW9 A;  4QR1 A;  3NGS A;  2Y8Y A;  5HRT A;  2GIR A;  2KT3 A;  2PII A;  3UDC A;  1S9G B;  4O23 A;  4PUO A;  2HGN A;  3OUY B;  1YIJ S;  4FDJ A;  4LFB F;  3BSN A;  2MB0 B;  2MZQ A;  1IUJ A;  1NSP A;  3WDO A;  3GB0 A;  3NAI A;  2QN6 B;  5D3G A;  4UZC A;  1F0X A;  1ROF A;  2ZBC A;  2HLU A;  1HHQ A;  4HAC B;  1HAR A;  1HI8 A;  4CYR A;  1H38 A;  1VQ5 S;  3D3C J;  3OJS A;  4KY3 A;  1HD0 A;  5IQQ A;  4ED8 A;  3KG4 A;  3WQP A;  3WX4 A;  4ZLN A;  1S1U A;  4DQP A;  1Q16 B;  3CC7 S;  4OL8 A;  2VBZ A;  1WDD A;  2QTW A;  3M2V A;  3RUB L;  3ZTS A;  3LGH A;  4F02 A;  4X65 F;  4X64 J;  4ETX A;  3TEG A;  1WOO A;  3OT9 A;  4GVB A;  4UY8 5;  2KHD A;  3T5H A;  4RW4 B;  3KYL A;  4NA3 A;  1P8G A;  1NJY A;  2DB1 A;  3DU5 A;  2ASL A;  4UPH A;  1T05 B;  1CS4 B;  2AQ4 A;  1RTZ A;  3ZZ0 A;  1TMM A;  4WK3 A;  3NGK A;  2CNK B;  2KN4 A;  1JB0 C;  2R8I A;  2H1Y A;  2IRY A;  2FZK B;  1GQE A;  3VQT A;  4DV5 F;  4AL7 A;  3LQV A;  3VZI A;  1FER A;  4O44 A;  4DS5 A;  2V6A A;  3CJR A;  3RAM A;  3DI6 B;  1KFS A;  4NOH A;  1KQK A;  5C42 B;  1Y6V A;  2RD5 C;  4F3Q A;  5C25 A;  3ETM A;  1FRM A;  3MMB A;  2RH3 A;  1ALH A;  4B9T A;  1D0E A;  2CVI A;  2FJA B;  2G0C A;  4ZIT A;  2PSZ A;  5AJ3 F;  2UUB F;  3T41 A;  2DHA A;  1Q78 A;  4H4O B;  2OPR A;  3EWG A;  1YKW A;  4Q43 A;  3T00 A;  4EBD A;  3ZZR A;  2CRL A;  3LAM A;  3PHT A;  2VQE F;  2JOQ A;  5KFY A;  2EEY A;  3DMJ B;  5BYQ A;  3ENV A;  5B0E A;  3OSP A;  4C8Y A;  3QAT A;  3ZZO A;  1S48 A;  2W5S A;  3BV8 A;  1SKR A;  3LWL A;  2AX0 A;  1BWV A;  3KLH A;  4RJV A;  3PTW A;  1L3V A;  1G2E A;  3B5Q A;  3MGJ A;  1HBM B;  2P5V A;  1MLA A;  3GJT B;  2JJ4 D;  1QJH A;  4IG3 B;  4QIV A;  4MKA A;  3DCA A;  1EW2 A;  1F1B B;  1YJV A;  2YXL A;  4DR6 F;  4DV0 F;  3G82 A;  2NCK L;  1RE1 B;  2ZZT A;  1E1Z P;  4OHZ A;  3QWP A;  5DLG A;  5HRO A;  3FC9 A;  1HI1 A;  1VRT B;  5DO2 A;  4G1I A;  3QIP A;  3KJF B;  1T9Y A;  3M9O B;  2VC1 A;  4R25 A;  2GW8 A;  3K5L A;  4CLL A;  1FXL A;  3T1Y J;  4OYI A;  2KG0 A;  1C4C A;  3PYE A;  3D1O A;  1UFL A;  5K8P A;  2IPO B;  4NI2 B;  2GO9 A;  4P2M A;  3KLE A;  2J5A A;  3DOL A;  3BR9 A;  3GWC A;  1F2H A;  5KT2 A;  4IOB A;  1V5I B;  3G6V A;  5I42 B;  2ZH2 A;  3TX8 A;  8ATC B;  1VLO A;  4JI2 F;  3MPY A;  1S49 A;  2PFD A;  3UPF A;  2BM0 A;  3N5B A;  4C6A A;  3OD2 A;  4LF7 J;  4I2P A;  3NCP A;  2JLE A;  4CNY A;  2DT9 A;  2UUA F;  4ZPV R;  3NKQ A;  2MZS A;  3MMA A;  5HMZ A;  1N8R T;  3AD9 C;  1EKR A;  2CJA A;  4DV4 F;  3VAJ A;  4WKR A;  2KFN A;  4F0K A;  4HH0 A;  1HNV B;  3VTI A;  2UZA A;  4DS4 A;  2Z57 B;  2GVZ A;  5K9F A;  2VHG A;  5C66 A;  1NZA A;  2CQ0 A;  3GJS B;  2N82 B;  1YBT A;  1RT7 A;  5MLC V;  2WSE C;  2VH7 A;  3HXM A;  1U4B A;  3EGZ A;  1R0B G;  1CEZ A;  2OEK A;  4PXE A;  1JLB B;  2OD4 A;  2HRT A;  3BDG B;  1UTA A;  5CQG A;  3GPA A;  2KZM A;  3AJD A;  2MQN A;  3M1V A;  1ZA1 B;  1GMV A;  4F7V A;  2KT5 A;  3J81 U;  1WHX A;  2FHM A;  3M8Y A;  2PI5 A;  2UVU A;  5INH A;  3SFU A;  4CM2 A;  1Q53 A;  1YJU A;  1T02 A;  2IJN A;  5ETN A;  4HVZ A;  4DR3 J;  4MIA A;  4DQR A;  4K4X A;  5IWA J;  2FHO B;  2O1P A;  1E33 P;  3LP2 B;  2MDA A;  1Y5L B;  5G0R A;  4F3M A;  7AT1 B;  4YOE A;  2OML A;  1HNI A;  2JEI A;  3FDS A;  4RPF A;  2R2T A;  5HLF B;  2Z2Y B;  2FTR A;  4ZGA A;  4P10 A;  2OLW A;  4WU2 A;  4X2B A;  3DLK A;  2CAJ A;  2B9W A;  1HR0 F;  2HBY B;  5I3P A;  2KG1 A;  4FDI A;  1M5S A;  1UVN A;  2L9W A;  5EDW A;  3CJ4 A;  1C0T A;  4XDC A;  2I5J B;  1VOM A;  2HWT A;  5K14 A;  5K20 B;  1KH7 A;  1JJC B;  1MN9 A;  3NGT A;  3PYD A;  4ECR A;  3SQG B;  3IXQ A;  3MDF A;  2LMI A;  2IYG A;  1WAC A;  4PAB A;  3Q8P B;  4G1Q A;  5KFT A;  4QW8 A;  4J9U E;  3BGL A;  4LQ9 A;  4H4M B;  1WWH A;  4WKY A;  1FFS B;  1REV B;  4WYW A;  1S0V A;  1IBM J;  3CDW A;  3MEC B;  1NHV A;  4DMZ A;  2GAG C;  3O44 A;  3CDE A;  2LU2 A;  4LFC F;  1F9E B;  2LEA A;  2IUC B;  2UU9 F;  5DDR C;  3ONQ A;  1WHV A;  3DRX A;  1HBN B;  3W9I A;  4UPL A;  3HD1 A;  2NSB A;  4MHX A;  4H54 A;  2K3K A;  5JUM A;  2XUL A;  4IQX A;  2YQ3 A;  1YJT A;  2HHV A;  3M2U A;  5ETT A;  1KTV A;  3BM7 A;  4C2M A;  2QLJ B;  3IP0 A;  2HND A;  4PPZ A;  2MZT A;  4P7V A;  1NLK L;  2ZM6 F;  2GHV C;  4C8Z A;  4KR0 B;  4JV5 J;  4F4Z A;  2JVR A;  2ZD1 A;  4DUZ F;  3ZZP A;  1XMB A;  3I6P A;  2MEW A;  1JLC B;  3BEG B;  2MKJ A;  1V3R A;  4YY3 F;  4DF8 A;  1BE4 A;  1XJW B;  3CO0 P;  1MWY A;  2YH1 A;  1A6L A;  5M2R A;  1O98 A;  4DUY J;  4Q0B A;  3UO0 A;  1VS3 A;  1YJR A;  5BYR A;  3LH2 S;  3LXQ A;  1S6P A;  2C2Z B;  3CUL A;  4DSI A;  4ALZ A;  1FJG F;  5IQ6 A;  4AXJ A;  3N28 A;  8RUC A;  1BUX A;  2RQM A;  2YWW A;  1MWZ A;  4QIG A;  5B0G A;  4F2R A;  1Q95 G;  3DFE A;  3I0S B;  2F8M A;  3DRS B;  1R43 A;  1VHI A;  3BSA A;  1MMN A;  2K1R A;  1GH8 A;  4FPI A;  4CIO A;  1K8A T;  2EXU A;  3HVR A;  3D0I E;  1B0V A;  3JXO A;  4WP8 A;  3R7B B;  1RUS A;  4K8R A;  2DHH A;  1JLG A;  2CAD A;  2YKM A;  4ZG9 A;  3KLG A;  2ZE2 A;  4O3R A;  2MLY A;  3CF5 Q;  2ACM A;  4CH1 A;  3EX7 B;  1X4H A;  3L3C A;  1N36 F;  2K06 A;  2R7Q A;  5L1J A;  4QYZ K;  3M6V A;  4I2Q B;  2YTC A;  5E41 A;  3PX0 A;  2GGP B;  1KQF B;  3G6X A;  4KV8 B;  2X1A A;  4NCG A;  2MKK A;  1RTI A;  1QD1 A;  2I6W A;  5F9L A;  2V34 A;  3RU0 A;  8AT1 B;  3OSN A;  2MKC A;  3NLC A;  4Q8F A;  1XMO F;  3DKD A;  1N6Q B;  1E2S P;  4Y2K A;  2HYI B;  5H9E K;  2W1B A;  1U48 A;  3SCI E;  3DLJ A;  2GC8 A;  1H7X A;  3ZXW A;  2N7Y A;  3P49 B;  3WX8 A;  3HHL A;  1U0H A;  3M9N B;  4TN2 A;  2W8S A;  2Q3P A;  2NSC A;  4FNH A;  5K5M A;  4L74 A;  4FZV A;  1IR1 A;  4NLG A;  3Q23 A;  5ITH A;  2YX7 A;  4J91 A;  1F5C A;  1LK5 A;  2QX0 A;  1Q5V A;  4A8Y A;  1EQJ A;  1K9M T;  4QPX A;  3RAX A;  2V68 A;  4Y0F A;  3P6Y C;  2C3U A;  1NPK A;  3UCG A;  2C3P A;  2W9B A;  4MY4 A;  4W92 B;  1RGV A;  4AYB D;  4DPW A;  4JV2 A;  3T1A A;  4NEZ A;  4C3M A;  2YWF A;  3PHE A;  1YBA A;  2IA6 A;  3EDR B;  3LP0 B;  4LF6 J;  3Q0A A;  2V67 A;  2WON A;  4CLU A;  2B7B B;  3F41 A;  1FVS A;  2YNH B;  4MIV A;  3TAR A;  4DWI A;  1SKU B;  3PYF A;  1TL1 B;  3MZI A;  2J0X A;  2ZKT A;  2ZHB A;  3R5C A;  3BB5 A;  2QMX A;  1PG5 B;  1RDR A;  1N34 J;  3UD4 P;  3FSI A;  4KH0 B;  4KE5 A;  3CD5 A;  1XTZ A;  2ZH7 A;  5ETK A;  3O8W A;  2O66 A;  4GKK J;  1RTD A;  3QT8 A;  3SV3 A;  4QIE A;  5KG6 A;  3CO9 A;  1NH7 A;  2DNN A;  2FLN A;  2H48 B;  2P6T A;  3U7J A;  2CJB A;  3M8W A;  2DGW A;  2IHR 1;  2R7W A;  1SV5 B;  1WF0 A;  1LKZ A;  3HM9 A;  3GP9 A;  2AJ1 A;  3KUH A;  2HGL A;  2VJU A;  2FUG 9;  2IMW P;  4RX6 A;  4O4G A;  1VJW A;  4P72 A;  3QAE A;  4CLP A;  3T9N A;  4YN3 B;  2RE1 A;  3HI9 A;  4NLQ A;  4ZHR A;  4X4P A;  5AXK A;  1XNR J;  2BQR A;  2E7W A;  2XHW A;  1S9E B;  1DRZ A;  3AHP A;  2IFX A;  4DPT A;  3GV8 B;  3BSO A;  3BDP A;  1Q4R A;  3AFG A;  5AE1 A;  5C24 B;  1VQ4 S;  1IKV B;  4DR5 F;  3BN4 A;  1HYS B;  1RTH A;  4IKA A;  1FRL A;  3UR0 A;  3D67 A;  1FJC A;  2A1B A;  5KFE A;  4JV0 A;  5CA5 A;  1WC6 A;  2YNF A;  5D6G A;  4YR3 A;  1TKZ A;  4JV1 A;  5LJ3 Y;  4LBI A;  2E1A A;  2E1P A;  4NLS A;  5J2M A;  1FKO A;  4WII A;  1VRU B;  3OR2 A;  4ES1 A;  2VA2 A;  2F4V F;  5C5J A;  4ZP9 A;  2EKY A;  4O0N A;  4ID8 A;  4KO0 A;  1DZ5 A;  4A8W A;  2ZDO A;  2ZWP A;  5F3T A;  1S7I A;  4F67 A;  3MAA B;  1RBL A;  3KK1 B;  1UPP A;  1OPI A;  4PQU A;  3DDN A;  2HLT A;  3W8P A;  4NZ6 A;  2W5V A;  2JEF A;  3OL6 A;  1C0U A;  2W9C B;  3JB9 k;  5SZT A;  1RAG B;  4B3M J;  1SJ3 P;  3U02 A;  2GVD B;  1C1C A;  2M7S A;  5IT4 A;  2CDQ A;  2ROE A;  2KL8 A;  4K7Q A;  4FS1 A;  5CYM A;  1TKX A;  1YSJ A;  2HFZ A;  4CCH A;  1PC4 A;  1V5V A;  3PEJ A;  4X4U A;  2ZUG A;  5F8I A;  4EI2 A;  4DUY F;  2VBX A;  4W4M A;  2GMH A;  2DNP A;  2XY7 A;  5HAN A;  2ZH6 A;  2HQF A;  3C14 A;  5FDL A;  3NBP A;  4L72 B;  1T9V A;  4USM A;  3CD0 A;  1OS5 A;  1VQK S;  3W2V A;  2PT0 A;  1RBA A;  1IM4 A;  4WZM A;  5DQH A;  1ZEB A;  3CSK A;  4KB7 A;  1JLE B;  5HJX A;  3B78 A;  4DPX A;  1HD1 A;  1E6Y A;  1UWB B;  3PJX A;  3PR5 B;  1XNQ F;  4YR1 A;  4J9N A;  5HAO A;  2RIL A;  4R5P A;  1J5O B;  3K8V A;  2WBR A;  1CSJ A;  2M52 A;  3WIU A;  2J7K A;  2BQ3 A;  1OO0 B;  2A18 A;  4YB6 A;  1NM2 A;  2MLZ A;  2YQ1 A;  4DSK A;  2X3G A;  4RUB A;  2ACY A;  4LIR A;  1F3V A;  3ILJ A;  2V50 A;  2F9D A;  5CYQ A;  4EK2 A;  2XBP A;  1LWF B;  2XEX A;  3R5G A;  1MRO A;  3CNQ P;  4N7T A;  3X3U A;  1QVF R;  4I68 A;  3T5K A;  3L7P A;  1RAA B;  1VC6 A;  1HHT P;  5A8R A;  3QMQ A;  3WHI A;  4ZG6 A;  1FDD A;  2V94 A;  1AUK A;  3C15 A;  3PYG A;  1R3N A;  3JSR A;  3EPG A;  4DR4 J;  5T41 A;  3FFI A;  3S7R A;  3MCN A;  4HL9 A;  4YFU A;  4LF8 F;  3ITH B;  1KR4 A;  3ZZT A;  2OPP B;  3FCH A;  4RW9 B;  2ASD A;  1HWI A;  4Z2X A;  4XO0 A;  4ZIV A;  2KU7 A;  2RDI A;  3O5T B;  1S6O A;  2CPJ A;  2ANH A;  4LSN B;  4DHV A;  2ADC A;  3H7H B;  1JKH B;  2P8I A;  4AL6 A;  2I38 A;  5GOV A;  3GR0 A;  4JI8 J;  4PG8 A;  2BRK A;  5IS2 A;  3SQO P;  3NP5 A;  4WP3 A;  4JOU A;  2CUY A;  1AXQ A;  5EUH A;  2AZ3 A;  1RJJ A;  4GKJ J;  2HNY A;  1U24 A;  1S12 A;  2OI2 A;  3QJJ A;  3S1T A;  1G7C B;  2QSW A;  5J2N A;  2I0X A;  4J9Q A;  1S5Z A;  2C42 A;  2GMJ A;  1ACM B;  5C7P A;  2PFF B;  1RKI A;  2IJF A;  3OTD A;  3QLH B;  3JTP A;  3D1Q A;  3VGU A;  3T9Z A;  2ZOM A;  4NLV A;  5M2U A;  3RW7 A;  1UVJ A;  2LXI A;  3RRK A;  2QE5 A;  4JI5 J;  1J5E F;  3OHB A;  1TL7 B;  2M8D B;  2B9E A;  2ROP A;  3EXC X;  3LGM A;  4ZVG A;  2LP4 A;  5EWG A;  1UVM A;  3CMR A;  1CC7 A;  3V4M A;  3R9L A;  5KFO A;  1N34 F;  4PG6 A;  4NX9 A;  3DOK A;  1UEK A;  4TN0 A;  1CJT A;  3ELH A;  2GNK A;  4KJI A;  3K5N A;  3CME S;  4NWB A;  1X4D A;  5KTQ A;  4GKK F;  3K7R A;  3M8P B;  1C2P A;  2VKZ G;  3M7V A;  1X31 C;  4TVA B;  1CLF A;  4H4K A;  2VG5 A;  5GRR A;  3VVT A;  5HQL A;  2VG7 B;  5KG7 A;  5CZX A;  3PG9 A;  2F63 A;  3MK2 A;  3BDE A;  1VHF A;  4UZB A;  4M95 A;  2YH0 A;  5IOL A;  2AU0 A;  4D3H A;  4OJ3 A;  2RRB A;  1LW0 B;  2DGT A;  1HNW F;  4NWX A;  3F0N A;  5IC4 B;  2F8H A;  5DDO C;  2EKN A;  4PR6 A;  1F9H A;  2ZKU A;  5D4P A;  2CNN B;  4A47 A;  1UEV A;  1S79 A;  3HVA A;  4I64 A;  5KFL A;  4NCA A;  3W63 A;  3J7Y I;  2EFQ A;  4XK8 C;  1B64 A;  4DN0 A;  3O6Q A;  2PEH A;  4CO5 A;  1CPZ A;  3LAK A;  3DU6 A;  1FNO A;  4NXN F;  3TZZ A;  1AA1 B;  1Y7A A;  2H9Z A;  4LRD A;  9RUB A;  5AXL A;  5HP1 A;  4TYA A;  2UXD F;  5LXY A;  4K4T A;  3POT B;  2BJE A;  3PEH A;  3I87 A;  1TV6 B;  5KT5 A;  4OZ1 A;  1NHU A;  1T11 A;  1X4B A;  4BWJ A;  2HG4 A;  5GAG U;  5E3C A;  2B8Q A;  2E5J A;  3EM1 A;  4K2J A;  2F8E X;  4JI1 J;  1YG0 A;  4P2F A;  4PG7 A;  2DXE A;  5EX3 A;  5ETL A;  1LXN A;  1S99 A;  1ZYQ A;  1PAE X;  5CD4 H;  3NS7 B;  1ZOT A;  4DV6 F;  3QNW B;  2YNG B;  3M6U A;  4DQQ A;  2AGQ A;  5TJ3 A;  4IH5 A;  1WTB A;  3EZU A;  4FBT A;  2DGU A;  1TUV A;  2BZ2 A;  2AYB A;  3W9J A;  2BE2 A;  1U6B A;  3IBW A;  2HFU A;  1TUG B;  4E98 A;  4B3M F;  1VQ6 S;  4ZPW R;  2HBQ B;  1NAQ A;  1I94 J;  3QRP A;  2IRX A;  4B3R F;  4CYS A;  4MMO A;  4RUA A;  3HKW A;  3DXB A;  3W64 A;  4RBV A;  1NDK A;  4DR1 F;  2K3I A;  3TNV A;  2GA7 A;  1RT3 A;  3CED A;  4X66 J;  3W5Z A;  2B4P A;  2YKO A;  4OHX A;  3I96 A;  3DLE A;  3AB2 B;  2G2Y A;  4F4K A;  1V6H A;  1RHQ B;  3C6T B;  3I5B A;  4IDK B;  2I8E A;  3MCO A;  1T03 A;  1QAJ A;  1ED8 A;  1QUP A;  4OJG A;  2F3J A;  4ZPT R;  2BOP A;  2OEJ A;  2WSF C;  4I6A A;  2W9A A;  1HQU B;  2WW8 A;  4MT1 A;  4BDP A;  4CLT A;  2H3E B;  4ZVE A;  2ZVS A;  4ED0 A;  3MED B;  4H4O A;  1N54 B;  5HL7 Q;  2HQ3 A;  4G6V B;  4RU9 A;  5E3Q A;  4AQY J;  3UDE A;  4KFB A;  3CCE S;  3AOB A;  1SXL A;  2KB2 A;  2RRN A;  1R8A A;  2HBR B;  3HVT A;  1U1Q A;  4YB7 A;  2RH6 A;  1T3O A;  1QAI A;  5FLX Y;  1WTF A;  5KFI A;  2DKO B;  3D68 A;  3TAP A;  2G1D A;  3THV A;  2PA8 D;  2G0J A;  1FEE A;  4IG3 A;  5L1K A;  3MAQ A;  3GQC A;  2VFR A;  1LV5 A;  2CQG A;  3M8Q A;  2H54 B;  4A8O A;  4DX6 A;  2K8G A;  5KFA A;  3LA0 A;  1D8Y A;  1FSU A;  3UNG C;  4L73 A;  1A0O B;  2XGQ A;  3QWU A;  2D41 A;  3UN2 A;  3FUY A;  2R4F A;  3NMR A;  1M1G A;  3DHX A;  2XCP A;  2E1C A;  4C8M A;  3RYL A;  4W98 A;  3N0V A;  1HNX F;  3CGI A;  2R7S A;  4NXM F;  3CJT A;  3IS9 B;  1FKP A;  3J7A N;  4DG1 B;  3ULH A;  2J7U A;  2R7X A;  3HD2 A;  1FJ7 A;  4IRD A;  5HQ8 A;  2W8D A;  4XPE A;  4DL7 A;  4ECZ A;  1QSY A;  2C2O B;  3NS6 A;  2WVF A;  5AXM A;  4NML A;  4ECQ A;  2OPS B;  2XS5 A;  1RAH B;  1V9O A;  3EJM A;  4ZP6 A;  2R7U A;  1SUQ B;  1B70 B;  4C9D A;  4YQW A;  3EGW B;  1RT4 A;  3CE8 A;  3VWS A;  1PBA A;  2CZ4 A;  4ZG7 A;  3TEH B;  1LFW A;  2NUU G;  1NK8 A;  2DRB A;  1RT5 A;  3H40 A;  3GV7 B;  4JI5 F;  2ZHO A;  2RKI A;  2BW7 A;  1JIH A;  2GS8 A;  2VKR A;  2J9E A;  2DEI A;  3C8Y A;  2Y1R I;  3E01 A;  2XS7 A;  1H72 C;  1OY6 A;  4HI2 A;  3VGT A;  3QFH A;  5A6W A;  3OL7 A;  4DXL A;  2YVS A;  1IBK J;  5J2Q B;  3F56 A;  1ANJ A;  4ECW A;  3NKR A;  4CLF A;  4LFA F;  4EZ9 A;  2OKQ A;  3QGG A;  2MLX A;  2AMC B;  5D8H B;  3K5P A;  2LCW A;  3K17 A;  2QSF A;  4WE1 B;  3H2U B;  1G1X A;  4LQ3 A;  1DHM A;  1ANI A;  2KDO A;  4CWB A;  2B4U A;  4NYP A;  5IV4 A;  2VFV A;  4TLQ A;  3CCW A;  1NZ8 A;  3HSG A;  3LAL A;  5HLF A;  4HDH A;  4DSJ A;  5A0Y B;  2KVQ E;  3EXY A;  3I9Z A;  3HHD A;  3MTK A;  4NA1 A;  3K58 A;  1WHW A;  3SZZ A;  2H4W B;  4KAY A;  1UZH A;  4UF4 A;  4N5S A;  1TL4 A;  3TZY A;  3D0H E;  1NB7 A;  2YKQ A;  3QYY A;  2VV5 A;  3L09 A;  1Q1K A;  1S1T A;  2NRE A;  4OX9 F;  1PYO B;  2DH7 A;  3SQG A;  1NDL A;  1YWX A;  3DRP A;  4L76 A;  3OXG A;  3RR8 A;  1RWK B;  4JI1 F;  2XSJ B;  4ZVU B;  1U0S A;  3BGR B;  2LEB A;  2ASJ A;  1JLF B;  4V1A k;  5L0B A;  2YNI B;  3G87 A;  4AD6 A;  3UCZ P;  2BOA A;  1EAR A;  4I1T A;  3K0J A;  1RWO B;  4NYO A;  3VF0 B;  1ED9 A;  1SI9 A;  1CJK B;  5D77 A;  5JVG Q;  3V6D A;  4M5M A;  4C11 B;  4ZCK A;  5EGY A;  5DM7 Q;  1W7W A;  4K0K F;  4LF4 F;  4TY9 A;  2HIQ A;  3KWM A;  3VAG A;  4WJB A;  5FII A;  3IR6 B;  4UPI A;  4NLO A;  2IM1 A;  1I1G A;  2ZH8 A;  1OWX A;  1SQE A;  4F50 A;  4WFA Q;  2C3Y A;  1JLC A;  2GHW A;  5KT7 A;  3MPD A;  4PZV A;  3RJM B;  1HQE B;  2B8P A;  3I4P A;  4NLX A;  5RUB A;  2DIS A;  3RB3 A;  1JQG A;  2BE9 B;  2Q66 A;  2HNZ B;  1E6V A;  3ET6 A;  4JI3 F;  2VQF J;  3P8B B;  5F8L A;  1G4C A;  3H42 A;  2UUW A;  1YI2 S;  3MM5 A;  4RWX A;  1DFD A;  1R8C A;  3MWB A;  1K7H A;  3GFY A;  4C3L A;  4EFA C;  5E3R A;  3MM6 B;  2EFV A;  5KFX A;  4IR1 A;  4ECV A;  5THW A;  3KLV A;  1TR0 A;  4OZ3 A;  3PZP A;  1FDA A;  1CC8 A;  3UCU P;  3T1H J;  2GV1 A;  2FZG B;  4DPO A;  4P2X A;  1L3S A;  1ZPW X;  3WBZ A;  4QQB A;  2DHX A;  3W1Y C;  3W5Y A;  3TA0 A;  3A8E A;  1N2L A;  4I4B A;  3MF5 A;  4O0I A;  3C6U A;  3JYT A;  4PAA A;  3AQP A;  4B02 A;  3R5B A;  5DZ7 A;  4M8L A;  3KNA A;  1VCT A;  2EK6 A;  4KV8 A;  4YS2 A;  3DXS X;  2XCA A;  2CPZ A;  2FB0 A;  1R89 A;  4JI0 F;  1SIZ A;  2HQD A;  1PIL A;  5A8W A;  1S10 A;  2DPJ A;  2F9J A;  2FPH X;  2XLK A;  4ZLL A;  3Q2S C;  2DNM A;  4LRE A;  4OX7 A;  1N6Q A;  4ZPD A;  3O3L A;  1DUR A;  2APO A;  3Q3Q A;  5H9F K;  4AT1 B;  3DYA A;  5F9N A;  3GV5 B;  2XTJ P;  1NHK L;  3PXG a;  2MZR A;  1WG1 A;  1H98 A;  3KHH A;  2LFV A;  3A3O B;  3VHQ A;  1TP7 A;  4USI A;  3L9Z A;  1VIO A;  4LSL B;  3G6Y A;  1KC8 T;  4RNH A;  4LF9 F;  4CLS A;  4URG A;  1BY9 A;  4WU3 A;  2KZZ A;  1RHU B;  4C8K A;  3KHR A;  2R8H A;  5KG2 A;  4ZDN A;  4OZ5 A;  2CXE A;  2V4J A;  2BXJ A;  3Q83 A;  2XYG B;  2UXB J;  3MAH A;  4RZR A;  1XR7 A;  3CCS S;  1LEO A;  2PO4 A;  1U1K A;  1Y0H A;  4X62 F;  1H73 A;  1Y11 A;  1RYS A;  2QLW A;  2XY5 A;  2C22 A;  5DZ6 A;  2H5J B;  3BBF A;  3IMQ J;  4CI0 B;  1JLA A;  3HHN B;  2WOM B;  2YNH A;  1S97 A;  2HKE A;  3HSJ A;  1NPR A;  3BPS P;  3CCU S;  1EP4 B;  2CWX A;  3DRR A;  2CQ4 A;  1RXO B;  3BSC A;  2JEG A;  1RT1 B;  1LWC A;  3RGI A;  4NLW A;  3FVY A;  3B8H A;  3LP1 A;  2V8D A;  3A3P B;  1AUS L;  4MKY A;  2WVC A;  5HVH A;  4J9P A;  4R8U B;  3OXF A;  4B3T J;  4RUC A;  1H6K X;  1FWP A;  1HBO B;  1HBU A;  1SHN A;  2P2C B;  2WAQ D;  4CXK A;  1H3D A;  4YHH F;  2QMW A;  3IAS 9;  4KTQ A;  2CPY A;  4MAK A;  3GFH A;  4PG5 A;  4N77 A;  2R7O A;  4OX8 A;  4ZK7 M;  1N5Y B;  4PWD A;  1SV5 A;  3CCR S;  1UKU A;  4UOH A;  1EW9 A;  1QDU B;  1KON A;  1TL3 A;  1UFW A;  1D8Z A;  4FVM A;  2JC1 A;  3FBE A;  1MMD A;  1O5J A;  2Y1I A;  4KQZ A;  5LL6 d;  3I0R A;  4U6P A;  1FXR A;  3K2Y A;  1C1B A;  3GYN A;  3RRG A;  2SXL A;  3KDN A;  1AZS B;  2A6M A;  4ZOS A;  4GC6 A;  1HMV A;  4M5N A;  1DBD A;  3GE9 A;  1TVR B;  1S9F A;  1UET A;  5C24 A;  4FN5 A;  2MY7 A;  4ZLJ A;  4LFB J;  5DDQ C;  4AND A;  1EQM A;  4ZCL A; 
#chains in the Genus database with same CATH homology
 1K7H A;  1O99 A;  1EI6 A;  2QZU A;  3WAW A;  4ZGA A;  1KHN A;  1ALI A;  1KHJ A;  1EJJ A;  3ED4 A;  1HDH A;  4UPL A;  4MHX A;  1E1Z P;  5IJS A;  5DLT A;  1Y7A A;  3WAX A;  4LRC A;  3MK1 A;  1ED9 A;  5C66 A;  1URB A;  4LRD A;  4ZG7 A;  1N2K A;  5L0K A;  1SHN A;  5L0E A;  3UNY A;  1SHQ A;  1KHK A;  1EQJ A;  1Y6V A;  3CMR A;  4GTW A;  4CXS A;  3BDF A;  3UN3 A;  4KM4 A;  5DLW A;  2W5Q A;  4LRF A;  3UN5 A;  1HQA A;  3IGZ B;  4FDI A;  5LRM A;  1ZEB A;  4CXK A;  4ZG9 A;  2GSU A;  5LIA A;  3BDG A;  2GSO A;  3M8W A;  4MY4 A;  3WBH A;  1B8J A;  2W5W A;  1ALJ A;  2GLQ A;  1FSU A;  3SZZ A;  1ELY A;  1HJK A;  5EGH A;  3WAY A;  4TN0 A;  3T01 A;  1ED8 A;  1ALH A;  2ANH A;  3A52 A;  1N2L A;  4KAY A;  4GTZ A;  3UN2 A;  1KHL A;  1KH7 A;  3BDG B;  3DYC A;  5HRT A;  5AJ9 A;  5K4P A;  2W5X A;  4YR1 A;  5DLV A;  5GOV A;  1E3C P;  3BDH A;  1AJD A;  4LR9 A;  1EW9 A;  4UPI A;  3M7V A;  3T00 A;  2W5V A;  1ZED A;  4FDJ A;  4UOO A;  4LQY A;  3OT9 A;  4LRB A;  4UOR A;  4KJG A;  3TX0 A;  2D1G A;  1O98 A;  3M8Y A;  5GRR A;  4B56 A;  5INH A;  4LR7 A;  1KH5 A;  3E2D A;  3UO0 A;  2X98 A;  3NKP A;  5IJQ A;  4MIV A;  2XRG A;  3MK2 A;  3NKM A;  3TWZ A;  2GA3 A;  5TJ3 A;  2W5S A;  2W5T A;  2IFY A;  3LXQ A;  4UPH A;  3T02 A;  3NKN A;  1AJC A;  5KXA A;  1E2S P;  4NWJ A;  1E33 P;  3MK0 A;  1EW8 A;  4GTX A;  2VQR A;  4NWX A;  1ELX A;  5EGE A;  2W8D A;  3B5Q A;  1ANJ A;  4UOP A;  4UPK A;  1ZEF A;  4N7T A;  4LRA A;  3NKO A;  3NKQ A;  4QAX A;  4LR8 A;  2G9Y A;  2ZKT A;  3IGY B;  3TG0 A;  1ELZ A;  3NKR A;  2RH6 A;  3M8Z A;  2XR9 A;  5LRN A;  4LRE A;  4KAV A;  2IUC A;  3IDD A;  2GSN A;  3KD8 A;  1URA A;  3DPC A;  5L0B A;  1KH4 A;  4LR2 A;  4ZG6 A;  4CXU A;  2W5R A;  4CYS A;  3SZY A;  2W8S A;  1EW2 A;  3Q3Q A;  1AJB A;  1ALK A;  4GTY A;  1KH9 A;  2IUC B;  1ANI A;  1AUK A;  1AJA A;  1P49 A;  3NVL A;  4KJD A;  4CYR A;  5LQQ A;  3WAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...