3TWZA

Phosphorylated bacillus cereus phosphopentomutase in space group p212121
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
KYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
total genus 139
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3twzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3twzA01
1N2KA 4LR2A 5LQQA 2XR9A 1EI6A 3M7VA 3UN5A 3UN2A 4GTZA 4UPHA 4LRCA 5TJ3A 4CYRA 3OT9A 5DLWA 3LXQA 2ZKTA 4ZG7A 5DLTA 3NVLA 2QZUA 1SHQA 2GSNA 2RH6A 1ZEFA 4NWJA 3NKOA 5KXAA 2X98A 4UORA 5LIAA 3SZYA 2GLQA 3UO0A 1ELYA 3Q3QA 3B5QA 1ELZA 4LRFA 1E3CP 4ZGAA 3KD8A 3NKNA 4KAVA 1HDHA 1ALIA 4TN0A 3BDFA 4MIVA 3WAVA 1Y7AA 4ZG9A 3BDHA 1HQAA 1EW8A 4KJDA 2GA3A 3MK0A 3BDGA 1O99A 3E2DA 1KH7A 5IJQA 4LRBA 5L0EA 5IJSA 5C66A 1E1ZP 3WAYA 2ANHA 3TX0A 1ZEDA 3CMRA 4LR7A 1ZEBA 1ED8A 4CYSA 4B56A 5L0KA 4LREA 4LQYA 3MK1A 3T01A 3WAWA 1P49A 4UOPA 2W5QA 2W5XA 4ZG6A 1ALHA 1FSUA 4FDJA 1KH9A 2GSUA 3T00A 3NKQA 2IUCB 5HRTA 3NKPA 1EW9A 1EQJA 3M8WA 4GTXA 1B8JA 1KH4A 2G9YA 4CXSA 4KJGA 2GSOA 3IGYB 5AJ9A 2W5VA 3M8YA 5K4PA 1ALJA 2W5WA 4KAYA 3T02A 1EJJA 1E2SP 5EGHA 4UPIA 3A52A 4LRDA 2D1GA 4GTYA 3TG0A 3BDGB 5LRNA 1AUKA 4GTWA 1ANIA 3UNYA 1ELXA 4LR8A 1O98A 3DYCA 1URBA 5GRRA 1URAA 3UN3A 2W5SA 1K7HA 2W5TA 1KHLA 4YR1A 1ANJA 3IDDA 1AJDA 2VQRA 3IGZB 3WBHA 1Y6VA 1KHNA 1KHKA 1E33P 1ALKA 5INHA 4CXKA 3NKRA 5L0BA 1EW2A 4QAXA 5DLVA 4FDIA 4LR9A 1N2LA 2W5RA 3WAXA 3SZZA 1AJCA 5EGEA 4N7TA 4CXUA 3TWZA 5GOVA 1ED9A 1SHNA 3DPCA 3MK2A 4UOOA 1AJAA 2W8SA 4UPKA 4MHXA 1HJKA 2IUCA 2XRGA 4UPLA 5LRMA 2IFYA 4KM4A 3M8ZA 2W8DA 3NKMA 4NWXA 1KHJA 3ED4A 1AJBA 4MY4A 1KH5A 4LRAA
chains in the Genus database with same CATH superfamily
2E5HA 3NGRA 2OPSA 1Z4UA 3UN5A 5T7LA 3KLFA 4YUDA 3CJQA 2WW4A 3OSNA 3OR2A 2KL8A 1U0HA 4O4GB 1UVLA 1QVGR 1RT5B 3M6XA 1UA1A 2IIHA 1NJIT 1HNVB 4LSNB 3PR5B 1K47A 2DCUB 4ZJQA 1T9XA 1UJ4A 3NOCA 1URRA 3K2YA 4OX9J 1LWCA 3NS5A 2G13A 1TTHB 2JZ5A 2LQ5A 1TK8A 2MQOA 4MYTA 4V1Ak 4CO0A 4ETZA 4WP9A 2XMJA 2ZD1A 2B6AB 3QRPA 4WCEQ 3IS9B 3J7YU 1L3SA 2W1BA 1HNWJ 1N34F 2LFVA 1FNOA 3A13A 3CNQP 3Q8VA 5ETRA 2M52A 2OEMA 4URGA 2B4VA 5L9XA 1DTQB 3LANA 3FCVA 2JJ4D 5DRKA 4DR5J 3M9NB 2GGPA 3AJ1A 1X0PA 5K8PA 3OTEA 2JFKA 4NWBA 3CJKB 3PXGa 4A8OA 1BQMA 3NKOA 2BX6A 2CPFA 2YKMB 2K3KA 1RAOA 5EWFA 3EPIA 5IWAF 3J7Z5 5H9EJ 1X4BA 5J2NB 1N32J 4OZJA 4X4SA 4IFYA 2U1AA 3TZXA 3TAMA 4LFCJ 1RAAB 4L3KA 3TJ8A 2W5XA 1JXLA 3HVAA 3KTQA 1N5YB 3M2RB 3U27A 3VGUA 4KHPJ 4J9MA 4ZP6A 2J0WA 1B8JA 2BJ8A 1HPZA 4RJVA 2HHXA 1JLQB 2GSOA 4I7FA 2XYPB 1REGX 4O3PA 4DSFA 3KYLA 2VHGA 2XI3A 3WC0A 2ZH3A 2VKRA 3GIRA 5I3PA 1RISA 2L3MA 4I6YA 1WOSA 5HI7A 7AT1B 4DV5F 3GV5B 1U1KA 1MMNA 3QFHA 4NMXA 3GMGA 1EETA 4P2FA 3J81j 3AA9A 4NI2B 1RT1B 2R8JA 1PO6A 2KVIA 3KLVA 1TKZB 2E7WA 2Z57B 3D3CJ 3OXFA 2IMWP 3AOCA 3A12A 2E1AA 2BYCA 2B0GA 1KHWA 3BGUA 4IQXA 3KG4A 4Z37A 1RA7A 2C28A 3M8PA 4NCBA 2DRDA 3OXGA 2X1BA 3C15A 1WI8A 2DKOB 2ZFHA 3ET6A 2FUG9 1R3NA 2G1DA 4ZA1A 3MHYA 3HO1A 2XSJA 3I5CA 3NGDA 4K0KJ 1ZM4A 2DNGA 2MQPA 3J80Y 3OL8A 3LWMA 4WFXA 1KVJA 3RR7A 3NKPA 3RU0A 1NJYA 2A10A 1GT8A 3ULHA 5KG1A 3UVJB 1Q5YA 1ELOA 2HWTA 4P2SA 2DNMA 1ZM3A 1NHKL 2FY8A 2A2CA 1L5UA 2XNRA 2GC8A 2BJ1A 5DLFA 3Q86A 3CCVS 2CPEA 1VBKA 1N54B 1H2UX 4R5PA 4DU7A 2HNDB 4CTAA 3SSQA 5GAGU 4ECUA 2DNQA 3O6QA 4YR2A 5KT7A 1I94F 3A8JA 5E0OA 3W5XA 2DTJA 1SH0A 1T05B 1RTJA 3MK0A 5IJSA 2V8DA 2VFRA 3RB4A 3K57A 2GW8A 3EICA 1FEEA 2YH1A 4CLSA 1R8PA 2QX0A 4O0NA 2ZJPQ 1WSRA 4ZVGA 2NZCA 3GU0A 2OO4A 5A0YA 4PG4A 3ZTRA 4BHQA 5HSPA 1ALJA 1GK8A 3RGIA 3LP0A 2ALYB 3GB0A 2ADCA 5F8HA 2HRUA 3WBHA 4KV8B 5L0BA 2ADBA 4OYBA 2JHEA 4Q45A 3AOAA 4DCJB 2FJEB 3H90A 1QVFR 3VWSA 4C48A 3HFVA 1KH5A 1TL1B 1RSCA 1FKPA 3IXQA 4RKUC 3SV3A 3QLHA 4O3QA 2VH7A 3AD8C 2AYEA 2XY6A 2FZKB 4PXEA 4B3RF 4LIRA 4ZVQB 4HTIA 1FWLA 2XS2A 2E29A 2EBEA 4Y65A 4CYUB 4MMOA 2ZH8A 1PSDA 2NS1B 4LSNA 2YWEA 4DV6J 3E3XA 3NEKA 4EYIB 1KHLA 4QU7A 3J80U 2ROEA 1YJ9S 4DXLA 2XHCA 4BWJA 3PJWA 2V50A 4UPLA 3KK1B 2ZHAA 2AEJA 3NP5A 5E5NA 4NA2A 2DYAA 4NZ0A 4DX6A 2MPUA 3HHDA 1VK8A 2B6AA 3G8QA 3CC7S 3ITHB 3IS9A 1SUQA 2R8GA 3NAIA 4Q43A 2F40A 2JC1A 2HFOA 4QWBA 3MEEB 2KXFA 2AU0A 4P52A 2R4FA 3I9ZA 2AGPA 2ZOGA 4TU9A 2H51B 4AXIA 3TI0A 3I4PA 3A4TA 1CVJA 1R8CA 3NNHA 2CZ9A 3MCNA 3UR0A 1R6YA 3CJKA 2YXLA 4EU0A 1KH9A 1FXLA 2YKMA 3KG0A 1KQFB 1WC1A 5J2NA 4NLDA 4A48A 1X8DA 1B99A 4FPRA 2PFDA 5E3QA 4ZPBA 1X7VA 1UFLA 2PI5A 2VQRA 2K7KA 3MD1A 2OPPB 3BGRA 4OHVA 2HYIB 1N34J 3OTDA 1L3VA 1OS5A 2V8PA 4J9KA 4X64F 4AYBD 4RNNA 3X1LB 2B4PA 1W2BR 1S7IA 4DCOB 1PGZA 4LBPA 2YWFA 3MEKA 3NGSA 3G86A 3LGHA 5AE1A 1Y0HA 1YJNS 5BYQA 1I6JA 4DV7F 3NKNA 2HFSA 4E0DA 4U67Q 3PW0A 1T9TA 2XMVA 2V69A 3MPVA 1ITPA 4NI2A 2Z30B 1CC7A 1GFWB 1MWZA 2WVEA 5IWAJ 3H5SA 1LK5A 5KFSA 1GH8A 4ANDA 1P49A 2VUGA 1SV5B 1TKZA 4PUOB 2HAFA 4P9SA 3IN5A 3IGYB 2LXUA 4WE1B 1ICEB 1BGXT 2IFXA 3CDBA 3W8GA 4RW9A 3GWCA 2JEGA 2YY3A 3TVKA 3DLEB 7FD1A 4WFBQ 4F2RA 4I64A 3KNAA 3FKBA 4B9LA 2MSTA 4ID5B 4OLOA 1F0XA 3MR3A 2G9OA 1R89A 4NYZA 3DPCA 3BDEA 3ZZZA 2DXFA 2I8EA 4UQGA 1NHUA 2GMJA 1T3OA 3UVJA 4OYXA 1CJVB 4RW8B 1X4EA 4DV5J 1MNEA 2HVHA 1YHQS 2IHR1 3D6MB 3QBCA 5F9LA 1LWFB 2AP6A 3LW5C 1WHWA 3DLJA 4CLPA 3P5TL 4LVNP 2HQFA 2GCFA 3FC9A 2F65A 3V2UC 3CJ2A 1U24A 1UVNA 3WIVA 5HVHA 1D9DA 2VONA 1XQIA 1KH7A 1YZ6A 4U6PA 4OFZA 1JLFB 3DKDA 4QYZJ 4CLLA 4J7CA 2W9AA 5C5JA 4IOBA 2XC9A 2Z0GA 3OSPA 4IR1A 1PYSB 3HSJA 2IY5B 3R97A 1VQ7S 4HHUA 2HHSA 5LJ3Y 4Y34A 3EZOA 1C0TB 2ZNZA 2I0XA 4IH6A 3BZQA 3SQGB 3GV8B 1T05A 4EBCA 4RO0A 2WK4A 3CO0P 4TY9A 2W4CA 2HGNA 3N5FA 3NCPA 2HZAA 5KG0A 2BJDA 4CXKA 2MYFA 4DS5A 1RZMA 4B3MF 3W9HA 1WG4A 3AB2B 1HR0F 1FESA 3GYXB 4ZN1A 4CT9A 2YX1A 1S79A 3NKMA 3D6HB 1RT3B 2KT5A 4OQJA 3HSDA 4DPWA 4OLPA 2ZUAA 4O3SA 5F8MA 3LOUA 4DX5A 2ACYA 2ZKTA 2W01A 2B5JB 1VLOA 2QFJA 3LPYA 3PZPA 5AJ3F 2L41A 1TKTB 2V0NA 3BGFA 3H42A 4LRFA 5EN1A 2ALZA 2I5JB 4O44B 2AZ3A 2CG8A 4NRTA 5HO4A 2IM2A 1KLNA 2G4BA 3CMQA 5GAGI 1I94J 5KFJA 3AFGA 2IJFA 1OSCA 1TL1A 3BSCA 2ZM6F 4MK7A 2VB6A 4BBYA 3PX4A 3H59A 2HVIA 2FJDB 3QPIA 2X3DA 1VJWA 3HMJG 5HP1B 5AJ9A 2ZBPA 3BDGB 2EI5A 1I5OB 1RHQB 3Q8QB 2FPHX 2QC3A 4DL2A 1YG0A 3BYRA 2N7CA 2GHVC 5THWA 1LKZA 2CZ4A 4NA3A 2W5RA 1W2IA 1J27A 1GEHA 4EMDA 4HI2A 1E6YB 2BW2A 3BH7B 1U2FA 1G1XA 4LVOP 4CYUA 3FBEA 2F9JA 3M9OB 1WTFA 2H5JB 2UUTA 4NRUA 1HHSA 2BOAA 4DUTA 2YWWA 4B02A 4U7CA 3MF5A 2L48A 1B7FA 2AJFE 2EEYA 4TN0A 3ADAC 1Q1KA 1AB8A 2XTJP 3KK1A 3IRXB 4H4KC 3DRSB 3W7BA 2K3IA 3ITHA 2HIYA 3DXBA 4DR1F 2RU3A 3O44A 3K5PA 1ACMB 1N36F 2H9ZA 1REVA 3CMES 1FO1A 4B3RJ 3MEEA 5LRNA 1TL4A 3I56S 5MAOA 4PYDA 4NCGB 4PXBA 3QJJA 3CPWR 1AJDA 4CO2A 4C7QA 1QUVA 1Y5LB 4ES1A 2UZAA 3SCKE 4OYOA 4WTOB 2W7PA 4CXUA 1U1NA 1NK5A 2DNHA 1X4HA 3HKWA 4K2XA 1FK9B 3DC2A 1LW2B 2CPXA 1DAXA 2AW0A 4CM2A 1OO0B 4EEYA 1BMQB 1S0OA 2ZHOA 3B8HA 5EHHA 4WU3A 1RWMB 2QL7B 2OPPA 4ED7A 2OSRA 1YVFA 3WAVA 2DK2A 2YQ3A 3BB5A 4MIAA 4PWWA 3KJQB 3MK1A 2ASLA 3BF4A 4ZPVR 2DGVA 2OAUA 1BY9A 5CAAA 1LW0A 4HHJA 2BJEA 2V8GA 3L9ZA 4TVAB 3KLGB 1KD1T 1JJ4A 3RUBL 2E5LF 2KZMA 5KFUA 1ELXA 4BLGA 1WHVA 1FX2A 4C4WA 4L75A 4LF8F 1XEZA 4DFJA 3KDOA 2FC8A 4CO5A 2Q66A 4CI0B 3PW5A 3MM5B 3QAEA 3S01A 2XHWA 4QIWD 1S72S 3GYGA 2MKKA 1SV5A 1UMJA 1FERA 3CJ0A 4WJBA 4PUOA 1S6PB 2YKQA 5ITHA 3CD0A 2IFYA 1QM9A 4WE1A 3A3OB 1CLFA 3L09A 4C0HA 3BKUA 2J9DA 3DLEA 2QZUA 4DN0A 3OPKA 3GJQB 4AXJA 1JLBB 2AEFA 4X64J 4OZ3A 3FEZA 4ID5A 4KKOB 3K5OA 3BQ0A 4NYPA 1VRTA 4KGXB 1VC5A 1H7XA 1IJEB 1D9AA 5KG6A 4DV7J 3KK3B 5JJBA 2HIQA 1CJVA 5DG9A 5BJRA 2EXUA 4DSIA 4TN2A 2CJAA 1LWFA 1N5QA 2BE2B 3DFEA 4USVA 2CKWA 4JI2F 3PG9A 2J7UA 3Q8YA 3M8QB 2XS5A 2YTCA 2V68A 1O98A 2IA6A 1WEZA 3CWJA 4EYHB 2HHHF 1JLFA 1JJ2R 2CWXA 3DRXA 3I87A 3W8PA 2JEFA 3WBZA 2RT3A 5DS7A 2XLKA 4LF6F 4KJIA 5EGEA 1CQNA 4ELUA 1NUEA 2DPIA 3GCWP 1L3UA 3AH6A 4Y2CA 1C0TA 2BDPA 3TAPA 4IOAQ 5M2RA 3SQGA 1K8AT 5DDRC 1CS4B 1IKWB 3PKYA 1UVIA 3W62A 2KHDA 2XCAA 2E1MC 2NREA 2NYIA 4AQYF 4LSLA 3KJNB 5EUHA 4P2XA 1NCLA 4DQQA 2MJNA 4UUXA 3Q2SC 1HLWA 4KAVA 2CIMA 4QOTA 4F02A 4AUKA 3G96A 3TZZA 1F9FA 5IC4B 3TA2A 4CP5A 2BXJA 3O8WA 4NEYA 3CMRA 4F0MA 1KEKA 1KLMB 1S9GB 3PYGA 1UZHA 2B5JA 5BYRA 1CC8A 1GXUA 3R1HA 1TKTA 2IUCB 1X31C 5BR8F 2I5JA 3VAIA 3TG0A 1R8BA 4R0JA 2D1GA 5FDLA 2DR8A 2DGXA 2LQ8A 1FKOB 4J9VA 5F8NA 4A8XA 1B0VA 2XO7A 3MPUB 5H1SV 4C9DA 2AD9A 1HHTP 2ZZMA 4K4YA 4HL9A 2OPQA 3BSNA 3RZAA 1SXLA 4KM4A 3MPYA 1ZYQA 5HP1A 3FCWA 1XMOF 1KNZA 4WF9Q 4B3MJ 1HR0J 4RZRA 3NBPB 4X4OA 3P49B 1NSKL 3CJ5A 4NMLA 1JNZB 2I9SA 3OTBA 5KXAA 4UF4A 5KFFA 3HLUA 5KG2A 2Z2LA 3D3BJ 2XSFA 1E3CP 3A8KA 2CVEA 1DRZA 1GMWA 1U4BA 2HQGA 3DOMB 2ZE2B 5AJ3J 1KP6A 4CCHA 2I38A 3C14B 2GA3A 3DRRB 4FPIA 2AGOA 3CCSS 3PM9A 4DS4A 5K20B 1UEVA 2ERRA 2HRYA 1N52B 3ZXWA 2ZM6J 4Q0BB 4F4XA 4WIIA 1S12A 1FDDA 3VAHA 1T7PA 5F9NA 1AA1B 1WC5A 1NB2A 3IRXA 3KK2B 4Y2MA 2KT2A 5KFNA 3DRSA 2VG6B 1NNDA 4I69A 4QYRA 1GAOA 4BDPA 2MJUA 3M32B 1CSJA 2UVVA 5IT0A 1RBOB 2JVOA 2HHVA 3CCMS 2FVSA 2NPFA 1VQYA 4RUHA 3Q0AA 1V9OA 2MY8A 4I6WA 2PIIA 3P4UB 4YHHF 3M2VA 5L38A 2PD1A 2AV5A 3MM9B 2FHMA 2VPWB 1BQXA 2MHEA 3NG8A 2QGFB 3I31A 1FEHA 3TOQA 2JDJA 2CPYA 2H4WB 2ZBCA 1RUSA 3MUVP 5D0EA 2ZH5A 1D09B 4JI1F 3W61A 1KHVA 2QE5A 3HHKA 3KLHA 1FK9A 1YSJA 4N8NA 4J90A 1NK6A 4ZIWA 2ZH9A 4Q2LA 3RTVA 1KFDA 1BWEA 4I68A 3K8VA 4P72A 1VBYA 2DNYA 3PEHA 3R7BB 2ZOFA 2HBRB 4WIQA 1RT4B 1S59A 2WW8A 1N36J 3OBIA 5ETQA 5JVHQ 1SL2A 3HKZD 3J7AN 1JLEB 4WBFA 1ZM9A 3PYFA 4HI1A 4TYAA 1BD6A 1NXIA 1O8BA 5DDQC 1FRMA 2XO6A 2D74B 5L1KA 3RRKA 4CLFA 3BN7A 1K9MT 3KLGA 4DUYJ 5B08A 3RBZA 4KFBB 4DDFA 5IZHA 1VRQC 2ZBRA 3M6VA 1FKAF 2EG2A 4CIOA 1SHQA 1KS2A 4NWJA 3W2WB 5KT6A 1IQTA 2PC6A 4ZMMA 1VQ8S 4DOZA 3T5JA 2X3GA 5KFLA 5GAHU 4PWDA 2ROPA 1S6PA 3PY8A 4BCAA 3PX0A 2VBZA 3U7JA 2V9KA 4Y2IA 2VFVA 4RUAA 4IOCQ 2OMLA 1HWLA 4Z7YA 4XPEA 4U7UD 3JYTB 3F0NA 4M5IA 2EFGA 1JLBA 2RF2A 3G87A 1XMQF 3M8WA 4CXSA 4PQAA 3AOBA 4KKOA 1KVIA 4PG7A 2CNOB 3NMRA 2G0JA 3A52A 4I2PA 1S10A 1EARA 5DQIA 3MAHA 3KK3A 3MAAB 2HNZB 2E5LJ 2KU7A 3BGOP 5AXLA 2NLWA 1UWBA 1R7IA 1MN9A 4LF8J 2BE2A 1BXNA 3AT1B 2FIUA 3SEOA 3HHLD 4NZ6A 4NX9A 2C2EA 3ILLA 1N48A 2M8DB 4KT0C 2DH7A 2NCKL 3M8QA 3CC2S 2A0FB 1JMTA 3CJSA 3P6YC 2J8AA 2FHKA 3FNNA 2HPUA 1VISA 2DO0A 4M5KA 2C3YA 2Q79A 1TVRA 3G2XA 3NGTA 1RT2B 2HBQB 2Y8WA 4EGLA 1VCTA 4WXWA 4ATNA 4G1IA 2F3JA 3EPGA 5HBMB 1YJRA 1EQ0A 1CS4A 1IKWA 1DLOB 4L73A 4Y00A 2NZ4A 2HWIA 2AZ1A 3M2UA 4B17A 3A3NB 1TV6A 3G9CA 3HSZA 1K1QA 3BPSP 3NOGA 2W8KA 2YNHB 3M4XA 1KTQA 5IS2A 3FVYA 2ZITA 1BLUA 4JI2J 1XC9A 4ZLLA 2FC9A 5A8WB 1JNRB 1KVKA 3IR5B 4OYAA 2HHHJ 3SSRA 2IUCA 3LAKA 3T19A 5KFYA 3UQSA 2MKIA 3CVKA 4NLUA 4LF6J 2OMOA 1FDAA 2A3JA 2MDAA 1TL7B 3CTRA 3LH2S 3QO9B 2QFIA 1FKOA 1EQMA 3TP2A 2M9KA 3H2LA 3GSIA 4ZGAA 1RABB 3QFWA 1CJTB 4AQYJ 4NYOA 2XG8A 4XDCA 1U1OA 4DQSA 3NBPA 2FHJA 1AROP 5ETMA 3QT7A 3R8YA 2H3EB 4F67A 2IMOA 3CJTA 1T9YA 4H54A 4OJ1A 3IWNC 3BBFA 2H48B 3L7UA 2G9YA 4KJGA 4WWSA 3PDNA 2RILA 4B9VA 1E2SP 3DOMA 4QWCA 2ZE2A 3C14A 3DRRA 1I1GA 5BR8J 2CPHA 2KG0A 3QGGA 3B78A 2JEJA 4YB7A 2HWHA 3KNGA 4URQU 1N88A 4NLVA 3LTOA 3MR2A 2MZ1A 3Q22A 3OTCA 1SC1B 3E01B 4Q0BA 5IOLA 2LXIA 2BQ3A 5TJ3A 3KK2A 2VG6A 3FJ2A 4C8MA 1XMOJ 1Q7YT 2WSFC 3KHLA 2WAQD 5H9FK 1QTNB 5GVQA 1VMBA 3HT0A 4ZCKA 4RUBA 4C3MA 3K89A 4RNMA 3TAQA 4ZVEA 4HACB 1D8YA 3CCTA 1ED8A 1B0TA 3W2VB 1QLNA 3J7ZT 5ETVA 4A8MP 2YKAA 3MM9A 1SKRA 5KTQA 2QN6B 3NKQA 5E3AA 4ZP8A 2UVWA 4U7UK 4NASA 5HN0A 1HQUB 4CLWA 2ZDPA 5IQ6A 4PQUA 3LALA 3E51A 4C11A 2XMUA 1Q95G 2AJ4A 2DO4A 3POTB 4FKXA 4E2FB 4EBDA 3HF5A 1N2LA 2ZH2A 3SZZA 1XR5A 2W2PP 1GMUA 1PBAA 1PCAA 1Q7LB 2W24A 2C3PA 1U2RA 3HHNB 1QY7A 4ZCLA 3H25A 2FJXA 2C2ZB 1ZS6A 2GFFA 1Y3JA 4XAKA 3D6TB 1H2TZ 4QWDA 1RT4A 2YX4A 2WB4A 4G1PA 2OSQA 5LXRA 1UAWA 4JBCA 5LIAA 1C4AA 1JLEA 2C1EB 4YHHJ 3KUGA 2JNJA 2KZZA 3MFIA 4URSA 3VQTA 5IJQA 2KH9A 2GZOA 5C66A 2CNNB 2PMWA 1GXTA 1C1BB 4LF5F 2RHSB 4ZIVA 1GX6A 4JI1J 1BUXA 1RBLA 1M1HA 1BHNA 1M90T 4ED1A 1AFIA 3M30A 2XM3A 4UY85 4ED2A 3D0GE 2KJWA 2BJ9A 4FXVA 1KN6A 5E41A 3MOJB 3SDEB 1X0FA 1G4CA 2KT3A 2OH2A 1KHKA 1VQOS 3JYTA 4F26A 1IKVB 3CEDA 2WHOA 1RU2A 1HJKA 1SQEA 2XY5A 1UKUA 3S1TA 2RAQA 1Q8BA 2DH8A 1IXKA 2UV8A 3DOLB 3D0HE 4QW8A 2J0SD 1MSWD 2RS2A 5LL6d 4DFMA 3D67A 1S1WB 4JOUA 3MAAA 2GHWA 3UDLA 2MTLA 4YB5A 3IA0A 2BA9A 1FCAA 1RU1A 3A3PB 2F8HA 2DGWA 3MD3A 5D4PA 3ISND 4LR7A 1HW9A 2Q3PA 3BS9A 2EFOA 4A8WA 3DDKA 3I4HX 3N01A 5D77A 5GAHI 2VL1A 1SL1A 4J9OA 4BC9A 2IAJB 1TKDA 2EFQA 2CPJA 2O66A 1RT2A 2GNKA 1YQHA 4USHA 1XMQJ 3MDFA 5HBMA 1FD2A 5CABA 2OKQA 1DLOA 3WAXA 1RHKB 1OPZA 2V2VA 2BQUA 4PRFA 3EUNA 5HK4A 1TUWA 3F56A 4PPDA 1N2KA 3EXYA 2MLYA 3HPOA 4IG3B 2A6MA 4CLZA 3PIOQ 3ICLA 1RQ0A 5J2MB 4IRKA 2KFYA 5M2PA 4WKRA 3HHLC 4DR6F 2K1RB 5AE2A 4CM0A 1XK8A 1ZZFA 4L72B 3JQKA 1KDNA 2BM0A 2KYZA 3AAWB 3RB6A 1IN0A 2CQ0A 4USKA 1XR6A 4DPUA 3CIZA 1TL7A 5L1IA 2ZWPA 1HKAA 3KMQA 2V4JB 3QO9A 3WDOA 4IDKB 1QSSA 5ETPA 4USWA 2LEAA 1LXNA 2D41A 2RHQB 1KBRA 2KRBA 3VVTA 4EO8A 2C42A 2HFZA 1CJTA 3GFXA 1XNQF 4ED0A 2LXFA 1VRUB 2QZ8A 2ATLA 5H9EK 4N41A 1EX8A 2RS8A 2XLJA 4A8FA 3D0IE 3E2EA 4OL8A 4CH7A 2D69A 2UUAF 4C0BA 3W9IA 3H0PA 4GTZA 1OYEA 2VDIA 2OFHX 4N47A 1DQAA 4JV5F 1P9YA 3ILJA 3GSDA 4UOCA 1S97A 5L9NA 2OI2A 1U1PA 1RHMB 5JUMA 1HNWF 5ADZA 1XMBA 3KJVB 1BQNB 3E01A 1F1BB 2BZ2A 4CRJA 3TX0A 3D6FB 2DHXA 2VOOA 4LQYA 2AJ1A 1AZSB 3OHBA 3K5MA 2OHDA 1G3OA 2HHQA 1U0HB 3BKTA 3MECA 3KMSA 2JX2A 4DZDA 1TK5A 3UNYA 5ETLA 3IFEA 4RBVA 1LWCB 4HACA 2AWZA 2A18A 3FMWA 1S1UB 1Q8LA 4ALZA 3W5YA 3Q8RB 2HFVA 1U8SA 2VC0A 2R42A 1TMMA 3D2WA 2YPYA 2R7RA 3TQEA 3AD9C 5F3TA 2OPRB 2HBZB 1N4LA 2ZD1B 4LRAA 4NL5A 3TVZA 4MT1A 3GZ7A 1HQUA 2X1FA 3JQMA 1IR0A 4U8YA 3JSRA 5HVFA 1HNZF 1RTDB 1Y9OA 1TK0A 5KG5A 3DCAA 2H54B 3HD1A 2WVFA 2R7SA 4KGZB 3LP1A 2E66A 2ILZA 1WD6A 5ETSA 1E1ZP 3H2VE 2HQDA 3P3DA 2RU9A 2B4OA 3H5XA 1N33F 4TY8B 1FI4A 2L08A 4N76A 4RW7B 5L1JA 1WEYA 3SZ2A 1JB0C 4LIWA 1Q82T 2VKZG 2CAJA 2PT0A 3GJSB 5DJBA 1FX4A 3MMCB 4ITSA 2W2NP 3M6UA 5KFBA 1UETA 3CSKA 4K8RA 2DXEA 2IM3A 4QU6A 1F2GA 1C1BA 1I51B 4C2MA 2GIFA 2HURA 2KG1A 3QZ8A 3BGLA 3IBWA 1F5BA 2M88A 4QWEA 3CC4S 1OQ6A 2IDLA 2DD8S 5BYSA 1DBDA 4LMZA 3WC2A 4W90B 3TJAA 1CBKA 2Q6CA 2OELA 3W66A 4GVBB 1HI0P 2GLQA 4IUFA 1LWXA 4DV2F 1HQAA 2QYCA 4OZ0A 1EETB 1FTRA 4EBEA 5CQGA 4B3OB 3V6HA 1R6VA 2XB2D 1CJUB 2ROGA 3DU6A 1WF2A 4M95A 2LDYA 2A1BA 4KE5A 3BO4A 5CYMB 1VHIA 1VGYA 4LF5J 4WU2A 4X4NA 3IG1B 1WORA 1H2VZ 3C15B 4QR0A 4WYLA 3ET6B 2CJ9A 5I42B 5D3GA 3QRRA 5IXUA 2DNZA 1PG5B 2M8HA 2Z56B 1SJ1A 2Q1LA 1AJAA 3NRBA 2DJWA 2IAJA 3R1LA 4DV4F 1RBAA 4ZPTR 4F8RA 3Q24A 2YWGA 3M1VB 1LK7A 1NPRA 4OYWA 4GO5X 4RL1A 4UORA 2K06A 3ZTSA 5JMNA 3RBXA 3CCLS 4UQTA 5ETOA 3UR3C 2EG1A 4K59A 2CYYA 2GAHC 1FNXH 5GMDA 2YWHA 4ZP7A 2HFUA 5L1LA 2F1FA 4CTAB 1RLCL 2IDEA 4F0KA 4IG3A 4JI3F 3OJUA 4LFBF 1XN9A 2KXNB 5J2MA 2BV3A 5HRTA 1DQ8A 1Q5VA 2K1RA 2C2MB 4ZDNA 4DWIA 1RTJB 1FJGF 1NJWA 1SBRA 1BWVA 2OEJA 1OWXA 2JLGA 5A8RB 4PR6A 2MEWA 4RBUA 5IV4A 2V4JA 1FVQA 1FE4A 3MK2A 4MHXA 2NSCA 3KWMA 1FWPA 4ZPWR 4LF4F 3BPDA 5F41A 4DL5A 4DSLA 4FF1A 2WTFA 1VRUA 1D8ZA 2QLJB 1VI7A 4L76A 3HM9A 4C97A 4DSJA 3T5LA 2HS3A 4F25A 4DV6F 4LF7F 2LQBA 4FYDA 2H5EA 1P6TA 5CHCB 4DR6J 3FSYA 2ZVSA 1NSPA 3JQJA 2ASDA 2MLXA 1O5JA 4RUCA 1URNA 3AY0A 4ZG6A 1FKPB 1FD8A 2J7WA 3MR5A 2WSCC 4F4KA 2LLZA 3V4MA 4QIFA 4CO4A 3HZEA 5DGBA 4I1TA 2QV6A 1VOMA 4J9UE 1N56A 1Y7PA 1K0TA 1KFSA 1BQNA 1W25A 2EVZA 1MLAA 4NEZA 1SJ4P 3ZZ0A 3GQCA 1AZSA 1XNQJ 4DR7F 5KFEA 2ZJRQ 3OL7A 4M5DB 2HK3A 5KT3A 2CPZA 1RKJA 1HARA 2BANB 2O67A 4J9PA 4KPYA 2QLXA 2W4PA 4FBUA 4YDDB 4Q7AA 4LQ9A 1OYDA 2UVRA 2FQQB 3L4BC 2EPIA 3PCOB 2UUAJ 1S1UA 2BJ7A 2QIFA 2PN6A 5DQHA 4ERDA 2P6SA 3ZZUA 3HVTB 2VV5A 2ZKUA 4JV5J 1EHWA 2OPRA 5HMXA 5L0EA 2B9YA 2WCXA 1F5AA 1YTYA 1SUQB 3QGHA 3D1QA 1RAIB 3SFGA 3WAWA 1SC4B 4EWTA 1U8WA 1RTDA 4WZQA 4WFYA 2AEMA 4KGMA 3GCXP 4GTXA 2C2DA 1AFJA 3MM8B 5K4PA 2XS7A 3ENAA 4ED4A 3K0JA 2ZDOA 4O3OA 2ZEJA 2GS8A 1URAA 1T95A 2CZVC 1ANJA 2QMXA 4LF1A 3VAKA 3ILIA 4TY8A 3BN4A 4QYZK 2MKSA 4RW7A 3IR6B 2MKJA 1HFEL 3MMCA 2CNLB 3NVLA 2R8KA 2B4UA 1YRTA 4PXCA 1NPPA 3BGRB 1WWHA 3AQOA 3DU5A 1F60B 1XBWA 2HNYB 5T41A 1HNZJ 1UFKA 1RT7A 1HA1A 1VIOA 2F5GA 2DHHA 3FQKA 3EVWA 2BJ3A 2HHUA 4USTA 4OI3A 5LSLA 1ALHA 2JC0A 3LWLA 2CVIA 4GVBA 4DX7A 1WJ9A 2PSZA 5A6PA 3T02A 1N33J 4C0OC 4DL4A 2VFSA 1RT6B 2C3MA 5DM7Q 3UDVA 4B3OA 2VASA 5KOWA 1CJUA 1Y11A 2IVFB 3Q8SB 4QR1A 4Q2MA 1TZ0A 3CCQS 2Y1JA 2X1GA 2CQ3A 4YOEA 3C6UB 3TUIC 4C6AA 1UVMA 2M2BA 3GTYX 1NK8A 5CYMA 4MY4A 3EGZA 3IG1A 1U47A 4RW9B 2E1CA 4UPHA 3LA0A 5I42A 4ZPCA 3FEXB 2EFVA 1MWYA 5IFMA 4P71A 1TAUA 4LBHA 2KB2A 1P8GA 3SZYA 1APSA 3PACA 1FJEB 5EWEA 5SZTA 2C22A 5KFMA 2ACMA 4USMA 2GJIA 2BM1A 3KLEB 4L3NA 2AX0A 2CNKB 2BUNA 2J0XA 2ANHA 5HJYA 3M1VA 2NXCA 1FRHA 3TEGA 3U1MA 4DV2J 3MMJA 2ZH4A 2VDHA 2CQBA 2EW9A 1UWAA 2R7WA 4N8OA 1LNQA 4OHZA 2DR7A 4ANEA 3D7SB 4RX6A 3R5JB 2WOMB 3DGPB 5GADI 4DPOA 1ZOTA 3EJMA 2XLIA 4X4UA 4QAXA 4ETXA 3VZHA 3JTNA 2LDIA 1Q81T 1QD1A 4PG5A 3EGWB 1VC0A 1YWXA 3QJLA 2R7UA 3IBCB 2DB1A 4AT1B 3GLJA 2IYIA 3VGVA 2MQMA 1VLYA 2QL5B 5LT5A 4DV4J 5A8RA 1ELYA 1BE4A 2RQMA 3ONQA 3W1YC 5DDPC 5KFPA 4CZCA 2MQQA 2DRAA 1V3SA 3CGIA 3I32A 3UD3P 3Q83A 2V4QA 3KLIB 3NS6A 4DFPA 2BEFA 4BS2A 1SKSA 4JI7F 3Q8UA 1CEZA 2VD3A 3BR9A 4DPYA 2IRXA 5A6WA 4DI6A 1F6TA 3D1HA 3HHLB 2QA4G 4JI3J 4BC7A 4LFBJ 1S4FA 4XIUA 1RAEB 4K4UA 3HP6A 1TL3A 1K7HA 3S7RA 2W5TA 4UUWA 3JSMB 1TL5A 1QAYA 1QDUB 1ALKA 3CCRS 4DF8A 5KFKA 1FJGJ 2V2ZA 1IVZA 2AF6A 5KFZA 3C2PA 4UOGA 2ASJA 1LOUA 2LVWA 1U1LA 3BKFA 3UI3A 2RQ4A 1R0AB 2J9CA 2YQ1A 1RWOB 3BV8A 4DR4F 2E5IA 1ROFA 2DY1A 4LF4J 3BQ2A 3MR7A 3Q3QA 2DBBA 2VA2A 1TUVA 2V67A 1YRXA 3W63A 4OI4A 4M5DA 2J0QD 4F2SA 2BANA 2DR6A 1RAJA 3WIUA 4LF7J 4IRCA 3EDQB 1KSPA 2Z8QA 2B7BB 2IRUA 1VQKS 5F3ZA 3Q2TC 3PYDA 3HVTA 2VPZB 2RSQA 3AODA 1NM2A 1LFPA 3IGZB 2OD4A 2IVYA 1TFYA 1HW8A 1EW2A 1V6HA 4ZHRB 3JB9k 3AD7C 1HL6A 2ILYA 5T14A 3RBEA 1WKJA 1REVB 2QEXS 2W8DA 1M5VC 1FFGB 3MM8A 1WSVA 1EI6A 2H1YA 3MPDA 4DR7J 2G2OA 2B3TB 3NWRA 3OT9A 2N3LA 4DPTA 2UP1A 4ZG7A 2R7OA 2XY7A 1Q78A 1UCNA 1SB6A 2AJ0A 5SUHA 5B0EA 3LPEA 1JKHB 4ZPDA 3EWGA 4OX8A 1PIEA 4DLEA 1YKWA 1HDHA 2KRRA 3RB3A 3CIMA 4B3TF 2RNEA 2QO3A 1B64A 3I55S 6FDRA 1IBLJ 2UXCF 2DHSA 2MKHA 3U1NA 4PXDA 1NPKA 3ZZRA 2B9WA 2R9LA 1M1GA 1EQJA 3MPWA 4OI0A 4ZCMA 3ZZOA 4FXDA 4ZVUB 5E33A 3J7YI 2HNYA 3L7PA 1M5HA 4MIWA 1HWKA 2MKYA 4K4ZA 2W9BB 4IRDA 1RCXB 2DXDA 2G0IA 4IYQA 4GC6A 3Q23A 3EDRB 1LW0B 1C1CB 1SJRA 3FRYA 3MTJA 1OIAA 2H65B 1S0NA 2VF3A 3DOKB 5LQQA 4JB8B 1YZ7A 3M05A 4TLRA 5HQ8A 4OJ3A 4DU8A 4DV0F 1RT6A 4RW6A 3EVOA 1JJCB 4B3SF 1X4FA 2EBGA 4Q8EA 5IC6B 1SVDA 1LV5A 2DGQA 4X65F 2V8HA 2WRMA 3T1HF 2WB1D 4M5MA 3KUHA 2BVZA 3C6UA 1S48A 1WNEA 2KDOA 2FJVA 3M9MB 2HFNA 1NO8A 2DEJA 5KFVA 1C0UB 2QTWA 4Q5VA 5LMNF 4JUZA 2CA9A 1U02A 3T00A 4F3MA 4NOHA 1W7WA 2NYHA 3TW0A 1G2EA 1U1QA 4X66F 4RNHA 3VAMA 1YK9A 2W8LA 1HMVB 1VRTB 1H0HB 4LR8A 2FJAB 3KLEA 4JI4F 2RKIB 4W98A 3EGVA 1M5KC 3W3SA 3EZ5A 1WKLA 2P5VA 3LQVA 2VICA 2J9DE 1B7YB 2XMMA 4F7VA 2YWKA 1P9QC 3R2CJ 2XR9A 1J2VA 3ZTPA 1PJ7A 1MN7A 5L46A 2WOMA 3DGPA 4ICLB 3QJPA 3EZUA 4LFAF 2LP4A 2RQKA 2CDRB 4IO1A 3DGVA 3UD5A 1B0PA 4O23A 4UW2A 1UP1A 5ETTA 1VQLS 4ZG9A 4UZBA 4YN3B 3VZIA 4QBUA 4B9UA 3VAGA 5D0HA 3K17A 3MCSA 4TQSA 4DLGA 2CPDA 4WTYA 1DHMA 1DURA 1P1LA 4LSLB 4X4VA 2RMLA 4ZLNA 5LSOA 3HFKA 2WSEC 2W5VA 2HMIB 3CD5A 4GTWA 4GRSA 3QT8A 2GA7A 2PO4A 1N0VC 4OZ2A 4ZKAA 3KLIA 2F7VA 3LF0A 2Y0BB 2BOPA 5K5MA 2Z58B 2MQ8A 4K4XA 5HMWA 1Q79A 3FRZA 3TWZA 3BYPA 2OJ3A 4UOOA 3HD2A 4NZ7A 3SSSA 4CO1A 1HBOB 3MUMP 1FRKA 2UUBF 1N5VA 3HHLA 4V19J 5FDLB 3IO1A 3MEDB 4WXOA 5KFQA 4ZK7M 4IKAA 2ZZNA 4KTQA 3DM2B 3QGIA 2VFUA 3JSMA 1SJ3P 3MGJA 3N4WA 4IH7A 3GIIA 2IA0A 3QGPA 4DHVA 2OPQB 2KO1A 5CA5A 2OTJS 3OVBA 2KN4A 1KKHA 1U2CA 5HVGA 4DQPA 2YNIA 2BE9B 2VJVA 3DHWC 5E3RA 1RWWB 1R0AA 4B08A 5AXKA 2YNFB 3R2DJ 2JLEA 2FZGB 2HVDA 1WOOA 2SXLA 2WBMA 3DLGB 1RP5A 2J5AA 3W65A 2IJRA 3P96A 1FJCA 4JI7J 1M1KT 3BO3A 3TQ1A 1NK4A 3FBFA 1YLXA 4ECZA 1CULB 4ZVFA 5KFDA 2P6TA 3UE2A 3QWPA 1MU2B 1NDPA 3HCXA 2F4FA 3IMQJ 2DGTA 5KG4A 1ZETA 1FVSA 4OHWA 2VC1A 3RR8A 3M8RA 2CJBA 3K5NA 5CXTA 4LJMA 4OYIA 3N6LA 4E8UA 4CYRA 4P6QA 4MFBB 4AFFA 3UD4P 4ZVRB 2IBOA 4DJBA 3PHTA 1LFWA 5FD1A 4WFZA 3X3UA 4ZHRA 4IO9Q 2Z4PA 4DR4J 2GIRA 2NXJA 2O5DA 3QIDA 1EW8A 1N8RT 3E2DA 2CXEA 3H5UA 4A8QA 1RB0A 4C8YA 4ECVA 4ECTA 1KQSR 1ZEDA 4B56A 1S7HA 3T9ZA 5B0BA 4K4SA 2F4VJ 3VAJA 4K5RA 3PKMA 3MM6B 3M2VB 3GPAA 1JKHA 2UUCF 4DUYF 3RB0A 3MAQA 1UA0A 5EGHA 4MK8A 5CD4H 3PEJA 3DYCA 1YBTA 4FP9A 4CH1A 1FDNA 3KLHB 3CDUA 2ZJQQ 9RUBA 1ZTWA 2CADA 3H40A 3THVA 4QW9A 5DM6Q 1KC8T 3BDPA 1U49A 3NNAA 5HL7Q 1JLAB 4U8VA 1XWLA 1Y5NB 2CQHA 2XZDB 4YS2A 2YH0A 1FXRA 1YDLA 1LXJA 1Q8KA 2DGUA 5F8IA 3SBMA 1XR7A 3T1AA 2W9BA 6AT1B 2HZVA 1PAEX 1UEUA 3ILOA 4NXMF 1TKXB 4MKAA 2C2KB 1C2PA 3DXSX 2UU9F 5I3UA 5A8KA 3IRWP 1Y5IB 1C1CA 4JYAF 3VR1A 3HJFA 1S49A 3FSXA 2EKYA 1SJQA 2GMLA 3G6ES 3I0RA 3DOKA 3FZ2A 4FYWB 5DO2A 4F36A 4CYSA 4ILMA 2PMZD 4I2QA 1GTEA 4EUVA 2DNLA 1X60A 4QIGA 4B3TJ 3V4IA 4AL5A 5J2PB 3OUYB 4PWDB 3NNCA 2UXCJ 3B6BA 4GO7X 3DDNA 2HGLA 4QZVB 3CUNA 2PE8A 3DRPA 3DI6A 1RDRA 5C2GA 3TARA 5CZXA 1NHVA 5KAKA 1C0UA 3MURP 3V81B 2QJ3A 4GMKA 1QUPA 1VQ6S 2RF2B 5GOVA 4CLUA 2HSEB 5C2CA 2Y1RI 4J37A 4DCPB 3BBCA 3RRHA 3EYZA 4I2PB 3NXZA 2QMWA 1HMVA 4LRCA 1WG5A 5DDOC 4C8OA 2RKIA 5KFOA 2CDQA 1YJTA 1F9EB 3C16B 4ILRA 2ABYA 1UWBB 4DV0J 4B3SJ 3OR1B 5J1NA 2VOPA 2XGPA 4X65J 5IQQA 3T1HJ 3ZC4A 3FK4A 1D3WA 4OYPA 1UTAA 3R5AA 1RAHB 2DNRA 4ICLA 2RVJA 4O3NA 4JI0F 1TVRB 3P5BP 1ZM2A 5LMNJ 5E2QA 4DZ6A 3W64A 3UFCX 2X1AA 4X66J 3IM8A 1SJFA 4X62F 4HHHA 1CJKA 4JI4J 3M2UB 1DJ0A 1VS3A 1S5ZA 3UWTA 2V2QA 4NLYA 1TV6B 5EDWA 4DX8H 4FBTA 3EE3A 2HMIA 2E9TA 3F44A 3DN9A 5KFGA 2AJ2A 5KFXA 2MLZA 2HQ3A 5D0GA 1KQKA 2LU1A 1HHQA 4MIVA 2NXUA 4LFAJ 4U96A 4K2JA 4H4OB 2UV8G 2Y0SD 3HULA 1HBOA 1HI8A 3K5LA 3CD6S 5KFHA 2D9OA 4PG6A 3IC1A 2MGZA 3MEDA 3CJRA 5L0KA 1FE0A 4I6AA 3DM2A 3G6YA 4CQ1A 4ZLPA 1P1TA 2V63A 1VQ5S 4DV1F 3BEGB 2Y8YA 2ZH7A 3V6JA 4GTYA 2QA2A 1JWWA 2CJXB 1CPZA 3TVYA 1DZ5A 2APOA 5HLFA 2JH3A 3PRVA 3D28A 2FGOA 2ZNYA 2XYGB 3H2UB 4NLXA 5D6GA 2YNFA 8RUCA 3JSYA 3NY0A 4IG0B 3DLGA 4I4BA 2NXNA 3PRDA 3UCZP 2C2NA 1NRKA 1VR6A 2OTLS 2N82B 1CULA 3LXQA 1IBMF 4TQRA 2CPIA 1MU2A 2UUBJ 1SL0A 1TELA 4R8UB 2KI2A 1ZPVA 3VVUA 4ER8A 3KHRA 4YR3A 3BDHA 1IM6A 4DQIA 4PEOA 4LRBA 3OTOF 2VBYA 1R0BG 1FRIA 4TYBA 2E9RX 4KRWA 3G82A 3WZ0A 4MFBA 1U6ZA 2IRYA 1NJXA 2WZ1A 2IVMA 5KFTA 4R25A 3PYEA 4RBTA 3PRBA 2OEKA 3CCUS 3PFOA 2RQCA 5B0DA 1EJJA 2W5SA 3TUZC 3CCWA 3DRYA 4IQMA 2BRKA 3MM6A 3QATA 1C4CA 2CUYA 1VQMS 1HYSB 4ECSA 2VPXB 2FY1A 1NAQA 1LEOA 2XMKA 1YJWS 2FJBB 4FNIA 3R6GB 4UTGA 4PQUB 3K58A 4C11B 4YMEA 2MZTA 4YQWA 3CW2C 3HDSA 1SC6A 3R5BA 1X9MA 3ETOA 3IGNA 3M6WA 4CLYA 2VZ9A 4MAKA 4DL3A 1NDLA 2FB0A 4WP8A 1YBUA 4M5NA 4X4PA 1JLAA 1LQ9A 3DHXA 1VIXA 4IH5A 1KRPA 2JVRA 3JS9A 2W5QA 2EC2A 3D66A 2BW7A 3IWXA 2HRTA 3MR6A 3TR5A 2V6AA 1TKXA 1OPIA 3CJ8A 2IYGA 3LP2B 3L3CA 2DR9A 1ANIA 4KSEB 3G6XA 5FIIA 1SH2A 2UUCJ 2GX8A 1PAUB 2EK6A 3GG1A 4N5SA 3BR8A 4O4GA 1RT5A 2O1PA 3H98A 2ZBIA 4WZMA 3M8SA 3HSGA 3HVWA 3BSOA 1HNVA 1WC3A 5J2PA 2B56A 3FBBA 3M30B 4NWXA 3OUYA 1TP7A 2K2PA 4ELTA 4NLGA 2QSFA 3SXLA 2M4MA 3TRGA 2GSNA 3UDCA 2OIHA 3MTKA 2DEIA 3JAMY 4YFUA 3I82A 4ZN3A 2DIVA 2YNGB 2MXYA 2JWNA 3V81A 2IJNA 2NQPA 2RRAA 4Y0FA 3KOAA 1YJVA 1RE1B 4NXMJ 3S6EA 1NH7A 1EP4B 3WAYA 2N7YA 1NK7A 2UU9J 1SKWA 1X4CA 4USUA 4JYAJ 2IBKA 3HI9A 1DTQA 3C16A 3N5BA 2JFDA 3BQ1A 3Q8PB 2B7CB 2V9WA 1JJHA 2Q6BA 1Z2ZA 4RR5A 3C6TB 3OR1A 2GVDB 3MZIA 1VBZA 2C2OB 5HQMA 5DG7A 2ATCB 2RE1A 4A47A 3OLAA 2FLOA 4MTPA 3GIMA 1Y6VA 2C3UA 4OMFG 4KH0B 3PW7A 3ZFVA 1VQPS 1FHTA 1UFWA 3MFHA 2CG4A 5D4LA 4C98A 2EWHA 2FVPA 2DNKA 4UT4A 1RTZA 2GQCA 2MMYA 3G6VA 2CWKA 2AGQA 3NL0A 3N6NA 4AE5A 1N5YA 5J1EB 3M2RA 3FBCA 2EC0A 5DGAA 3IM9A 1JLQA 4FVCA 3OVAA 1F3VA 1IWAA 1RAGB 1ALIA 1YJUA 2GMHA 1O99A 1T03B 2P8IA 2EK1A 5ETKA 4DQRA 2QL9B 1TMJA 5GMKa 4XK8C 5AXMA 4OZNA 5D15A 1T9WA 4FDJA 2L9DA 1GTHA 5C25B 1M5PC 1SI9A 2GQ2A 2G1HA 2LMIA 5IT4A 1S1TB 2QA4S 2LU2A 3AXMA 2IPOB 1RT1A 1T94A 4H4OA 2LQ9A 4K4WA 1N5TA 2DIUA 2E44A 5LSRA 4DV3F 1Z1ZA 4JI0J 2ZH1A 3EVMA 1FRLA 2YKPA 2X7IA 1DFDA 2VFTA 4UPKA 4ZP9A 3H4BA 3AB4B 1A0OB 4X62J 1WG1A 3QWUA 2W7AA 2DNPA 2A6OA 2W2OP 4ZJLA 2XYHB 3CF5Q 5JXSA 2DH9A 2AKWB 4MKVA 1HD0A 3PJ9A 4G3IA 2OLWA 4OJHA 3TANA 4DPXA 1NLKL 4DSKA 4IG0A 4P10A 1KWMA 1T02A 3OFHA 2F8MA 1M5SA 5LJ5Y 5LOQA 2FHOB 4OYZA 4ECQA 3JAMU 2VODA 3I5AA 5KFRA 4LREA 1NZ8A 5KT5A 3CE8A 4HH1A 4LUBA 3F41A 3T1YF 2EFPA 1GMVA 3C46A 3TJ9A 2RDIA 4R8UA 4MKYA 4U9RA 4S0MA 2PFFB 1Z2LA 4N77A 2HNDA 2ASYA 3MMAB 4JV2A 2E7XA 4DV1J 4F3OA 1TAQA 1KONA 4ZCIA 4ZOSA 3CO9A 1ZA1B 2G2YA 1FFSB 2BE7D 2AYBA 5U47A 1AUSL 3R7NB 2XRGA 3MECB 2DT9A 3ED4A 2R7VA 1EZZB 3IAM9 4N56A 2HVZA 5G4DA 2KFZA 5IM0B 3GILA 3MMBB 2J76E 1WDTA 2PA3A 5DLTA 1S99A 2RH6A 1ZEFA 1U0SA 5K8NA 2HW3A 3H5YA 2NSBA 3P8BB 3OFGA 5GMEA 1IBMJ 1HYSA 5HROB 3NAHA 3SQOP 4LQ3A 3MXHP 2YBVA 3VGTA 4NXNF 4KV8A 4Y3CA 5KFAA 2CJKA 2HLTA 3VV2B 3OTOJ 2KTQA 1S1XB 3LP1B 3VQSA 2I1RA 5F0UA 1NKEA 1K73T 4HVZA 3TA0A 3DDIA 2MZJA 2RIJA 3AJDA 1PC4A 2JL9A 3QNWB 4P74A 5DLVA 2IM0A 2VU5A 6FD1A 2GQQA 4CH0S 1NK0A 2Z2ZA 1EKRA 4EO6A 1Y10A 1HWUA 3LP2A 1OSDA 2BRLA 4H4MB 4HDGA 4J9SA 2G0CA 5D0RA 1HIYA 3DLLQ 3D1OA 1MMDA 1NKBA 1HBMB 1QAIA 4RU2A 1J5OB 4OI6A 4HTJA 2RB7A 2RDDA 5DLGA 1JK9B 3BJYA 5E7OB 1WF0A 4A8KA 4RU9A 3EX7B 4HLBA 2FVRA 1SPBP 4NA1A 1YX2A 5CCMA 1RA6A 3VGSA 3A1YG 1R0CB 2DHGA 4DG1B 3SCLE 4FF2A 2YNGA 3D5MA 4TKTA 3VALA 3KKFA 3QT5A 1V3ZA 2FYXA 3KHHA 4NE9C 2FVCA 2PI4A 1F9HA 5A76A 2RJZA 1YJ7A 3RRGA 1NK9A 2R7QA 1EP4A 2KHCA 4XTTA 3CDAA 1S9EB 3EMTA 3NKRA 4LR9A 2F9DA 1PJ5A 4DSEA 4RW4B 1VFJA 4PABA 2NPIA 1JLGB 2MZSA 4YDXA 3VTIA 1N5SA 2LYVA 2OUGA 2YQ0A 2AQ4A 4LF9F 3C6TA 2GVDA 1QAXA 5CYQB 5D3GB 2GO8A 2XMWA 4M8LA 2WVBA 2VPYB 1PC5A 2LEBA 1NB7A 2ZUGA 4YB6A 1S6OA 3T6BA 3TUPA 4FDFA 4YEAA 2NUUG 3SIPB 1X5TA 4OZLA 3SYZA 1CQMA 1O6XA 1XJWB 1U6BA 5J1EA 2VG7B 1D0EA 1FRXA 4K4TA 3J81Y 2HGMA 4M5LA 4MKBA 3BSAA 2LECA 4DR2F 2XCPA 5K9FA 1NJZA 1T03A 1FDBA 5INHA 1E33P 3P45B 4O3RA 4LBIA 4ANCA 2UXDF 4MK9A 3QYYA 3FFIB 4CT8A 5C25A 3TA1A 1FWKA 1Y3KA 3GP9A 1IKYB 4MYUA 3ZO7A 1S1TA 1F2HA 3UNGC 3CCZA 2FLNA 1UZDA 1YITS 4UOFA 5A2QY 3IGVA 2ZC3A 2X98A 3GG0A 3OXLA 2XGQA 2XWXA 3KD8A 3ENVA 1JIHA 1FT8A 2J7KA 2O3DA 4ES3A 1M5OC 1YGYA 3GV7B 1T9UA 1FNMA 4IFVB 4ELVA 3GR0A 2BBEA 1JQGA 3ENWA 3THPA 2W2MP 2HAIA 4P7VA 2W2QP 1ZAWA 2FTRA 2VIHA 4B9NA 2CFXA 3B4DA 3ZTOA 3K8WA 4RW8A 3FDSA 2QLWA 2GV1A 5FJ4A 4B9SA 1RHRB 2POKA 1O0PA 4G6VB 4N7TA 3LGNA 1XNRF 1TFWA 4DV3J 2J9EA 4QQBA 3CULA 1RWUA 5KT2A 1T9VA 3N79A 1GNKA 2UUWA 4WYWA 3MMAA 4B9TA 1IR1A 3EXCX 2XULA 3UO0A 2WVDA 3WX8A 5KFIA 1IJFB 3I6PA 4CO3A 3SI8A 4PKDB 3U1LA 1VC6A 3MWBA 3PVXA 2LCWA 1RTIB 1S1VB 2LEPA 1S0VA 4ECWA 5IM0A 3MMBA 1FFWB 4Y6IA 1PYOB 1OMSA 5HATA 5KT4A 5KG7A 3OLBA 2GJFA 1KOHA 3D9BA 2HHTA 4NLTA 3LO3A 1RWNB 1WUUA 2WVCA 2W5WA 1RT3A 4LRDA 4J9QA 5HROA 1WDDA 5LMUF 3T1YJ 3QRQA 1UL3A 1I3OB 2CJYB 1S6QB 1RTHB 4OHXA 3UDEA 1A6LA 5B0FA 5D4OA 2VG5B 1Q4RA 3FMBA 4KO0B 4CNZA 5LM7E 5K8OA 4DMZA 1SCJB 3TYTA 4O44A 4ED5A 1U6FA 3J81U 3M8ZA 1S1XA 2MZRA 4LSZB 3UN2A 3N28A 2Z2MA 1HI1A 4CDIA 1RWVB 3AHPA 2Q43A 1JX4A 2YKNB 1S9FA 4NPOA 1FRJA 4JP8A 1U7LA 5CH7B 1ELZA 1WTBA 2DISA 3HK2A 4Z7CA 2V2KA 1RACB 4P73A 2VQFF 4ZVPB 2RH3A 3K59A 3BDGA 3K7RA 5A2QU 4RWXA 1EJ7L 2NUHA 3GIKA 1FA0A 4H4MA 4FF3A 3GFZA 4E98A 4QCLA 3IP0A 1R8AA 4C8NA 3FZBA 2RD5C 5EWGA 1E6YA 4NXNJ 1RKIA 1HBMA 3B54A 3SFUA 3QZ7A 3NGUA 4X4TA 1J5OA 1RT7B 2J6SA 2XMAA 3VAFA 3U02A 3ZTQA 4ED6A 2PEHA 3IDDA 4DL7A 4QPTA 3TNVA 1U45A 4OJGA 1PYTA 1AW0A 2PA8D 1HBUB 4DG1A 2ZOMA 2XEXA 2DR5A 2AT1B 3TUJC 1HNIB 3FQLA 4ZVOB 1JXEA 4RLEA 5AE3A 1RYRA 4F4YA 3HJVA 5G0RB 2MQNA 1WI6A 1S9EA 1KOOA 5K14B 1NMEB 2IM1A 1B70B 4RW4A 2ZWOA 1JLGA 4OI1A 3DMJB 2FJWA 2BMBA 3BBBA 4NCGA 4WP3A 1RWXB 1ZEBA 5CYQA 2RDJA 2XWYA 3OW2R 1FF2A 1PKUA 4O0IA 2HS4A 2HLUA 4MH8A 2Y1LB 3C66A 1XERA 3RYLA 3CCJS 5CYJA 1F5CA 2E5GA 1LW2A 5EGYA 2D1CA 5AXNA 3A8EA 3L95X 4ZS6A 2VBXA 3UN3A 2CRLA 1X5PA 4GKJF 2HVEA 1GXLA 5HJXA 5HMYA 1KHNA 1IWGA 1T11A 2R2RA 1ZA2B 4JI5F 2BKPA 1ED9A 4DR1J 3ZZTA 4HKQA 3EM1A 4KR0B 1IBKF 1ZAXA 4KC5A 4MIBA 2VG7A 2GIQA 2M0GB 1MMLA 1KHJA 2I2YA 2PDAA 3FUYA 3T5KA 2KM8C 3I5BA 3O5TB 1U48A 3OJSA 3TEHB 1ZPWX 1XIQA 3D54A 1H72C 3RG6A 1S76D 4LF9J 3BM7A 1S57A 5C7PA 2WONB 3FFIA 3KFWX 3D68A 1KR4A 1T0TV 3OL9A 3ISNC 4ILLA 1IKYA 1JXVA 5KOXA 3NLCA 5DQGA 3T01A 4KAIA 3MM5A 3ISZA 3R5GA 3PX6A 2ZVIA 4UZCA 4RNFA 1DARA 2HHPA 4Z2XA 1N6QB 4FS2A 1VQSA 1XTZA 4KPCA 4D3GA 4M5HA 5D78A 4JV1A 4UPIA 3CDWA 5CZVA 3C19A 3ENQA 4M1KA 4FS1A 4IFVA 2HQIA 2JEIA 4FN5A 2Z2YB 4KGVB 3DNCA 4K4VA 4DR2J 4QR2A 4KB7A 3CJ4A 2W8SA 2QRRA 4HR2A 4A4JA 4NLPA 3TO8A 1X5SA 1M0SA 1TU0B 2UXDJ 3SV4A 1TL3B 1SQGA 4JI8F 2R3VA 3R27A 5GAEU 1B4SA 3WHIA 1G6BA 2P9EA 4UOHA 3SMZA 4WKYA 1D9FA 5LXYA 2AJQA 1GQEA 3R5DA 4KHMA 4OYMA 4FF4A 3H8YA 3DLKB 2N3OA 1VJQA 2LA6A 1ZBTA 1ZAVA 1MW7A 3GYNA 5L39A 2CQ2A 3JTOA 4C8KA 4GVLA 1TQLA 2XBPA 3J7A1 1HBNB 1OY6A 1SC3B 2D3O1 1FSUA 3JXOA 2DNOA 3IR7B 1U25A 2FZCB 3CDEA 5M2UA 1IR2A 4U95A 4YR0A 3Q89A 3OL6A 4YB1P 1BC6A 2JLFA 2BKOA 1RTIA 1S1VA 1NDCA 1EB0A 1YI2S 4K7QA 1K44A 2J6TA 4Q8FA 2KXHA 5F8LA 1R43A 1RHUB 1A9NB 4HDHA 2YKOA 4QJVA 1HNXF 5LRMA 4K5SA 5B7WA 4DR3F 4DFKA 1UPPA 4J91A 1IBLF 2B9XA 1RWPB 3TZWA 5CD4A 4ZVTB 4A8YA 1KLMA 1H73A 3AXKA 1YRUA 1NZAA 1XNRJ 1S6QA 5J1PA 1RTHA 2XQCA 1S9GA 3HXMA 4PZVA 1J5EF 2VG5A 1V5VA 1S6UA 4KO0A 3UCGA 2D3ZA 5KG3A 3C3LA 1W26A 4PPZA 4OX6A 3T3FA 3OHAA 4GKKF 1YIJS 2XI2A 3LGMA 1QE1B 1VYAA 3QIPB 4RWWA 2W9CB 3O3LA 2E7VA 1OY8A 3AJ2A 4QIEA 2BQRA 2AYMA 4NLSA 3PV8A 4ED3A 2H4YB 2FLPA 1OY9A 2YKNA 3N0VA 3RBDA 4EI2A 4YY3F 1SIWB 5C42B 1U09A 1IKXB 4P75A 3GJRB 3MOZA 4XDDA 1X4DA 2B8QA 3V5RA 5C24B 2ZHBA 5HMZA 1VBXA 1WC4A 5LMUJ 4AL6A 5AT1B 1U1MA 1CG2A 1UW9A 4M63A 4ED8A 2M70A 3OFFA 3PR4A 2M3DA 5IT9Y 5MLCV 3HHEA 2HK2A 3SCIE 3ELHA 2VJUA 2B9EA 3LAMA 5HANA 4OV6A 2D3OR 4Y2AA 4HH0A 1H98A 3BDFA 1HBUA 7FDRA 2P9CA 4TU7A 3MUTP 3EGNA 1AUDA 1WACA 3GR1A 1RXOB 4CWBA 4KGKA 1HNIA 4Y2KA 4RW6B 3HFZB 1L3KA 4W92B 1QTMA 2HKEA 2PGCA 3B82A 4X4RA 2VQFJ 5G0RA 3M32A 4WPAA 4ID8A 1UPMB 2V34A 2D9PA 5CCLA 4DUZF 3ETMA 5K14A 4FXWA 3BREA 1UEKA 3M8YA 4KIAA 1AUKA 2XZWA 3DMJA 1SIZA 3IBFB 2E1PA 4YR1A 1SQFA 4BWMA 1WKKA 1RWKB 4X2BA 4FDIA 4PAAA 3ZZYA 2CQGA 1DTTB 3F73A 5DZ7A 3V6KA 2NR0A 4OV1A 3RJMB 2R8IA 3IWLA 3M7VA 1MWQA 4G65A 2OGUA 2YVSA 4DEZA 4J9LA 1VQNS 5F8GA 4EZ6A 1H6KX 2H5IB 2GHPA 4I56A 2HG4A 2L9WA 2R2SA 2W25A 5DG8A 1GX5A 3DLHA 2MZQA 4KQZA 4C8LA 4L6V3 1WC6A 3T41A 3R5CA 5J2QB 1G7CB 4KJDA 1V3RA 1QSLA 5B0AA 1ZTTA 4G1QB 4HEA9 3VHQA 2OD6A 2W7OA 1WC0A 3QQCD 3CXCR 4ZITA 2E9ZA 3ZZPA 1AYEA 2YX7A 2LQJA 3GE9A 4HT7A 4CLTA 3THTA 1Q53A 2WBRA 2Y9HA 3RAXA 3OV7A 2U2FA 2WONA 2XNQA 4KFBA 3W5ZA 4Y28C 2W4DA 3CB4A 2DGSA 4TNOA 1TUGB 1Y00A 3H20A 4DL0C 1AXQA 2R8HA 3W2WA 3PNIA 1T8EA 2B43A 1VK3A 1N6QA 4GKJJ 3B4MA 4ZVHA 4LR2A 2FGCA 3VF0B 4PYAA 2FVQA 4JI5J 1RLDA 2IC3B 2HEKA 2B51A 5HAOA 1Q0NA 1AT1B 4PWUA 1IBKJ 4CNYA 2DHAA 2AIRB 4DF4A 1QAJA 3MM7B 4NLOA 1H7WA 4DL6A 3C8YA 1OQ3A 2VQEF 4DN9A 5IT9U 5B09A 1JLCB 3D4JA 2GVZB 3L7OA 2C2RA 2HNZA 2LA4A 3MEGB 3KJFB 2BKNA 3NS7B 3TX8A 3PIPQ 2JOQA 2DPJA 1PILA 2YNIB 3DLKA 4FVMA 1UJ6A 1URBA 5KFWA 1E6VB 5I3QA 4OHYA 2UVUA 3O2IA 4P7TA 1IM4A 2DCLA 1RK8A 2I6WA 4TU8A 1HBNA 1NU4A 3W9JA 3PO4A 1IQZA 3IAS9 3UPFA 3ZNUA 4JI6F 3R7SB 3WX4A 2BACA 2AYGA 2F4VF 1KQGB 2RUGA 5F8JA 5BXIA 3UW1A 1H74A 1WF1A 3KDNA 4NLRA 3H7HB 4QPXA 3V6DB 3AQPA 4FYYB 4AD6A 2QSWA 3B5QA 1MROB 1GMWD 2ZZTA 1K0VA 4JI8J 3PHEA 3ZNJ1 2JRSA 5D4NA 5GAEI 2KYXA 2RRNA 2YNHA 4F0HA 1H38A 1Y4ZB 2GAGC 2P2CB 3DYAB 2GJ2A 2QMUB 1NKCA 2VBWA 2UXBF 5A8WA 4ZLJA 4JV0A 3R3TA 4M5GA 1KTVA 4ZVSB 5IV3A 2A2DA 4KY3A 4F04B 1RADB 4KAYA 4V19X 4FYVB 2KFNA 2ZH6A 1HQEB 1QE1A 1NSQA 1FJ7A 1Q8IA 4NLQA 3QIPA 2QG9B 1X5OA 2CQ1A 2W9CA 2AHOB 3NWGA 4WK1A 1VQ9S 1LWEB 2RRBA 4W4MA 2M7SA 2X51A 3N9UC 1X4AA 2FLLA 4USJC 1VQ4S 4FZVA 4GC7A 1ZZNA 1R31A 3RW7A 3DLBA 1H3DA 3KUEA 5C42A 2MY7A 3I0SB 1IKXA 1HNXJ 4DR3J 2DY9A 5EX3A 5C24A 4O4RA 2N4CA 4TXSA 3WQPA 1Q86T 4HYKA 4OX9F 1YBAA 3OD2A 1UW4A 4QIVA 3G8SA 1Y7AA 5RUBA 1J5EJ 4KHRA 5E3CA 2MQLA 4X84A 3NGKA 1EIYB 2HHWA 8AT1B 4GKKJ 1WHXA 4TLQA 1HD1A 1RI7A 3NMAA 4FNHA 2P9GA 1RAFB 1WHYA 4DBQA 2DRBA 1EW9A 1S4EA 4J5OA 1U1RA 1RCOB 2C3OA 5I3UB 4LF2A 5A8KB 2OPSB 1NEEA 5T7LB 5HQLA 1HWJA 4B9MA 3KLFB 4USIA 3G8TA 1HWIA 3I0RB 3QSYB 2MKCA 3CJ3A 1F3FA 4YY3J 4WFAQ 3OR2B 4J9RA 2L9NA 2PEBA 4DR5F 1D1UA 4I2QB 2DITA 3V4IB 1QJHA 1EKSA 2OFGX 1R8HA 4RNOA 4F50A 4WK3A 1SHNA 3FGVA 3HZGA 4OIXA 3RAQA 1AJBA 4C3KA 3GONA 3W60A 4IR9A 4J9NA 3W2VA 3DRPB 3DI6B 1PBUA 3QT6A 3A8IA 3G71S 1N0UA 1N32F 2KVQE 3PO5A 3O1LA 1P27B 3FEYB 1DTTA 3PW2A 1VHFA 2QLBB 1UVKA 4KBIA 2R2UA 4ES2A 4LFCF 2NXEA 3BO2A 3T5HA 4D3HA 4KHPF 3PFEA 3RAMA 3POTA 4H4KA 4R0EA 2VA3A 2N4DA 4C3LA 1RGVA 2RUSA 3MCOA 2MSSA 2GSUA 4MJKA 3FCHA 4A46A 4I67A 2ZC4A 3FSIA 1KH4A 2GGPB 1U26A 2AMCB 5EX0A 3RW6A 2E5JA 2KKHA 5FLXY 3QMQA 5J2QA 3KG1A 2F8EX 4DUZJ 8ATCB 2DNNA 1BQMB 3I96A 3US5A 1NDKA 4I0WA 2ZBQA 4G1QA 1WOPA 4CLKA 4HT5A 2AX1A 4KYZA 2K7JA 4FKYA 4P2MA 4IFYB 2BABA 3G4SS 2V5HG 2JSXA 2DVIA 2CJQA 2O01C 1V5IB 2F63A 3PTWA 1B3TA 3TAMB 2V4RA 1L3TA 4ZPAA 1WELA 3PW4A 1HPZB 1CJKB 2G2ZA 4I7FB 5KFCA 1S0MA 1FXDA 1DQ9A 4ENOA 4F4ZA 4K0KF 2EKNA 1ZH5A 2E1RA 2Y1IA 1K1SA 3NKYA 2OP5A 3E8OA 1EAYC 2IC3A 3SDEA 2CQDA 2R7XA 2KM8B 3R6LB 1SKUB 4OZ5A 2QA1A 1T3NA 1IKVA 3I9V9 2CQ4A 4ECXA 1WEXA 1IUJA 1SH3A 3GJTB 2BR0A 2HBYB 3DOLA 3MM7A 3CMAS 3CT9A 3GFHA 3CCES 5H9FJ 3OVSA 2Y3YA 5K8MA 1RHJB 2K8GA 2MGZB 4L74A 5DETA 2QYGA 2EFNA 1JLCA 5GADU 1UVJA 2GVZA 1S1WA 3QSIA 4QWAA 3MEGA 1OJ4A 1AJCA 2B8PA 3HT3A 1Q16B 3M8PB 1NBEB 1QSYA 3KXDA 4C8ZA 3MI7X 1TR0A 3UCUP 1X9WA 4F3QA 4XO0A 2XSJB 5HLFB 1RJJA 1E6VA 2FD2A 2FDNA 3OQ2A 2GO9A 4EZ9A 2YPZA 3GFYA 4EK2A 4LT6A 2HS0A 2J6UA 3JSBA 5DZ6A 1O51A 1NSAA 9ATCB 4WFNQ 3VCDA 3MCMA 4K50A 4NCAA 4F4WA 1A7GE 2D3UA 4AL7A 5ETNA 2M5YA 1UJ5A 2FHJD 4M94A 3N6MA 1R27B 5JVGQ 3V6DA 2VQEJ 3PJXA 2XMTA 3LUYA 1MROA 5D8HB 3CD7A 2QT7A 4R5PB 2QLFB 4F4AA 5B0CA 5GRRA 3QAUA 3DYAA 4XPCA 4PG8A 4EFAC 3G82B 1ULRA 4FYXB 2COLA 4ECYA 5FLXU 4M5JA 4ECRA 1DY3A 2MB0B 4YP3A 1NH8A 3SCJE 2J8SA 2KJVA 2R2TA 2D7SA 4KH1B 5DLWA 3R9LA 3S8SA 1HQEA 4JI6J 2MHNA 4X4QA 4IDKA 4OZ1A 3BH6B 4NLWA 4OX7A 1LWEA 5F0WA 2DGOA 2CQIA 3AA8A 5A0YB 2HQCA 3HX9A 2CQPA 4PCQA 5L8RC 2PMHA 1X4GA 3LP0B 5I4MA 1MG7A 1HQ2A 3HVRA 1FTCA 3I0SA 3NCRA 4UOPA 3T9NA 2R7TA 3KHGA 4OI2A 5B0GA 3T6JA 2UXBJ 4UY8T 3GIJA 4A8SA 2LKZA 3OFEA 2V8VA 4ZJOA 1S77D 4RPFA 1RYSA 3TZYA 3NCQA 1PJ6A 1IBCB 1VDHA 4Q44A 3QLHB 5E3PA 3JTPA 3H4DA 2CQCA 1X9SA 2XZTB 2V94A 2HZCA 3KJVA
chains in the Genus database with same CATH topology
1N2KA 4LR2A 5LQQA 2XR9A 1EI6A 3M7VA 3UN5A 3UN2A 4GTZA 4UPHA 4LRCA 5TJ3A 4CYRA 3OT9A 5DLWA 3LXQA 2ZKTA 4ZG7A 5DLTA 3NVLA 2QZUA 1SHQA 2GSNA 2RH6A 1ZEFA 4NWJA 3NKOA 5KXAA 2X98A 4UORA 5LIAA 3SZYA 2GLQA 3UO0A 1ELYA 3Q3QA 3B5QA 1ELZA 4LRFA 1E3CP 4ZGAA 3KD8A 3NKNA 4KAVA 1HDHA 1ALIA 4TN0A 3BDFA 4MIVA 3WAVA 1Y7AA 4ZG9A 3BDHA 1HQAA 1EW8A 4KJDA 2GA3A 3MK0A 3BDGA 1O99A 3E2DA 1KH7A 5IJQA 4LRBA 5L0EA 5IJSA 5C66A 1E1ZP 3WAYA 2ANHA 3TX0A 1ZEDA 3CMRA 4LR7A 1ZEBA 1ED8A 4CYSA 4B56A 5L0KA 4LREA 4LQYA 3MK1A 3T01A 3WAWA 1P49A 4UOPA 2W5QA 2W5XA 4ZG6A 1ALHA 1FSUA 4FDJA 1KH9A 2GSUA 3T00A 3NKQA 2IUCB 5HRTA 3NKPA 1EW9A 1EQJA 3M8WA 4GTXA 1B8JA 1KH4A 2G9YA 4CXSA 4KJGA 2GSOA 3IGYB 5AJ9A 2W5VA 3M8YA 5K4PA 1ALJA 2W5WA 4KAYA 3T02A 1EJJA 1E2SP 5EGHA 4UPIA 3A52A 4LRDA 2D1GA 4GTYA 3TG0A 3BDGB 5LRNA 1AUKA 4GTWA 1ANIA 3UNYA 1ELXA 4LR8A 1O98A 3DYCA 1URBA 5GRRA 1URAA 3UN3A 2W5SA 1K7HA 2W5TA 1KHLA 4YR1A 1ANJA 3IDDA 1AJDA 2VQRA 3IGZB 3WBHA 1Y6VA 1KHNA 1KHKA 1E33P 1ALKA 5INHA 4CXKA 3NKRA 5L0BA 1EW2A 4QAXA 5DLVA 4FDIA 4LR9A 1N2LA 2W5RA 3WAXA 3SZZA 1AJCA 5EGEA 4N7TA 4CXUA 3TWZA 5GOVA 1ED9A 1SHNA 3DPCA 3MK2A 4UOOA 1AJAA 2W8SA 4UPKA 4MHXA 1HJKA 2IUCA 2XRGA 4UPLA 5LRMA 2IFYA 4KM4A 3M8ZA 2W8DA 3NKMA 4NWXA 1KHJA 3ED4A 1AJBA 4MY4A 1KH5A 4LRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2K A;  4LR2 A;  5LQQ A;  2XR9 A;  1EI6 A;  3M7V A;  3UN5 A;  3UN2 A;  4GTZ A;  4UPH A;  4LRC A;  5TJ3 A;  4CYR A;  3OT9 A;  5DLW A;  3LXQ A;  2ZKT A;  4ZG7 A;  5DLT A;  3NVL A;  2QZU A;  1SHQ A;  2GSN A;  2RH6 A;  1ZEF A;  4NWJ A;  3NKO A;  5KXA A;  2X98 A;  4UOR A;  5LIA A;  3SZY A;  2GLQ A;  3UO0 A;  1ELY A;  3Q3Q A;  3B5Q A;  1ELZ A;  4LRF A;  1E3C P;  4ZGA A;  3KD8 A;  3NKN A;  4KAV A;  1HDH A;  1ALI A;  4TN0 A;  3BDF A;  4MIV A;  3WAV A;  1Y7A A;  4ZG9 A;  3BDH A;  1HQA A;  1EW8 A;  4KJD A;  2GA3 A;  3MK0 A;  3BDG A;  1O99 A;  3E2D A;  1KH7 A;  5IJQ A;  4LRB A;  5L0E A;  5IJS A;  5C66 A;  1E1Z P;  3WAY A;  2ANH A;  3TX0 A;  1ZED A;  3CMR A;  4LR7 A;  1ZEB A;  1ED8 A;  4CYS A;  4B56 A;  5L0K A;  4LRE A;  4LQY A;  3MK1 A;  3T01 A;  3WAW A;  1P49 A;  4UOP A;  2W5Q A;  2W5X A;  4ZG6 A;  1ALH A;  1FSU A;  4FDJ A;  1KH9 A;  2GSU A;  3T00 A;  3NKQ A;  2IUC B;  5HRT A;  3NKP A;  1EW9 A;  1EQJ A;  3M8W A;  4GTX A;  1B8J A;  1KH4 A;  2G9Y A;  4CXS A;  4KJG A;  2GSO A;  3IGY B;  5AJ9 A;  2W5V A;  3M8Y A;  5K4P A;  1ALJ A;  2W5W A;  4KAY A;  3T02 A;  1EJJ A;  1E2S P;  5EGH A;  4UPI A;  3A52 A;  4LRD A;  2D1G A;  4GTY A;  3TG0 A;  3BDG B;  5LRN A;  1AUK A;  4GTW A;  1ANI A;  3UNY A;  1ELX A;  4LR8 A;  1O98 A;  3DYC A;  1URB A;  5GRR A;  1URA A;  3UN3 A;  2W5S A;  1K7H A;  2W5T A;  1KHL A;  4YR1 A;  1ANJ A;  3IDD A;  1AJD A;  2VQR A;  3IGZ B;  3WBH A;  1Y6V A;  1KHN A;  1KHK A;  1E33 P;  1ALK A;  5INH A;  4CXK A;  3NKR A;  5L0B A;  1EW2 A;  4QAX A;  5DLV A;  4FDI A;  4LR9 A;  1N2L A;  2W5R A;  3WAX A;  3SZZ A;  1AJC A;  5EGE A;  4N7T A;  4CXU A;  3TWZ A;  5GOV A;  1ED9 A;  1SHN A;  3DPC A;  3MK2 A;  4UOO A;  1AJA A;  2W8S A;  4UPK A;  4MHX A;  1HJK A;  2IUC A;  2XRG A;  4UPL A;  5LRM A;  2IFY A;  4KM4 A;  3M8Z A;  2W8D A;  3NKM A;  4NWX A;  1KHJ A;  3ED4 A;  1AJB A;  4MY4 A;  1KH5 A;  4LRA A; 
#chains in the Genus database with same CATH topology
 2E5H A;  3NGR A;  2OPS A;  1Z4U A;  3UN5 A;  5T7L A;  3KLF A;  4YUD A;  3CJQ A;  2WW4 A;  3OSN A;  3OR2 A;  2KL8 A;  1U0H A;  4O4G B;  1UVL A;  1QVG R;  1RT5 B;  3M6X A;  1UA1 A;  2IIH A;  1NJI T;  1HNV B;  4LSN B;  3PR5 B;  1K47 A;  2DCU B;  4ZJQ A;  1T9X A;  1UJ4 A;  3NOC A;  1URR A;  3K2Y A;  4OX9 J;  1LWC A;  3NS5 A;  2G13 A;  1TTH B;  2JZ5 A;  2LQ5 A;  1TK8 A;  2MQO A;  4MYT A;  4V1A k;  4CO0 A;  4ETZ A;  4WP9 A;  2XMJ A;  2ZD1 A;  2B6A B;  3QRP A;  4WCE Q;  3IS9 B;  3J7Y U;  1L3S A;  2W1B A;  1HNW J;  1N34 F;  2LFV A;  1FNO A;  3A13 A;  3CNQ P;  3Q8V A;  5ETR A;  2M52 A;  2OEM A;  4URG A;  2B4V A;  5L9X A;  1DTQ B;  3LAN A;  3FCV A;  2JJ4 D;  5DRK A;  4DR5 J;  3M9N B;  2GGP A;  3AJ1 A;  1X0P A;  5K8P A;  3OTE A;  2JFK A;  4NWB A;  3CJK B;  3PXG a;  4A8O A;  1BQM A;  3NKO A;  2BX6 A;  2CPF A;  2YKM B;  2K3K A;  1RAO A;  5EWF A;  3EPI A;  5IWA F;  3J7Z 5;  5H9E J;  1X4B A;  5J2N B;  1N32 J;  4OZJ A;  4X4S A;  4IFY A;  2U1A A;  3TZX A;  3TAM A;  4LFC J;  1RAA B;  4L3K A;  3TJ8 A;  2W5X A;  1JXL A;  3HVA A;  3KTQ A;  1N5Y B;  3M2R B;  3U27 A;  3VGU A;  4KHP J;  4J9M A;  4ZP6 A;  2J0W A;  1B8J A;  2BJ8 A;  1HPZ A;  4RJV A;  2HHX A;  1JLQ B;  2GSO A;  4I7F A;  2XYP B;  1REG X;  4O3P A;  4DSF A;  3KYL A;  2VHG A;  2XI3 A;  3WC0 A;  2ZH3 A;  2VKR A;  3GIR A;  5I3P A;  1RIS A;  2L3M A;  4I6Y A;  1WOS A;  5HI7 A;  7AT1 B;  4DV5 F;  3GV5 B;  1U1K A;  1MMN A;  3QFH A;  4NMX A;  3GMG A;  1EET A;  4P2F A;  3J81 j;  3AA9 A;  4NI2 B;  1RT1 B;  2R8J A;  1PO6 A;  2KVI A;  3KLV A;  1TKZ B;  2E7W A;  2Z57 B;  3D3C J;  3OXF A;  2IMW P;  3AOC A;  3A12 A;  2E1A A;  2BYC A;  2B0G A;  1KHW A;  3BGU A;  4IQX A;  3KG4 A;  4Z37 A;  1RA7 A;  2C28 A;  3M8P A;  4NCB A;  2DRD A;  3OXG A;  2X1B A;  3C15 A;  1WI8 A;  2DKO B;  2ZFH A;  3ET6 A;  2FUG 9;  1R3N A;  2G1D A;  4ZA1 A;  3MHY A;  3HO1 A;  2XSJ A;  3I5C A;  3NGD A;  4K0K J;  1ZM4 A;  2DNG A;  2MQP A;  3J80 Y;  3OL8 A;  3LWM A;  4WFX A;  1KVJ A;  3RR7 A;  3NKP A;  3RU0 A;  1NJY A;  2A10 A;  1GT8 A;  3ULH A;  5KG1 A;  3UVJ B;  1Q5Y A;  1ELO A;  2HWT A;  4P2S A;  2DNM A;  1ZM3 A;  1NHK L;  2FY8 A;  2A2C A;  1L5U A;  2XNR A;  2GC8 A;  2BJ1 A;  5DLF A;  3Q86 A;  3CCV S;  2CPE A;  1VBK A;  1N54 B;  1H2U X;  4R5P A;  4DU7 A;  2HND B;  4CTA A;  3SSQ A;  5GAG U;  4ECU A;  2DNQ A;  3O6Q A;  4YR2 A;  5KT7 A;  1I94 F;  3A8J A;  5E0O A;  3W5X A;  2DTJ A;  1SH0 A;  1T05 B;  1RTJ A;  3MK0 A;  5IJS A;  2V8D A;  2VFR A;  3RB4 A;  3K57 A;  2GW8 A;  3EIC A;  1FEE A;  2YH1 A;  4CLS A;  1R8P A;  2QX0 A;  4O0N A;  2ZJP Q;  1WSR A;  4ZVG A;  2NZC A;  3GU0 A;  2OO4 A;  5A0Y A;  4PG4 A;  3ZTR A;  4BHQ A;  5HSP A;  1ALJ A;  1GK8 A;  3RGI A;  3LP0 A;  2ALY B;  3GB0 A;  2ADC A;  5F8H A;  2HRU A;  3WBH A;  4KV8 B;  5L0B A;  2ADB A;  4OYB A;  2JHE A;  4Q45 A;  3AOA A;  4DCJ B;  2FJE B;  3H90 A;  1QVF R;  3VWS A;  4C48 A;  3HFV A;  1KH5 A;  1TL1 B;  1RSC A;  1FKP A;  3IXQ A;  4RKU C;  3SV3 A;  3QLH A;  4O3Q A;  2VH7 A;  3AD8 C;  2AYE A;  2XY6 A;  2FZK B;  4PXE A;  4B3R F;  4LIR A;  4ZVQ B;  4HTI A;  1FWL A;  2XS2 A;  2E29 A;  2EBE A;  4Y65 A;  4CYU B;  4MMO A;  2ZH8 A;  1PSD A;  2NS1 B;  4LSN A;  2YWE A;  4DV6 J;  3E3X A;  3NEK A;  4EYI B;  1KHL A;  4QU7 A;  3J80 U;  2ROE A;  1YJ9 S;  4DXL A;  2XHC A;  4BWJ A;  3PJW A;  2V50 A;  4UPL A;  3KK1 B;  2ZHA A;  2AEJ A;  3NP5 A;  5E5N A;  4NA2 A;  2DYA A;  4NZ0 A;  4DX6 A;  2MPU A;  3HHD A;  1VK8 A;  2B6A A;  3G8Q A;  3CC7 S;  3ITH B;  3IS9 A;  1SUQ A;  2R8G A;  3NAI A;  4Q43 A;  2F40 A;  2JC1 A;  2HFO A;  4QWB A;  3MEE B;  2KXF A;  2AU0 A;  4P52 A;  2R4F A;  3I9Z A;  2AGP A;  2ZOG A;  4TU9 A;  2H51 B;  4AXI A;  3TI0 A;  3I4P A;  3A4T A;  1CVJ A;  1R8C A;  3NNH A;  2CZ9 A;  3MCN A;  3UR0 A;  1R6Y A;  3CJK A;  2YXL A;  4EU0 A;  1KH9 A;  1FXL A;  2YKM A;  3KG0 A;  1KQF B;  1WC1 A;  5J2N A;  4NLD A;  4A48 A;  1X8D A;  1B99 A;  4FPR A;  2PFD A;  5E3Q A;  4ZPB A;  1X7V A;  1UFL A;  2PI5 A;  2VQR A;  2K7K A;  3MD1 A;  2OPP B;  3BGR A;  4OHV A;  2HYI B;  1N34 J;  3OTD A;  1L3V A;  1OS5 A;  2V8P A;  4J9K A;  4X64 F;  4AYB D;  4RNN A;  3X1L B;  2B4P A;  1W2B R;  1S7I A;  4DCO B;  1PGZ A;  4LBP A;  2YWF A;  3MEK A;  3NGS A;  3G86 A;  3LGH A;  5AE1 A;  1Y0H A;  1YJN S;  5BYQ A;  1I6J A;  4DV7 F;  3NKN A;  2HFS A;  4E0D A;  4U67 Q;  3PW0 A;  1T9T A;  2XMV A;  2V69 A;  3MPV A;  1ITP A;  4NI2 A;  2Z30 B;  1CC7 A;  1GFW B;  1MWZ A;  2WVE A;  5IWA J;  3H5S A;  1LK5 A;  5KFS A;  1GH8 A;  4AND A;  1P49 A;  2VUG A;  1SV5 B;  1TKZ A;  4PUO B;  2HAF A;  4P9S A;  3IN5 A;  3IGY B;  2LXU A;  4WE1 B;  1ICE B;  1BGX T;  2IFX A;  3CDB A;  3W8G A;  4RW9 A;  3GWC A;  2JEG A;  2YY3 A;  3TVK A;  3DLE B;  7FD1 A;  4WFB Q;  4F2R A;  4I64 A;  3KNA A;  3FKB A;  4B9L A;  2MST A;  4ID5 B;  4OLO A;  1F0X A;  3MR3 A;  2G9O A;  1R89 A;  4NYZ A;  3DPC A;  3BDE A;  3ZZZ A;  2DXF A;  2I8E A;  4UQG A;  1NHU A;  2GMJ A;  1T3O A;  3UVJ A;  4OYX A;  1CJV B;  4RW8 B;  1X4E A;  4DV5 J;  1MNE A;  2HVH A;  1YHQ S;  2IHR 1;  3D6M B;  3QBC A;  5F9L A;  1LWF B;  2AP6 A;  3LW5 C;  1WHW A;  3DLJ A;  4CLP A;  3P5T L;  4LVN P;  2HQF A;  2GCF A;  3FC9 A;  2F65 A;  3V2U C;  3CJ2 A;  1U24 A;  1UVN A;  3WIV A;  5HVH A;  1D9D A;  2VON A;  1XQI A;  1KH7 A;  1YZ6 A;  4U6P A;  4OFZ A;  1JLF B;  3DKD A;  4QYZ J;  4CLL A;  4J7C A;  2W9A A;  5C5J A;  4IOB A;  2XC9 A;  2Z0G A;  3OSP A;  4IR1 A;  1PYS B;  3HSJ A;  2IY5 B;  3R97 A;  1VQ7 S;  4HHU A;  2HHS A;  5LJ3 Y;  4Y34 A;  3EZO A;  1C0T B;  2ZNZ A;  2I0X A;  4IH6 A;  3BZQ A;  3SQG B;  3GV8 B;  1T05 A;  4EBC A;  4RO0 A;  2WK4 A;  3CO0 P;  4TY9 A;  2W4C A;  2HGN A;  3N5F A;  3NCP A;  2HZA A;  5KG0 A;  2BJD A;  4CXK A;  2MYF A;  4DS5 A;  1RZM A;  4B3M F;  3W9H A;  1WG4 A;  3AB2 B;  1HR0 F;  1FES A;  3GYX B;  4ZN1 A;  4CT9 A;  2YX1 A;  1S79 A;  3NKM A;  3D6H B;  1RT3 B;  2KT5 A;  4OQJ A;  3HSD A;  4DPW A;  4OLP A;  2ZUA A;  4O3S A;  5F8M A;  3LOU A;  4DX5 A;  2ACY A;  2ZKT A;  2W01 A;  2B5J B;  1VLO A;  2QFJ A;  3LPY A;  3PZP A;  5AJ3 F;  2L41 A;  1TKT B;  2V0N A;  3BGF A;  3H42 A;  4LRF A;  5EN1 A;  2ALZ A;  2I5J B;  4O44 B;  2AZ3 A;  2CG8 A;  4NRT A;  5HO4 A;  2IM2 A;  1KLN A;  2G4B A;  3CMQ A;  5GAG I;  1I94 J;  5KFJ A;  3AFG A;  2IJF A;  1OSC A;  1TL1 A;  3BSC A;  2ZM6 F;  4MK7 A;  2VB6 A;  4BBY A;  3PX4 A;  3H59 A;  2HVI A;  2FJD B;  3QPI A;  2X3D A;  1VJW A;  3HMJ G;  5HP1 B;  5AJ9 A;  2ZBP A;  3BDG B;  2EI5 A;  1I5O B;  1RHQ B;  3Q8Q B;  2FPH X;  2QC3 A;  4DL2 A;  1YG0 A;  3BYR A;  2N7C A;  2GHV C;  5THW A;  1LKZ A;  2CZ4 A;  4NA3 A;  2W5R A;  1W2I A;  1J27 A;  1GEH A;  4EMD A;  4HI2 A;  1E6Y B;  2BW2 A;  3BH7 B;  1U2F A;  1G1X A;  4LVO P;  4CYU A;  3FBE A;  2F9J A;  3M9O B;  1WTF A;  2H5J B;  2UUT A;  4NRU A;  1HHS A;  2BOA A;  4DUT A;  2YWW A;  4B02 A;  4U7C A;  3MF5 A;  2L48 A;  1B7F A;  2AJF E;  2EEY A;  4TN0 A;  3ADA C;  1Q1K A;  1AB8 A;  2XTJ P;  3KK1 A;  3IRX B;  4H4K C;  3DRS B;  3W7B A;  2K3I A;  3ITH A;  2HIY A;  3DXB A;  4DR1 F;  2RU3 A;  3O44 A;  3K5P A;  1ACM B;  1N36 F;  2H9Z A;  1REV A;  3CME S;  1FO1 A;  4B3R J;  3MEE A;  5LRN A;  1TL4 A;  3I56 S;  5MAO A;  4PYD A;  4NCG B;  4PXB A;  3QJJ A;  3CPW R;  1AJD A;  4CO2 A;  4C7Q A;  1QUV A;  1Y5L B;  4ES1 A;  2UZA A;  3SCK E;  4OYO A;  4WTO B;  2W7P A;  4CXU A;  1U1N A;  1NK5 A;  2DNH A;  1X4H A;  3HKW A;  4K2X A;  1FK9 B;  3DC2 A;  1LW2 B;  2CPX A;  1DAX A;  2AW0 A;  4CM2 A;  1OO0 B;  4EEY A;  1BMQ B;  1S0O A;  2ZHO A;  3B8H A;  5EHH A;  4WU3 A;  1RWM B;  2QL7 B;  2OPP A;  4ED7 A;  2OSR A;  1YVF A;  3WAV A;  2DK2 A;  2YQ3 A;  3BB5 A;  4MIA A;  4PWW A;  3KJQ B;  3MK1 A;  2ASL A;  3BF4 A;  4ZPV R;  2DGV A;  2OAU A;  1BY9 A;  5CAA A;  1LW0 A;  4HHJ A;  2BJE A;  2V8G A;  3L9Z A;  4TVA B;  3KLG B;  1KD1 T;  1JJ4 A;  3RUB L;  2E5L F;  2KZM A;  5KFU A;  1ELX A;  4BLG A;  1WHV A;  1FX2 A;  4C4W A;  4L75 A;  4LF8 F;  1XEZ A;  4DFJ A;  3KDO A;  2FC8 A;  4CO5 A;  2Q66 A;  4CI0 B;  3PW5 A;  3MM5 B;  3QAE A;  3S01 A;  2XHW A;  4QIW D;  1S72 S;  3GYG A;  2MKK A;  1SV5 A;  1UMJ A;  1FER A;  3CJ0 A;  4WJB A;  4PUO A;  1S6P B;  2YKQ A;  5ITH A;  3CD0 A;  2IFY A;  1QM9 A;  4WE1 A;  3A3O B;  1CLF A;  3L09 A;  4C0H A;  3BKU A;  2J9D A;  3DLE A;  2QZU A;  4DN0 A;  3OPK A;  3GJQ B;  4AXJ A;  1JLB B;  2AEF A;  4X64 J;  4OZ3 A;  3FEZ A;  4ID5 A;  4KKO B;  3K5O A;  3BQ0 A;  4NYP A;  1VRT A;  4KGX B;  1VC5 A;  1H7X A;  1IJE B;  1D9A A;  5KG6 A;  4DV7 J;  3KK3 B;  5JJB A;  2HIQ A;  1CJV A;  5DG9 A;  5BJR A;  2EXU A;  4DSI A;  4TN2 A;  2CJA A;  1LWF A;  1N5Q A;  2BE2 B;  3DFE A;  4USV A;  2CKW A;  4JI2 F;  3PG9 A;  2J7U A;  3Q8Y A;  3M8Q B;  2XS5 A;  2YTC A;  2V68 A;  1O98 A;  2IA6 A;  1WEZ A;  3CWJ A;  4EYH B;  2HHH F;  1JLF A;  1JJ2 R;  2CWX A;  3DRX A;  3I87 A;  3W8P A;  2JEF A;  3WBZ A;  2RT3 A;  5DS7 A;  2XLK A;  4LF6 F;  4KJI A;  5EGE A;  1CQN A;  4ELU A;  1NUE A;  2DPI A;  3GCW P;  1L3U A;  3AH6 A;  4Y2C A;  1C0T A;  2BDP A;  3TAP A;  4IOA Q;  5M2R A;  3SQG A;  1K8A T;  5DDR C;  1CS4 B;  1IKW B;  3PKY A;  1UVI A;  3W62 A;  2KHD A;  2XCA A;  2E1M C;  2NRE A;  2NYI A;  4AQY F;  4LSL A;  3KJN B;  5EUH A;  4P2X A;  1NCL A;  4DQQ A;  2MJN A;  4UUX A;  3Q2S C;  1HLW A;  4KAV A;  2CIM A;  4QOT A;  4F02 A;  4AUK A;  3G96 A;  3TZZ A;  1F9F A;  5IC4 B;  3TA2 A;  4CP5 A;  2BXJ A;  3O8W A;  4NEY A;  3CMR A;  4F0M A;  1KEK A;  1KLM B;  1S9G B;  3PYG A;  1UZH A;  2B5J A;  5BYR A;  1CC8 A;  1GXU A;  3R1H A;  1TKT A;  2IUC B;  1X31 C;  5BR8 F;  2I5J A;  3VAI A;  3TG0 A;  1R8B A;  4R0J A;  2D1G A;  5FDL A;  2DR8 A;  2DGX A;  2LQ8 A;  1FKO B;  4J9V A;  5F8N A;  4A8X A;  1B0V A;  2XO7 A;  3MPU B;  5H1S V;  4C9D A;  2AD9 A;  1HHT P;  2ZZM A;  4K4Y A;  4HL9 A;  2OPQ A;  3BSN A;  3RZA A;  1SXL A;  4KM4 A;  3MPY A;  1ZYQ A;  5HP1 A;  3FCW A;  1XMO F;  1KNZ A;  4WF9 Q;  4B3M J;  1HR0 J;  4RZR A;  3NBP B;  4X4O A;  3P49 B;  1NSK L;  3CJ5 A;  4NML A;  1JNZ B;  2I9S A;  3OTB A;  5KXA A;  4UF4 A;  5KFF A;  3HLU A;  5KG2 A;  2Z2L A;  3D3B J;  2XSF A;  1E3C P;  3A8K A;  2CVE A;  1DRZ A;  1GMW A;  1U4B A;  2HQG A;  3DOM B;  2ZE2 B;  5AJ3 J;  1KP6 A;  4CCH A;  2I38 A;  3C14 B;  2GA3 A;  3DRR B;  4FPI A;  2AGO A;  3CCS S;  3PM9 A;  4DS4 A;  5K20 B;  1UEV A;  2ERR A;  2HRY A;  1N52 B;  3ZXW A;  2ZM6 J;  4Q0B B;  4F4X A;  4WII A;  1S12 A;  1FDD A;  3VAH A;  1T7P A;  5F9N A;  1AA1 B;  1WC5 A;  1NB2 A;  3IRX A;  3KK2 B;  4Y2M A;  2KT2 A;  5KFN A;  3DRS A;  2VG6 B;  1NND A;  4I69 A;  4QYR A;  1GAO A;  4BDP A;  2MJU A;  3M32 B;  1CSJ A;  2UVV A;  5IT0 A;  1RBO B;  2JVO A;  2HHV A;  3CCM S;  2FVS A;  2NPF A;  1VQY A;  4RUH A;  3Q0A A;  1V9O A;  2MY8 A;  4I6W A;  2PII A;  3P4U B;  4YHH F;  3M2V A;  5L38 A;  2PD1 A;  2AV5 A;  3MM9 B;  2FHM A;  2VPW B;  1BQX A;  2MHE A;  3NG8 A;  2QGF B;  3I31 A;  1FEH A;  3TOQ A;  2JDJ A;  2CPY A;  2H4W B;  2ZBC A;  1RUS A;  3MUV P;  5D0E A;  2ZH5 A;  1D09 B;  4JI1 F;  3W61 A;  1KHV A;  2QE5 A;  3HHK A;  3KLH A;  1FK9 A;  1YSJ A;  4N8N A;  4J90 A;  1NK6 A;  4ZIW A;  2ZH9 A;  4Q2L A;  3RTV A;  1KFD A;  1BWE A;  4I68 A;  3K8V A;  4P72 A;  1VBY A;  2DNY A;  3PEH A;  3R7B B;  2ZOF A;  2HBR B;  4WIQ A;  1RT4 B;  1S59 A;  2WW8 A;  1N36 J;  3OBI A;  5ETQ A;  5JVH Q;  1SL2 A;  3HKZ D;  3J7A N;  1JLE B;  4WBF A;  1ZM9 A;  3PYF A;  4HI1 A;  4TYA A;  1BD6 A;  1NXI A;  1O8B A;  5DDQ C;  1FRM A;  2XO6 A;  2D74 B;  5L1K A;  3RRK A;  4CLF A;  3BN7 A;  1K9M T;  3KLG A;  4DUY J;  5B08 A;  3RBZ A;  4KFB B;  4DDF A;  5IZH A;  1VRQ C;  2ZBR A;  3M6V A;  1FKA F;  2EG2 A;  4CIO A;  1SHQ A;  1KS2 A;  4NWJ A;  3W2W B;  5KT6 A;  1IQT A;  2PC6 A;  4ZMM A;  1VQ8 S;  4DOZ A;  3T5J A;  2X3G A;  5KFL A;  5GAH U;  4PWD A;  2ROP A;  1S6P A;  3PY8 A;  4BCA A;  3PX0 A;  2VBZ A;  3U7J A;  2V9K A;  4Y2I A;  2VFV A;  4RUA A;  4IOC Q;  2OML A;  1HWL A;  4Z7Y A;  4XPE A;  4U7U D;  3JYT B;  3F0N A;  4M5I A;  2EFG A;  1JLB A;  2RF2 A;  3G87 A;  1XMQ F;  3M8W A;  4CXS A;  4PQA A;  3AOB A;  4KKO A;  1KVI A;  4PG7 A;  2CNO B;  3NMR A;  2G0J A;  3A52 A;  4I2P A;  1S10 A;  1EAR A;  5DQI A;  3MAH A;  3KK3 A;  3MAA B;  2HNZ B;  2E5L J;  2KU7 A;  3BGO P;  5AXL A;  2NLW A;  1UWB A;  1R7I A;  1MN9 A;  4LF8 J;  2BE2 A;  1BXN A;  3AT1 B;  2FIU A;  3SEO A;  3HHL D;  4NZ6 A;  4NX9 A;  2C2E A;  3ILL A;  1N48 A;  2M8D B;  4KT0 C;  2DH7 A;  2NCK L;  3M8Q A;  3CC2 S;  2A0F B;  1JMT A;  3CJS A;  3P6Y C;  2J8A A;  2FHK A;  3FNN A;  2HPU A;  1VIS A;  2DO0 A;  4M5K A;  2C3Y A;  2Q79 A;  1TVR A;  3G2X A;  3NGT A;  1RT2 B;  2HBQ B;  2Y8W A;  4EGL A;  1VCT A;  4WXW A;  4ATN A;  4G1I A;  2F3J A;  3EPG A;  5HBM B;  1YJR A;  1EQ0 A;  1CS4 A;  1IKW A;  1DLO B;  4L73 A;  4Y00 A;  2NZ4 A;  2HWI A;  2AZ1 A;  3M2U A;  4B17 A;  3A3N B;  1TV6 A;  3G9C A;  3HSZ A;  1K1Q A;  3BPS P;  3NOG A;  2W8K A;  2YNH B;  3M4X A;  1KTQ A;  5IS2 A;  3FVY A;  2ZIT A;  1BLU A;  4JI2 J;  1XC9 A;  4ZLL A;  2FC9 A;  5A8W B;  1JNR B;  1KVK A;  3IR5 B;  4OYA A;  2HHH J;  3SSR A;  2IUC A;  3LAK A;  3T19 A;  5KFY A;  3UQS A;  2MKI A;  3CVK A;  4NLU A;  4LF6 J;  2OMO A;  1FDA A;  2A3J A;  2MDA A;  1TL7 B;  3CTR A;  3LH2 S;  3QO9 B;  2QFI A;  1FKO A;  1EQM A;  3TP2 A;  2M9K A;  3H2L A;  3GSI A;  4ZGA A;  1RAB B;  3QFW A;  1CJT B;  4AQY J;  4NYO A;  2XG8 A;  4XDC A;  1U1O A;  4DQS A;  3NBP A;  2FHJ A;  1ARO P;  5ETM A;  3QT7 A;  3R8Y A;  2H3E B;  4F67 A;  2IMO A;  3CJT A;  1T9Y A;  4H54 A;  4OJ1 A;  3IWN C;  3BBF A;  2H48 B;  3L7U A;  2G9Y A;  4KJG A;  4WWS A;  3PDN A;  2RIL A;  4B9V A;  1E2S P;  3DOM A;  4QWC A;  2ZE2 A;  3C14 A;  3DRR A;  1I1G A;  5BR8 J;  2CPH A;  2KG0 A;  3QGG A;  3B78 A;  2JEJ A;  4YB7 A;  2HWH A;  3KNG A;  4URQ U;  1N88 A;  4NLV A;  3LTO A;  3MR2 A;  2MZ1 A;  3Q22 A;  3OTC A;  1SC1 B;  3E01 B;  4Q0B A;  5IOL A;  2LXI A;  2BQ3 A;  5TJ3 A;  3KK2 A;  2VG6 A;  3FJ2 A;  4C8M A;  1XMO J;  1Q7Y T;  2WSF C;  3KHL A;  2WAQ D;  5H9F K;  1QTN B;  5GVQ A;  1VMB A;  3HT0 A;  4ZCK A;  4RUB A;  4C3M A;  3K89 A;  4RNM A;  3TAQ A;  4ZVE A;  4HAC B;  1D8Y A;  3CCT A;  1ED8 A;  1B0T A;  3W2V B;  1QLN A;  3J7Z T;  5ETV A;  4A8M P;  2YKA A;  3MM9 A;  1SKR A;  5KTQ A;  2QN6 B;  3NKQ A;  5E3A A;  4ZP8 A;  2UVW A;  4U7U K;  4NAS A;  5HN0 A;  1HQU B;  4CLW A;  2ZDP A;  5IQ6 A;  4PQU A;  3LAL A;  3E51 A;  4C11 A;  2XMU A;  1Q95 G;  2AJ4 A;  2DO4 A;  3POT B;  4FKX A;  4E2F B;  4EBD A;  3HF5 A;  1N2L A;  2ZH2 A;  3SZZ A;  1XR5 A;  2W2P P;  1GMU A;  1PBA A;  1PCA A;  1Q7L B;  2W24 A;  2C3P A;  1U2R A;  3HHN B;  1QY7 A;  4ZCL A;  3H25 A;  2FJX A;  2C2Z B;  1ZS6 A;  2GFF A;  1Y3J A;  4XAK A;  3D6T B;  1H2T Z;  4QWD A;  1RT4 A;  2YX4 A;  2WB4 A;  4G1P A;  2OSQ A;  5LXR A;  1UAW A;  4JBC A;  5LIA A;  1C4A A;  1JLE A;  2C1E B;  4YHH J;  3KUG A;  2JNJ A;  2KZZ A;  3MFI A;  4URS A;  3VQT A;  5IJQ A;  2KH9 A;  2GZO A;  5C66 A;  2CNN B;  2PMW A;  1GXT A;  1C1B B;  4LF5 F;  2RHS B;  4ZIV A;  1GX6 A;  4JI1 J;  1BUX A;  1RBL A;  1M1H A;  1BHN A;  1M90 T;  4ED1 A;  1AFI A;  3M30 A;  2XM3 A;  4UY8 5;  4ED2 A;  3D0G E;  2KJW A;  2BJ9 A;  4FXV A;  1KN6 A;  5E41 A;  3MOJ B;  3SDE B;  1X0F A;  1G4C A;  2KT3 A;  2OH2 A;  1KHK A;  1VQO S;  3JYT A;  4F26 A;  1IKV B;  3CED A;  2WHO A;  1RU2 A;  1HJK A;  1SQE A;  2XY5 A;  1UKU A;  3S1T A;  2RAQ A;  1Q8B A;  2DH8 A;  1IXK A;  2UV8 A;  3DOL B;  3D0H E;  4QW8 A;  2J0S D;  1MSW D;  2RS2 A;  5LL6 d;  4DFM A;  3D67 A;  1S1W B;  4JOU A;  3MAA A;  2GHW A;  3UDL A;  2MTL A;  4YB5 A;  3IA0 A;  2BA9 A;  1FCA A;  1RU1 A;  3A3P B;  2F8H A;  2DGW A;  3MD3 A;  5D4P A;  3ISN D;  4LR7 A;  1HW9 A;  2Q3P A;  3BS9 A;  2EFO A;  4A8W A;  3DDK A;  3I4H X;  3N01 A;  5D77 A;  5GAH I;  2VL1 A;  1SL1 A;  4J9O A;  4BC9 A;  2IAJ B;  1TKD A;  2EFQ A;  2CPJ A;  2O66 A;  1RT2 A;  2GNK A;  1YQH A;  4USH A;  1XMQ J;  3MDF A;  5HBM A;  1FD2 A;  5CAB A;  2OKQ A;  1DLO A;  3WAX A;  1RHK B;  1OPZ A;  2V2V A;  2BQU A;  4PRF A;  3EUN A;  5HK4 A;  1TUW A;  3F56 A;  4PPD A;  1N2K A;  3EXY A;  2MLY A;  3HPO A;  4IG3 B;  2A6M A;  4CLZ A;  3PIO Q;  3ICL A;  1RQ0 A;  5J2M B;  4IRK A;  2KFY A;  5M2P A;  4WKR A;  3HHL C;  4DR6 F;  2K1R B;  5AE2 A;  4CM0 A;  1XK8 A;  1ZZF A;  4L72 B;  3JQK A;  1KDN A;  2BM0 A;  2KYZ A;  3AAW B;  3RB6 A;  1IN0 A;  2CQ0 A;  4USK A;  1XR6 A;  4DPU A;  3CIZ A;  1TL7 A;  5L1I A;  2ZWP A;  1HKA A;  3KMQ A;  2V4J B;  3QO9 A;  3WDO A;  4IDK B;  1QSS A;  5ETP A;  4USW A;  2LEA A;  1LXN A;  2D41 A;  2RHQ B;  1KBR A;  2KRB A;  3VVT A;  4EO8 A;  2C42 A;  2HFZ A;  1CJT A;  3GFX A;  1XNQ F;  4ED0 A;  2LXF A;  1VRU B;  2QZ8 A;  2ATL A;  5H9E K;  4N41 A;  1EX8 A;  2RS8 A;  2XLJ A;  4A8F A;  3D0I E;  3E2E A;  4OL8 A;  4CH7 A;  2D69 A;  2UUA F;  4C0B A;  3W9I A;  3H0P A;  4GTZ A;  1OYE A;  2VDI A;  2OFH X;  4N47 A;  1DQA A;  4JV5 F;  1P9Y A;  3ILJ A;  3GSD A;  4UOC A;  1S97 A;  5L9N A;  2OI2 A;  1U1P A;  1RHM B;  5JUM A;  1HNW F;  5ADZ A;  1XMB A;  3KJV B;  1BQN B;  3E01 A;  1F1B B;  2BZ2 A;  4CRJ A;  3TX0 A;  3D6F B;  2DHX A;  2VOO A;  4LQY A;  2AJ1 A;  1AZS B;  3OHB A;  3K5M A;  2OHD A;  1G3O A;  2HHQ A;  1U0H B;  3BKT A;  3MEC A;  3KMS A;  2JX2 A;  4DZD A;  1TK5 A;  3UNY A;  5ETL A;  3IFE A;  4RBV A;  1LWC B;  4HAC A;  2AWZ A;  2A18 A;  3FMW A;  1S1U B;  1Q8L A;  4ALZ A;  3W5Y A;  3Q8R B;  2HFV A;  1U8S A;  2VC0 A;  2R42 A;  1TMM A;  3D2W A;  2YPY A;  2R7R A;  3TQE A;  3AD9 C;  5F3T A;  2OPR B;  2HBZ B;  1N4L A;  2ZD1 B;  4LRA A;  4NL5 A;  3TVZ A;  4MT1 A;  3GZ7 A;  1HQU A;  2X1F A;  3JQM A;  1IR0 A;  4U8Y A;  3JSR A;  5HVF A;  1HNZ F;  1RTD B;  1Y9O A;  1TK0 A;  5KG5 A;  3DCA A;  2H54 B;  3HD1 A;  2WVF A;  2R7S A;  4KGZ B;  3LP1 A;  2E66 A;  2ILZ A;  1WD6 A;  5ETS A;  1E1Z P;  3H2V E;  2HQD A;  3P3D A;  2RU9 A;  2B4O A;  3H5X A;  1N33 F;  4TY8 B;  1FI4 A;  2L08 A;  4N76 A;  4RW7 B;  5L1J A;  1WEY A;  3SZ2 A;  1JB0 C;  4LIW A;  1Q82 T;  2VKZ G;  2CAJ A;  2PT0 A;  3GJS B;  5DJB A;  1FX4 A;  3MMC B;  4ITS A;  2W2N P;  3M6U A;  5KFB A;  1UET A;  3CSK A;  4K8R A;  2DXE A;  2IM3 A;  4QU6 A;  1F2G A;  1C1B A;  1I51 B;  4C2M A;  2GIF A;  2HUR A;  2KG1 A;  3QZ8 A;  3BGL A;  3IBW A;  1F5B A;  2M88 A;  4QWE A;  3CC4 S;  1OQ6 A;  2IDL A;  2DD8 S;  5BYS A;  1DBD A;  4LMZ A;  3WC2 A;  4W90 B;  3TJA A;  1CBK A;  2Q6C A;  2OEL A;  3W66 A;  4GVB B;  1HI0 P;  2GLQ A;  4IUF A;  1LWX A;  4DV2 F;  1HQA A;  2QYC A;  4OZ0 A;  1EET B;  1FTR A;  4EBE A;  5CQG A;  4B3O B;  3V6H A;  1R6V A;  2XB2 D;  1CJU B;  2ROG A;  3DU6 A;  1WF2 A;  4M95 A;  2LDY A;  2A1B A;  4KE5 A;  3BO4 A;  5CYM B;  1VHI A;  1VGY A;  4LF5 J;  4WU2 A;  4X4N A;  3IG1 B;  1WOR A;  1H2V Z;  3C15 B;  4QR0 A;  4WYL A;  3ET6 B;  2CJ9 A;  5I42 B;  5D3G A;  3QRR A;  5IXU A;  2DNZ A;  1PG5 B;  2M8H A;  2Z56 B;  1SJ1 A;  2Q1L A;  1AJA A;  3NRB A;  2DJW A;  2IAJ A;  3R1L A;  4DV4 F;  1RBA A;  4ZPT R;  4F8R A;  3Q24 A;  2YWG A;  3M1V B;  1LK7 A;  1NPR A;  4OYW A;  4GO5 X;  4RL1 A;  4UOR A;  2K06 A;  3ZTS A;  5JMN A;  3RBX A;  3CCL S;  4UQT A;  5ETO A;  3UR3 C;  2EG1 A;  4K59 A;  2CYY A;  2GAH C;  1FNX H;  5GMD A;  2YWH A;  4ZP7 A;  2HFU A;  5L1L A;  2F1F A;  4CTA B;  1RLC L;  2IDE A;  4F0K A;  4IG3 A;  4JI3 F;  3OJU A;  4LFB F;  1XN9 A;  2KXN B;  5J2M A;  2BV3 A;  5HRT A;  1DQ8 A;  1Q5V A;  2K1R A;  2C2M B;  4ZDN A;  4DWI A;  1RTJ B;  1FJG F;  1NJW A;  1SBR A;  1BWV A;  2OEJ A;  1OWX A;  2JLG A;  5A8R B;  4PR6 A;  2MEW A;  4RBU A;  5IV4 A;  2V4J A;  1FVQ A;  1FE4 A;  3MK2 A;  4MHX A;  2NSC A;  3KWM A;  1FWP A;  4ZPW R;  4LF4 F;  3BPD A;  5F41 A;  4DL5 A;  4DSL A;  4FF1 A;  2WTF A;  1VRU A;  1D8Z A;  2QLJ B;  1VI7 A;  4L76 A;  3HM9 A;  4C97 A;  4DSJ A;  3T5L A;  2HS3 A;  4F25 A;  4DV6 F;  4LF7 F;  2LQB A;  4FYD A;  2H5E A;  1P6T A;  5CHC B;  4DR6 J;  3FSY A;  2ZVS A;  1NSP A;  3JQJ A;  2ASD A;  2MLX A;  1O5J A;  4RUC A;  1URN A;  3AY0 A;  4ZG6 A;  1FKP B;  1FD8 A;  2J7W A;  3MR5 A;  2WSC C;  4F4K A;  2LLZ A;  3V4M A;  4QIF A;  4CO4 A;  3HZE A;  5DGB A;  4I1T A;  2QV6 A;  1VOM A;  4J9U E;  1N56 A;  1Y7P A;  1K0T A;  1KFS A;  1BQN A;  1W25 A;  2EVZ A;  1MLA A;  4NEZ A;  1SJ4 P;  3ZZ0 A;  3GQC A;  1AZS A;  1XNQ J;  4DR7 F;  5KFE A;  2ZJR Q;  3OL7 A;  4M5D B;  2HK3 A;  5KT3 A;  2CPZ A;  1RKJ A;  1HAR A;  2BAN B;  2O67 A;  4J9P A;  4KPY A;  2QLX A;  2W4P A;  4FBU A;  4YDD B;  4Q7A A;  4LQ9 A;  1OYD A;  2UVR A;  2FQQ B;  3L4B C;  2EPI A;  3PCO B;  2UUA J;  1S1U A;  2BJ7 A;  2QIF A;  2PN6 A;  5DQH A;  4ERD A;  2P6S A;  3ZZU A;  3HVT B;  2VV5 A;  2ZKU A;  4JV5 J;  1EHW A;  2OPR A;  5HMX A;  5L0E A;  2B9Y A;  2WCX A;  1F5A A;  1YTY A;  1SUQ B;  3QGH A;  3D1Q A;  1RAI B;  3SFG A;  3WAW A;  1SC4 B;  4EWT A;  1U8W A;  1RTD A;  4WZQ A;  4WFY A;  2AEM A;  4KGM A;  3GCX P;  4GTX A;  2C2D A;  1AFJ A;  3MM8 B;  5K4P A;  2XS7 A;  3ENA A;  4ED4 A;  3K0J A;  2ZDO A;  4O3O A;  2ZEJ A;  2GS8 A;  1URA A;  1T95 A;  2CZV C;  1ANJ A;  2QMX A;  4LF1 A;  3VAK A;  3ILI A;  4TY8 A;  3BN4 A;  4QYZ K;  2MKS A;  4RW7 A;  3IR6 B;  2MKJ A;  1HFE L;  3MMC A;  2CNL B;  3NVL A;  2R8K A;  2B4U A;  1YRT A;  4PXC A;  1NPP A;  3BGR B;  1WWH A;  3AQO A;  3DU5 A;  1F60 B;  1XBW A;  2HNY B;  5T41 A;  1HNZ J;  1UFK A;  1RT7 A;  1HA1 A;  1VIO A;  2F5G A;  2DHH A;  3FQK A;  3EVW A;  2BJ3 A;  2HHU A;  4UST A;  4OI3 A;  5LSL A;  1ALH A;  2JC0 A;  3LWL A;  2CVI A;  4GVB A;  4DX7 A;  1WJ9 A;  2PSZ A;  5A6P A;  3T02 A;  1N33 J;  4C0O C;  4DL4 A;  2VFS A;  1RT6 B;  2C3M A;  5DM7 Q;  3UDV A;  4B3O A;  2VAS A;  5KOW A;  1CJU A;  1Y11 A;  2IVF B;  3Q8S B;  4QR1 A;  4Q2M A;  1TZ0 A;  3CCQ S;  2Y1J A;  2X1G A;  2CQ3 A;  4YOE A;  3C6U B;  3TUI C;  4C6A A;  1UVM A;  2M2B A;  3GTY X;  1NK8 A;  5CYM A;  4MY4 A;  3EGZ A;  3IG1 A;  1U47 A;  4RW9 B;  2E1C A;  4UPH A;  3LA0 A;  5I42 A;  4ZPC A;  3FEX B;  2EFV A;  1MWY A;  5IFM A;  4P71 A;  1TAU A;  4LBH A;  2KB2 A;  1P8G A;  3SZY A;  1APS A;  3PAC A;  1FJE B;  5EWE A;  5SZT A;  2C22 A;  5KFM A;  2ACM A;  4USM A;  2GJI A;  2BM1 A;  3KLE B;  4L3N A;  2AX0 A;  2CNK B;  2BUN A;  2J0X A;  2ANH A;  5HJY A;  3M1V A;  2NXC A;  1FRH A;  3TEG A;  3U1M A;  4DV2 J;  3MMJ A;  2ZH4 A;  2VDH A;  2CQB A;  2EW9 A;  1UWA A;  2R7W A;  4N8O A;  1LNQ A;  4OHZ A;  2DR7 A;  4ANE A;  3D7S B;  4RX6 A;  3R5J B;  2WOM B;  3DGP B;  5GAD I;  4DPO A;  1ZOT A;  3EJM A;  2XLI A;  4X4U A;  4QAX A;  4ETX A;  3VZH A;  3JTN A;  2LDI A;  1Q81 T;  1QD1 A;  4PG5 A;  3EGW B;  1VC0 A;  1YWX A;  3QJL A;  2R7U A;  3IBC B;  2DB1 A;  4AT1 B;  3GLJ A;  2IYI A;  3VGV A;  2MQM A;  1VLY A;  2QL5 B;  5LT5 A;  4DV4 J;  5A8R A;  1ELY A;  1BE4 A;  2RQM A;  3ONQ A;  3W1Y C;  5DDP C;  5KFP A;  4CZC A;  2MQQ A;  2DRA A;  1V3S A;  3CGI A;  3I32 A;  3UD3 P;  3Q83 A;  2V4Q A;  3KLI B;  3NS6 A;  4DFP A;  2BEF A;  4BS2 A;  1SKS A;  4JI7 F;  3Q8U A;  1CEZ A;  2VD3 A;  3BR9 A;  4DPY A;  2IRX A;  5A6W A;  4DI6 A;  1F6T A;  3D1H A;  3HHL B;  2QA4 G;  4JI3 J;  4BC7 A;  4LFB J;  1S4F A;  4XIU A;  1RAE B;  4K4U A;  3HP6 A;  1TL3 A;  1K7H A;  3S7R A;  2W5T A;  4UUW A;  3JSM B;  1TL5 A;  1QAY A;  1QDU B;  1ALK A;  3CCR S;  4DF8 A;  5KFK A;  1FJG J;  2V2Z A;  1IVZ A;  2AF6 A;  5KFZ A;  3C2P A;  4UOG A;  2ASJ A;  1LOU A;  2LVW A;  1U1L A;  3BKF A;  3UI3 A;  2RQ4 A;  1R0A B;  2J9C A;  2YQ1 A;  1RWO B;  3BV8 A;  4DR4 F;  2E5I A;  1ROF A;  2DY1 A;  4LF4 J;  3BQ2 A;  3MR7 A;  3Q3Q A;  2DBB A;  2VA2 A;  1TUV A;  2V67 A;  1YRX A;  3W63 A;  4OI4 A;  4M5D A;  2J0Q D;  4F2S A;  2BAN A;  2DR6 A;  1RAJ A;  3WIU A;  4LF7 J;  4IRC A;  3EDQ B;  1KSP A;  2Z8Q A;  2B7B B;  2IRU A;  1VQK S;  5F3Z A;  3Q2T C;  3PYD A;  3HVT A;  2VPZ B;  2RSQ A;  3AOD A;  1NM2 A;  1LFP A;  3IGZ B;  2OD4 A;  2IVY A;  1TFY A;  1HW8 A;  1EW2 A;  1V6H A;  4ZHR B;  3JB9 k;  3AD7 C;  1HL6 A;  2ILY A;  5T14 A;  3RBE A;  1WKJ A;  1REV B;  2QEX S;  2W8D A;  1M5V C;  1FFG B;  3MM8 A;  1WSV A;  1EI6 A;  2H1Y A;  3MPD A;  4DR7 J;  2G2O A;  2B3T B;  3NWR A;  3OT9 A;  2N3L A;  4DPT A;  2UP1 A;  4ZG7 A;  2R7O A;  2XY7 A;  1Q78 A;  1UCN A;  1SB6 A;  2AJ0 A;  5SUH A;  5B0E A;  3LPE A;  1JKH B;  4ZPD A;  3EWG A;  4OX8 A;  1PIE A;  4DLE A;  1YKW A;  1HDH A;  2KRR A;  3RB3 A;  3CIM A;  4B3T F;  2RNE A;  2QO3 A;  1B64 A;  3I55 S;  6FDR A;  1IBL J;  2UXC F;  2DHS A;  2MKH A;  3U1N A;  4PXD A;  1NPK A;  3ZZR A;  2B9W A;  2R9L A;  1M1G A;  1EQJ A;  3MPW A;  4OI0 A;  4ZCM A;  3ZZO A;  4FXD A;  4ZVU B;  5E33 A;  3J7Y I;  2HNY A;  3L7P A;  1M5H A;  4MIW A;  1HWK A;  2MKY A;  4K4Z A;  2W9B B;  4IRD A;  1RCX B;  2DXD A;  2G0I A;  4IYQ A;  4GC6 A;  3Q23 A;  3EDR B;  1LW0 B;  1C1C B;  1SJR A;  3FRY A;  3MTJ A;  1OIA A;  2H65 B;  1S0N A;  2VF3 A;  3DOK B;  5LQQ A;  4JB8 B;  1YZ7 A;  3M05 A;  4TLR A;  5HQ8 A;  4OJ3 A;  4DU8 A;  4DV0 F;  1RT6 A;  4RW6 A;  3EVO A;  1JJC B;  4B3S F;  1X4F A;  2EBG A;  4Q8E A;  5IC6 B;  1SVD A;  1LV5 A;  2DGQ A;  4X65 F;  2V8H A;  2WRM A;  3T1H F;  2WB1 D;  4M5M A;  3KUH A;  2BVZ A;  3C6U A;  1S48 A;  1WNE A;  2KDO A;  2FJV A;  3M9M B;  2HFN A;  1NO8 A;  2DEJ A;  5KFV A;  1C0U B;  2QTW A;  4Q5V A;  5LMN F;  4JUZ A;  2CA9 A;  1U02 A;  3T00 A;  4F3M A;  4NOH A;  1W7W A;  2NYH A;  3TW0 A;  1G2E A;  1U1Q A;  4X66 F;  4RNH A;  3VAM A;  1YK9 A;  2W8L A;  1HMV B;  1VRT B;  1H0H B;  4LR8 A;  2FJA B;  3KLE A;  4JI4 F;  2RKI B;  4W98 A;  3EGV A;  1M5K C;  3W3S A;  3EZ5 A;  1WKL A;  2P5V A;  3LQV A;  2VIC A;  2J9D E;  1B7Y B;  2XMM A;  4F7V A;  2YWK A;  1P9Q C;  3R2C J;  2XR9 A;  1J2V A;  3ZTP A;  1PJ7 A;  1MN7 A;  5L46 A;  2WOM A;  3DGP A;  4ICL B;  3QJP A;  3EZU A;  4LFA F;  2LP4 A;  2RQK A;  2CDR B;  4IO1 A;  3DGV A;  3UD5 A;  1B0P A;  4O23 A;  4UW2 A;  1UP1 A;  5ETT A;  1VQL S;  4ZG9 A;  4UZB A;  4YN3 B;  3VZI A;  4QBU A;  4B9U A;  3VAG A;  5D0H A;  3K17 A;  3MCS A;  4TQS A;  4DLG A;  2CPD A;  4WTY A;  1DHM A;  1DUR A;  1P1L A;  4LSL B;  4X4V A;  2RML A;  4ZLN A;  5LSO A;  3HFK A;  2WSE C;  2W5V A;  2HMI B;  3CD5 A;  4GTW A;  4GRS A;  3QT8 A;  2GA7 A;  2PO4 A;  1N0V C;  4OZ2 A;  4ZKA A;  3KLI A;  2F7V A;  3LF0 A;  2Y0B B;  2BOP A;  5K5M A;  2Z58 B;  2MQ8 A;  4K4X A;  5HMW A;  1Q79 A;  3FRZ A;  3TWZ A;  3BYP A;  2OJ3 A;  4UOO A;  3HD2 A;  4NZ7 A;  3SSS A;  4CO1 A;  1HBO B;  3MUM P;  1FRK A;  2UUB F;  1N5V A;  3HHL A;  4V19 J;  5FDL B;  3IO1 A;  3MED B;  4WXO A;  5KFQ A;  4ZK7 M;  4IKA A;  2ZZN A;  4KTQ A;  3DM2 B;  3QGI A;  2VFU A;  3JSM A;  1SJ3 P;  3MGJ A;  3N4W A;  4IH7 A;  3GII A;  2IA0 A;  3QGP A;  4DHV A;  2OPQ B;  2KO1 A;  5CA5 A;  2OTJ S;  3OVB A;  2KN4 A;  1KKH A;  1U2C A;  5HVG A;  4DQP A;  2YNI A;  2BE9 B;  2VJV A;  3DHW C;  5E3R A;  1RWW B;  1R0A A;  4B08 A;  5AXK A;  2YNF B;  3R2D J;  2JLE A;  2FZG B;  2HVD A;  1WOO A;  2SXL A;  2WBM A;  3DLG B;  1RP5 A;  2J5A A;  3W65 A;  2IJR A;  3P96 A;  1FJC A;  4JI7 J;  1M1K T;  3BO3 A;  3TQ1 A;  1NK4 A;  3FBF A;  1YLX A;  4ECZ A;  1CUL B;  4ZVF A;  5KFD A;  2P6T A;  3UE2 A;  3QWP A;  1MU2 B;  1NDP A;  3HCX A;  2F4F A;  3IMQ J;  2DGT A;  5KG4 A;  1ZET A;  1FVS A;  4OHW A;  2VC1 A;  3RR8 A;  3M8R A;  2CJB A;  3K5N A;  5CXT A;  4LJM A;  4OYI A;  3N6L A;  4E8U A;  4CYR A;  4P6Q A;  4MFB B;  4AFF A;  3UD4 P;  4ZVR B;  2IBO A;  4DJB A;  3PHT A;  1LFW A;  5FD1 A;  4WFZ A;  3X3U A;  4ZHR A;  4IO9 Q;  2Z4P A;  4DR4 J;  2GIR A;  2NXJ A;  2O5D A;  3QID A;  1EW8 A;  1N8R T;  3E2D A;  2CXE A;  3H5U A;  4A8Q A;  1RB0 A;  4C8Y A;  4ECV A;  4ECT A;  1KQS R;  1ZED A;  4B56 A;  1S7H A;  3T9Z A;  5B0B A;  4K4S A;  2F4V J;  3VAJ A;  4K5R A;  3PKM A;  3MM6 B;  3M2V B;  3GPA A;  1JKH A;  2UUC F;  4DUY F;  3RB0 A;  3MAQ A;  1UA0 A;  5EGH A;  4MK8 A;  5CD4 H;  3PEJ A;  3DYC A;  1YBT A;  4FP9 A;  4CH1 A;  1FDN A;  3KLH B;  3CDU A;  2ZJQ Q;  9RUB A;  1ZTW A;  2CAD A;  3H40 A;  3THV A;  4QW9 A;  5DM6 Q;  1KC8 T;  3BDP A;  1U49 A;  3NNA A;  5HL7 Q;  1JLA B;  4U8V A;  1XWL A;  1Y5N B;  2CQH A;  2XZD B;  4YS2 A;  2YH0 A;  1FXR A;  1YDL A;  1LXJ A;  1Q8K A;  2DGU A;  5F8I A;  3SBM A;  1XR7 A;  3T1A A;  2W9B A;  6AT1 B;  2HZV A;  1PAE X;  1UEU A;  3ILO A;  4NXM F;  1TKX B;  4MKA A;  2C2K B;  1C2P A;  3DXS X;  2UU9 F;  5I3U A;  5A8K A;  3IRW P;  1Y5I B;  1C1C A;  4JYA F;  3VR1 A;  3HJF A;  1S49 A;  3FSX A;  2EKY A;  1SJQ A;  2GML A;  3G6E S;  3I0R A;  3DOK A;  3FZ2 A;  4FYW B;  5DO2 A;  4F36 A;  4CYS A;  4ILM A;  2PMZ D;  4I2Q A;  1GTE A;  4EUV A;  2DNL A;  1X60 A;  4QIG A;  4B3T J;  3V4I A;  4AL5 A;  5J2P B;  3OUY B;  4PWD B;  3NNC A;  2UXC J;  3B6B A;  4GO7 X;  3DDN A;  2HGL A;  4QZV B;  3CUN A;  2PE8 A;  3DRP A;  3DI6 A;  1RDR A;  5C2G A;  3TAR A;  5CZX A;  1NHV A;  5KAK A;  1C0U A;  3MUR P;  3V81 B;  2QJ3 A;  4GMK A;  1QUP A;  1VQ6 S;  2RF2 B;  5GOV A;  4CLU A;  2HSE B;  5C2C A;  2Y1R I;  4J37 A;  4DCP B;  3BBC A;  3RRH A;  3EYZ A;  4I2P B;  3NXZ A;  2QMW A;  1HMV A;  4LRC A;  1WG5 A;  5DDO C;  4C8O A;  2RKI A;  5KFO A;  2CDQ A;  1YJT A;  1F9E B;  3C16 B;  4ILR A;  2ABY A;  1UWB B;  4DV0 J;  4B3S J;  3OR1 B;  5J1N A;  2VOP A;  2XGP A;  4X65 J;  5IQQ A;  3T1H J;  3ZC4 A;  3FK4 A;  1D3W A;  4OYP A;  1UTA A;  3R5A A;  1RAH B;  2DNR A;  4ICL A;  2RVJ A;  4O3N A;  4JI0 F;  1TVR B;  3P5B P;  1ZM2 A;  5LMN J;  5E2Q A;  4DZ6 A;  3W64 A;  3UFC X;  2X1A A;  4X66 J;  3IM8 A;  1SJF A;  4X62 F;  4HHH A;  1CJK A;  4JI4 J;  3M2U B;  1DJ0 A;  1VS3 A;  1S5Z A;  3UWT A;  2V2Q A;  4NLY A;  1TV6 B;  5EDW A;  4DX8 H;  4FBT A;  3EE3 A;  2HMI A;  2E9T A;  3F44 A;  3DN9 A;  5KFG A;  2AJ2 A;  5KFX A;  2MLZ A;  2HQ3 A;  5D0G A;  1KQK A;  2LU1 A;  1HHQ A;  4MIV A;  2NXU A;  4LFA J;  4U96 A;  4K2J A;  4H4O B;  2UV8 G;  2Y0S D;  3HUL A;  1HBO A;  1HI8 A;  3K5L A;  3CD6 S;  5KFH A;  2D9O A;  4PG6 A;  3IC1 A;  2MGZ A;  3MED A;  3CJR A;  5L0K A;  1FE0 A;  4I6A A;  3DM2 A;  3G6Y A;  4CQ1 A;  4ZLP A;  1P1T A;  2V63 A;  1VQ5 S;  4DV1 F;  3BEG B;  2Y8Y A;  2ZH7 A;  3V6J A;  4GTY A;  2QA2 A;  1JWW A;  2CJX B;  1CPZ A;  3TVY A;  1DZ5 A;  2APO A;  5HLF A;  2JH3 A;  3PRV A;  3D28 A;  2FGO A;  2ZNY A;  2XYG B;  3H2U B;  4NLX A;  5D6G A;  2YNF A;  8RUC A;  3JSY A;  3NY0 A;  4IG0 B;  3DLG A;  4I4B A;  2NXN A;  3PRD A;  3UCZ P;  2C2N A;  1NRK A;  1VR6 A;  2OTL S;  2N82 B;  1CUL A;  3LXQ A;  1IBM F;  4TQR A;  2CPI A;  1MU2 A;  2UUB J;  1SL0 A;  1TEL A;  4R8U B;  2KI2 A;  1ZPV A;  3VVU A;  4ER8 A;  3KHR A;  4YR3 A;  3BDH A;  1IM6 A;  4DQI A;  4PEO A;  4LRB A;  3OTO F;  2VBY A;  1R0B G;  1FRI A;  4TYB A;  2E9R X;  4KRW A;  3G82 A;  3WZ0 A;  4MFB A;  1U6Z A;  2IRY A;  1NJX A;  2WZ1 A;  2IVM A;  5KFT A;  4R25 A;  3PYE A;  4RBT A;  3PRB A;  2OEK A;  3CCU S;  3PFO A;  2RQC A;  5B0D A;  1EJJ A;  2W5S A;  3TUZ C;  3CCW A;  3DRY A;  4IQM A;  2BRK A;  3MM6 A;  3QAT A;  1C4C A;  2CUY A;  1VQM S;  1HYS B;  4ECS A;  2VPX B;  2FY1 A;  1NAQ A;  1LEO A;  2XMK A;  1YJW S;  2FJB B;  4FNI A;  3R6G B;  4UTG A;  4PQU B;  3K58 A;  4C11 B;  4YME A;  2MZT A;  4YQW A;  3CW2 C;  3HDS A;  1SC6 A;  3R5B A;  1X9M A;  3ETO A;  3IGN A;  3M6W A;  4CLY A;  2VZ9 A;  4MAK A;  4DL3 A;  1NDL A;  2FB0 A;  4WP8 A;  1YBU A;  4M5N A;  4X4P A;  1JLA A;  1LQ9 A;  3DHX A;  1VIX A;  4IH5 A;  1KRP A;  2JVR A;  3JS9 A;  2W5Q A;  2EC2 A;  3D66 A;  2BW7 A;  3IWX A;  2HRT A;  3MR6 A;  3TR5 A;  2V6A A;  1TKX A;  1OPI A;  3CJ8 A;  2IYG A;  3LP2 B;  3L3C A;  2DR9 A;  1ANI A;  4KSE B;  3G6X A;  5FII A;  1SH2 A;  2UUC J;  2GX8 A;  1PAU B;  2EK6 A;  3GG1 A;  4N5S A;  3BR8 A;  4O4G A;  1RT5 A;  2O1P A;  3H98 A;  2ZBI A;  4WZM A;  3M8S A;  3HSG A;  3HVW A;  3BSO A;  1HNV A;  1WC3 A;  5J2P A;  2B56 A;  3FBB A;  3M30 B;  4NWX A;  3OUY A;  1TP7 A;  2K2P A;  4ELT A;  4NLG A;  2QSF A;  3SXL A;  2M4M A;  3TRG A;  2GSN A;  3UDC A;  2OIH A;  3MTK A;  2DEI A;  3JAM Y;  4YFU A;  3I82 A;  4ZN3 A;  2DIV A;  2YNG B;  2MXY A;  2JWN A;  3V81 A;  2IJN A;  2NQP A;  2RRA A;  4Y0F A;  3KOA A;  1YJV A;  1RE1 B;  4NXM J;  3S6E A;  1NH7 A;  1EP4 B;  3WAY A;  2N7Y A;  1NK7 A;  2UU9 J;  1SKW A;  1X4C A;  4USU A;  4JYA J;  2IBK A;  3HI9 A;  1DTQ A;  3C16 A;  3N5B A;  2JFD A;  3BQ1 A;  3Q8P B;  2B7C B;  2V9W A;  1JJH A;  2Q6B A;  1Z2Z A;  4RR5 A;  3C6T B;  3OR1 A;  2GVD B;  3MZI A;  1VBZ A;  2C2O B;  5HQM A;  5DG7 A;  2ATC B;  2RE1 A;  4A47 A;  3OLA A;  2FLO A;  4MTP A;  3GIM A;  1Y6V A;  2C3U A;  4OMF G;  4KH0 B;  3PW7 A;  3ZFV A;  1VQP S;  1FHT A;  1UFW A;  3MFH A;  2CG4 A;  5D4L A;  4C98 A;  2EWH A;  2FVP A;  2DNK A;  4UT4 A;  1RTZ A;  2GQC A;  2MMY A;  3G6V A;  2CWK A;  2AGQ A;  3NL0 A;  3N6N A;  4AE5 A;  1N5Y A;  5J1E B;  3M2R A;  3FBC A;  2EC0 A;  5DGA A;  3IM9 A;  1JLQ A;  4FVC A;  3OVA A;  1F3V A;  1IWA A;  1RAG B;  1ALI A;  1YJU A;  2GMH A;  1O99 A;  1T03 B;  2P8I A;  2EK1 A;  5ETK A;  4DQR A;  2QL9 B;  1TMJ A;  5GMK a;  4XK8 C;  5AXM A;  4OZN A;  5D15 A;  1T9W A;  4FDJ A;  2L9D A;  1GTH A;  5C25 B;  1M5P C;  1SI9 A;  2GQ2 A;  2G1H A;  2LMI A;  5IT4 A;  1S1T B;  2QA4 S;  2LU2 A;  3AXM A;  2IPO B;  1RT1 A;  1T94 A;  4H4O A;  2LQ9 A;  4K4W A;  1N5T A;  2DIU A;  2E44 A;  5LSR A;  4DV3 F;  1Z1Z A;  4JI0 J;  2ZH1 A;  3EVM A;  1FRL A;  2YKP A;  2X7I A;  1DFD A;  2VFT A;  4UPK A;  4ZP9 A;  3H4B A;  3AB4 B;  1A0O B;  4X62 J;  1WG1 A;  3QWU A;  2W7A A;  2DNP A;  2A6O A;  2W2O P;  4ZJL A;  2XYH B;  3CF5 Q;  5JXS A;  2DH9 A;  2AKW B;  4MKV A;  1HD0 A;  3PJ9 A;  4G3I A;  2OLW A;  4OJH A;  3TAN A;  4DPX A;  1NLK L;  4DSK A;  4IG0 A;  4P10 A;  1KWM A;  1T02 A;  3OFH A;  2F8M A;  1M5S A;  5LJ5 Y;  5LOQ A;  2FHO B;  4OYZ A;  4ECQ A;  3JAM U;  2VOD A;  3I5A A;  5KFR A;  4LRE A;  1NZ8 A;  5KT5 A;  3CE8 A;  4HH1 A;  4LUB A;  3F41 A;  3T1Y F;  2EFP A;  1GMV A;  3C46 A;  3TJ9 A;  2RDI A;  4R8U A;  4MKY A;  4U9R A;  4S0M A;  2PFF B;  1Z2L A;  4N77 A;  2HND A;  2ASY A;  3MMA B;  4JV2 A;  2E7X A;  4DV1 J;  4F3O A;  1TAQ A;  1KON A;  4ZCI A;  4ZOS A;  3CO9 A;  1ZA1 B;  2G2Y A;  1FFS B;  2BE7 D;  2AYB A;  5U47 A;  1AUS L;  3R7N B;  2XRG A;  3MEC B;  2DT9 A;  3ED4 A;  2R7V A;  1EZZ B;  3IAM 9;  4N56 A;  2HVZ A;  5G4D A;  2KFZ A;  5IM0 B;  3GIL A;  3MMB B;  2J76 E;  1WDT A;  2PA3 A;  5DLT A;  1S99 A;  2RH6 A;  1ZEF A;  1U0S A;  5K8N A;  2HW3 A;  3H5Y A;  2NSB A;  3P8B B;  3OFG A;  5GME A;  1IBM J;  1HYS A;  5HRO B;  3NAH A;  3SQO P;  4LQ3 A;  3MXH P;  2YBV A;  3VGT A;  4NXN F;  4KV8 A;  4Y3C A;  5KFA A;  2CJK A;  2HLT A;  3VV2 B;  3OTO J;  2KTQ A;  1S1X B;  3LP1 B;  3VQS A;  2I1R A;  5F0U A;  1NKE A;  1K73 T;  4HVZ A;  3TA0 A;  3DDI A;  2MZJ A;  2RIJ A;  3AJD A;  1PC4 A;  2JL9 A;  3QNW B;  4P74 A;  5DLV A;  2IM0 A;  2VU5 A;  6FD1 A;  2GQQ A;  4CH0 S;  1NK0 A;  2Z2Z A;  1EKR A;  4EO6 A;  1Y10 A;  1HWU A;  3LP2 A;  1OSD A;  2BRL A;  4H4M B;  4HDG A;  4J9S A;  2G0C A;  5D0R A;  1HIY A;  3DLL Q;  3D1O A;  1MMD A;  1NKB A;  1HBM B;  1QAI A;  4RU2 A;  1J5O B;  4OI6 A;  4HTJ A;  2RB7 A;  2RDD A;  5DLG A;  1JK9 B;  3BJY A;  5E7O B;  1WF0 A;  4A8K A;  4RU9 A;  3EX7 B;  4HLB A;  2FVR A;  1SPB P;  4NA1 A;  1YX2 A;  5CCM A;  1RA6 A;  3VGS A;  3A1Y G;  1R0C B;  2DHG A;  4DG1 B;  3SCL E;  4FF2 A;  2YNG A;  3D5M A;  4TKT A;  3VAL A;  3KKF A;  3QT5 A;  1V3Z A;  2FYX A;  3KHH A;  4NE9 C;  2FVC A;  2PI4 A;  1F9H A;  5A76 A;  2RJZ A;  1YJ7 A;  3RRG A;  1NK9 A;  2R7Q A;  1EP4 A;  2KHC A;  4XTT A;  3CDA A;  1S9E B;  3EMT A;  3NKR A;  4LR9 A;  2F9D A;  1PJ5 A;  4DSE A;  4RW4 B;  1VFJ A;  4PAB A;  2NPI A;  1JLG B;  2MZS A;  4YDX A;  3VTI A;  1N5S A;  2LYV A;  2OUG A;  2YQ0 A;  2AQ4 A;  4LF9 F;  3C6T A;  2GVD A;  1QAX A;  5CYQ B;  5D3G B;  2GO8 A;  2XMW A;  4M8L A;  2WVB A;  2VPY B;  1PC5 A;  2LEB A;  1NB7 A;  2ZUG A;  4YB6 A;  1S6O A;  3T6B A;  3TUP A;  4FDF A;  4YEA A;  2NUU G;  3SIP B;  1X5T A;  4OZL A;  3SYZ A;  1CQM A;  1O6X A;  1XJW B;  1U6B A;  5J1E A;  2VG7 B;  1D0E A;  1FRX A;  4K4T A;  3J81 Y;  2HGM A;  4M5L A;  4MKB A;  3BSA A;  2LEC A;  4DR2 F;  2XCP A;  5K9F A;  1NJZ A;  1T03 A;  1FDB A;  5INH A;  1E33 P;  3P45 B;  4O3R A;  4LBI A;  4ANC A;  2UXD F;  4MK9 A;  3QYY A;  3FFI B;  4CT8 A;  5C25 A;  3TA1 A;  1FWK A;  1Y3K A;  3GP9 A;  1IKY B;  4MYU A;  3ZO7 A;  1S1T A;  1F2H A;  3UNG C;  3CCZ A;  2FLN A;  1UZD A;  1YIT S;  4UOF A;  5A2Q Y;  3IGV A;  2ZC3 A;  2X98 A;  3GG0 A;  3OXL A;  2XGQ A;  2XWX A;  3KD8 A;  3ENV A;  1JIH A;  1FT8 A;  2J7K A;  2O3D A;  4ES3 A;  1M5O C;  1YGY A;  3GV7 B;  1T9U A;  1FNM A;  4IFV B;  4ELV A;  3GR0 A;  2BBE A;  1JQG A;  3ENW A;  3THP A;  2W2M P;  2HAI A;  4P7V A;  2W2Q P;  1ZAW A;  2FTR A;  2VIH A;  4B9N A;  2CFX A;  3B4D A;  3ZTO A;  3K8W A;  4RW8 A;  3FDS A;  2QLW A;  2GV1 A;  5FJ4 A;  4B9S A;  1RHR B;  2POK A;  1O0P A;  4G6V B;  4N7T A;  3LGN A;  1XNR F;  1TFW A;  4DV3 J;  2J9E A;  4QQB A;  3CUL A;  1RWU A;  5KT2 A;  1T9V A;  3N79 A;  1GNK A;  2UUW A;  4WYW A;  3MMA A;  4B9T A;  1IR1 A;  3EXC X;  2XUL A;  3UO0 A;  2WVD A;  3WX8 A;  5KFI A;  1IJF B;  3I6P A;  4CO3 A;  3SI8 A;  4PKD B;  3U1L A;  1VC6 A;  3MWB A;  3PVX A;  2LCW A;  1RTI B;  1S1V B;  2LEP A;  1S0V A;  4ECW A;  5IM0 A;  3MMB A;  1FFW B;  4Y6I A;  1PYO B;  1OMS A;  5HAT A;  5KT4 A;  5KG7 A;  3OLB A;  2GJF A;  1KOH A;  3D9B A;  2HHT A;  4NLT A;  3LO3 A;  1RWN B;  1WUU A;  2WVC A;  2W5W A;  1RT3 A;  4LRD A;  4J9Q A;  5HRO A;  1WDD A;  5LMU F;  3T1Y J;  3QRQ A;  1UL3 A;  1I3O B;  2CJY B;  1S6Q B;  1RTH B;  4OHX A;  3UDE A;  1A6L A;  5B0F A;  5D4O A;  2VG5 B;  1Q4R A;  3FMB A;  4KO0 B;  4CNZ A;  5LM7 E;  5K8O A;  4DMZ A;  1SCJ B;  3TYT A;  4O44 A;  4ED5 A;  1U6F A;  3J81 U;  3M8Z A;  1S1X A;  2MZR A;  4LSZ B;  3UN2 A;  3N28 A;  2Z2M A;  1HI1 A;  4CDI A;  1RWV B;  3AHP A;  2Q43 A;  1JX4 A;  2YKN B;  1S9F A;  4NPO A;  1FRJ A;  4JP8 A;  1U7L A;  5CH7 B;  1ELZ A;  1WTB A;  2DIS A;  3HK2 A;  4Z7C A;  2V2K A;  1RAC B;  4P73 A;  2VQF F;  4ZVP B;  2RH3 A;  3K59 A;  3BDG A;  3K7R A;  5A2Q U;  4RWX A;  1EJ7 L;  2NUH A;  3GIK A;  1FA0 A;  4H4M A;  4FF3 A;  3GFZ A;  4E98 A;  4QCL A;  3IP0 A;  1R8A A;  4C8N A;  3FZB A;  2RD5 C;  5EWG A;  1E6Y A;  4NXN J;  1RKI A;  1HBM A;  3B54 A;  3SFU A;  3QZ7 A;  3NGU A;  4X4T A;  1J5O A;  1RT7 B;  2J6S A;  2XMA A;  3VAF A;  3U02 A;  3ZTQ A;  4ED6 A;  2PEH A;  3IDD A;  4DL7 A;  4QPT A;  3TNV A;  1U45 A;  4OJG A;  1PYT A;  1AW0 A;  2PA8 D;  1HBU B;  4DG1 A;  2ZOM A;  2XEX A;  2DR5 A;  2AT1 B;  3TUJ C;  1HNI B;  3FQL A;  4ZVO B;  1JXE A;  4RLE A;  5AE3 A;  1RYR A;  4F4Y A;  3HJV A;  5G0R B;  2MQN A;  1WI6 A;  1S9E A;  1KOO A;  5K14 B;  1NME B;  2IM1 A;  1B70 B;  4RW4 A;  2ZWO A;  1JLG A;  4OI1 A;  3DMJ B;  2FJW A;  2BMB A;  3BBB A;  4NCG A;  4WP3 A;  1RWX B;  1ZEB A;  5CYQ A;  2RDJ A;  2XWY A;  3OW2 R;  1FF2 A;  1PKU A;  4O0I A;  2HS4 A;  2HLU A;  4MH8 A;  2Y1L B;  3C66 A;  1XER A;  3RYL A;  3CCJ S;  5CYJ A;  1F5C A;  2E5G A;  1LW2 A;  5EGY A;  2D1C A;  5AXN A;  3A8E A;  3L95 X;  4ZS6 A;  2VBX A;  3UN3 A;  2CRL A;  1X5P A;  4GKJ F;  2HVE A;  1GXL A;  5HJX A;  5HMY A;  1KHN A;  1IWG A;  1T11 A;  2R2R A;  1ZA2 B;  4JI5 F;  2BKP A;  1ED9 A;  4DR1 J;  3ZZT A;  4HKQ A;  3EM1 A;  4KR0 B;  1IBK F;  1ZAX A;  4KC5 A;  4MIB A;  2VG7 A;  2GIQ A;  2M0G B;  1MML A;  1KHJ A;  2I2Y A;  2PDA A;  3FUY A;  3T5K A;  2KM8 C;  3I5B A;  3O5T B;  1U48 A;  3OJS A;  3TEH B;  1ZPW X;  1XIQ A;  3D54 A;  1H72 C;  3RG6 A;  1S76 D;  4LF9 J;  3BM7 A;  1S57 A;  5C7P A;  2WON B;  3FFI A;  3KFW X;  3D68 A;  1KR4 A;  1T0T V;  3OL9 A;  3ISN C;  4ILL A;  1IKY A;  1JXV A;  5KOX A;  3NLC A;  5DQG A;  3T01 A;  4KAI A;  3MM5 A;  3ISZ A;  3R5G A;  3PX6 A;  2ZVI A;  4UZC A;  4RNF A;  1DAR A;  2HHP A;  4Z2X A;  1N6Q B;  4FS2 A;  1VQS A;  1XTZ A;  4KPC A;  4D3G A;  4M5H A;  5D78 A;  4JV1 A;  4UPI A;  3CDW A;  5CZV A;  3C19 A;  3ENQ A;  4M1K A;  4FS1 A;  4IFV A;  2HQI A;  2JEI A;  4FN5 A;  2Z2Y B;  4KGV B;  3DNC A;  4K4V A;  4DR2 J;  4QR2 A;  4KB7 A;  3CJ4 A;  2W8S A;  2QRR A;  4HR2 A;  4A4J A;  4NLP A;  3TO8 A;  1X5S A;  1M0S A;  1TU0 B;  2UXD J;  3SV4 A;  1TL3 B;  1SQG A;  4JI8 F;  2R3V A;  3R27 A;  5GAE U;  1B4S A;  3WHI A;  1G6B A;  2P9E A;  4UOH A;  3SMZ A;  4WKY A;  1D9F A;  5LXY A;  2AJQ A;  1GQE A;  3R5D A;  4KHM A;  4OYM A;  4FF4 A;  3H8Y A;  3DLK B;  2N3O A;  1VJQ A;  2LA6 A;  1ZBT A;  1ZAV A;  1MW7 A;  3GYN A;  5L39 A;  2CQ2 A;  3JTO A;  4C8K A;  4GVL A;  1TQL A;  2XBP A;  3J7A 1;  1HBN B;  1OY6 A;  1SC3 B;  2D3O 1;  1FSU A;  3JXO A;  2DNO A;  3IR7 B;  1U25 A;  2FZC B;  3CDE A;  5M2U A;  1IR2 A;  4U95 A;  4YR0 A;  3Q89 A;  3OL6 A;  4YB1 P;  1BC6 A;  2JLF A;  2BKO A;  1RTI A;  1S1V A;  1NDC A;  1EB0 A;  1YI2 S;  4K7Q A;  1K44 A;  2J6T A;  4Q8F A;  2KXH A;  5F8L A;  1R43 A;  1RHU B;  1A9N B;  4HDH A;  2YKO A;  4QJV A;  1HNX F;  5LRM A;  4K5S A;  5B7W A;  4DR3 F;  4DFK A;  1UPP A;  4J91 A;  1IBL F;  2B9X A;  1RWP B;  3TZW A;  5CD4 A;  4ZVT B;  4A8Y A;  1KLM A;  1H73 A;  3AXK A;  1YRU A;  1NZA A;  1XNR J;  1S6Q A;  5J1P A;  1RTH A;  2XQC A;  1S9G A;  3HXM A;  4PZV A;  1J5E F;  2VG5 A;  1V5V A;  1S6U A;  4KO0 A;  3UCG A;  2D3Z A;  5KG3 A;  3C3L A;  1W26 A;  4PPZ A;  4OX6 A;  3T3F A;  3OHA A;  4GKK F;  1YIJ S;  2XI2 A;  3LGM A;  1QE1 B;  1VYA A;  3QIP B;  4RWW A;  2W9C B;  3O3L A;  2E7V A;  1OY8 A;  3AJ2 A;  4QIE A;  2BQR A;  2AYM A;  4NLS A;  3PV8 A;  4ED3 A;  2H4Y B;  2FLP A;  1OY9 A;  2YKN A;  3N0V A;  3RBD A;  4EI2 A;  4YY3 F;  1SIW B;  5C42 B;  1U09 A;  1IKX B;  4P75 A;  3GJR B;  3MOZ A;  4XDD A;  1X4D A;  2B8Q A;  3V5R A;  5C24 B;  2ZHB A;  5HMZ A;  1VBX A;  1WC4 A;  5LMU J;  4AL6 A;  5AT1 B;  1U1M A;  1CG2 A;  1UW9 A;  4M63 A;  4ED8 A;  2M70 A;  3OFF A;  3PR4 A;  2M3D A;  5IT9 Y;  5MLC V;  3HHE A;  2HK2 A;  3SCI E;  3ELH A;  2VJU A;  2B9E A;  3LAM A;  5HAN A;  4OV6 A;  2D3O R;  4Y2A A;  4HH0 A;  1H98 A;  3BDF A;  1HBU A;  7FDR A;  2P9C A;  4TU7 A;  3MUT P;  3EGN A;  1AUD A;  1WAC A;  3GR1 A;  1RXO B;  4CWB A;  4KGK A;  1HNI A;  4Y2K A;  4RW6 B;  3HFZ B;  1L3K A;  4W92 B;  1QTM A;  2HKE A;  2PGC A;  3B82 A;  4X4R A;  2VQF J;  5G0R A;  3M32 A;  4WPA A;  4ID8 A;  1UPM B;  2V34 A;  2D9P A;  5CCL A;  4DUZ F;  3ETM A;  5K14 A;  4FXW A;  3BRE A;  1UEK A;  3M8Y A;  4KIA A;  1AUK A;  2XZW A;  3DMJ A;  1SIZ A;  3IBF B;  2E1P A;  4YR1 A;  1SQF A;  4BWM A;  1WKK A;  1RWK B;  4X2B A;  4FDI A;  4PAA A;  3ZZY A;  2CQG A;  1DTT B;  3F73 A;  5DZ7 A;  3V6K A;  2NR0 A;  4OV1 A;  3RJM B;  2R8I A;  3IWL A;  3M7V A;  1MWQ A;  4G65 A;  2OGU A;  2YVS A;  4DEZ A;  4J9L A;  1VQN S;  5F8G A;  4EZ6 A;  1H6K X;  2H5I B;  2GHP A;  4I56 A;  2HG4 A;  2L9W A;  2R2S A;  2W25 A;  5DG8 A;  1GX5 A;  3DLH A;  2MZQ A;  4KQZ A;  4C8L A;  4L6V 3;  1WC6 A;  3T41 A;  3R5C A;  5J2Q B;  1G7C B;  4KJD A;  1V3R A;  1QSL A;  5B0A A;  1ZTT A;  4G1Q B;  4HEA 9;  3VHQ A;  2OD6 A;  2W7O A;  1WC0 A;  3QQC D;  3CXC R;  4ZIT A;  2E9Z A;  3ZZP A;  1AYE A;  2YX7 A;  2LQJ A;  3GE9 A;  4HT7 A;  4CLT A;  3THT A;  1Q53 A;  2WBR A;  2Y9H A;  3RAX A;  3OV7 A;  2U2F A;  2WON A;  2XNQ A;  4KFB A;  3W5Z A;  4Y28 C;  2W4D A;  3CB4 A;  2DGS A;  4TNO A;  1TUG B;  1Y00 A;  3H20 A;  4DL0 C;  1AXQ A;  2R8H A;  3W2W A;  3PNI A;  1T8E A;  2B43 A;  1VK3 A;  1N6Q A;  4GKJ J;  3B4M A;  4ZVH A;  4LR2 A;  2FGC A;  3VF0 B;  4PYA A;  2FVQ A;  4JI5 J;  1RLD A;  2IC3 B;  2HEK A;  2B51 A;  5HAO A;  1Q0N A;  1AT1 B;  4PWU A;  1IBK J;  4CNY A;  2DHA A;  2AIR B;  4DF4 A;  1QAJ A;  3MM7 B;  4NLO A;  1H7W A;  4DL6 A;  3C8Y A;  1OQ3 A;  2VQE F;  4DN9 A;  5IT9 U;  5B09 A;  1JLC B;  3D4J A;  2GVZ B;  3L7O A;  2C2R A;  2HNZ A;  2LA4 A;  3MEG B;  3KJF B;  2BKN A;  3NS7 B;  3TX8 A;  3PIP Q;  2JOQ A;  2DPJ A;  1PIL A;  2YNI B;  3DLK A;  4FVM A;  1UJ6 A;  1URB A;  5KFW A;  1E6V B;  5I3Q A;  4OHY A;  2UVU A;  3O2I A;  4P7T A;  1IM4 A;  2DCL A;  1RK8 A;  2I6W A;  4TU8 A;  1HBN A;  1NU4 A;  3W9J A;  3PO4 A;  1IQZ A;  3IAS 9;  3UPF A;  3ZNU A;  4JI6 F;  3R7S B;  3WX4 A;  2BAC A;  2AYG A;  2F4V F;  1KQG B;  2RUG A;  5F8J A;  5BXI A;  3UW1 A;  1H74 A;  1WF1 A;  3KDN A;  4NLR A;  3H7H B;  4QPX A;  3V6D B;  3AQP A;  4FYY B;  4AD6 A;  2QSW A;  3B5Q A;  1MRO B;  1GMW D;  2ZZT A;  1K0V A;  4JI8 J;  3PHE A;  3ZNJ 1;  2JRS A;  5D4N A;  5GAE I;  2KYX A;  2RRN A;  2YNH A;  4F0H A;  1H38 A;  1Y4Z B;  2GAG C;  2P2C B;  3DYA B;  2GJ2 A;  2QMU B;  1NKC A;  2VBW A;  2UXB F;  5A8W A;  4ZLJ A;  4JV0 A;  3R3T A;  4M5G A;  1KTV A;  4ZVS B;  5IV3 A;  2A2D A;  4KY3 A;  4F04 B;  1RAD B;  4KAY A;  4V19 X;  4FYV B;  2KFN A;  2ZH6 A;  1HQE B;  1QE1 A;  1NSQ A;  1FJ7 A;  1Q8I A;  4NLQ A;  3QIP A;  2QG9 B;  1X5O A;  2CQ1 A;  2W9C A;  2AHO B;  3NWG A;  4WK1 A;  1VQ9 S;  1LWE B;  2RRB A;  4W4M A;  2M7S A;  2X51 A;  3N9U C;  1X4A A;  2FLL A;  4USJ C;  1VQ4 S;  4FZV A;  4GC7 A;  1ZZN A;  1R31 A;  3RW7 A;  3DLB A;  1H3D A;  3KUE A;  5C42 A;  2MY7 A;  3I0S B;  1IKX A;  1HNX J;  4DR3 J;  2DY9 A;  5EX3 A;  5C24 A;  4O4R A;  2N4C A;  4TXS A;  3WQP A;  1Q86 T;  4HYK A;  4OX9 F;  1YBA A;  3OD2 A;  1UW4 A;  4QIV A;  3G8S A;  1Y7A A;  5RUB A;  1J5E J;  4KHR A;  5E3C A;  2MQL A;  4X84 A;  3NGK A;  1EIY B;  2HHW A;  8AT1 B;  4GKK J;  1WHX A;  4TLQ A;  1HD1 A;  1RI7 A;  3NMA A;  4FNH A;  2P9G A;  1RAF B;  1WHY A;  4DBQ A;  2DRB A;  1EW9 A;  1S4E A;  4J5O A;  1U1R A;  1RCO B;  2C3O A;  5I3U B;  4LF2 A;  5A8K B;  2OPS B;  1NEE A;  5T7L B;  5HQL A;  1HWJ A;  4B9M A;  3KLF B;  4USI A;  3G8T A;  1HWI A;  3I0R B;  3QSY B;  2MKC A;  3CJ3 A;  1F3F A;  4YY3 J;  4WFA Q;  3OR2 B;  4J9R A;  2L9N A;  2PEB A;  4DR5 F;  1D1U A;  4I2Q B;  2DIT A;  3V4I B;  1QJH A;  1EKS A;  2OFG X;  1R8H A;  4RNO A;  4F50 A;  4WK3 A;  1SHN A;  3FGV A;  3HZG A;  4OIX A;  3RAQ A;  1AJB A;  4C3K A;  3GON A;  3W60 A;  4IR9 A;  4J9N A;  3W2V A;  3DRP B;  3DI6 B;  1PBU A;  3QT6 A;  3A8I A;  3G71 S;  1N0U A;  1N32 F;  2KVQ E;  3PO5 A;  3O1L A;  1P27 B;  3FEY B;  1DTT A;  3PW2 A;  1VHF A;  2QLB B;  1UVK A;  4KBI A;  2R2U A;  4ES2 A;  4LFC F;  2NXE A;  3BO2 A;  3T5H A;  4D3H A;  4KHP F;  3PFE A;  3RAM A;  3POT A;  4H4K A;  4R0E A;  2VA3 A;  2N4D A;  4C3L A;  1RGV A;  2RUS A;  3MCO A;  2MSS A;  2GSU A;  4MJK A;  3FCH A;  4A46 A;  4I67 A;  2ZC4 A;  3FSI A;  1KH4 A;  2GGP B;  1U26 A;  2AMC B;  5EX0 A;  3RW6 A;  2E5J A;  2KKH A;  5FLX Y;  3QMQ A;  5J2Q A;  3KG1 A;  2F8E X;  4DUZ J;  8ATC B;  2DNN A;  1BQM B;  3I96 A;  3US5 A;  1NDK A;  4I0W A;  2ZBQ A;  4G1Q A;  1WOP A;  4CLK A;  4HT5 A;  2AX1 A;  4KYZ A;  2K7J A;  4FKY A;  4P2M A;  4IFY B;  2BAB A;  3G4S S;  2V5H G;  2JSX A;  2DVI A;  2CJQ A;  2O01 C;  1V5I B;  2F63 A;  3PTW A;  1B3T A;  3TAM B;  2V4R A;  1L3T A;  4ZPA A;  1WEL A;  3PW4 A;  1HPZ B;  1CJK B;  2G2Z A;  4I7F B;  5KFC A;  1S0M A;  1FXD A;  1DQ9 A;  4ENO A;  4F4Z A;  4K0K F;  2EKN A;  1ZH5 A;  2E1R A;  2Y1I A;  1K1S A;  3NKY A;  2OP5 A;  3E8O A;  1EAY C;  2IC3 A;  3SDE A;  2CQD A;  2R7X A;  2KM8 B;  3R6L B;  1SKU B;  4OZ5 A;  2QA1 A;  1T3N A;  1IKV A;  3I9V 9;  2CQ4 A;  4ECX A;  1WEX A;  1IUJ A;  1SH3 A;  3GJT B;  2BR0 A;  2HBY B;  3DOL A;  3MM7 A;  3CMA S;  3CT9 A;  3GFH A;  3CCE S;  5H9F J;  3OVS A;  2Y3Y A;  5K8M A;  1RHJ B;  2K8G A;  2MGZ B;  4L74 A;  5DET A;  2QYG A;  2EFN A;  1JLC A;  5GAD U;  1UVJ A;  2GVZ A;  1S1W A;  3QSI A;  4QWA A;  3MEG A;  1OJ4 A;  1AJC A;  2B8P A;  3HT3 A;  1Q16 B;  3M8P B;  1NBE B;  1QSY A;  3KXD A;  4C8Z A;  3MI7 X;  1TR0 A;  3UCU P;  1X9W A;  4F3Q A;  4XO0 A;  2XSJ B;  5HLF B;  1RJJ A;  1E6V A;  2FD2 A;  2FDN A;  3OQ2 A;  2GO9 A;  4EZ9 A;  2YPZ A;  3GFY A;  4EK2 A;  4LT6 A;  2HS0 A;  2J6U A;  3JSB A;  5DZ6 A;  1O51 A;  1NSA A;  9ATC B;  4WFN Q;  3VCD A;  3MCM A;  4K50 A;  4NCA A;  4F4W A;  1A7G E;  2D3U A;  4AL7 A;  5ETN A;  2M5Y A;  1UJ5 A;  2FHJ D;  4M94 A;  3N6M A;  1R27 B;  5JVG Q;  3V6D A;  2VQE J;  3PJX A;  2XMT A;  3LUY A;  1MRO A;  5D8H B;  3CD7 A;  2QT7 A;  4R5P B;  2QLF B;  4F4A A;  5B0C A;  5GRR A;  3QAU A;  3DYA A;  4XPC A;  4PG8 A;  4EFA C;  3G82 B;  1ULR A;  4FYX B;  2COL A;  4ECY A;  5FLX U;  4M5J A;  4ECR A;  1DY3 A;  2MB0 B;  4YP3 A;  1NH8 A;  3SCJ E;  2J8S A;  2KJV A;  2R2T A;  2D7S A;  4KH1 B;  5DLW A;  3R9L A;  3S8S A;  1HQE A;  4JI6 J;  2MHN A;  4X4Q A;  4IDK A;  4OZ1 A;  3BH6 B;  4NLW A;  4OX7 A;  1LWE A;  5F0W A;  2DGO A;  2CQI A;  3AA8 A;  5A0Y B;  2HQC A;  3HX9 A;  2CQP A;  4PCQ A;  5L8R C;  2PMH A;  1X4G A;  3LP0 B;  5I4M A;  1MG7 A;  1HQ2 A;  3HVR A;  1FTC A;  3I0S A;  3NCR A;  4UOP A;  3T9N A;  2R7T A;  3KHG A;  4OI2 A;  5B0G A;  3T6J A;  2UXB J;  4UY8 T;  3GIJ A;  4A8S A;  2LKZ A;  3OFE A;  2V8V A;  4ZJO A;  1S77 D;  4RPF A;  1RYS A;  3TZY A;  3NCQ A;  1PJ6 A;  1IBC B;  1VDH A;  4Q44 A;  3QLH B;  5E3P A;  3JTP A;  3H4D A;  2CQC A;  1X9S A;  2XZT B;  2V94 A;  2HZC A;  3KJV A; 
#chains in the Genus database with same CATH homology
 1N2K A;  4LR2 A;  5LQQ A;  2XR9 A;  1EI6 A;  3M7V A;  3UN5 A;  3UN2 A;  4GTZ A;  4UPH A;  4LRC A;  5TJ3 A;  4CYR A;  3OT9 A;  5DLW A;  3LXQ A;  2ZKT A;  4ZG7 A;  5DLT A;  3NVL A;  2QZU A;  1SHQ A;  2GSN A;  2RH6 A;  1ZEF A;  4NWJ A;  3NKO A;  5KXA A;  2X98 A;  4UOR A;  5LIA A;  3SZY A;  2GLQ A;  3UO0 A;  1ELY A;  3Q3Q A;  3B5Q A;  1ELZ A;  4LRF A;  1E3C P;  4ZGA A;  3KD8 A;  3NKN A;  4KAV A;  1HDH A;  1ALI A;  4TN0 A;  3BDF A;  4MIV A;  3WAV A;  1Y7A A;  4ZG9 A;  3BDH A;  1HQA A;  1EW8 A;  4KJD A;  2GA3 A;  3MK0 A;  3BDG A;  1O99 A;  3E2D A;  1KH7 A;  5IJQ A;  4LRB A;  5L0E A;  5IJS A;  5C66 A;  1E1Z P;  3WAY A;  2ANH A;  3TX0 A;  1ZED A;  3CMR A;  4LR7 A;  1ZEB A;  1ED8 A;  4CYS A;  4B56 A;  5L0K A;  4LRE A;  4LQY A;  3MK1 A;  3T01 A;  3WAW A;  1P49 A;  4UOP A;  2W5Q A;  2W5X A;  4ZG6 A;  1ALH A;  1FSU A;  4FDJ A;  1KH9 A;  2GSU A;  3T00 A;  3NKQ A;  2IUC B;  5HRT A;  3NKP A;  1EW9 A;  1EQJ A;  3M8W A;  4GTX A;  1B8J A;  1KH4 A;  2G9Y A;  4CXS A;  4KJG A;  2GSO A;  3IGY B;  5AJ9 A;  2W5V A;  3M8Y A;  5K4P A;  1ALJ A;  2W5W A;  4KAY A;  3T02 A;  1EJJ A;  1E2S P;  5EGH A;  4UPI A;  3A52 A;  4LRD A;  2D1G A;  4GTY A;  3TG0 A;  3BDG B;  5LRN A;  1AUK A;  4GTW A;  1ANI A;  3UNY A;  1ELX A;  4LR8 A;  1O98 A;  3DYC A;  1URB A;  5GRR A;  1URA A;  3UN3 A;  2W5S A;  1K7H A;  2W5T A;  1KHL A;  4YR1 A;  1ANJ A;  3IDD A;  1AJD A;  2VQR A;  3IGZ B;  3WBH A;  1Y6V A;  1KHN A;  1KHK A;  1E33 P;  1ALK A;  5INH A;  4CXK A;  3NKR A;  5L0B A;  1EW2 A;  4QAX A;  5DLV A;  4FDI A;  4LR9 A;  1N2L A;  2W5R A;  3WAX A;  3SZZ A;  1AJC A;  5EGE A;  4N7T A;  4CXU A;  3TWZ A;  5GOV A;  1ED9 A;  1SHN A;  3DPC A;  3MK2 A;  4UOO A;  1AJA A;  2W8S A;  4UPK A;  4MHX A;  1HJK A;  2IUC A;  2XRG A;  4UPL A;  5LRM A;  2IFY A;  4KM4 A;  3M8Z A;  2W8D A;  3NKM A;  4NWX A;  1KHJ A;  3ED4 A;  1AJB A;  4MY4 A;  1KH5 A;  4LRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...