3TWZA

Phosphorylated bacillus cereus phosphopentomutase in space group p212121
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
KYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 139
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3twzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3twzA01
4ZG7A 4MHXA 2XRGA 3IGYB 1EJJA 4UPHA 4FDIA 1EW9A 1ALIA 1URAA 3LXQA 1ANJA 3NKPA 2RH6A 5TJ3A 4CYSA 3NVLA 5EGEA 3WBHA 3OT9A 3M7VA 3UO0A 3E2DA 4LREA 4B56A 3NKNA 4KJGA 2D1GA 5C66A 1AJBA 5LIAA 3UNYA 4MIVA 2IFYA 5DLTA 5HRTA 2W5QA 4N7TA 1ZEFA 3BDGA 3NKOA 2VQRA 1E1ZP 5IJQA 2W5RA 4UOPA 1ELXA 3NKMA 1B8JA 1E3CP 4QAXA 5GRRA 3TWZA 3MK0A 1KH9A 4CYRA 5DLWA 3DYCA 4LR7A 4KAYA 5EGHA 2QZUA 3KD8A 1ZEBA 4CXSA 3UN5A 1ED8A 2GSUA 5AJ9A 1URBA 3WAYA 1HDHA 2W8DA 3ED4A 4KJDA 4UPLA 1KHNA 1KH4A 1E2SP 3BDGB 1ELZA 4CXKA 1P49A 2G9YA 1EW2A 3NKRA 4LR8A 1FSUA 4UORA 1EQJA 1SHQA 1AJDA 3M8WA 3WAXA 1ED9A 4GTWA 4YR1A 3SZYA 1ANIA 3NKQA 3T02A 1AJAA 2GLQA 4KAVA 4ZG9A 4TN0A 5INHA 2XR9A 3DPCA 2W5SA 4NWJA 1ALJA 3BDFA 1KHLA 4MY4A 5GOVA 4CXUA 1HJKA 3B5QA 4GTZA 5IJSA 2GA3A 3A52A 3IGZB 4UOOA 4LRDA 2ANHA 2W5TA 4UPIA 1EW8A 4NWXA 3IDDA 1ALHA 5L0BA 3UN3A 1ALKA 2GSOA 5LQQA 1K7HA 5KXAA 2GSNA 1EI6A 2W5VA 2X98A 2ZKTA 4FDJA 4LR2A 4LQYA 3SZZA 3TX0A 5L0KA 3BDHA 3MK1A 2W5XA 1AUKA 1SHNA 1E33P 2W8SA 4UPKA 3WAVA 2IUCA 3UN2A 1N2KA 4LR9A 2IUCB 5L0EA 3T01A 3TG0A 2W5WA 4LRFA 1ZEDA 4ZGAA 4GTXA 4GTYA 3CMRA 1AJCA 5K4PA 1KH7A 3T00A 3WAWA 1N2LA 3M8ZA 5LRMA 4LRCA 1KH5A 1Y7AA 4LRAA 3MK2A 1O98A 1ELYA 4ZG6A 5DLVA 3M8YA 1O99A 5LRNA 4LRBA 1HQAA 1KHKA 1KHJA 3Q3QA 4KM4A 1Y6VA
chains in the Genus database with same CATH superfamily
1YSJA 1FXLA 1TMMA 1U02A 3VGVA 1X9MA 2Z56B 4O3OA 3KHLA 2IMWP 1DARA 1ZS6A 1ZM4A 3BM7A 3I0SA 4G1QA 2OEMA 1W7WA 1RHMB 1VOMA 2IJRA 4PABA 5CYMB 3X1LB 1B7FA 2FJBB 1CJUB 1RT7B 3GCWP 4DUZJ 1HHSA 2AWZA 3TYTA 5EDWA 1YHQS 2HMIB 4CO1A 3KLGA 2H5IB 2X7IA 4ZPAA 1NAQA 1T0TV 4PYAA 4B02A 4PRFA 1FXRA 1YZ6A 3OXFA 3CB4A 4Y28C 3QT5A 1GMWA 5C42B 3M8SA 2OFHX 3K5LA 3T9ZA 1RWVB 4U9RA 1NSAA 5LXRA 1QSLA 3CNQP 1FJ7A 4RBUA 2HZCA 2M8HA 1VQLS 4CYUA 3AHPA 2ZH6A 2ADCA 4X4VA 3JTPA 2HFVA 2W7AA 2OPRA 2HURA 3TVYA 4PWDA 2ZE2B 5KFXA 1NHKL 3MF5A 4HHHA 4ELTA 1F3FA 3PFEA 3GTYX 4O0IA 2W5RA 4HACB 4ECQA 3QATA 4Y65A 4WFXA 1WSRA 1MWYA 3DRXA 3R5DA 4RKUC 3RBXA 1CBKA 1S12A 4CM0A 3A4TA 3CCMS 2JEFA 2HHXA 3U02A 2FLLA 1TUWA 4Y2CA 2HQGA 2V94A 5IFMA 2XMJA 2XGQA 4P6QA 4E2FB 2FVPA 1R0AA 1Z4UA 1I3OB 2Z4PA 1LOUA 3IFEA 2V8VA 3P96A 5AJ3J 3CCES 1HR0J 1L3VA 1GH8A 3WAYA 3E3XA 3V4MA 2HYIB 2HIQA 4J9MA 1UVKA 2XY5A 3MFHA 3V4IB 5LL6d 5BR8F 2R2RA 1SC4B 1PAEX 1V3RA 3PJXA 4UOCA 4OYMA 4C0HA 4R0EA 2ZM6F 1FKOA 4JV5J 3OR1A 4NCGA 5KFEA 4NL5A 2LQBA 4CLFA 4P2XA 2CKWA 2NXCA 4ZHRB 2GGPB 4DR7J 1T02A 3N6MA 3PTWA 4J9PA 2MKYA 3D4JA 4HI2A 2E66A 4N77A 3LTOA 2VFVA 1V3ZA 1BUXA 5F41A 2HBRB 4F04B 3GV8B 1T05B 4TN0A 2EFGA 5IC6B 4F2RA 2CWXA 3GWCA 3Q8PB 2FUG9 1OS5A 5GAEI 4IFYB 3CMES 1EX8A 2IYGA 2NPFA 1VLOA 1UFKA 5IT0A 2QO3A 4DG1B 3CTRA 5D8HB 2DY1A 4R8UA 1WF2A 4HKQA 2OELA 4IOBA 4IRCA 4CLZA 2JSXA 1HW8A 3OFEA 3IGZB 4MK7A 1EKRA 4NXNF 1RWUA 1KWMA 1JLGA 3AXMA 3NGTA 4ZP8A 4Z2XA 1CULB 4DR5F 1JX4A 4ERDA 3BGUA 3VAMA 1RT1A 1HD0A 4DDFA 1TKTA 2YKMB 1HBNA 5J2PB 1N8RT 5M2UA 5KFKA 2YQ0A 3W3SA 3O5TB 4FXVA 1SH0A 2QL5B 3QZ7A 1RAJA 1SHNA 3OFGA 1UFWA 5FLXU 3NY0A 3DI6B 4WTYA 1M0SA 3EPGA 1GMUA 2BV3A 3LP0A 1CJUA 5D4PA 5AXMA 1RP5A 2FJAB 5HVGA 3KLEA 4JYAF 4KHRA 2FGOA 2R7QA 2E1RA 2BJ1A 3MWBA 3PYGA 5GAHI 3ETOA 1J5OB 3BDPA 2KHDA 1ZPVA 1T7PA 2DR8A 1H73A 1KN6A 2XEXA 3DLEB 1KH5A 2QG9B 1RKJA 5IOLA 5HBMB 1PAUB 3BV8A 1G1XA 2IBKA 4ZHRA 2UXDF 2F65A 4DR4J 1BQNB 3RZAA 2FLPA 2I1RA 2W4DA 1KHJA 4Y34A 2CADA 1QAYA 2YKOA 4NEZA 3R6LB 3TOQA 4PZVA 1JWWA 1HLWA 5M2PA 1IWAA 1WKJA 2CVEA 1DAXA 3IGYB 2Y1RI 4ZPDA 2LQ9A 2EBGA 3HO1A 2DNQA 3M05A 3VAFA 2IBOA 3IWXA 1DTQB 1A7GE 3VVTA 1RAOA 5KG5A 4KGKA 1ACMB 2MZQA 5HN0A 2ZE2A 2M8DB 1YJTA 4QIVA 2HEKA 2D1GA 2XMKA 3MPUB 1Q8IA 5C66A 1GX6A 2XSFA 1VJQA 2HQIA 1XMOJ 1YI2S 3UNYA 1IKVB 2VF3A 3ULHA 2C3PA 1S6OA 2MQOA 3M9MB 3T1YJ 1SKWA 5DLTA 1LW2B 1RT2A 2MKKA 4Q45A 3LWLA 1U1MA 2VQEJ 2W9AA 4MIAA 1VRUB 1R43A 1NSPA 4NLWA 4CYRA 5D4NA 1REVA 2OMOA 2L08A 4RWXA 3QRPA 3T1YF 3DM2A 3DOKA 2RHQB 5CH7B 3W5ZA 4P10A 2ZHOA 3S8SA 1TFYA 5K8MA 2PE8A 4B3SJ 2IMOA 1Q53A 4I6YA 4NWBA 2R8KA 1HNVA 2DCLA 2B6AB 3I32A 2AEFA 3C6TA 4DV2F 1IM4A 3OXLA 3JSRA 2QA2A 2XMVA 4CTAA 4M5DA 1I6JA 3A3OB 3MMCA 4H4OB 4K0KF 1X31C 4ZVFA 1DBDA 1I1GA 7AT1B 1E2SP 1YRXA 1HL6A 2XYPB 2AU0A 2EFPA 1WC3A 4QW8A 2PT0A 1YBUA 5BXIA 4KTQA 3PW2A 3NKRA 1LWEA 1VFJA 1ZM3A 3KDNA 3OV7A 3C2PA 1FK9B 4MFBB 5A6PA 3SQOP 1BQMA 3AD8C 1RTDA 2B4OA 2L9NA 1FKPB 2VOOA 1YITS 4OYPA 3RGIA 2HK2A 3A13A 3HT0A 1TV6A 1VMBA 2IIHA 3N79A 2AEJA 4K8RA 1X9SA 1R3NA 1WELA 2IAJB 4USMA 1VRTA 1GMWD 4ECRA 1JLFA 5KG4A 2XNRA 3PRDA 1S7HA 2BUNA 2V2KA 4WYLA 3LALA 4Y2KA 1NPKA 4M5IA 3ZFVA 1KD1T 1CQNA 2M7SA 3THTA 4LSLB 4K4TA 4J9UE 2MLZA 3H8YA 3H20A 4RW7A 1UL3A 1S76D 3LGMA 1EW8A 1FA0A 3GQCA 3NMRA 3DU5A 1VQ5S 4USKA 5I4MA 5KFSA 5LQQA 3Q8VA 3S1TA 1IBMF 2GVZA 3DC2A 1SH3A 2EC0A 1U24A 2HGNA 3QLHB 3E01B 3VGUA 4DR2F 5ETKA 3TX0A 3J7Z5 5K14B 3PKMA 2HS4A 2A2CA 2DGWA 3K5OA 1MROB 3KUHA 3LP0B 2YKNB 1FJGJ 3WAVA 1FJEB 1F3VA 2LKZA 3TUIC 4U95A 2DNGA 3MTKA 1K1QA 4LRFA 2DXDA 3AB4B 2V67A 4C48A 4GTYA 4OV1A 1X7VA 5CCLA 1S1XB 1VYAA 3CDAA 4OJ1A 2H4YB 3DGVA 3MAAA 3DOMB 4TNOA 5ETPA 5FDLA 1U49A 1C4CA 1TL3A 1RT1B 1FE0A 1Y3KA 3BR9A 1M5HA 2YPZA 4X4QA 1H72C 2GAGC 2YX1A 1L3UA 1CC8A 4C8MA 1YJNS 4H4MA 4HTIA 1S48A 2BVZA 2AX0A 3NCPA 2FVQA 2R7OA 3RR8A 3BKFA 1CS4A 1S0NA 5THWA 2K7JA 1RT5A 4I0WA 1MLAA 1SKRA 1AW0A 4QBUA 1JIHA 3JB9k 2B4PA 1H7WA 1QE1B 2F63A 2KVQE 2QLWA 2X1GA 3G86A 3MD1A 3OTDA 4HH0A 4LBHA 5GAGU 1N36J 3IG1A 1N5YB 4WIIA 4DR1J 3NGDA 3OT9A 1QVGR 3ZNUA 3VAHA 3HCXA 2F7VA 2FDNA 1SJRA 2ILYA 4NLOA 3KDOA 1JNZB 1NCLA 3ZO7A 1KQSR 3DRSA 3HLUA 3DFEA 1WACA 3VWSA 1U7LA 1MMNA 4IYQA 4RL1A 2QA4S 1WSVA 3HM9A 3LANA 5G0RA 2B56A 5CQGA 4OI3A 3TVKA 2JVRA 2ZNZA 4NCGB 3IM8A 2IFYA 4Y2IA 1A0OB 2OPPB 4MK9A 1NDCA 2FYXA 1RACB 4CLTA 1FEHA 2DNOA 3DDNA 1S49A 1YRTA 4DHVA 2G1HA 1IM6A 3LW5C 4LSLA 3KLFA 1U1PA 4KJIA 5AJ3F 4OX6A 4Q8EA 4HTJA 4DWIA 2RU9A 3NRBA 3C14A 3NCQA 4TN2A 3TANA 2UVUA 3BBCA 4N5SA 1N33J 2YKQA 1GT8A 3R5BA 3R5AA 1U6ZA 3BZQA 4O3NA 1LXNA 2PEHA 2HVHA 3KXDA 4U96A 4RLEA 3HD1A 3KJQB 3T1HJ 5L1KA 2F8HA 2ADBA 1URBA 2R7WA 2LEAA 1IQZA 1FO1A 3H59A 3NWGA 5HSPA 3MFIA 2MKIA 3Q89A 4X4OA 1T03A 4UY8T 1N33F 1X0FA 2YBVA 4WK1A 4NLYA 1U48A 2BA9A 4Z37A 2KJWA 2XO6A 5C25A 1N0VC 1LXJA 5IXUA 2JLFA 4NYZA 2IHR1 4WFZA 3G6YA 1WWHA 1OPZA 3CCVS 2CQDA 2NSCA 5H9EJ 3NOGA 2DGTA 2O01C 2AZ3A 2YNHB 3EE3A 4FYXB 4NMLA 4P73A 4ZMMA 5D4LA 1N6QB 4LJMA 4M8LA 1RT4A 3SYZA 2C1EB 4PWUA 5DG7A 2MGZA 2VC0A 5B0FA 3FBBA 2D9PA 4CYUB 1R6VA 2HBZB 3ZTSA 1XR6A 2XMAA 2HHUA 1K0TA 2GNKA 1RADB 3FNNA 5SUHA 1GFWB 1X8DA 3PY8A 3DGPA 2GQQA 1HQEB 1P9QC 2ERRA 4UW2A 2LQJA 3ET6A 1TK8A 1UW4A 3SIPB 1N32F 4FVCA 1AUDA 2WVFA 4EI2A 3LQVA 4DQSA 3DLKA 1YIJS 1S0VA 2KTQA 2RD5C 1C4AA 2G2OA 3O3LA 5FIIA 4UOOA 1FDDA 2MPUA 1F1BB 2DRAA 2JZ5A 4JOUA 3BS9A 3CCQS 2LXIA 2M0GB 3DU6A 3QLHA 2O3DA 5DM6Q 4RZRA 5KFCA 3OL7A 4I68A 2I8EA 4NI2B 1K8AT 1IKVA 4K5SA 3ZZOA 3OW2R 2POKA 4M5JA 4ZCKA 1R8BA 2BKNA 2HVZA 4EYHB 3DRPA 1M5SA 3CD6S 1N88A 2H65B 4GO5X 4Y3CA 2QSFA 4JV0A 5KFJA 5F3TA 3W62A 1VC0A 1T94A 2RHSB 5A8RA 2GVZB 4Q8FA 4KYZA 1EARA 4FF2A 3GJQB 3LAKA 2BQUA 1AYEA 4RX6A 1L3TA 2IUCB 2RILA 4RUCA 2N3LA 1E6YA 3NS7B 1P6TA 1R31A 1R6YA 3CJSA 4DMZA 2Q6BA 2NR0A 2KFZA 2YWHA 4I2QA 1PYOB 1SJ1A 3CDEA 3VCDA 1JKHA 2NS1B 1NKEA 2V2VA 3SXLA 1N34J 2ZWPA 4YMEA 2OKQA 1RWPB 3KJFB 5D78A 3US5A 3M8YA 4H4KC 4FPRA 1DZ5A 3M6WA 4KM4A 1HWLA 2FVRA 3UI3A 1NKCA 1C0TB 3HZEA 4KGZB 4NX9A 1RUSA 2EFNA 5DJBA 1QDUB 2J0QD 4XTTA 2KI2A 4ZVPB 1T9WA 1VBKA 2B5JA 1ALIA 2MQLA 3MMCB 5TJ3A 1A6LA 1SIZA 3PG9A 6FDRA 3DKDA 4DQRA 2UV8A 3DI6A 3GFHA 2C2OB 3HFZB 3WHIA 4ANDA 2HHHF 1DQAA 1RA7A 4B56A 3EM1A 3NKNA 1XNQJ 3L7UA 2BEFA 4F0MA 1R8PA 5A8WB 1XEZA 3DYAA 1CPZA 4HDHA 4YR3A 2ZZNA 3ZTOA 1Y00A 3IM9A 1D3WA 2WSCC 3AT1B 2OGUA 4B3MJ 2OHDA 3Q22A 3A3PB 4C11A 8RUCA 1RTHA 2AGOA 1WG5A 3I5BA 5D6GA 3VAGA 1IBKF 4F7VA 2B9XA 3OHBA 2QX0A 1UEUA 4DN9A 3H5YA 2K1RA 1AA1B 2VBYA 3R5CA 1U1RA 1PIEA 2G2ZA 1FVQA 4DV0F 4O3SA 3MK0A 1X5OA 2W4CA 4FKXA 1C1CA 1NH7A 2V63A 3PNIA 4X4SA 2EWHA 2RRAA 1Q81T 4B3MF 3GIJA 4FF3A 1VQNS 2W5VA 2DT9A 1B99A 3D0IE 1SV5B 2CQ2A 1KR4A 2PN6A 2GSUA 3C16B 3HZGA 1NDLA 1DTQA 4DV0J 2B8QA 2CPZA 1RZMA 2DHSA 2OTLS 4DCPB 3GIIA 3CCRS 4DV1F 1UJ4A 3A12A 3PYFA 4MJKA 2DH8A 2VIHA 4J9QA 1KRPA 4HT7A 1OYDA 2ZH1A 4LMZA 1R7IA 3K89A 1NSQA 5F9LA 5H1SV 4M95A 5GADU 3FC9A 2FC9A 3QGGA 1LWCB 3OUYB 4FKYA 4DSLA 4RNOA 4MIWA 4GTWA 4P9SA 3MMJA 1E6VA 1K1SA 1IKYA 4U7UD 3DHXA 4IH7A 1U45A 3J81U 4RPFA 1Y3JA 1X5TA 1HPZA 1G3OA 1F9HA 2IJFA 5GAEU 2E1CA 1FNOA 1S9FA 5KT2A 3KYLA 3VV2B 1TL4A 3CJ8A 3CE8A 1KQGB 3W2VB 2VODA 4TXSA 1BWVA 4ZVRB 2EI5A 4EZ9A 4JI4F 1Q8KA 3VQSA 1OSCA 3BF4A 1SB6A 3OTOJ 4HACA 1U09A 2MHEA 3CIMA 5HLFA 1S6PA 3OTBA 3N9UC 4WU3A 1N48A 4IRDA 4I6WA 2HPUA 4C0OC 4X64F 1FJGF 3KMQA 1RAHB 3N0VA 2LXUA 2CPIA 2GCFA 2PA8D 2WBMA 2AMCB 4EK2A 2R2UA 1PG5B 1CULA 2YQ3A 3R5GA 3TA1A 4ZLLA 4ZK7M 1R27B 1RJJA 3KG4A 3PACA 5KFIA 3V2UC 4I1TA 3CJ2A 2CDRB 3VGSA 5DG8A 1HNXF 4ZLNA 2ZDPA 3HD2A 1JLQA 4CH1A 5F8MA 3MM8A 3WIUA 1NJZA 1CQMA 4XAKA 1TTHB 3MGJA 3OBIA 1WI8A 3JQMA 4ZP6A 1VQKS 1T9XA 2G1DA 1P8GA 4ZKAA 2DEJA 3QAUA 3FK4A 2I5JB 4PCQA 2DPJA 2OFGX 2K06A 2DNKA 5IT4A 4QYZK 2EC2A 4NA2A 3KKFA 5C42A 1CLFA 5J1PA 4ECZA 4ZGAA 3CJ5A 2B4UA 3GIRA 3EVWA 4MKVA 1KONA 4MKBA 5DRKA 1RU2A 2C42A 3HSZA 3PRBA 4USJC 1TUGB 1WKLA 2ZNYA 3NBPA 4QR1A 5KOXA 4YUDA 1MNEA 2RQKA 2P9EA 5B7WA 2YX4A 2I0XA 3TZYA 5KG7A 5EX0A 2IVMA 3RAQA 2J6SA 1TL7A 2VPWB 3QT8A 2YY3A 2DXFA 1T8EA 4C8LA 3UD5A 1RQ0A 4PG4A 2JX2A 3M32B 3IGNA 5JVHQ 4OV6A 1ICEB 1UTAA 4F4KA 5K8NA 2R7SA 5KFNA 3Q24A 2RU3A 2DR7A 4YOEA 5KT6A 3NKPA 3W8GA 3CULA 2NYHA 2HHWA 3W7BA 2OMLA 3NG8A 5J2NB 2D1CA 4ILLA 2VJUA 1FDBA 3NOCA 2KL8A 1FEEA 2WAQD 4JV2A 3KK3A 1IKYB 2EFQA 1DQ8A 3V4IA 2CPXA 1FI4A 2DNRA 4Q0BB 3R1LA 4ZPVR 2WSFC 2F9DA 4BC9A 3BO3A 1B0PA 2VG5B 4AE5A 3J7YI 1NEEA 1LWFA 2B9YA 4O3QA 4ZLJA 3A3NB 3KTQA 4FNIA 2HWHA 4C8NA 1X4DA 3QGIA 3D6TB 2IDLA 3HVTA 1JXVA 2EKYA 3KWMA 1PBUA 3DXSX 3FCVA 4CLWA 2BKPA 4NLPA 5KFMA 2OPRB 3ITHB 4O3PA 3HMJG 4J9VA 3HHDA 4M5HA 1U6FA 1TZ0A 3V5RA 1FD2A 4RUHA 3NMAA 1GMVA 1GTHA 4DCOB 5JXSA 5HJXA 2C2MB 4J9LA 2FVSA 2CPDA 4DR6F 4WYWA 5JMNA 2AYMA 2ZITA 1SKSA 1JXLA 4FBTA 2UXCF 3MCSA 2VDIA 2VG6B 2CPJA 4M1KA 1VBZA 2UUBF 1FRLA 3OHAA 4P7TA 4AYBD 5BJRA 2ZJQQ 3DLKB 2XCPA 3LAMA 2E7WA 2UZAA 1Q4RA 1Z1ZA 3PJ9A 1HIYA 2WW8A 1HNVB 2HNYA 3BDEA 3H98A 1PJ6A 4H4MB 4H4KA 1S6QA 4DF4A 1KHNA 4BDPA 2J9CA 4M5LA 4C11B 2DO4A 3O2IA 2FY1A 3U1LA 5L39A 4KHPF 4NE9C 3I9V9 2GIRA 1NBEB 5I42B 1FWPA 3M8RA 1TKXB 2E5GA 2V8DA 3M1VB 4OI2A 5F0UA 5KT7A 5CYMA 3Q86A 4M5GA 3HT3A 2F8EX 4AL6A 3W60A 2OPQB 4HVZA 1H38A 2ZVSA 1JQGA 4ECVA 4KHPJ 1NM2A 2OPSA 2VQFJ 4DL6A 4C3MA 1QVFR 2GLQA 1RABB 2CQ3A 4F0HA 4OI0A 3UW1A 5CXTA 3CMQA 3WDOA 1RAIB 1QAXA 2R3VA 3G8TA 1U1LA 4X62F 2AYBA 4Y0FA 3MM7B 2XG8A 4XIUA 2Z2MA 4OYXA 1FCAA 2RF2A 3CC7S 2A3JA 3QQCD 4YP3A 4DV4J 1RA6A 3N6NA 1JKHB 1UJ6A 3I82A 3B82A 1OY6A 2GV1A 3HVWA 4Q2MA 2CJ9A 2IUCA 5EWFA 4UPHA 2KVIA 3L4BC 4RW6B 4A4JA 4A8MP 4ZJQA 2CVIA 3G8QA 4A8SA 1HNWF 2VB6A 2ACMA 4KT0C 2QLXA 4QCLA 2WONB 1U26A 2CJBA 3N6LA 3J7AN 1R0CB 2HVIA 3IMQJ 3U7JA 3AY0A 5D3GB 2VA3A 1OO0B 3MXHP 3GYXB 3KNGA 2F8MA 2H4WB 3B8HA 3GZ7A 2CFXA 2HQDA 2YWKA 3GYNA 3MEEA 4ED4A 4DR5J 3A8JA 3KJNB 4KQZA 2G13A 2OPPA 4K5RA 4UQTA 3R7NB 3RRGA 4B9MA 5EN1A 2O66A 2RNEA 2X3GA 5U47A 4B9NA 5A8RB 2Z57B 3DOLA 3FQKA 2VPZB 2OD4A 1JJ2R 4WPAA 2VHGA 4FYDA 2DGVA 5KFLA 3CO9A 1WTFA 1WG1A 1RT3B 2VPXB 1VISA 5LM7E 2EXUA 3J7YU 1Y5NB 1SJQA 4RW9B 1KH7A 2RRBA 1B0TA 1J5OA 2B4VA 2CJYB 3A8IA 2KM8B 1TL7B 4LRAA 3MK2A 3ET6B 3LP2B 3K5PA 1Q79A 4JYAJ 3JSYA 3GFYA 5HMYA 1FRMA 1QTMA 1KNZA 1FT8A 1QE1A 1UEKA 1EP4A 4RJVA 1UPMB 2HHTA 4ZDNA 3HSJA 3FCWA 2R8HA 1VC6A 1UEVA 5B0EA 4DV6F 1HKAA 1V9OA 2WHOA 3C6TB 2QMXA 1RWKB 2EG1A 3K8VA 3ZTPA 4ZIWA 1YQHA 4EEYA 1SCJB 1VDHA 3H2LA 1TKDA 4M5MA 1HQEA 4BC7A 2WOMA 4M94A 2R7UA 1URAA 1NB7A 3HHLB 1C2PA 3BBFA 4NLDA 4Q2LA 1VBYA 2OP5A 5E3PA 4X4PA 5LMUF 3N5BA 4DV6J 4WWSA 1HQUB 1X9WA 4KFBB 1S0OA 1WORA 3TNVA 2ZDOA 4KGXB 1HBUB 2BZ2A 4IFVB 3W9JA 4CLKA 4ICLB 3OL8A 4OYIA 3MM6B 3P6YC 4LVNP 3QRQA 3HKWA 2BW2A 4DSEA 2GMJA 1WF0A 1VQMS 1WEYA 2XLIA 2A6MA 2J8AA 5LIAA 1HFEL 1F2HA 1N5VA 1RU1A 5KFTA 1AXQA 4B17A 3RB4A 2FIUA 2X51A 5IJQA 2BE2A 1DLOA 4L74A 5K5MA 3R2DJ 4UUXA 4Q0BA 2FJDB 4OLOA 3DN9A 4GTXA 5J1EA 1S6PB 3FEYB 4LFCJ 5GRRA 1EETA 3BO2A 2J76E 2CRLA 2XMTA 4Y2AA 1LWFB 2G4BA 1D1UA 3PEHA 2F4VF 1Q7LB 4ZN1A 2HZAA 2QZUA 4YB5A 2XWXA 2ALYB 2VL1A 3KMSA 5DDPC 2BBEA 4U8YA 2IC3A 4ZPCA 4FYWB 2QMWA 3NGRA 2COLA 1SC6A 4UQGA 3PR5B 1WTBA 1NPPA 2QYGA 2IVFB 2F4VJ 4DPOA 5BYSA 2ZJPQ 1RLCL 2VFUA 4L72B 5DLFA 1TUVA 2IM0A 4J7CA 3R27A 4EBEA 3BDGB 3E8OA 1FX4A 3K58A 3C8YA 2R42A 3GU0A 4LF4F 3JXOA 5IWAJ 1X4AA 1U0SA 3D1HA 3IG1B 2IRUA 3MEDB 2XMUA 4JI2F 3BO4A 1G7CB 5KG1A 3PX0A 4YR1A 3IC1A 1DLOB 3RBEA 2DBBA 1RKIA 3LOUA 4NYOA 1FFGB 4N8NA 3UNGC 4CO2A 2VA2A 5INHA 4IQXA 1RCXB 4ID8A 4ZOSA 3QNWB 3MM6A 4RUBA 4PQUA 1UZHA 4KO0B 4M5KA 1XNRJ 1QSSA 1CC7A 1WEXA 2CQBA 3W64A 5KFWA 2Z30B 3H7HB 1S77D 5GADI 1YJUA 5C2GA 3RB3A 2DKOB 3DOMA 5FDLB 4XPEA 2ABYA 4DZDA 2XLJA 1RT7A 4NCBA 5IJSA 1GXUA 3HHLA 2JL9A 3L09A 4KPYA 4CIOA 1G6BA 3SCIE 1L5UA 3MHYA 3J81j 2MZJA 4EBCA 3VAKA 1U8WA 2GZOA 1CJVA 2DH9A 1KFSA 4B3OB 5KXAA 1N52B 3W5YA 4YY3F 4DJBA 5I3UB 4FS2A 3CCZA 1EP4B 1YRUA 3CJ3A 4ZPTR 3W2VA 5L0KA 1ZPWX 2CJXB 2YXLA 3KFWX 3Q8UA 2Y9HA 4ZA1A 5A8KB 4EBDA 2PMWA 1Q5YA 1B7YB 3HVAA 1WJ9A 3MR5A 1RHKB 2EEYA 3PRVA 3UN2A 2BJ3A 3QPIA 5EWEA 4JUZA 3VALA 3MEEB 2ALZA 4OZNA 2ASYA 1TELA 2V8HA 4KAIA 1EQ0A 4QIEA 1J2VA 1M90T 3AOAA 2CZVC 4KY3A 2D74B 4RNMA 1R8HA 3UD4P 2CNOB 1TK0A 2UXBJ 2EPIA 2QTWA 2C2RA 2IY5B 1FVSA 2ZUGA 4P75A 5EUHA 5T41A 2XM3A 1UWBA 3W66A 4ED2A 1U4BA 3K7RA 1HNZF 3QT6A 2DGQA 4RW4A 1TV6B 3CEDA 3RAMA 3DLBA 4DBQA 3FZ2A 5KFFA 4NYPA 2VKRA 1UFLA 3EMTA 2HG4A 1T3OA 1RAFB 1M1GA 3T6BA 2OEJA 4YHHF 5B0GA 3TA0A 3KLIB 4DL4A 4DI6A 4HL9A 3PDNA 4ZVGA 3PIOQ 3QGPA 4QR2A 3ZZZA 2XO7A 1YGYA 2DIVA 1TVRB 2OPSB 4P74A 4WP9A 1SQGA 1PO6A 3OTEA 5KAKA 2VG7B 2DYAA 1NZAA 5CZXA 2V8PA 4OZ1A 4B3RJ 3AFGA 3TQEA 4KV8A 4M5DB 3BN4A 1UVNA 5I3UA 1OY9A 3M30A 1AJBA 1QUPA 2IJNA 3GV7B 5C2CA 1KVKA 5HL7Q 2JFKA 2EBEA 4HT5A 4B3OA 4ES1A 3UQSA 1OYEA 2HHSA 1S1TA 2WVEA 4Y6IA 1JLAB 1V5VA 4UOPA 3MD3A 3HFVA 4ZVEA 1RYRA 3T1HF 2HZVA 3WIVA 2HMIA 1UP1A 1HBNB 2VASA 2IFXA 2IRYA 2UUWA 3KG1A 3EGZA 1CEZA 1BE4A 4NZ0A 5D0GA 3FBEA 4TU9A 4J9KA 3SFGA 1RHRB 2FQQB 3IAS9 2D3O1 3WX4A 4B3TJ 3KHGA 1Y4ZB 3D0HE 4A8QA 2W2PP 2VC1A 2C2EA 1N6QA 3DOKB 2FPHX 2W8KA 2X1FA 2L9WA 1IWGA 2PA3A 3KNAA 2VBXA 1XQIA 4IOCQ 4E0DA 4EUVA 5B08A 2RH3A 1RWMB 1PYSB 1HDHA 1WOOA 4KJDA 4F26A 1HMVB 3EYZA 4EU0A 3IA0A 4MKAA 3D9BA 4KKOB 1S59A 1X4EA 4NRTA 1U1NA 3MEDA 2G9YA 1V5IB 2RDDA 5H9FJ 2VQFF 1VIXA 2DR9A 1QLNA 1YBAA 3TJAA 4C3KA 2ZH9A 2QYCA 1YZ7A 2VPYB 4RW4B 1HR0F 3M2VB 1FSUA 4AD6A 2LDIA 4I6AA 4USIA 4CRJA 3SV3A 4A8OA 2J9DE 1UMJA 3P4UB 4X62J 2C2NA 2JEIA 7FD1A 1NJYA 1S9GB 3FUYA 1RTIA 5L38A 3PIPQ 3WAXA 1ZM2A 1N5YA 3T02A 1M5VC 4N76A 2AJ1A 4OZ2A 2F4FA 4I2QB 2MSSA 3QYYA 5A0YB 3MR6A 4NWJA 4G1IA 1KVJA 2KRRA 2CJKA 4FN5A 2BRKA 4NA1A 4MY4A 2KYZA 2LQ5A 3OL6A 2V4RA 2VONA 2EK6A 3EUNA 5I3QA 5GVQA 1VQPS 1NK4A 2OSRA 2YKPA 2N4CA 2VH7A 1Q78A 2KZMA 3T1AA 2XB2D 2YH0A 3B5QA 4ANEA 3A52A 2Z2ZA 2KO1A 2W2QP 2D7SA 2HQCA 5KG2A 1NPRA 1S5ZA 3IBFB 3K59A 1P1TA 4K0KJ 1BC6A 3A8KA 2AJQA 5AE1A 3HX9A 4ZP9A 2RQCA 4LF6F 5M2RA 2IM3A 2V9WA 2ZKTA 2X98A 4LR2A 1KHWA 2KXHA 1KQFB 3TZWA 3DGPB 4NLUA 4XO0A 4KHMA 3U1NA 1FNXH 3PO5A 4PWDB 4K50A 3D1OA 2HWTA 3PFOA 1OMSA 1WEZA 2BM1A 1N34F 3WC0A 2CAJA 4BWMA 4X4RA 2MGZB 4LQYA 1B0VA 1JLGB 4DL7A 4CCHA 2HHPA 2V4QA 4ICLA 3GV5B 3L95X 5KOWA 2HGLA 2DD8S 3O8WA 2KT2A 1VIOA 3C6UA 3M2UB 4LUBA 3CGIA 1RT5B 2W9CB 5LRMA 2DK2A 1HYSB 3W65A 1KS2A 4O4GA 4TVAB 4IFYA 3R7SB 4AXIA 4C3LA 4D3HA 3SSSA 5DLVA 2NYIA 3LP2A 4NXMF 3ENVA 1FE4A 2QC3A 1YJ7A 3D66A 2CWKA 2DXEA 4NLSA 3SSQA 2HHHJ 2R7TA 1V3SA 5GAGI 2GHWA 1RAGB 2YKNA 4IG0A 3MMBB 3NXZA 5I3PA 4E8UA 1Q82T 4GKKJ 3MUMP 4FPIA 2RH6A 2J7KA 2UV8G 2H5JB 1EZZB 3BR8A 1IBCB 1XMBA 3KUGA 3NS5A 4YB7A 3OSNA 4YN3B 4R25A 3HULA 5F8GA 3FBCA 5FD1A 5HMZA 1ELZA 5CAAA 1R0BG 3UVJA 3Q8YA 5HK4A 2BANA 3OVBA 3MDFA 2MJUA 2BE7D 3QIPA 5B0AA 1CJTA 4ZIVA 1ZETA 3N28A 5CYJA 5LMUJ 1NXIA 1LWCA 2YNFA 1EB0A 4OHYA 2J0XA 3JSMB 4BLGA 4I7FB 3T6JA 4ZVOB 1EJ7L 3M8PA 3ILLA 2DR5A 4LF8J 4ED0A 3ISZA 3NNHA 4MT1A 1B8JA 3NKMA 3AJ1A 1RDRA 1HBMA 1SH2A 2CG8A 5J1NA 5GMKa 3BH6B 2V4JA 4C98A 2FY8A 3PW5A 1PC5A 3LUYA 2DIUA 3SSRA 5KG6A 4IO1A 3VTIA 4DV3J 2OEKA 1N54B 4TLQA 1IJEB 4MH8A 1FF2A 2V69A 3MMBA 3UN5A 3EDRB 4LF8F 3M8QB 3O6QA 3QGHA 1ED8A 4XPCA 1X4BA 3KK2A 2OD6A 2WVDA 3C16A 1IR0A 1YTYA 4GKJF 1WDTA 1DRZA 1IR1A 3LO3A 5HAOA 1H2TZ 1NUEA 1GK8A 4CDIA 1K44A 5KFPA 3SZ2A 3D3CJ 3RB0A 2M5YA 1M1HA 1WC4A 1VCTA 4ZJOA 4CO0A 1TL3B 4OYZA 1HQUA 2YH1A 3T5KA 2B0GA 4IDKB 2M4MA 4QWDA 3TAPA 1YDLA 2ZUAA 2I38A 4U8VA 2RIJA 4OZ5A 2GVDB 2MMYA 3JAMY 2VUGA 4DN0A 3NCRA 1NHUA 4ZLPA 1H74A 3DHWC 1PSDA 2JNJA 4LVOP 5K20B 4YR0A 1S72S 2M9KA 2W24A 4ZITA 2Z58B 4P52A 1D0EA 4USWA 2ASDA 2Q66A 3OVSA 1DTTB 2X1AA 1FRJA 1S1XA 2IRXA 1IKWA 1AROP 3DYAB 4B9LA 5K14A 2PFDA 3T9NA 4UTGA 4LF5J 2WSEC 3W1YC 3AB2B 3D2WA 2E5IA 1REGX 1YJWS 5ETQA 2WVBA 2CYYA 2M2BA 3LF0A 4DEZA 1HJKA 6FD1A 2QGFB 3KK2B 1VC5A 3GSIA 4TY9A 2J6TA 3JS9A 4LRDA 1K9MT 4DQIA 3HJVA 3DDIA 1HNXJ 2XGPA 5IM0A 3VVUA 1PJ5A 4I56A 1IBLF 3TJ8A 2ILZA 3I4HX 4ZPBA 2BJ8A 2ZC4A 1NK6A 2FZCB 1VRTB 2LQ8A 2RQMA 5DQHA 4DZ6A 5CD4H 1B64A 3V6JA 3U1MA 2RS8A 5A2QY 2J0SD 3IRXA 3MM9A 4GO7X 8AT1B 3KLHB 3MECB 1N32J 1SVDA 4QWEA 5L0EA 3P3DA 4MMOA 1RISA 1SQEA 3GR1A 3UDLA 5CA5A 1HNIA 4YY3J 4DLEA 3PX4A 2EW9A 2DTJA 2VD3A 3ICLA 1MMLA 4DV7J 2AV5A 2UP1A 1V6HA 2PC6A 3GJSB 4WZMA 1AJCA 1VBXA 4NCAA 3QRRA 3MTJA 3GFZA 4ECYA 4QOTA 3EXYA 3M8ZA 4LRCA 4Q44A 3TRGA 3Q8SB 4AFFA 1VQ7S 4XDCA 1S4EA 4ECUA 2YWGA 1XC9A 2Y0BB 4FBUA 5CCMA 4K4ZA 2IPOB 4IG0B 1YLXA 3CD7A 4CO3A 1X4CA 3HJFA 2U2FA 3W8PA 2KXFA 4LSZB 2BX6A 1B70B 4NEYA 3VHQA 1MWZA 4CWBA 1KC8T 3CCUS 3C19A 3FDSA 1IKWB 5KFZA 3NAIA 2CJAA 5DQIA 4FF1A 2HAFA 3NVLA 4CYSA 2FVCA 1TFWA 5D0RA 3C6UB 3ZZ0A 5HROB 2KJVA 2DNZA 2H9ZA 1CVJA 4HI1A 2E9TA 2HLTA 3Q8QB 3R2CJ 2DHGA 3OVAA 4OQJA 2GO8A 3CD0A 3I55S 4LF9J 1WC6A 2GMLA 2I5JA 3B6BA 3I0RA 5F0WA 3UDCA 2UUCJ 1JXEA 5B09A 3G87A 1U2CA 2DGUA 5KT5A 1WC0A 1MN9A 2KG1A 4OIXA 2UUBJ 2F9JA 1TL1A 5C24B 1SUQA 1XR5A 3FMWA 3L9ZA 4A8WA 1TVRA 1ZA2B 4B9UA 3BSCA 1FHTA 4LFBF 4PG5A 4HHJA 3B4MA 2UUCF 2K3KA 4RBTA 2CUYA 3GYGA 4CLLA 4DG1A 3UFCX 1XMQJ 4C4WA 1S7IA 2WB1D 4EO6A 1H6KX 3KD8A 3THPA 1SQFA 1N0UA 2H5EA 2W8LA 3UCUP 2GGPA 2ASLA 1T3NA 3DLHA 3CJRA 4JV5F 5T7LB 2GQCA 1MSWD 5KG3A 1KBRA 1HPZB 1RWXB 1T9YA 5HQLA 1Y7PA 3JSBA 3GIMA 2VJVA 1CJTB 4OYWA 3BH7B 1ZAWA 2MQQA 2RDJA 1UVMA 4DPXA 2MEWA 1ELYA 1ZYQA 3R7BB 3FJ2A 2KFYA 4RU2A 1KH4A 5HQ8A 1N5QA 1NLKL 4WE1A 3KK3B 2L41A 4MTPA 2XMMA 4LQ9A 3FEXB 2DNPA 2BJ7A 1VQSA 5D15A 1WC1A 3EWGA 1O5JA 4LR8A 4HDGA 1OQ6A 3BKTA 2M88A 3RB6A 3JTNA 1TKZB 1NNDA 2CQGA 2CXEA 2FJXA 2CJQA 2RQ4A 1IR2A 2L48A 1YG0A 3UR0A 1F9FA 3TQ1A 2MLXA 1PGZA 3BB5A 2CQ1A 1B3TA 4I64A 1VQYA 4IOAQ 1U25A 3G8SA 4KKOA 3QFWA 2R9LA 3MPDA 4OLPA 2C2DA 4CQ1A 1EHWA 3DRSB 2FHKA 1S9EA 1HWJA 5AT1B 4DFJA 4I2PB 2KFNA 3TJ9A 1CJVB 2V9KA 3ENQA 1GX5A 3PZPA 3V81B 3LWMA 1TL1B 2W7OA 3CJKB 4AT1B 1AT1B 4CLUA 1KOHA 4DU7A 2E5JA 3CCSS 5L0BA 5CZVA 3UN3A 2ZBQA 5F8HA 3KK1A 1ALKA 2DNMA 4W4MA 4ZP7A 4PUOA 2GSNA 2MSTA 2C22A 1O0PA 2KG0A 2LECA 5IS2A 3T19A 1BMQB 2W5XA 5H9FK 2E5LF 1W2BR 3HK2A 4QWBA 2A1BA 1ELXA 4IG3A 3ILIA 3NGUA 3P49B 2HRTA 2LU2A 3GLJA 1SL2A 4F4XA 3CT9A 5DETA 1WOPA 4PXCA 3KJVA 2B5JB 2JRSA 3LH2S 3CCJS 4JV1A 3BEGB 1RK8A 1X5PA 1C0UB 2XI3A 3E51A 1ZA1B 3O44A 1T05A 3OR1B 1RBAA 4NLVA 2ZOGA 4R0JA 4ES3A 1WC5A 4Z7YA 3PYDA 3I5AA 3OJUA 1M5KC 1TKZA 4L73A 1LK5A 4AXJA 3EZOA 1HWKA 2DNYA 2YKAA 3K2YA 4KH1B 3B4DA 4C97A 2XYGB 2ZH7A 3CCLS 3Q3QA 4IR1A 4WFBQ 3LP1B 4K2XA 2L3MA 3TVZA 1NK7A 4W92B 3PM9A 5IT9Y 4KSEB 1UJ5A 3VZHA 4FDIA 1E6YB 2A10A 5AXNA 2AZ1A 1F5AA 3HI9A 2C3MA 2HFOA 5SZTA 1XIQA 1SJFA 4ECSA 1AZSA 2AYEA 2FHJD 2WZ1A 2YNIA 3GONA 1EETB 1O6XA 2CZ4A 2XSJA 2JH3A 3POTA 3E2DA 4JBCA 2FZGB 4ZVQB 2ZHAA 5HMWA 1CSJA 4LFAJ 2AGPA 1RE1B 4URQU 4XK8C 2I6WA 3PXGa 5K8OA 4RW8A 3IS9B 3I96A 2WB4A 1WHWA 3MCMA 2MY8A 1O8BA 4USHA 3CPWR 1ZEFA 2NZCA 4NI2A 2CPHA 1SUQB 1WI6A 3AODA 1MMDA 4ZVSB 5F3ZA 5F8IA 4X65J 1L3SA 4JP8A 2VQRA 1BD6A 1F2GA 2P5VA 4OYAA 3RW7A 4LFAF 1I51B 2Y0SD 2CZ9A 3DRPB 2QE5A 4Q7AA 3V6KA 4QPTA 1YK9A 1TKXA 3M1VA 4YDDB 3BN7A 3I0RB 1RTZA 3G6ES 4DV2J 2KM8C 1VGYA 4WP3A 4DUYF 3K8WA 4DR3F 1D9FA 4X65F 1ZEBA 3CDUA 5EGYA 1Q7YT 2IVYA 1UKUA 4ITSA 2VFRA 1R8CA 2RB7A 4NLTA 4CO5A 3BYPA 3H42A 5L1JA 4L75A 1CJKA 4JI2J 5C7PA 2ZWOA 3TX8A 2HKEA 1XWLA 1SC1B 4F3OA 1ZH5A 4PXBA 4DFPA 3RBDA 3BQ2A 1JJHA 1H98A 2JHEA 2MB0B 1EW2A 4TY8B 4CH7A 3EXCX 2D9OA 3EGNA 1EQJA 1S1WA 1FDNA 2MJNA 4RR5A 4JI5F 2WW4A 1J5EF 3N5FA 4LBPA 1LW2A 1RT2B 2MDAA 2N4DA 4A46A 2XS7A 2LMIA 2YNHA 2BYCA 3KLHA 5HVFA 1GNKA 3BGFA 2MZ1A 2RSQA 2GC8A 4JI3J 1BWEA 1NK8A 5IWAF 5J2QB 1ALJA 1NH8A 2KDOA 3KLIA 4DFMA 3EX7B 1QUVA 2JLEA 1PCAA 3PX6A 1F5BA 3M4XA 2GJ2A 3ENAA 2YNFB 3GPAA 4X4UA 5J2NA 3SV4A 1YJVA 3MMAA 3Q83A 1VHFA 1Q8LA 2P9CA 3TEHB 3QSYB 2J6UA 4LF7F 4DS5A 3VF0B 2XLKA 2H3EB 3M32A 2DO0A 3EZUA 2QL7B 4M5NA 2HQFA 2DHHA 1EIYB 2KT5A 3SZZA 5B0BA 4CI0B 4WKRA 3KJVB 3MK1A 3G6XA 1YBTA 4OHZA 3KLEB 1AUKA 1FRXA 2Z8QA 2HIYA 4JI8F 3SCJE 1RBLA 1HBOB 4DL2A 2AEMA 2UXBF 4PPZA 3F56A 2A6OA 3MZIA 4ZVTB 3K5NA 2JLGA 4DR2J 3T3FA 2BW7A 3NLCA 1NK9A 2DRDA 2YX7A 4LF2A 2IM1A 4FP9A 2HRYA 4LT6A 4C0BA 1S99A 1GEHA 1RI7A 1SKUB 2ZBPA 4YS2A 2GJFA 4EMDA 5F9NA 3MUVP 3NP5A 3KOAA 2QRRA 1Y7AA 2K8GA 7FDRA 2V50A 3RRKA 5ETVA 2C2ZB 4DPUA 3OL9A 5CYQB 4FYYB 2WOMB 1S10A 1R8AA 2QLJB 2V2ZA 2OO4A 4LRBA 4O4GB 4DU8A 4NLQA 3N4WA 4DL0C 2V5HG 1C1BB 2QZ8A 3VAIA 2D3ZA 3TO8A 1CS4B 4QU7A 1QTNB 2VG6A 3QWUA 4CLSA 1S1VB 2EG2A 1RT4B 2PMHA 3EJMA 2ROPA 3D67A 4CNZA 2P6TA 3FRZA 4MYUA 2N3OA 1XBWA 1BQXA 2W01A 1T03B 2PSZA 5GMDA 3M6XA 1HNZJ 3UO0A 2V2QA 4HHUA 1VI7A 1R89A 1T9UA 4LREA 3VGTA 2NXEA 3FVYA 5LMNF 1D9AA 3NAHA 2OUGA 2LEBA 5KFUA 3M8PB 2YPYA 1HARA 1ZZFA 1F0XA 4PR6A 2ROEA 4U7UK 3VZIA 3ISND 5LOQA 5C5JA 1N36F 2FLNA 3C46A 2QFJA 1U47A 4DPTA 1VR6A 2DR6A 2V34A 3ZZRA 2J8SA 1Q8BA 4ZS6A 2ZHBA 4PWWA 4DQQA 1XMQF 3BDGA 2G0JA 2W25A 4ZVHA 4LF1A 2LA4A 4I7FA 3CIZA 3Q8RB 1ELOA 3TWZA 3D6FB 3FBFA 2GW8A 1U0HB 3EICA 3MPVA 5BYQA 4L6V3 4JI7J 5D3GA 3QJJA 2P9GA 2WONA 1PILA 1VHIA 3C15B 1RLDA 1IXKA 3AOBA 2AJ0A 4I4BA 1RB0A 2DHAA 4X66J 1JLEA 3BGLA 4LSNA 4NPOA 5LSRA 5KT3A 5BR8J 4DV5F 3V6DB 1SL1A 5DGBA 5FJ4A 5IQ6A 4LFBJ 3TUJC 1M1KT 3QMQA 4TU8A 2VICA 1XJWB 1B4SA 1ZOTA 2LVWA 3L7OA 3P5TL 4GRSA 4GVBB 1JLFB 3QJLA 2UXCJ 3IGVA 3CDBA 2BE2B 2W2OP 4V1Ak 3MM5B 4CXKA 4GC6A 4QYZJ 5DDQC 3D5MA 5L1IA 2DGSA 1GTEA 1KEKA 3GR0A 4DX6A 1I94J 3AJ2A 1VRQC 2A0FB 3BQ1A 3RR7A 1Z2ZA 1SHQA 3DXBA 1UVIA 1AJDA 2J7UA 3PYEA 2HS0A 1NO8A 1ZTWA 3SZYA 4G3IA 2MZRA 3G2XA 3NGKA 4UT4A 3KLGB 1NK5A 1KTVA 4P2FA 4TY8A 4CLPA 1RHJB 4EGLA 2XR9A 5IV4A 4K4YA 2W5SA 5HATA 1LFPA 2HFZA 3FCHA 4NXNJ 5F8LA 4RUAA 2R7VA 2W4PA 5KFGA 4A8KA 4F8RA 3TUPA 2K2PA 3OLBA 4MYTA 3CF5Q 4CXUA 2NXNA 1OSDA 2XZWA 5DZ6A 2N7CA 3D0GE 3DLJA 1WHYA 1VK3A 4FF4A 3O1LA 4K7QA 2W5TA 5A8WA 3BGRB 2FZKB 2WCXA 2W9BB 3D7SB 4IUFA 1G2EA 3IDDA 1JLCA 2XULA 4OJGA 2D3OR 2HBQB 1RT6B 2N7YA 4WF9Q 4RU9A 4RW9A 3JAMU 1S1UA 4FXWA 4DL3A 2KN4A 4Y00A 1MN7A 4ECWA 5L1LA 3LA0A 1RAEB 3K5MA 1SIWB 2MY7A 3E01A 2W8SA 1UAWA 3I56S 5KFVA 4LF6J 4K59A 3HVRA 1VK8A 4V19X 2LYVA 4A47A 2W5WA 4CT9A 5E3AA 5K9FA 1KFDA 1IJFB 5ITHA 1LV5A 1AUSL 4AL7A 1WDDA 2FB0A 5A0YA 3S7RA 5K4PA 5HI7A 4ED1A 2Q1LA 2DHXA 1ZTTA 1Y5LB 2HRUA 1EQMA 4WBFA 2HAIA 3PHEA 5KFDA 3IN5A 3T00A 2DB1A 5LXYA 1JMTA 3TUZC 4GKKF 1S9GA 5F8JA 3H90A 3IXQA 3OTCA 1U1KA 5KFHA 2G9OA 2Z2LA 3EVOA 5AE2A 4K4SA 1IUJA 2UVRA 4F2SA 1IKXB 4LIRA 1Q0NA 3FMBA 2YQ1A 1XERA 1RT6A 1BXNA 3LP1A 3HXMA 3RJMB 2NREA 4IRKA 2XRGA 3UE2A 2ZH8A 3RAXA 4C6AA 2PO4A 2E1MC 2M70A 3SQGB 4OX7A 4H4OA 2ASJA 1M5PC 4JI1J 1XMOF 1LEOA 3TP2A 5L9NA 4ALZA 2XYHB 2KZZA 2HS3A 2XS2A 3SMZA 3W5XA 1Y0HA 1KDNA 3CVKA 1WF1A 2VV5A 4K4XA 4EZ6A 4LFCF 1IVZA 1YWXA 3LGHA 1RYSA 4R5PB 2D69A 5EX3A 4U7CA 2YKMA 3DLLQ 3BPDA 4IKAA 4IDKA 2CPFA 4IO9Q 4MIVA 4WU2A 2D3UA 4DR3J 1WOSA 5HRTA 1S97A 1KP6A 2HVEA 2EFVA 2X3DA 1Y5IB 4F0KA 4ZCMA 2XI2A 4P2SA 4J9RA 2NQPA 2UUAF 2E5HA 1T95A 4YFUA 2CNNB 1HA1A 2MKHA 1RHUB 2DNNA 4GKJJ 4KAYA 1KTQA 3LPEA 1D8ZA 3WC2A 1WKKA 1EAYC 2GQ2A 3ITHA 2B3TB 4KGVB 4OX9F 3HP6A 2KU7A 4ZVUB 3OLAA 3BSOA 2HVDA 1QJHA 2EVZA 2M52A 5L9XA 1IBKJ 5F8NA 3W63A 2XHWA 2OI2A 4JI0F 1UW9A 2ZOMA 3C3LA 4WIQA 1HD1A 1RSCA 1S57A 2Q3PA 4DUYJ 4LSNB 2Q79A 4F4AA 2C2KB 2WVCA 4JI6J 1FWLA 4DPYA 5HP1B 4OHWA 4ED3A 2XSJB 4ID5B 4JI0J 4A48A 2V4JB 4PG8A 4NLXA 1NHVA 3SEOA 4UZBA 3QIPB 4OZ3A 2AYGA 4UORA 3D6HB 5L46A 1U2RA 2GA7A 1E6VB 2RDIA 4WE1B 4KRWA 2HLUA 4OX8A 1KLMB 3R97A 3C66A 2BKOA 1M5OC 1ANIA 1VQOS 3BJYA 1FNMA 2ZZMA 3D54A 3W2WA 4DSIA 1NU4A 2ZOFA 4FNHA 1FFSB 3HFKA 5T7LA 5MLCV 3MI7X 3H5SA 3OPKA 1ULRA 4RO0A 3UDVA 5J1EB 2QN6B 3RG6A 3WBZA 4Q43A 4DX8H 4DSFA 5GOVA 1J5EJ 2AP6A 5K8PA 4C8OA 4J9OA 2IM2A 2C3UA 5RUBA 4FS1A 2IA0A 2RKIA 3M6VA 4ZG7A 1W25A 4WFNQ 3H25A 3PR4A 2ANHA 1QAJA 2O1PA 4AQYJ 4XDDA 1RTJA 4NWXA 4OZLA 1W26A 3ZXWA 1VQ9S 1BLUA 2AKWB 3EVMA 3M6UA 1W2IA 5J2PA 2ZBIA 1HHTP 2HW3A 4MHXA 1WNEA 1C1BA 3BPSP 4USUA 4L3KA 4DR6J 3SFUA 1K0VA 4KO0A 3MUTP 4F02A 2AT1B 2BMBA 5C24A 4GMKA 4ZN3A 4P2MA 3R9LA 1RXOB 4TQRA 2RVJA 2B7BB 4I67A 4QIGA 2GIFA 3BGOP 1U1OA 1IBMJ 5DLGA 5D4OA 2P2CB 2MZSA 3AQPA 1S9EB 3CSKA 3PHTA 3ZTRA 4WK3A 4BHQA 4O4RA 4WCEQ 2C28A 4QWAA 1BGXT 2DNLA 3KHRA 3DMJA 2ZFHA 5ETNA 2PFFB 2CQIA 2LXFA 2ZEJA 2YWEA 5KT4A 3TAQA 5EWGA 3BREA 3GMGA 5LSOA 5EHHA 2BOPA 2A18A 3GCXP 4J90A 4IH6A 3W9HA 4DOZA 2WK4A 5LSLA 4ZG6A 2NSBA 4GVBA 2HGMA 2ZBRA 1OY8A 1UVLA 2KXNB 4DR1F 1TAUA 3PW4A 3IO1A 2Q6CA 1Y6VA 1URRA 2XMWA 3LGNA 3SI8A 2EK1A 2MQMA 5D77A 4ED6A 1N5TA 5LMNJ 2QMUB 2IA6A 4URSA 1PBAA 5JVGQ 4BBYA 5AE3A 1ZBTA 1UVJA 2Q43A 2P8IA 1X5SA 2GS8A 2GX8A 3CUNA 1K73T 4B3RF 4X2BA 1ANJA 1G4CA 4NZ6A 2KHCA 5EGEA 5E5NA 3WBHA 3Q0AA 4YB6A 1OJ4A 2ACYA 4G6VB 3DLGB 3W61A 2VBWA 2XNQA 4HR2A 5D0HA 2UU9F 3H40A 4JB8B 4LBIA 3FEZA 5BYRA 2ZZTA 4KJGA 4BS2A 3OJSA 4KPCA 3D3BJ 4TYAA 5J2QA 1HNIB 4DUZF 2QA1A 3FFIA 5D0EA 5ETTA 2BXJA 1VLYA 2UU9J 3IAM9 5HP1A 2W5QA 4N7TA 1RTIB 3M2RB 1E1ZP 2AJFE 2WRMA 3IR6B 3ZZUA 2KKHA 4BCAA 4MK8A 4ED5A 3D28A 2AJ2A 5IT9U 2JVOA 2AJ4A 2MHNA 1S79A 1T9VA 2GHPA 1PJ7A 4WFAQ 2IDEA 4LR7A 2H51B 5J2MB 4ECXA 1VQ4S 2Y8WA 3DYCA 3VAJA 4F50A 3GIKA 1FTCA 2QLFB 2VFTA 2PMZD 5KFYA 2XCAA 4X84A 5IC4B 3IR7B 2NUHA 2NXUA 3RBZA 4CNYA 2R7RA 5CHCB 1GAOA 4J91A 2ZM6J 3BSAA 1DTTA 4ZJLA 4JI7F 1IN0A 2E29A 4CZCA 3M9OB 2XY6A 4HH1A 5DDRC 3CJ4A 5KFAA 2BR0A 4OHXA 3K57A 1S1TB 3NKQA 5E33A 5ETOA 2I2YA 4B3TF 2HNYB 3B54A 4DV5J 5HROA 1P49A 1N4LA 4D3GA 2GAHC 4CTAB 4UZCA 4E98A 3QBCA 1KHVA 3HHEA 4G1QB 3QFHA 1FFWB 5IV3A 1SL0A 1NKBA 3DOLB 3F41A 1RCOB 1Q16B 3EGVA 4DV4F 2JDJA 4PXEA 4K2JA 3TZZA 4ZG9A 3AH6A 1IKXA 1I94F 3CO0P 1MROA 3J80U 4RW8B 5DZ7A 1WUUA 2HNZA 1FTRA 2RAQA 3MM5A 4DR7F 2CQPA 2FTRA 2LP4A 3SQGA 5C25B 2Y3YA 1KHLA 2W7PA 2VG7A 1EKSA 2V0NA 4K4VA 1VQ6S 1P1LA 1YVFA 4TLRA 5HANA 4F67A 3PV8A 3NGSA 3G9CA 4GTZA 2OSQA 2GA3A 1DFDA 2L9DA 1D8YA 3V6DA 5LT5A 2E44A 3T41A 5ETRA 1VS3A 2YNGA 1UETA 2ZH4A 4ER8A 2R2SA 1ALHA 3A8EA 1Q86T 2GSOA 3UCZP 4LQ3A 2O67A 3JSMA 3MECA 2BABA 4PG7A 3JQJA 1URNA 1FWKA 1JK9B 4FDJA 5IM0B 2MLYA 5KFOA 1KSPA 3HHNB 3MM7A 3Q2SC 5DQGA 9RUBA 3QIDA 1F9EB 3G96A 3KG0A 2ZC3A 2DGOA 3ZZTA 5A6WA 2J7WA 1HNWJ 1E33P 5FLXY 2O5DA 4KB7A 2G2YA 1N2KA 2DCUB 4W98A 2J9EA 1IQTA 3H2VE 4FYVB 1SBRA 3X3UA 2W9BA 2EFOA 3GJTB 2BANB 2MTLA 3IBWA 2ZH5A 2ZH2A 4N56A 3ETMA 2HNZB 2NXJA 5GAHU 3NBPB 1MU2B 2HBYB 3CJTA 2DPIA 3CMRA 4PYDA 5KFRA 1S1UB 1K47A 3V6HA 4NZ7A 5ETLA 3TAMA 3QJPA 2X1BA 3DNCA 3AJDA 1OQ3A 1P9YA 4RBVA 3DMJB 4KBIA 3KUEA 4HEA9 1S1VA 3MCNA 3RW6A 2LCWA 1O99A 1LWXA 3NEKA 4DFKA 3J7A1 1UWAA 2PDAA 2WBRA 3CJ0A 4IG3B 2OAUA 2VBZA 1XN9A 2H54B 1JLQB 3PCOB 4FVMA 3KK1B 2DJWA 2I9SA 1QM9A 2ZD1A 2XZTB 2LFVA 4DR4F 2UXDJ 1EW9A 4OYOA 3R8YA 2FJVA 2DISA 2LDYA 4N8OA 4IH5A 1DQ9A 1TKTB 4KE5A 1HYSA 4QPXA 4NA3A 4O44B 3VR1A 2W9CA 1MWQA 1MW7A 3MAAB 2J0WA 3I87A 3ONQA 4KIAA 2AW0A 4DQPA 2KB2A 1KKHA 1KQKA 3M2RA 1NSKL 3S6EA 4PQUB 1NJWA 3MPWA 3HVTB 4GVLA 5HLFB 3ZNJ1 1N56A 2AX1A 4OJ3A 3ZC4A 2XY7A 2NUUG 3R1HA 3G82B 3H0PA 3ZTQA 1NK0A 2OH2A 4EYIB 4JI1F 1WHVA 3I9ZA 2RKIB 1RWWB 3H4BA 4OFZA 4DXLA 2Z2YB 3HHKA 3DRRA 4LIWA 1SI9A 2FC8A 4MAKA 1XNQF 2R7XA 1RTJB 3MEGB 1FRKA 3N01A 4KC5A 3MR3A 5LJ5Y 2CG4A 1RAAB 3C14B 3EGWB 4QJVA 4ED7A 3EDQB 3D6MB 1AZSB 1LK7A 2GO9A 2YNIB 1F5CA 4PXDA 4YQWA 1XR7A 4TU7A 4RNHA 4QIFA 4N41A 2R2TA 3MOJB 1FKAF 3KLVA 4DLGA 4PG6A 3ILJA 3SCKE 2BJEA 3ILOA 3A1YG 1OPIA 2VOPA 3MMAB 3NL0A 2UUAJ 3ZZPA 4KGMA 2XBPA 4PAAA 3CJQA 4Z7CA 3F44A 2UUTA 2YWFA 4DCJB 3FQLA 5G0RB 1TK5A 1FKOB 1FXDA 2LEPA 5HO4A 4UPLA 3TARA 1YJRA 1FJCA 1APSA 1BY9A 2FLOA 1RBOB 2Y8YA 1UA0A 2CQHA 4ANCA 1AFIA 4DSJA 2K3IA 2RMLA 4PPDA 3BQ0A 2FJWA 5HMXA 5E3QA 2GFFA 3IWLA 4NLRA 4LF9F 4H54A 4WKYA 3CC4S 3AOCA 4WXWA 3M8WA 1BQMB 5DG9A 1KLNA 1LW0A 3PO4A 1FDAA 2HFUA 1S1WB 1SPBP 3UWTA 3I6PA 2XWYA 1UZDA 3AA8A 3FSXA 3M2VA 4J9SA 3BYRA 4LF4J 3MURP 3OSPA 2K1RB 2R8IA 3BDFA 1RWOB 2AHOB 1TQLA 1Y10A 1HI8A 2HQ3A 2JEGA 2CNLB 4ZCIA 2QLBB 4TKTA 4ENOA 4QW9A 2PI5A 4PUOB 3CWJA 3MM8B 3Q2TC 5JJBA 4W90B 4TYBA 4B9VA 2PD1A 3MPYA 3GP9A 1Q95G 5CYQA 1GXTA 2LU1A 2DNHA 4A8FA 3I0SB 4LF5F 2J5AA 2BM0A 4OZJA 3K17A 4CLYA 2VFSA 3AQOA 4I2PA 4ELVA 4QQBA 3I31A 4DF8A 3WQPA 2J9DA 2NLWA 2RUSA 4R5PA 4TQSA 3CC2S 2QA4G 2XHCA 3PJWA 2HNDA 4N47A 4OMFG 4QWCA 3RRHA 3BDHA 2K7KA 5A2QU 4C9DA 1SJ4P 4X64J 3GSDA 1C0TA 2F5GA 2XZDB 1IBLJ 3TAMB 1JNRB 3FKBA 3DCAA 3M30B 4F36A 3TG0A 5AXLA 3GB0A 4KR0B 2GJIA 2H48B 2LLZA 1UA1A 3QZ8A 3PW0A 1ROFA 2DH7A 4NRUA 3QO9A 3OUYA 4OZ0A 3POTB 3J7ZT 3Q23A 2C3YA 4J37A 3IWNC 5GMEA 4F3QA 5JUMA 1UWBB 4DV7F 3HHLD 5G4DA 3NNAA 8ATCB 4IR9A 1HWIA 4OJHA 1UCNA 5E2QA 4ZPWR 3SBMA 5AXKA 4ATNA 1KHKA 2CDQA 4C8ZA 5MAOA 1FKPA 1NDPA 1WD6A 2HFSA 3GG1A 2RF2B 3T5LA 1JLBA 1O51A 3RUBL 2UVVA 1BQNA 1EJJA 1I5OB 4MIBA 4A8XA 3LXQA 2IAJA 1C1CB 5DO2A 1LWEB 1AFJA 4C7QA 3LPYA 3M7VA 2HWIA 2RE1A 3ELHA 2DITA 1X4HA 3CCWA 3TW0A 2GHVC 1A9NB 1SV5A 4I69A 4WZQA 1C0UA 1H0HB 2CIMA 1QD1A 4YHHJ 1RTHB 2JFDA 1FD8A 2MXYA 3D68A 3CW2C 4KH0B 1TMJA 3JYTB 2KYXA 4YR2A 2OIHA 1YX2A 1RHQB 3QSIA 2AQ4A 2BACA 2B7CB 1LKZA 2FHOB 2NCKL 2B8PA 3NWRA 4PQAA 2PGCA 2BOAA 4WP8A 3TZXA 1U6BA 1JLAA 2NPIA 3UCGA 1DHMA 1FRIA 2JEJA 3BGRA 5A8KA 1VQ8S 3SCLE 1NZ8A 3HPOA 1KOOA 1ZAXA 3DM2B 1YKWA 4B08A 3MAHA 4EO8A 2RS2A 1P27B 2MQPA 1ITPA 1RWNB 1KH9A 2NZ4A 1NRKA 4ZCLA 4ES2A 2BQ3A 4G65A 1U2FA 2B6AA 1VRUA 4GC7A 2RT3A 4O23A 5E3CA 2E1PA 2Z0GA 4M63A 2RRNA 3GJRB 4NOHA 3GG0A 4P71A 5E3RA 3HHLC 3G6VA 4CXSA 3MOZA 3ENWA 3CXCR 3IP0A 3L3CA 3FSIA 3FSYA 4R8UB 2BE9B 2KRBA 3EZ5A 2F1FA 4OYBA 1QSYA 3H5UA 2W8DA 3AXKA 4ILRA 4QIWD 3ED4A 5DGAA 2M3DA 3CD5A 1T11A 1DJ0A 3MCOA 3WX8A 1TAQA 5LJ3Y 1LW0B 3PW7A 3HSDA 2CQ0A 5HQMA 1DY3A 2MKSA 3HDSA 4X66F 2XQCA 4UPKA 3OD2A 3D1QA 3GILA 5J2MA 2DRBA 2CQCA 3FFIB 4UUWA 3PKYA 3I5CA 1HBMB 3HKZD 2GMHA 5HVHA 2W1BA 3AA9A 3OFHA 1GXLA 1L3KA 2CQ4A 2Y1JA 3TI0A 2C3OA 3BBBA 1TL5A 1ED9A 1JLBB 1ZM9A 2E7XA 4U67Q 2MQNA 2ZVIA 2QL9B 4X4NA 4AUKA 4NMXA 2MKCA 3HSGA 4CT8A 2QV6A 3CCTA 5KFQA 2V68A 2IC3B 1FERA 1SC3B 2BRLA 2IYIA 3S01A 2G0IA 1BHNA 1LQ9A 2AF6A 2JJ4D 3C15A 3JQKA 1MG7A 3TEGA 3F73A 5B0DA 5KFBA 1H7XA 3QAEA 4B9TA 4FDFA 1PC4A 1QY7A 3QO9B 2F3JA 1HW9A 3L7PA 4YEAA 3GFXA 2FGCA 2HHVA 2HNDB 3RYLA 3UVJB 2E5LJ 4UPIA 3DRYA 4F4WA 2P6SA 4URGA 1S6UA 2W2NP 2HHQA 1DURA 1XTZA 3SDEB 4UOGA 1X0PA 3F0NA 4PKDB 2HK3A 2KH9A 1EI6A 5L8RC 4DL5A 4O3RA 1UPPA 1F60B 2JC0A 9ATCB 1NMEB 3MEGA 1HBUA 2WTFA 1X60A 4WXOA 1Y9OA 4U6PA 4J9NA 4HYKA 4KFBA 5H9EK 2AD9A 2E1AA 1LNQA 2QIFA 4L76A 4O44A 4QZVB 4DPWA 1PKUA 3G71S 4QU6A 3G82A 3IBCB 3CJKA 4RWWA 5E0OA 4BWJA 4DX5A 2QEXS 1HWUA 2HFNA 3THVA 4NXMJ 2ZJRQ 4ILMA 3GE9A 2W2MP 1S4FA 3M2UA 3BSNA 4K4WA 4DS4A 1O98A 2B9EA 4WJBA 1S0MA 5CD4A 1VJWA 4UOHA 3RU0A 4RW7B 5LRNA 1J27A 4DUTA 4OI6A 2U1AA 3V81A 3P45B 4ETZA 2XS5A 3CMAS 2OTJS 4YDXA 3SDEA 2UVWA 3M8QA 3K0JA 2DEIA 5HJYA 1MU2A 1Y11A 2V8GA 4YB1P 2ATLA 4OI4A 3OXGA 4C8YA 2BJ9A 1AB8A 2H1YA 2R8JA 2PI4A 2XC9A 2F40A 1JB0C 5ADZA 4F4YA 2B43A 5IQQA 1NB2A 3W2WB 4K4UA 3NNCA 3P8BB 5E7OB 2BDPA 2N82B 3M9NB 3TR5A 1JLEB 1HHQA 1RGVA 4ECTA 4F3MA 4F25A 3MEKA 3MR2A 1TU0B 3MR7A 4NASA 4P7VA 1U0HA 4EFAC 3QWPA 5IZHA 3KLFB 2B51A 2BJDA 1WG4A 4ED8A 2LA6A 2ROGA 3CDWA 3OR2A 4DV3F 4L3NA 1KLMA 1TP7A 4USTA 4NLGA 4OL8A 3NKOA 2R4FA 3DRRB 1LFWA 1XK8A 4OI1A 2EKNA 1E3CP 4QAXA 4RNFA 4FZVA 5KTQA 1D9DA 2VU5A 1ZAVA 2ATCB 3JTOA 1Q5VA 3PVXA 5DLWA 3AAWB 4ID5A 3QT7A 4IQMA 2V6AA 1R0AB 2QJ3A 2RUGA 5EGHA 1TR0A 2FHMA 4PEOA 4IFVA 2VQEF 3AD7C 3T5HA 3R5JB 5T14A 1HMVA 2VDHA 3H2UB 2ZH3A 1ZZNA 3R3TA 3UR3C 5AJ9A 4O0NA 4A8YA 1X4GA 1HI1A 2MKJA 3RTVA 4CH0S 2DVIA 2DY9A 2KT3A 1D09B 3FZBA 3FGVA 3BKUA 1H2UX 2CPYA 2OJ3A 4B3SF 4OX9J 2OPQA 2AIRB 3VQTA 2YWWA 2JWNA 2FHJA 1GQEA 2E7VA 3NS6A 4JI3F 3R6GB 1U8SA 4CM2A 4DV1J 3UD3P 2BQRA 4QR0A 2YTCA 2MZTA 1CG2A 3ISNC 1F6TA 2ZD1B 3FRYA 1S6QB 2VKZG 3MAQA 1SJ3P 1YJ9S 2GVDA 4JI6F 2Y1IA 6AT1B 3P5BP 4JI4J 1NJIT 3J81Y 2AGQA 1FX2A 4C8KA 1HQ2A 1JJ4A 1AJAA 1REVB 4KAVA 2PIIA 5I42A 1FESA 3OTOF 3DPCA 1U1QA 4V19J 5E41A 4AQYF 2MYFA 3UDEA 2QSWA 3PEJA 2VZ9A 4G1PA 4ELUA 4JI5J 4UY85 4AL5A 5DS7A 4Q5VA 1QAIA 2DGXA 3OFFA 4UOFA 2YVSA 2CPEA 1HBOA 2APOA 5CABA 3EPIA 3WZ0A 1N5SA 2QT7A 2R8GA 3UPFA 5ETSA 1RT3A 1FRHA 4RNNA 2ZBCA 3KHHA 3IRWP 4KV8B 3TA2A 3JYTA 1NJXA 2CNKB 2JC1A 2SXLA 3OQ2A 4CO4A 4X4TA 1XNRF 3E2EA 4JI8J 1T9TA 2CA9A 4Y2MA 1HI0P 1H2VZ 1K7HA 2ZKUA 3W9IA 3H4DA 3T5JA 2Y1LB 2A2DA 5B0CA 4B9SA 3IS9A 2D41A 2YNGB 4DX7A 3T01A 2QFIA 4RW6A 5DM7Q 4LF7J 2G0CA 3IR5B 1KVIA 4WFYA 4J5OA 3I4PA 3OR2B 4OHVA 4USVA 1Q1KA 3J80Y 5KG0A 4S0MA 3DLGA 4LR9A 1PYTA 3IRXB 3MM9B 4P72A 5A76A 5DDOC 1OWXA 3NKYA 1RTDB 2JOQA 1JJCB 2VG5A 2PEBA 4ETXA 1OIAA 1ZEDA 4FXDA 4HLBA 4CP5A 2GIQA 3G4SS 3B78A 1WHXA 1NDKA 5HBMA 2OLWA 1H3DA 3ADAC 4EWTA 3AD9C 2B9WA 2XTJP 2MQ8A 4UF4A 2RJZA 4C2MA 4WTOB 1N2LA 3WAWA 1Z2LA 1JLCB 4MFBA 2E9ZA 1FK9A 3ZZYA 4F4ZA 2FJEB 5ETMA 1SXLA 4MKYA 4QYRA 1X4FA 4DSKA 1CJKB 2FD2A 3H5XA 3DLEA 3U27A 1HQAA 2HSEB 3DDKA 3HF5A 2E9RX
chains in the Genus database with same CATH topology
4ZG7A 4MHXA 2XRGA 3IGYB 1EJJA 4UPHA 4FDIA 1EW9A 1ALIA 1URAA 3LXQA 1ANJA 3NKPA 2RH6A 5TJ3A 4CYSA 3NVLA 5EGEA 3WBHA 3OT9A 3M7VA 3UO0A 3E2DA 4LREA 4B56A 3NKNA 4KJGA 2D1GA 5C66A 1AJBA 5LIAA 3UNYA 4MIVA 2IFYA 5DLTA 5HRTA 2W5QA 4N7TA 1ZEFA 3BDGA 3NKOA 2VQRA 1E1ZP 5IJQA 2W5RA 4UOPA 1ELXA 3NKMA 1B8JA 1E3CP 4QAXA 5GRRA 3TWZA 3MK0A 1KH9A 4CYRA 5DLWA 3DYCA 4LR7A 4KAYA 5EGHA 2QZUA 3KD8A 1ZEBA 4CXSA 3UN5A 1ED8A 2GSUA 5AJ9A 1URBA 3WAYA 1HDHA 2W8DA 3ED4A 4KJDA 4UPLA 1KHNA 1KH4A 1E2SP 3BDGB 1ELZA 4CXKA 1P49A 2G9YA 1EW2A 3NKRA 4LR8A 1FSUA 4UORA 1EQJA 1SHQA 1AJDA 3M8WA 3WAXA 1ED9A 4GTWA 4YR1A 3SZYA 1ANIA 3NKQA 3T02A 1AJAA 2GLQA 4KAVA 4ZG9A 4TN0A 5INHA 2XR9A 3DPCA 2W5SA 4NWJA 1ALJA 3BDFA 1KHLA 4MY4A 5GOVA 4CXUA 1HJKA 3B5QA 4GTZA 5IJSA 2GA3A 3A52A 3IGZB 4UOOA 4LRDA 2ANHA 2W5TA 4UPIA 1EW8A 4NWXA 3IDDA 1ALHA 5L0BA 3UN3A 1ALKA 2GSOA 5LQQA 1K7HA 5KXAA 2GSNA 1EI6A 2W5VA 2X98A 2ZKTA 4FDJA 4LR2A 4LQYA 3SZZA 3TX0A 5L0KA 3BDHA 3MK1A 2W5XA 1AUKA 1SHNA 1E33P 2W8SA 4UPKA 3WAVA 2IUCA 3UN2A 1N2KA 4LR9A 2IUCB 5L0EA 3T01A 3TG0A 2W5WA 4LRFA 1ZEDA 4ZGAA 4GTXA 4GTYA 3CMRA 1AJCA 5K4PA 1KH7A 3T00A 3WAWA 1N2LA 3M8ZA 5LRMA 4LRCA 1KH5A 1Y7AA 4LRAA 3MK2A 1O98A 1ELYA 4ZG6A 5DLVA 3M8YA 1O99A 5LRNA 4LRBA 1HQAA 1KHKA 1KHJA 3Q3QA 4KM4A 1Y6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZG7 A;  4MHX A;  2XRG A;  3IGY B;  1EJJ A;  4UPH A;  4FDI A;  1EW9 A;  1ALI A;  1URA A;  3LXQ A;  1ANJ A;  3NKP A;  2RH6 A;  5TJ3 A;  4CYS A;  3NVL A;  5EGE A;  3WBH A;  3OT9 A;  3M7V A;  3UO0 A;  3E2D A;  4LRE A;  4B56 A;  3NKN A;  4KJG A;  2D1G A;  5C66 A;  1AJB A;  5LIA A;  3UNY A;  4MIV A;  2IFY A;  5DLT A;  5HRT A;  2W5Q A;  4N7T A;  1ZEF A;  3BDG A;  3NKO A;  2VQR A;  1E1Z P;  5IJQ A;  2W5R A;  4UOP A;  1ELX A;  3NKM A;  1B8J A;  1E3C P;  4QAX A;  5GRR A;  3TWZ A;  3MK0 A;  1KH9 A;  4CYR A;  5DLW A;  3DYC A;  4LR7 A;  4KAY A;  5EGH A;  2QZU A;  3KD8 A;  1ZEB A;  4CXS A;  3UN5 A;  1ED8 A;  2GSU A;  5AJ9 A;  1URB A;  3WAY A;  1HDH A;  2W8D A;  3ED4 A;  4KJD A;  4UPL A;  1KHN A;  1KH4 A;  1E2S P;  3BDG B;  1ELZ A;  4CXK A;  1P49 A;  2G9Y A;  1EW2 A;  3NKR A;  4LR8 A;  1FSU A;  4UOR A;  1EQJ A;  1SHQ A;  1AJD A;  3M8W A;  3WAX A;  1ED9 A;  4GTW A;  4YR1 A;  3SZY A;  1ANI A;  3NKQ A;  3T02 A;  1AJA A;  2GLQ A;  4KAV A;  4ZG9 A;  4TN0 A;  5INH A;  2XR9 A;  3DPC A;  2W5S A;  4NWJ A;  1ALJ A;  3BDF A;  1KHL A;  4MY4 A;  5GOV A;  4CXU A;  1HJK A;  3B5Q A;  4GTZ A;  5IJS A;  2GA3 A;  3A52 A;  3IGZ B;  4UOO A;  4LRD A;  2ANH A;  2W5T A;  4UPI A;  1EW8 A;  4NWX A;  3IDD A;  1ALH A;  5L0B A;  3UN3 A;  1ALK A;  2GSO A;  5LQQ A;  1K7H A;  5KXA A;  2GSN A;  1EI6 A;  2W5V A;  2X98 A;  2ZKT A;  4FDJ A;  4LR2 A;  4LQY A;  3SZZ A;  3TX0 A;  5L0K A;  3BDH A;  3MK1 A;  2W5X A;  1AUK A;  1SHN A;  1E33 P;  2W8S A;  4UPK A;  3WAV A;  2IUC A;  3UN2 A;  1N2K A;  4LR9 A;  2IUC B;  5L0E A;  3T01 A;  3TG0 A;  2W5W A;  4LRF A;  1ZED A;  4ZGA A;  4GTX A;  4GTY A;  3CMR A;  1AJC A;  5K4P A;  1KH7 A;  3T00 A;  3WAW A;  1N2L A;  3M8Z A;  5LRM A;  4LRC A;  1KH5 A;  1Y7A A;  4LRA A;  3MK2 A;  1O98 A;  1ELY A;  4ZG6 A;  5DLV A;  3M8Y A;  1O99 A;  5LRN A;  4LRB A;  1HQA A;  1KHK A;  1KHJ A;  3Q3Q A;  4KM4 A;  1Y6V A; 
#chains in the Genus database with same CATH topology
 1YSJ A;  1FXL A;  1TMM A;  1U02 A;  3VGV A;  1X9M A;  2Z56 B;  4O3O A;  3KHL A;  2IMW P;  1DAR A;  1ZS6 A;  1ZM4 A;  3BM7 A;  3I0S A;  4G1Q A;  2OEM A;  1W7W A;  1RHM B;  1VOM A;  2IJR A;  4PAB A;  5CYM B;  3X1L B;  1B7F A;  2FJB B;  1CJU B;  1RT7 B;  3GCW P;  4DUZ J;  1HHS A;  2AWZ A;  3TYT A;  5EDW A;  1YHQ S;  2HMI B;  4CO1 A;  3KLG A;  2H5I B;  2X7I A;  4ZPA A;  1NAQ A;  1T0T V;  4PYA A;  4B02 A;  4PRF A;  1FXR A;  1YZ6 A;  3OXF A;  3CB4 A;  4Y28 C;  3QT5 A;  1GMW A;  5C42 B;  3M8S A;  2OFH X;  3K5L A;  3T9Z A;  1RWV B;  4U9R A;  1NSA A;  5LXR A;  1QSL A;  3CNQ P;  1FJ7 A;  4RBU A;  2HZC A;  2M8H A;  1VQL S;  4CYU A;  3AHP A;  2ZH6 A;  2ADC A;  4X4V A;  3JTP A;  2HFV A;  2W7A A;  2OPR A;  2HUR A;  3TVY A;  4PWD A;  2ZE2 B;  5KFX A;  1NHK L;  3MF5 A;  4HHH A;  4ELT A;  1F3F A;  3PFE A;  3GTY X;  4O0I A;  2W5R A;  4HAC B;  4ECQ A;  3QAT A;  4Y65 A;  4WFX A;  1WSR A;  1MWY A;  3DRX A;  3R5D A;  4RKU C;  3RBX A;  1CBK A;  1S12 A;  4CM0 A;  3A4T A;  3CCM S;  2JEF A;  2HHX A;  3U02 A;  2FLL A;  1TUW A;  4Y2C A;  2HQG A;  2V94 A;  5IFM A;  2XMJ A;  2XGQ A;  4P6Q A;  4E2F B;  2FVP A;  1R0A A;  1Z4U A;  1I3O B;  2Z4P A;  1LOU A;  3IFE A;  2V8V A;  3P96 A;  5AJ3 J;  3CCE S;  1HR0 J;  1L3V A;  1GH8 A;  3WAY A;  3E3X A;  3V4M A;  2HYI B;  2HIQ A;  4J9M A;  1UVK A;  2XY5 A;  3MFH A;  3V4I B;  5LL6 d;  5BR8 F;  2R2R A;  1SC4 B;  1PAE X;  1V3R A;  3PJX A;  4UOC A;  4OYM A;  4C0H A;  4R0E A;  2ZM6 F;  1FKO A;  4JV5 J;  3OR1 A;  4NCG A;  5KFE A;  4NL5 A;  2LQB A;  4CLF A;  4P2X A;  2CKW A;  2NXC A;  4ZHR B;  2GGP B;  4DR7 J;  1T02 A;  3N6M A;  3PTW A;  4J9P A;  2MKY A;  3D4J A;  4HI2 A;  2E66 A;  4N77 A;  3LTO A;  2VFV A;  1V3Z A;  1BUX A;  5F41 A;  2HBR B;  4F04 B;  3GV8 B;  1T05 B;  4TN0 A;  2EFG A;  5IC6 B;  4F2R A;  2CWX A;  3GWC A;  3Q8P B;  2FUG 9;  1OS5 A;  5GAE I;  4IFY B;  3CME S;  1EX8 A;  2IYG A;  2NPF A;  1VLO A;  1UFK A;  5IT0 A;  2QO3 A;  4DG1 B;  3CTR A;  5D8H B;  2DY1 A;  4R8U A;  1WF2 A;  4HKQ A;  2OEL A;  4IOB A;  4IRC A;  4CLZ A;  2JSX A;  1HW8 A;  3OFE A;  3IGZ B;  4MK7 A;  1EKR A;  4NXN F;  1RWU A;  1KWM A;  1JLG A;  3AXM A;  3NGT A;  4ZP8 A;  4Z2X A;  1CUL B;  4DR5 F;  1JX4 A;  4ERD A;  3BGU A;  3VAM A;  1RT1 A;  1HD0 A;  4DDF A;  1TKT A;  2YKM B;  1HBN A;  5J2P B;  1N8R T;  5M2U A;  5KFK A;  2YQ0 A;  3W3S A;  3O5T B;  4FXV A;  1SH0 A;  2QL5 B;  3QZ7 A;  1RAJ A;  1SHN A;  3OFG A;  1UFW A;  5FLX U;  3NY0 A;  3DI6 B;  4WTY A;  1M0S A;  3EPG A;  1GMU A;  2BV3 A;  3LP0 A;  1CJU A;  5D4P A;  5AXM A;  1RP5 A;  2FJA B;  5HVG A;  3KLE A;  4JYA F;  4KHR A;  2FGO A;  2R7Q A;  2E1R A;  2BJ1 A;  3MWB A;  3PYG A;  5GAH I;  3ETO A;  1J5O B;  3BDP A;  2KHD A;  1ZPV A;  1T7P A;  2DR8 A;  1H73 A;  1KN6 A;  2XEX A;  3DLE B;  1KH5 A;  2QG9 B;  1RKJ A;  5IOL A;  5HBM B;  1PAU B;  3BV8 A;  1G1X A;  2IBK A;  4ZHR A;  2UXD F;  2F65 A;  4DR4 J;  1BQN B;  3RZA A;  2FLP A;  2I1R A;  2W4D A;  1KHJ A;  4Y34 A;  2CAD A;  1QAY A;  2YKO A;  4NEZ A;  3R6L B;  3TOQ A;  4PZV A;  1JWW A;  1HLW A;  5M2P A;  1IWA A;  1WKJ A;  2CVE A;  1DAX A;  3IGY B;  2Y1R I;  4ZPD A;  2LQ9 A;  2EBG A;  3HO1 A;  2DNQ A;  3M05 A;  3VAF A;  2IBO A;  3IWX A;  1DTQ B;  1A7G E;  3VVT A;  1RAO A;  5KG5 A;  4KGK A;  1ACM B;  2MZQ A;  5HN0 A;  2ZE2 A;  2M8D B;  1YJT A;  4QIV A;  2HEK A;  2D1G A;  2XMK A;  3MPU B;  1Q8I A;  5C66 A;  1GX6 A;  2XSF A;  1VJQ A;  2HQI A;  1XMO J;  1YI2 S;  3UNY A;  1IKV B;  2VF3 A;  3ULH A;  2C3P A;  1S6O A;  2MQO A;  3M9M B;  3T1Y J;  1SKW A;  5DLT A;  1LW2 B;  1RT2 A;  2MKK A;  4Q45 A;  3LWL A;  1U1M A;  2VQE J;  2W9A A;  4MIA A;  1VRU B;  1R43 A;  1NSP A;  4NLW A;  4CYR A;  5D4N A;  1REV A;  2OMO A;  2L08 A;  4RWX A;  3QRP A;  3T1Y F;  3DM2 A;  3DOK A;  2RHQ B;  5CH7 B;  3W5Z A;  4P10 A;  2ZHO A;  3S8S A;  1TFY A;  5K8M A;  2PE8 A;  4B3S J;  2IMO A;  1Q53 A;  4I6Y A;  4NWB A;  2R8K A;  1HNV A;  2DCL A;  2B6A B;  3I32 A;  2AEF A;  3C6T A;  4DV2 F;  1IM4 A;  3OXL A;  3JSR A;  2QA2 A;  2XMV A;  4CTA A;  4M5D A;  1I6J A;  3A3O B;  3MMC A;  4H4O B;  4K0K F;  1X31 C;  4ZVF A;  1DBD A;  1I1G A;  7AT1 B;  1E2S P;  1YRX A;  1HL6 A;  2XYP B;  2AU0 A;  2EFP A;  1WC3 A;  4QW8 A;  2PT0 A;  1YBU A;  5BXI A;  4KTQ A;  3PW2 A;  3NKR A;  1LWE A;  1VFJ A;  1ZM3 A;  3KDN A;  3OV7 A;  3C2P A;  1FK9 B;  4MFB B;  5A6P A;  3SQO P;  1BQM A;  3AD8 C;  1RTD A;  2B4O A;  2L9N A;  1FKP B;  2VOO A;  1YIT S;  4OYP A;  3RGI A;  2HK2 A;  3A13 A;  3HT0 A;  1TV6 A;  1VMB A;  2IIH A;  3N79 A;  2AEJ A;  4K8R A;  1X9S A;  1R3N A;  1WEL A;  2IAJ B;  4USM A;  1VRT A;  1GMW D;  4ECR A;  1JLF A;  5KG4 A;  2XNR A;  3PRD A;  1S7H A;  2BUN A;  2V2K A;  4WYL A;  3LAL A;  4Y2K A;  1NPK A;  4M5I A;  3ZFV A;  1KD1 T;  1CQN A;  2M7S A;  3THT A;  4LSL B;  4K4T A;  4J9U E;  2MLZ A;  3H8Y A;  3H20 A;  4RW7 A;  1UL3 A;  1S76 D;  3LGM A;  1EW8 A;  1FA0 A;  3GQC A;  3NMR A;  3DU5 A;  1VQ5 S;  4USK A;  5I4M A;  5KFS A;  5LQQ A;  3Q8V A;  3S1T A;  1IBM F;  2GVZ A;  3DC2 A;  1SH3 A;  2EC0 A;  1U24 A;  2HGN A;  3QLH B;  3E01 B;  3VGU A;  4DR2 F;  5ETK A;  3TX0 A;  3J7Z 5;  5K14 B;  3PKM A;  2HS4 A;  2A2C A;  2DGW A;  3K5O A;  1MRO B;  3KUH A;  3LP0 B;  2YKN B;  1FJG J;  3WAV A;  1FJE B;  1F3V A;  2LKZ A;  3TUI C;  4U95 A;  2DNG A;  3MTK A;  1K1Q A;  4LRF A;  2DXD A;  3AB4 B;  2V67 A;  4C48 A;  4GTY A;  4OV1 A;  1X7V A;  5CCL A;  1S1X B;  1VYA A;  3CDA A;  4OJ1 A;  2H4Y B;  3DGV A;  3MAA A;  3DOM B;  4TNO A;  5ETP A;  5FDL A;  1U49 A;  1C4C A;  1TL3 A;  1RT1 B;  1FE0 A;  1Y3K A;  3BR9 A;  1M5H A;  2YPZ A;  4X4Q A;  1H72 C;  2GAG C;  2YX1 A;  1L3U A;  1CC8 A;  4C8M A;  1YJN S;  4H4M A;  4HTI A;  1S48 A;  2BVZ A;  2AX0 A;  3NCP A;  2FVQ A;  2R7O A;  3RR8 A;  3BKF A;  1CS4 A;  1S0N A;  5THW A;  2K7J A;  1RT5 A;  4I0W A;  1MLA A;  1SKR A;  1AW0 A;  4QBU A;  1JIH A;  3JB9 k;  2B4P A;  1H7W A;  1QE1 B;  2F63 A;  2KVQ E;  2QLW A;  2X1G A;  3G86 A;  3MD1 A;  3OTD A;  4HH0 A;  4LBH A;  5GAG U;  1N36 J;  3IG1 A;  1N5Y B;  4WII A;  4DR1 J;  3NGD A;  3OT9 A;  1QVG R;  3ZNU A;  3VAH A;  3HCX A;  2F7V A;  2FDN A;  1SJR A;  2ILY A;  4NLO A;  3KDO A;  1JNZ B;  1NCL A;  3ZO7 A;  1KQS R;  3DRS A;  3HLU A;  3DFE A;  1WAC A;  3VWS A;  1U7L A;  1MMN A;  4IYQ A;  4RL1 A;  2QA4 S;  1WSV A;  3HM9 A;  3LAN A;  5G0R A;  2B56 A;  5CQG A;  4OI3 A;  3TVK A;  2JVR A;  2ZNZ A;  4NCG B;  3IM8 A;  2IFY A;  4Y2I A;  1A0O B;  2OPP B;  4MK9 A;  1NDC A;  2FYX A;  1RAC B;  4CLT A;  1FEH A;  2DNO A;  3DDN A;  1S49 A;  1YRT A;  4DHV A;  2G1H A;  1IM6 A;  3LW5 C;  4LSL A;  3KLF A;  1U1P A;  4KJI A;  5AJ3 F;  4OX6 A;  4Q8E A;  4HTJ A;  4DWI A;  2RU9 A;  3NRB A;  3C14 A;  3NCQ A;  4TN2 A;  3TAN A;  2UVU A;  3BBC A;  4N5S A;  1N33 J;  2YKQ A;  1GT8 A;  3R5B A;  3R5A A;  1U6Z A;  3BZQ A;  4O3N A;  1LXN A;  2PEH A;  2HVH A;  3KXD A;  4U96 A;  4RLE A;  3HD1 A;  3KJQ B;  3T1H J;  5L1K A;  2F8H A;  2ADB A;  1URB A;  2R7W A;  2LEA A;  1IQZ A;  1FO1 A;  3H59 A;  3NWG A;  5HSP A;  3MFI A;  2MKI A;  3Q89 A;  4X4O A;  1T03 A;  4UY8 T;  1N33 F;  1X0F A;  2YBV A;  4WK1 A;  4NLY A;  1U48 A;  2BA9 A;  4Z37 A;  2KJW A;  2XO6 A;  5C25 A;  1N0V C;  1LXJ A;  5IXU A;  2JLF A;  4NYZ A;  2IHR 1;  4WFZ A;  3G6Y A;  1WWH A;  1OPZ A;  3CCV S;  2CQD A;  2NSC A;  5H9E J;  3NOG A;  2DGT A;  2O01 C;  2AZ3 A;  2YNH B;  3EE3 A;  4FYX B;  4NML A;  4P73 A;  4ZMM A;  5D4L A;  1N6Q B;  4LJM A;  4M8L A;  1RT4 A;  3SYZ A;  2C1E B;  4PWU A;  5DG7 A;  2MGZ A;  2VC0 A;  5B0F A;  3FBB A;  2D9P A;  4CYU B;  1R6V A;  2HBZ B;  3ZTS A;  1XR6 A;  2XMA A;  2HHU A;  1K0T A;  2GNK A;  1RAD B;  3FNN A;  5SUH A;  1GFW B;  1X8D A;  3PY8 A;  3DGP A;  2GQQ A;  1HQE B;  1P9Q C;  2ERR A;  4UW2 A;  2LQJ A;  3ET6 A;  1TK8 A;  1UW4 A;  3SIP B;  1N32 F;  4FVC A;  1AUD A;  2WVF A;  4EI2 A;  3LQV A;  4DQS A;  3DLK A;  1YIJ S;  1S0V A;  2KTQ A;  2RD5 C;  1C4A A;  2G2O A;  3O3L A;  5FII A;  4UOO A;  1FDD A;  2MPU A;  1F1B B;  2DRA A;  2JZ5 A;  4JOU A;  3BS9 A;  3CCQ S;  2LXI A;  2M0G B;  3DU6 A;  3QLH A;  2O3D A;  5DM6 Q;  4RZR A;  5KFC A;  3OL7 A;  4I68 A;  2I8E A;  4NI2 B;  1K8A T;  1IKV A;  4K5S A;  3ZZO A;  3OW2 R;  2POK A;  4M5J A;  4ZCK A;  1R8B A;  2BKN A;  2HVZ A;  4EYH B;  3DRP A;  1M5S A;  3CD6 S;  1N88 A;  2H65 B;  4GO5 X;  4Y3C A;  2QSF A;  4JV0 A;  5KFJ A;  5F3T A;  3W62 A;  1VC0 A;  1T94 A;  2RHS B;  5A8R A;  2GVZ B;  4Q8F A;  4KYZ A;  1EAR A;  4FF2 A;  3GJQ B;  3LAK A;  2BQU A;  1AYE A;  4RX6 A;  1L3T A;  2IUC B;  2RIL A;  4RUC A;  2N3L A;  1E6Y A;  3NS7 B;  1P6T A;  1R31 A;  1R6Y A;  3CJS A;  4DMZ A;  2Q6B A;  2NR0 A;  2KFZ A;  2YWH A;  4I2Q A;  1PYO B;  1SJ1 A;  3CDE A;  3VCD A;  1JKH A;  2NS1 B;  1NKE A;  2V2V A;  3SXL A;  1N34 J;  2ZWP A;  4YME A;  2OKQ A;  1RWP B;  3KJF B;  5D78 A;  3US5 A;  3M8Y A;  4H4K C;  4FPR A;  1DZ5 A;  3M6W A;  4KM4 A;  1HWL A;  2FVR A;  3UI3 A;  1NKC A;  1C0T B;  3HZE A;  4KGZ B;  4NX9 A;  1RUS A;  2EFN A;  5DJB A;  1QDU B;  2J0Q D;  4XTT A;  2KI2 A;  4ZVP B;  1T9W A;  1VBK A;  2B5J A;  1ALI A;  2MQL A;  3MMC B;  5TJ3 A;  1A6L A;  1SIZ A;  3PG9 A;  6FDR A;  3DKD A;  4DQR A;  2UV8 A;  3DI6 A;  3GFH A;  2C2O B;  3HFZ B;  3WHI A;  4AND A;  2HHH F;  1DQA A;  1RA7 A;  4B56 A;  3EM1 A;  3NKN A;  1XNQ J;  3L7U A;  2BEF A;  4F0M A;  1R8P A;  5A8W B;  1XEZ A;  3DYA A;  1CPZ A;  4HDH A;  4YR3 A;  2ZZN A;  3ZTO A;  1Y00 A;  3IM9 A;  1D3W A;  2WSC C;  3AT1 B;  2OGU A;  4B3M J;  2OHD A;  3Q22 A;  3A3P B;  4C11 A;  8RUC A;  1RTH A;  2AGO A;  1WG5 A;  3I5B A;  5D6G A;  3VAG A;  1IBK F;  4F7V A;  2B9X A;  3OHB A;  2QX0 A;  1UEU A;  4DN9 A;  3H5Y A;  2K1R A;  1AA1 B;  2VBY A;  3R5C A;  1U1R A;  1PIE A;  2G2Z A;  1FVQ A;  4DV0 F;  4O3S A;  3MK0 A;  1X5O A;  2W4C A;  4FKX A;  1C1C A;  1NH7 A;  2V63 A;  3PNI A;  4X4S A;  2EWH A;  2RRA A;  1Q81 T;  4B3M F;  3GIJ A;  4FF3 A;  1VQN S;  2W5V A;  2DT9 A;  1B99 A;  3D0I E;  1SV5 B;  2CQ2 A;  1KR4 A;  2PN6 A;  2GSU A;  3C16 B;  3HZG A;  1NDL A;  1DTQ A;  4DV0 J;  2B8Q A;  2CPZ A;  1RZM A;  2DHS A;  2OTL S;  4DCP B;  3GII A;  3CCR S;  4DV1 F;  1UJ4 A;  3A12 A;  3PYF A;  4MJK A;  2DH8 A;  2VIH A;  4J9Q A;  1KRP A;  4HT7 A;  1OYD A;  2ZH1 A;  4LMZ A;  1R7I A;  3K89 A;  1NSQ A;  5F9L A;  5H1S V;  4M95 A;  5GAD U;  3FC9 A;  2FC9 A;  3QGG A;  1LWC B;  3OUY B;  4FKY A;  4DSL A;  4RNO A;  4MIW A;  4GTW A;  4P9S A;  3MMJ A;  1E6V A;  1K1S A;  1IKY A;  4U7U D;  3DHX A;  4IH7 A;  1U45 A;  3J81 U;  4RPF A;  1Y3J A;  1X5T A;  1HPZ A;  1G3O A;  1F9H A;  2IJF A;  5GAE U;  2E1C A;  1FNO A;  1S9F A;  5KT2 A;  3KYL A;  3VV2 B;  1TL4 A;  3CJ8 A;  3CE8 A;  1KQG B;  3W2V B;  2VOD A;  4TXS A;  1BWV A;  4ZVR B;  2EI5 A;  4EZ9 A;  4JI4 F;  1Q8K A;  3VQS A;  1OSC A;  3BF4 A;  1SB6 A;  3OTO J;  4HAC A;  1U09 A;  2MHE A;  3CIM A;  5HLF A;  1S6P A;  3OTB A;  3N9U C;  4WU3 A;  1N48 A;  4IRD A;  4I6W A;  2HPU A;  4C0O C;  4X64 F;  1FJG F;  3KMQ A;  1RAH B;  3N0V A;  2LXU A;  2CPI A;  2GCF A;  2PA8 D;  2WBM A;  2AMC B;  4EK2 A;  2R2U A;  1PG5 B;  1CUL A;  2YQ3 A;  3R5G A;  3TA1 A;  4ZLL A;  4ZK7 M;  1R27 B;  1RJJ A;  3KG4 A;  3PAC A;  5KFI A;  3V2U C;  4I1T A;  3CJ2 A;  2CDR B;  3VGS A;  5DG8 A;  1HNX F;  4ZLN A;  2ZDP A;  3HD2 A;  1JLQ A;  4CH1 A;  5F8M A;  3MM8 A;  3WIU A;  1NJZ A;  1CQM A;  4XAK A;  1TTH B;  3MGJ A;  3OBI A;  1WI8 A;  3JQM A;  4ZP6 A;  1VQK S;  1T9X A;  2G1D A;  1P8G A;  4ZKA A;  2DEJ A;  3QAU A;  3FK4 A;  2I5J B;  4PCQ A;  2DPJ A;  2OFG X;  2K06 A;  2DNK A;  5IT4 A;  4QYZ K;  2EC2 A;  4NA2 A;  3KKF A;  5C42 A;  1CLF A;  5J1P A;  4ECZ A;  4ZGA A;  3CJ5 A;  2B4U A;  3GIR A;  3EVW A;  4MKV A;  1KON A;  4MKB A;  5DRK A;  1RU2 A;  2C42 A;  3HSZ A;  3PRB A;  4USJ C;  1TUG B;  1WKL A;  2ZNY A;  3NBP A;  4QR1 A;  5KOX A;  4YUD A;  1MNE A;  2RQK A;  2P9E A;  5B7W A;  2YX4 A;  2I0X A;  3TZY A;  5KG7 A;  5EX0 A;  2IVM A;  3RAQ A;  2J6S A;  1TL7 A;  2VPW B;  3QT8 A;  2YY3 A;  2DXF A;  1T8E A;  4C8L A;  3UD5 A;  1RQ0 A;  4PG4 A;  2JX2 A;  3M32 B;  3IGN A;  5JVH Q;  4OV6 A;  1ICE B;  1UTA A;  4F4K A;  5K8N A;  2R7S A;  5KFN A;  3Q24 A;  2RU3 A;  2DR7 A;  4YOE A;  5KT6 A;  3NKP A;  3W8G A;  3CUL A;  2NYH A;  2HHW A;  3W7B A;  2OML A;  3NG8 A;  5J2N B;  2D1C A;  4ILL A;  2VJU A;  1FDB A;  3NOC A;  2KL8 A;  1FEE A;  2WAQ D;  4JV2 A;  3KK3 A;  1IKY B;  2EFQ A;  1DQ8 A;  3V4I A;  2CPX A;  1FI4 A;  2DNR A;  4Q0B B;  3R1L A;  4ZPV R;  2WSF C;  2F9D A;  4BC9 A;  3BO3 A;  1B0P A;  2VG5 B;  4AE5 A;  3J7Y I;  1NEE A;  1LWF A;  2B9Y A;  4O3Q A;  4ZLJ A;  3A3N B;  3KTQ A;  4FNI A;  2HWH A;  4C8N A;  1X4D A;  3QGI A;  3D6T B;  2IDL A;  3HVT A;  1JXV A;  2EKY A;  3KWM A;  1PBU A;  3DXS X;  3FCV A;  4CLW A;  2BKP A;  4NLP A;  5KFM A;  2OPR B;  3ITH B;  4O3P A;  3HMJ G;  4J9V A;  3HHD A;  4M5H A;  1U6F A;  1TZ0 A;  3V5R A;  1FD2 A;  4RUH A;  3NMA A;  1GMV A;  1GTH A;  4DCO B;  5JXS A;  5HJX A;  2C2M B;  4J9L A;  2FVS A;  2CPD A;  4DR6 F;  4WYW A;  5JMN A;  2AYM A;  2ZIT A;  1SKS A;  1JXL A;  4FBT A;  2UXC F;  3MCS A;  2VDI A;  2VG6 B;  2CPJ A;  4M1K A;  1VBZ A;  2UUB F;  1FRL A;  3OHA A;  4P7T A;  4AYB D;  5BJR A;  2ZJQ Q;  3DLK B;  2XCP A;  3LAM A;  2E7W A;  2UZA A;  1Q4R A;  1Z1Z A;  3PJ9 A;  1HIY A;  2WW8 A;  1HNV B;  2HNY A;  3BDE A;  3H98 A;  1PJ6 A;  4H4M B;  4H4K A;  1S6Q A;  4DF4 A;  1KHN A;  4BDP A;  2J9C A;  4M5L A;  4C11 B;  2DO4 A;  3O2I A;  2FY1 A;  3U1L A;  5L39 A;  4KHP F;  4NE9 C;  3I9V 9;  2GIR A;  1NBE B;  5I42 B;  1FWP A;  3M8R A;  1TKX B;  2E5G A;  2V8D A;  3M1V B;  4OI2 A;  5F0U A;  5KT7 A;  5CYM A;  3Q86 A;  4M5G A;  3HT3 A;  2F8E X;  4AL6 A;  3W60 A;  2OPQ B;  4HVZ A;  1H38 A;  2ZVS A;  1JQG A;  4ECV A;  4KHP J;  1NM2 A;  2OPS A;  2VQF J;  4DL6 A;  4C3M A;  1QVF R;  2GLQ A;  1RAB B;  2CQ3 A;  4F0H A;  4OI0 A;  3UW1 A;  5CXT A;  3CMQ A;  3WDO A;  1RAI B;  1QAX A;  2R3V A;  3G8T A;  1U1L A;  4X62 F;  2AYB A;  4Y0F A;  3MM7 B;  2XG8 A;  4XIU A;  2Z2M A;  4OYX A;  1FCA A;  2RF2 A;  3CC7 S;  2A3J A;  3QQC D;  4YP3 A;  4DV4 J;  1RA6 A;  3N6N A;  1JKH B;  1UJ6 A;  3I82 A;  3B82 A;  1OY6 A;  2GV1 A;  3HVW A;  4Q2M A;  2CJ9 A;  2IUC A;  5EWF A;  4UPH A;  2KVI A;  3L4B C;  4RW6 B;  4A4J A;  4A8M P;  4ZJQ A;  2CVI A;  3G8Q A;  4A8S A;  1HNW F;  2VB6 A;  2ACM A;  4KT0 C;  2QLX A;  4QCL A;  2WON B;  1U26 A;  2CJB A;  3N6L A;  3J7A N;  1R0C B;  2HVI A;  3IMQ J;  3U7J A;  3AY0 A;  5D3G B;  2VA3 A;  1OO0 B;  3MXH P;  3GYX B;  3KNG A;  2F8M A;  2H4W B;  3B8H A;  3GZ7 A;  2CFX A;  2HQD A;  2YWK A;  3GYN A;  3MEE A;  4ED4 A;  4DR5 J;  3A8J A;  3KJN B;  4KQZ A;  2G13 A;  2OPP A;  4K5R A;  4UQT A;  3R7N B;  3RRG A;  4B9M A;  5EN1 A;  2O66 A;  2RNE A;  2X3G A;  5U47 A;  4B9N A;  5A8R B;  2Z57 B;  3DOL A;  3FQK A;  2VPZ B;  2OD4 A;  1JJ2 R;  4WPA A;  2VHG A;  4FYD A;  2DGV A;  5KFL A;  3CO9 A;  1WTF A;  1WG1 A;  1RT3 B;  2VPX B;  1VIS A;  5LM7 E;  2EXU A;  3J7Y U;  1Y5N B;  1SJQ A;  4RW9 B;  1KH7 A;  2RRB A;  1B0T A;  1J5O A;  2B4V A;  2CJY B;  3A8I A;  2KM8 B;  1TL7 B;  4LRA A;  3MK2 A;  3ET6 B;  3LP2 B;  3K5P A;  1Q79 A;  4JYA J;  3JSY A;  3GFY A;  5HMY A;  1FRM A;  1QTM A;  1KNZ A;  1FT8 A;  1QE1 A;  1UEK A;  1EP4 A;  4RJV A;  1UPM B;  2HHT A;  4ZDN A;  3HSJ A;  3FCW A;  2R8H A;  1VC6 A;  1UEV A;  5B0E A;  4DV6 F;  1HKA A;  1V9O A;  2WHO A;  3C6T B;  2QMX A;  1RWK B;  2EG1 A;  3K8V A;  3ZTP A;  4ZIW A;  1YQH A;  4EEY A;  1SCJ B;  1VDH A;  3H2L A;  1TKD A;  4M5M A;  1HQE A;  4BC7 A;  2WOM A;  4M94 A;  2R7U A;  1URA A;  1NB7 A;  3HHL B;  1C2P A;  3BBF A;  4NLD A;  4Q2L A;  1VBY A;  2OP5 A;  5E3P A;  4X4P A;  5LMU F;  3N5B A;  4DV6 J;  4WWS A;  1HQU B;  1X9W A;  4KFB B;  1S0O A;  1WOR A;  3TNV A;  2ZDO A;  4KGX B;  1HBU B;  2BZ2 A;  4IFV B;  3W9J A;  4CLK A;  4ICL B;  3OL8 A;  4OYI A;  3MM6 B;  3P6Y C;  4LVN P;  3QRQ A;  3HKW A;  2BW2 A;  4DSE A;  2GMJ A;  1WF0 A;  1VQM S;  1WEY A;  2XLI A;  2A6M A;  2J8A A;  5LIA A;  1HFE L;  1F2H A;  1N5V A;  1RU1 A;  5KFT A;  1AXQ A;  4B17 A;  3RB4 A;  2FIU A;  2X51 A;  5IJQ A;  2BE2 A;  1DLO A;  4L74 A;  5K5M A;  3R2D J;  4UUX A;  4Q0B A;  2FJD B;  4OLO A;  3DN9 A;  4GTX A;  5J1E A;  1S6P B;  3FEY B;  4LFC J;  5GRR A;  1EET A;  3BO2 A;  2J76 E;  2CRL A;  2XMT A;  4Y2A A;  1LWF B;  2G4B A;  1D1U A;  3PEH A;  2F4V F;  1Q7L B;  4ZN1 A;  2HZA A;  2QZU A;  4YB5 A;  2XWX A;  2ALY B;  2VL1 A;  3KMS A;  5DDP C;  2BBE A;  4U8Y A;  2IC3 A;  4ZPC A;  4FYW B;  2QMW A;  3NGR A;  2COL A;  1SC6 A;  4UQG A;  3PR5 B;  1WTB A;  1NPP A;  2QYG A;  2IVF B;  2F4V J;  4DPO A;  5BYS A;  2ZJP Q;  1RLC L;  2VFU A;  4L72 B;  5DLF A;  1TUV A;  2IM0 A;  4J7C A;  3R27 A;  4EBE A;  3BDG B;  3E8O A;  1FX4 A;  3K58 A;  3C8Y A;  2R42 A;  3GU0 A;  4LF4 F;  3JXO A;  5IWA J;  1X4A A;  1U0S A;  3D1H A;  3IG1 B;  2IRU A;  3MED B;  2XMU A;  4JI2 F;  3BO4 A;  1G7C B;  5KG1 A;  3PX0 A;  4YR1 A;  3IC1 A;  1DLO B;  3RBE A;  2DBB A;  1RKI A;  3LOU A;  4NYO A;  1FFG B;  4N8N A;  3UNG C;  4CO2 A;  2VA2 A;  5INH A;  4IQX A;  1RCX B;  4ID8 A;  4ZOS A;  3QNW B;  3MM6 A;  4RUB A;  4PQU A;  1UZH A;  4KO0 B;  4M5K A;  1XNR J;  1QSS A;  1CC7 A;  1WEX A;  2CQB A;  3W64 A;  5KFW A;  2Z30 B;  3H7H B;  1S77 D;  5GAD I;  1YJU A;  5C2G A;  3RB3 A;  2DKO B;  3DOM A;  5FDL B;  4XPE A;  2ABY A;  4DZD A;  2XLJ A;  1RT7 A;  4NCB A;  5IJS A;  1GXU A;  3HHL A;  2JL9 A;  3L09 A;  4KPY A;  4CIO A;  1G6B A;  3SCI E;  1L5U A;  3MHY A;  3J81 j;  2MZJ A;  4EBC A;  3VAK A;  1U8W A;  2GZO A;  1CJV A;  2DH9 A;  1KFS A;  4B3O B;  5KXA A;  1N52 B;  3W5Y A;  4YY3 F;  4DJB A;  5I3U B;  4FS2 A;  3CCZ A;  1EP4 B;  1YRU A;  3CJ3 A;  4ZPT R;  3W2V A;  5L0K A;  1ZPW X;  2CJX B;  2YXL A;  3KFW X;  3Q8U A;  2Y9H A;  4ZA1 A;  5A8K B;  4EBD A;  2PMW A;  1Q5Y A;  1B7Y B;  3HVA A;  1WJ9 A;  3MR5 A;  1RHK B;  2EEY A;  3PRV A;  3UN2 A;  2BJ3 A;  3QPI A;  5EWE A;  4JUZ A;  3VAL A;  3MEE B;  2ALZ A;  4OZN A;  2ASY A;  1TEL A;  2V8H A;  4KAI A;  1EQ0 A;  4QIE A;  1J2V A;  1M90 T;  3AOA A;  2CZV C;  4KY3 A;  2D74 B;  4RNM A;  1R8H A;  3UD4 P;  2CNO B;  1TK0 A;  2UXB J;  2EPI A;  2QTW A;  2C2R A;  2IY5 B;  1FVS A;  2ZUG A;  4P75 A;  5EUH A;  5T41 A;  2XM3 A;  1UWB A;  3W66 A;  4ED2 A;  1U4B A;  3K7R A;  1HNZ F;  3QT6 A;  2DGQ A;  4RW4 A;  1TV6 B;  3CED A;  3RAM A;  3DLB A;  4DBQ A;  3FZ2 A;  5KFF A;  4NYP A;  2VKR A;  1UFL A;  3EMT A;  2HG4 A;  1T3O A;  1RAF B;  1M1G A;  3T6B A;  2OEJ A;  4YHH F;  5B0G A;  3TA0 A;  3KLI B;  4DL4 A;  4DI6 A;  4HL9 A;  3PDN A;  4ZVG A;  3PIO Q;  3QGP A;  4QR2 A;  3ZZZ A;  2XO7 A;  1YGY A;  2DIV A;  1TVR B;  2OPS B;  4P74 A;  4WP9 A;  1SQG A;  1PO6 A;  3OTE A;  5KAK A;  2VG7 B;  2DYA A;  1NZA A;  5CZX A;  2V8P A;  4OZ1 A;  4B3R J;  3AFG A;  3TQE A;  4KV8 A;  4M5D B;  3BN4 A;  1UVN A;  5I3U A;  1OY9 A;  3M30 A;  1AJB A;  1QUP A;  2IJN A;  3GV7 B;  5C2C A;  1KVK A;  5HL7 Q;  2JFK A;  2EBE A;  4HT5 A;  4B3O A;  4ES1 A;  3UQS A;  1OYE A;  2HHS A;  1S1T A;  2WVE A;  4Y6I A;  1JLA B;  1V5V A;  4UOP A;  3MD3 A;  3HFV A;  4ZVE A;  1RYR A;  3T1H F;  2HZV A;  3WIV A;  2HMI A;  1UP1 A;  1HBN B;  2VAS A;  2IFX A;  2IRY A;  2UUW A;  3KG1 A;  3EGZ A;  1CEZ A;  1BE4 A;  4NZ0 A;  5D0G A;  3FBE A;  4TU9 A;  4J9K A;  3SFG A;  1RHR B;  2FQQ B;  3IAS 9;  2D3O 1;  3WX4 A;  4B3T J;  3KHG A;  1Y4Z B;  3D0H E;  4A8Q A;  2W2P P;  2VC1 A;  2C2E A;  1N6Q A;  3DOK B;  2FPH X;  2W8K A;  2X1F A;  2L9W A;  1IWG A;  2PA3 A;  3KNA A;  2VBX A;  1XQI A;  4IOC Q;  4E0D A;  4EUV A;  5B08 A;  2RH3 A;  1RWM B;  1PYS B;  1HDH A;  1WOO A;  4KJD A;  4F26 A;  1HMV B;  3EYZ A;  4EU0 A;  3IA0 A;  4MKA A;  3D9B A;  4KKO B;  1S59 A;  1X4E A;  4NRT A;  1U1N A;  3MED A;  2G9Y A;  1V5I B;  2RDD A;  5H9F J;  2VQF F;  1VIX A;  2DR9 A;  1QLN A;  1YBA A;  3TJA A;  4C3K A;  2ZH9 A;  2QYC A;  1YZ7 A;  2VPY B;  4RW4 B;  1HR0 F;  3M2V B;  1FSU A;  4AD6 A;  2LDI A;  4I6A A;  4USI A;  4CRJ A;  3SV3 A;  4A8O A;  2J9D E;  1UMJ A;  3P4U B;  4X62 J;  2C2N A;  2JEI A;  7FD1 A;  1NJY A;  1S9G B;  3FUY A;  1RTI A;  5L38 A;  3PIP Q;  3WAX A;  1ZM2 A;  1N5Y A;  3T02 A;  1M5V C;  4N76 A;  2AJ1 A;  4OZ2 A;  2F4F A;  4I2Q B;  2MSS A;  3QYY A;  5A0Y B;  3MR6 A;  4NWJ A;  4G1I A;  1KVJ A;  2KRR A;  2CJK A;  4FN5 A;  2BRK A;  4NA1 A;  4MY4 A;  2KYZ A;  2LQ5 A;  3OL6 A;  2V4R A;  2VON A;  2EK6 A;  3EUN A;  5I3Q A;  5GVQ A;  1VQP S;  1NK4 A;  2OSR A;  2YKP A;  2N4C A;  2VH7 A;  1Q78 A;  2KZM A;  3T1A A;  2XB2 D;  2YH0 A;  3B5Q A;  4ANE A;  3A52 A;  2Z2Z A;  2KO1 A;  2W2Q P;  2D7S A;  2HQC A;  5KG2 A;  1NPR A;  1S5Z A;  3IBF B;  3K59 A;  1P1T A;  4K0K J;  1BC6 A;  3A8K A;  2AJQ A;  5AE1 A;  3HX9 A;  4ZP9 A;  2RQC A;  4LF6 F;  5M2R A;  2IM3 A;  2V9W A;  2ZKT A;  2X98 A;  4LR2 A;  1KHW A;  2KXH A;  1KQF B;  3TZW A;  3DGP B;  4NLU A;  4XO0 A;  4KHM A;  3U1N A;  1FNX H;  3PO5 A;  4PWD B;  4K50 A;  3D1O A;  2HWT A;  3PFO A;  1OMS A;  1WEZ A;  2BM1 A;  1N34 F;  3WC0 A;  2CAJ A;  4BWM A;  4X4R A;  2MGZ B;  4LQY A;  1B0V A;  1JLG B;  4DL7 A;  4CCH A;  2HHP A;  2V4Q A;  4ICL A;  3GV5 B;  3L95 X;  5KOW A;  2HGL A;  2DD8 S;  3O8W A;  2KT2 A;  1VIO A;  3C6U A;  3M2U B;  4LUB A;  3CGI A;  1RT5 B;  2W9C B;  5LRM A;  2DK2 A;  1HYS B;  3W65 A;  1KS2 A;  4O4G A;  4TVA B;  4IFY A;  3R7S B;  4AXI A;  4C3L A;  4D3H A;  3SSS A;  5DLV A;  2NYI A;  3LP2 A;  4NXM F;  3ENV A;  1FE4 A;  2QC3 A;  1YJ7 A;  3D66 A;  2CWK A;  2DXE A;  4NLS A;  3SSQ A;  2HHH J;  2R7T A;  1V3S A;  5GAG I;  2GHW A;  1RAG B;  2YKN A;  4IG0 A;  3MMB B;  3NXZ A;  5I3P A;  4E8U A;  1Q82 T;  4GKK J;  3MUM P;  4FPI A;  2RH6 A;  2J7K A;  2UV8 G;  2H5J B;  1EZZ B;  3BR8 A;  1IBC B;  1XMB A;  3KUG A;  3NS5 A;  4YB7 A;  3OSN A;  4YN3 B;  4R25 A;  3HUL A;  5F8G A;  3FBC A;  5FD1 A;  5HMZ A;  1ELZ A;  5CAA A;  1R0B G;  3UVJ A;  3Q8Y A;  5HK4 A;  2BAN A;  3OVB A;  3MDF A;  2MJU A;  2BE7 D;  3QIP A;  5B0A A;  1CJT A;  4ZIV A;  1ZET A;  3N28 A;  5CYJ A;  5LMU J;  1NXI A;  1LWC A;  2YNF A;  1EB0 A;  4OHY A;  2J0X A;  3JSM B;  4BLG A;  4I7F B;  3T6J A;  4ZVO B;  1EJ7 L;  3M8P A;  3ILL A;  2DR5 A;  4LF8 J;  4ED0 A;  3ISZ A;  3NNH A;  4MT1 A;  1B8J A;  3NKM A;  3AJ1 A;  1RDR A;  1HBM A;  1SH2 A;  2CG8 A;  5J1N A;  5GMK a;  3BH6 B;  2V4J A;  4C98 A;  2FY8 A;  3PW5 A;  1PC5 A;  3LUY A;  2DIU A;  3SSR A;  5KG6 A;  4IO1 A;  3VTI A;  4DV3 J;  2OEK A;  1N54 B;  4TLQ A;  1IJE B;  4MH8 A;  1FF2 A;  2V69 A;  3MMB A;  3UN5 A;  3EDR B;  4LF8 F;  3M8Q B;  3O6Q A;  3QGH A;  1ED8 A;  4XPC A;  1X4B A;  3KK2 A;  2OD6 A;  2WVD A;  3C16 A;  1IR0 A;  1YTY A;  4GKJ F;  1WDT A;  1DRZ A;  1IR1 A;  3LO3 A;  5HAO A;  1H2T Z;  1NUE A;  1GK8 A;  4CDI A;  1K44 A;  5KFP A;  3SZ2 A;  3D3C J;  3RB0 A;  2M5Y A;  1M1H A;  1WC4 A;  1VCT A;  4ZJO A;  4CO0 A;  1TL3 B;  4OYZ A;  1HQU A;  2YH1 A;  3T5K A;  2B0G A;  4IDK B;  2M4M A;  4QWD A;  3TAP A;  1YDL A;  2ZUA A;  2I38 A;  4U8V A;  2RIJ A;  4OZ5 A;  2GVD B;  2MMY A;  3JAM Y;  2VUG A;  4DN0 A;  3NCR A;  1NHU A;  4ZLP A;  1H74 A;  3DHW C;  1PSD A;  2JNJ A;  4LVO P;  5K20 B;  4YR0 A;  1S72 S;  2M9K A;  2W24 A;  4ZIT A;  2Z58 B;  4P52 A;  1D0E A;  4USW A;  2ASD A;  2Q66 A;  3OVS A;  1DTT B;  2X1A A;  1FRJ A;  1S1X A;  2IRX A;  1IKW A;  1ARO P;  3DYA B;  4B9L A;  5K14 A;  2PFD A;  3T9N A;  4UTG A;  4LF5 J;  2WSE C;  3W1Y C;  3AB2 B;  3D2W A;  2E5I A;  1REG X;  1YJW S;  5ETQ A;  2WVB A;  2CYY A;  2M2B A;  3LF0 A;  4DEZ A;  1HJK A;  6FD1 A;  2QGF B;  3KK2 B;  1VC5 A;  3GSI A;  4TY9 A;  2J6T A;  3JS9 A;  4LRD A;  1K9M T;  4DQI A;  3HJV A;  3DDI A;  1HNX J;  2XGP A;  5IM0 A;  3VVU A;  1PJ5 A;  4I56 A;  1IBL F;  3TJ8 A;  2ILZ A;  3I4H X;  4ZPB A;  2BJ8 A;  2ZC4 A;  1NK6 A;  2FZC B;  1VRT B;  2LQ8 A;  2RQM A;  5DQH A;  4DZ6 A;  5CD4 H;  1B64 A;  3V6J A;  3U1M A;  2RS8 A;  5A2Q Y;  2J0S D;  3IRX A;  3MM9 A;  4GO7 X;  8AT1 B;  3KLH B;  3MEC B;  1N32 J;  1SVD A;  4QWE A;  5L0E A;  3P3D A;  4MMO A;  1RIS A;  1SQE A;  3GR1 A;  3UDL A;  5CA5 A;  1HNI A;  4YY3 J;  4DLE A;  3PX4 A;  2EW9 A;  2DTJ A;  2VD3 A;  3ICL A;  1MML A;  4DV7 J;  2AV5 A;  2UP1 A;  1V6H A;  2PC6 A;  3GJS B;  4WZM A;  1AJC A;  1VBX A;  4NCA A;  3QRR A;  3MTJ A;  3GFZ A;  4ECY A;  4QOT A;  3EXY A;  3M8Z A;  4LRC A;  4Q44 A;  3TRG A;  3Q8S B;  4AFF A;  1VQ7 S;  4XDC A;  1S4E A;  4ECU A;  2YWG A;  1XC9 A;  2Y0B B;  4FBU A;  5CCM A;  4K4Z A;  2IPO B;  4IG0 B;  1YLX A;  3CD7 A;  4CO3 A;  1X4C A;  3HJF A;  2U2F A;  3W8P A;  2KXF A;  4LSZ B;  2BX6 A;  1B70 B;  4NEY A;  3VHQ A;  1MWZ A;  4CWB A;  1KC8 T;  3CCU S;  3C19 A;  3FDS A;  1IKW B;  5KFZ A;  3NAI A;  2CJA A;  5DQI A;  4FF1 A;  2HAF A;  3NVL A;  4CYS A;  2FVC A;  1TFW A;  5D0R A;  3C6U B;  3ZZ0 A;  5HRO B;  2KJV A;  2DNZ A;  2H9Z A;  1CVJ A;  4HI1 A;  2E9T A;  2HLT A;  3Q8Q B;  3R2C J;  2DHG A;  3OVA A;  4OQJ A;  2GO8 A;  3CD0 A;  3I55 S;  4LF9 J;  1WC6 A;  2GML A;  2I5J A;  3B6B A;  3I0R A;  5F0W A;  3UDC A;  2UUC J;  1JXE A;  5B09 A;  3G87 A;  1U2C A;  2DGU A;  5KT5 A;  1WC0 A;  1MN9 A;  2KG1 A;  4OIX A;  2UUB J;  2F9J A;  1TL1 A;  5C24 B;  1SUQ A;  1XR5 A;  3FMW A;  3L9Z A;  4A8W A;  1TVR A;  1ZA2 B;  4B9U A;  3BSC A;  1FHT A;  4LFB F;  4PG5 A;  4HHJ A;  3B4M A;  2UUC F;  2K3K A;  4RBT A;  2CUY A;  3GYG A;  4CLL A;  4DG1 A;  3UFC X;  1XMQ J;  4C4W A;  1S7I A;  2WB1 D;  4EO6 A;  1H6K X;  3KD8 A;  3THP A;  1SQF A;  1N0U A;  2H5E A;  2W8L A;  3UCU P;  2GGP A;  2ASL A;  1T3N A;  3DLH A;  3CJR A;  4JV5 F;  5T7L B;  2GQC A;  1MSW D;  5KG3 A;  1KBR A;  1HPZ B;  1RWX B;  1T9Y A;  5HQL A;  1Y7P A;  3JSB A;  3GIM A;  2VJV A;  1CJT B;  4OYW A;  3BH7 B;  1ZAW A;  2MQQ A;  2RDJ A;  1UVM A;  4DPX A;  2MEW A;  1ELY A;  1ZYQ A;  3R7B B;  3FJ2 A;  2KFY A;  4RU2 A;  1KH4 A;  5HQ8 A;  1N5Q A;  1NLK L;  4WE1 A;  3KK3 B;  2L41 A;  4MTP A;  2XMM A;  4LQ9 A;  3FEX B;  2DNP A;  2BJ7 A;  1VQS A;  5D15 A;  1WC1 A;  3EWG A;  1O5J A;  4LR8 A;  4HDG A;  1OQ6 A;  3BKT A;  2M88 A;  3RB6 A;  3JTN A;  1TKZ B;  1NND A;  2CQG A;  2CXE A;  2FJX A;  2CJQ A;  2RQ4 A;  1IR2 A;  2L48 A;  1YG0 A;  3UR0 A;  1F9F A;  3TQ1 A;  2MLX A;  1PGZ A;  3BB5 A;  2CQ1 A;  1B3T A;  4I64 A;  1VQY A;  4IOA Q;  1U25 A;  3G8S A;  4KKO A;  3QFW A;  2R9L A;  3MPD A;  4OLP A;  2C2D A;  4CQ1 A;  1EHW A;  3DRS B;  2FHK A;  1S9E A;  1HWJ A;  5AT1 B;  4DFJ A;  4I2P B;  2KFN A;  3TJ9 A;  1CJV B;  2V9K A;  3ENQ A;  1GX5 A;  3PZP A;  3V81 B;  3LWM A;  1TL1 B;  2W7O A;  3CJK B;  4AT1 B;  1AT1 B;  4CLU A;  1KOH A;  4DU7 A;  2E5J A;  3CCS S;  5L0B A;  5CZV A;  3UN3 A;  2ZBQ A;  5F8H A;  3KK1 A;  1ALK A;  2DNM A;  4W4M A;  4ZP7 A;  4PUO A;  2GSN A;  2MST A;  2C22 A;  1O0P A;  2KG0 A;  2LEC A;  5IS2 A;  3T19 A;  1BMQ B;  2W5X A;  5H9F K;  2E5L F;  1W2B R;  3HK2 A;  4QWB A;  2A1B A;  1ELX A;  4IG3 A;  3ILI A;  3NGU A;  3P49 B;  2HRT A;  2LU2 A;  3GLJ A;  1SL2 A;  4F4X A;  3CT9 A;  5DET A;  1WOP A;  4PXC A;  3KJV A;  2B5J B;  2JRS A;  3LH2 S;  3CCJ S;  4JV1 A;  3BEG B;  1RK8 A;  1X5P A;  1C0U B;  2XI3 A;  3E51 A;  1ZA1 B;  3O44 A;  1T05 A;  3OR1 B;  1RBA A;  4NLV A;  2ZOG A;  4R0J A;  4ES3 A;  1WC5 A;  4Z7Y A;  3PYD A;  3I5A A;  3OJU A;  1M5K C;  1TKZ A;  4L73 A;  1LK5 A;  4AXJ A;  3EZO A;  1HWK A;  2DNY A;  2YKA A;  3K2Y A;  4KH1 B;  3B4D A;  4C97 A;  2XYG B;  2ZH7 A;  3CCL S;  3Q3Q A;  4IR1 A;  4WFB Q;  3LP1 B;  4K2X A;  2L3M A;  3TVZ A;  1NK7 A;  4W92 B;  3PM9 A;  5IT9 Y;  4KSE B;  1UJ5 A;  3VZH A;  4FDI A;  1E6Y B;  2A10 A;  5AXN A;  2AZ1 A;  1F5A A;  3HI9 A;  2C3M A;  2HFO A;  5SZT A;  1XIQ A;  1SJF A;  4ECS A;  1AZS A;  2AYE A;  2FHJ D;  2WZ1 A;  2YNI A;  3GON A;  1EET B;  1O6X A;  2CZ4 A;  2XSJ A;  2JH3 A;  3POT A;  3E2D A;  4JBC A;  2FZG B;  4ZVQ B;  2ZHA A;  5HMW A;  1CSJ A;  4LFA J;  2AGP A;  1RE1 B;  4URQ U;  4XK8 C;  2I6W A;  3PXG a;  5K8O A;  4RW8 A;  3IS9 B;  3I96 A;  2WB4 A;  1WHW A;  3MCM A;  2MY8 A;  1O8B A;  4USH A;  3CPW R;  1ZEF A;  2NZC A;  4NI2 A;  2CPH A;  1SUQ B;  1WI6 A;  3AOD A;  1MMD A;  4ZVS B;  5F3Z A;  5F8I A;  4X65 J;  1L3S A;  4JP8 A;  2VQR A;  1BD6 A;  1F2G A;  2P5V A;  4OYA A;  3RW7 A;  4LFA F;  1I51 B;  2Y0S D;  2CZ9 A;  3DRP B;  2QE5 A;  4Q7A A;  3V6K A;  4QPT A;  1YK9 A;  1TKX A;  3M1V A;  4YDD B;  3BN7 A;  3I0R B;  1RTZ A;  3G6E S;  4DV2 J;  2KM8 C;  1VGY A;  4WP3 A;  4DUY F;  3K8W A;  4DR3 F;  1D9F A;  4X65 F;  1ZEB A;  3CDU A;  5EGY A;  1Q7Y T;  2IVY A;  1UKU A;  4ITS A;  2VFR A;  1R8C A;  2RB7 A;  4NLT A;  4CO5 A;  3BYP A;  3H42 A;  5L1J A;  4L75 A;  1CJK A;  4JI2 J;  5C7P A;  2ZWO A;  3TX8 A;  2HKE A;  1XWL A;  1SC1 B;  4F3O A;  1ZH5 A;  4PXB A;  4DFP A;  3RBD A;  3BQ2 A;  1JJH A;  1H98 A;  2JHE A;  2MB0 B;  1EW2 A;  4TY8 B;  4CH7 A;  3EXC X;  2D9O A;  3EGN A;  1EQJ A;  1S1W A;  1FDN A;  2MJN A;  4RR5 A;  4JI5 F;  2WW4 A;  1J5E F;  3N5F A;  4LBP A;  1LW2 A;  1RT2 B;  2MDA A;  2N4D A;  4A46 A;  2XS7 A;  2LMI A;  2YNH A;  2BYC A;  3KLH A;  5HVF A;  1GNK A;  3BGF A;  2MZ1 A;  2RSQ A;  2GC8 A;  4JI3 J;  1BWE A;  1NK8 A;  5IWA F;  5J2Q B;  1ALJ A;  1NH8 A;  2KDO A;  3KLI A;  4DFM A;  3EX7 B;  1QUV A;  2JLE A;  1PCA A;  3PX6 A;  1F5B A;  3M4X A;  2GJ2 A;  3ENA A;  2YNF B;  3GPA A;  4X4U A;  5J2N A;  3SV4 A;  1YJV A;  3MMA A;  3Q83 A;  1VHF A;  1Q8L A;  2P9C A;  3TEH B;  3QSY B;  2J6U A;  4LF7 F;  4DS5 A;  3VF0 B;  2XLK A;  2H3E B;  3M32 A;  2DO0 A;  3EZU A;  2QL7 B;  4M5N A;  2HQF A;  2DHH A;  1EIY B;  2KT5 A;  3SZZ A;  5B0B A;  4CI0 B;  4WKR A;  3KJV B;  3MK1 A;  3G6X A;  1YBT A;  4OHZ A;  3KLE B;  1AUK A;  1FRX A;  2Z8Q A;  2HIY A;  4JI8 F;  3SCJ E;  1RBL A;  1HBO B;  4DL2 A;  2AEM A;  2UXB F;  4PPZ A;  3F56 A;  2A6O A;  3MZI A;  4ZVT B;  3K5N A;  2JLG A;  4DR2 J;  3T3F A;  2BW7 A;  3NLC A;  1NK9 A;  2DRD A;  2YX7 A;  4LF2 A;  2IM1 A;  4FP9 A;  2HRY A;  4LT6 A;  4C0B A;  1S99 A;  1GEH A;  1RI7 A;  1SKU B;  2ZBP A;  4YS2 A;  2GJF A;  4EMD A;  5F9N A;  3MUV P;  3NP5 A;  3KOA A;  2QRR A;  1Y7A A;  2K8G A;  7FDR A;  2V50 A;  3RRK A;  5ETV A;  2C2Z B;  4DPU A;  3OL9 A;  5CYQ B;  4FYY B;  2WOM B;  1S10 A;  1R8A A;  2QLJ B;  2V2Z A;  2OO4 A;  4LRB A;  4O4G B;  4DU8 A;  4NLQ A;  3N4W A;  4DL0 C;  2V5H G;  1C1B B;  2QZ8 A;  3VAI A;  2D3Z A;  3TO8 A;  1CS4 B;  4QU7 A;  1QTN B;  2VG6 A;  3QWU A;  4CLS A;  1S1V B;  2EG2 A;  1RT4 B;  2PMH A;  3EJM A;  2ROP A;  3D67 A;  4CNZ A;  2P6T A;  3FRZ A;  4MYU A;  2N3O A;  1XBW A;  1BQX A;  2W01 A;  1T03 B;  2PSZ A;  5GMD A;  3M6X A;  1HNZ J;  3UO0 A;  2V2Q A;  4HHU A;  1VI7 A;  1R89 A;  1T9U A;  4LRE A;  3VGT A;  2NXE A;  3FVY A;  5LMN F;  1D9A A;  3NAH A;  2OUG A;  2LEB A;  5KFU A;  3M8P B;  2YPY A;  1HAR A;  1ZZF A;  1F0X A;  4PR6 A;  2ROE A;  4U7U K;  3VZI A;  3ISN D;  5LOQ A;  5C5J A;  1N36 F;  2FLN A;  3C46 A;  2QFJ A;  1U47 A;  4DPT A;  1VR6 A;  2DR6 A;  2V34 A;  3ZZR A;  2J8S A;  1Q8B A;  4ZS6 A;  2ZHB A;  4PWW A;  4DQQ A;  1XMQ F;  3BDG A;  2G0J A;  2W25 A;  4ZVH A;  4LF1 A;  2LA4 A;  4I7F A;  3CIZ A;  3Q8R B;  1ELO A;  3TWZ A;  3D6F B;  3FBF A;  2GW8 A;  1U0H B;  3EIC A;  3MPV A;  5BYQ A;  4L6V 3;  4JI7 J;  5D3G A;  3QJJ A;  2P9G A;  2WON A;  1PIL A;  1VHI A;  3C15 B;  1RLD A;  1IXK A;  3AOB A;  2AJ0 A;  4I4B A;  1RB0 A;  2DHA A;  4X66 J;  1JLE A;  3BGL A;  4LSN A;  4NPO A;  5LSR A;  5KT3 A;  5BR8 J;  4DV5 F;  3V6D B;  1SL1 A;  5DGB A;  5FJ4 A;  5IQ6 A;  4LFB J;  3TUJ C;  1M1K T;  3QMQ A;  4TU8 A;  2VIC A;  1XJW B;  1B4S A;  1ZOT A;  2LVW A;  3L7O A;  3P5T L;  4GRS A;  4GVB B;  1JLF B;  3QJL A;  2UXC J;  3IGV A;  3CDB A;  2BE2 B;  2W2O P;  4V1A k;  3MM5 B;  4CXK A;  4GC6 A;  4QYZ J;  5DDQ C;  3D5M A;  5L1I A;  2DGS A;  1GTE A;  1KEK A;  3GR0 A;  4DX6 A;  1I94 J;  3AJ2 A;  1VRQ C;  2A0F B;  3BQ1 A;  3RR7 A;  1Z2Z A;  1SHQ A;  3DXB A;  1UVI A;  1AJD A;  2J7U A;  3PYE A;  2HS0 A;  1NO8 A;  1ZTW A;  3SZY A;  4G3I A;  2MZR A;  3G2X A;  3NGK A;  4UT4 A;  3KLG B;  1NK5 A;  1KTV A;  4P2F A;  4TY8 A;  4CLP A;  1RHJ B;  4EGL A;  2XR9 A;  5IV4 A;  4K4Y A;  2W5S A;  5HAT A;  1LFP A;  2HFZ A;  3FCH A;  4NXN J;  5F8L A;  4RUA A;  2R7V A;  2W4P A;  5KFG A;  4A8K A;  4F8R A;  3TUP A;  2K2P A;  3OLB A;  4MYT A;  3CF5 Q;  4CXU A;  2NXN A;  1OSD A;  2XZW A;  5DZ6 A;  2N7C A;  3D0G E;  3DLJ A;  1WHY A;  1VK3 A;  4FF4 A;  3O1L A;  4K7Q A;  2W5T A;  5A8W A;  3BGR B;  2FZK B;  2WCX A;  2W9B B;  3D7S B;  4IUF A;  1G2E A;  3IDD A;  1JLC A;  2XUL A;  4OJG A;  2D3O R;  2HBQ B;  1RT6 B;  2N7Y A;  4WF9 Q;  4RU9 A;  4RW9 A;  3JAM U;  1S1U A;  4FXW A;  4DL3 A;  2KN4 A;  4Y00 A;  1MN7 A;  4ECW A;  5L1L A;  3LA0 A;  1RAE B;  3K5M A;  1SIW B;  2MY7 A;  3E01 A;  2W8S A;  1UAW A;  3I56 S;  5KFV A;  4LF6 J;  4K59 A;  3HVR A;  1VK8 A;  4V19 X;  2LYV A;  4A47 A;  2W5W A;  4CT9 A;  5E3A A;  5K9F A;  1KFD A;  1IJF B;  5ITH A;  1LV5 A;  1AUS L;  4AL7 A;  1WDD A;  2FB0 A;  5A0Y A;  3S7R A;  5K4P A;  5HI7 A;  4ED1 A;  2Q1L A;  2DHX A;  1ZTT A;  1Y5L B;  2HRU A;  1EQM A;  4WBF A;  2HAI A;  3PHE A;  5KFD A;  3IN5 A;  3T00 A;  2DB1 A;  5LXY A;  1JMT A;  3TUZ C;  4GKK F;  1S9G A;  5F8J A;  3H90 A;  3IXQ A;  3OTC A;  1U1K A;  5KFH A;  2G9O A;  2Z2L A;  3EVO A;  5AE2 A;  4K4S A;  1IUJ A;  2UVR A;  4F2S A;  1IKX B;  4LIR A;  1Q0N A;  3FMB A;  2YQ1 A;  1XER A;  1RT6 A;  1BXN A;  3LP1 A;  3HXM A;  3RJM B;  2NRE A;  4IRK A;  2XRG A;  3UE2 A;  2ZH8 A;  3RAX A;  4C6A A;  2PO4 A;  2E1M C;  2M70 A;  3SQG B;  4OX7 A;  4H4O A;  2ASJ A;  1M5P C;  4JI1 J;  1XMO F;  1LEO A;  3TP2 A;  5L9N A;  4ALZ A;  2XYH B;  2KZZ A;  2HS3 A;  2XS2 A;  3SMZ A;  3W5X A;  1Y0H A;  1KDN A;  3CVK A;  1WF1 A;  2VV5 A;  4K4X A;  4EZ6 A;  4LFC F;  1IVZ A;  1YWX A;  3LGH A;  1RYS A;  4R5P B;  2D69 A;  5EX3 A;  4U7C A;  2YKM A;  3DLL Q;  3BPD A;  4IKA A;  4IDK A;  2CPF A;  4IO9 Q;  4MIV A;  4WU2 A;  2D3U A;  4DR3 J;  1WOS A;  5HRT A;  1S97 A;  1KP6 A;  2HVE A;  2EFV A;  2X3D A;  1Y5I B;  4F0K A;  4ZCM A;  2XI2 A;  4P2S A;  4J9R A;  2NQP A;  2UUA F;  2E5H A;  1T95 A;  4YFU A;  2CNN B;  1HA1 A;  2MKH A;  1RHU B;  2DNN A;  4GKJ J;  4KAY A;  1KTQ A;  3LPE A;  1D8Z A;  3WC2 A;  1WKK A;  1EAY C;  2GQ2 A;  3ITH A;  2B3T B;  4KGV B;  4OX9 F;  3HP6 A;  2KU7 A;  4ZVU B;  3OLA A;  3BSO A;  2HVD A;  1QJH A;  2EVZ A;  2M52 A;  5L9X A;  1IBK J;  5F8N A;  3W63 A;  2XHW A;  2OI2 A;  4JI0 F;  1UW9 A;  2ZOM A;  3C3L A;  4WIQ A;  1HD1 A;  1RSC A;  1S57 A;  2Q3P A;  4DUY J;  4LSN B;  2Q79 A;  4F4A A;  2C2K B;  2WVC A;  4JI6 J;  1FWL A;  4DPY A;  5HP1 B;  4OHW A;  4ED3 A;  2XSJ B;  4ID5 B;  4JI0 J;  4A48 A;  2V4J B;  4PG8 A;  4NLX A;  1NHV A;  3SEO A;  4UZB A;  3QIP B;  4OZ3 A;  2AYG A;  4UOR A;  3D6H B;  5L46 A;  1U2R A;  2GA7 A;  1E6V B;  2RDI A;  4WE1 B;  4KRW A;  2HLU A;  4OX8 A;  1KLM B;  3R97 A;  3C66 A;  2BKO A;  1M5O C;  1ANI A;  1VQO S;  3BJY A;  1FNM A;  2ZZM A;  3D54 A;  3W2W A;  4DSI A;  1NU4 A;  2ZOF A;  4FNH A;  1FFS B;  3HFK A;  5T7L A;  5MLC V;  3MI7 X;  3H5S A;  3OPK A;  1ULR A;  4RO0 A;  3UDV A;  5J1E B;  2QN6 B;  3RG6 A;  3WBZ A;  4Q43 A;  4DX8 H;  4DSF A;  5GOV A;  1J5E J;  2AP6 A;  5K8P A;  4C8O A;  4J9O A;  2IM2 A;  2C3U A;  5RUB A;  4FS1 A;  2IA0 A;  2RKI A;  3M6V A;  4ZG7 A;  1W25 A;  4WFN Q;  3H25 A;  3PR4 A;  2ANH A;  1QAJ A;  2O1P A;  4AQY J;  4XDD A;  1RTJ A;  4NWX A;  4OZL A;  1W26 A;  3ZXW A;  1VQ9 S;  1BLU A;  2AKW B;  3EVM A;  3M6U A;  1W2I A;  5J2P A;  2ZBI A;  1HHT P;  2HW3 A;  4MHX A;  1WNE A;  1C1B A;  3BPS P;  4USU A;  4L3K A;  4DR6 J;  3SFU A;  1K0V A;  4KO0 A;  3MUT P;  4F02 A;  2AT1 B;  2BMB A;  5C24 A;  4GMK A;  4ZN3 A;  4P2M A;  3R9L A;  1RXO B;  4TQR A;  2RVJ A;  2B7B B;  4I67 A;  4QIG A;  2GIF A;  3BGO P;  1U1O A;  1IBM J;  5DLG A;  5D4O A;  2P2C B;  2MZS A;  3AQP A;  1S9E B;  3CSK A;  3PHT A;  3ZTR A;  4WK3 A;  4BHQ A;  4O4R A;  4WCE Q;  2C28 A;  4QWA A;  1BGX T;  2DNL A;  3KHR A;  3DMJ A;  2ZFH A;  5ETN A;  2PFF B;  2CQI A;  2LXF A;  2ZEJ A;  2YWE A;  5KT4 A;  3TAQ A;  5EWG A;  3BRE A;  3GMG A;  5LSO A;  5EHH A;  2BOP A;  2A18 A;  3GCX P;  4J90 A;  4IH6 A;  3W9H A;  4DOZ A;  2WK4 A;  5LSL A;  4ZG6 A;  2NSB A;  4GVB A;  2HGM A;  2ZBR A;  1OY8 A;  1UVL A;  2KXN B;  4DR1 F;  1TAU A;  3PW4 A;  3IO1 A;  2Q6C A;  1Y6V A;  1URR A;  2XMW A;  3LGN A;  3SI8 A;  2EK1 A;  2MQM A;  5D77 A;  4ED6 A;  1N5T A;  5LMN J;  2QMU B;  2IA6 A;  4URS A;  1PBA A;  5JVG Q;  4BBY A;  5AE3 A;  1ZBT A;  1UVJ A;  2Q43 A;  2P8I A;  1X5S A;  2GS8 A;  2GX8 A;  3CUN A;  1K73 T;  4B3R F;  4X2B A;  1ANJ A;  1G4C A;  4NZ6 A;  2KHC A;  5EGE A;  5E5N A;  3WBH A;  3Q0A A;  4YB6 A;  1OJ4 A;  2ACY A;  4G6V B;  3DLG B;  3W61 A;  2VBW A;  2XNQ A;  4HR2 A;  5D0H A;  2UU9 F;  3H40 A;  4JB8 B;  4LBI A;  3FEZ A;  5BYR A;  2ZZT A;  4KJG A;  4BS2 A;  3OJS A;  4KPC A;  3D3B J;  4TYA A;  5J2Q A;  1HNI B;  4DUZ F;  2QA1 A;  3FFI A;  5D0E A;  5ETT A;  2BXJ A;  1VLY A;  2UU9 J;  3IAM 9;  5HP1 A;  2W5Q A;  4N7T A;  1RTI B;  3M2R B;  1E1Z P;  2AJF E;  2WRM A;  3IR6 B;  3ZZU A;  2KKH A;  4BCA A;  4MK8 A;  4ED5 A;  3D28 A;  2AJ2 A;  5IT9 U;  2JVO A;  2AJ4 A;  2MHN A;  1S79 A;  1T9V A;  2GHP A;  1PJ7 A;  4WFA Q;  2IDE A;  4LR7 A;  2H51 B;  5J2M B;  4ECX A;  1VQ4 S;  2Y8W A;  3DYC A;  3VAJ A;  4F50 A;  3GIK A;  1FTC A;  2QLF B;  2VFT A;  2PMZ D;  5KFY A;  2XCA A;  4X84 A;  5IC4 B;  3IR7 B;  2NUH A;  2NXU A;  3RBZ A;  4CNY A;  2R7R A;  5CHC B;  1GAO A;  4J91 A;  2ZM6 J;  3BSA A;  1DTT A;  4ZJL A;  4JI7 F;  1IN0 A;  2E29 A;  4CZC A;  3M9O B;  2XY6 A;  4HH1 A;  5DDR C;  3CJ4 A;  5KFA A;  2BR0 A;  4OHX A;  3K57 A;  1S1T B;  3NKQ A;  5E33 A;  5ETO A;  2I2Y A;  4B3T F;  2HNY B;  3B54 A;  4DV5 J;  5HRO A;  1P49 A;  1N4L A;  4D3G A;  2GAH C;  4CTA B;  4UZC A;  4E98 A;  3QBC A;  1KHV A;  3HHE A;  4G1Q B;  3QFH A;  1FFW B;  5IV3 A;  1SL0 A;  1NKB A;  3DOL B;  3F41 A;  1RCO B;  1Q16 B;  3EGV A;  4DV4 F;  2JDJ A;  4PXE A;  4K2J A;  3TZZ A;  4ZG9 A;  3AH6 A;  1IKX A;  1I94 F;  3CO0 P;  1MRO A;  3J80 U;  4RW8 B;  5DZ7 A;  1WUU A;  2HNZ A;  1FTR A;  2RAQ A;  3MM5 A;  4DR7 F;  2CQP A;  2FTR A;  2LP4 A;  3SQG A;  5C25 B;  2Y3Y A;  1KHL A;  2W7P A;  2VG7 A;  1EKS A;  2V0N A;  4K4V A;  1VQ6 S;  1P1L A;  1YVF A;  4TLR A;  5HAN A;  4F67 A;  3PV8 A;  3NGS A;  3G9C A;  4GTZ A;  2OSQ A;  2GA3 A;  1DFD A;  2L9D A;  1D8Y A;  3V6D A;  5LT5 A;  2E44 A;  3T41 A;  5ETR A;  1VS3 A;  2YNG A;  1UET A;  2ZH4 A;  4ER8 A;  2R2S A;  1ALH A;  3A8E A;  1Q86 T;  2GSO A;  3UCZ P;  4LQ3 A;  2O67 A;  3JSM A;  3MEC A;  2BAB A;  4PG7 A;  3JQJ A;  1URN A;  1FWK A;  1JK9 B;  4FDJ A;  5IM0 B;  2MLY A;  5KFO A;  1KSP A;  3HHN B;  3MM7 A;  3Q2S C;  5DQG A;  9RUB A;  3QID A;  1F9E B;  3G96 A;  3KG0 A;  2ZC3 A;  2DGO A;  3ZZT A;  5A6W A;  2J7W A;  1HNW J;  1E33 P;  5FLX Y;  2O5D A;  4KB7 A;  2G2Y A;  1N2K A;  2DCU B;  4W98 A;  2J9E A;  1IQT A;  3H2V E;  4FYV B;  1SBR A;  3X3U A;  2W9B A;  2EFO A;  3GJT B;  2BAN B;  2MTL A;  3IBW A;  2ZH5 A;  2ZH2 A;  4N56 A;  3ETM A;  2HNZ B;  2NXJ A;  5GAH U;  3NBP B;  1MU2 B;  2HBY B;  3CJT A;  2DPI A;  3CMR A;  4PYD A;  5KFR A;  1S1U B;  1K47 A;  3V6H A;  4NZ7 A;  5ETL A;  3TAM A;  3QJP A;  2X1B A;  3DNC A;  3AJD A;  1OQ3 A;  1P9Y A;  4RBV A;  3DMJ B;  4KBI A;  3KUE A;  4HEA 9;  1S1V A;  3MCN A;  3RW6 A;  2LCW A;  1O99 A;  1LWX A;  3NEK A;  4DFK A;  3J7A 1;  1UWA A;  2PDA A;  2WBR A;  3CJ0 A;  4IG3 B;  2OAU A;  2VBZ A;  1XN9 A;  2H54 B;  1JLQ B;  3PCO B;  4FVM A;  3KK1 B;  2DJW A;  2I9S A;  1QM9 A;  2ZD1 A;  2XZT B;  2LFV A;  4DR4 F;  2UXD J;  1EW9 A;  4OYO A;  3R8Y A;  2FJV A;  2DIS A;  2LDY A;  4N8O A;  4IH5 A;  1DQ9 A;  1TKT B;  4KE5 A;  1HYS A;  4QPX A;  4NA3 A;  4O44 B;  3VR1 A;  2W9C A;  1MWQ A;  1MW7 A;  3MAA B;  2J0W A;  3I87 A;  3ONQ A;  4KIA A;  2AW0 A;  4DQP A;  2KB2 A;  1KKH A;  1KQK A;  3M2R A;  1NSK L;  3S6E A;  4PQU B;  1NJW A;  3MPW A;  3HVT B;  4GVL A;  5HLF B;  3ZNJ 1;  1N56 A;  2AX1 A;  4OJ3 A;  3ZC4 A;  2XY7 A;  2NUU G;  3R1H A;  3G82 B;  3H0P A;  3ZTQ A;  1NK0 A;  2OH2 A;  4EYI B;  4JI1 F;  1WHV A;  3I9Z A;  2RKI B;  1RWW B;  3H4B A;  4OFZ A;  4DXL A;  2Z2Y B;  3HHK A;  3DRR A;  4LIW A;  1SI9 A;  2FC8 A;  4MAK A;  1XNQ F;  2R7X A;  1RTJ B;  3MEG B;  1FRK A;  3N01 A;  4KC5 A;  3MR3 A;  5LJ5 Y;  2CG4 A;  1RAA B;  3C14 B;  3EGW B;  4QJV A;  4ED7 A;  3EDQ B;  3D6M B;  1AZS B;  1LK7 A;  2GO9 A;  2YNI B;  1F5C A;  4PXD A;  4YQW A;  1XR7 A;  4TU7 A;  4RNH A;  4QIF A;  4N41 A;  2R2T A;  3MOJ B;  1FKA F;  3KLV A;  4DLG A;  4PG6 A;  3ILJ A;  3SCK E;  2BJE A;  3ILO A;  3A1Y G;  1OPI A;  2VOP A;  3MMA B;  3NL0 A;  2UUA J;  3ZZP A;  4KGM A;  2XBP A;  4PAA A;  3CJQ A;  4Z7C A;  3F44 A;  2UUT A;  2YWF A;  4DCJ B;  3FQL A;  5G0R B;  1TK5 A;  1FKO B;  1FXD A;  2LEP A;  5HO4 A;  4UPL A;  3TAR A;  1YJR A;  1FJC A;  1APS A;  1BY9 A;  2FLO A;  1RBO B;  2Y8Y A;  1UA0 A;  2CQH A;  4ANC A;  1AFI A;  4DSJ A;  2K3I A;  2RML A;  4PPD A;  3BQ0 A;  2FJW A;  5HMX A;  5E3Q A;  2GFF A;  3IWL A;  4NLR A;  4LF9 F;  4H54 A;  4WKY A;  3CC4 S;  3AOC A;  4WXW A;  3M8W A;  1BQM B;  5DG9 A;  1KLN A;  1LW0 A;  3PO4 A;  1FDA A;  2HFU A;  1S1W B;  1SPB P;  3UWT A;  3I6P A;  2XWY A;  1UZD A;  3AA8 A;  3FSX A;  3M2V A;  4J9S A;  3BYR A;  4LF4 J;  3MUR P;  3OSP A;  2K1R B;  2R8I A;  3BDF A;  1RWO B;  2AHO B;  1TQL A;  1Y10 A;  1HI8 A;  2HQ3 A;  2JEG A;  2CNL B;  4ZCI A;  2QLB B;  4TKT A;  4ENO A;  4QW9 A;  2PI5 A;  4PUO B;  3CWJ A;  3MM8 B;  3Q2T C;  5JJB A;  4W90 B;  4TYB A;  4B9V A;  2PD1 A;  3MPY A;  3GP9 A;  1Q95 G;  5CYQ A;  1GXT A;  2LU1 A;  2DNH A;  4A8F A;  3I0S B;  4LF5 F;  2J5A A;  2BM0 A;  4OZJ A;  3K17 A;  4CLY A;  2VFS A;  3AQO A;  4I2P A;  4ELV A;  4QQB A;  3I31 A;  4DF8 A;  3WQP A;  2J9D A;  2NLW A;  2RUS A;  4R5P A;  4TQS A;  3CC2 S;  2QA4 G;  2XHC A;  3PJW A;  2HND A;  4N47 A;  4OMF G;  4QWC A;  3RRH A;  3BDH A;  2K7K A;  5A2Q U;  4C9D A;  1SJ4 P;  4X64 J;  3GSD A;  1C0T A;  2F5G A;  2XZD B;  1IBL J;  3TAM B;  1JNR B;  3FKB A;  3DCA A;  3M30 B;  4F36 A;  3TG0 A;  5AXL A;  3GB0 A;  4KR0 B;  2GJI A;  2H48 B;  2LLZ A;  1UA1 A;  3QZ8 A;  3PW0 A;  1ROF A;  2DH7 A;  4NRU A;  3QO9 A;  3OUY A;  4OZ0 A;  3POT B;  3J7Z T;  3Q23 A;  2C3Y A;  4J37 A;  3IWN C;  5GME A;  4F3Q A;  5JUM A;  1UWB B;  4DV7 F;  3HHL D;  5G4D A;  3NNA A;  8ATC B;  4IR9 A;  1HWI A;  4OJH A;  1UCN A;  5E2Q A;  4ZPW R;  3SBM A;  5AXK A;  4ATN A;  1KHK A;  2CDQ A;  4C8Z A;  5MAO A;  1FKP A;  1NDP A;  1WD6 A;  2HFS A;  3GG1 A;  2RF2 B;  3T5L A;  1JLB A;  1O51 A;  3RUB L;  2UVV A;  1BQN A;  1EJJ A;  1I5O B;  4MIB A;  4A8X A;  3LXQ A;  2IAJ A;  1C1C B;  5DO2 A;  1LWE B;  1AFJ A;  4C7Q A;  3LPY A;  3M7V A;  2HWI A;  2RE1 A;  3ELH A;  2DIT A;  1X4H A;  3CCW A;  3TW0 A;  2GHV C;  1A9N B;  1SV5 A;  4I69 A;  4WZQ A;  1C0U A;  1H0H B;  2CIM A;  1QD1 A;  4YHH J;  1RTH B;  2JFD A;  1FD8 A;  2MXY A;  3D68 A;  3CW2 C;  4KH0 B;  1TMJ A;  3JYT B;  2KYX A;  4YR2 A;  2OIH A;  1YX2 A;  1RHQ B;  3QSI A;  2AQ4 A;  2BAC A;  2B7C B;  1LKZ A;  2FHO B;  2NCK L;  2B8P A;  3NWR A;  4PQA A;  2PGC A;  2BOA A;  4WP8 A;  3TZX A;  1U6B A;  1JLA A;  2NPI A;  3UCG A;  1DHM A;  1FRI A;  2JEJ A;  3BGR A;  5A8K A;  1VQ8 S;  3SCL E;  1NZ8 A;  3HPO A;  1KOO A;  1ZAX A;  3DM2 B;  1YKW A;  4B08 A;  3MAH A;  4EO8 A;  2RS2 A;  1P27 B;  2MQP A;  1ITP A;  1RWN B;  1KH9 A;  2NZ4 A;  1NRK A;  4ZCL A;  4ES2 A;  2BQ3 A;  4G65 A;  1U2F A;  2B6A A;  1VRU A;  4GC7 A;  2RT3 A;  4O23 A;  5E3C A;  2E1P A;  2Z0G A;  4M63 A;  2RRN A;  3GJR B;  4NOH A;  3GG0 A;  4P71 A;  5E3R A;  3HHL C;  3G6V A;  4CXS A;  3MOZ A;  3ENW A;  3CXC R;  3IP0 A;  3L3C A;  3FSI A;  3FSY A;  4R8U B;  2BE9 B;  2KRB A;  3EZ5 A;  2F1F A;  4OYB A;  1QSY A;  3H5U A;  2W8D A;  3AXK A;  4ILR A;  4QIW D;  3ED4 A;  5DGA A;  2M3D A;  3CD5 A;  1T11 A;  1DJ0 A;  3MCO A;  3WX8 A;  1TAQ A;  5LJ3 Y;  1LW0 B;  3PW7 A;  3HSD A;  2CQ0 A;  5HQM A;  1DY3 A;  2MKS A;  3HDS A;  4X66 F;  2XQC A;  4UPK A;  3OD2 A;  3D1Q A;  3GIL A;  5J2M A;  2DRB A;  2CQC A;  3FFI B;  4UUW A;  3PKY A;  3I5C A;  1HBM B;  3HKZ D;  2GMH A;  5HVH A;  2W1B A;  3AA9 A;  3OFH A;  1GXL A;  1L3K A;  2CQ4 A;  2Y1J A;  3TI0 A;  2C3O A;  3BBB A;  1TL5 A;  1ED9 A;  1JLB B;  1ZM9 A;  2E7X A;  4U67 Q;  2MQN A;  2ZVI A;  2QL9 B;  4X4N A;  4AUK A;  4NMX A;  2MKC A;  3HSG A;  4CT8 A;  2QV6 A;  3CCT A;  5KFQ A;  2V68 A;  2IC3 B;  1FER A;  1SC3 B;  2BRL A;  2IYI A;  3S01 A;  2G0I A;  1BHN A;  1LQ9 A;  2AF6 A;  2JJ4 D;  3C15 A;  3JQK A;  1MG7 A;  3TEG A;  3F73 A;  5B0D A;  5KFB A;  1H7X A;  3QAE A;  4B9T A;  4FDF A;  1PC4 A;  1QY7 A;  3QO9 B;  2F3J A;  1HW9 A;  3L7P A;  4YEA A;  3GFX A;  2FGC A;  2HHV A;  2HND B;  3RYL A;  3UVJ B;  2E5L J;  4UPI A;  3DRY A;  4F4W A;  2P6S A;  4URG A;  1S6U A;  2W2N P;  2HHQ A;  1DUR A;  1XTZ A;  3SDE B;  4UOG A;  1X0P A;  3F0N A;  4PKD B;  2HK3 A;  2KH9 A;  1EI6 A;  5L8R C;  4DL5 A;  4O3R A;  1UPP A;  1F60 B;  2JC0 A;  9ATC B;  1NME B;  3MEG A;  1HBU A;  2WTF A;  1X60 A;  4WXO A;  1Y9O A;  4U6P A;  4J9N A;  4HYK A;  4KFB A;  5H9E K;  2AD9 A;  2E1A A;  1LNQ A;  2QIF A;  4L76 A;  4O44 A;  4QZV B;  4DPW A;  1PKU A;  3G71 S;  4QU6 A;  3G82 A;  3IBC B;  3CJK A;  4RWW A;  5E0O A;  4BWJ A;  4DX5 A;  2QEX S;  1HWU A;  2HFN A;  3THV A;  4NXM J;  2ZJR Q;  4ILM A;  3GE9 A;  2W2M P;  1S4F A;  3M2U A;  3BSN A;  4K4W A;  4DS4 A;  1O98 A;  2B9E A;  4WJB A;  1S0M A;  5CD4 A;  1VJW A;  4UOH A;  3RU0 A;  4RW7 B;  5LRN A;  1J27 A;  4DUT A;  4OI6 A;  2U1A A;  3V81 A;  3P45 B;  4ETZ A;  2XS5 A;  3CMA S;  2OTJ S;  4YDX A;  3SDE A;  2UVW A;  3M8Q A;  3K0J A;  2DEI A;  5HJY A;  1MU2 A;  1Y11 A;  2V8G A;  4YB1 P;  2ATL A;  4OI4 A;  3OXG A;  4C8Y A;  2BJ9 A;  1AB8 A;  2H1Y A;  2R8J A;  2PI4 A;  2XC9 A;  2F40 A;  1JB0 C;  5ADZ A;  4F4Y A;  2B43 A;  5IQQ A;  1NB2 A;  3W2W B;  4K4U A;  3NNC A;  3P8B B;  5E7O B;  2BDP A;  2N82 B;  3M9N B;  3TR5 A;  1JLE B;  1HHQ A;  1RGV A;  4ECT A;  4F3M A;  4F25 A;  3MEK A;  3MR2 A;  1TU0 B;  3MR7 A;  4NAS A;  4P7V A;  1U0H A;  4EFA C;  3QWP A;  5IZH A;  3KLF B;  2B51 A;  2BJD A;  1WG4 A;  4ED8 A;  2LA6 A;  2ROG A;  3CDW A;  3OR2 A;  4DV3 F;  4L3N A;  1KLM A;  1TP7 A;  4UST A;  4NLG A;  4OL8 A;  3NKO A;  2R4F A;  3DRR B;  1LFW A;  1XK8 A;  4OI1 A;  2EKN A;  1E3C P;  4QAX A;  4RNF A;  4FZV A;  5KTQ A;  1D9D A;  2VU5 A;  1ZAV A;  2ATC B;  3JTO A;  1Q5V A;  3PVX A;  5DLW A;  3AAW B;  4ID5 A;  3QT7 A;  4IQM A;  2V6A A;  1R0A B;  2QJ3 A;  2RUG A;  5EGH A;  1TR0 A;  2FHM A;  4PEO A;  4IFV A;  2VQE F;  3AD7 C;  3T5H A;  3R5J B;  5T14 A;  1HMV A;  2VDH A;  3H2U B;  2ZH3 A;  1ZZN A;  3R3T A;  3UR3 C;  5AJ9 A;  4O0N A;  4A8Y A;  1X4G A;  1HI1 A;  2MKJ A;  3RTV A;  4CH0 S;  2DVI A;  2DY9 A;  2KT3 A;  1D09 B;  3FZB A;  3FGV A;  3BKU A;  1H2U X;  2CPY A;  2OJ3 A;  4B3S F;  4OX9 J;  2OPQ A;  2AIR B;  3VQT A;  2YWW A;  2JWN A;  2FHJ A;  1GQE A;  2E7V A;  3NS6 A;  4JI3 F;  3R6G B;  1U8S A;  4CM2 A;  4DV1 J;  3UD3 P;  2BQR A;  4QR0 A;  2YTC A;  2MZT A;  1CG2 A;  3ISN C;  1F6T A;  2ZD1 B;  3FRY A;  1S6Q B;  2VKZ G;  3MAQ A;  1SJ3 P;  1YJ9 S;  2GVD A;  4JI6 F;  2Y1I A;  6AT1 B;  3P5B P;  4JI4 J;  1NJI T;  3J81 Y;  2AGQ A;  1FX2 A;  4C8K A;  1HQ2 A;  1JJ4 A;  1AJA A;  1REV B;  4KAV A;  2PII A;  5I42 A;  1FES A;  3OTO F;  3DPC A;  1U1Q A;  4V19 J;  5E41 A;  4AQY F;  2MYF A;  3UDE A;  2QSW A;  3PEJ A;  2VZ9 A;  4G1P A;  4ELU A;  4JI5 J;  4UY8 5;  4AL5 A;  5DS7 A;  4Q5V A;  1QAI A;  2DGX A;  3OFF A;  4UOF A;  2YVS A;  2CPE A;  1HBO A;  2APO A;  5CAB A;  3EPI A;  3WZ0 A;  1N5S A;  2QT7 A;  2R8G A;  3UPF A;  5ETS A;  1RT3 A;  1FRH A;  4RNN A;  2ZBC A;  3KHH A;  3IRW P;  4KV8 B;  3TA2 A;  3JYT A;  1NJX A;  2CNK B;  2JC1 A;  2SXL A;  3OQ2 A;  4CO4 A;  4X4T A;  1XNR F;  3E2E A;  4JI8 J;  1T9T A;  2CA9 A;  4Y2M A;  1HI0 P;  1H2V Z;  1K7H A;  2ZKU A;  3W9I A;  3H4D A;  3T5J A;  2Y1L B;  2A2D A;  5B0C A;  4B9S A;  3IS9 A;  2D41 A;  2YNG B;  4DX7 A;  3T01 A;  2QFI A;  4RW6 A;  5DM7 Q;  4LF7 J;  2G0C A;  3IR5 B;  1KVI A;  4WFY A;  4J5O A;  3I4P A;  3OR2 B;  4OHV A;  4USV A;  1Q1K A;  3J80 Y;  5KG0 A;  4S0M A;  3DLG A;  4LR9 A;  1PYT A;  3IRX B;  3MM9 B;  4P72 A;  5A76 A;  5DDO C;  1OWX A;  3NKY A;  1RTD B;  2JOQ A;  1JJC B;  2VG5 A;  2PEB A;  4ETX A;  1OIA A;  1ZED A;  4FXD A;  4HLB A;  4CP5 A;  2GIQ A;  3G4S S;  3B78 A;  1WHX A;  1NDK A;  5HBM A;  2OLW A;  1H3D A;  3ADA C;  4EWT A;  3AD9 C;  2B9W A;  2XTJ P;  2MQ8 A;  4UF4 A;  2RJZ A;  4C2M A;  4WTO B;  1N2L A;  3WAW A;  1Z2L A;  1JLC B;  4MFB A;  2E9Z A;  1FK9 A;  3ZZY A;  4F4Z A;  2FJE B;  5ETM A;  1SXL A;  4MKY A;  4QYR A;  1X4F A;  4DSK A;  1CJK B;  2FD2 A;  3H5X A;  3DLE A;  3U27 A;  1HQA A;  2HSE B;  3DDK A;  3HF5 A;  2E9R X; 
#chains in the Genus database with same CATH homology
 4ZG7 A;  4MHX A;  2XRG A;  3IGY B;  1EJJ A;  4UPH A;  4FDI A;  1EW9 A;  1ALI A;  1URA A;  3LXQ A;  1ANJ A;  3NKP A;  2RH6 A;  5TJ3 A;  4CYS A;  3NVL A;  5EGE A;  3WBH A;  3OT9 A;  3M7V A;  3UO0 A;  3E2D A;  4LRE A;  4B56 A;  3NKN A;  4KJG A;  2D1G A;  5C66 A;  1AJB A;  5LIA A;  3UNY A;  4MIV A;  2IFY A;  5DLT A;  5HRT A;  2W5Q A;  4N7T A;  1ZEF A;  3BDG A;  3NKO A;  2VQR A;  1E1Z P;  5IJQ A;  2W5R A;  4UOP A;  1ELX A;  3NKM A;  1B8J A;  1E3C P;  4QAX A;  5GRR A;  3TWZ A;  3MK0 A;  1KH9 A;  4CYR A;  5DLW A;  3DYC A;  4LR7 A;  4KAY A;  5EGH A;  2QZU A;  3KD8 A;  1ZEB A;  4CXS A;  3UN5 A;  1ED8 A;  2GSU A;  5AJ9 A;  1URB A;  3WAY A;  1HDH A;  2W8D A;  3ED4 A;  4KJD A;  4UPL A;  1KHN A;  1KH4 A;  1E2S P;  3BDG B;  1ELZ A;  4CXK A;  1P49 A;  2G9Y A;  1EW2 A;  3NKR A;  4LR8 A;  1FSU A;  4UOR A;  1EQJ A;  1SHQ A;  1AJD A;  3M8W A;  3WAX A;  1ED9 A;  4GTW A;  4YR1 A;  3SZY A;  1ANI A;  3NKQ A;  3T02 A;  1AJA A;  2GLQ A;  4KAV A;  4ZG9 A;  4TN0 A;  5INH A;  2XR9 A;  3DPC A;  2W5S A;  4NWJ A;  1ALJ A;  3BDF A;  1KHL A;  4MY4 A;  5GOV A;  4CXU A;  1HJK A;  3B5Q A;  4GTZ A;  5IJS A;  2GA3 A;  3A52 A;  3IGZ B;  4UOO A;  4LRD A;  2ANH A;  2W5T A;  4UPI A;  1EW8 A;  4NWX A;  3IDD A;  1ALH A;  5L0B A;  3UN3 A;  1ALK A;  2GSO A;  5LQQ A;  1K7H A;  5KXA A;  2GSN A;  1EI6 A;  2W5V A;  2X98 A;  2ZKT A;  4FDJ A;  4LR2 A;  4LQY A;  3SZZ A;  3TX0 A;  5L0K A;  3BDH A;  3MK1 A;  2W5X A;  1AUK A;  1SHN A;  1E33 P;  2W8S A;  4UPK A;  3WAV A;  2IUC A;  3UN2 A;  1N2K A;  4LR9 A;  2IUC B;  5L0E A;  3T01 A;  3TG0 A;  2W5W A;  4LRF A;  1ZED A;  4ZGA A;  4GTX A;  4GTY A;  3CMR A;  1AJC A;  5K4P A;  1KH7 A;  3T00 A;  3WAW A;  1N2L A;  3M8Z A;  5LRM A;  4LRC A;  1KH5 A;  1Y7A A;  4LRA A;  3MK2 A;  1O98 A;  1ELY A;  4ZG6 A;  5DLV A;  3M8Y A;  1O99 A;  5LRN A;  4LRB A;  1HQA A;  1KHK A;  1KHJ A;  3Q3Q A;  4KM4 A;  1Y6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...