3TWZA

Phosphorylated bacillus cereus phosphopentomutase in space group p212121
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
b'KYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3twzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3twzA01
5AJ9A 1HJKA 3UN3A 4GTYA 3T02A 2G9YA 3WAXA 3SZZA 3NKMA 4LRBA 4LRDA 2IFYA 1ALKA 3LXQA 3DPCA 4QAXA 3M8YA 2W5WA 2X98A 3TX0A 3Q3QA 3CMRA 1EJJA 2XR9A 5L0KA 1Y7AA 1KHJA 3UNYA 4YR1A 4LR8A 3DYCA 3KD8A 5L0BA 3WAWA 4CXKA 5EGHA 4LQYA 4LR9A 2VQRA 3BDGB 3MK2A 2IUCA 2IUCB 1FSUA 2GSUA 1ALJA 3T01A 4UOOA 2QZUA 3UO0A 3BDHA 3WAVA 5DLVA 4CXUA 1EW2A 4GTXA 4CYSA 1ELXA 3BDFA 3WBHA 4UPIA 5GRRA 2W5QA 4ZG6A 1AJAA 5C66A 4FDIA 5LQQA 5LIAA 5DLWA 5LRMA 1KHLA 1E1ZP 2D1GA 5KXAA 1HQAA 1ANJA 3MK0A 1AJCA 4TN0A 1KH9A 5DLTA 4UPLA 1ANIA 5K4PA 2W5XA 1O98A 4N7TA 3NVLA 4CXSA 1N2LA 1ZEDA 2W5RA 2W8DA 4LR2A 2W5TA 1E3CP 5TJ3A 3WAYA 4FDJA 2ZKTA 1ALIA 4NWJA 5LRNA 3NKQA 1EI6A 2W8SA 4ZG9A 4MHXA 4LRAA 1B8JA 2GSNA 4KJDA 5L0EA 3A52A 4KAVA 5GOVA 4LRCA 1ALHA 1AUKA 3IDDA 5INHA 1EW9A 1URBA 3OT9A 2XRGA 3NKOA 1ED8A 1ELZA 1AJBA 3MK1A 2RH6A 1HDHA 2W5VA 4B56A 4UORA 4MIVA 4GTWA 1ZEBA 3IGZB 3NKPA 5EGEA 4KAYA 2GA3A 1EW8A 1P49A 1SHNA 1Y6VA 3NKNA 1KH7A 1ELYA 4MY4A 4ZG7A 1EQJA 1K7HA 3TWZA 3NKRA 3TG0A 5HRTA 3UN5A 3M8WA 3UN2A 4ZGAA 4LRFA 1KH5A 1KHKA 4NWXA 1KHNA 4CYRA 1N2KA 4LR7A 3M7VA 4KM4A 4UPKA 3E2DA 3ED4A 1E2SP 3B5QA 4KJGA 4UPHA 1O99A 1AJDA 1URAA 3SZYA 2GLQA 1SHQA 2W5SA 4GTZA 5IJSA 3BDGA 1ZEFA 1KH4A 2GSOA 4UOPA 1E33P 2ANHA 4LREA 3IGYB 1ED9A 5IJQA 3M8ZA 3T00A
chains in the Genus database with same CATH superfamily
4P9SA 3LGHA 3FDSA 5IOLA 3KDOA 3CJKB 2VODA 5CHCB 5KT5A 2XR9A 2XLJA 3CCMS 1J5EJ 4MYTA 2VQEJ 1ALJA 1XBWA 3TARA 3QT7A 4XO0A 5D8HB 4DQRA 4L73A 5KG3A 3LWLA 2MQQA 1DTQA 4EEYA 1HR0F 4ZLNA 4Y00A 1B7FA 4K2XA 4CH7A 2K3KA 4AXIA 2G1DA 3VR1A 4CH1A 4ECQA 2NXEA 5T14A 1CJKB 1YJ7A 2ZBRA 5AXKA 1LQ9A 5I42B 3JAMU 4X4RA 4DX6A 3T5LA 2Z57B 2OSQA 5G0RB 1ELOA 3OTEA 2XMAA 4ECSA 1VISA 4DR6J 1FX4A 2M0GB 2QX0A 3CCTA 4NLRA 3CJRA 4PXDA 5K8NA 4LFCF 1AZSB 2ZH4A 2A18A 1TV6B 2D3ZA 4YOEA 4AL7A 1HQEA 1ZEFA 2CPZA 4RW9A 4MK7A 1GMVA 3CTRA 1UVJA 3C46A 1T03B 1CS4B 2G9YA 2BMBA 1I3OB 4ZPCA 1A6LA 2H48B 3PEHA 4IDKB 2W8LA 3TX0A 2RD5C 2ATLA 1HBOA 5KFUA 1XNRF 4UQTA 3RU0A 3GILA 1VMBA 1Z2LA 4X4TA 3DLGA 1XR7A 3MM8B 2YWGA 1O98A 3EPIA 2MDAA 2LFVA 1IKXB 3CDUA 4C11B 3VAHA 3NAIA 2APOA 3PG9A 1RT2A 4JI5J 1S59A 5E3PA 5KT7A 5D4NA 4RBUA 5JVGQ 4LBPA 2ZH8A 5C25A 2CQIA 1S9GB 1C1CB 3OVBA 2A0FB 2C3UA 1OIAA 2MQPA 4CO4A 2P6SA 3H4BA 1Q5VA 3C14B 3ITHB 1BXNA 5CYMB 4K4XA 4RPFA 4JI1J 1H38A 4PG6A 2DHSA 1YZ6A 4DPYA 1WOPA 1EIYB 1NJXA 3LXQA 2J76E 1HNVA 2Y1RI 3D0HE 4J9MA 4LT6A 2JHEA 2W2PP 3MD3A 5KFPA 1RTIB 4ETXA 2HZAA 3DNCA 1XNRJ 4KJIA 5HN0A 4HDHA 3OSPA 1IN0A 1X9MA 2FJAB 2VJUA 1D1UA 2QLBB 3ADAC 3EWGA 4QIWD 1PGZA 1OY8A 3CJ4A 1TL5A 3LGMA 1W2BR 3R5DA 3TI0A 3NVLA 2FVPA 4A8WA 3HX9A 4JV1A 4A47A 2CG8A 1UJ5A 2ZH9A 3KKFA 5IV4A 1LWFA 3ILOA 1WHWA 5E3AA 3CCVS 4GVLA 2HFOA 4DQSA 4FPIA 2P9EA 2ZOGA 5HQLA 2DEJA 2Y8YA 2EC0A 1RAGB 3O44A 3MR2A 1MROA 3A3NB 4H4OB 1VQ8S 1GXLA 1U2FA 5KFKA 1HWLA 1KHVA 1VRUB 1IBCB 3CXCR 3QJLA 1URAA 2JEIA 2KFYA 1N6QB 2XSJA 5K8OA 4LQ3A 4USHA 1MWYA 4UUWA 1IKYA 3UQSA 3GFZA 3PHEA 3NGUA 3DOMA 2UXDJ 3QAEA 1NB2A 1SUQA 3JS9A 4KGMA 3THTA 3IMQJ 3LP1B 1CJVA 4ZIVA 3IM8A 3O5TB 2YKOA 4EYIB 4B17A 2EVZA 3BGFA 3FSIA 1KR4A 4ZHRB 4DPOA 1VI7A 3A8KA 2CJBA 4WKRA 1BLUA 4CI0B 3AD9C 3D1QA 2BKPA 5BXIA 2MKCA 3CCLS 3MUVP 5HL7Q 2E1AA 3Q89A 3DRSB 2HVZA 2GJFA 2E1MC 2LCWA 5D78A 4C98A 3UCGA 4OYBA 3NAHA 4J9VA 1O8BA 4IG3B 4RUHA 2CPFA 2CPDA 3HMJG 1AW0A 2W2NP 3L7UA 1Q7YT 3OR2B 2X1FA 5DETA 4NOHA 1SB6A 2YTCA 3GJSB 4RWWA 4WF9Q 1S1TB 5KFQA 1IJFB 1L3SA 3PVXA 1RACB 4IOBA 2CQDA 4F4WA 2I38A 3JB9k 4ZG6A 2H65B 2ZHBA 4X2BA 3TAMB 4ETZA 1K1QA 4IOCQ 2D3OR 3GPAA 4C9DA 1RU2A 2AGOA 4JI8F 4EUVA 1FKPB 5CD4H 3NLCA 3MM9B 5ITHA 3KJVB 4NE9C 1MLAA 3KK1A 4DFKA 4C6AA 1YITS 1WG1A 2DGQA 1LWCA 3WIUA 3PCOB 2E9RX 3PYGA 1TFWA 1MN7A 4N47A 2GMHA 4OX6A 2J6UA 4MFBB 4ZITA 3WDOA 4Q45A 2DNQA 3B54A 1A9NB 3U27A 2DY1A 1JLQA 3JTNA 1UFWA 4LREA 3T00A 5LSLA 3NGDA 4QJVA 1AXQA 3V4IA 4NLXA 3LP2B 4FVMA 3BR8A 1H7XA 4OYWA 3BGRB 3UDCA 4KC5A 4I2PB 2B51A 4CLTA 1LV5A 3BV8A 4LQYA 3T01A 1KONA 1KTVA 2GS8A 5HBMB 2FJXA 4DPUA 1HL6A 4CP5A 2EPIA 1RUSA 1NKEA 2BOAA 1WC4A 3MCSA 4L6V3 4JI4J 1X7VA 1WSRA 4DWIA 4XAKA 2JWNA 4M5HA 3FVYA 3B4DA 3A13A 3LPYA 3TOQA 2B4UA 2PGCA 1MMDA 4ECRA 4OZ1A 4EBDA 5HLFA 3G82A 1S76D 2BANB 1GFWB 2HWIA 1S1WB 1Q7LB 4TU7A 1NBEB 4DS5A 4KY3A 4CLWA 4ZCKA 3NCRA 2VA2A 3KOAA 2BA9A 5D3GB 1KHNA 4EWTA 2GMJA 3LAMA 2AMCB 4OI2A 2HQFA 4OHXA 4J9QA 2ZOFA 2FJBB 5CA5A 2A2CA 1S1XA 4CZCA 1YTYA 5KOXA 1SC4B 4DL7A 2ASYA 3C2PA 3KG0A 3S6EA 4K0KF 4U7UK 2RNEA 2B5JB 2CQ4A 1RCXB 1AA1B 2V8VA 4UOHA 1F0XA 3PHTA 1VK3A 1UP1A 4FZVA 3M30B 1FRLA 2H1YA 4O0NA 4RW8A 1YQHA 4C2MA 1Q53A 2ALYB 3AY0A 4URSA 2MKHA 5IQ6A 4RNFA 4PUOA 3R5CA 5JMNA 1S6OA 2XYGB 4KV8A 1IM6A 2UZAA 3I4PA 4J9SA 1CJTA 3MAHA 3ETOA 2BKNA 4WE1B 4F02A 5KFCA 3BO4A 1WKKA 2YWEA 3BEGB 2JJ4D 5DLFA 2E1RA 3CDEA 3TRGA 3EDQB 4DFPA 1U1MA 2UVRA 3AXKA 1DQAA 5IJQA 5J2QA 1RJJA 2FTRA 3LH2S 3DLEB 1WEZA 4LRDA 2FLOA 2LLZA 5L0KA 1LOUA 2L08A 3G2XA 3KLGA 3VAMA 2AYEA 2HS3A 4WFYA 4KGKA 2KFNA 2YNFB 5KG2A 3M32B 3ZZ0A 4DV2J 5KFFA 5SUHA 2CQ1A 3AODA 2XI2A 2XY5A 4K0KJ 1QVFR 2ZDOA 3BH7B 4I1TA 2GVZB 3GYGA 1X4CA 4URQU 5GMEA 4A8SA 2CJYB 2QN6B 1RA7A 1ZPWX 5KFTA 3TNVA 3V5RA 3C19A 4DR1J 4NLYA 3T1YJ 1P6TA 3PEJA 2OTLS 2XQCA 3MMCB 4DF8A 4C0OC 2DNHA 3NP5A 4JI2F 1B99A 2FQQB 3LP0B 1FD2A 1D3WA 1D8YA 2RMLA 2PMHA 3VAIA 1B70B 3UVJA 1WSVA 2R9LA 2B4VA 3LQVA 4O3NA 4BWJA 3OTCA 1JLCA 1I1GA 3CCUS 4F4XA 1FJGF 1QE1B 1DLOB 3RAMA 2CWKA 1M5PC 2FC8A 3MM7A 1YJRA 3DLJA 4YY3F 4TXSA 4F4ZA 3QMQA 3W2WB 4P7TA 4OHZA 4C8NA 2KM8C 2KU7A 1CLFA 4JYAJ 2EEYA 1QD1A 2YQ3A 2MY8A 1YX2A 2MJUA 3FMWA 2DXFA 1APSA 5E7OB 1QUPA 2ZWOA 1GAOA 4K50A 5C66A 4H4MB 4NRUA 3L95X 1S77D 4GVBA 5KFNA 2XZWA 3TJ8A 5M2PA 3T5JA 2JDJA 5KFVA 2W8DA 1FEHA 3QSIA 3NKQA 3CULA 2AEMA 4PZVA 4Q0BA 3DOKB 2XNQA 3N6NA 2HHTA 3K58A 4BC9A 3VQSA 2BVZA 2PT0A 2ZZNA 1R0CB 2YKNA 2VG5A 4LSLB 3MECA 1LW0B 2ZH2A 1HIYA 2E66A 2J9CA 2ZC4A 2G1HA 2X3GA 1ZTWA 2W9BA 1X4BA 1VIXA 2B43A 2FPHX 3IC1A 4OLOA 4FDFA 5CH7B 3HKWA 3QRQA 2EI5A 1FNXH 4WK1A 4O3OA 4GKJF 2R8GA 4KKOB 5KT2A 3ET6A 4X65F 4WYLA 5IT0A 1IKVA 3CD5A 3ENAA 2GQCA 2QIFA 3KXDA 4P74A 5M2RA 3NBPA 4CLYA 4J90A 1SL2A 3L09A 3OVAA 2WCXA 4KHMA 1YBAA 2XHCA 5B08A 5F8IA 4DPXA 1X31C 1GTHA 3TUIC 2MQLA 5HP1A 2DCUB 3EGZA 4WFBQ 4QU7A 4LR2A 2AJ0A 3O8WA 2C3OA 3R1LA 2GVDB 4LRAA 2DPIA 3KLIA 3ENVA 5L0EA 4QWBA 3IGNA 3Q8YA 3SCIE 2W9CB 2W5VA 5E33A 3HKZD 3U02A 2M2BA 1OMSA 3F56A 3MAAA 2EWHA 1R8AA 1M1KT 3P49B 1RTDA 2UUCF 5DS7A 3CJKA 3KJQB 1FDBA 3GIRA 4LF7F 2C2NA 3VAKA 1UJ4A 4USKA 2RDJA 1KLMB 3R8YA 4LSZB 3W63A 4GTYA 2DD8S 4FP9A 1KDNA 5HROB 4Z7YA 3AA9A 3VZIA 5HMYA 1GMWD 3DOLB 3LOUA 4I6YA 4LVOP 4N41A 4TLRA 2WVEA 4DF4A 1FJEB 2QO3A 2HRUA 3HHLD 1OYEA 4BC7A 4W92B 3L3CA 4Y6IA 3EX7B 5I42A 1N88A 1E1ZP 1RWOB 4UF4A 1SV5B 1Y7PA 1KVIA 3Q8VA 4IH6A 4HEA9 2ASJA 1KSPA 2B3TB 2CQ2A 3T9NA 3ZO7A 4K4VA 3I0SB 4DG1B 5F3ZA 1IM4A 1D0EA 4X64J 4D3HA 5GADU 4FYDA 4M5IA 2DKOB 2XWYA 1AZSA 4O3RA 4UOCA 1VQ5S 2CVIA 1HDHA 3UCZP 3UD5A 1TV6A 2XMMA 4P2MA 2PI4A 1NJIT 2VFTA 1A0OB 1FTRA 3DRRA 1T03A 1CS4A 4P2FA 3DU5A 4KHPF 3QIPB 1KHKA 4NWXA 4IDKA 3FZ2A 4W90B 1CQMA 3N6MA 1XN9A 2IVMA 2E44A 3G8TA 2FVQA 3DLHA 2F1FA 3C6TB 3PJXA 4QR2A 1I94J 4RO0A 4OZ2A 2W9AA 2EG1A 3MPUB 1DAXA 2IRYA 2BJ9A 3H0PA 4C11A 4L75A 4JI3J 2GSUA 1RTHB 3MM6B 1SXLA 2BJEA 4P71A 1U1OA 5I3UA 2PIIA 3FFIB 2BE2A 4NZ0A 4IFVA 2N82B 4UUXA 4ECYA 3PW7A 2PEBA 1S9GA 1LXNA 1IBKJ 3JSRA 1IBMJ 4DOZA 1YKWA 1GT8A 4Z2XA 2FDNA 2MQOA 1UEUA 2ZHAA 5CYMA 1SKRA 4YP3A 1RHMB 2G9OA 4DR3J 1J5OA 2AD9A 2XZDB 2AGPA 3NKNA 4USUA 1REVB 5HRTA 3FBCA 4KHPJ 2FY1A 3SZYA 1AJDA 1VQOS 2DNYA 1RTIA 1X4GA 2CRLA 5T41A 3RJMB 3C3LA 2ZE2A 1X0FA 1U0SA 1Q79A 4MTPA 4Y2AA 1UVIA 3PW4A 2MTLA 4YFUA 3CC7S 4TQRA 1TKDA 4IRDA 1DQ8A 1YRTA 5H9FJ 3MUMP 3BDGB 1KP6A 2QLJB 4ID5A 4TYAA 2X51A 3FQLA 3BGLA 3LF0A 2HVDA 1C0TB 3HDSA 3W9JA 5J2MB 3ILJA 1VQNS 4N7TA 2KRRA 2VZ9A 4OV1A 2W5TA 4FDJA 4F4YA 5HVHA 5J2NB 1R8HA 1Q95G 1P1TA 2E9TA 1R8PA 3NKOA 1VBKA 2KXFA 3M8SA 3IS9B 2NXUA 1FFSB 1U1RA 2G0JA 2HK2A 1SL0A 1N6QA 1JJHA 1RAFB 2OPPB 3DI6B 4ECWA 4FYXB 3OR1B 2O5DA 3CJ5A 1FT8A 3UR0A 2B9WA 2B8PA 2HAIA 1Q82T 4WK3A 3BDPA 2UU9J 2C42A 1U2RA 3H5YA 2F8MA 3LP1A 1VJQA 3OTOJ 1R6YA 1SC1B 4CT8A 1O6XA 8AT1B 4KTQA 1C4AA 3E01A 2BR0A 4ZHRA 5DZ6A 4ENOA 1Q8IA 4ELUA 4ECUA 3T9ZA 2QL5B 1LW2B 2YY3A 1FK9B 4IKAA 1CEZA 4DV1F 2J5AA 4OYIA 4BCAA 4DI6A 3CUNA 1JLGB 3DRSA 4NWJA 2UXCF 1EI6A 4G1QB 2H4YB 3CDWA 1RP5A 2DR8A 2UUBF 5GOVA 4YHHF 1RWNB 4M5DB 2IY5B 4DV4F 4IG3A 1YG0A 4B3RF 4FS1A 2DNOA 2IVYA 1XJWB 1RT7B 2GQ2A 4HHHA 3R7NB 1WTBA 3DHWC 3D5MA 5D4OA 1NDPA 2RS2A 1WI6A 4OJGA 2N7CA 1Z4UA 3OR2A 4PEOA 1JXLA 5DG9A 3N5BA 3ENQA 1RQ0A 1S1TA 1JLEB 3DLBA 3CD0A 3TA0A 1HMVB 5K5MA 3UI3A 2LU2A 2E5JA 1YWXA 4F7VA 4ZVQB 4IYQA 2DNRA 1AROP 3TAMA 3VZHA 2MZRA 1BE4A 1G6BA 1JLFB 1KVKA 3FCVA 1KHJA 1FKPA 2J9DA 1HNWF 2W2OP 2RVJA 3MM9A 3SQGB 3MDFA 1CG2A 2ZKUA 1SC6A 3ISZA 1QVGR 4CLUA 4I0WA 1XMOJ 4B08A 1T9WA 3G6ES 3T19A 5EHHA 1SI9A 3QPIA 3TO8A 1RAOA 1VOMA 2J7UA 3LO3A 1SJ3P 4R8UB 2R7SA 1EETB 4ZCLA 5J1PA 1T9VA 2FHOB 4RU2A 1U0HB 5A6PA 1TTHB 2CWXA 4EI2A 5LMNJ 3MD1A 1SHNA 1RWPB 1FRXA 1CULB 3VAFA 3LP2A 3DC2A 2NXCA 4PWWA 2BEFA 3HK2A 2QE5A 3GIMA 2JC0A 4I2PA 1JJCB 3BGOP 2GHPA 2YNHA 2PEHA 4WWSA 2HNZB 1CC7A 3CJQA 4YR2A 2L41A 5HBMA 1RBOB 5AXNA 5HMWA 4ZPVR 1LK7A 3RBXA 4P75A 1FNMA 1WC5A 4USTA 2E7XA 1FWKA 1NK9A 4NLOA 3PZPA 2JEFA 2VV5A 1ZTTA 2WK4A 4YMEA 3M2UB 3HT3A 2HVHA 2WB4A 2Y3YA 3P96A 2HQIA 4PXCA 2HHUA 4DSEA 4AD6A 1U6BA 1RADB 4L74A 1AJCA 2V9WA 1HBMB 4QYRA 5HJXA 2P2CB 2RQMA 1IR1A 1S6UA 2W01A 2GSNA 4KJDA 1SJFA 2MYFA 5IFMA 2KG0A 2OAUA 3K89A 3QLHB 2I5JB 3EVMA 4NX9A 3QJJA 2MPUA 3PNIA 2Y0BB 1KVJA 3K8VA 4OX9J 2NR0A 2F40A 2CPIA 4KGVB 4GO7X 1JNRB 4CYRA 3Q2SC 3CGIA 5T7LB 5ETRA 4OI0A 1T3NA 1CPZA 5C2GA 2VPXB 2HK3A 3QSYB 4TU8A 1IR0A 1MW7A 4DXLA 2BACA 2W7PA 2KI2A 5C5JA 2PMWA 3M30A 1NK7A 5DLVA 2DTJA 3SI8A 5EDWA 4OHYA 1H7WA 2QA4G 1NXIA 4L76A 1FCAA 3GV8B 3RRKA 2IMWP 2IPOB 3GB0A 2BQUA 3UW1A 5BYSA 3W60A 2E7WA 3HHEA 3G86A 2ASDA 2Y1JA 1UWBB 1OSDA 1H6KX 1U7LA 2GX8A 2O1PA 4RKUC 1RGVA 4ED2A 1M5KC 2K3IA 2WTFA 1FWPA 3EDRB 3MCNA 1TELA 2M52A 4N5SA 2M7SA 3V6DB 3OHAA 3HVTB 1HWIA 4J9NA 4BDPA 4OX8A 4ZA1A 1RT1A 2CQCA 3DLEA 3F0NA 1Q4RA 3OV7A 1DRZA 5KFRA 3SYZA 2C2OB 4ICLB 1NDKA 2OI2A 1O99A 2OO4A 1RBLA 1VC0A 4CTAB 2YNFA 2ZZTA 1PO6A 2G4BA 3H8YA 3EGVA 2ZWPA 1IVZA 3DPCA 2JNJA 2BE7D 3FEXB 4FYWB 1VRQC 1G4CA 4AL5A 4YQWA 2GVZA 4Z37A 3WBHA 3T41A 4UQGA 1FKOA 3Q8RB 1FWLA 2RDDA 5JUMA 3H2LA 5KXAA 1BMQB 1DTQB 2W5XA 2V8DA 1ZM4A 2OELA 1FJCA 4P10A 1KBRA 4DR5F 3NXZA 1JB0C 1Y5LB 1HYSB 2WVCA 3IA0A 3W9IA 2F9DA 2M8DB 2BV3A 4OQJA 3A3OB 1X4EA 4ZPWR 2LDIA 2F4FA 2D9PA 1QE1A 2XG8A 4NA3A 3W2WA 2V2QA 5HATA 2HHVA 2GIRA 4O23A 3MWBA 2CVEA 1RABB 5AXLA 3D1OA 4UPHA 4GTZA 1SHQA 2B9YA 1HQEB 2ADCA 4GRSA 1M90T 4KR0B 3QJPA 4H4MA 1PIEA 4R0JA 4KT0C 5AE2A 4G1PA 1HBOB 5L0BA 4PPZA 2RS8A 1RHUB 1X5OA 5EX0A 1JJ4A 4GTXA 3UE2A 3QRPA 3DLGB 1U8WA 4WP9A 4PR6A 3W64A 4LF8F 5FD1A 4J9OA 4DV7J 1G7CB 5H9FK 2G2OA 1U6ZA 4LSLA 1K47A 2G13A 3AT1B 4OZNA 4ZN1A 3NL0A 4A46A 1NK6A 3RAXA 3MEGB 4PG5A 1RT2B 1WNEA 1T0TV 2I8EA 2Q43A 4C8LA 4H54A 2WHOA 1VQYA 2RH3A 4F0MA 2F4VF 1FERA 5C25B 2AX0A 2C3MA 1N0VC 3V2UC 1KRPA 2LECA 4I56A 1WG5A 4ZK7M 5LOQA 3HCXA 4ZP6A 1S72S 2O3DA 3X1LB 1N4LA 1X9SA 4G1IA 1HWUA 2R7VA 1ZA2B 2VL1A 3QT6A 2CDRB 1IQZA 5HQ8A 3FQKA 2UVVA 4ID8A 1YLXA 5HMZA 1S6QA 2MXYA 4KAIA 2CQ0A 3D68A 3TZZA 1FRJA 2FHJD 3SV4A 3KUHA 4DLGA 1VBYA 1DURA 1BGXT 3EM1A 1EW2A 3TX8A 1UMJA 2W5QA 3C66A 2VPYB 2DGOA 3OBIA 5A0YA 2WZ1A 2W9CA 4C8OA 3I82A 1XMQJ 4EU0A 1ZA1B 4DV5J 1F5AA 2KYZA 2FZGB 4URGA 1SH2A 4NLPA 4TYBA 1LWFB 3F73A 4NXMJ 1X0PA 5FJ4A 4C3KA 2JC1A 1NJZA 4NPOA 1H2TZ 3DDKA 2IJRA 1S9FA 2HIQA 4HTJA 2XBPA 3H2UB 4ED4A 3T1HF 1MROB 4NMLA 4CRJA 4OX7A 4RR5A 2FVCA 3DOLA 2MSTA 4CNZA 3ED4A 1IUJA 1HI0P 5L1KA 4H4KC 1PC5A 1K0TA 2CQBA 2XSJB 3ZFVA 3VWSA 1VIOA 2KYXA 1T05A 4PXEA 3S1TA 3UN3A 1NHKL 2E5LJ 3EZUA 1RT5A 3HJVA 3MTKA 4ER8A 2RQCA 1IKYB 4WP3A 1T8EA 1SV5A 5I3QA 2AYGA 3DOMB 5KFMA 3VGSA 3W65A 2MEWA 1CBKA 1V9OA 1SUQB 4KPCA 3I5BA 2QV6A 1TAUA 4CM0A 2OJ3A 4ZPAA 3LA0A 1Y3KA 2WW4A 5IC6B 4DR2F 1NDCA 2PDAA 4NYZA 2AZ3A 3GE9A 5ETQA 2DRAA 4ALZA 2Z2MA 2KDOA 4FYVB 3OJSA 4RNNA 3SDEB 2XS5A 2EFGA 2AEJA 3OL9A 3K5MA 4JV2A 2DGWA 3HJFA 2C28A 1AUDA 3LANA 1EZZB 4DV6J 4ED3A 5CCLA 1X4DA 5ETNA 3C6TA 3OUYB 3J7ZT 4HLBA 4QWEA 4CLPA 3D54A 2CYYA 3KMQA 1EKSA 2CJAA 1N2KA 1S49A 1WEXA 4LR7A 4QQBA 2F9JA 4QIEA 2BJ8A 4NXNJ 4ED8A 2F5GA 4WXWA 4NCAA 1RTHA 3GJTB 2XB2D 5DGAA 2XS2A 3HHLB 1Q0NA 2CZVC 1V5VA 4RW6B 4ED0A 1PC4A 5C24B 4CXUA 2M8HA 3HD1A 4ZVEA 1WHXA 4RW4B 4QZVB 1MWZA 1HWJA 1D9FA 2X3DA 2BJ3A 1S0NA 1HHSA 4V1Ak 3DXBA 1JQGA 1UETA 2HQGA 5U47A 3KK1B 2DGTA 1REVA 4OI3A 1TK0A 2EBEA 1RWMB 3MPDA 4DUYJ 1DBDA 3E51A 3MHYA 3NY0A 3RR8A 3MMBB 5HJYA 1KH5A 4ZPTR 2Z58B 1ZETA 2VPWB 2GZOA 4B3SF 1E2SP 3T6JA 1TL3B 5F41A 3M9OB 2OTJS 1YZ7A 3BDGA 2QC3A 4NZ6A 4X84A 2F65A 2HFUA 2YH0A 1NZ8A 1TKZB 1L5UA 1VQ6S 3AD8C 4MAKA 2QEXS 4FXDA 5J2MA 1Y5IB 3N4WA 3IBWA 4WU2A 1T9XA 5J2NA 3T5KA 3QFWA 2HS0A 2HHHF 3WX4A 4I67A 4PQAA 2YQ1A 3H2VE 2JEGA 5DLWA 2NXNA 3DN9A 4D3GA 3IS9A 4Y3CA 1NK8A 4XDCA 5A8RB 3ISNC 2HS4A 2HMIB 4P2XA 4USVA 1PILA 1AB8A 1VQ9S 2OPPA 3ZTQA 3PW5A 3DI6A 1XNQF 4CLLA 1URNA 3OR1A 3JSMB 3KNAA 2JL9A 3BH6B 4MH8A 3LUYA 2RSQA 4FF2A 1N32J 2BE9B 1QSLA 3D6TB 4I6AA 3TA1A 2CNOB 4Y0FA 2R7RA 4KAYA 1HI1A 2DVIA 3BBCA 1NRKA 1F6TA 2VH7A 3MEKA 1SH0A 3R7SB 1RAHB 3D3BJ 5HMXA 3U1MA 1U49A 2I0XA 4QPXA 3WZ0A 3G8SA 2GIQA 5KFJA 4KE5A 2U2FA 1BWEA 1LW2A 3K5OA 4AQYF 5DM7Q 1ZZFA 4RNOA 1FK9A 2IIHA 5E41A 2V4JB 3CCES 4PABA 2IVFB 2VQRA 1JLGA 5ETSA 4G1QA 1F3FA 4OJ3A 3OJUA 1U26A 2W4DA 3H40A 2R8IA 5BYQA 5E3CA 4TU9A 3OSNA 4ZVOB 5K20B 3GU0A 1EJ7L 4NA1A 1RBAA 2VQFF 2CNKB 2EC2A 3OT9A 1ELZA 4KV8B 4M5NA 4KFBB 5L1JA 4CQ1A 3NMAA 4F3QA 1GMUA 2KT3A 1LNQA 1HMVA 1BUXA 3X3UA 4PQUA 4O3PA 2GA3A 2ROGA 2D74B 3L4BC 1RHRB 2R2TA 2A10A 3DRYA 3I5AA 2HGMA 1VK8A 3I32A 4C3LA 1JLFA 2ADBA 1UVMA 1RE1B 1QJHA 1RU1A 3RZAA 2JLEA 1Q86T 2Z2ZA 4HHJA 4P6QA 3SEOA 3M9MB 2MKSA 3SQGA 3VQTA 4IQXA 2AT1B 3R3TA 4OZ0A 4DPTA 4E0DA 4ZLJA 2LXFA 1H3DA 2LEBA 2DHXA 4AQYJ 3NS7B 3KLGB 2HQ3A 1RT3B 3NCQA 3BDHA 4IUFA 1Y11A 1P8GA 4UPIA 1AFJA 1EETA 2IM3A 3DXSX 2QG9B 4ILMA 4G3IA 5E3QA 1N34F 2YNIA 5HAOA 2FHKA 1XMBA 3LALA 1HA1A 3FKBA 1YRUA 1FRKA 3AFGA 4EMDA 2W8KA 3P6YC 1HPZB 1CULA 2CAJA 2K1RA 3KLEB 2LKZA 1RYSA 2IHR1 5LSOA 2HNZA 4LF6F 1K9MT 1TL4A 2NS1B 4HH0A 4MKVA 1ELYA 2A2DA 4LF9J 1V3ZA 3CJTA 3Q0AA 5D0GA 5J1EA 2GCFA 4DFMA 3GLJA 3PR4A 3O2IA 4ES3A 2JEJA 3HT0A 3OHBA 2JSXA 1F2HA 1F9EB 4DR7J 3SSQA 3W66A 3CMRA 1T3OA 5I4MA 3QYYA 4DUZF 4UW2A 5IXUA 1HBMA 7AT1B 1VQKS 3MMAB 5AE3A 1IKWA 5L1LA 5LMUF 3H90A 5B0CA 2JX2A 3QLHA 2I5JA 2VIHA 2FC9A 3IWNC 1HBNB 4ELTA 1YRXA 2DR6A 3K7RA 4LF4F 1TUGB 2YXLA 1WTFA 4Q0BB 1KQGB 4NCBA 4KO0A 2E1CA 2RRAA 5T7LA 3W1YC 4U67Q 1JLAB 4OI6A 2HHXA 2VG5B 2BJDA 4K4YA 4WFZA 4J5OA 2AJFE 1N36J 3Q83A 4WTYA 2ZEJA 1UEVA 3KK3B 3R5GA 1FKAF 2VDHA 5H9EJ 3CPWR 1J5EF 2VQEF 3SV3A 3CJ0A 3EMTA 2W2MP 4CDIA 1KOOA 4W98A 4Z7CA 2POKA 3GV5B 1ZAWA 3Q8QB 4QPTA 1LKZA 3J7Z5 2M88A 4WYWA 3ET6B 2VHGA 2AIRB 5FDLB 1IKVB 1RWVB 2X1AA 3IAM9 3KJFB 3CC4S 3PY8A 1N5SA 3NBPB 2VG7A 1XIQA 1RYRA 4J7CA 3WC2A 2ROEA 4OYAA 4MIWA 3LAKA 1QLNA 2A1BA 2IC3B 3NCPA 2J0SD 1U4BA 4F0KA 1HLWA 4DR6F 3HVTA 1HFEL 1ZEDA 4F2SA 3EYZA 1FRHA 1X5PA 4HT7A 1N48A 2Q6CA 3VVUA 3KLIB 4MK8A 4ICLA 2FGOA 2C2MB 5DM6Q 1X60A 2AW0A 2MLYA 4DN9A 2IAJB 2M5YA 1U6FA 1RAIB 5D6GA 3UFCX 4CTAA 3BQ1A 3MAAB 4B3TJ 1TL1A 1UA1A 1XQIA 1RTDB 2AHOB 2YWKA 2N3LA 1QSYA 2JZ5A 4LFAJ 2BZ2A 3MR3A 4ZCIA 4QWDA 2J7WA 2CQPA 5EWEA 2KT5A 3I0RA 2DGUA 3KUEA 4OL8A 1RXOB 5ETKA 2ZJQQ 3Q3QA 2X1BA 2HNDB 4JI5F 1HYSA 2Q79A 2QZUA 2LA6A 2HNYB 2HZVA 3UWTA 4MYUA 4BBYA 1O51A 1GX6A 4DCJB 4I4BA 2C2ZB 4NLUA 4PCQA 1A7GE 2FY8A 2WSEC 1RWKB 3LPEA 4ELVA 3A4TA 4ZCMA 1GXUA 3OFFA 4NLDA 4JI1F 1XWLA 2KVQE 4CH0S 2Z2LA 2Z0GA 3OXFA 3DCAA 4DX7A 3ZZZA 1P49A 3CNQP 3DRRB 2DGXA 1ZOTA 5GAHI 3THPA 5LXYA 3D6HB 4UOGA 4F4AA 4NI2A 2XI3A 3L7OA 5K8MA 2J0WA 3E2DA 3A8JA 2MKJA 2HW3A 1U1PA 3PJ9A 5J1NA 3GIJA 1HNXJ 3HSJA 3ZC4A 1H74A 1FO1A 2IFYA 2CJ9A 2CPEA 3CJ2A 5D77A 3K8WA 1X4FA 2ZBIA 2KT2A 2H5IB 1KLNA 4UZBA 1K8AT 3FUYA 4HT5A 3MEGA 4CLKA 4QR0A 1PYOB 4KGZB 3D28A 2RU9A 1PSDA 4ZVFA 2QLWA 5I3UB 2F7VA 2BE2B 4IFVB 3SFGA 1L3UA 4RBTA 1JIHA 4CO5A 4I2QB 3FMBA 3PACA 2QFIA 5AJ3J 2RRNA 1TAQA 5JVHQ 3SCKE 4KHRA 2ZH7A 3A1YG 1WDDA 1QDUB 1T11A 3POTA 4LRCA 1KS2A 1RT4B 2R2RA 2WB1D 2IM2A 2DIUA 2NYIA 2HBRB 1YJWS 2HFNA 1J5OB 1S10A 2YX7A 1DJ0A 4FXWA 2UXDF 3O6QA 3EJMA 3U1LA 3MZIA 1UFLA 1Y4ZB 1OSCA 2ZE2B 2RQKA 1FDAA 2DCLA 2RU3A 3FZBA 4N8OA 2R2SA 3GP9A 2XMWA 1TKXB 4DV0F 4OZJA 3JQKA 1BC6A 1OO0B 2H54B 3MK2A 1VS3A 4ID5B 5B0BA 3VCDA 1C4CA 3OFHA 4YDDB 4P72A 4IFYB 4ZPDA 1BD6A 4PXBA 2HEKA 3M9NB 5KFGA 2IJFA 2IDLA 2XZTB 2ZZMA 3DLLQ 2ZKTA 1U1KA 5L1IA 2VPZB 2VKRA 1S0MA 1H98A 4X66J 2DH7A 2V2ZA 1QUVA 2GW8A 5LT5A 2E5HA 3CC2S 2Z4PA 2V68A 1LEOA 4AL6A 5ETLA 2DHGA 3BM7A 4TNOA 1EW8A 4LF5J 3GJQB 4WPAA 2BUNA 4Q7AA 5KT6A 1K0VA 1PBAA 5ETVA 2R7XA 1KWMA 2XMTA 5BR8J 2HKEA 2EFNA 3A3PB 4FVCA 4O44B 2DJWA 3G71S 1EHWA 3W3SA 2YPZA 1N8RT 1HJKA 3BREA 2DNPA 4KYZA 4GKKJ 3SXLA 1UVKA 3W2VA 3U1NA 2OFHX 2HGLA 3JTOA 2XS7A 3WQPA 3MCMA 4KH0B 3E01B 3D67A 4DV0J 1O0PA 5A8WA 1F3VA 4B9MA 3SDEA 5KFSA 3I55S 3TQEA 2V63A 1S1UA 1M0SA 4FDIA 4RX6A 4OYPA 5F0UA 2KJWA 5CQGA 2VJVA 2XMVA 3D6MB 2KRBA 3CMAS 3LW5C 3OUYA 4HVZA 2OKQA 4XPCA 1ALHA 3ICLA 1C0UB 4MJKA 1P9QC 1HBUA 1GMWA 2MZJA 1OPIA 1HD1A 2ZVIA 3JQMA 2FJEB 3PV8A 4ITSA 2V6AA 1YBTA 3TVKA 1ICEB 2BQRA 2VBXA 2LQ5A 4M5KA 3HHLA 3TA2A 3SCLE 1U1NA 4F26A 1XERA 2GLQA 4KIAA 4QBUA 4RW6A 5C24A 1HHQA 2ANHA 4RW4A 1V5IB 3KLFB 1KQSR 4PKDB 4JI4F 3EGWB 1NKCA 2JFKA 1XTZA 3GTYX 1MN9A 2D7SA 1WHVA 2BKOA 2QFJA 3G6YA 1HWKA 1UFKA 4X62F 4NA2A 2OPSB 3MEEB 1ANJA 5CYQA 4K4ZA 2UUAJ 3DYAA 4UOFA 3W62A 3MMBA 3JYTB 3H5XA 4OLPA 1NPKA 4O3QA 3WHIA 5JJBA 2AP6A 2UUWA 4C3MA 1Q5YA 2IJNA 2C2RA 1DARA 1TL3A 4A8QA 4RUBA 4Q8EA 1VBZA 3NKPA 3PO4A 4OYMA 1T7PA 1R3NA 1N33J 1R89A 2DO4A 1TP7A 3I6PA 1TKZA 4ECZA 4MKYA 2ZFHA 4ZJLA 5KFZA 2LDYA 1BQMA 4F8RA 4WZQA 2YNHB 3I87A 3FK4A 3WX8A 2HBZB 2B7CB 2Q3PA 3PM9A 2VC1A 5H9EK 4F0HA 3I31A 3HFKA 2SXLA 2R4FA 1CQNA 4C8MA 2ATCB 4YR1A 2W4CA 2XMUA 4MIAA 1QAJA 5A8RA 2HMIA 3IBFB 2QMXA 3RBZA 1ZS6A 2RE1A 3ETMA 3JSMA 1AJAA 4X4OA 4USIA 4I64A 4J9KA 2CPJA 3RYLA 3BJYA 4DL0C 1SKWA 4X62J 3D66A 2Z56B 1HARA 3OL7A 1UVNA 5E0OA 1HNIB 4JV0A 3HXMA 3GV7B 3A8IA 1PYTA 4LMZA 2YKAA 3IWXA 3CDAA 5HQMA 3KDNA 1IBLJ 1N5QA 3IAS9 3IDDA 1RTJA 5DDQC 4DU8A 2QMWA 4NCGA 2K06A 1PJ7A 2PE8A 1S0VA 5KFHA 4GTWA 4DCPB 4NEYA 2CXEA 4GC7A 2OPRA 4K4UA 3IR5B 1BQNB 2Z30B 4LRFA 5DQIA 2V4JA 2LEPA 1X5SA 1ZAVA 1EP4B 2DY9A 3GCWP 4JI0J 4DV2F 4C97A 4OHWA 4IH5A 3T3FA 3KUGA 3KTQA 1NJYA 2WVFA 2BBEA 2RAQA 4AYBD 3ZNJ1 1JKHB 4JBCA 2CJKA 3QNWB 2C22A 5F8GA 1RWUA 2V34A 1B3TA 3TEGA 4DR1F 3T1YF 3AQPA 3N6LA 1MU2A 3SFUA 4KFBA 4CLZA 3SBMA 2BRKA 2VG6A 4HR2A 5B0GA 2RF2B 2HLUA 1U09A 2MJNA 3HHKA 4EYHB 3IXQA 3FEYB 2V50A 2H4WB 2B6AB 2N3OA 1HKAA 5GVQA 5DQHA 1U24A 1ZM2A 1SIWB 4OIXA 2RHQB 2VC0A 1UW9A 2H5JB 4EFAC 2Z2YB 4F36A 1RT1B 2HSEB 4JYAF 2LQJA 3M8WA 1XEZA 3M8QB 2MZTA 3H25A 2CZ4A 4PPDA 2DNMA 1PBUA 3QIDA 2ROPA 1RT3A 1RLCL 5A2QY 2L48A 4C8YA 4RUAA 2Q1LA 2CKWA 2XCPA 4C8KA 1WOSA 3N5FA 3B8HA 4B9VA 3T6BA 5B0AA 5C42A 2HHSA 1S6PB 4ZKAA 1TKTA 2DYAA 1XK8A 1NSQA 4FXVA 2ZH3A 5DJBA 3UNGC 1X4AA 1PAUB 3OPKA 2D1CA 1HPZA 2UP1A 2DR9A 1FKOB 3SIPB 3KLEA 4O3SA 1HHTP 3R2DJ 3EXCX 1ANIA 1D9DA 1BQXA 3GIKA 2MSSA 3DGPB 5CABA 4JV5F 4J91A 2MHEA 1KN6A 4B3MJ 1WC3A 1RCOB 4ATNA 2KO1A 4LBIA 2VOPA 3IG1B 5INHA 3DMJA 2XULA 1RAJA 2CZ9A 3G6VA 5D15A 3M8RA 2Y8WA 2YKPA 1WKJA 5L38A 4KSEB 2CUYA 4B9NA 2B0GA 1Y6VA 1ZAXA 5F3TA 4CLFA 3QGIA 1B0PA 2Y9HA 4QU6A 1GNKA 1DFDA 2YWFA 2E7VA 3GQCA 2NREA 1B7YB 2W5SA 2L9NA 5GAEI 3MMAA 1UPMB 1NLKL 2WVBA 3V6KA 2VUGA 2HG4A 4BWMA 3TR5A 2G2ZA 2R7TA 3PW2A 4JI7J 3HVAA 1RDRA 3BSCA 1HBNA 1VGYA 3Q2TC 2ERRA 5EN1A 2EW9A 4U7CA 3GR0A 4OJHA 2ZM6J 3HVRA 4R5PB 4CYSA 3NGRA 1FD8A 1HNZJ 2AKWB 2CA9A 3R5BA 1VC6A 1JLAA 1Y0HA 2ACYA 3MUTP 3VV2B 1N2LA 2B9EA 3KK3A 3M1VA 2EK1A 5DDRC 4JV5J 4CO0A 4ZIWA 3Q22A 2HHWA 4H4KA 4A48A 4QW9A 4ZJQA 1DTTA 3OTBA 4MIVA 6FD1A 3GG1A 4R0EA 2ZDPA 3GFYA 1E6VB 4I6WA 4FF4A 4FBTA 2W25A 5KT3A 2K2PA 4A4JA 2VOOA 1WEYA 5FDLA 4Q43A 3TP2A 4CIOA 4DR4J 1X9WA 1ZPVA 2J9EA 5AJ9A 1M5HA 2P6TA 1VHFA 1BWVA 1U8SA 3IM9A 2V8PA 4IRKA 2IC3A 4NMXA 1S6QB 3M8YA 5C7PA 5EUHA 3CJ8A 2VASA 4DV3J 1JX4A 2KFZA 4X64F 1PAEX 1Y5NB 1ZM9A 3O1LA 5AT1B 3HO1A 4DSJA 2ZBCA 1Y9OA 1O5JA 5CD4A 3TW0A 5A0YB 1KHLA 4WBFA 4I7FA 2XMKA 2QJ3A 4QWCA 2IAJA 1UAWA 4GC6A 4NLSA 1E3CP 3WAYA 3VVTA 3Q24A 1NUEA 2FLPA 1VQSA 4LF1A 5CYJA 3MK1A 4JB8B 3HPOA 1T9YA 1GX5A 1I94F 1S79A 4E98A 1YK9A 2DNLA 1ACMB 1YIJS 3V6JA 3UN2A 1UL3A 4P7VA 4DSFA 4Q2LA 3EGNA 1NHUA 3EPGA 4NYPA 4JI3F 4HACB 1VC5A 3GMGA 2HNDA 4QIFA 2E5IA 2X7IA 2HNYA 4WU3A 2ZJRQ 1T05B 1RT5B 3IO1A 1L3TA 1IBKF 1IBMF 3B78A 4ED6A 2UVUA 2H5EA 3HF5A 3KJNB 2IUCA 1EAYC 1YBUA 1SC3B 3TZYA 1YI2S 3IR7B 1FVSA 1VJWA 4PG7A 2AJ4A 3BO2A 4DR3F 4UPLA 2DXEA 2V2KA 2R2UA 2NPIA 1QTNB 2GAGC 2FYXA 1SKUB 3HZEA 2AWZA 1B8JA 1RKIA 3A52A 2QZ8A 2I6WA 3L9ZA 2XY6A 2GHWA 3M2VB 3C6UB 1V6HA 3DLKA 1FEEA 4YDXA 4ZVUB 4M5GA 4ZDNA 2VONA 5CXTA 5GAGI 3W8PA 5D0EA 2CFXA 3LGNA 4EZ6A 4YB5A 1WC1A 4AFFA 3IGYB 2CNLB 4RNHA 3UPFA 4EBEA 5HO4A 4CT9A 2B8QA 1R0AB 1NU4A 1HQUB 3ILLA 4I2QA 1YDLA 1JNZB 4CXKA 5DLGA 3KHLA 3ZZOA 2B4PA 3RB4A 2J0XA 1RT4A 1UA0A 3D7SB 5KG1A 4A8FA 2R7UA 2DGVA 2Y1IA 1HQAA 1TUVA 5DG7A 1FFWB 3PFEA 3BDEA 1JXEA 3KFWX 5A2QU 3BN7A 2LP4A 2QGFB 2FJVA 3EZOA 4KAVA 1RK8A 1M5VC 3CCRS 2UU9F 3NWRA 4LSNB 2XCAA 2LQ8A 1QM9A 3JXOA 4MIBA 2BOPA 3OTOF 3QO9B 1HR0J 3PJWA 3UN5A 4Q2MA 5G4DA 1T95A 4YEAA 1TKXA 5J2PB 4ZP8A 4FKXA 3PKYA 2AX1A 3N28A 3KK2A 1ROFA 3CDBA 4IFYA 3WAXA 5DDOC 2IDEA 7FDRA 2EFVA 3Q8PB 3CVKA 1RA6A 4OJ1A 2DGSA 5IQQA 1TL7A 4G6VB 4LFCJ 4M5LA 3PYDA 5A76A 2KXNB 3WAVA 3OFEA 2E5GA 3HSZA 1YSJA 2DH9A 2DISA 5ADZA 4O4GB 4F50A 3TUPA 5HVGA 3M4XA 3P8BB 4IH7A 3ONQA 1KEKA 4PG8A 2ZUGA 4ILLA 4YR3A 4DDFA 3ZXWA 3MGJA 4X4PA 2HBYB 1EW9A 2BM0A 2FJWA 4O44A 3VGVA 2JRSA 2AJ1A 4M94A 3BSAA 2FHJA 4QOTA 3BO3A 2MQMA 4P73A 2AYMA 4MY4A 3A8EA 1QY7A 1RHQB 4EO6A 3KMSA 1Y3JA 3M7VA 1RHJB 2VFVA 2V94A 1SVDA 4V19X 1XR5A 4BHQA 1PG5B 3ZZTA 1XMOF 4Q44A 2VICA 5LXRA 1JLBB 2DEIA 1ALKA 3HFZB 3UDEA 1UW4A 1BY9A 1MNEA 2V4QA 3SMZA 3OQ2A 2L9DA 5GRRA 3HVWA 3KNGA 1YJVA 3NKYA 2WVDA 4NASA 1S4FA 3GFXA 1C0UA 4K2JA 3GCXP 5LMNF 5KG6A 5DLTA 4LVNP 3M6VA 3CD6S 4ZG9A 4F25A 4M63A 4WXOA 1R6VA 2HQCA 4A8YA 4N56A 2GA7A 1VQLS 2RHSB 1I5OB 5BYRA 2ABYA 7FD1A 3NOCA 5IS2A 3J81j 2ZJPQ 4PQUB 4YB6A 4XIUA 3R97A 1XR6A 3KLFA 1F9HA 4BLGA 2HVIA 1FFGB 3HHNB 3RBDA 2KM8B 3IRXB 5ETOA 3HHDA 3M8PB 5DO2A 4OYXA 1YVFA 2AGQA 3IP0A 2Y1LB 1RISA 1Q81T 4UY85 4IOAQ 2HWHA 3TVZA 2GAHC 2RT3A 4EZ9A 3W61A 2EFQA 4FF3A 1NPPA 2HIYA 1CJUB 2OPSA 3MEEA 2MKYA 4EGLA 5ETMA 4DL2A 1Y7AA 1WC6A 4K8RA 5EGHA 3FBFA 3CT9A 3M2RB 3JYTA 3AXMA 5HANA 2NQPA 2DB1A 4CWBA 1T9UA 3R9LA 2YNIB 2OIHA 4OX9F 3ZZRA 2DNKA 2MKIA 4F3OA 5TJ3A 2EKYA 2R7OA 3TUJC 1VLOA 5IT4A 4IQMA 1URRA 4TY8B 3QFHA 2AYBA 2K1RB 5KFXA 2VB6A 3PRVA 3CO0P 3B4MA 4HKQA 1ZEBA 1NCLA 5K9FA 5GMKa 3QT5A 4C7QA 2IM0A 1AYEA 2JLFA 2CADA 4DS4A 2ZUAA 3DM2B 5J1EB 3OXLA 1D8ZA 4U7UD 4U8VA 2C1EB 2GGPB 5CZXA 1ZH5A 2XC9A 3D9BA 4J9LA 2DXDA 3FBBA 5LSRA 5FLXY 3RAQA 3WIVA 3C16B 5EWGA 3ZTRA 3RR7A 2HHQA 3BQ2A 1RZMA 2OEKA 1FRIA 3BPSP 5F0WA 2VFRA 3BN4A 2OPQA 4KRWA 3RB3A 3KG4A 1HNIA 2GMLA 1P27B 1NSKL 1IKWB 1ELXA 4KQZA 1OQ3A 2KHDA 2IYGA 1M1HA 1EKRA 1JMTA 2MGZB 4TN0A 1LK5A 2V69A 3AD7C 1ALIA 3MCOA 5GAHU 1BQNA 2W24A 3FNNA 4KO0B 4KB7A 1URBA 2YX4A 5F8NA 4F04B 1TFYA 1EP4A 4E8UA 2KZMA 3F44A 4N76A 3BSNA 1IWAA 1NK4A 4JI8J 4LF2A 1W2IA 2XNRA 4RW7B 1F2GA 1JKHA 1MWQA 3W5ZA 2HWTA 4A8XA 2MY7A 5M2UA 1FNOA 2V9KA 3MEDA 5THWA 1KC8T 1FXDA 3TJ9A 4ZP7A 2HFZA 2P8IA 2IRUA 1RWXB 2LEAA 2RF2A 3QRRA 1SJ4P 2RIJA 4Y28C 2WAQD 2C2EA 3FEZA 2VG7B 2B6AA 4AT1B 4M5JA 3NOGA 1ZM3A 4JOUA 2FD2A 2GHVC 5A8KB 4ZMMA 1NJWA 4DZDA 2HFVA 3J7A1 4DN0A 3G9CA 4IR1A 3FBEA 2B4OA 4RLEA 5K14A 2L9WA 2XYPB 1V3RA 2YX1A 2PO4A 3M8QA 4KPYA 1VQPS 4OZ5A 1L3VA 3UD4P 3NEKA 2C2DA 5KT4A 2OH2A 1K73T 4B9TA 2W7AA 2ZOMA 4X4NA 2NZ4A 1TL1B 3SSSA 2E9ZA 1WORA 4K59A 1S6PA 3KLVA 4WFNQ 1KKHA 2I1RA 3CWJA 1FXRA 3G4SS 3D4JA 3R27A 1I51B 4N77A 4E2FB 1R8CA 4DV7F 2J8AA 3VHQA 3SZZA 3I0RB 4J37A 3TEHB 2X98A 4CO3A 4B3OB 1FTCA 4C0BA 2WSCC 4OZ3A 3DGPA 2J7KA 2CQ3A 2QLFB 5F9LA 4OI1A 2J6TA 1FE4A 4NZ7A 3IG1A 5LRMA 1KQFB 4CNYA 2QRRA 2WONB 3H20A 3ISND 4J9RA 3ZTSA 1VRTB 5K4PA 4ZVHA 1PKUA 1TZ0A 3BB5A 3V81B 1UEKA 3RB6A 1SQEA 2VD3A 4Y2KA 2RKIA 4U8YA 4X4UA 4HI1A 4ED7A 3RRGA 5KFOA 2QMUB 3TYTA 5C2CA 1EQJA 4NI2B 5B0EA 3CB4A 2GQQA 3TQ1A 5KG4A 4XK8C 4DCOB 3MR5A 1MG7A 2KXHA 2Q6BA 2JLGA 1RT6A 4R5PA 4UTGA 3MURP 2KN4A 1X8DA 3AA8A 4L3NA 5E2QA 1XMQF 4USJC 4DV5F 4UZCA 2WOMB 2LA4A 1R43A 2YKMA 4QCLA 1SIZA 4NXMF 3OXGA 1NAQA 2QLXA 1WELA 1F1BB 2CPYA 2XSFA 3DRPA 2XYHB 1ZYQA 5ETTA 2LU1A 2NUHA 1E6VA 2M70A 3KHHA 3POTB 3RBEA 2LMIA 3KYLA 4DZ6A 1M5OC 3OTDA 1P1LA 3G96A 4CO1A 4DQPA 1R27B 2E5LF 2HQDA 4ZPBA 2NSCA 2AZ1A 5IV3A 3NGTA 2XLKA 3VF0B 2J9DE 3C15A 4XDDA 2LYVA 3MM5B 4OMFG 1RWWB 4WP8A 4M1KA 2OGUA 1J2VA 2R3VA 5AXMA 2PN6A 4JI2J 3VALA 1EJJA 4PG4A 2FVRA 4ED5A 3IGVA 1B0VA 3RW6A 1FSUA 3ZZPA 3PR5B 1UVLA 1FJGJ 3V4MA 5IM0A 4DV6F 2E29A 2OHDA 4C48A 4YY3J 3IRWP 2YVSA 2W2QP 3BBBA 4Y34A 3IFEA 1EQMA 2DIVA 3GWCA 5FLXU 3NNAA 5DZ7A 2OD6A 1SJQA 5DG8A 1SL1A 9RUBA 4MHXA 3JSBA 3PX0A 5F8LA 4NXNF 5B7WA 4HACA 3GJRB 4RL1A 1NEEA 5L46A 4DHVA 1WOOA 4UT4A 3J7AN 1M1GA 4B9SA 3N01A 2QYGA 1WF1A 4MKAA 2V2VA 1KQKA 1S7IA 2DNZA 3GZ7A 4YR0A 3B5QA 4X4SA 4NLTA 4USWA 1KH4A 1K1SA 2VBZA 1F9FA 3ZZYA 3H98A 2EKNA 3GYNA 3Q8SB 3W2VB 3VTIA 5CAAA 1LWEB 4JP8A 4XPEA 2XHWA 2V4RA 2NCKL 5A8WB 5DGBA 4YB7A 1R31A 2QYCA 4DX5A 2HYIB 2R8JA 4DUYF 4WIIA 1U2CA 1S1UB 2CJQA 1G1XA 1S1VB 1UWAA 4GKJJ 2OMLA 1SH3A 3JSYA 1X5TA 3M2VA 3C6UA 2H51B 4X65J 1NZAA 4M5MA 2KH9A 5EWFA 2CQHA 4CLSA 2LXUA 1CJKA 4CO2A 4RNMA 4FBUA 3ZNUA 2W1BA 1HBUB 3QGGA 3NS6A 5G0RA 2I9SA 2VF3A 5DRKA 5DDPC 2YWHA 3ILIA 5IWAF 3SQOP 1S9EB 3BR9A 3OL8A 4G65A 5E5NA 1R0AA 2YKQA 2B56A 1HQUA 3K5NA 2K7JA 1U1LA 4NLWA 1VR6A 3OW2R 2A6MA 4R25A 3V6HA 1WWHA 1UZDA 1N5TA 2HGNA 4USMA 4Y2MA 1Q8KA 1KHWA 3UNYA 2UUCJ 2AQ4A 3CJSA 1OPZA 1YJTA 2VBYA 2ZD1B 2GFFA 1RLDA 3S8SA 4LF7J 2PMZD 1N32F 2BJ7A 3MM8A 3P45B 3AAWB 2H3EB 4DL4A 4LSNA 5CYQB 3G6XA 4DL5A 3N0VA 4U95A 1FDDA 1IKXA 3J7YI 2ILYA 2KZZA 4OV6A 3DYAB 3QO9A 3RGIA 4YUDA 4B02A 2FUG9 2DR7A 3NG8A 2HURA 2BJ1A 3K2YA 4YS2A 2FZKB 3JQJA 3CW2C 5J2PA 1SQGA 2LQ9A 1ZBTA 1AFIA 4TKTA 2QL9B 1C1CA 1HW9A 5EGEA 4LUBA 2K8GA 4X4VA 3H5UA 1YJUA 3MPWA 1H2UX 3MR6A 2XO7A 4S0MA 5IWAJ 3MOJB 4ANEA 3MI7X 2HRYA 3LWMA 4BS2A 1Q78A 1BQMB 4WJBA 3C14A 3ITHA 1HQ2A 1VQ7S 4NLQA 3QGPA 1SKSA 4O4GA 4ZVSB 1FF2A 2OD4A 2QT7A 2WSFC 3T5HA 1FX2A 2GNKA 1WHYA 4UOOA 2D69A 3BQ0A 4QIGA 4IR9A 4HTIA 1E6YB 2DH8A 2LVWA 3VAJA 2UV8G 1RB0A 2BM1A 2W5RA 2HLTA 4O0IA 2KTQA 1C1BB 2CIMA 2ZNYA 1WF2A 3L7PA 2X1GA 3H5SA 4EBCA 1RTJB 5L39A 3AOCA 3FGVA 4FYYB 2U1AA 5CCMA 5KFAA 1TQLA 1TR0A 3I56S 4NCGB 2PA3A 5GAEU 3AOBA 5D0HA 2OPRB 1JLBA 4NLVA 4H4OA 3VGTA 3OFGA 1VRUA 4Q8FA 2AEFA 1G3OA 1YJ9S 1F60B 1S7HA 3DHXA 3CCSS 2WRMA 5B09A 2DPJA 1GXTA 2COLA 3FRZA 3MFHA 3T02A 1DY3A 3SZ2A 3FSYA 1IXKA 4QAXA 3HULA 2G0IA 2HVEA 2C3PA 4NLGA 4LFBF 3D6FB 1GTEA 1DZ5A 3CEDA 3UCUP 5EGYA 3KLHB 1MU2B 2R8KA 1ZZNA 4F2RA 2VG6B 1S12A 3MK0A 4HL9A 4RBVA 4RUCA 3GIIA 1KFDA 5SZTA 4LF9F 3H4DA 4IRCA 2AF6A 4TQSA 3IRXA 3HZGA 1Q8BA 2GC8A 3M8PA 2KL8A 2OEJA 4DFJA 5BJRA 4DR7F 2M3DA 2GJ2A 3PIOQ 2GIFA 2UVWA 3RW7A 1K7HA 1CJUA 1VYAA 4FN5A 2BX6A 3PX6A 3PXGa 4KM4A 2MZ1A 2P9CA 1JWWA 1V3SA 2ZNZA 4ANDA 3IN5A 4AE5A 3M2RA 2NLWA 4F67A 1PCAA 4ECTA 5C42B 4F4KA 2VFSA 3I5CA 1H73A 1TKTB 2VKZG 4LR8A 3DYCA 1UTAA 1JXVA 5D0RA 1N5YB 4MK9A 4LFBJ 3KG1A 1SCJB 2HZCA 4TY8A 4QR1A 2N4CA 2MLZA 3D1HA 2FZCB 1N36F 4J9PA 1KD1T 5KTQA 2RRBA 4OYZA 3K5LA 4WCEQ 3GONA 3KJVA 1CSJA 1NDLA 1FDNA 1AT1B 2VA3A 2FHMA 1WKLA 4MT1A 4RZRA 3DM2A 3DMJB 5JXSA 4FNIA 2FIUA 1B0TA 2FGCA 2RH6A 2GGPA 5LM7E 1SQFA 2AV5A 3C16A 4DV1J 3GFHA 3VGUA 2MLXA 4MFBA 3AB2B 1HI8A 2IA6A 1TVRB 2UXCJ 3AOAA 3NWGA 2UUBJ 4YHHJ 4KJGA 1M5SA 4UOPA 3S7RA 4DV4J 4XTTA 4DL3A 4WFAQ 2HBQB 4B3RJ 2XO6A 1S48A 4CYUB 5LL6d 3NMRA 1WACA 2MGZA 2BDPA 3D3CJ 4RWXA 3BGRA 4K4SA 2PFDA 3UO0A 1PJ5A 4K5RA 1F5CA 1AUSL 1S97A 1EQ0A 5LIAA 4O4RA 5LQQA 5IT9Y 3P3DA 1EARA 3HHLC 4B3TF 3HSDA 4J9UE 3WBZA 2RJZA 1KOHA 3UR3C 1FVQA 3BF4A 3BZQA 5LRNA 3M1VB 2BXJA 5GAGU 1HNWJ 4RW7A 3Q8UA 2VBWA 2QA2A 1NMEB 5GMDA 4MKBA 4NYOA 4LFAF 3K59A 2ZC3A 3HP6A 2BANA 4PWUA 1S1WA 1DTTB 3PO5A 2KVIA 2PSZA 1OWXA 1W26A 4TLQA 1NSAA 2JH3A 4Y65A 5D3GA 3WC0A 4HI2A 3R1HA 4PYDA 1Q1KA 2MQNA 3QT8A 4UPKA 1S0OA 1CC8A 4DL6A 5HI7A 4ERDA 2BRLA 3CD7A 3OD2A 2W7OA 5CZVA 2MHNA 4WFXA 1EB0A 4PYAA 1VCTA 3CIMA 1TMJA 3W9HA 1T02A 3CF5Q 8RUCA 5A8KA 4QYZJ 4LBHA 4OZLA 2R7WA 3J81Y 3KHGA 2P9GA 4IG0B 4DQQA 2BABA 3AHPA 1RHKB 1C2PA 3K57A 2F63A 3MR7A 1K44A 2B5JA 2BW7A 2RB7A 4I7FB 5KG0A 1NK5A 4ZLLA 1KH9A 2XLIA 3VAGA 1I6JA 5KFIA 4RJVA 1D09B 3TAQA 2KHCA 4U96A 2IBOA 2NUUG 1TU0B 2PD1A 3ELHA 2D9OA 4U6PA 1HNXF 2R8HA 3TAPA 4DU7A 2EG2A 3PX4A 2EK6A 2PFFB 4WE1A 3HM9A 4DQIA 4KBIA 4ES2A 3RB0A 3TG0A 4ZJOA 2VU5A 1TK8A 3BYRA 4DUTA 4B3OA 4TY9A 2GV1A 3MPVA 1VQ4S 2R42A 2N7YA 1E33P 4LIWA 4LIRA 2ZBQA 3TZXA 3GSIA 3MTJA 2YNGB 1X4HA 2IMOA 3BKTA 2WONA 5AJ3F 1R7IA 1VRTA 1WC0A 2V5HG 3E8OA 4TN2A 4K7QA 2A6OA 3US5A 3KD8A 4ES1A 2IUCB 2G2YA 5L9NA 3V81A 1R0BG 4PWDB 3P5BP 3CE8A 3M32A 2J6SA 1GK8A 2DHAA 1NK0A 1OY9A 4QW8A 2NXJA 4DEZA 3R6LB 2ALZA 2HHPA 2IM1A 1NH8A 1YHQS 4Y2IA 2QSWA 2UXBF 1HD0A 1OY6A 3MMCA 4U9RA 3MOZA 3DLKB 2OMOA 3CMQA 3IGZB 3LP0A 4L72B 2HFSA 3NKRA 3IBCB 2WOMA 3H59A 4OFZA 5RUBA 2GO9A 3FSXA 1NNDA 3QQCD 5IC4B 5IJSA 1GEHA 1DLOA 1PYSB 3M8ZA 2JOQA 3J80Y 2K7KA 1L3KA 3BKFA 2F8HA 4ZOSA 1U02A 4Q5VA 5KAKA 3WAWA 4LR9A 3MAQA 3NGKA 2Q66A 5KFLA 4RW9B 5F9NA 4P52A 2H9ZA 4X66F 4FS2A 2WBMA 4M95A 1RTZA 1VQMS 1WUUA 1CVJA 3QWUA 1GH8A 2DNGA 2AU0A 4LF5F 3I9ZA 3UD3P 1JK9B 4ILRA 1NSPA 2LQBA 5IZHA 3B82A 5BR8F 5KG5A 3DOKA 3TUZC 2MQ8A 1ULRA 2B9XA 2XM3A 4A8OA 3MM5A 2OFGX 4B56A 1SJ1A 4GO5X 3S01A 2UXBJ 1LW0A 3P5TL 3UDVA 4GKKF 5A6WA 3MF5A 3R2CJ 4IO1A 2LXIA 4DR5J 1LXJA 1HW8A 2XGQA 1RSCA 2B7BB 5HK4A 2V0NA 3HD2A 3KK2B 3LTOA 4KKOA 1EX8A 3NKMA 3F41A 3FC9A 2DRDA 4QWAA 1H72C 1TL7B 2J8SA 3NGSA 3DRXA 5D4PA 2CPXA 1WG4A 4OYOA 3TVYA 4DSIA 1Q16B 4LQ9A 3R5JB 3K0JA 4DMZA 2IYIA 3CO9A 5E3RA 1HNVB 3EVWA 3NS5A 4DJBA 2XEXA 2GVDA 2A3JA 1DHMA 4DLEA 2BW2A 4ZVGA 2W4PA 4HH1A 3PRDA 4LF8J 4W4MA 3AH6A 4ZP9A 1S4EA 2ZH6A 5IT9U 1LWEA 1T9TA 1NO8A 1XC9A 1G2EA 2F4VJ 1KLMA 1OQ6A 1T94A 2HRTA 1S1VA 1QSSA 5HROA 2O66A 2UUAF 1U47A 2JVOA 5KFBA 1P9YA 5LJ5Y 2WBRA 2DITA 4NRTA 1Z1ZA 3K5PA 2DK2A 3BDFA 2E1PA 3PKMA 1IQTA 2JFDA 4I68A 3QZ7A 1FXLA 1N33F 4L3KA 4CXSA 3B6BA 1R8BA 1N56A 2D3UA 3M6WA 2W8SA 3I0SA 4DG1A 3OVSA 1S9EA 5L9XA 1B4SA 1LFWA 1CJVB 3FJ2A 5KOWA 2XRGA 4HHUA 1QAXA 1ED8A 2RDIA 3QWPA 2XGPA 1YGYA 1FJ7A 3BBFA 2EXUA 3QATA 3GSDA 2G0CA 3J81U 4UORA 2FLNA 1Y10A 2OSRA 4ED1A 3RTVA 2ZH5A 4NL5A 3D2WA 4ZGAA 1H2VZ 3QIPA 3N9UC 2MZQA 4X4QA 2OUGA 3ZZUA 3AJ2A 4P2SA 4K4WA 2ZD1A 3QBCA 2DT9A 4WKYA 3QGHA 3BSOA 2XY7A 2OLWA 1FESA 5HSPA 4ECVA 3T1HJ 3CCQS 5MAOA 4Y2CA 1FHTA 4AXJA 4OI4A 4FF1A 3TJAA 1IBLF 3SCJE 2QA1A 4B9LA 1NPRA 3MM6A 3BYPA 2V8HA 1UZHA 3H7HB 3TZWA 2IRXA 3FFIA 3EICA 1QAIA 1NHVA 1KTQA 3M6UA 3OL6A 1WJ9A 2C2KB 2F3JA 2RUSA 2O67A 3ULHA 3W5XA 2ZVSA 3MFIA 2EFOA 2BQ3A 2QTWA 4HDGA 1NB7A 1S57A 3HLUA 3R6GB 4JI0F 2YPYA 1W7WA 3W5YA 4WIQA 3PIPQ 4DR2J 4FKYA 4PRFA 4ZVPB 1Z2ZA 4DSLA 1LWCB 1NKBA 5D4LA 2GSOA 3EE3A 1N52B 3AJDA 3CCZA 3U7JA 1E6YA 3E2EA 1N0UA 3EXYA 2FJDB 2F8EX 2OPQB 4FPRA 2D41A 2V8GA 5H1SV 1JLQB 1IJEB 1C1BA 3W8GA 3BS9A 4DSKA 2CQGA 4EK2A 2PC6A 3V4IB 4IO9Q 4QYZK 3FCHA 4ZN3A 1Q8LA 1C0TA 4EO8A 2YBVA 2CPHA 2I2YA 1WF0A 2KG1A 3J80U 4YN3B 1JJ2R 1UPPA 3PDNA 2KJVA 4ANCA 2HAFA 5L8RC 2ZITA 4ZS6A 1GQEA 3SSRA 1PJ6A 2KKHA 2CJXB 2XMJA 3AB4B 3DFEA 3Q23A 2OEMA 4LJMA 5GADI 3EZ5A 5MLCV 2N4DA 5HLFB 3G82B 3UDLA 2Y0SD 3PYFA 3MEDB 8ATCB 4ZVRB 3TWZA 4WZMA 3MXHP 4DPWA 3KLHA 5KFEA 1Y00A 1OS5A 2RILA 3JAMY 2YQ0A 5F8MA 2IBKA 2D3O1 4DBQA 2M4MA 3A12A 2NYHA 4C0HA 4GMKA 4B3MF 4B3SJ 3I9V9 3TANA 4K4TA 1FI4A 1F5BA 2JVRA 6AT1B 6FDRA 1MSWD 3DGVA 1S1XB 1B64A 2DO0A 3OLAA 4A8MP 2GO8A 1RKJA 3CMES 1VLYA 3RRHA 3FRYA 5K14B 2ILZA 1OYDA 1UJ6A 2V67A 1U48A 1BHNA 1FE0A 1DQ9A 2PA8D 4M5DA 3PYEA 2HHHJ 3I96A 1RAAB 2DNNA 3G8QA 3R7BB 2ZBPA 1RT7A 3NNHA 4RW8B 1SJRA 3AJ1A 4JI7F 1KH7A 4ZG7A 1TUWA 5I3PA 3CCWA 4PUOB 1XNQJ 2PI5A 2ZM6F 1VHIA 1JLEA 1CJTB 3GYXB 1QTMA 4CM2A 1N5YA 1HNZF 2YH1A 3I4HX 1ED9A 2UV8A 2ZHOA 2AJQA 5AE1A 4ECXA 1S5ZA 4M8LA 3D0IE 4KH1B 3PW0A 4A8KA 1RAEB 4F3MA 2CG4A 2MKKA 2MZSA 4C4WA 2CNNB 5J2QB 4NEZA 2L3MA 1N5VA 1FRMA 4TVAB 3Q86A 4YB1P 4MMOA 4OHVA 3THVA 5ETPA 3PRBA 4V19J 3DKDA 2ACMA 2HPUA 2XWXA 4WTOB 4KGXB 1IR2A 2J0QD 3EUNA 4R8UA 2DR5A 2IFXA 1TVRA 1AUKA 4DR4F 5LJ3Y 1AJBA 4HYKA 1U45A 3HFVA 1U0HA 2RKIB 5EX3A 3O3LA 2FB0A 3EVOA 3M6XA 3KWMA 3DU6A 4PAAA 3AQOA 3JTPA 2ZH1A 4AUKA 4FNHA 4JI6F 4CYUA 2VQFJ 4DV3F 4I69A 4JUZA 5HVFA 1UCNA 3NNCA 2QSFA 3K17A 3RUBL 1RT6B 1UKUA 1N54B 1SPBP 4RU9A 3W7BA 1J27A 1VBXA 1ITPA 2P5VA 9ATCB 2NSBA 3E3XA 4LRBA 3QZ8A 3PFOA 4DX8H 2W5WA 2QL7B 3UVJB 2YKMB 1U1QA 2M9KA 5FIIA 1YJNS 2XTJP 1VDHA 1JLCB 4ZVTB 2QA4S 4ZLPA 3IWLA 3M2UA 3OLBA 3PTWA 1S99A 3MM7B 4C8ZA 1FA0A 2R7QA 2AJ2A 2EBGA 1H0HB 4CCHA 3GR1A 2NPFA 2D1GA 5F8JA 3DRPB 3T1AA 3BKUA 4UY8T 2FLLA 3ZTOA 3C8YA 1MMNA 1NM2A 2FVSA 3CIZA 3HI9A 2DRBA 2KB2A 4B9UA 1WI8A 2YWWA 4N8NA 3N79A 3BPDA 4GVBB 3R5AA 3G87A 5F8HA 5KG7A 1TK5A 1KFSA 3D0GE 1NH7A 1OJ4A 2EFPA 1N34J 1WD6A 3BGUA 2GJIA 3C15B 1WDTA 1MMLA 3H42A 1LFPA 4JI6J 4IG0A 5B0FA 2YKNB 4NWBA 3IR6B 3MECB 1QAYA 1REGX 2VDIA 4LF6J 5KFWA 5KFDA 3QAUA 2VFUA 2Z8QA 2W9BB 3KHRA 2ASLA 1IWGA 3MPYA 5KFYA 3ZTPA 2RQ4A 3J7YU 3CCJS 3CJ3A 3GG0A 4QIVA 3FCWA 2DBBA 3P4UB 2MMYA 3NRBA 3HSGA 1SBRA 5IM0B 1RI7A 5DQGA 5B0DA 2CDQA 2C3YA 1W25A 3ENWA 1D9AA 2IA0A 2UUTA 1LWXA 1TMMA 1KNZA 4DUZJ 3DDNA 1UWBA 2DHHA 2WW8A 4K5SA 5LMUJ 2OP5A 3M05A 3V6DA 5HP1B 2BYCA 3MMJA 2RUGA 2YNGA 1U25A 4LF4J 3RG6A 3DDIA 5K8PA 2MB0B 2O01C 3CSKA 1VFJA 2NZCA 4PWDA
chains in the Genus database with same CATH topology
5AJ9A 1HJKA 3UN3A 4GTYA 3T02A 2G9YA 3WAXA 3SZZA 3NKMA 4LRBA 4LRDA 2IFYA 1ALKA 3LXQA 3DPCA 4QAXA 3M8YA 2W5WA 2X98A 3TX0A 3Q3QA 3CMRA 1EJJA 2XR9A 5L0KA 1Y7AA 1KHJA 3UNYA 4YR1A 4LR8A 3DYCA 3KD8A 5L0BA 3WAWA 4CXKA 5EGHA 4LQYA 4LR9A 2VQRA 3BDGB 3MK2A 2IUCA 2IUCB 1FSUA 2GSUA 1ALJA 3T01A 4UOOA 2QZUA 3UO0A 3BDHA 3WAVA 5DLVA 4CXUA 1EW2A 4GTXA 4CYSA 1ELXA 3BDFA 3WBHA 4UPIA 5GRRA 2W5QA 4ZG6A 1AJAA 5C66A 4FDIA 5LQQA 5LIAA 5DLWA 5LRMA 1KHLA 1E1ZP 2D1GA 5KXAA 1HQAA 1ANJA 3MK0A 1AJCA 4TN0A 1KH9A 5DLTA 4UPLA 1ANIA 5K4PA 2W5XA 1O98A 4N7TA 3NVLA 4CXSA 1N2LA 1ZEDA 2W5RA 2W8DA 4LR2A 2W5TA 1E3CP 5TJ3A 3WAYA 4FDJA 2ZKTA 1ALIA 4NWJA 5LRNA 3NKQA 1EI6A 2W8SA 4ZG9A 4MHXA 4LRAA 1B8JA 2GSNA 4KJDA 5L0EA 3A52A 4KAVA 5GOVA 4LRCA 1ALHA 1AUKA 3IDDA 5INHA 1EW9A 1URBA 3OT9A 2XRGA 3NKOA 1ED8A 1ELZA 1AJBA 3MK1A 2RH6A 1HDHA 2W5VA 4B56A 4UORA 4MIVA 4GTWA 1ZEBA 3IGZB 3NKPA 5EGEA 4KAYA 2GA3A 1EW8A 1P49A 1SHNA 1Y6VA 3NKNA 1KH7A 1ELYA 4MY4A 4ZG7A 1EQJA 1K7HA 3TWZA 3NKRA 3TG0A 5HRTA 3UN5A 3M8WA 3UN2A 4ZGAA 4LRFA 1KH5A 1KHKA 4NWXA 1KHNA 4CYRA 1N2KA 4LR7A 3M7VA 4KM4A 4UPKA 3E2DA 3ED4A 1E2SP 3B5QA 4KJGA 4UPHA 1O99A 1AJDA 1URAA 3SZYA 2GLQA 1SHQA 2W5SA 4GTZA 5IJSA 3BDGA 1ZEFA 1KH4A 2GSOA 4UOPA 1E33P 2ANHA 4LREA 3IGYB 1ED9A 5IJQA 3M8ZA 3T00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ9 A;  1HJK A;  3UN3 A;  4GTY A;  3T02 A;  2G9Y A;  3WAX A;  3SZZ A;  3NKM A;  4LRB A;  4LRD A;  2IFY A;  1ALK A;  3LXQ A;  3DPC A;  4QAX A;  3M8Y A;  2W5W A;  2X98 A;  3TX0 A;  3Q3Q A;  3CMR A;  1EJJ A;  2XR9 A;  5L0K A;  1Y7A A;  1KHJ A;  3UNY A;  4YR1 A;  4LR8 A;  3DYC A;  3KD8 A;  5L0B A;  3WAW A;  4CXK A;  5EGH A;  4LQY A;  4LR9 A;  2VQR A;  3BDG B;  3MK2 A;  2IUC A;  2IUC B;  1FSU A;  2GSU A;  1ALJ A;  3T01 A;  4UOO A;  2QZU A;  3UO0 A;  3BDH A;  3WAV A;  5DLV A;  4CXU A;  1EW2 A;  4GTX A;  4CYS A;  1ELX A;  3BDF A;  3WBH A;  4UPI A;  5GRR A;  2W5Q A;  4ZG6 A;  1AJA A;  5C66 A;  4FDI A;  5LQQ A;  5LIA A;  5DLW A;  5LRM A;  1KHL A;  1E1Z P;  2D1G A;  5KXA A;  1HQA A;  1ANJ A;  3MK0 A;  1AJC A;  4TN0 A;  1KH9 A;  5DLT A;  4UPL A;  1ANI A;  5K4P A;  2W5X A;  1O98 A;  4N7T A;  3NVL A;  4CXS A;  1N2L A;  1ZED A;  2W5R A;  2W8D A;  4LR2 A;  2W5T A;  1E3C P;  5TJ3 A;  3WAY A;  4FDJ A;  2ZKT A;  1ALI A;  4NWJ A;  5LRN A;  3NKQ A;  1EI6 A;  2W8S A;  4ZG9 A;  4MHX A;  4LRA A;  1B8J A;  2GSN A;  4KJD A;  5L0E A;  3A52 A;  4KAV A;  5GOV A;  4LRC A;  1ALH A;  1AUK A;  3IDD A;  5INH A;  1EW9 A;  1URB A;  3OT9 A;  2XRG A;  3NKO A;  1ED8 A;  1ELZ A;  1AJB A;  3MK1 A;  2RH6 A;  1HDH A;  2W5V A;  4B56 A;  4UOR A;  4MIV A;  4GTW A;  1ZEB A;  3IGZ B;  3NKP A;  5EGE A;  4KAY A;  2GA3 A;  1EW8 A;  1P49 A;  1SHN A;  1Y6V A;  3NKN A;  1KH7 A;  1ELY A;  4MY4 A;  4ZG7 A;  1EQJ A;  1K7H A;  3TWZ A;  3NKR A;  3TG0 A;  5HRT A;  3UN5 A;  3M8W A;  3UN2 A;  4ZGA A;  4LRF A;  1KH5 A;  1KHK A;  4NWX A;  1KHN A;  4CYR A;  1N2K A;  4LR7 A;  3M7V A;  4KM4 A;  4UPK A;  3E2D A;  3ED4 A;  1E2S P;  3B5Q A;  4KJG A;  4UPH A;  1O99 A;  1AJD A;  1URA A;  3SZY A;  2GLQ A;  1SHQ A;  2W5S A;  4GTZ A;  5IJS A;  3BDG A;  1ZEF A;  1KH4 A;  2GSO A;  4UOP A;  1E33 P;  2ANH A;  4LRE A;  3IGY B;  1ED9 A;  5IJQ A;  3M8Z A;  3T00 A; 
#chains in the Genus database with same CATH topology
 4P9S A;  3LGH A;  3FDS A;  5IOL A;  3KDO A;  3CJK B;  2VOD A;  5CHC B;  5KT5 A;  2XR9 A;  2XLJ A;  3CCM S;  1J5E J;  4MYT A;  2VQE J;  1ALJ A;  1XBW A;  3TAR A;  3QT7 A;  4XO0 A;  5D8H B;  4DQR A;  4L73 A;  5KG3 A;  3LWL A;  2MQQ A;  1DTQ A;  4EEY A;  1HR0 F;  4ZLN A;  4Y00 A;  1B7F A;  4K2X A;  4CH7 A;  2K3K A;  4AXI A;  2G1D A;  3VR1 A;  4CH1 A;  4ECQ A;  2NXE A;  5T14 A;  1CJK B;  1YJ7 A;  2ZBR A;  5AXK A;  1LQ9 A;  5I42 B;  3JAM U;  4X4R A;  4DX6 A;  3T5L A;  2Z57 B;  2OSQ A;  5G0R B;  1ELO A;  3OTE A;  2XMA A;  4ECS A;  1VIS A;  4DR6 J;  1FX4 A;  2M0G B;  2QX0 A;  3CCT A;  4NLR A;  3CJR A;  4PXD A;  5K8N A;  4LFC F;  1AZS B;  2ZH4 A;  2A18 A;  1TV6 B;  2D3Z A;  4YOE A;  4AL7 A;  1HQE A;  1ZEF A;  2CPZ A;  4RW9 A;  4MK7 A;  1GMV A;  3CTR A;  1UVJ A;  3C46 A;  1T03 B;  1CS4 B;  2G9Y A;  2BMB A;  1I3O B;  4ZPC A;  1A6L A;  2H48 B;  3PEH A;  4IDK B;  2W8L A;  3TX0 A;  2RD5 C;  2ATL A;  1HBO A;  5KFU A;  1XNR F;  4UQT A;  3RU0 A;  3GIL A;  1VMB A;  1Z2L A;  4X4T A;  3DLG A;  1XR7 A;  3MM8 B;  2YWG A;  1O98 A;  3EPI A;  2MDA A;  2LFV A;  1IKX B;  3CDU A;  4C11 B;  3VAH A;  3NAI A;  2APO A;  3PG9 A;  1RT2 A;  4JI5 J;  1S59 A;  5E3P A;  5KT7 A;  5D4N A;  4RBU A;  5JVG Q;  4LBP A;  2ZH8 A;  5C25 A;  2CQI A;  1S9G B;  1C1C B;  3OVB A;  2A0F B;  2C3U A;  1OIA A;  2MQP A;  4CO4 A;  2P6S A;  3H4B A;  1Q5V A;  3C14 B;  3ITH B;  1BXN A;  5CYM B;  4K4X A;  4RPF A;  4JI1 J;  1H38 A;  4PG6 A;  2DHS A;  1YZ6 A;  4DPY A;  1WOP A;  1EIY B;  1NJX A;  3LXQ A;  2J76 E;  1HNV A;  2Y1R I;  3D0H E;  4J9M A;  4LT6 A;  2JHE A;  2W2P P;  3MD3 A;  5KFP A;  1RTI B;  4ETX A;  2HZA A;  3DNC A;  1XNR J;  4KJI A;  5HN0 A;  4HDH A;  3OSP A;  1IN0 A;  1X9M A;  2FJA B;  2VJU A;  1D1U A;  2QLB B;  3ADA C;  3EWG A;  4QIW D;  1PGZ A;  1OY8 A;  3CJ4 A;  1TL5 A;  3LGM A;  1W2B R;  3R5D A;  3TI0 A;  3NVL A;  2FVP A;  4A8W A;  3HX9 A;  4JV1 A;  4A47 A;  2CG8 A;  1UJ5 A;  2ZH9 A;  3KKF A;  5IV4 A;  1LWF A;  3ILO A;  1WHW A;  5E3A A;  3CCV S;  4GVL A;  2HFO A;  4DQS A;  4FPI A;  2P9E A;  2ZOG A;  5HQL A;  2DEJ A;  2Y8Y A;  2EC0 A;  1RAG B;  3O44 A;  3MR2 A;  1MRO A;  3A3N B;  4H4O B;  1VQ8 S;  1GXL A;  1U2F A;  5KFK A;  1HWL A;  1KHV A;  1VRU B;  1IBC B;  3CXC R;  3QJL A;  1URA A;  2JEI A;  2KFY A;  1N6Q B;  2XSJ A;  5K8O A;  4LQ3 A;  4USH A;  1MWY A;  4UUW A;  1IKY A;  3UQS A;  3GFZ A;  3PHE A;  3NGU A;  3DOM A;  2UXD J;  3QAE A;  1NB2 A;  1SUQ A;  3JS9 A;  4KGM A;  3THT A;  3IMQ J;  3LP1 B;  1CJV A;  4ZIV A;  3IM8 A;  3O5T B;  2YKO A;  4EYI B;  4B17 A;  2EVZ A;  3BGF A;  3FSI A;  1KR4 A;  4ZHR B;  4DPO A;  1VI7 A;  3A8K A;  2CJB A;  4WKR A;  1BLU A;  4CI0 B;  3AD9 C;  3D1Q A;  2BKP A;  5BXI A;  2MKC A;  3CCL S;  3MUV P;  5HL7 Q;  2E1A A;  3Q89 A;  3DRS B;  2HVZ A;  2GJF A;  2E1M C;  2LCW A;  5D78 A;  4C98 A;  3UCG A;  4OYB A;  3NAH A;  4J9V A;  1O8B A;  4IG3 B;  4RUH A;  2CPF A;  2CPD A;  3HMJ G;  1AW0 A;  2W2N P;  3L7U A;  1Q7Y T;  3OR2 B;  2X1F A;  5DET A;  4NOH A;  1SB6 A;  2YTC A;  3GJS B;  4RWW A;  4WF9 Q;  1S1T B;  5KFQ A;  1IJF B;  1L3S A;  3PVX A;  1RAC B;  4IOB A;  2CQD A;  4F4W A;  2I38 A;  3JB9 k;  4ZG6 A;  2H65 B;  2ZHB A;  4X2B A;  3TAM B;  4ETZ A;  1K1Q A;  4IOC Q;  2D3O R;  3GPA A;  4C9D A;  1RU2 A;  2AGO A;  4JI8 F;  4EUV A;  1FKP B;  5CD4 H;  3NLC A;  3MM9 B;  5ITH A;  3KJV B;  4NE9 C;  1MLA A;  3KK1 A;  4DFK A;  4C6A A;  1YIT S;  1WG1 A;  2DGQ A;  1LWC A;  3WIU A;  3PCO B;  2E9R X;  3PYG A;  1TFW A;  1MN7 A;  4N47 A;  2GMH A;  4OX6 A;  2J6U A;  4MFB B;  4ZIT A;  3WDO A;  4Q45 A;  2DNQ A;  3B54 A;  1A9N B;  3U27 A;  2DY1 A;  1JLQ A;  3JTN A;  1UFW A;  4LRE A;  3T00 A;  5LSL A;  3NGD A;  4QJV A;  1AXQ A;  3V4I A;  4NLX A;  3LP2 B;  4FVM A;  3BR8 A;  1H7X A;  4OYW A;  3BGR B;  3UDC A;  4KC5 A;  4I2P B;  2B51 A;  4CLT A;  1LV5 A;  3BV8 A;  4LQY A;  3T01 A;  1KON A;  1KTV A;  2GS8 A;  5HBM B;  2FJX A;  4DPU A;  1HL6 A;  4CP5 A;  2EPI A;  1RUS A;  1NKE A;  2BOA A;  1WC4 A;  3MCS A;  4L6V 3;  4JI4 J;  1X7V A;  1WSR A;  4DWI A;  4XAK A;  2JWN A;  4M5H A;  3FVY A;  3B4D A;  3A13 A;  3LPY A;  3TOQ A;  2B4U A;  2PGC A;  1MMD A;  4ECR A;  4OZ1 A;  4EBD A;  5HLF A;  3G82 A;  1S76 D;  2BAN B;  1GFW B;  2HWI A;  1S1W B;  1Q7L B;  4TU7 A;  1NBE B;  4DS5 A;  4KY3 A;  4CLW A;  4ZCK A;  3NCR A;  2VA2 A;  3KOA A;  2BA9 A;  5D3G B;  1KHN A;  4EWT A;  2GMJ A;  3LAM A;  2AMC B;  4OI2 A;  2HQF A;  4OHX A;  4J9Q A;  2ZOF A;  2FJB B;  5CA5 A;  2A2C A;  1S1X A;  4CZC A;  1YTY A;  5KOX A;  1SC4 B;  4DL7 A;  2ASY A;  3C2P A;  3KG0 A;  3S6E A;  4K0K F;  4U7U K;  2RNE A;  2B5J B;  2CQ4 A;  1RCX B;  1AA1 B;  2V8V A;  4UOH A;  1F0X A;  3PHT A;  1VK3 A;  1UP1 A;  4FZV A;  3M30 B;  1FRL A;  2H1Y A;  4O0N A;  4RW8 A;  1YQH A;  4C2M A;  1Q53 A;  2ALY B;  3AY0 A;  4URS A;  2MKH A;  5IQ6 A;  4RNF A;  4PUO A;  3R5C A;  5JMN A;  1S6O A;  2XYG B;  4KV8 A;  1IM6 A;  2UZA A;  3I4P A;  4J9S A;  1CJT A;  3MAH A;  3ETO A;  2BKN A;  4WE1 B;  4F02 A;  5KFC A;  3BO4 A;  1WKK A;  2YWE A;  3BEG B;  2JJ4 D;  5DLF A;  2E1R A;  3CDE A;  3TRG A;  3EDQ B;  4DFP A;  1U1M A;  2UVR A;  3AXK A;  1DQA A;  5IJQ A;  5J2Q A;  1RJJ A;  2FTR A;  3LH2 S;  3DLE B;  1WEZ A;  4LRD A;  2FLO A;  2LLZ A;  5L0K A;  1LOU A;  2L08 A;  3G2X A;  3KLG A;  3VAM A;  2AYE A;  2HS3 A;  4WFY A;  4KGK A;  2KFN A;  2YNF B;  5KG2 A;  3M32 B;  3ZZ0 A;  4DV2 J;  5KFF A;  5SUH A;  2CQ1 A;  3AOD A;  2XI2 A;  2XY5 A;  4K0K J;  1QVF R;  2ZDO A;  3BH7 B;  4I1T A;  2GVZ B;  3GYG A;  1X4C A;  4URQ U;  5GME A;  4A8S A;  2CJY B;  2QN6 B;  1RA7 A;  1ZPW X;  5KFT A;  3TNV A;  3V5R A;  3C19 A;  4DR1 J;  4NLY A;  3T1Y J;  1P6T A;  3PEJ A;  2OTL S;  2XQC A;  3MMC B;  4DF8 A;  4C0O C;  2DNH A;  3NP5 A;  4JI2 F;  1B99 A;  2FQQ B;  3LP0 B;  1FD2 A;  1D3W A;  1D8Y A;  2RML A;  2PMH A;  3VAI A;  1B70 B;  3UVJ A;  1WSV A;  2R9L A;  2B4V A;  3LQV A;  4O3N A;  4BWJ A;  3OTC A;  1JLC A;  1I1G A;  3CCU S;  4F4X A;  1FJG F;  1QE1 B;  1DLO B;  3RAM A;  2CWK A;  1M5P C;  2FC8 A;  3MM7 A;  1YJR A;  3DLJ A;  4YY3 F;  4TXS A;  4F4Z A;  3QMQ A;  3W2W B;  4P7T A;  4OHZ A;  4C8N A;  2KM8 C;  2KU7 A;  1CLF A;  4JYA J;  2EEY A;  1QD1 A;  2YQ3 A;  2MY8 A;  1YX2 A;  2MJU A;  3FMW A;  2DXF A;  1APS A;  5E7O B;  1QUP A;  2ZWO A;  1GAO A;  4K50 A;  5C66 A;  4H4M B;  4NRU A;  3L95 X;  1S77 D;  4GVB A;  5KFN A;  2XZW A;  3TJ8 A;  5M2P A;  3T5J A;  2JDJ A;  5KFV A;  2W8D A;  1FEH A;  3QSI A;  3NKQ A;  3CUL A;  2AEM A;  4PZV A;  4Q0B A;  3DOK B;  2XNQ A;  3N6N A;  2HHT A;  3K58 A;  4BC9 A;  3VQS A;  2BVZ A;  2PT0 A;  2ZZN A;  1R0C B;  2YKN A;  2VG5 A;  4LSL B;  3MEC A;  1LW0 B;  2ZH2 A;  1HIY A;  2E66 A;  2J9C A;  2ZC4 A;  2G1H A;  2X3G A;  1ZTW A;  2W9B A;  1X4B A;  1VIX A;  2B43 A;  2FPH X;  3IC1 A;  4OLO A;  4FDF A;  5CH7 B;  3HKW A;  3QRQ A;  2EI5 A;  1FNX H;  4WK1 A;  4O3O A;  4GKJ F;  2R8G A;  4KKO B;  5KT2 A;  3ET6 A;  4X65 F;  4WYL A;  5IT0 A;  1IKV A;  3CD5 A;  3ENA A;  2GQC A;  2QIF A;  3KXD A;  4P74 A;  5M2R A;  3NBP A;  4CLY A;  4J90 A;  1SL2 A;  3L09 A;  3OVA A;  2WCX A;  4KHM A;  1YBA A;  2XHC A;  5B08 A;  5F8I A;  4DPX A;  1X31 C;  1GTH A;  3TUI C;  2MQL A;  5HP1 A;  2DCU B;  3EGZ A;  4WFB Q;  4QU7 A;  4LR2 A;  2AJ0 A;  3O8W A;  2C3O A;  3R1L A;  2GVD B;  4LRA A;  2DPI A;  3KLI A;  3ENV A;  5L0E A;  4QWB A;  3IGN A;  3Q8Y A;  3SCI E;  2W9C B;  2W5V A;  5E33 A;  3HKZ D;  3U02 A;  2M2B A;  1OMS A;  3F56 A;  3MAA A;  2EWH A;  1R8A A;  1M1K T;  3P49 B;  1RTD A;  2UUC F;  5DS7 A;  3CJK A;  3KJQ B;  1FDB A;  3GIR A;  4LF7 F;  2C2N A;  3VAK A;  1UJ4 A;  4USK A;  2RDJ A;  1KLM B;  3R8Y A;  4LSZ B;  3W63 A;  4GTY A;  2DD8 S;  4FP9 A;  1KDN A;  5HRO B;  4Z7Y A;  3AA9 A;  3VZI A;  5HMY A;  1GMW D;  3DOL B;  3LOU A;  4I6Y A;  4LVO P;  4N41 A;  4TLR A;  2WVE A;  4DF4 A;  1FJE B;  2QO3 A;  2HRU A;  3HHL D;  1OYE A;  4BC7 A;  4W92 B;  3L3C A;  4Y6I A;  3EX7 B;  5I42 A;  1N88 A;  1E1Z P;  1RWO B;  4UF4 A;  1SV5 B;  1Y7P A;  1KVI A;  3Q8V A;  4IH6 A;  4HEA 9;  2ASJ A;  1KSP A;  2B3T B;  2CQ2 A;  3T9N A;  3ZO7 A;  4K4V A;  3I0S B;  4DG1 B;  5F3Z A;  1IM4 A;  1D0E A;  4X64 J;  4D3H A;  5GAD U;  4FYD A;  4M5I A;  2DKO B;  2XWY A;  1AZS A;  4O3R A;  4UOC A;  1VQ5 S;  2CVI A;  1HDH A;  3UCZ P;  3UD5 A;  1TV6 A;  2XMM A;  4P2M A;  2PI4 A;  1NJI T;  2VFT A;  1A0O B;  1FTR A;  3DRR A;  1T03 A;  1CS4 A;  4P2F A;  3DU5 A;  4KHP F;  3QIP B;  1KHK A;  4NWX A;  4IDK A;  3FZ2 A;  4W90 B;  1CQM A;  3N6M A;  1XN9 A;  2IVM A;  2E44 A;  3G8T A;  2FVQ A;  3DLH A;  2F1F A;  3C6T B;  3PJX A;  4QR2 A;  1I94 J;  4RO0 A;  4OZ2 A;  2W9A A;  2EG1 A;  3MPU B;  1DAX A;  2IRY A;  2BJ9 A;  3H0P A;  4C11 A;  4L75 A;  4JI3 J;  2GSU A;  1RTH B;  3MM6 B;  1SXL A;  2BJE A;  4P71 A;  1U1O A;  5I3U A;  2PII A;  3FFI B;  2BE2 A;  4NZ0 A;  4IFV A;  2N82 B;  4UUX A;  4ECY A;  3PW7 A;  2PEB A;  1S9G A;  1LXN A;  1IBK J;  3JSR A;  1IBM J;  4DOZ A;  1YKW A;  1GT8 A;  4Z2X A;  2FDN A;  2MQO A;  1UEU A;  2ZHA A;  5CYM A;  1SKR A;  4YP3 A;  1RHM B;  2G9O A;  4DR3 J;  1J5O A;  2AD9 A;  2XZD B;  2AGP A;  3NKN A;  4USU A;  1REV B;  5HRT A;  3FBC A;  4KHP J;  2FY1 A;  3SZY A;  1AJD A;  1VQO S;  2DNY A;  1RTI A;  1X4G A;  2CRL A;  5T41 A;  3RJM B;  3C3L A;  2ZE2 A;  1X0F A;  1U0S A;  1Q79 A;  4MTP A;  4Y2A A;  1UVI A;  3PW4 A;  2MTL A;  4YFU A;  3CC7 S;  4TQR A;  1TKD A;  4IRD A;  1DQ8 A;  1YRT A;  5H9F J;  3MUM P;  3BDG B;  1KP6 A;  2QLJ B;  4ID5 A;  4TYA A;  2X51 A;  3FQL A;  3BGL A;  3LF0 A;  2HVD A;  1C0T B;  3HDS A;  3W9J A;  5J2M B;  3ILJ A;  1VQN S;  4N7T A;  2KRR A;  2VZ9 A;  4OV1 A;  2W5T A;  4FDJ A;  4F4Y A;  5HVH A;  5J2N B;  1R8H A;  1Q95 G;  1P1T A;  2E9T A;  1R8P A;  3NKO A;  1VBK A;  2KXF A;  3M8S A;  3IS9 B;  2NXU A;  1FFS B;  1U1R A;  2G0J A;  2HK2 A;  1SL0 A;  1N6Q A;  1JJH A;  1RAF B;  2OPP B;  3DI6 B;  4ECW A;  4FYX B;  3OR1 B;  2O5D A;  3CJ5 A;  1FT8 A;  3UR0 A;  2B9W A;  2B8P A;  2HAI A;  1Q82 T;  4WK3 A;  3BDP A;  2UU9 J;  2C42 A;  1U2R A;  3H5Y A;  2F8M A;  3LP1 A;  1VJQ A;  3OTO J;  1R6Y A;  1SC1 B;  4CT8 A;  1O6X A;  8AT1 B;  4KTQ A;  1C4A A;  3E01 A;  2BR0 A;  4ZHR A;  5DZ6 A;  4ENO A;  1Q8I A;  4ELU A;  4ECU A;  3T9Z A;  2QL5 B;  1LW2 B;  2YY3 A;  1FK9 B;  4IKA A;  1CEZ A;  4DV1 F;  2J5A A;  4OYI A;  4BCA A;  4DI6 A;  3CUN A;  1JLG B;  3DRS A;  4NWJ A;  2UXC F;  1EI6 A;  4G1Q B;  2H4Y B;  3CDW A;  1RP5 A;  2DR8 A;  2UUB F;  5GOV A;  4YHH F;  1RWN B;  4M5D B;  2IY5 B;  4DV4 F;  4IG3 A;  1YG0 A;  4B3R F;  4FS1 A;  2DNO A;  2IVY A;  1XJW B;  1RT7 B;  2GQ2 A;  4HHH A;  3R7N B;  1WTB A;  3DHW C;  3D5M A;  5D4O A;  1NDP A;  2RS2 A;  1WI6 A;  4OJG A;  2N7C A;  1Z4U A;  3OR2 A;  4PEO A;  1JXL A;  5DG9 A;  3N5B A;  3ENQ A;  1RQ0 A;  1S1T A;  1JLE B;  3DLB A;  3CD0 A;  3TA0 A;  1HMV B;  5K5M A;  3UI3 A;  2LU2 A;  2E5J A;  1YWX A;  4F7V A;  4ZVQ B;  4IYQ A;  2DNR A;  1ARO P;  3TAM A;  3VZH A;  2MZR A;  1BE4 A;  1G6B A;  1JLF B;  1KVK A;  3FCV A;  1KHJ A;  1FKP A;  2J9D A;  1HNW F;  2W2O P;  2RVJ A;  3MM9 A;  3SQG B;  3MDF A;  1CG2 A;  2ZKU A;  1SC6 A;  3ISZ A;  1QVG R;  4CLU A;  4I0W A;  1XMO J;  4B08 A;  1T9W A;  3G6E S;  3T19 A;  5EHH A;  1SI9 A;  3QPI A;  3TO8 A;  1RAO A;  1VOM A;  2J7U A;  3LO3 A;  1SJ3 P;  4R8U B;  2R7S A;  1EET B;  4ZCL A;  5J1P A;  1T9V A;  2FHO B;  4RU2 A;  1U0H B;  5A6P A;  1TTH B;  2CWX A;  4EI2 A;  5LMN J;  3MD1 A;  1SHN A;  1RWP B;  1FRX A;  1CUL B;  3VAF A;  3LP2 A;  3DC2 A;  2NXC A;  4PWW A;  2BEF A;  3HK2 A;  2QE5 A;  3GIM A;  2JC0 A;  4I2P A;  1JJC B;  3BGO P;  2GHP A;  2YNH A;  2PEH A;  4WWS A;  2HNZ B;  1CC7 A;  3CJQ A;  4YR2 A;  2L41 A;  5HBM A;  1RBO B;  5AXN A;  5HMW A;  4ZPV R;  1LK7 A;  3RBX A;  4P75 A;  1FNM A;  1WC5 A;  4UST A;  2E7X A;  1FWK A;  1NK9 A;  4NLO A;  3PZP A;  2JEF A;  2VV5 A;  1ZTT A;  2WK4 A;  4YME A;  3M2U B;  3HT3 A;  2HVH A;  2WB4 A;  2Y3Y A;  3P96 A;  2HQI A;  4PXC A;  2HHU A;  4DSE A;  4AD6 A;  1U6B A;  1RAD B;  4L74 A;  1AJC A;  2V9W A;  1HBM B;  4QYR A;  5HJX A;  2P2C B;  2RQM A;  1IR1 A;  1S6U A;  2W01 A;  2GSN A;  4KJD A;  1SJF A;  2MYF A;  5IFM A;  2KG0 A;  2OAU A;  3K89 A;  3QLH B;  2I5J B;  3EVM A;  4NX9 A;  3QJJ A;  2MPU A;  3PNI A;  2Y0B B;  1KVJ A;  3K8V A;  4OX9 J;  2NR0 A;  2F40 A;  2CPI A;  4KGV B;  4GO7 X;  1JNR B;  4CYR A;  3Q2S C;  3CGI A;  5T7L B;  5ETR A;  4OI0 A;  1T3N A;  1CPZ A;  5C2G A;  2VPX B;  2HK3 A;  3QSY B;  4TU8 A;  1IR0 A;  1MW7 A;  4DXL A;  2BAC A;  2W7P A;  2KI2 A;  5C5J A;  2PMW A;  3M30 A;  1NK7 A;  5DLV A;  2DTJ A;  3SI8 A;  5EDW A;  4OHY A;  1H7W A;  2QA4 G;  1NXI A;  4L76 A;  1FCA A;  3GV8 B;  3RRK A;  2IMW P;  2IPO B;  3GB0 A;  2BQU A;  3UW1 A;  5BYS A;  3W60 A;  2E7W A;  3HHE A;  3G86 A;  2ASD A;  2Y1J A;  1UWB B;  1OSD A;  1H6K X;  1U7L A;  2GX8 A;  2O1P A;  4RKU C;  1RGV A;  4ED2 A;  1M5K C;  2K3I A;  2WTF A;  1FWP A;  3EDR B;  3MCN A;  1TEL A;  2M52 A;  4N5S A;  2M7S A;  3V6D B;  3OHA A;  3HVT B;  1HWI A;  4J9N A;  4BDP A;  4OX8 A;  4ZA1 A;  1RT1 A;  2CQC A;  3DLE A;  3F0N A;  1Q4R A;  3OV7 A;  1DRZ A;  5KFR A;  3SYZ A;  2C2O B;  4ICL B;  1NDK A;  2OI2 A;  1O99 A;  2OO4 A;  1RBL A;  1VC0 A;  4CTA B;  2YNF A;  2ZZT A;  1PO6 A;  2G4B A;  3H8Y A;  3EGV A;  2ZWP A;  1IVZ A;  3DPC A;  2JNJ A;  2BE7 D;  3FEX B;  4FYW B;  1VRQ C;  1G4C A;  4AL5 A;  4YQW A;  2GVZ A;  4Z37 A;  3WBH A;  3T41 A;  4UQG A;  1FKO A;  3Q8R B;  1FWL A;  2RDD A;  5JUM A;  3H2L A;  5KXA A;  1BMQ B;  1DTQ B;  2W5X A;  2V8D A;  1ZM4 A;  2OEL A;  1FJC A;  4P10 A;  1KBR A;  4DR5 F;  3NXZ A;  1JB0 C;  1Y5L B;  1HYS B;  2WVC A;  3IA0 A;  3W9I A;  2F9D A;  2M8D B;  2BV3 A;  4OQJ A;  3A3O B;  1X4E A;  4ZPW R;  2LDI A;  2F4F A;  2D9P A;  1QE1 A;  2XG8 A;  4NA3 A;  3W2W A;  2V2Q A;  5HAT A;  2HHV A;  2GIR A;  4O23 A;  3MWB A;  2CVE A;  1RAB B;  5AXL A;  3D1O A;  4UPH A;  4GTZ A;  1SHQ A;  2B9Y A;  1HQE B;  2ADC A;  4GRS A;  1M90 T;  4KR0 B;  3QJP A;  4H4M A;  1PIE A;  4R0J A;  4KT0 C;  5AE2 A;  4G1P A;  1HBO B;  5L0B A;  4PPZ A;  2RS8 A;  1RHU B;  1X5O A;  5EX0 A;  1JJ4 A;  4GTX A;  3UE2 A;  3QRP A;  3DLG B;  1U8W A;  4WP9 A;  4PR6 A;  3W64 A;  4LF8 F;  5FD1 A;  4J9O A;  4DV7 J;  1G7C B;  5H9F K;  2G2O A;  1U6Z A;  4LSL A;  1K47 A;  2G13 A;  3AT1 B;  4OZN A;  4ZN1 A;  3NL0 A;  4A46 A;  1NK6 A;  3RAX A;  3MEG B;  4PG5 A;  1RT2 B;  1WNE A;  1T0T V;  2I8E A;  2Q43 A;  4C8L A;  4H54 A;  2WHO A;  1VQY A;  2RH3 A;  4F0M A;  2F4V F;  1FER A;  5C25 B;  2AX0 A;  2C3M A;  1N0V C;  3V2U C;  1KRP A;  2LEC A;  4I56 A;  1WG5 A;  4ZK7 M;  5LOQ A;  3HCX A;  4ZP6 A;  1S72 S;  2O3D A;  3X1L B;  1N4L A;  1X9S A;  4G1I A;  1HWU A;  2R7V A;  1ZA2 B;  2VL1 A;  3QT6 A;  2CDR B;  1IQZ A;  5HQ8 A;  3FQK A;  2UVV A;  4ID8 A;  1YLX A;  5HMZ A;  1S6Q A;  2MXY A;  4KAI A;  2CQ0 A;  3D68 A;  3TZZ A;  1FRJ A;  2FHJ D;  3SV4 A;  3KUH A;  4DLG A;  1VBY A;  1DUR A;  1BGX T;  3EM1 A;  1EW2 A;  3TX8 A;  1UMJ A;  2W5Q A;  3C66 A;  2VPY B;  2DGO A;  3OBI A;  5A0Y A;  2WZ1 A;  2W9C A;  4C8O A;  3I82 A;  1XMQ J;  4EU0 A;  1ZA1 B;  4DV5 J;  1F5A A;  2KYZ A;  2FZG B;  4URG A;  1SH2 A;  4NLP A;  4TYB A;  1LWF B;  3F73 A;  4NXM J;  1X0P A;  5FJ4 A;  4C3K A;  2JC1 A;  1NJZ A;  4NPO A;  1H2T Z;  3DDK A;  2IJR A;  1S9F A;  2HIQ A;  4HTJ A;  2XBP A;  3H2U B;  4ED4 A;  3T1H F;  1MRO B;  4NML A;  4CRJ A;  4OX7 A;  4RR5 A;  2FVC A;  3DOL A;  2MST A;  4CNZ A;  3ED4 A;  1IUJ A;  1HI0 P;  5L1K A;  4H4K C;  1PC5 A;  1K0T A;  2CQB A;  2XSJ B;  3ZFV A;  3VWS A;  1VIO A;  2KYX A;  1T05 A;  4PXE A;  3S1T A;  3UN3 A;  1NHK L;  2E5L J;  3EZU A;  1RT5 A;  3HJV A;  3MTK A;  4ER8 A;  2RQC A;  1IKY B;  4WP3 A;  1T8E A;  1SV5 A;  5I3Q A;  2AYG A;  3DOM B;  5KFM A;  3VGS A;  3W65 A;  2MEW A;  1CBK A;  1V9O A;  1SUQ B;  4KPC A;  3I5B A;  2QV6 A;  1TAU A;  4CM0 A;  2OJ3 A;  4ZPA A;  3LA0 A;  1Y3K A;  2WW4 A;  5IC6 B;  4DR2 F;  1NDC A;  2PDA A;  4NYZ A;  2AZ3 A;  3GE9 A;  5ETQ A;  2DRA A;  4ALZ A;  2Z2M A;  2KDO A;  4FYV B;  3OJS A;  4RNN A;  3SDE B;  2XS5 A;  2EFG A;  2AEJ A;  3OL9 A;  3K5M A;  4JV2 A;  2DGW A;  3HJF A;  2C28 A;  1AUD A;  3LAN A;  1EZZ B;  4DV6 J;  4ED3 A;  5CCL A;  1X4D A;  5ETN A;  3C6T A;  3OUY B;  3J7Z T;  4HLB A;  4QWE A;  4CLP A;  3D54 A;  2CYY A;  3KMQ A;  1EKS A;  2CJA A;  1N2K A;  1S49 A;  1WEX A;  4LR7 A;  4QQB A;  2F9J A;  4QIE A;  2BJ8 A;  4NXN J;  4ED8 A;  2F5G A;  4WXW A;  4NCA A;  1RTH A;  3GJT B;  2XB2 D;  5DGA A;  2XS2 A;  3HHL B;  1Q0N A;  2CZV C;  1V5V A;  4RW6 B;  4ED0 A;  1PC4 A;  5C24 B;  4CXU A;  2M8H A;  3HD1 A;  4ZVE A;  1WHX A;  4RW4 B;  4QZV B;  1MWZ A;  1HWJ A;  1D9F A;  2X3D A;  2BJ3 A;  1S0N A;  1HHS A;  4V1A k;  3DXB A;  1JQG A;  1UET A;  2HQG A;  5U47 A;  3KK1 B;  2DGT A;  1REV A;  4OI3 A;  1TK0 A;  2EBE A;  1RWM B;  3MPD A;  4DUY J;  1DBD A;  3E51 A;  3MHY A;  3NY0 A;  3RR8 A;  3MMB B;  5HJY A;  1KH5 A;  4ZPT R;  2Z58 B;  1ZET A;  2VPW B;  2GZO A;  4B3S F;  1E2S P;  3T6J A;  1TL3 B;  5F41 A;  3M9O B;  2OTJ S;  1YZ7 A;  3BDG A;  2QC3 A;  4NZ6 A;  4X84 A;  2F65 A;  2HFU A;  2YH0 A;  1NZ8 A;  1TKZ B;  1L5U A;  1VQ6 S;  3AD8 C;  4MAK A;  2QEX S;  4FXD A;  5J2M A;  1Y5I B;  3N4W A;  3IBW A;  4WU2 A;  1T9X A;  5J2N A;  3T5K A;  3QFW A;  2HS0 A;  2HHH F;  3WX4 A;  4I67 A;  4PQA A;  2YQ1 A;  3H2V E;  2JEG A;  5DLW A;  2NXN A;  3DN9 A;  4D3G A;  3IS9 A;  4Y3C A;  1NK8 A;  4XDC A;  5A8R B;  3ISN C;  2HS4 A;  2HMI B;  4P2X A;  4USV A;  1PIL A;  1AB8 A;  1VQ9 S;  2OPP A;  3ZTQ A;  3PW5 A;  3DI6 A;  1XNQ F;  4CLL A;  1URN A;  3OR1 A;  3JSM B;  3KNA A;  2JL9 A;  3BH6 B;  4MH8 A;  3LUY A;  2RSQ A;  4FF2 A;  1N32 J;  2BE9 B;  1QSL A;  3D6T B;  4I6A A;  3TA1 A;  2CNO B;  4Y0F A;  2R7R A;  4KAY A;  1HI1 A;  2DVI A;  3BBC A;  1NRK A;  1F6T A;  2VH7 A;  3MEK A;  1SH0 A;  3R7S B;  1RAH B;  3D3B J;  5HMX A;  3U1M A;  1U49 A;  2I0X A;  4QPX A;  3WZ0 A;  3G8S A;  2GIQ A;  5KFJ A;  4KE5 A;  2U2F A;  1BWE A;  1LW2 A;  3K5O A;  4AQY F;  5DM7 Q;  1ZZF A;  4RNO A;  1FK9 A;  2IIH A;  5E41 A;  2V4J B;  3CCE S;  4PAB A;  2IVF B;  2VQR A;  1JLG A;  5ETS A;  4G1Q A;  1F3F A;  4OJ3 A;  3OJU A;  1U26 A;  2W4D A;  3H40 A;  2R8I A;  5BYQ A;  5E3C A;  4TU9 A;  3OSN A;  4ZVO B;  5K20 B;  3GU0 A;  1EJ7 L;  4NA1 A;  1RBA A;  2VQF F;  2CNK B;  2EC2 A;  3OT9 A;  1ELZ A;  4KV8 B;  4M5N A;  4KFB B;  5L1J A;  4CQ1 A;  3NMA A;  4F3Q A;  1GMU A;  2KT3 A;  1LNQ A;  1HMV A;  1BUX A;  3X3U A;  4PQU A;  4O3P A;  2GA3 A;  2ROG A;  2D74 B;  3L4B C;  1RHR B;  2R2T A;  2A10 A;  3DRY A;  3I5A A;  2HGM A;  1VK8 A;  3I32 A;  4C3L A;  1JLF A;  2ADB A;  1UVM A;  1RE1 B;  1QJH A;  1RU1 A;  3RZA A;  2JLE A;  1Q86 T;  2Z2Z A;  4HHJ A;  4P6Q A;  3SEO A;  3M9M B;  2MKS A;  3SQG A;  3VQT A;  4IQX A;  2AT1 B;  3R3T A;  4OZ0 A;  4DPT A;  4E0D A;  4ZLJ A;  2LXF A;  1H3D A;  2LEB A;  2DHX A;  4AQY J;  3NS7 B;  3KLG B;  2HQ3 A;  1RT3 B;  3NCQ A;  3BDH A;  4IUF A;  1Y11 A;  1P8G A;  4UPI A;  1AFJ A;  1EET A;  2IM3 A;  3DXS X;  2QG9 B;  4ILM A;  4G3I A;  5E3Q A;  1N34 F;  2YNI A;  5HAO A;  2FHK A;  1XMB A;  3LAL A;  1HA1 A;  3FKB A;  1YRU A;  1FRK A;  3AFG A;  4EMD A;  2W8K A;  3P6Y C;  1HPZ B;  1CUL A;  2CAJ A;  2K1R A;  3KLE B;  2LKZ A;  1RYS A;  2IHR 1;  5LSO A;  2HNZ A;  4LF6 F;  1K9M T;  1TL4 A;  2NS1 B;  4HH0 A;  4MKV A;  1ELY A;  2A2D A;  4LF9 J;  1V3Z A;  3CJT A;  3Q0A A;  5D0G A;  5J1E A;  2GCF A;  4DFM A;  3GLJ A;  3PR4 A;  3O2I A;  4ES3 A;  2JEJ A;  3HT0 A;  3OHB A;  2JSX A;  1F2H A;  1F9E B;  4DR7 J;  3SSQ A;  3W66 A;  3CMR A;  1T3O A;  5I4M A;  3QYY A;  4DUZ F;  4UW2 A;  5IXU A;  1HBM A;  7AT1 B;  1VQK S;  3MMA B;  5AE3 A;  1IKW A;  5L1L A;  5LMU F;  3H90 A;  5B0C A;  2JX2 A;  3QLH A;  2I5J A;  2VIH A;  2FC9 A;  3IWN C;  1HBN B;  4ELT A;  1YRX A;  2DR6 A;  3K7R A;  4LF4 F;  1TUG B;  2YXL A;  1WTF A;  4Q0B B;  1KQG B;  4NCB A;  4KO0 A;  2E1C A;  2RRA A;  5T7L A;  3W1Y C;  4U67 Q;  1JLA B;  4OI6 A;  2HHX A;  2VG5 B;  2BJD A;  4K4Y A;  4WFZ A;  4J5O A;  2AJF E;  1N36 J;  3Q83 A;  4WTY A;  2ZEJ A;  1UEV A;  3KK3 B;  3R5G A;  1FKA F;  2VDH A;  5H9E J;  3CPW R;  1J5E F;  2VQE F;  3SV3 A;  3CJ0 A;  3EMT A;  2W2M P;  4CDI A;  1KOO A;  4W98 A;  4Z7C A;  2POK A;  3GV5 B;  1ZAW A;  3Q8Q B;  4QPT A;  1LKZ A;  3J7Z 5;  2M88 A;  4WYW A;  3ET6 B;  2VHG A;  2AIR B;  5FDL B;  1IKV B;  1RWV B;  2X1A A;  3IAM 9;  3KJF B;  3CC4 S;  3PY8 A;  1N5S A;  3NBP B;  2VG7 A;  1XIQ A;  1RYR A;  4J7C A;  3WC2 A;  2ROE A;  4OYA A;  4MIW A;  3LAK A;  1QLN A;  2A1B A;  2IC3 B;  3NCP A;  2J0S D;  1U4B A;  4F0K A;  1HLW A;  4DR6 F;  3HVT A;  1HFE L;  1ZED A;  4F2S A;  3EYZ A;  1FRH A;  1X5P A;  4HT7 A;  1N48 A;  2Q6C A;  3VVU A;  3KLI B;  4MK8 A;  4ICL A;  2FGO A;  2C2M B;  5DM6 Q;  1X60 A;  2AW0 A;  2MLY A;  4DN9 A;  2IAJ B;  2M5Y A;  1U6F A;  1RAI B;  5D6G A;  3UFC X;  4CTA A;  3BQ1 A;  3MAA B;  4B3T J;  1TL1 A;  1UA1 A;  1XQI A;  1RTD B;  2AHO B;  2YWK A;  2N3L A;  1QSY A;  2JZ5 A;  4LFA J;  2BZ2 A;  3MR3 A;  4ZCI A;  4QWD A;  2J7W A;  2CQP A;  5EWE A;  2KT5 A;  3I0R A;  2DGU A;  3KUE A;  4OL8 A;  1RXO B;  5ETK A;  2ZJQ Q;  3Q3Q A;  2X1B A;  2HND B;  4JI5 F;  1HYS A;  2Q79 A;  2QZU A;  2LA6 A;  2HNY B;  2HZV A;  3UWT A;  4MYU A;  4BBY A;  1O51 A;  1GX6 A;  4DCJ B;  4I4B A;  2C2Z B;  4NLU A;  4PCQ A;  1A7G E;  2FY8 A;  2WSE C;  1RWK B;  3LPE A;  4ELV A;  3A4T A;  4ZCM A;  1GXU A;  3OFF A;  4NLD A;  4JI1 F;  1XWL A;  2KVQ E;  4CH0 S;  2Z2L A;  2Z0G A;  3OXF A;  3DCA A;  4DX7 A;  3ZZZ A;  1P49 A;  3CNQ P;  3DRR B;  2DGX A;  1ZOT A;  5GAH I;  3THP A;  5LXY A;  3D6H B;  4UOG A;  4F4A A;  4NI2 A;  2XI3 A;  3L7O A;  5K8M A;  2J0W A;  3E2D A;  3A8J A;  2MKJ A;  2HW3 A;  1U1P A;  3PJ9 A;  5J1N A;  3GIJ A;  1HNX J;  3HSJ A;  3ZC4 A;  1H74 A;  1FO1 A;  2IFY A;  2CJ9 A;  2CPE A;  3CJ2 A;  5D77 A;  3K8W A;  1X4F A;  2ZBI A;  2KT2 A;  2H5I B;  1KLN A;  4UZB A;  1K8A T;  3FUY A;  4HT5 A;  3MEG A;  4CLK A;  4QR0 A;  1PYO B;  4KGZ B;  3D28 A;  2RU9 A;  1PSD A;  4ZVF A;  2QLW A;  5I3U B;  2F7V A;  2BE2 B;  4IFV B;  3SFG A;  1L3U A;  4RBT A;  1JIH A;  4CO5 A;  4I2Q B;  3FMB A;  3PAC A;  2QFI A;  5AJ3 J;  2RRN A;  1TAQ A;  5JVH Q;  3SCK E;  4KHR A;  2ZH7 A;  3A1Y G;  1WDD A;  1QDU B;  1T11 A;  3POT A;  4LRC A;  1KS2 A;  1RT4 B;  2R2R A;  2WB1 D;  2IM2 A;  2DIU A;  2NYI A;  2HBR B;  1YJW S;  2HFN A;  1J5O B;  1S10 A;  2YX7 A;  1DJ0 A;  4FXW A;  2UXD F;  3O6Q A;  3EJM A;  3U1L A;  3MZI A;  1UFL A;  1Y4Z B;  1OSC A;  2ZE2 B;  2RQK A;  1FDA A;  2DCL A;  2RU3 A;  3FZB A;  4N8O A;  2R2S A;  3GP9 A;  2XMW A;  1TKX B;  4DV0 F;  4OZJ A;  3JQK A;  1BC6 A;  1OO0 B;  2H54 B;  3MK2 A;  1VS3 A;  4ID5 B;  5B0B A;  3VCD A;  1C4C A;  3OFH A;  4YDD B;  4P72 A;  4IFY B;  4ZPD A;  1BD6 A;  4PXB A;  2HEK A;  3M9N B;  5KFG A;  2IJF A;  2IDL A;  2XZT B;  2ZZM A;  3DLL Q;  2ZKT A;  1U1K A;  5L1I A;  2VPZ B;  2VKR A;  1S0M A;  1H98 A;  4X66 J;  2DH7 A;  2V2Z A;  1QUV A;  2GW8 A;  5LT5 A;  2E5H A;  3CC2 S;  2Z4P A;  2V68 A;  1LEO A;  4AL6 A;  5ETL A;  2DHG A;  3BM7 A;  4TNO A;  1EW8 A;  4LF5 J;  3GJQ B;  4WPA A;  2BUN A;  4Q7A A;  5KT6 A;  1K0V A;  1PBA A;  5ETV A;  2R7X A;  1KWM A;  2XMT A;  5BR8 J;  2HKE A;  2EFN A;  3A3P B;  4FVC A;  4O44 B;  2DJW A;  3G71 S;  1EHW A;  3W3S A;  2YPZ A;  1N8R T;  1HJK A;  3BRE A;  2DNP A;  4KYZ A;  4GKK J;  3SXL A;  1UVK A;  3W2V A;  3U1N A;  2OFH X;  2HGL A;  3JTO A;  2XS7 A;  3WQP A;  3MCM A;  4KH0 B;  3E01 B;  3D67 A;  4DV0 J;  1O0P A;  5A8W A;  1F3V A;  4B9M A;  3SDE A;  5KFS A;  3I55 S;  3TQE A;  2V63 A;  1S1U A;  1M0S A;  4FDI A;  4RX6 A;  4OYP A;  5F0U A;  2KJW A;  5CQG A;  2VJV A;  2XMV A;  3D6M B;  2KRB A;  3CMA S;  3LW5 C;  3OUY A;  4HVZ A;  2OKQ A;  4XPC A;  1ALH A;  3ICL A;  1C0U B;  4MJK A;  1P9Q C;  1HBU A;  1GMW A;  2MZJ A;  1OPI A;  1HD1 A;  2ZVI A;  3JQM A;  2FJE B;  3PV8 A;  4ITS A;  2V6A A;  1YBT A;  3TVK A;  1ICE B;  2BQR A;  2VBX A;  2LQ5 A;  4M5K A;  3HHL A;  3TA2 A;  3SCL E;  1U1N A;  4F26 A;  1XER A;  2GLQ A;  4KIA A;  4QBU A;  4RW6 A;  5C24 A;  1HHQ A;  2ANH A;  4RW4 A;  1V5I B;  3KLF B;  1KQS R;  4PKD B;  4JI4 F;  3EGW B;  1NKC A;  2JFK A;  1XTZ A;  3GTY X;  1MN9 A;  2D7S A;  1WHV A;  2BKO A;  2QFJ A;  3G6Y A;  1HWK A;  1UFK A;  4X62 F;  4NA2 A;  2OPS B;  3MEE B;  1ANJ A;  5CYQ A;  4K4Z A;  2UUA J;  3DYA A;  4UOF A;  3W62 A;  3MMB A;  3JYT B;  3H5X A;  4OLP A;  1NPK A;  4O3Q A;  3WHI A;  5JJB A;  2AP6 A;  2UUW A;  4C3M A;  1Q5Y A;  2IJN A;  2C2R A;  1DAR A;  1TL3 A;  4A8Q A;  4RUB A;  4Q8E A;  1VBZ A;  3NKP A;  3PO4 A;  4OYM A;  1T7P A;  1R3N A;  1N33 J;  1R89 A;  2DO4 A;  1TP7 A;  3I6P A;  1TKZ A;  4ECZ A;  4MKY A;  2ZFH A;  4ZJL A;  5KFZ A;  2LDY A;  1BQM A;  4F8R A;  4WZQ A;  2YNH B;  3I87 A;  3FK4 A;  3WX8 A;  2HBZ B;  2B7C B;  2Q3P A;  3PM9 A;  2VC1 A;  5H9E K;  4F0H A;  3I31 A;  3HFK A;  2SXL A;  2R4F A;  1CQN A;  4C8M A;  2ATC B;  4YR1 A;  2W4C A;  2XMU A;  4MIA A;  1QAJ A;  5A8R A;  2HMI A;  3IBF B;  2QMX A;  3RBZ A;  1ZS6 A;  2RE1 A;  3ETM A;  3JSM A;  1AJA A;  4X4O A;  4USI A;  4I64 A;  4J9K A;  2CPJ A;  3RYL A;  3BJY A;  4DL0 C;  1SKW A;  4X62 J;  3D66 A;  2Z56 B;  1HAR A;  3OL7 A;  1UVN A;  5E0O A;  1HNI B;  4JV0 A;  3HXM A;  3GV7 B;  3A8I A;  1PYT A;  4LMZ A;  2YKA A;  3IWX A;  3CDA A;  5HQM A;  3KDN A;  1IBL J;  1N5Q A;  3IAS 9;  3IDD A;  1RTJ A;  5DDQ C;  4DU8 A;  2QMW A;  4NCG A;  2K06 A;  1PJ7 A;  2PE8 A;  1S0V A;  5KFH A;  4GTW A;  4DCP B;  4NEY A;  2CXE A;  4GC7 A;  2OPR A;  4K4U A;  3IR5 B;  1BQN B;  2Z30 B;  4LRF A;  5DQI A;  2V4J A;  2LEP A;  1X5S A;  1ZAV A;  1EP4 B;  2DY9 A;  3GCW P;  4JI0 J;  4DV2 F;  4C97 A;  4OHW A;  4IH5 A;  3T3F A;  3KUG A;  3KTQ A;  1NJY A;  2WVF A;  2BBE A;  2RAQ A;  4AYB D;  3ZNJ 1;  1JKH B;  4JBC A;  2CJK A;  3QNW B;  2C22 A;  5F8G A;  1RWU A;  2V34 A;  1B3T A;  3TEG A;  4DR1 F;  3T1Y F;  3AQP A;  3N6L A;  1MU2 A;  3SFU A;  4KFB A;  4CLZ A;  3SBM A;  2BRK A;  2VG6 A;  4HR2 A;  5B0G A;  2RF2 B;  2HLU A;  1U09 A;  2MJN A;  3HHK A;  4EYH B;  3IXQ A;  3FEY B;  2V50 A;  2H4W B;  2B6A B;  2N3O A;  1HKA A;  5GVQ A;  5DQH A;  1U24 A;  1ZM2 A;  1SIW B;  4OIX A;  2RHQ B;  2VC0 A;  1UW9 A;  2H5J B;  4EFA C;  2Z2Y B;  4F36 A;  1RT1 B;  2HSE B;  4JYA F;  2LQJ A;  3M8W A;  1XEZ A;  3M8Q B;  2MZT A;  3H25 A;  2CZ4 A;  4PPD A;  2DNM A;  1PBU A;  3QID A;  2ROP A;  1RT3 A;  1RLC L;  5A2Q Y;  2L48 A;  4C8Y A;  4RUA A;  2Q1L A;  2CKW A;  2XCP A;  4C8K A;  1WOS A;  3N5F A;  3B8H A;  4B9V A;  3T6B A;  5B0A A;  5C42 A;  2HHS A;  1S6P B;  4ZKA A;  1TKT A;  2DYA A;  1XK8 A;  1NSQ A;  4FXV A;  2ZH3 A;  5DJB A;  3UNG C;  1X4A A;  1PAU B;  3OPK A;  2D1C A;  1HPZ A;  2UP1 A;  2DR9 A;  1FKO B;  3SIP B;  3KLE A;  4O3S A;  1HHT P;  3R2D J;  3EXC X;  1ANI A;  1D9D A;  1BQX A;  3GIK A;  2MSS A;  3DGP B;  5CAB A;  4JV5 F;  4J91 A;  2MHE A;  1KN6 A;  4B3M J;  1WC3 A;  1RCO B;  4ATN A;  2KO1 A;  4LBI A;  2VOP A;  3IG1 B;  5INH A;  3DMJ A;  2XUL A;  1RAJ A;  2CZ9 A;  3G6V A;  5D15 A;  3M8R A;  2Y8W A;  2YKP A;  1WKJ A;  5L38 A;  4KSE B;  2CUY A;  4B9N A;  2B0G A;  1Y6V A;  1ZAX A;  5F3T A;  4CLF A;  3QGI A;  1B0P A;  2Y9H A;  4QU6 A;  1GNK A;  1DFD A;  2YWF A;  2E7V A;  3GQC A;  2NRE A;  1B7Y B;  2W5S A;  2L9N A;  5GAE I;  3MMA A;  1UPM B;  1NLK L;  2WVB A;  3V6K A;  2VUG A;  2HG4 A;  4BWM A;  3TR5 A;  2G2Z A;  2R7T A;  3PW2 A;  4JI7 J;  3HVA A;  1RDR A;  3BSC A;  1HBN A;  1VGY A;  3Q2T C;  2ERR A;  5EN1 A;  2EW9 A;  4U7C A;  3GR0 A;  4OJH A;  2ZM6 J;  3HVR A;  4R5P B;  4CYS A;  3NGR A;  1FD8 A;  1HNZ J;  2AKW B;  2CA9 A;  3R5B A;  1VC6 A;  1JLA A;  1Y0H A;  2ACY A;  3MUT P;  3VV2 B;  1N2L A;  2B9E A;  3KK3 A;  3M1V A;  2EK1 A;  5DDR C;  4JV5 J;  4CO0 A;  4ZIW A;  3Q22 A;  2HHW A;  4H4K A;  4A48 A;  4QW9 A;  4ZJQ A;  1DTT A;  3OTB A;  4MIV A;  6FD1 A;  3GG1 A;  4R0E A;  2ZDP A;  3GFY A;  1E6V B;  4I6W A;  4FF4 A;  4FBT A;  2W25 A;  5KT3 A;  2K2P A;  4A4J A;  2VOO A;  1WEY A;  5FDL A;  4Q43 A;  3TP2 A;  4CIO A;  4DR4 J;  1X9W A;  1ZPV A;  2J9E A;  5AJ9 A;  1M5H A;  2P6T A;  1VHF A;  1BWV A;  1U8S A;  3IM9 A;  2V8P A;  4IRK A;  2IC3 A;  4NMX A;  1S6Q B;  3M8Y A;  5C7P A;  5EUH A;  3CJ8 A;  2VAS A;  4DV3 J;  1JX4 A;  2KFZ A;  4X64 F;  1PAE X;  1Y5N B;  1ZM9 A;  3O1L A;  5AT1 B;  3HO1 A;  4DSJ A;  2ZBC A;  1Y9O A;  1O5J A;  5CD4 A;  3TW0 A;  5A0Y B;  1KHL A;  4WBF A;  4I7F A;  2XMK A;  2QJ3 A;  4QWC A;  2IAJ A;  1UAW A;  4GC6 A;  4NLS A;  1E3C P;  3WAY A;  3VVT A;  3Q24 A;  1NUE A;  2FLP A;  1VQS A;  4LF1 A;  5CYJ A;  3MK1 A;  4JB8 B;  3HPO A;  1T9Y A;  1GX5 A;  1I94 F;  1S79 A;  4E98 A;  1YK9 A;  2DNL A;  1ACM B;  1YIJ S;  3V6J A;  3UN2 A;  1UL3 A;  4P7V A;  4DSF A;  4Q2L A;  3EGN A;  1NHU A;  3EPG A;  4NYP A;  4JI3 F;  4HAC B;  1VC5 A;  3GMG A;  2HND A;  4QIF A;  2E5I A;  2X7I A;  2HNY A;  4WU3 A;  2ZJR Q;  1T05 B;  1RT5 B;  3IO1 A;  1L3T A;  1IBK F;  1IBM F;  3B78 A;  4ED6 A;  2UVU A;  2H5E A;  3HF5 A;  3KJN B;  2IUC A;  1EAY C;  1YBU A;  1SC3 B;  3TZY A;  1YI2 S;  3IR7 B;  1FVS A;  1VJW A;  4PG7 A;  2AJ4 A;  3BO2 A;  4DR3 F;  4UPL A;  2DXE A;  2V2K A;  2R2U A;  2NPI A;  1QTN B;  2GAG C;  2FYX A;  1SKU B;  3HZE A;  2AWZ A;  1B8J A;  1RKI A;  3A52 A;  2QZ8 A;  2I6W A;  3L9Z A;  2XY6 A;  2GHW A;  3M2V B;  3C6U B;  1V6H A;  3DLK A;  1FEE A;  4YDX A;  4ZVU B;  4M5G A;  4ZDN A;  2VON A;  5CXT A;  5GAG I;  3W8P A;  5D0E A;  2CFX A;  3LGN A;  4EZ6 A;  4YB5 A;  1WC1 A;  4AFF A;  3IGY B;  2CNL B;  4RNH A;  3UPF A;  4EBE A;  5HO4 A;  4CT9 A;  2B8Q A;  1R0A B;  1NU4 A;  1HQU B;  3ILL A;  4I2Q A;  1YDL A;  1JNZ B;  4CXK A;  5DLG A;  3KHL A;  3ZZO A;  2B4P A;  3RB4 A;  2J0X A;  1RT4 A;  1UA0 A;  3D7S B;  5KG1 A;  4A8F A;  2R7U A;  2DGV A;  2Y1I A;  1HQA A;  1TUV A;  5DG7 A;  1FFW B;  3PFE A;  3BDE A;  1JXE A;  3KFW X;  5A2Q U;  3BN7 A;  2LP4 A;  2QGF B;  2FJV A;  3EZO A;  4KAV A;  1RK8 A;  1M5V C;  3CCR S;  2UU9 F;  3NWR A;  4LSN B;  2XCA A;  2LQ8 A;  1QM9 A;  3JXO A;  4MIB A;  2BOP A;  3OTO F;  3QO9 B;  1HR0 J;  3PJW A;  3UN5 A;  4Q2M A;  5G4D A;  1T95 A;  4YEA A;  1TKX A;  5J2P B;  4ZP8 A;  4FKX A;  3PKY A;  2AX1 A;  3N28 A;  3KK2 A;  1ROF A;  3CDB A;  4IFY A;  3WAX A;  5DDO C;  2IDE A;  7FDR A;  2EFV A;  3Q8P B;  3CVK A;  1RA6 A;  4OJ1 A;  2DGS A;  5IQQ A;  1TL7 A;  4G6V B;  4LFC J;  4M5L A;  3PYD A;  5A76 A;  2KXN B;  3WAV A;  3OFE A;  2E5G A;  3HSZ A;  1YSJ A;  2DH9 A;  2DIS A;  5ADZ A;  4O4G B;  4F50 A;  3TUP A;  5HVG A;  3M4X A;  3P8B B;  4IH7 A;  3ONQ A;  1KEK A;  4PG8 A;  2ZUG A;  4ILL A;  4YR3 A;  4DDF A;  3ZXW A;  3MGJ A;  4X4P A;  2HBY B;  1EW9 A;  2BM0 A;  2FJW A;  4O44 A;  3VGV A;  2JRS A;  2AJ1 A;  4M94 A;  3BSA A;  2FHJ A;  4QOT A;  3BO3 A;  2MQM A;  4P73 A;  2AYM A;  4MY4 A;  3A8E A;  1QY7 A;  1RHQ B;  4EO6 A;  3KMS A;  1Y3J A;  3M7V A;  1RHJ B;  2VFV A;  2V94 A;  1SVD A;  4V19 X;  1XR5 A;  4BHQ A;  1PG5 B;  3ZZT A;  1XMO F;  4Q44 A;  2VIC A;  5LXR A;  1JLB B;  2DEI A;  1ALK A;  3HFZ B;  3UDE A;  1UW4 A;  1BY9 A;  1MNE A;  2V4Q A;  3SMZ A;  3OQ2 A;  2L9D A;  5GRR A;  3HVW A;  3KNG A;  1YJV A;  3NKY A;  2WVD A;  4NAS A;  1S4F A;  3GFX A;  1C0U A;  4K2J A;  3GCX P;  5LMN F;  5KG6 A;  5DLT A;  4LVN P;  3M6V A;  3CD6 S;  4ZG9 A;  4F25 A;  4M63 A;  4WXO A;  1R6V A;  2HQC A;  4A8Y A;  4N56 A;  2GA7 A;  1VQL S;  2RHS B;  1I5O B;  5BYR A;  2ABY A;  7FD1 A;  3NOC A;  5IS2 A;  3J81 j;  2ZJP Q;  4PQU B;  4YB6 A;  4XIU A;  3R97 A;  1XR6 A;  3KLF A;  1F9H A;  4BLG A;  2HVI A;  1FFG B;  3HHN B;  3RBD A;  2KM8 B;  3IRX B;  5ETO A;  3HHD A;  3M8P B;  5DO2 A;  4OYX A;  1YVF A;  2AGQ A;  3IP0 A;  2Y1L B;  1RIS A;  1Q81 T;  4UY8 5;  4IOA Q;  2HWH A;  3TVZ A;  2GAH C;  2RT3 A;  4EZ9 A;  3W61 A;  2EFQ A;  4FF3 A;  1NPP A;  2HIY A;  1CJU B;  2OPS A;  3MEE A;  2MKY A;  4EGL A;  5ETM A;  4DL2 A;  1Y7A A;  1WC6 A;  4K8R A;  5EGH A;  3FBF A;  3CT9 A;  3M2R B;  3JYT A;  3AXM A;  5HAN A;  2NQP A;  2DB1 A;  4CWB A;  1T9U A;  3R9L A;  2YNI B;  2OIH A;  4OX9 F;  3ZZR A;  2DNK A;  2MKI A;  4F3O A;  5TJ3 A;  2EKY A;  2R7O A;  3TUJ C;  1VLO A;  5IT4 A;  4IQM A;  1URR A;  4TY8 B;  3QFH A;  2AYB A;  2K1R B;  5KFX A;  2VB6 A;  3PRV A;  3CO0 P;  3B4M A;  4HKQ A;  1ZEB A;  1NCL A;  5K9F A;  5GMK a;  3QT5 A;  4C7Q A;  2IM0 A;  1AYE A;  2JLF A;  2CAD A;  4DS4 A;  2ZUA A;  3DM2 B;  5J1E B;  3OXL A;  1D8Z A;  4U7U D;  4U8V A;  2C1E B;  2GGP B;  5CZX A;  1ZH5 A;  2XC9 A;  3D9B A;  4J9L A;  2DXD A;  3FBB A;  5LSR A;  5FLX Y;  3RAQ A;  3WIV A;  3C16 B;  5EWG A;  3ZTR A;  3RR7 A;  2HHQ A;  3BQ2 A;  1RZM A;  2OEK A;  1FRI A;  3BPS P;  5F0W A;  2VFR A;  3BN4 A;  2OPQ A;  4KRW A;  3RB3 A;  3KG4 A;  1HNI A;  2GML A;  1P27 B;  1NSK L;  1IKW B;  1ELX A;  4KQZ A;  1OQ3 A;  2KHD A;  2IYG A;  1M1H A;  1EKR A;  1JMT A;  2MGZ B;  4TN0 A;  1LK5 A;  2V69 A;  3AD7 C;  1ALI A;  3MCO A;  5GAH U;  1BQN A;  2W24 A;  3FNN A;  4KO0 B;  4KB7 A;  1URB A;  2YX4 A;  5F8N A;  4F04 B;  1TFY A;  1EP4 A;  4E8U A;  2KZM A;  3F44 A;  4N76 A;  3BSN A;  1IWA A;  1NK4 A;  4JI8 J;  4LF2 A;  1W2I A;  2XNR A;  4RW7 B;  1F2G A;  1JKH A;  1MWQ A;  3W5Z A;  2HWT A;  4A8X A;  2MY7 A;  5M2U A;  1FNO A;  2V9K A;  3MED A;  5THW A;  1KC8 T;  1FXD A;  3TJ9 A;  4ZP7 A;  2HFZ A;  2P8I A;  2IRU A;  1RWX B;  2LEA A;  2RF2 A;  3QRR A;  1SJ4 P;  2RIJ A;  4Y28 C;  2WAQ D;  2C2E A;  3FEZ A;  2VG7 B;  2B6A A;  4AT1 B;  4M5J A;  3NOG A;  1ZM3 A;  4JOU A;  2FD2 A;  2GHV C;  5A8K B;  4ZMM A;  1NJW A;  4DZD A;  2HFV A;  3J7A 1;  4DN0 A;  3G9C A;  4IR1 A;  3FBE A;  2B4O A;  4RLE A;  5K14 A;  2L9W A;  2XYP B;  1V3R A;  2YX1 A;  2PO4 A;  3M8Q A;  4KPY A;  1VQP S;  4OZ5 A;  1L3V A;  3UD4 P;  3NEK A;  2C2D A;  5KT4 A;  2OH2 A;  1K73 T;  4B9T A;  2W7A A;  2ZOM A;  4X4N A;  2NZ4 A;  1TL1 B;  3SSS A;  2E9Z A;  1WOR A;  4K59 A;  1S6P A;  3KLV A;  4WFN Q;  1KKH A;  2I1R A;  3CWJ A;  1FXR A;  3G4S S;  3D4J A;  3R27 A;  1I51 B;  4N77 A;  4E2F B;  1R8C A;  4DV7 F;  2J8A A;  3VHQ A;  3SZZ A;  3I0R B;  4J37 A;  3TEH B;  2X98 A;  4CO3 A;  4B3O B;  1FTC A;  4C0B A;  2WSC C;  4OZ3 A;  3DGP A;  2J7K A;  2CQ3 A;  2QLF B;  5F9L A;  4OI1 A;  2J6T A;  1FE4 A;  4NZ7 A;  3IG1 A;  5LRM A;  1KQF B;  4CNY A;  2QRR A;  2WON B;  3H20 A;  3ISN D;  4J9R A;  3ZTS A;  1VRT B;  5K4P A;  4ZVH A;  1PKU A;  1TZ0 A;  3BB5 A;  3V81 B;  1UEK A;  3RB6 A;  1SQE A;  2VD3 A;  4Y2K A;  2RKI A;  4U8Y A;  4X4U A;  4HI1 A;  4ED7 A;  3RRG A;  5KFO A;  2QMU B;  3TYT A;  5C2C A;  1EQJ A;  4NI2 B;  5B0E A;  3CB4 A;  2GQQ A;  3TQ1 A;  5KG4 A;  4XK8 C;  4DCO B;  3MR5 A;  1MG7 A;  2KXH A;  2Q6B A;  2JLG A;  1RT6 A;  4R5P A;  4UTG A;  3MUR P;  2KN4 A;  1X8D A;  3AA8 A;  4L3N A;  5E2Q A;  1XMQ F;  4USJ C;  4DV5 F;  4UZC A;  2WOM B;  2LA4 A;  1R43 A;  2YKM A;  4QCL A;  1SIZ A;  4NXM F;  3OXG A;  1NAQ A;  2QLX A;  1WEL A;  1F1B B;  2CPY A;  2XSF A;  3DRP A;  2XYH B;  1ZYQ A;  5ETT A;  2LU1 A;  2NUH A;  1E6V A;  2M70 A;  3KHH A;  3POT B;  3RBE A;  2LMI A;  3KYL A;  4DZ6 A;  1M5O C;  3OTD A;  1P1L A;  3G96 A;  4CO1 A;  4DQP A;  1R27 B;  2E5L F;  2HQD A;  4ZPB A;  2NSC A;  2AZ1 A;  5IV3 A;  3NGT A;  2XLK A;  3VF0 B;  2J9D E;  3C15 A;  4XDD A;  2LYV A;  3MM5 B;  4OMF G;  1RWW B;  4WP8 A;  4M1K A;  2OGU A;  1J2V A;  2R3V A;  5AXM A;  2PN6 A;  4JI2 J;  3VAL A;  1EJJ A;  4PG4 A;  2FVR A;  4ED5 A;  3IGV A;  1B0V A;  3RW6 A;  1FSU A;  3ZZP A;  3PR5 B;  1UVL A;  1FJG J;  3V4M A;  5IM0 A;  4DV6 F;  2E29 A;  2OHD A;  4C48 A;  4YY3 J;  3IRW P;  2YVS A;  2W2Q P;  3BBB A;  4Y34 A;  3IFE A;  1EQM A;  2DIV A;  3GWC A;  5FLX U;  3NNA A;  5DZ7 A;  2OD6 A;  1SJQ A;  5DG8 A;  1SL1 A;  9RUB A;  4MHX A;  3JSB A;  3PX0 A;  5F8L A;  4NXN F;  5B7W A;  4HAC A;  3GJR B;  4RL1 A;  1NEE A;  5L46 A;  4DHV A;  1WOO A;  4UT4 A;  3J7A N;  1M1G A;  4B9S A;  3N01 A;  2QYG A;  1WF1 A;  4MKA A;  2V2V A;  1KQK A;  1S7I A;  2DNZ A;  3GZ7 A;  4YR0 A;  3B5Q A;  4X4S A;  4NLT A;  4USW A;  1KH4 A;  1K1S A;  2VBZ A;  1F9F A;  3ZZY A;  3H98 A;  2EKN A;  3GYN A;  3Q8S B;  3W2V B;  3VTI A;  5CAA A;  1LWE B;  4JP8 A;  4XPE A;  2XHW A;  2V4R A;  2NCK L;  5A8W B;  5DGB A;  4YB7 A;  1R31 A;  2QYC A;  4DX5 A;  2HYI B;  2R8J A;  4DUY F;  4WII A;  1U2C A;  1S1U B;  2CJQ A;  1G1X A;  1S1V B;  1UWA A;  4GKJ J;  2OML A;  1SH3 A;  3JSY A;  1X5T A;  3M2V A;  3C6U A;  2H51 B;  4X65 J;  1NZA A;  4M5M A;  2KH9 A;  5EWF A;  2CQH A;  4CLS A;  2LXU A;  1CJK A;  4CO2 A;  4RNM A;  4FBU A;  3ZNU A;  2W1B A;  1HBU B;  3QGG A;  3NS6 A;  5G0R A;  2I9S A;  2VF3 A;  5DRK A;  5DDP C;  2YWH A;  3ILI A;  5IWA F;  3SQO P;  1S9E B;  3BR9 A;  3OL8 A;  4G65 A;  5E5N A;  1R0A A;  2YKQ A;  2B56 A;  1HQU A;  3K5N A;  2K7J A;  1U1L A;  4NLW A;  1VR6 A;  3OW2 R;  2A6M A;  4R25 A;  3V6H A;  1WWH A;  1UZD A;  1N5T A;  2HGN A;  4USM A;  4Y2M A;  1Q8K A;  1KHW A;  3UNY A;  2UUC J;  2AQ4 A;  3CJS A;  1OPZ A;  1YJT A;  2VBY A;  2ZD1 B;  2GFF A;  1RLD A;  3S8S A;  4LF7 J;  2PMZ D;  1N32 F;  2BJ7 A;  3MM8 A;  3P45 B;  3AAW B;  2H3E B;  4DL4 A;  4LSN A;  5CYQ B;  3G6X A;  4DL5 A;  3N0V A;  4U95 A;  1FDD A;  1IKX A;  3J7Y I;  2ILY A;  2KZZ A;  4OV6 A;  3DYA B;  3QO9 A;  3RGI A;  4YUD A;  4B02 A;  2FUG 9;  2DR7 A;  3NG8 A;  2HUR A;  2BJ1 A;  3K2Y A;  4YS2 A;  2FZK B;  3JQJ A;  3CW2 C;  5J2P A;  1SQG A;  2LQ9 A;  1ZBT A;  1AFI A;  4TKT A;  2QL9 B;  1C1C A;  1HW9 A;  5EGE A;  4LUB A;  2K8G A;  4X4V A;  3H5U A;  1YJU A;  3MPW A;  1H2U X;  3MR6 A;  2XO7 A;  4S0M A;  5IWA J;  3MOJ B;  4ANE A;  3MI7 X;  2HRY A;  3LWM A;  4BS2 A;  1Q78 A;  1BQM B;  4WJB A;  3C14 A;  3ITH A;  1HQ2 A;  1VQ7 S;  4NLQ A;  3QGP A;  1SKS A;  4O4G A;  4ZVS B;  1FF2 A;  2OD4 A;  2QT7 A;  2WSF C;  3T5H A;  1FX2 A;  2GNK A;  1WHY A;  4UOO A;  2D69 A;  3BQ0 A;  4QIG A;  4IR9 A;  4HTI A;  1E6Y B;  2DH8 A;  2LVW A;  3VAJ A;  2UV8 G;  1RB0 A;  2BM1 A;  2W5R A;  2HLT A;  4O0I A;  2KTQ A;  1C1B B;  2CIM A;  2ZNY A;  1WF2 A;  3L7P A;  2X1G A;  3H5S A;  4EBC A;  1RTJ B;  5L39 A;  3AOC A;  3FGV A;  4FYY B;  2U1A A;  5CCM A;  5KFA A;  1TQL A;  1TR0 A;  3I56 S;  4NCG B;  2PA3 A;  5GAE U;  3AOB A;  5D0H A;  2OPR B;  1JLB A;  4NLV A;  4H4O A;  3VGT A;  3OFG A;  1VRU A;  4Q8F A;  2AEF A;  1G3O A;  1YJ9 S;  1F60 B;  1S7H A;  3DHX A;  3CCS S;  2WRM A;  5B09 A;  2DPJ A;  1GXT A;  2COL A;  3FRZ A;  3MFH A;  3T02 A;  1DY3 A;  3SZ2 A;  3FSY A;  1IXK A;  4QAX A;  3HUL A;  2G0I A;  2HVE A;  2C3P A;  4NLG A;  4LFB F;  3D6F B;  1GTE A;  1DZ5 A;  3CED A;  3UCU P;  5EGY A;  3KLH B;  1MU2 B;  2R8K A;  1ZZN A;  4F2R A;  2VG6 B;  1S12 A;  3MK0 A;  4HL9 A;  4RBV A;  4RUC A;  3GII A;  1KFD A;  5SZT A;  4LF9 F;  3H4D A;  4IRC A;  2AF6 A;  4TQS A;  3IRX A;  3HZG A;  1Q8B A;  2GC8 A;  3M8P A;  2KL8 A;  2OEJ A;  4DFJ A;  5BJR A;  4DR7 F;  2M3D A;  2GJ2 A;  3PIO Q;  2GIF A;  2UVW A;  3RW7 A;  1K7H A;  1CJU A;  1VYA A;  4FN5 A;  2BX6 A;  3PX6 A;  3PXG a;  4KM4 A;  2MZ1 A;  2P9C A;  1JWW A;  1V3S A;  2ZNZ A;  4AND A;  3IN5 A;  4AE5 A;  3M2R A;  2NLW A;  4F67 A;  1PCA A;  4ECT A;  5C42 B;  4F4K A;  2VFS A;  3I5C A;  1H73 A;  1TKT B;  2VKZ G;  4LR8 A;  3DYC A;  1UTA A;  1JXV A;  5D0R A;  1N5Y B;  4MK9 A;  4LFB J;  3KG1 A;  1SCJ B;  2HZC A;  4TY8 A;  4QR1 A;  2N4C A;  2MLZ A;  3D1H A;  2FZC B;  1N36 F;  4J9P A;  1KD1 T;  5KTQ A;  2RRB A;  4OYZ A;  3K5L A;  4WCE Q;  3GON A;  3KJV A;  1CSJ A;  1NDL A;  1FDN A;  1AT1 B;  2VA3 A;  2FHM A;  1WKL A;  4MT1 A;  4RZR A;  3DM2 A;  3DMJ B;  5JXS A;  4FNI A;  2FIU A;  1B0T A;  2FGC A;  2RH6 A;  2GGP A;  5LM7 E;  1SQF A;  2AV5 A;  3C16 A;  4DV1 J;  3GFH A;  3VGU A;  2MLX A;  4MFB A;  3AB2 B;  1HI8 A;  2IA6 A;  1TVR B;  2UXC J;  3AOA A;  3NWG A;  2UUB J;  4YHH J;  4KJG A;  1M5S A;  4UOP A;  3S7R A;  4DV4 J;  4XTT A;  4DL3 A;  4WFA Q;  2HBQ B;  4B3R J;  2XO6 A;  1S48 A;  4CYU B;  5LL6 d;  3NMR A;  1WAC A;  2MGZ A;  2BDP A;  3D3C J;  4RWX A;  3BGR A;  4K4S A;  2PFD A;  3UO0 A;  1PJ5 A;  4K5R A;  1F5C A;  1AUS L;  1S97 A;  1EQ0 A;  5LIA A;  4O4R A;  5LQQ A;  5IT9 Y;  3P3D A;  1EAR A;  3HHL C;  4B3T F;  3HSD A;  4J9U E;  3WBZ A;  2RJZ A;  1KOH A;  3UR3 C;  1FVQ A;  3BF4 A;  3BZQ A;  5LRN A;  3M1V B;  2BXJ A;  5GAG U;  1HNW J;  4RW7 A;  3Q8U A;  2VBW A;  2QA2 A;  1NME B;  5GMD A;  4MKB A;  4NYO A;  4LFA F;  3K59 A;  2ZC3 A;  3HP6 A;  2BAN A;  4PWU A;  1S1W A;  1DTT B;  3PO5 A;  2KVI A;  2PSZ A;  1OWX A;  1W26 A;  4TLQ A;  1NSA A;  2JH3 A;  4Y65 A;  5D3G A;  3WC0 A;  4HI2 A;  3R1H A;  4PYD A;  1Q1K A;  2MQN A;  3QT8 A;  4UPK A;  1S0O A;  1CC8 A;  4DL6 A;  5HI7 A;  4ERD A;  2BRL A;  3CD7 A;  3OD2 A;  2W7O A;  5CZV A;  2MHN A;  4WFX A;  1EB0 A;  4PYA A;  1VCT A;  3CIM A;  1TMJ A;  3W9H A;  1T02 A;  3CF5 Q;  8RUC A;  5A8K A;  4QYZ J;  4LBH A;  4OZL A;  2R7W A;  3J81 Y;  3KHG A;  2P9G A;  4IG0 B;  4DQQ A;  2BAB A;  3AHP A;  1RHK B;  1C2P A;  3K57 A;  2F63 A;  3MR7 A;  1K44 A;  2B5J A;  2BW7 A;  2RB7 A;  4I7F B;  5KG0 A;  1NK5 A;  4ZLL A;  1KH9 A;  2XLI A;  3VAG A;  1I6J A;  5KFI A;  4RJV A;  1D09 B;  3TAQ A;  2KHC A;  4U96 A;  2IBO A;  2NUU G;  1TU0 B;  2PD1 A;  3ELH A;  2D9O A;  4U6P A;  1HNX F;  2R8H A;  3TAP A;  4DU7 A;  2EG2 A;  3PX4 A;  2EK6 A;  2PFF B;  4WE1 A;  3HM9 A;  4DQI A;  4KBI A;  4ES2 A;  3RB0 A;  3TG0 A;  4ZJO A;  2VU5 A;  1TK8 A;  3BYR A;  4DUT A;  4B3O A;  4TY9 A;  2GV1 A;  3MPV A;  1VQ4 S;  2R42 A;  2N7Y A;  1E33 P;  4LIW A;  4LIR A;  2ZBQ A;  3TZX A;  3GSI A;  3MTJ A;  2YNG B;  1X4H A;  2IMO A;  3BKT A;  2WON A;  5AJ3 F;  1R7I A;  1VRT A;  1WC0 A;  2V5H G;  3E8O A;  4TN2 A;  4K7Q A;  2A6O A;  3US5 A;  3KD8 A;  4ES1 A;  2IUC B;  2G2Y A;  5L9N A;  3V81 A;  1R0B G;  4PWD B;  3P5B P;  3CE8 A;  3M32 A;  2J6S A;  1GK8 A;  2DHA A;  1NK0 A;  1OY9 A;  4QW8 A;  2NXJ A;  4DEZ A;  3R6L B;  2ALZ A;  2HHP A;  2IM1 A;  1NH8 A;  1YHQ S;  4Y2I A;  2QSW A;  2UXB F;  1HD0 A;  1OY6 A;  3MMC A;  4U9R A;  3MOZ A;  3DLK B;  2OMO A;  3CMQ A;  3IGZ B;  3LP0 A;  4L72 B;  2HFS A;  3NKR A;  3IBC B;  2WOM A;  3H59 A;  4OFZ A;  5RUB A;  2GO9 A;  3FSX A;  1NND A;  3QQC D;  5IC4 B;  5IJS A;  1GEH A;  1DLO A;  1PYS B;  3M8Z A;  2JOQ A;  3J80 Y;  2K7K A;  1L3K A;  3BKF A;  2F8H A;  4ZOS A;  1U02 A;  4Q5V A;  5KAK A;  3WAW A;  4LR9 A;  3MAQ A;  3NGK A;  2Q66 A;  5KFL A;  4RW9 B;  5F9N A;  4P52 A;  2H9Z A;  4X66 F;  4FS2 A;  2WBM A;  4M95 A;  1RTZ A;  1VQM S;  1WUU A;  1CVJ A;  3QWU A;  1GH8 A;  2DNG A;  2AU0 A;  4LF5 F;  3I9Z A;  3UD3 P;  1JK9 B;  4ILR A;  1NSP A;  2LQB A;  5IZH A;  3B82 A;  5BR8 F;  5KG5 A;  3DOK A;  3TUZ C;  2MQ8 A;  1ULR A;  2B9X A;  2XM3 A;  4A8O A;  3MM5 A;  2OFG X;  4B56 A;  1SJ1 A;  4GO5 X;  3S01 A;  2UXB J;  1LW0 A;  3P5T L;  3UDV A;  4GKK F;  5A6W A;  3MF5 A;  3R2C J;  4IO1 A;  2LXI A;  4DR5 J;  1LXJ A;  1HW8 A;  2XGQ A;  1RSC A;  2B7B B;  5HK4 A;  2V0N A;  3HD2 A;  3KK2 B;  3LTO A;  4KKO A;  1EX8 A;  3NKM A;  3F41 A;  3FC9 A;  2DRD A;  4QWA A;  1H72 C;  1TL7 B;  2J8S A;  3NGS A;  3DRX A;  5D4P A;  2CPX A;  1WG4 A;  4OYO A;  3TVY A;  4DSI A;  1Q16 B;  4LQ9 A;  3R5J B;  3K0J A;  4DMZ A;  2IYI A;  3CO9 A;  5E3R A;  1HNV B;  3EVW A;  3NS5 A;  4DJB A;  2XEX A;  2GVD A;  2A3J A;  1DHM A;  4DLE A;  2BW2 A;  4ZVG A;  2W4P A;  4HH1 A;  3PRD A;  4LF8 J;  4W4M A;  3AH6 A;  4ZP9 A;  1S4E A;  2ZH6 A;  5IT9 U;  1LWE A;  1T9T A;  1NO8 A;  1XC9 A;  1G2E A;  2F4V J;  1KLM A;  1OQ6 A;  1T94 A;  2HRT A;  1S1V A;  1QSS A;  5HRO A;  2O66 A;  2UUA F;  1U47 A;  2JVO A;  5KFB A;  1P9Y A;  5LJ5 Y;  2WBR A;  2DIT A;  4NRT A;  1Z1Z A;  3K5P A;  2DK2 A;  3BDF A;  2E1P A;  3PKM A;  1IQT A;  2JFD A;  4I68 A;  3QZ7 A;  1FXL A;  1N33 F;  4L3K A;  4CXS A;  3B6B A;  1R8B A;  1N56 A;  2D3U A;  3M6W A;  2W8S A;  3I0S A;  4DG1 A;  3OVS A;  1S9E A;  5L9X A;  1B4S A;  1LFW A;  1CJV B;  3FJ2 A;  5KOW A;  2XRG A;  4HHU A;  1QAX A;  1ED8 A;  2RDI A;  3QWP A;  2XGP A;  1YGY A;  1FJ7 A;  3BBF A;  2EXU A;  3QAT A;  3GSD A;  2G0C A;  3J81 U;  4UOR A;  2FLN A;  1Y10 A;  2OSR A;  4ED1 A;  3RTV A;  2ZH5 A;  4NL5 A;  3D2W A;  4ZGA A;  1H2V Z;  3QIP A;  3N9U C;  2MZQ A;  4X4Q A;  2OUG A;  3ZZU A;  3AJ2 A;  4P2S A;  4K4W A;  2ZD1 A;  3QBC A;  2DT9 A;  4WKY A;  3QGH A;  3BSO A;  2XY7 A;  2OLW A;  1FES A;  5HSP A;  4ECV A;  3T1H J;  3CCQ S;  5MAO A;  4Y2C A;  1FHT A;  4AXJ A;  4OI4 A;  4FF1 A;  3TJA A;  1IBL F;  3SCJ E;  2QA1 A;  4B9L A;  1NPR A;  3MM6 A;  3BYP A;  2V8H A;  1UZH A;  3H7H B;  3TZW A;  2IRX A;  3FFI A;  3EIC A;  1QAI A;  1NHV A;  1KTQ A;  3M6U A;  3OL6 A;  1WJ9 A;  2C2K B;  2F3J A;  2RUS A;  2O67 A;  3ULH A;  3W5X A;  2ZVS A;  3MFI A;  2EFO A;  2BQ3 A;  2QTW A;  4HDG A;  1NB7 A;  1S57 A;  3HLU A;  3R6G B;  4JI0 F;  2YPY A;  1W7W A;  3W5Y A;  4WIQ A;  3PIP Q;  4DR2 J;  4FKY A;  4PRF A;  4ZVP B;  1Z2Z A;  4DSL A;  1LWC B;  1NKB A;  5D4L A;  2GSO A;  3EE3 A;  1N52 B;  3AJD A;  3CCZ A;  3U7J A;  1E6Y A;  3E2E A;  1N0U A;  3EXY A;  2FJD B;  2F8E X;  2OPQ B;  4FPR A;  2D41 A;  2V8G A;  5H1S V;  1JLQ B;  1IJE B;  1C1B A;  3W8G A;  3BS9 A;  4DSK A;  2CQG A;  4EK2 A;  2PC6 A;  3V4I B;  4IO9 Q;  4QYZ K;  3FCH A;  4ZN3 A;  1Q8L A;  1C0T A;  4EO8 A;  2YBV A;  2CPH A;  2I2Y A;  1WF0 A;  2KG1 A;  3J80 U;  4YN3 B;  1JJ2 R;  1UPP A;  3PDN A;  2KJV A;  4ANC A;  2HAF A;  5L8R C;  2ZIT A;  4ZS6 A;  1GQE A;  3SSR A;  1PJ6 A;  2KKH A;  2CJX B;  2XMJ A;  3AB4 B;  3DFE A;  3Q23 A;  2OEM A;  4LJM A;  5GAD I;  3EZ5 A;  5MLC V;  2N4D A;  5HLF B;  3G82 B;  3UDL A;  2Y0S D;  3PYF A;  3MED B;  8ATC B;  4ZVR B;  3TWZ A;  4WZM A;  3MXH P;  4DPW A;  3KLH A;  5KFE A;  1Y00 A;  1OS5 A;  2RIL A;  3JAM Y;  2YQ0 A;  5F8M A;  2IBK A;  2D3O 1;  4DBQ A;  2M4M A;  3A12 A;  2NYH A;  4C0H A;  4GMK A;  4B3M F;  4B3S J;  3I9V 9;  3TAN A;  4K4T A;  1FI4 A;  1F5B A;  2JVR A;  6AT1 B;  6FDR A;  1MSW D;  3DGV A;  1S1X B;  1B64 A;  2DO0 A;  3OLA A;  4A8M P;  2GO8 A;  1RKJ A;  3CME S;  1VLY A;  3RRH A;  3FRY A;  5K14 B;  2ILZ A;  1OYD A;  1UJ6 A;  2V67 A;  1U48 A;  1BHN A;  1FE0 A;  1DQ9 A;  2PA8 D;  4M5D A;  3PYE A;  2HHH J;  3I96 A;  1RAA B;  2DNN A;  3G8Q A;  3R7B B;  2ZBP A;  1RT7 A;  3NNH A;  4RW8 B;  1SJR A;  3AJ1 A;  4JI7 F;  1KH7 A;  4ZG7 A;  1TUW A;  5I3P A;  3CCW A;  4PUO B;  1XNQ J;  2PI5 A;  2ZM6 F;  1VHI A;  1JLE A;  1CJT B;  3GYX B;  1QTM A;  4CM2 A;  1N5Y A;  1HNZ F;  2YH1 A;  3I4H X;  1ED9 A;  2UV8 A;  2ZHO A;  2AJQ A;  5AE1 A;  4ECX A;  1S5Z A;  4M8L A;  3D0I E;  4KH1 B;  3PW0 A;  4A8K A;  1RAE B;  4F3M A;  2CG4 A;  2MKK A;  2MZS A;  4C4W A;  2CNN B;  5J2Q B;  4NEZ A;  2L3M A;  1N5V A;  1FRM A;  4TVA B;  3Q86 A;  4YB1 P;  4MMO A;  4OHV A;  3THV A;  5ETP A;  3PRB A;  4V19 J;  3DKD A;  2ACM A;  2HPU A;  2XWX A;  4WTO B;  4KGX B;  1IR2 A;  2J0Q D;  3EUN A;  4R8U A;  2DR5 A;  2IFX A;  1TVR A;  1AUK A;  4DR4 F;  5LJ3 Y;  1AJB A;  4HYK A;  1U45 A;  3HFV A;  1U0H A;  2RKI B;  5EX3 A;  3O3L A;  2FB0 A;  3EVO A;  3M6X A;  3KWM A;  3DU6 A;  4PAA A;  3AQO A;  3JTP A;  2ZH1 A;  4AUK A;  4FNH A;  4JI6 F;  4CYU A;  2VQF J;  4DV3 F;  4I69 A;  4JUZ A;  5HVF A;  1UCN A;  3NNC A;  2QSF A;  3K17 A;  3RUB L;  1RT6 B;  1UKU A;  1N54 B;  1SPB P;  4RU9 A;  3W7B A;  1J27 A;  1VBX A;  1ITP A;  2P5V A;  9ATC B;  2NSB A;  3E3X A;  4LRB A;  3QZ8 A;  3PFO A;  4DX8 H;  2W5W A;  2QL7 B;  3UVJ B;  2YKM B;  1U1Q A;  2M9K A;  5FII A;  1YJN S;  2XTJ P;  1VDH A;  1JLC B;  4ZVT B;  2QA4 S;  4ZLP A;  3IWL A;  3M2U A;  3OLB A;  3PTW A;  1S99 A;  3MM7 B;  4C8Z A;  1FA0 A;  2R7Q A;  2AJ2 A;  2EBG A;  1H0H B;  4CCH A;  3GR1 A;  2NPF A;  2D1G A;  5F8J A;  3DRP B;  3T1A A;  3BKU A;  4UY8 T;  2FLL A;  3ZTO A;  3C8Y A;  1MMN A;  1NM2 A;  2FVS A;  3CIZ A;  3HI9 A;  2DRB A;  2KB2 A;  4B9U A;  1WI8 A;  2YWW A;  4N8N A;  3N79 A;  3BPD A;  4GVB B;  3R5A A;  3G87 A;  5F8H A;  5KG7 A;  1TK5 A;  1KFS A;  3D0G E;  1NH7 A;  1OJ4 A;  2EFP A;  1N34 J;  1WD6 A;  3BGU A;  2GJI A;  3C15 B;  1WDT A;  1MML A;  3H42 A;  1LFP A;  4JI6 J;  4IG0 A;  5B0F A;  2YKN B;  4NWB A;  3IR6 B;  3MEC B;  1QAY A;  1REG X;  2VDI A;  4LF6 J;  5KFW A;  5KFD A;  3QAU A;  2VFU A;  2Z8Q A;  2W9B B;  3KHR A;  2ASL A;  1IWG A;  3MPY A;  5KFY A;  3ZTP A;  2RQ4 A;  3J7Y U;  3CCJ S;  3CJ3 A;  3GG0 A;  4QIV A;  3FCW A;  2DBB A;  3P4U B;  2MMY A;  3NRB A;  3HSG A;  1SBR A;  5IM0 B;  1RI7 A;  5DQG A;  5B0D A;  2CDQ A;  2C3Y A;  1W25 A;  3ENW A;  1D9A A;  2IA0 A;  2UUT A;  1LWX A;  1TMM A;  1KNZ A;  4DUZ J;  3DDN A;  1UWB A;  2DHH A;  2WW8 A;  4K5S A;  5LMU J;  2OP5 A;  3M05 A;  3V6D A;  5HP1 B;  2BYC A;  3MMJ A;  2RUG A;  2YNG A;  1U25 A;  4LF4 J;  3RG6 A;  3DDI A;  5K8P A;  2MB0 B;  2O01 C;  3CSK A;  1VFJ A;  2NZC A;  4PWD A; 
#chains in the Genus database with same CATH homology
 5AJ9 A;  1HJK A;  3UN3 A;  4GTY A;  3T02 A;  2G9Y A;  3WAX A;  3SZZ A;  3NKM A;  4LRB A;  4LRD A;  2IFY A;  1ALK A;  3LXQ A;  3DPC A;  4QAX A;  3M8Y A;  2W5W A;  2X98 A;  3TX0 A;  3Q3Q A;  3CMR A;  1EJJ A;  2XR9 A;  5L0K A;  1Y7A A;  1KHJ A;  3UNY A;  4YR1 A;  4LR8 A;  3DYC A;  3KD8 A;  5L0B A;  3WAW A;  4CXK A;  5EGH A;  4LQY A;  4LR9 A;  2VQR A;  3BDG B;  3MK2 A;  2IUC A;  2IUC B;  1FSU A;  2GSU A;  1ALJ A;  3T01 A;  4UOO A;  2QZU A;  3UO0 A;  3BDH A;  3WAV A;  5DLV A;  4CXU A;  1EW2 A;  4GTX A;  4CYS A;  1ELX A;  3BDF A;  3WBH A;  4UPI A;  5GRR A;  2W5Q A;  4ZG6 A;  1AJA A;  5C66 A;  4FDI A;  5LQQ A;  5LIA A;  5DLW A;  5LRM A;  1KHL A;  1E1Z P;  2D1G A;  5KXA A;  1HQA A;  1ANJ A;  3MK0 A;  1AJC A;  4TN0 A;  1KH9 A;  5DLT A;  4UPL A;  1ANI A;  5K4P A;  2W5X A;  1O98 A;  4N7T A;  3NVL A;  4CXS A;  1N2L A;  1ZED A;  2W5R A;  2W8D A;  4LR2 A;  2W5T A;  1E3C P;  5TJ3 A;  3WAY A;  4FDJ A;  2ZKT A;  1ALI A;  4NWJ A;  5LRN A;  3NKQ A;  1EI6 A;  2W8S A;  4ZG9 A;  4MHX A;  4LRA A;  1B8J A;  2GSN A;  4KJD A;  5L0E A;  3A52 A;  4KAV A;  5GOV A;  4LRC A;  1ALH A;  1AUK A;  3IDD A;  5INH A;  1EW9 A;  1URB A;  3OT9 A;  2XRG A;  3NKO A;  1ED8 A;  1ELZ A;  1AJB A;  3MK1 A;  2RH6 A;  1HDH A;  2W5V A;  4B56 A;  4UOR A;  4MIV A;  4GTW A;  1ZEB A;  3IGZ B;  3NKP A;  5EGE A;  4KAY A;  2GA3 A;  1EW8 A;  1P49 A;  1SHN A;  1Y6V A;  3NKN A;  1KH7 A;  1ELY A;  4MY4 A;  4ZG7 A;  1EQJ A;  1K7H A;  3TWZ A;  3NKR A;  3TG0 A;  5HRT A;  3UN5 A;  3M8W A;  3UN2 A;  4ZGA A;  4LRF A;  1KH5 A;  1KHK A;  4NWX A;  1KHN A;  4CYR A;  1N2K A;  4LR7 A;  3M7V A;  4KM4 A;  4UPK A;  3E2D A;  3ED4 A;  1E2S P;  3B5Q A;  4KJG A;  4UPH A;  1O99 A;  1AJD A;  1URA A;  3SZY A;  2GLQ A;  1SHQ A;  2W5S A;  4GTZ A;  5IJS A;  3BDG A;  1ZEF A;  1KH4 A;  2GSO A;  4UOP A;  1E33 P;  2ANH A;  4LRE A;  3IGY B;  1ED9 A;  5IJQ A;  3M8Z A;  3T00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...