3TWZA

Phosphorylated bacillus cereus phosphopentomutase in space group p212121
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
KYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 139
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3twzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3twzA01
1EI6A 3DYCA 3WAYA 4UOPA 2GA3A 4GTYA 5IJSA 1ED9A 1SHNA 4CXUA 2IUCA 4UPHA 3UNYA 2GLQA 3WAWA 4LRAA 4KM4A 1ANIA 4GTZA 2W5RA 5DLWA 1ZEBA 4GTWA 2XRGA 1ALHA 3M8WA 1AJCA 3WAXA 2X98A 3NVLA 4UPKA 1ZEDA 1ED8A 3NKOA 1O99A 3UN2A 4CXSA 3WBHA 3KD8A 3SZYA 2W8DA 1E33P 2G9YA 5GRRA 3NKNA 4MY4A 1URAA 1EW9A 3DPCA 4LQYA 3SZZA 2W8SA 1ELXA 2GSNA 5EGHA 2W5WA 3BDHA 1AJBA 1Y6VA 1EJJA 4FDIA 4MIVA 5EGEA 3B5QA 4LR7A 3CMRA 4CYSA 1AUKA 1E1ZP 1EW8A 5K4PA 4KJGA 5KXAA 3OT9A 3WAVA 4UPLA 1HQAA 1AJDA 4LRCA 5L0EA 4LRBA 1KH9A 4B56A 1P49A 1ALJA 5L0KA 1URBA 2ANHA 2W5SA 4ZG9A 3T02A 2D1GA 5GOVA 5LIAA 3LXQA 5L0BA 3IDDA 4CYRA 3TX0A 1B8JA 3NKRA 2W5QA 1SHQA 3UO0A 1E2SP 3IGYB 1KH4A 3BDGA 4NWXA 4N7TA 1K7HA 2W5TA 1EQJA 1ELYA 3M7VA 4YR1A 3E2DA 4LREA 1ANJA 4UPIA 2VQRA 1N2LA 3MK1A 5C66A 1KH7A 4UOOA 5LRNA 3T01A 4NWJA 3A52A 2W5XA 4FDJA 4ZGAA 5DLVA 4LRDA 4GTXA 2GSOA 1ALKA 4LR8A 4KAVA 4ZG7A 2RH6A 3M8ZA 5TJ3A 4LRFA 3UN3A 1ZEFA 5INHA 3M8YA 2W5VA 3NKPA 1FSUA 1E3CP 3BDFA 2QZUA 3Q3QA 1ALIA 5LQQA 4ZG6A 3NKMA 3IGZB 3BDGB 1KHNA 5DLTA 4KAYA 1KH5A 3ED4A 2GSUA 3T00A 1O98A 4UORA 1HJKA 1KHJA 3NKQA 4TN0A 3TWZA 3TG0A 4QAXA 2ZKTA 4LR2A 1ELZA 1KHLA 1EW2A 1N2KA 5AJ9A 5LRMA 5IJQA 4CXKA 3MK2A 2XR9A 4MHXA 1KHKA 2IUCB 4LR9A 1Y7AA 1HDHA 3UN5A 3MK0A 5HRTA 4KJDA 2IFYA 1AJAA
chains in the Genus database with same CATH superfamily
1WSVA 1YZ7A 1WG5A 2O5DA 3W2VB 1Q5YA 3B8HA 1DLOB 3D7SB 4NLVA 2MQ8A 2CPIA 2FJVA 3BPSP 2CYYA 1XR5A 5D8HB 1WORA 2R2SA 1IBKJ 1ZAWA 3TVKA 4RNFA 4YY3F 1JLBA 1GEHA 4K4XA 4M5IA 2CPEA 4JI6J 2YX7A 2XY5A 1Y6VA 1M1GA 1NZAA 2COLA 2ZOMA 1M1HA 2WVEA 1IBLJ 4P72A 1YBTA 2ZH3A 1L3VA 2B8PA 2IRYA 2O67A 1TKTB 3QT8A 4TQSA 3PO5A 2IM2A 1F5AA 1VISA 3GJSB 1DY3A 4P71A 1U1PA 4CXSA 2HQFA 2QC3A 2ZE2A 3G8QA 5HMYA 2GV1A 3W5YA 2PFFB 3SEOA 1UPMB 2W2QP 5GRRA 4ZP7A 2DITA 5M2PA 2FDNA 2ZNYA 1AROP 2KT3A 3ZNJ1 1VYAA 4QW8A 5C25B 3KK1A 5L1KA 1B0VA 2ZBCA 3OV7A 2E5HA 3IXQA 4UUXA 3BSOA 3SXLA 3H2UB 1YBAA 3RAQA 1S76D 4DV2F 3CIMA 3M32B 1SJ3P 3HXMA 3CGIA 2B51A 2XYHB 3A13A 3KFWX 4IFYA 1UEKA 1G4CA 1RAAB 1VHIA 2RDDA 4DV5J 1BC6A 3NGKA 3CJ4A 2POKA 4LBIA 4U8YA 3LF0A 1Q78A 3I5CA 1GTEA 2HBQB 5C24B 4ECQA 3GU0A 3ITHA 4ZS6A 2ZJRQ 5KG6A 5DJBA 4P10A 3T02A 5LSLA 2CJQA 5KFFA 2QL9B 2R7RA 2XNQA 1SJFA 1MU2A 4QIWD 1SKUB 2ZNZA 3VR1A 2AIRB 2AWZA 3IP0A 1U6ZA 2RJZA 3NEKA 2KZZA 4N8NA 1UTAA 3OR2B 4OHZA 2GMJA 5D3GB 4A8YA 2MSTA 1FWKA 1RTIB 4ZPDA 3U1LA 2AGQA 1W2BR 2Y9HA 4HL9A 5ETPA 2R4FA 5IV4A 1SVDA 1U0HB 1XR7A 1CJTA 4KSEB 3GFZA 1N48A 4M5NA 2FY1A 3DMJA 5H9FJ 4ECYA 4I67A 1PAEX 3DM2A 4LR8A 3SI8A 3OTOJ 1BMQB 2K7KA 3H59A 2K1RB 2V9KA 3IRXA 4AQYJ 4K4YA 3PJXA 1WWHA 4USJC 4TU9A 1CC8A 3PJWA 3L7UA 3HHKA 2VJUA 4JI7J 5T7LA 4GVLA 1EP4B 1FRHA 1CVJA 4KGZB 4DFJA 4ZVUB 1HHSA 1XNRF 2E1CA 3G82B 5HANA 4K4ZA 3GYGA 2VDIA 4DV6J 3ZC4A 2RT3A 2HMIA 2DRAA 1G1XA 2MQPA 2J0XA 2J6SA 2C2MB 1C4CA 2YXLA 2DXFA 4OX7A 2GGPA 3TJ8A 4CLTA 4LQ3A 1HKAA 1NPRA 2LYVA 3DXBA 4DPXA 4X4OA 1RWMB 1SH0A 3BGFA 2I8EA 2OPQA 2IAJB 3CVKA 1RACB 3QIPB 4OYAA 3BF4A 3ZZPA 5J1NA 5KFWA 4X4SA 4YR2A 3SSSA 2IYIA 1X4DA 2OFHX 4NLOA 4LJMA 3VAHA 1D09B 1U6FA 1RK8A 2EEYA 1VQ7S 2PO4A 2V8VA 4LR9A 1M1KT 3R27A 2BM1A 1FJ7A 1S57A 1ITPA 1VQOS 2ZWPA 5HRTA 4X4RA 3H4DA 1B3TA 3NMRA 2J7WA 4EMDA 4TU8A 1N32F 4C8MA 5IJSA 2VPXB 1HBUB 3LPEA 1AUSL 1FRMA 1OY8A 4L75A 2CPJA 4NLRA 4W4MA 5F3ZA 2IUCA 3DHWC 3EVMA 5M2RA 4Q8FA 2DGWA 1E6YA 1WF2A 4F0MA 3PCOB 2QZ8A 4EYIB 1ZEBA 4USWA 4UZBA 1NJWA 5A76A 1FCAA 2X98A 1KLMB 2E7XA 2FGOA 2DCLA 5ETLA 5IT4A 1U09A 2DNPA 4YB7A 3RAXA 2MHNA 2L3MA 4WFXA 3TP2A 3UCZP 1BQXA 5IXUA 4DL6A 2CQHA 1HBNB 3A12A 3NNHA 2CWKA 4FN5A 5F8MA 1ZEDA 3H42A 3HDSA 1TV6B 1TZ0A 1VQSA 4D3GA 2W7OA 3VAFA 1RQ0A 2BBEA 3TUZC 3KLIA 3FBEA 2NR0A 2DY9A 2CIMA 2QN6B 3R5JB 2FVSA 2JFKA 2I38A 2JEGA 1K0TA 1URAA 3NKNA 3HKWA 1ELXA 2D7SA 1PBUA 4ZHRA 2GSNA 3ZZTA 1A6LA 4DZ6A 2VA3A 1HIYA 3DLKA 2WOMB 4Z2XA 2XZWA 3CF5Q 4LF9J 4Y34A 1V3RA 2XMAA 2ZDPA 2W25A 4DPYA 5E3PA 2VKZG 3MD1A 3MAQA 1HD1A 2EFVA 1H72C 4JI8F 4DR4J 4UF4A 1HQUB 1AJDA 1PKUA 2Z0GA 3KHGA 4Q44A 1JWWA 2IFXA 2YX1A 2B9XA 2HURA 3FRYA 2D3O1 3RBZA 4ZG9A 3LPYA 2HQ3A 3D9BA 1ICEB 4DQQA 2N7YA 3W3SA 4NLGA 3LA0A 2PEBA 4B08A 1JIHA 1SH3A 1SQGA 1P8GA 5LJ3Y 3C15B 3QT6A 1NK9A 2PI4A 3D6FB 5CYQB 2CPDA 3ZTPA 2AD9A 4F2RA 5DLTA 3OBIA 4NLPA 5BYRA 3DLJA 3MAHA 4LFAJ 4ZLPA 2W5QA 5EX3A 4CLLA 1BY9A 2B4PA 4E0DA 3N0VA 4TLQA 2AJFE 4ZVRB 3DGPA 1YDLA 3MPUB 3H5YA 1PCAA 1YRXA 4O4GB 3F73A 5AJ9A 1N2LA 3EGVA 5CCLA 1S1TA 5L38A 5J1PA 3WHIA 2LCWA 1T02A 5KFSA 1MSWD 5L1IA 2GX8A 4FP9A 1C1CA 4OI1A 4PG8A 1LNQA 2CQ1A 3IN5A 1YX2A 3R5DA 4WTYA 5KFDA 3B82A 3CCUS 1K44A 4BCAA 2VC0A 2BVZA 3GB0A 3GFXA 2DD8S 2F63A 2MZ1A 2AGOA 3DLGB 1Q5VA 2HAIA 1UFLA 3PFEA 5EWGA 3PR5B 3CPWR 1RT1B 1WHXA 5KG0A 5F8HA 1LK5A 2KT2A 5E5NA 7FD1A 3KLFA 1K1SA 1VCTA 2ZC3A 4MKVA 4NLYA 4J9LA 4F4KA 2NS1B 1BQNB 5DLGA 4ECVA 4HT7A 4W92B 4URQU 2JVOA 4I2QB 4YDXA 5A8KA 1SL1A 2ZBRA 5H9EJ 1S4FA 2VL1A 4QZVB 3S7RA 3VTIA 2VHGA 1KH5A 5D0GA 3NGUA 1NBEB 3MECB 1UJ5A 3DI6A 3NKQA 1N0VC 4DV3F 2JC0A 4HH1A 1NO8A 3CNQP 4LSLA 2ZKTA 4QWEA 5FJ4A 3AA8A 4LF8J 2XHCA 3CJTA 2V4JA 3CO0P 1QD1A 2EFQA 2ZE2B 2HBZB 4QR2A 5G4DA 4BWMA 4DXLA 5JUMA 3R2CJ 4X4NA 1C0UB 4RUCA 1TL7A 3K5NA 1EETB 2D74B 3EVWA 3R8YA 5KFRA 5HLFA 3C6UA 1U1RA 1FVSA 2M88A 1HNXF 1VQ8S 3J7ZT 2E44A 2XG8A 1HR0F 1OO0B 1RI7A 2QLBB 5LXYA 3MEDA 2DNHA 3NLCA 3TNVA 3W9JA 1T8EA 1JX4A 3J7A1 1EX8A 2ASYA 2AW0A 4ZJQA 3OVBA 2W2NP 1FJCA 1BGXT 1VRTA 5E2QA 5FD1A 3U1MA 4HYKA 4K4UA 2GQ2A 5L8RC 1AFIA 3FEZA 5CH7B 3D6MB 3Q2SC 2KO1A 5IC6B 4JV5F 2VPWB 5DLWA 3EGWB 4DV7J 4G1QA 4CZCA 3MDFA 2PN6A 3THVA 3CJ8A 4DCJB 3CDAA 2PA3A 3DDKA 3M05A 5KT3A 4NOHA 5J2QA 5C42A 4CWBA 2RKIB 2BQRA 3WIUA 4IQXA 1WDTA 2J9EA 4I0WA 3D54A 2ZH2A 3UFCX 2RUGA 2KG1A 1U8SA 3KD8A 4FBTA 3MM8B 4FYDA 2GFFA 4KQZA 3HVRA 3C46A 1RT7A 3TJAA 1SJRA 3M30B 1YJWS 3H90A 2XCPA 4HEA9 2DNQA 2ZOFA 1S12A 2ZH1A 4TN2A 5KFUA 3RUBL 1F3VA 1NHVA 1WHWA 1WI6A 2CZ9A 2E7WA 3P96A 3QYYA 3TQEA 3GV5B 3KNAA 3L7OA 1H73A 1B7YB 5K8NA 2DHAA 3KUEA 3R7BB 2MDAA 4K5RA 5D0HA 2KT5A 5A8RA 1Q82T 4M5JA 4MAKA 4P2FA 4BHQA 2XO6A 1KQSR 4B3OA 1KH9A 1RT6B 1SB6A 1T0TV 2HFUA 2IIHA 3MEEA 4CYUA 5LJ5Y 2BQUA 1IKXA 2X1FA 4PWDB 2HWTA 1PYTA 3A3PB 4ZVQB 2DHSA 2LQ9A 3BGUA 1X7VA 4JI2J 4B56A 1C0TA 1RYRA 3J80U 1PG5B 1SC1B 2DNZA 2G4BA 3MD3A 4DV0J 4DV1F 3HHNB 2AP6A 4ZVOB 3CTRA 2LEBA 1FKOA 3RZAA 2LXIA 2QMWA 4Y0FA 3A3OB 2XSJB 5F8IA 1NSKL 2PA8D 5F0UA 1N88A 2QE5A 2YBVA 1KRPA 4FS1A 1F5BA 2YPZA 1RT5B 2D9PA 4R25A 5HBMB 3G8SA 2OAUA 1UA0A 4DFPA 1UVMA 2DTJA 2QL5B 2UUCJ 4QU6A 3Q8SB 2BA9A 3TR5A 5B0DA 1GQEA 2XO7A 1LV5A 1RSCA 2EXUA 2LEAA 3GG0A 3D2WA 1OQ6A 2DB1A 2V34A 1N33F 2BJ3A 5DLVA 2RS2A 4OYWA 4DG1A 4M5GA 3ZFVA 2HNZA 1VRTB 2C1EB 4NRUA 3PZPA 1Q8LA 3DOMA 3NBPB 2AMCB 1JLGB 2HKEA 2VV5A 5KFZA 2WK4A 5B0AA 2IMOA 1NNDA 4FNHA 1S0MA 4DR1J 4QR0A 2CJXB 3M8YA 5CHCB 4Q0BA 2NREA 3RU0A 4LVNP 4AXIA 2JH3A 3UDEA 1WF0A 4GVBA 1R6YA 2DNNA 3N6NA 4FVCA 2DGQA 1CULA 3M9MB 4FF3A 1BUXA 4YB6A 2V4JB 1TUWA 3FKBA 3L4BC 3MTJA 1HBOA 3N79A 3NY0A 3WBZA 4ZLLA 5KFKA 1L3SA 3ED4A 1VS3A 2XZDB 4KO0B 4NRTA 4CQ1A 4J9RA 3TANA 1J27A 4ECRA 2CG4A 4WP3A 1U49A 2RNEA 3V2UC 4PR6A 1LXNA 1BLUA 3R3TA 4RNMA 4ZK7M 1XIQA 3MM5A 5D6GA 1HPZA 3L9ZA 1RE1B 4F4YA 4IOCQ 4CXKA 3C6TB 2XR9A 4TY9A 2DRBA 4MHXA 3GIJA 1LEOA 1ZM9A 2K7JA 4K8RA 1RT3B 1WTBA 3C8YA 4M8LA 5DLFA 2HQGA 4WP8A 5F8LA 4QCLA 1CEZA 3CC7S 2J9DA 2OO4A 1ZPWX 1UWBB 1R43A 3ILIA 4B3SF 1AJAA 1R0AA 3T5KA 4V19X 4YUDA 1Q0NA 2UVRA 1UJ6A 4DL0C 4RX6A 5B7WA 3G9CA 1S1UB 2Q6CA 4TKTA 2XGPA 2HFSA 4CT9A 2JHEA 2BKPA 4F02A 2XC9A 1RBAA 1WEXA 2QYGA 1EKSA 3P5TL 1DAXA 2MTLA 5IZHA 3TAPA 1U26A 3C14A 2UUCF 1PILA 2K2PA 2DT9A 4X65J 5L0EA 2OGUA 1UVLA 5GADU 3MR3A 1HA1A 4ICLA 4CIOA 1DJ0A 2X3DA 4UOGA 4DL4A 1ED8A 5H9EK 2GHVC 5D78A 2QLJB 3WC2A 3Q86A 5I42A 3TARA 1FNMA 3W2VA 3PV8A 1S0NA 1VJWA 3M8QB 1E33P 1D3WA 1Q8BA 3O5TB 4LIRA 1X9WA 3PDNA 3HULA 2KJWA 1X9MA 3IBFB 3JSYA 4MY4A 1OY9A 1SV5B 1UVJA 4LQYA 2W8SA 1YLXA 4DCOB 2YWHA 1S1VB 1NXIA 1NB7A 2ZM6F 3W64A 5B09A 5L39A 5KAKA 5A0YB 3V6JA 4FKXA 1TKXA 3VGVA 4O3NA 3JTPA 2FJAB 3QT7A 4LF1A 4DPWA 4LF8F 5G0RB 3CMRA 3I0SB 5E0OA 2QL7B 3BN7A 2DRDA 2YKAA 3F0NA 3TZZA 2PGCA 3BR8A 3I55S 4DV6F 3U27A 1RYSA 5A2QY 1ZZFA 2RB7A 2YKPA 4QWCA 4KHMA 4DF8A 1VQPS 2ZH8A 2QIFA 1AFJA 3AD7C 5HP1B 5KFVA 3KXDA 2HAFA 3I9V9 3PFOA 4PEOA 5F3TA 2RRAA 5I3QA 4ZLNA 1KVIA 4ZHRB 4WU2A 1S6PB 2WB1D 4IFVA 4DMZA 2CPHA 1RT4A 2D1GA 5KOWA 1FDBA 1DTQB 4DI6A 2AJQA 3KLIB 2IHR1 3I0SA 2CJ9A 4F04B 4AUKA 4E98A 2VFSA 3AA9A 3EZUA 1VRUA 4MKBA 2KG0A 3I5BA 4OYMA 2KTQA 1K7HA 3RBDA 1A0OB 3M7VA 2NYHA 2BJ8A 3HSGA 2MKCA 4PKDB 2CNOB 2I0XA 3H40A 1HQEA 2W8LA 1IBLF 4ANCA 1B64A 1S6OA 4EGLA 1Y5LB 2FHMA 3CJ2A 3LAMA 3R5CA 4FDJA 3JQMA 2ZWOA 1UA1A 4CH1A 4J9KA 1S72S 2GJIA 4AL7A 1OYEA 2V50A 4UQGA 3LGNA 5E3CA 5AXKA 4QIEA 2XCAA 2GCFA 3AHPA 1QM9A 3Q8VA 2V2VA 4J37A 2W5VA 1E3CP 1XK8A 3UWTA 5FLXY 3M6XA 2LQ5A 3ONQA 3MEGB 1HNZJ 2DHXA 2XWXA 1YRUA 2CPFA 1VQNS 3QGIA 4NX9A 1YBUA 1SL2A 2ATLA 1IJFB 1S9GA 1K9MT 2M0GB 2DGVA 1URRA 3SMZA 4F3MA 4CLUA 4EYHB 1Q81T 1NJXA 1NK8A 4ZCKA 5KG7A 4Y2IA 1O98A 4KY3A 3IS9B 2Q6BA 3E2EA 1N36F 2CQDA 2HHUA 4UOHA 1RHUB 4KGMA 2N4DA 4HLBA 1IR0A 3TAMA 1WD6A 2NUHA 1FF2A 3POTB 3G96A 1EW2A 1F2GA 4PG6A 1KVKA 1SC6A 5J2PA 3I0RB 3WX8A 2KH9A 1CJVB 1KHKA 1NMEB 3MM5B 4DFKA 2AQ4A 1EP4A 2DNLA 3GIIA 2EFPA 4OYIA 2BJ7A 2RH3A 3A3NB 5DM6Q 2ZH6A 4CCHA 4Q8EA 3I56S 3GG1A 3PW4A 3PEHA 5D4LA 5DZ6A 1F9HA 3SCJE 2XMJA 4ENOA 1MWZA 2RILA 5JVGQ 1HNIA 1O6XA 1WC5A 3MM7A 1Y9OA 4OMFG 4XK8C 2MKKA 2QLXA 3K17A 5SUHA 3TW0A 3UNYA 5HO4A 2QYCA 1RWXB 2YH0A 4EUVA 1X4BA 4M5KA 2PE8A 4DX8H 1T94A 2GMLA 3BGRB 4WCEQ 2BOPA 1X5OA 3FEYB 2ZH9A 1Y5NB 5K9FA 3Q8QB 1NB2A 4TYBA 4ZP9A 1WC0A 2CFXA 4O3OA 3GWCA 4Q0BB 1B70B 1RHRB 2B6AA 3DLEA 3HHLB 3MAAA 2YWGA 4J9NA 2HK2A 5D77A 2JWNA 3BYPA 2JDJA 3CJRA 4MYTA 3IG1A 1R8PA 4CLZA 2N3OA 2UVVA 1MNEA 4IYQA 3OR1A 4L3NA 2HNZB 4Y28C 3DDIA 3W7BA 1T05B 4DR7F 3MCMA 3NKRA 2HWHA 2HK3A 2HHXA 2IY5B 4IO1A 4DV4J 4O4RA 8RUCA 2B8QA 3ZZRA 5HROB 1ZM3A 2G2ZA 3AJ2A 1S10A 2G9YA 5CAAA 5A8WA 4NASA 3IRWP 2L9DA 2P5VA 4NZ0A 1B99A 3NP5A 1TL7B 2KU7A 3MMCB 4ZPCA 5ADZA 4ZITA 2CPZA 2QV6A 1RWOB 3MM7B 5FDLB 4CLFA 3T5JA 3CCLS 4KPCA 3AOAA 5F8GA 1REVB 2YNIB 3KLEB 1CJKB 1Q4RA 1WI8A 3M8PB 3AODA 3D0HE 3W8GA 1GNKA 2V8DA 3NOCA 1N6QA 4KJGA 4MKAA 1NJYA 2F8EX 1R8CA 2CDRB 4XTTA 5A0YA 4HI2A 1MWYA 5J2PB 4ECSA 5DO2A 4DSLA 4JV0A 3W1YC 2RUSA 2XEXA 5KFTA 1URBA 3H2VE 4JYAF 2YNFB 2H5IB 1AA1B 5LIAA 3RJMB 3I5AA 1BE4A 3LWLA 2ZD1B 4P7VA 3QAEA 4ZCMA 4I2PA 4G3IA 4F0HA 4C0OC 1JLCB 4JI7F 3TZWA 1JLFA 2G1DA 3BZQA 2IC3A 4U7UK 4J9PA 4KE5A 1S9GB 3CDEA 2HZCA 3GFHA 2XQCA 1J5EF 1HNWJ 3N28A 2GA7A 3VCDA 2RHQB 1ANJA 3FCHA 2AZ1A 1K8AT 4RU2A 3GYNA 3M2UB 1FESA 1N52B 5KT6A 5LRNA 2D1CA 3PJ9A 1NSAA 1R0CB 2XBPA 2WVCA 3A52A 1HD0A 3E3XA 1XC9A 1D8YA 4C3KA 1Q53A 1R6VA 3UVJB 2M8HA 4D3HA 4EO6A 1DLOA 1WC6A 2PSZA 3PNIA 4RNNA 4X4TA 3IWXA 1K0VA 3BJYA 2GIQA 2QO3A 4Y2AA 2PFDA 1RHJB 1QTNB 1IM4A 5KOXA 3ET6B 4L3KA 2OTLS 1PO6A 1M90T 3H2LA 2WZ1A 3K8VA 2Q1LA 3FK4A 1IUJA 4J90A 3WZ0A 4OYBA 1EZZB 2W2OP 1ZBTA 3BQ0A 2EBEA 4JI6F 4YY3J 1GX6A 4X4PA 2WONB 5J2NA 1KHNA 4DOZA 2HHHJ 4DR3F 1EARA 3UW1A 5AJ3J 2UP1A 4I64A 3GSDA 1VQ5S 3CD0A 3DRSA 3RB4A 1FEHA 4KHPJ 3C19A 4IUFA 5KFOA 1WC1A 5HLFB 1ZA1B 3FRZA 3OD2A 2ZJQQ 1J2VA 4Y2CA 4EBDA 3QO9A 1ZTWA 3NOGA 2RAQA 4NEYA 4OJGA 1UJ4A 3CIZA 3MURP 1SH2A 1URNA 4OX8A 1WOSA 4ZPWR 2FZGB 3DCAA 4LSLB 3P45B 1YJ9S 1NU4A 3ZZYA 3SSRA 5DDQC 4BC7A 4JI2F 2MZQA 1XNRJ 3ADAC 1VK3A 2DH7A 3WAYA 4EBCA 2O01C 2QMXA 4HTJA 4RW6A 4LFCJ 5F8JA 4NLTA 3NL0A 3N9UC 4DFMA 1SHNA 3JB9k 3NXZA 3CW2C 4CXUA 1YK9A 3ZZUA 4ES3A 4P9SA 3PW0A 3R5BA 3PX4A 2ADCA 2KZMA 4GTWA 1JB0C 2YWEA 3EXCX 4B9MA 1Y00A 1WG4A 2G2OA 5IM0A 5EDWA 3QSYB 4UPKA 4RW7B 3V6DB 2DJWA 3HMJG 1R3NA 2Z58B 8ATCB 1G6BA 2W2MP 4BS2A 1O99A 3F41A 2HZVA 1CS4A 2DNYA 1XMQF 1VJQA 3M1VB 1C1CB 1EKRA 4E2FB 2FLNA 3N6MA 3QIDA 5EGYA 4JYAJ 1VHFA 2H4YB 3I87A 2DNKA 4Q2MA 4B17A 4LFCF 3QFWA 3SCLE 5KFJA 4CM2A 1U1NA 3B78A 4V1Ak 3HHLD 4U7UD 1Y3KA 1IVZA 3RRGA 2W01A 5DG9A 3OLAA 4K2JA 4FDIA 3K2YA 5J1EB 3MF5A 1FRJA 3Q8PB 2AU0A 2OMLA 5KT7A 1S0OA 2AV5A 3S01A 1YHQS 1SBRA 3KJNB 1V3SA 2KM8C 3OHBA 2IVMA 2AYEA 1EIYB 4WYLA 2KHCA 3FMBA 1DTTA 5LM7E 1FHTA 1RT3A 5KFXA 1C1BA 2BE2A 4F3OA 4OHXA 1YGYA 4YHHJ 4JI4F 1N5SA 4M5LA 2FJEB 2J0WA 1X4HA 1TL3B 4ZPVR 1D9AA 2ZFHA 4HHHA 4ALZA 4MT1A 4X64F 1TKDA 2NQPA 1AW0A 1JLFB 3RB0A 1WEYA 2V2QA 1HYSB 1RT7B 3CDWA 4I1TA 3JQJA 3QBCA 3IDDA 2Z2MA 4TU7A 4C48A 1IJEB 1SPBP 2C2OB 2Y1RI 4KT0C 4ED7A 3HHLC 5FDLA 7FDRA 3WX4A 1XMOF 2IMWP 1KH4A 4N7TA 3EYZA 1SKWA 2RKIA 4A8FA 2MHEA 3TQ1A 2VG5A 3UR3C 4J9MA 1LKZA 1X31C 3MXHP 2BW2A 1E6VA 3IAM9 2MJUA 4LREA 2ROEA 3UPFA 1RTDB 2FLPA 3MK1A 3LALA 4UOOA 1AXQA 5HROA 4G1QB 2ATCB 1D0EA 1FXRA 3SQOP 4HHUA 2VBYA 2QGFB 1CQMA 2WTFA 2CVIA 3LUYA 3MOZA 2JFDA 4LF7F 4IR9A 1TV6A 1DURA 1WC3A 4P75A 3N5FA 1UPPA 4KAVA 3IG1B 3E01A 3NS7B 1FX2A 2J8AA 1UZHA 5H9FK 1OSCA 3CB4A 3DYAA 1KQFB 1S0VA 1MROB 1LXJA 2P6SA 1EAYC 3AAWB 2CNLB 1HWLA 1FSUA 2P9GA 3QRQA 2IDLA 4V19J 1RLCL 3QGHA 2ZHOA 3Q23A 4KV8B 3HP6A 5LMUF 4BDPA 4FF4A 2B4UA 4ECUA 2JEIA 3NKMA 3ITHB 4IRCA 2RRBA 2H51B 4YR0A 3OUYB 5KFMA 2RU3A 3SV3A 2UVWA 1DARA 1FO1A 1VMBA 3CCQS 2FHJA 2XSJA 3AB2B 1HFEL 3TWZA 1A9NB 1FKOB 4IFYB 3TG0A 5ETKA 3VGTA 1IM6A 5L46A 3ZZOA 3CC4S 3M8SA 2F7VA 2J8SA 1GT8A 4RKUC 4M5HA 4DSKA 3HJFA 4O44A 5BXIA 3MWBA 1BQNA 2LMIA 3HFKA 1ELOA 3W9IA 4OJHA 1Y7AA 1VC5A 2LU2A 1I94F 4URSA 2DKOB 3CJSA 5B0CA 3CULA 5LMUJ 4KJDA 3UNGC 1UMJA 1NKCA 2CQBA 2FLOA 3DOLB 3PACA 3V4MA 4Z7CA 3LP0B 3IM8A 2E9TA 2ALZA 3ZNUA 5LXRA 4WFBQ 1R8AA 1X5SA 2E1PA 4DSIA 4CO5A 4DBQA 3QZ8A 2PC6A 2XMVA 4QQBA 3TX8A 1S59A 4MIAA 3BN4A 4USHA 3M30A 4JUZA 1W7WA 5K20B 1DQ9A 1IR1A 4C4WA 2NZCA 3G6XA 5J2MB 3PY8A 3QMQA 4RBTA 3OFFA 4X66J 3MPDA 4PCQA 4LF4J 3D66A 2MZSA 2C22A 1FRIA 3OLBA 1RZMA 2B0GA 2LU1A 3MR5A 4C8ZA 2BRLA 2NZ4A 3IFEA 1ACMB 3HJVA 4RW7A 3LOUA 2HNDB 4RJVA 5IM0B 2UVUA 1OPZA 3M6UA 2N4CA 1JQGA 1TUGB 3MR7A 1RJJA 5KTQA 1U4BA 3DPCA 2VOOA 3ZZ0A 2NSCA 4P52A 4CRJA 5EGHA 1VIOA 1WF1A 1RB0A 3QLHA 3BDHA 1WUUA 1NSQA 3HD1A 4MIVA 4RBVA 2HG4A 4Y2KA 2I6WA 1JJ2R 2OIHA 1DBDA 1TU0B 3R5AA 1H7WA 1CJUA 4M1KA 4RU9A 1H6KX 1LWFB 1TL4A 2CQ4A 2HVZA 4ZIVA 5B08A 2X7IA 3PHEA 2VKRA 4PG4A 4WFYA 3WAVA 2MXYA 3M4XA 1Z1ZA 2B4OA 2ACMA 1C0UA 4LRCA 1CG2A 4ZA1A 1LWXA 5C24A 1TTHB 4PYAA 1PJ6A 2FJDB 3OHAA 3M9OB 2KFNA 1IQTA 1NDLA 4USUA 2BUNA 2Y0SD 3VZIA 3Q2TC 1KTVA 1EJ7L 1HNVA 3BKUA 3L95X 3DLHA 5GOVA 2R8IA 4CO1A 2ERRA 3AOCA 3UQSA 1ZS6A 2F4VF 4C8YA 4WXWA 3GCWP 1FD8A 2W7AA 3F44A 1JXEA 3M6WA 3P4UB 4JI0F 5A8KB 1Q79A 1HHQA 3WDOA 4ZLJA 4C8OA 2MSSA 2W5TA 1IKYA 2VICA 2XMKA 1RWUA 2BANA 5DG7A 4NXNJ 3QO9B 1FERA 2ZHBA 3DRRB 2DGTA 1C2PA 1FXDA 3DLGA 5L9NA 3VAJA 5U47A 4B9LA 4JV1A 4LMZA 1YSJA 2C3MA 2XTJP 3HZEA 6FDRA 1S99A 1IXKA 3CCTA 1X5PA 5JMNA 2ZH7A 3PO4A 1MLAA 4DSFA 1YJTA 4Q5VA 3OL9A 2IBKA 1HBUA 3V81A 4CH7A 5A6WA 3M8ZA 3OPKA 3JYTA 4LRFA 4GO7X 4ID8A 3CWJA 2EG1A 5BJRA 4LBHA 2KM8B 2DY1A 2KVQE 2WBMA 4DX7A 1PSDA 2NCKL 1U25A 4PWUA 1N8RT 4ZKAA 2VODA 2HHSA 5KT5A 4OLPA 4DS5A 4DSJA 4NXMF 1UVNA 4A8KA 3S1TA 3UVJA 4QWBA 2HNYA 4DR4F 3LP1A 4UW2A 3Q22A 2AJ0A 2UV8G 3MM9A 3C15A 3DRPB 4ICLB 3PX0A 2PI5A 1TAUA 1HJKA 1GAOA 2BJDA 2JVRA 3M2UA 3L09A 3ZTSA 3ILLA 2R2TA 2XB2D 1KHLA 3ENVA 4WIIA 1J5OB 1XNQJ 4KPYA 2NPIA 1GMUA 2F9JA 2ROPA 4PAAA 1TK8A 3CMES 3JAMU 2JLFA 2X51A 4DEZA 5DETA 2K8GA 4X4VA 1XNQF 1Q7YT 2IFYA 1RWPB 3NKOA 3FQKA 1X5TA 4KO0A 2NLWA 4AE5A 1R0AB 4I7FB 1KFSA 4UOPA 4GTYA 3A1YG 3LANA 4CLPA 1QTMA 4USTA 1VK8A 5D0RA 4K4VA 1FRKA 2BANB 2EWHA 3DLKB 3DOKB 5K8PA 2DR5A 4KM4A 1HWJA 1CLFA 3C6TA 3MM6A 4PXCA 4DR2J 1CJTB 1HPZB 4USKA 3KKFA 2DBBA 4FF1A 2ACYA 1R31A 1WKLA 3T1HJ 2V2ZA 3UE2A 3WAXA 2UXDJ 1YJRA 3ETOA 2DR7A 3V5RA 3KLEA 1M5VC 3V6KA 4DS4A 1JLGA 1G7CB 1HBOB 1HWUA 2M7SA 4O0NA 1UW4A 4K50A 1PYOB 2PEHA 3ZO7A 2F9DA 2G1HA 5HVFA 3HHLA 3MAAB 1U48A 1HNZF 2WHOA 4EFAC 3MR6A 2JZ5A 3CXCR 4OIXA 4U6PA 4NEZA 3T1YJ 1TK0A 3C2PA 3IR7B 1CJUB 3I96A 3M2RB 4AQYF 1MROA 2EK1A 2ZVSA 4X84A 5B0FA 2XS2A 4QR1A 3D0GE 4FYWB 1AJBA 2V94A 3BS9A 1Y0HA 2E1MC 1EJJA 2R7SA 4ER8A 1ZAXA 1U24A 1JLEA 2GVZA 1DQ8A 3V4IA 1E1ZP 1S9EB 2QSFA 1CPZA 1GX5A 2AZ3A 2MKYA 4GO5X 1R89A 2QLWA 1SL0A 4LFBJ 4B9NA 1GXLA 2W9CA 2VZ9A 4XPCA 1UZDA 3A8EA 4NLXA 4PG5A 1ROFA 4CNYA 2B5JB 2ZH4A 1HNXJ 2LQJA 1F9EB 2PD1A 4OYOA 4F0KA 3L3CA 3POTA 4IO9Q 2JEJA 1ALJA 1P9YA 1U02A 2RVJA 2AJ2A 1MN7A 3S6EA 5C25A 3T1YF 1HW8A 5D4OA 1VBYA 2A2DA 4DQPA 3DN9A 2E1RA 2MZJA 1P27B 1X0PA 2NSBA 2YVSA 3MCOA 1V3ZA 3TEHB 5J2MA 1JLAA 1NJIT 4MK7A 3GE9A 2ZZMA 2DK2A 4DV4F 3BDPA 4AFFA 3W8PA 3G82A 1XN9A 4E8UA 1VQYA 4C2MA 3K57A 3QJPA 4P73A 1ZPVA 4WKYA 4K7QA 1IKXB 1NK5A 2C3PA 2FUG9 5HK4A 2FVPA 1FKPA 3RW6A 2CQ2A 4Y6IA 5KFYA 4OI3A 4DR5J 4ZGAA 1N5YA 4RL1A 2DYAA 4KJIA 1QE1A 2G2YA 1Y7PA 4MIWA 4CT8A 4WE1B 2CKWA 1S48A 3AT1B 5J2QB 3R6LB 4CO4A 2RQKA 4LF4F 4FYXB 5GAHU 1I51B 2CG8A 2FVRA 1U0HA 3UN3A 2AHOB 2N7CA 2UUAF 3N6LA 1H7XA 9ATCB 2FJBB 3BDFA 1G3OA 5CYMB 5DGAA 3J7YU 1V5VA 4DR2F 2FHJD 3BBFA 2GVZB 1JLEB 1NM2A 2OPPA 3M2VA 4FKYA 4DV2J 1WOOA 4X65F 3V4IB 2UUWA 3NRBA 5A6PA 3OUYA 4GKKF 3IGZB 1CS4B 2X1BA 1RHKB 3KJFB 4S0MA 1I94J 3KDNA 1KTQA 2XMMA 3MZIA 3R9LA 4OZJA 1PAUB 4UORA 4RPFA 4TN0A 1ZM4A 2JRSA 1T9XA 3TA0A 1YJVA 4C6AA 4LR2A 1FTRA 1HQEB 1U2FA 2KRRA 3PYEA 2JL9A 2IJFA 4DV0F 3TVYA 3MFIA 2GIRA 1IKYB 3GLJA 2OHDA 4PUOB 1JJHA 1HW9A 2ILZA 5EN1A 3HT0A 4J9SA 1SJ1A 5MAOA 4RW6B 2KXFA 5F9LA 1ZOTA 3A4TA 3BR9A 3MMBB 4FF2A 2V9WA 1HNVB 3TZYA 4OLOA 1HQ2A 4YN3B 2N3LA 3OVAA 5K14B 1E6VB 1RTDA 2AF6A 2QJ3A 1HNWF 2HHVA 1XJWB 4NZ6A 2VG5B 5L9XA 2VG6B 4IOAQ 4UPHA 3QWPA 3HFVA 1BXNA 2QA4S 1R0BG 1N36J 4GTZA 1ANIA 3FBCA 2HW3A 4ZJLA 3LW5C 2A10A 4DPTA 2XS7A 4OHWA 3OQ2A 1RAFB 3M8QA 2QA2A 3EE3A 3B4DA 3K8WA 2R8JA 3MI7X 3DI6B 2FLLA 1FE4A 2CA9A 2H1YA 1TVRA 2RS8A 3BBBA 2Y0BB 3IGVA 4TY8B 5K5MA 1RCOB 3UN2A 3CJ3A 2MLZA 1VLYA 3EGNA 3JSBA 1L3KA 3SQGB 1N6QB 4X4UA 1U1QA 5LT5A 4PQUA 1S1VA 1TUVA 2C2ZB 2MQQA 3WBHA 2DH8A 4JI3F 1RTZA 3S8SA 1UFKA 2HHWA 2DPJA 3NGDA 4H4MB 3QT5A 4N56A 1SJ4P 1S1TB 1ZM2A 4Y2MA 3CUNA 2Y1IA 5IT9U 2HLTA 2WW4A 1GK8A 3KJQB 1T03A 2CQCA 3CJ0A 2HHHF 4NCBA 3HX9A 2V0NA 2W5WA 2L9WA 2J5AA 1H74A 2K06A 5I3UB 1RXOB 2C2RA 5DRKA 4PPZA 1M5OC 3B5QA 3HZGA 2KL8A 3Q8YA 4KFBA 2D3UA 2CJKA 5CABA 3NMAA 4MFBA 4U67Q 3RRKA 1RWWB 3QJLA 4XIUA 3THTA 2IM1A 3O44A 3MGJA 1Y3JA 3WIVA 2XI3A 1IKWB 5C2GA 4H4MA 4N8OA 3H25A 2OPRB 1NKBA 1RISA 3K5OA 3BQ2A 1FDAA 5HMWA 3JYTB 2ASJA 1EQ0A 1CQNA 2C2EA 3AFGA 3GV8B 1ALKA 3LH2S 1TFWA 3GR0A 4C8NA 2LXUA 4O0IA 2VPYB 3LP0A 4CLKA 3M8RA 2R2RA 5ETOA 4RNOA 4CYRA 4HT5A 2ZD1A 2UXCF 4DZDA 5GAGI 1B8JA 1PC4A 3D28A 3DLLQ 2EK6A 3KG0A 3PEJA 1RTHB 1Z2ZA 3BGOP 1LWCB 5KFGA 4AL6A 5KG5A 3LTOA 1Y11A 2LQ8A 5B0BA 1ELYA 4GVBB 4F25A 4A8OA 5HMZA 1F6TA 4NMLA 4A48A 1XEZA 3BSAA 5CZXA 4FZVA 4DR3J 4YEAA 1GFWB 1S97A 1SC3B 2DNMA 3IC1A 2BW7A 4NE9C 3KHHA 1IBKF 1REVA 2YNIA 1NDPA 2HHQA 2F4FA 2OSRA 4U7CA 3DU5A 3HHDA 3NBPA 2MY7A 4F7VA 4OI0A 3M9NB 2MQMA 4OHYA 2U1AA 4AD6A 5I3PA 3RRHA 1H0HB 1NH7A 2GVDA 2QFIA 1QDUB 1K47A 2VBXA 4JBCA 1KHWA 4LF2A 2V63A 3OSPA 4C8LA 1UVIA 4C11B 4YHHF 1TKZB 4JI4J 2KFYA 2ZM6J 4X4QA 1QUVA 2VG7A 5HMXA 3Q3QA 4JB8B 6FD1A 1VC6A 3KG4A 4GKJJ 2YWKA 2XLJA 1C4AA 4OZLA 2E66A 5HVHA 1B0PA 1RT5A 2WONA 5HBMA 1RBOB 3OR1B 1RT2A 5IOLA 5J2NB 1HBNA 3VQSA 4MH8A 5KG3A 1HARA 1UL3A 3BSCA 3MEKA 4DG1B 1U1KA 4LFAF 4B3RF 4M5DB 1P1TA 2R3VA 2B6AB 3DLEB 1RADB 2FIUA 3FFIA 5KG1A 2BKNA 3J7Z5 1JKHB 2F5GA 1WKJA 3OL7A 1WOPA 3OTOF 3VWSA 3T5LA 3BH7B 3ILOA 4KBIA 1E6YB 3EGZA 2D3OR 3R7SB 4L76A 2DEIA 3G86A 4J7CA 4ZPAA 2W4PA 5KFBA 3ELHA 3TUPA 3KLHB 2M2BA 2IJNA 2CWXA 4HACB 3EX7B 2WVFA 4ED5A 1RDRA 3IWLA 3SSQA 1IBCB 2CQ3A 5GVQA 1SIWB 3AJDA 2GA3A 1LW2B 5JXSA 2R2UA 4HDHA 3NCRA 2BDPA 4MJKA 4W98A 4ZDNA 5A2QU 3HF5A 3KLGA 3RAMA 3MOJB 4RUHA 4K0KJ 1TFYA 3ENQA 4UUWA 3DOLA 1FEEA 2CJYB 1MG7A 3LP2B 2ALYB 4I2PB 4WIQA 2RQCA 4B3OB 1O8BA 2V67A 5KFNA 4DLEA 1VBXA 4LF6F 2RU9A 3D4JA 2BJ9A 3OTCA 2BABA 2CPXA 2WAQD 3KK2A 4P2XA 2C42A 5ETQA 4RWXA 1XMBA 2Y1JA 5DDPC 1X4GA 4LUBA 2VQEJ 4OZNA 4XPEA 3D1OA 3Q0AA 3SV4A 1T3NA 4B3TJ 3SZYA 2FTRA 2FVCA 3I82A 5HQLA 2CZ4A 4Q45A 1JKHA 3RBEA 1IBMJ 2DR8A 2KRBA 1NHUA 3DU6A 2YQ3A 3M8PA 1CJKA 4P6QA 3UDCA 1U1MA 3FEXB 3MM8A 4DUYF 1FKAF 4L72B 2GHPA 2AKWB 2R8GA 1IWAA 1RT2B 4U8VA 3CMQA 4ZVEA 4ANEA 4CM0A 1KEKA 2EPIA 3MFHA 1XMOJ 2GO9A 4GKJF 3MTKA 2G13A 2YKOA 5K4PA 3D1QA 1VQ4S 4ZP8A 4I6YA 2ZZNA 2VG7B 2KJVA 2MQLA 2F40A 4Y65A 3W9HA 1TKZA 4EEYA 2H3EB 2IPOB 1B7FA 1D1UA 2WRMA 5GMEA 1RAOA 3KWMA 1ED9A 2AYBA 1FXLA 2MKJA 1P49A 5L0KA 1X4FA 3OR2A 4A46A 2ANHA 1F1BB 1UCNA 2D3ZA 4QOTA 2HBYB 1F0XA 2WSEC 3CCVS 4DLGA 3T9NA 3LWMA 3MECA 1IKVA 2WW8A 3AOBA 4DUYJ 1O51A 3C6UB 2I9SA 3CO9A 3H8YA 4BWJA 3ULHA 1SHQA 3IGYB 3NCPA 4NWXA 1VQLS 4C3MA 3G8TA 3HSDA 3PRVA 3BO3A 4RW4B 2W9BB 2EKNA 2I5JB 5HP1A 3H0PA 2YQ1A 1LWEB 4IOBA 4LSNB 5IQQA 3BREA 5D0EA 3KLFB 2VIHA 1FVQA 1QY7A 2BJ1A 2IM3A 2PT0A 4IR1A 5I4MA 5HAOA 4CP5A 2H5EA 3D68A 3DRSB 3PYFA 2C28A 2BYCA 4NLDA 4ZG6A 3H5SA 3EMTA 5E33A 1SKRA 2RH6A 1FNOA 4HVZA 4EWTA 1C1BB 2BE2B 3GILA 3R5GA 3F56A 1QVFR 1Q8KA 1FA0A 4PQAA 2GIFA 2C2NA 1SV5A 3QAUA 4RO0A 1RT1A 1KQGB 1YJUA 2CUYA 3K89A 2DNRA 2FZKB 2W1BA 3DRPA 4FYYB 2L08A 5LMNJ 1X9SA 2DVIA 3LP1B 4NMXA 1LW0A 4UOCA 3I32A 5ETTA 3W61A 4CH0S 2BEFA 4EZ6A 4JP8A 5J1EA 2MB0B 4TYAA 2C3YA 2YY3A 1LOUA 5I3UA 4LF5F 4ES1A 3T3FA 2HHTA 2QLFB 2E5IA 2LP4A 4F2SA 2BE9B 3CD5A 1XMQJ 3CD6S 1FJGF 1AZSA 1GMWD 2V2KA 2HGMA 1UWAA 2ZDOA 2B7CB 3AQOA 4UOFA 1NHKL 2FB0A 2GO8A 2P8IA 3C14B 2DGSA 3CT9A 3DRXA 4NLWA 1ZH5A 2LQBA 1FRXA 3DGPB 2J6TA 4PQUB 4LFBF 1Z4UA 3SIPB 2KDOA 2VBZA 1S1UA 2M8DB 1S1XB 8AT1B 1N33J 3MK0A 2E7VA 5LMNF 3UCUP 3EJMA 4WFAQ 3RBXA 3RB6A 1L5UA 1V5IB 1JJCB 1OWXA 1D8ZA 3FQLA 2CAJA 2HFZA 3BYRA 1RAJA 4DUTA 1TL1B 5GAHI 3MR2A 5GAEU 1DFDA 5D15A 4LRAA 5DZ7A 4DUZJ 2E5JA 2J6UA 2RQMA 1B4SA 4PYDA 2HS0A 4QJVA 5EHHA 2AJ4A 2VU5A 2AJ1A 3FVYA 5H1SV 3A8JA 1Q16B 1NK6A 3BQ1A 5B0GA 3EDQB 3I6PA 3R7NB 1KSPA 4B9TA 2VFRA 3JQKA 3HVAA 4RNHA 3GCXP 3NVLA 2XLIA 3UD5A 5DM7Q 1GH8A 3E8OA 1WSRA 4KIAA 1SXLA 2GZOA 5EWEA 3PW7A 1R27B 2XGQA 3PW2A 3U1NA 2NXJA 5E3QA 1N56A 4KKOB 3G87A 2NXCA 3EPIA 1LFWA 1I1GA 3NCQA 3FZ2A 4PG7A 1JNZB 3QZ7A 4JI1F 1YWXA 1BWVA 2DR6A 4C97A 3OTBA 1T9TA 3GFYA 5K8OA 1YJNS 5AXNA 5DG8A 4A8QA 4M95A 4ID5B 3W2WA 3G6ES 5A8WB 3PRDA 2EI5A 4ZN3A 4KAIA 4QWAA 1RWKB 4DQIA 1YG0A 4ES2A 4GMKA 2VQFF 1H2TZ 1WEZA 2FC8A 1NPKA 3OFHA 3BM7A 3CJQA 3B4MA 3FJ2A 4QYZJ 2MZTA 4LBPA 1HMVA 5HJXA 4LVOP 2QRRA 4H54A 4XAKA 2H54B 5M2UA 4DL7A 1REGX 2BJEA 3D1HA 1WJ9A 3J7YI 3I31A 3HVTB 4B3MF 1AUKA 4LF5J 3DGVA 1QAJA 1A7GE 3HK2A 2QT7A 2HWIA 4DSEA 1EQMA 3AD8C 5KXAA 1H2VZ 1OPIA 2BOAA 2B9YA 3AB4B 4K4WA 3DLBA 2J0SD 3HSJA 1FWLA 2IDEA 4MK9A 2APOA 5CA5A 4CLYA 2Z2LA 4L6V3 1JK9B 2BV3A 3K5PA 5IT9Y 2B56A 5KFAA 2OPQB 1RU1A 3QIPA 3J80Y 2W5SA 1SJQA 4F4XA 1HNIB 2J0QD 3P49B 1U45A 3PG9A 2CPYA 3PM9A 5D4NA 2HHPA 4L73A 4ED3A 2QFJA 1YI2S 5C5JA 1NK0A 2HS3A 2JSXA 2HMIB 3KNGA 2R7OA 2OFGX 4DV3J 1CJVA 1RWVB 2ZOGA 4NI2B 2R9LA 4HI1A 4DX5A 1EQJA 3ZTOA 5IQ6A 1JNRB 2WSFC 2W2PP 3A8KA 3PYGA 2PMZD 1P9QC 1JLAB 4C7QA 3KYLA 3TI0A 3L7PA 4ELUA 1YITS 4DV7F 1UWBA 2FYXA 2MKHA 2LVWA 2P9EA 2J7KA 3UD4P 3D3CJ 1KONA 5BYSA 3PIOQ 1ZTTA 2CNKB 1RTHA 3KTQA 1FT8A 1V9OA 2MEWA 3TYTA 5HL7Q 5TJ3A 2HQIA 3ENWA 1X4AA 3MPVA 4PXEA 4F67A 3SDEB 3VF0B 5AXLA 4NXMJ 1OIAA 5CXTA 5T7LB 2KN4A 3HVWA 3CCSS 2G0IA 1NAQA 4IG3A 2FJXA 1Q8IA 1O0PA 3IGNA 3OJSA 2MMYA 3KLVA 6AT1B 3HPOA 4A4JA 1RKJA 1D9FA 2ZEJA 3D6HB 3GZ7A 4NLQA 1D9DA 2IRUA 4O23A 4P7TA 4JI5F 1HWKA 4M94A 3QFHA 1ZYQA 3BSNA 1IKWA 1PBAA 2UXBJ 4WZMA 1MU2B 4GRSA 3EWGA 4KV8A 2ZITA 2V5HG 3EM1A 1VDHA 3GJTB 4QIVA 2I2YA 4F3QA 2ZC4A 4I56A 4DR6J 4KH0B 1U1OA 4NZ7A 2EFGA 5IJQA 4R5PB 1O5JA 1T11A 3DYAB 4PWWA 2JX2A 3VGSA 3O8WA 2HGLA 4ED4A 5LQQA 2ZKUA 2KI2A 1T05A 3E01B 4H4KA 3W66A 4EO8A 1T3OA 1YJ7A 3DOMB 1VQ9S 3W65A 1SQEA 4HTIA 2OH2A 3T6BA 4QYZK 1XQIA 1VGYA 2YKNA 3TAQA 2OEKA 4DPUA 3HT3A 4C98A 2O66A 5E7OB 4QBUA 2VFTA 3EXYA 1KDNA 2UUAJ 2I1RA 1N34F 2IBOA 4NLSA 4OZ0A 4DL3A 4OL8A 4QW9A 1RWNB 2A1BA 1MN9A 1Q95G 2Z56B 4JV2A 1TVRB 3EZOA 4NCGB 3IBWA 4NA3A 3RTVA 5EUHA 3KHRA 5HQMA 2VC1A 4M5MA 2LEPA 5GAGU 1JMTA 5IV3A 2KYXA 3M8WA 4RR5A 4KGKA 1KNZA 4ECTA 4UY85 1RCXB 2I5JA 1P1LA 1S7HA 4DJBA 3C16B 2NXUA 2D41A 5G0RA 3MMJA 2IA0A 1CSJA 2UZAA 1TL3A 3W60A 4RUAA 1OYDA 1L3TA 3I0RA 4C8KA 4F8RA 1UP1A 1U2CA 3AQPA 1FDNA 3CEDA 1KR4A 3MMBA 2FC9A 4CDIA 5HN0A 1OSDA 1MMLA 4OI2A 1VC0A 2YKNB 2ADBA 4W90B 3P8BB 3VAIA 1U47A 2YNGA 3CMAS 2E5LF 3SZZA 3MHYA 4USVA 4ED6A 4F4WA 2KXNB 4I6AA 2DNOA 2FPHX 4IKAA 4ZP6A 4LSZB 5ITHA 3AY0A 3MMAA 5T14A 5B0EA 3BO4A 2E9RX 4QYRA 4O3PA 4ZCIA 4FPIA 3TZXA 4FNIA 4RUBA 4X2BA 2ZBIA 4EK2A 1YVFA 5AJ3F 4ECWA 3OT9A 2PMHA 4DF4A 5HQ8A 1Q86T 1HQAA 1UETA 2BX6A 3VV2B 2FGCA 2M4MA 4DN0A 2UV8A 4AYBD 2YKQA 3CCES 2AT1B 2O1PA 1VI7A 3M2VB 1NRKA 3EVOA 2B4VA 3OFEA 3QRPA 5ETVA 1N5VA 3LGHA 2MKSA 3NWGA 4OX6A 1VFJA 5KFIA 4A8SA 3UD3P 4FYVB 4N76A 2P2CB 4NYPA 4DUZF 2DH9A 3OXFA 4OV1A 4AT1B 3KUGA 4YFUA 1RKIA 1TELA 1W25A 4NLUA 3GV7B 3EDRB 5DQHA 1N0UA 2YWFA 1KOHA 4NL5A 4DV1J 1VLOA 2LECA 4JV5J 2Z2YB 2Y1LB 3IO1A 3VHQA 1N32J 3AH6A 4QWDA 2JLEA 1BWEA 2GHWA 4UTGA 1HQUA 4KHRA 2VQRA 2QMUB 5C66A 1R7IA 1NDCA 2BMBA 2LDYA 3B54A 4AXJA 1FKPB 4WXOA 4PWDA 2OPSB 4OHVA 4BBYA 5LSRA 1OQ3A 1AUDA 3T5HA 3SBMA 3EZ5A 1RT4B 2XNRA 1AYEA 4CI0B 3D67A 4N5SA 3T1HF 5KFCA 1N4LA 1XERA 2OUGA 4DV5F 1KD1T 2KVIA 1CULB 2FQQB 1OY6A 5HI7A 3UR0A 3G4SS 2W4DA 4QIGA 2GW8A 2HRUA 3QQCD 4G6VB 2QZUA 2IJRA 4RW8A 2H48B 1TAQA 3SFGA 3TRGA 3GIKA 1FK9B 2UUTA 4MTPA 3CCJS 3KOAA 4B02A 1S6QA 2YPYA 2DISA 4N77A 1TKXB 2J9CA 2JC1A 1GXUA 1GMWA 1FE0A 2M70A 3NGSA 4LQ9A 4TNOA 4CNZA 2BR0A 3SFUA 3OTDA 3OTEA 2XHWA 1RHMB 1XBWA 5KFEA 1OS5A 2W9CB 1Y4ZB 4MMOA 1CC7A 3CCZA 4RBUA 5E3AA 2ZZTA 1J5EJ 1KP6A 1NZ8A 1UEUA 1XWLA 4OQJA 2RDJA 4LF9F 4ITSA 2ZJPQ 3MCNA 5LRMA 1X0FA 2A3JA 3ETMA 2GSUA 3MK2A 1WDDA 2WB4A 4NPOA 3I4HX 1M5SA 5RUBA 2IUCB 4N41A 3THPA 2CJAA 2GMHA 4C11A 2XY7A 5DQIA 3C3LA 1U7LA 5CCMA 1Q7LB 1NH8A 2ZUAA 2A6OA 2UU9F 1EI6A 3P5BP 5AE1A 4FPRA 2Q3PA 1UFWA 4FXVA 1TL5A 4O4GA 1IN0A 2BKOA 2MJNA 2XWYA 2XMTA 2XI2A 5HJYA 2HRTA 5GAEI 3VAMA 1F3FA 1MMDA 2YH1A 1P6TA 2IC3B 2M52A 2HFVA 4OI6A 3K5LA 2DPIA 4CTAB 4RLEA 4X62J 3NS5A 3PHTA 3SCKE 5CYQA 1WNEA 2DXEA 4WJBA 2OP5A 3PX6A 3MM6B 4J9VA 3PIPQ 5A8RB 4DR1F 4DCPB 4PRFA 2VOPA 4P74A 4FXWA 2Q79A 1RAIB 1JJ4A 5E3RA 5DDRC 1RU2A 4O44B 2DHGA 2L9NA 1S5ZA 2NXEA 1SI9A 2RF2B 4K5SA 5KG2A 4I7FA 2CQIA 2EVZA 3VAGA 1IWGA 1JLQA 2HFOA 4ELVA 4U96A 1NSPA 4KTQA 4ATNA 2ZH5A 3GJQB 5D3GA 2C3UA 2VPZB 1NDKA 2UXCJ 3VVTA 3QPIA 4DHVA 4JI1J 2UUBJ 3BV8A 3GMGA 4MKYA 2EC0A 3DM2B 3K7RA 4USIA 2C2DA 1F2HA 3VAKA 4O3RA 4TVAB 2E1AA 2VFVA 2KHDA 3MM9B 3Q8RB 3RR7A 2HNYB 3DXSX 1FDDA 4H4OA 4WKRA 3CSKA 5HATA 2M9KA 4Q7AA 4UPLA 1QSSA 1XTZA 2HQCA 1BHNA 2CADA 4I69A 1M0SA 5DGBA 3OL8A 1QSLA 1FJGJ 4ELTA 1T95A 2RE1A 1LQ9A 2V68A 4LRBA 4IG0B 3WQPA 4XDCA 2YNGB 3P6YC 4M63A 4Y00A 1KLMA 5DDOC 4NA1A 4CO0A 3PYDA 3KUHA 3TX0A 2AGPA 1SQFA 2KYZA 1SCJB 3BB5A 5FIIA 5KG4A 2CJBA 3IR5B 1KLNA 2GAGC 3V81B 2AYGA 2AEJA 3BGRA 4YR3A 3DFEA 3BDGA 3C66A 2CRLA 3NS6A 1HL6A 1FTCA 1DHMA 3RW7A 3UI3A 1FK9A 3U7JA 1JXVA 4TLRA 4YR1A 3ISND 1KFDA 3VGUA 1WTFA 4EU0A 2B43A 3FBFA 2XMWA 2V6AA 1W2IA 3DRRA 1KH7A 2ABYA 3QRRA 5CYJA 4IQMA 1T9UA 5JJBA 3LGMA 4JOUA 4I68A 2RSQA 4P2MA 4ECXA 4HH0A 4RW4A 1AT1B 2Y3YA 2VQEF 2VG6A 2JEFA 2GSOA 4ECZA 4GTXA 4XDDA 1DZ5A 4WTOB 2R7TA 1HI8A 3GJRB 4I2QA 4QPTA 4IH6A 2IAJA 1ZEFA 3KK1B 3BEGB 2BM0A 2UU9J 3MEEB 2X1GA 2AYMA 2PIIA 3W5XA 5IWAF 1V6HA 2QA4G 3N01A 3QSIA 2R42A 4YB5A 2XSFA 4OJ3A 5LOQA 4CO3A 1FRLA 4DQRA 4ERDA 1X8DA 2MLXA 2QG9B 5E41A 1UVKA 2DGXA 1TL1A 2YNHB 1MWQA 4WK3A 3CJKA 3IBCB 4CO2A 3HLUA 4FVMA 1RTJB 3OSNA 2C3OA 3TA2A 4ANDA 1SIZA 4MK8A 2JNJA 2Q43A 4LIWA 1KHJA 4C9DA 2C2KB 1UAWA 2B7BB 3DC2A 5CD4A 4NXNF 4QAXA 1DQAA 1PYSB 2HVHA 4IH7A 4B3MJ 1FD2A 2VB6A 2WVBA 4JI3J 1Q1KA 2R8HA 5BR8F 3M1VA 3VVUA 3QLHB 5ETSA 5F41A 1S9FA 4YQWA 2DIUA 2XULA 2DHHA 4LF7J 3R1HA 2JJ4D 3DMJB 3PRBA 5IC4B 3TVZA 5C42B 3K5MA 1AZSB 1U1LA 2ILYA 3T1AA 2RHSB 2MYFA 1H38A 4WP9A 2VBWA 3KDOA 3PR4A 2UUBF 1AJCA 3ISNC 1RAEB 4G65A 4A47A 2HIQA 3IWNC 1Y5IB 2CZVC 3JS9A 4TQRA 3MUVP 4WE1A 1RTIA 2YKMB 1QE1B 3MCSA 3HSZA 4UZCA 1FFGB 5ETNA 4ZCLA 1VRUB 1KBRA 1SC4B 2XY6A 2V8PA 4DR5F 4USMA 1K73T 4JI0J 3B6BA 3W63A 2DEJA 3MEDB 1ALHA 3LAKA 3LP2A 3I4PA 3D5MA 4UT4A 3SCIE 3KHLA 3JXOA 3H4BA 1GMVA 1TMJA 4ED0A 1RTJA 2Z8QA 1EETA 2OSQA 4NI2A 2YNHA 3NGTA 3QATA 1S6PA 4IFVB 4WFZA 2OLWA 1LW2A 3SZ2A 1RUSA 4H4KC 2GAHC 2XLKA 3OXGA 3VQTA 2J76E 4NWBA 3R97A 2MKIA 3NGRA 3BBCA 1M5PC 5C2CA 4YDDB 1X60A 4OZ1A 5KT2A 2W8DA 2F3JA 2ASDA 1U8WA 2ZUGA 1LWEA 3HI9A 4LSNA 2R7XA 5AXMA 3UDLA 4WFNQ 5AE2A 4YP3A 3HD2A 2A6MA 1VBKA 1QAYA 2RRNA 2W9BA 2V8HA 1ZZNA 4EBEA 3TO8A 3O1LA 3MUMP 5F0WA 4O3SA 3US5A 4KRWA 2WCXA 2H65B 3G6YA 4YB1P 2P9CA 3RR8A 4B9VA 2HVEA 5EGEA 4KYZA 2Z4PA 4NCAA 1IKVB 1FI4A 2QEXS 4IRKA 4LF6J 3BKFA 1FNXH 1S6UA 1N5QA 3KJVA 2DCUB 4KH1B 4BLGA 4WBFA 4B3RJ 4KHPF 2CVEA 5DQGA 1T7PA 2UXBF 2BACA 1CBKA 3FBBA 4B3TF 4XO0A 1KS2A 1WG1A 3JTOA 5IWAJ 2DXDA 3BPDA 2JLGA 2MY8A 2MQOA 1TK5A 3FCWA 3M2RA 4H4OB 1R8BA 2R7QA 3HCXA 1KC8T 2H4WB 4A8MP 3CD7A 3CJ5A 1JLBB 4G1IA 4WWSA 2V4RA 3EUNA 2LLZA 5D4PA 1RBLA 4KKOA 3OL6A 5LL6d 1L3UA 1OMSA 3IAS9 2IM0A 1VR6A 4C3LA 4OV6A 3N4WA 4UPIA 1YQHA 4Y3CA 2EC2A 4YOEA 3KK3A 3FMWA 5AT1B 1JLCA 1U2RA 3QNWB 1U6BA 2LFVA 2DR9A 2Y8YA 3SDEA 2XRGA 1NPPA 2W4CA 3FNNA 3Q83A 4LRDA 1S49A 1I5OB 2DIVA 1HBMA 3VZHA 4J9QA 4A8WA 3TEGA 2U2FA 4RW9B 4RW9A 4X64J 3DOKA 3GSIA 4ZG7A 3P3DA 3JSRA 3ZTRA 1FFSB 1NCLA 2WBRA 3X3UA 3T19A 2AEFA 5CD4H 3AD9C 5INHA 3HFZB 5IS2A 3GP9A 2RIJA 1HYSA 4CTAA 2Z30B 2YX4A 4ZN1A 1QVGR 1S1XA 1PGZA 1RAGB 4X62F 1QAXA 4WU3A 3KJVB 3G71S 1HR0J 1NK4A 4OZ5A 5L1JA 1RA7A 2LA6A 4NYZA 4ILRA 1J5OA 2XYPB 2FHOB 1UEVA 5BYQA 4ILLA 4KAYA 3MMCA 5KFHA 1DTTB 4GC7A 2W8KA 4QU7A 3LQVA 2HEKA 1MW7A 4WZQA 3HM9A 1H3DA 2HIYA 1PJ5A 2NXNA 2W24A 3D0IE 3Q89A 4HACA 2OELA 4C0HA 4GKKJ 3KK3B 2D9OA 2F8HA 3W62A 2LA4A 4Z7YA 3KG1A 2EKYA 3TJ9A 4ZVPB 2ZHAA 4X66F 3FSYA 1RHQB 1WKKA 4RZRA 3GPAA 4PPDA 3PKYA 1HI0P 1LW0B 4J9UE 2HVDA 2W9AA 4OI4A 3PTWA 3TUJC 3UN5A 1WACA 1APSA 3FFIB 2VA2A 2GC8A 2PMWA 2ZVIA 3HVTA 4DX6A 5KFLA 2HZAA 2DO0A 3FSXA 4J5OA 4CLWA 3JSMB 3NNCA 2VFUA 1BD6A 4IDKB 2JOQA 3Q24A 3V6HA 2GLQA 3O3LA 1S6QB 1WHYA 4LT6A 2VASA 3V6DA 1ELZA 4JI8J 2QX0A 2GQCA 5EWFA 2W5RA 3FCVA 2OEMA 3BO2A 2FVQA 3J81U 2HBRB 1VRQC 3NKYA 1PC5A 4L74A 2OD4A 3OVSA 2Q66A 2KFZA 4FBUA 3IMQJ 4ZMMA 4U95A 2XMUA 2QA1A 1FWPA 4HDGA 1C0TB 1WHVA 3NAIA 3H5XA 2PDAA 5JVHQ 2GJFA 3K0JA 3QGPA 1N54B 2RD5C 2OPSA 4CYUB 3TAMB 1HI1A 1TQLA 1FX4A 4ZPBA 1VBZA 1QAIA 1F60B 3PXGa 3JAMY 3M6VA 4ZVSB 2VONA 4ILMA 3Q8UA 3AJ1A 2MLYA 4OZ3A 2QSWA 4Z37A 3HO1A 3QJJA 1W26A 1GXTA 1TKTA 4CYSA 4DN9A 2EFNA 3J81Y 1S4EA 3K59A 2HQDA 4Q2LA 1LWFA 3O6QA 2O3DA 2V4QA 2F65A 3GONA 4QIFA 4A8XA 4DL2A 2R7VA 1QSYA 4ZVTB 1Z2LA 4ETXA 1X4EA 2HFNA 1ZA2B 2K1RA 3IRXB 4IH5A 4Q43A 2CXEA 2OPPB 2IYGA 1WELA 1TMMA 1KN6A 3G6VA 2YKMA 5SZTA 4WYWA 2RQ4A 2OJ3A 2EFOA 4I6WA 1DRZA 1QLNA 3CCMS 3ET6A 3AXMA 5EX0A 1T9YA 2J9DE 4ED8A 3LXQA 3NWRA 2VQFJ 4MFBB 1YTYA 2HNDA 4FXDA 5C7PA 4KFBB 3TUIC 3J81j 3ILJA 2R8KA 2HLUA 3UO0A 2HVIA 2XYGB 3PW5A 3RG6A 1KOOA 2BE7D 3DRYA 3R6GB 1T9VA 1UKUA 2XZTB 4K59A 4PZVA 4DDFA 7AT1B 1T03B 1NKEA 4B9UA 4URGA 4KB7A 3CCRS 1NJZA 4K2XA 3E2DA 2KKHA 4PABA 3WC0A 3TA1A 4EZ9A 3T01A 2WSCC 2Z57B 3MPWA 4NWJA 2BXJA 2DGUA 4WF9Q 3R1LA 2W5XA 2VDHA 2X3GA 3FDSA 3GTYX 3IA0A 4ETZA 4ED1A 1UW9A 2QTWA 1R8HA 3FGVA 3CJKB 1LFPA 3T41A 3MMAB 4EI2A 1IBMF 1PIEA 2FJWA 1H2UX 3KMQA 2GJ2A 3C16A 2M3DA 3D6TB 1QJHA 4ZJOA 2OEJA 1S77D 2AX0A 1S7IA 1IQZA 1HHTP 3NKPA 1YRTA 1QUPA 3BKTA 2RMLA 3GYXB 1LK7A 3CDUA 4GC6A 4CLSA 3CE8A 2YNFA 1ZETA 4OX9J 2OKQA 2G0JA 4G1PA 3KLHA 2G9OA 5HVGA 4NCGA 5ETRA 1ALIA 2NYIA 3M32A 1HLWA 3MPYA 1S79A 4WK1A 2E29A 1VOMA 3AXKA 4OFZA 3T6JA 4YMEA 2XM3A 3N5BA 2A0FB 1SKSA 3BDGB 3GIRA 1IR2A 2F1FA 2LXFA 5AE3A 3T00A 2FD2A 4DU8A 3OJUA 3DDNA 1YKWA 1F9FA 4TXSA 5DS7A 4C0BA 3D3BJ 2VF3A 3GQCA 4K4TA 3PVXA 3BDEA 4IG0A 2GNKA 3IM9A 3J7AN 2ZBPA 2CQGA 4R8UB 5I42B 2Y8WA 1VIXA 1I3OB 2K3IA 3OFGA 3T9ZA 5MLCV 2YWWA 2MGZA 2V69A 2B3TB 1F5CA 4ZVHA 3QWUA 3JSMA 5FLXU 1JXLA 2E9ZA 1HDHA 2DO4A 1PJ7A 1ULRA 4HHJA 3FUYA 1M5HA 4HR2A 2CNNB 3U02A 2IVFB 3DYCA 4OYPA 1YIJS 4U9RA 2NPFA 2W7PA 2YQ0A 2BZ2A 1I6JA 3HHEA 2L48A 4PXBA 2J7UA 3K58A 4F26A 3WAWA 2HYIB 3NNAA 3H98A 3W5ZA 1X4CA 1B0TA 1NLKL 3DHXA 5HSPA 4R5PA 1T9WA 1KWMA 2FZCB 5CYMA 1S1WB 4UQTA 1N5TA 5T41A 3UDVA 1XR6A 1JLQB 4DL5A 4OYXA 3A8IA 4HKQA 2L41A 4MYUA 2AX1A 4QPXA 2A2CA 3H20A 5KT4A 2MZRA 3OW2R 2ROGA 3BGLA 4KR0B 2VH7A 1VQ6S 3KK2B 1LWCA 5L1LA 3HKZD 3TOQA 4ZIWA 1N5YB 2XS5A 2DNGA 2X1AA 1VQKS 4NA2A 2R7WA 4IG3B 4ED2A 3CCWA 2OI2A 1RA6A 3ZXWA 3PKMA 3DNCA 1BQMA 1BQMB 1N34J 1EW9A 2F8MA 2LDIA 2ZBQA 3ICLA 4NYOA 3KLGB 2CQPA 2B9EA 2RDIA 4F4AA 1U0SA 2E5GA 3CDBA 5F9NA 4FDFA 2RF2A 3I9ZA 4OX9F 3MUTP 4OYZA 1RLDA 2H9ZA 2MPUA 2WOMA 2IVYA 2OTJS 1SUQB 2FY8A 4R0EA 4LR7A 1NK7A 1EW8A 4J91A 4UY8T 2MQNA 2GS8A 2HPUA 1RP5A 2UXDF 4JI5J 3RGIA 5IFMA 3IS9A 2DGOA 2LKZA 3O2IA 2KB2A 4P2SA 1S1WA 3ZTQA 2BQ3A 2EBGA 3EICA 3ISZA 3CC2S 1NUEA 3NG8A 2HGNA 1RAHB 3ENAA 4RWWA 5KFQA 2B5JA 2N82B 3GIMA 3RB3A 3G2XA 1OJ4A 4B9SA 2P6TA 4N47A 3NAHA 1YZ6A 1FJEB 4DU7A 5GADI 3MEGA 3VALA 3X1LB 2CQ0A 2HRYA 4KGVB 5GMDA 5BR8J 5F8NA 4M5DA 5L0BA 1RABB 1S9EA 2D69A 4DWIA 5GMKa 4R0JA 4J9OA 3ZZZA 5LSOA 4I4BA 4K4SA 1E2SP 3QGGA 3FZBA 3SQGA 1GTHA 3JTNA 4DPOA 2MGZB 4TY8A 2FHKA 2OD6A 3H7HB 4DR6F 4R8UA 2KXHA 4MIBA 4IDKA 1N2KA 1HWIA 4F36A 1KKHA 4ID5A 3W2WB 2G0CA 1EHWA 4DQSA 3LO3A 2V8GA 4IRDA 2GVDB 1TR0A 2K3KA 4O3QA 2VJVA 1KVJA 2H5JB 2AEMA 4K0KF 3UCGA 4ZVFA 3OXLA 5CQGA 1HMVB 1NEEA 4B3SJ 5K14A 4F50A 1RGVA 2M5YA 4OZ2A 1FFWB 4ZPTR 3KMSA 2GQQA 2Z2ZA 4KC5A 2IA6A 1H98A 1G2EA 1K1QA 4ZOSA 1RT6A 1DTQA 1AB8A 1MMNA 4RW8B 3DKDA 4ZVGA 1KQKA 5K8MA 2GGPB 3FSIA 2EG2A 2R7UA 1Y10A 4F4ZA 1TP7A 3BH6B 4PUOA 5KFPA 2E5LJ 2HS4A 1SUQA 2SXLA 5CZVA 1M5KC 4BC9A 1ZAVA 3EPGA 3SYZA 3FC9A 2VUGA 4PXDA 2BRKA 2EW9A 2VD3A 3R2DJ 4AL5A 3H5UA 1WC4A 2A18A 5ETMA 4FS2A 2ASLA 2HSEB 2WVDA 1VQMS 4YS2A 5IT0A 1EB0A 1KHVA 2NUUG 3IR6B 2IRXA 2B9WA 2OPRA 2YTCA 2CDQA 2OMOA 1HBMB 4WPAA 5THWA 3RYLA 2F4VJ 3E51A 4DR7J 3GR1A 4OJ1A 9RUBA 4KGXB
chains in the Genus database with same CATH topology
1EI6A 3DYCA 3WAYA 4UOPA 2GA3A 4GTYA 5IJSA 1ED9A 1SHNA 4CXUA 2IUCA 4UPHA 3UNYA 2GLQA 3WAWA 4LRAA 4KM4A 1ANIA 4GTZA 2W5RA 5DLWA 1ZEBA 4GTWA 2XRGA 1ALHA 3M8WA 1AJCA 3WAXA 2X98A 3NVLA 4UPKA 1ZEDA 1ED8A 3NKOA 1O99A 3UN2A 4CXSA 3WBHA 3KD8A 3SZYA 2W8DA 1E33P 2G9YA 5GRRA 3NKNA 4MY4A 1URAA 1EW9A 3DPCA 4LQYA 3SZZA 2W8SA 1ELXA 2GSNA 5EGHA 2W5WA 3BDHA 1AJBA 1Y6VA 1EJJA 4FDIA 4MIVA 5EGEA 3B5QA 4LR7A 3CMRA 4CYSA 1AUKA 1E1ZP 1EW8A 5K4PA 4KJGA 5KXAA 3OT9A 3WAVA 4UPLA 1HQAA 1AJDA 4LRCA 5L0EA 4LRBA 1KH9A 4B56A 1P49A 1ALJA 5L0KA 1URBA 2ANHA 2W5SA 4ZG9A 3T02A 2D1GA 5GOVA 5LIAA 3LXQA 5L0BA 3IDDA 4CYRA 3TX0A 1B8JA 3NKRA 2W5QA 1SHQA 3UO0A 1E2SP 3IGYB 1KH4A 3BDGA 4NWXA 4N7TA 1K7HA 2W5TA 1EQJA 1ELYA 3M7VA 4YR1A 3E2DA 4LREA 1ANJA 4UPIA 2VQRA 1N2LA 3MK1A 5C66A 1KH7A 4UOOA 5LRNA 3T01A 4NWJA 3A52A 2W5XA 4FDJA 4ZGAA 5DLVA 4LRDA 4GTXA 2GSOA 1ALKA 4LR8A 4KAVA 4ZG7A 2RH6A 3M8ZA 5TJ3A 4LRFA 3UN3A 1ZEFA 5INHA 3M8YA 2W5VA 3NKPA 1FSUA 1E3CP 3BDFA 2QZUA 3Q3QA 1ALIA 5LQQA 4ZG6A 3NKMA 3IGZB 3BDGB 1KHNA 5DLTA 4KAYA 1KH5A 3ED4A 2GSUA 3T00A 1O98A 4UORA 1HJKA 1KHJA 3NKQA 4TN0A 3TWZA 3TG0A 4QAXA 2ZKTA 4LR2A 1ELZA 1KHLA 1EW2A 1N2KA 5AJ9A 5LRMA 5IJQA 4CXKA 3MK2A 2XR9A 4MHXA 1KHKA 2IUCB 4LR9A 1Y7AA 1HDHA 3UN5A 3MK0A 5HRTA 4KJDA 2IFYA 1AJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI6 A;  3DYC A;  3WAY A;  4UOP A;  2GA3 A;  4GTY A;  5IJS A;  1ED9 A;  1SHN A;  4CXU A;  2IUC A;  4UPH A;  3UNY A;  2GLQ A;  3WAW A;  4LRA A;  4KM4 A;  1ANI A;  4GTZ A;  2W5R A;  5DLW A;  1ZEB A;  4GTW A;  2XRG A;  1ALH A;  3M8W A;  1AJC A;  3WAX A;  2X98 A;  3NVL A;  4UPK A;  1ZED A;  1ED8 A;  3NKO A;  1O99 A;  3UN2 A;  4CXS A;  3WBH A;  3KD8 A;  3SZY A;  2W8D A;  1E33 P;  2G9Y A;  5GRR A;  3NKN A;  4MY4 A;  1URA A;  1EW9 A;  3DPC A;  4LQY A;  3SZZ A;  2W8S A;  1ELX A;  2GSN A;  5EGH A;  2W5W A;  3BDH A;  1AJB A;  1Y6V A;  1EJJ A;  4FDI A;  4MIV A;  5EGE A;  3B5Q A;  4LR7 A;  3CMR A;  4CYS A;  1AUK A;  1E1Z P;  1EW8 A;  5K4P A;  4KJG A;  5KXA A;  3OT9 A;  3WAV A;  4UPL A;  1HQA A;  1AJD A;  4LRC A;  5L0E A;  4LRB A;  1KH9 A;  4B56 A;  1P49 A;  1ALJ A;  5L0K A;  1URB A;  2ANH A;  2W5S A;  4ZG9 A;  3T02 A;  2D1G A;  5GOV A;  5LIA A;  3LXQ A;  5L0B A;  3IDD A;  4CYR A;  3TX0 A;  1B8J A;  3NKR A;  2W5Q A;  1SHQ A;  3UO0 A;  1E2S P;  3IGY B;  1KH4 A;  3BDG A;  4NWX A;  4N7T A;  1K7H A;  2W5T A;  1EQJ A;  1ELY A;  3M7V A;  4YR1 A;  3E2D A;  4LRE A;  1ANJ A;  4UPI A;  2VQR A;  1N2L A;  3MK1 A;  5C66 A;  1KH7 A;  4UOO A;  5LRN A;  3T01 A;  4NWJ A;  3A52 A;  2W5X A;  4FDJ A;  4ZGA A;  5DLV A;  4LRD A;  4GTX A;  2GSO A;  1ALK A;  4LR8 A;  4KAV A;  4ZG7 A;  2RH6 A;  3M8Z A;  5TJ3 A;  4LRF A;  3UN3 A;  1ZEF A;  5INH A;  3M8Y A;  2W5V A;  3NKP A;  1FSU A;  1E3C P;  3BDF A;  2QZU A;  3Q3Q A;  1ALI A;  5LQQ A;  4ZG6 A;  3NKM A;  3IGZ B;  3BDG B;  1KHN A;  5DLT A;  4KAY A;  1KH5 A;  3ED4 A;  2GSU A;  3T00 A;  1O98 A;  4UOR A;  1HJK A;  1KHJ A;  3NKQ A;  4TN0 A;  3TWZ A;  3TG0 A;  4QAX A;  2ZKT A;  4LR2 A;  1ELZ A;  1KHL A;  1EW2 A;  1N2K A;  5AJ9 A;  5LRM A;  5IJQ A;  4CXK A;  3MK2 A;  2XR9 A;  4MHX A;  1KHK A;  2IUC B;  4LR9 A;  1Y7A A;  1HDH A;  3UN5 A;  3MK0 A;  5HRT A;  4KJD A;  2IFY A;  1AJA A; 
#chains in the Genus database with same CATH topology
 1WSV A;  1YZ7 A;  1WG5 A;  2O5D A;  3W2V B;  1Q5Y A;  3B8H A;  1DLO B;  3D7S B;  4NLV A;  2MQ8 A;  2CPI A;  2FJV A;  3BPS P;  2CYY A;  1XR5 A;  5D8H B;  1WOR A;  2R2S A;  1IBK J;  1ZAW A;  3TVK A;  4RNF A;  4YY3 F;  1JLB A;  1GEH A;  4K4X A;  4M5I A;  2CPE A;  4JI6 J;  2YX7 A;  2XY5 A;  1Y6V A;  1M1G A;  1NZA A;  2COL A;  2ZOM A;  1M1H A;  2WVE A;  1IBL J;  4P72 A;  1YBT A;  2ZH3 A;  1L3V A;  2B8P A;  2IRY A;  2O67 A;  1TKT B;  3QT8 A;  4TQS A;  3PO5 A;  2IM2 A;  1F5A A;  1VIS A;  3GJS B;  1DY3 A;  4P71 A;  1U1P A;  4CXS A;  2HQF A;  2QC3 A;  2ZE2 A;  3G8Q A;  5HMY A;  2GV1 A;  3W5Y A;  2PFF B;  3SEO A;  1UPM B;  2W2Q P;  5GRR A;  4ZP7 A;  2DIT A;  5M2P A;  2FDN A;  2ZNY A;  1ARO P;  2KT3 A;  3ZNJ 1;  1VYA A;  4QW8 A;  5C25 B;  3KK1 A;  5L1K A;  1B0V A;  2ZBC A;  3OV7 A;  2E5H A;  3IXQ A;  4UUX A;  3BSO A;  3SXL A;  3H2U B;  1YBA A;  3RAQ A;  1S76 D;  4DV2 F;  3CIM A;  3M32 B;  1SJ3 P;  3HXM A;  3CGI A;  2B51 A;  2XYH B;  3A13 A;  3KFW X;  4IFY A;  1UEK A;  1G4C A;  1RAA B;  1VHI A;  2RDD A;  4DV5 J;  1BC6 A;  3NGK A;  3CJ4 A;  2POK A;  4LBI A;  4U8Y A;  3LF0 A;  1Q78 A;  3I5C A;  1GTE A;  2HBQ B;  5C24 B;  4ECQ A;  3GU0 A;  3ITH A;  4ZS6 A;  2ZJR Q;  5KG6 A;  5DJB A;  4P10 A;  3T02 A;  5LSL A;  2CJQ A;  5KFF A;  2QL9 B;  2R7R A;  2XNQ A;  1SJF A;  1MU2 A;  4QIW D;  1SKU B;  2ZNZ A;  3VR1 A;  2AIR B;  2AWZ A;  3IP0 A;  1U6Z A;  2RJZ A;  3NEK A;  2KZZ A;  4N8N A;  1UTA A;  3OR2 B;  4OHZ A;  2GMJ A;  5D3G B;  4A8Y A;  2MST A;  1FWK A;  1RTI B;  4ZPD A;  3U1L A;  2AGQ A;  1W2B R;  2Y9H A;  4HL9 A;  5ETP A;  2R4F A;  5IV4 A;  1SVD A;  1U0H B;  1XR7 A;  1CJT A;  4KSE B;  3GFZ A;  1N48 A;  4M5N A;  2FY1 A;  3DMJ A;  5H9F J;  4ECY A;  4I67 A;  1PAE X;  3DM2 A;  4LR8 A;  3SI8 A;  3OTO J;  1BMQ B;  2K7K A;  3H59 A;  2K1R B;  2V9K A;  3IRX A;  4AQY J;  4K4Y A;  3PJX A;  1WWH A;  4USJ C;  4TU9 A;  1CC8 A;  3PJW A;  3L7U A;  3HHK A;  2VJU A;  4JI7 J;  5T7L A;  4GVL A;  1EP4 B;  1FRH A;  1CVJ A;  4KGZ B;  4DFJ A;  4ZVU B;  1HHS A;  1XNR F;  2E1C A;  3G82 B;  5HAN A;  4K4Z A;  3GYG A;  2VDI A;  4DV6 J;  3ZC4 A;  2RT3 A;  2HMI A;  2DRA A;  1G1X A;  2MQP A;  2J0X A;  2J6S A;  2C2M B;  1C4C A;  2YXL A;  2DXF A;  4OX7 A;  2GGP A;  3TJ8 A;  4CLT A;  4LQ3 A;  1HKA A;  1NPR A;  2LYV A;  3DXB A;  4DPX A;  4X4O A;  1RWM B;  1SH0 A;  3BGF A;  2I8E A;  2OPQ A;  2IAJ B;  3CVK A;  1RAC B;  3QIP B;  4OYA A;  3BF4 A;  3ZZP A;  5J1N A;  5KFW A;  4X4S A;  4YR2 A;  3SSS A;  2IYI A;  1X4D A;  2OFH X;  4NLO A;  4LJM A;  3VAH A;  1D09 B;  1U6F A;  1RK8 A;  2EEY A;  1VQ7 S;  2PO4 A;  2V8V A;  4LR9 A;  1M1K T;  3R27 A;  2BM1 A;  1FJ7 A;  1S57 A;  1ITP A;  1VQO S;  2ZWP A;  5HRT A;  4X4R A;  3H4D A;  1B3T A;  3NMR A;  2J7W A;  4EMD A;  4TU8 A;  1N32 F;  4C8M A;  5IJS A;  2VPX B;  1HBU B;  3LPE A;  1AUS L;  1FRM A;  1OY8 A;  4L75 A;  2CPJ A;  4NLR A;  4W4M A;  5F3Z A;  2IUC A;  3DHW C;  3EVM A;  5M2R A;  4Q8F A;  2DGW A;  1E6Y A;  1WF2 A;  4F0M A;  3PCO B;  2QZ8 A;  4EYI B;  1ZEB A;  4USW A;  4UZB A;  1NJW A;  5A76 A;  1FCA A;  2X98 A;  1KLM B;  2E7X A;  2FGO A;  2DCL A;  5ETL A;  5IT4 A;  1U09 A;  2DNP A;  4YB7 A;  3RAX A;  2MHN A;  2L3M A;  4WFX A;  3TP2 A;  3UCZ P;  1BQX A;  5IXU A;  4DL6 A;  2CQH A;  1HBN B;  3A12 A;  3NNH A;  2CWK A;  4FN5 A;  5F8M A;  1ZED A;  3H42 A;  3HDS A;  1TV6 B;  1TZ0 A;  1VQS A;  4D3G A;  2W7O A;  3VAF A;  1RQ0 A;  2BBE A;  3TUZ C;  3KLI A;  3FBE A;  2NR0 A;  2DY9 A;  2CIM A;  2QN6 B;  3R5J B;  2FVS A;  2JFK A;  2I38 A;  2JEG A;  1K0T A;  1URA A;  3NKN A;  3HKW A;  1ELX A;  2D7S A;  1PBU A;  4ZHR A;  2GSN A;  3ZZT A;  1A6L A;  4DZ6 A;  2VA3 A;  1HIY A;  3DLK A;  2WOM B;  4Z2X A;  2XZW A;  3CF5 Q;  4LF9 J;  4Y34 A;  1V3R A;  2XMA A;  2ZDP A;  2W25 A;  4DPY A;  5E3P A;  2VKZ G;  3MD1 A;  3MAQ A;  1HD1 A;  2EFV A;  1H72 C;  4JI8 F;  4DR4 J;  4UF4 A;  1HQU B;  1AJD A;  1PKU A;  2Z0G A;  3KHG A;  4Q44 A;  1JWW A;  2IFX A;  2YX1 A;  2B9X A;  2HUR A;  3FRY A;  2D3O 1;  3RBZ A;  4ZG9 A;  3LPY A;  2HQ3 A;  3D9B A;  1ICE B;  4DQQ A;  2N7Y A;  3W3S A;  4NLG A;  3LA0 A;  2PEB A;  4B08 A;  1JIH A;  1SH3 A;  1SQG A;  1P8G A;  5LJ3 Y;  3C15 B;  3QT6 A;  1NK9 A;  2PI4 A;  3D6F B;  5CYQ B;  2CPD A;  3ZTP A;  2AD9 A;  4F2R A;  5DLT A;  3OBI A;  4NLP A;  5BYR A;  3DLJ A;  3MAH A;  4LFA J;  4ZLP A;  2W5Q A;  5EX3 A;  4CLL A;  1BY9 A;  2B4P A;  4E0D A;  3N0V A;  4TLQ A;  2AJF E;  4ZVR B;  3DGP A;  1YDL A;  3MPU B;  3H5Y A;  1PCA A;  1YRX A;  4O4G B;  3F73 A;  5AJ9 A;  1N2L A;  3EGV A;  5CCL A;  1S1T A;  5L38 A;  5J1P A;  3WHI A;  2LCW A;  1T02 A;  5KFS A;  1MSW D;  5L1I A;  2GX8 A;  4FP9 A;  1C1C A;  4OI1 A;  4PG8 A;  1LNQ A;  2CQ1 A;  3IN5 A;  1YX2 A;  3R5D A;  4WTY A;  5KFD A;  3B82 A;  3CCU S;  1K44 A;  4BCA A;  2VC0 A;  2BVZ A;  3GB0 A;  3GFX A;  2DD8 S;  2F63 A;  2MZ1 A;  2AGO A;  3DLG B;  1Q5V A;  2HAI A;  1UFL A;  3PFE A;  5EWG A;  3PR5 B;  3CPW R;  1RT1 B;  1WHX A;  5KG0 A;  5F8H A;  1LK5 A;  2KT2 A;  5E5N A;  7FD1 A;  3KLF A;  1K1S A;  1VCT A;  2ZC3 A;  4MKV A;  4NLY A;  4J9L A;  4F4K A;  2NS1 B;  1BQN B;  5DLG A;  4ECV A;  4HT7 A;  4W92 B;  4URQ U;  2JVO A;  4I2Q B;  4YDX A;  5A8K A;  1SL1 A;  2ZBR A;  5H9E J;  1S4F A;  2VL1 A;  4QZV B;  3S7R A;  3VTI A;  2VHG A;  1KH5 A;  5D0G A;  3NGU A;  1NBE B;  3MEC B;  1UJ5 A;  3DI6 A;  3NKQ A;  1N0V C;  4DV3 F;  2JC0 A;  4HH1 A;  1NO8 A;  3CNQ P;  4LSL A;  2ZKT A;  4QWE A;  5FJ4 A;  3AA8 A;  4LF8 J;  2XHC A;  3CJT A;  2V4J A;  3CO0 P;  1QD1 A;  2EFQ A;  2ZE2 B;  2HBZ B;  4QR2 A;  5G4D A;  4BWM A;  4DXL A;  5JUM A;  3R2C J;  4X4N A;  1C0U B;  4RUC A;  1TL7 A;  3K5N A;  1EET B;  2D74 B;  3EVW A;  3R8Y A;  5KFR A;  5HLF A;  3C6U A;  1U1R A;  1FVS A;  2M88 A;  1HNX F;  1VQ8 S;  3J7Z T;  2E44 A;  2XG8 A;  1HR0 F;  1OO0 B;  1RI7 A;  2QLB B;  5LXY A;  3MED A;  2DNH A;  3NLC A;  3TNV A;  3W9J A;  1T8E A;  1JX4 A;  3J7A 1;  1EX8 A;  2ASY A;  2AW0 A;  4ZJQ A;  3OVB A;  2W2N P;  1FJC A;  1BGX T;  1VRT A;  5E2Q A;  5FD1 A;  3U1M A;  4HYK A;  4K4U A;  2GQ2 A;  5L8R C;  1AFI A;  3FEZ A;  5CH7 B;  3D6M B;  3Q2S C;  2KO1 A;  5IC6 B;  4JV5 F;  2VPW B;  5DLW A;  3EGW B;  4DV7 J;  4G1Q A;  4CZC A;  3MDF A;  2PN6 A;  3THV A;  3CJ8 A;  4DCJ B;  3CDA A;  2PA3 A;  3DDK A;  3M05 A;  5KT3 A;  4NOH A;  5J2Q A;  5C42 A;  4CWB A;  2RKI B;  2BQR A;  3WIU A;  4IQX A;  1WDT A;  2J9E A;  4I0W A;  3D54 A;  2ZH2 A;  3UFC X;  2RUG A;  2KG1 A;  1U8S A;  3KD8 A;  4FBT A;  3MM8 B;  4FYD A;  2GFF A;  4KQZ A;  3HVR A;  3C46 A;  1RT7 A;  3TJA A;  1SJR A;  3M30 B;  1YJW S;  3H90 A;  2XCP A;  4HEA 9;  2DNQ A;  2ZOF A;  1S12 A;  2ZH1 A;  4TN2 A;  5KFU A;  3RUB L;  1F3V A;  1NHV A;  1WHW A;  1WI6 A;  2CZ9 A;  2E7W A;  3P96 A;  3QYY A;  3TQE A;  3GV5 B;  3KNA A;  3L7O A;  1H73 A;  1B7Y B;  5K8N A;  2DHA A;  3KUE A;  3R7B B;  2MDA A;  4K5R A;  5D0H A;  2KT5 A;  5A8R A;  1Q82 T;  4M5J A;  4MAK A;  4P2F A;  4BHQ A;  2XO6 A;  1KQS R;  4B3O A;  1KH9 A;  1RT6 B;  1SB6 A;  1T0T V;  2HFU A;  2IIH A;  3MEE A;  4CYU A;  5LJ5 Y;  2BQU A;  1IKX A;  2X1F A;  4PWD B;  2HWT A;  1PYT A;  3A3P B;  4ZVQ B;  2DHS A;  2LQ9 A;  3BGU A;  1X7V A;  4JI2 J;  4B56 A;  1C0T A;  1RYR A;  3J80 U;  1PG5 B;  1SC1 B;  2DNZ A;  2G4B A;  3MD3 A;  4DV0 J;  4DV1 F;  3HHN B;  2AP6 A;  4ZVO B;  3CTR A;  2LEB A;  1FKO A;  3RZA A;  2LXI A;  2QMW A;  4Y0F A;  3A3O B;  2XSJ B;  5F8I A;  1NSK L;  2PA8 D;  5F0U A;  1N88 A;  2QE5 A;  2YBV A;  1KRP A;  4FS1 A;  1F5B A;  2YPZ A;  1RT5 B;  2D9P A;  4R25 A;  5HBM B;  3G8S A;  2OAU A;  1UA0 A;  4DFP A;  1UVM A;  2DTJ A;  2QL5 B;  2UUC J;  4QU6 A;  3Q8S B;  2BA9 A;  3TR5 A;  5B0D A;  1GQE A;  2XO7 A;  1LV5 A;  1RSC A;  2EXU A;  2LEA A;  3GG0 A;  3D2W A;  1OQ6 A;  2DB1 A;  2V34 A;  1N33 F;  2BJ3 A;  5DLV A;  2RS2 A;  4OYW A;  4DG1 A;  4M5G A;  3ZFV A;  2HNZ A;  1VRT B;  2C1E B;  4NRU A;  3PZP A;  1Q8L A;  3DOM A;  3NBP B;  2AMC B;  1JLG B;  2HKE A;  2VV5 A;  5KFZ A;  2WK4 A;  5B0A A;  2IMO A;  1NND A;  4FNH A;  1S0M A;  4DR1 J;  4QR0 A;  2CJX B;  3M8Y A;  5CHC B;  4Q0B A;  2NRE A;  3RU0 A;  4LVN P;  4AXI A;  2JH3 A;  3UDE A;  1WF0 A;  4GVB A;  1R6Y A;  2DNN A;  3N6N A;  4FVC A;  2DGQ A;  1CUL A;  3M9M B;  4FF3 A;  1BUX A;  4YB6 A;  2V4J B;  1TUW A;  3FKB A;  3L4B C;  3MTJ A;  1HBO A;  3N79 A;  3NY0 A;  3WBZ A;  4ZLL A;  5KFK A;  1L3S A;  3ED4 A;  1VS3 A;  2XZD B;  4KO0 B;  4NRT A;  4CQ1 A;  4J9R A;  3TAN A;  1J27 A;  4ECR A;  2CG4 A;  4WP3 A;  1U49 A;  2RNE A;  3V2U C;  4PR6 A;  1LXN A;  1BLU A;  3R3T A;  4RNM A;  4ZK7 M;  1XIQ A;  3MM5 A;  5D6G A;  1HPZ A;  3L9Z A;  1RE1 B;  4F4Y A;  4IOC Q;  4CXK A;  3C6T B;  2XR9 A;  4TY9 A;  2DRB A;  4MHX A;  3GIJ A;  1LEO A;  1ZM9 A;  2K7J A;  4K8R A;  1RT3 B;  1WTB A;  3C8Y A;  4M8L A;  5DLF A;  2HQG A;  4WP8 A;  5F8L A;  4QCL A;  1CEZ A;  3CC7 S;  2J9D A;  2OO4 A;  1ZPW X;  1UWB B;  1R43 A;  3ILI A;  4B3S F;  1AJA A;  1R0A A;  3T5K A;  4V19 X;  4YUD A;  1Q0N A;  2UVR A;  1UJ6 A;  4DL0 C;  4RX6 A;  5B7W A;  3G9C A;  1S1U B;  2Q6C A;  4TKT A;  2XGP A;  2HFS A;  4CT9 A;  2JHE A;  2BKP A;  4F02 A;  2XC9 A;  1RBA A;  1WEX A;  2QYG A;  1EKS A;  3P5T L;  1DAX A;  2MTL A;  5IZH A;  3TAP A;  1U26 A;  3C14 A;  2UUC F;  1PIL A;  2K2P A;  2DT9 A;  4X65 J;  5L0E A;  2OGU A;  1UVL A;  5GAD U;  3MR3 A;  1HA1 A;  4ICL A;  4CIO A;  1DJ0 A;  2X3D A;  4UOG A;  4DL4 A;  1ED8 A;  5H9E K;  2GHV C;  5D78 A;  2QLJ B;  3WC2 A;  3Q86 A;  5I42 A;  3TAR A;  1FNM A;  3W2V A;  3PV8 A;  1S0N A;  1VJW A;  3M8Q B;  1E33 P;  1D3W A;  1Q8B A;  3O5T B;  4LIR A;  1X9W A;  3PDN A;  3HUL A;  2KJW A;  1X9M A;  3IBF B;  3JSY A;  4MY4 A;  1OY9 A;  1SV5 B;  1UVJ A;  4LQY A;  2W8S A;  1YLX A;  4DCO B;  2YWH A;  1S1V B;  1NXI A;  1NB7 A;  2ZM6 F;  3W64 A;  5B09 A;  5L39 A;  5KAK A;  5A0Y B;  3V6J A;  4FKX A;  1TKX A;  3VGV A;  4O3N A;  3JTP A;  2FJA B;  3QT7 A;  4LF1 A;  4DPW A;  4LF8 F;  5G0R B;  3CMR A;  3I0S B;  5E0O A;  2QL7 B;  3BN7 A;  2DRD A;  2YKA A;  3F0N A;  3TZZ A;  2PGC A;  3BR8 A;  3I55 S;  4DV6 F;  3U27 A;  1RYS A;  5A2Q Y;  1ZZF A;  2RB7 A;  2YKP A;  4QWC A;  4KHM A;  4DF8 A;  1VQP S;  2ZH8 A;  2QIF A;  1AFJ A;  3AD7 C;  5HP1 B;  5KFV A;  3KXD A;  2HAF A;  3I9V 9;  3PFO A;  4PEO A;  5F3T A;  2RRA A;  5I3Q A;  4ZLN A;  1KVI A;  4ZHR B;  4WU2 A;  1S6P B;  2WB1 D;  4IFV A;  4DMZ A;  2CPH A;  1RT4 A;  2D1G A;  5KOW A;  1FDB A;  1DTQ B;  4DI6 A;  2AJQ A;  3KLI B;  2IHR 1;  3I0S A;  2CJ9 A;  4F04 B;  4AUK A;  4E98 A;  2VFS A;  3AA9 A;  3EZU A;  1VRU A;  4MKB A;  2KG0 A;  3I5B A;  4OYM A;  2KTQ A;  1K7H A;  3RBD A;  1A0O B;  3M7V A;  2NYH A;  2BJ8 A;  3HSG A;  2MKC A;  4PKD B;  2CNO B;  2I0X A;  3H40 A;  1HQE A;  2W8L A;  1IBL F;  4ANC A;  1B64 A;  1S6O A;  4EGL A;  1Y5L B;  2FHM A;  3CJ2 A;  3LAM A;  3R5C A;  4FDJ A;  3JQM A;  2ZWO A;  1UA1 A;  4CH1 A;  4J9K A;  1S72 S;  2GJI A;  4AL7 A;  1OYE A;  2V50 A;  4UQG A;  3LGN A;  5E3C A;  5AXK A;  4QIE A;  2XCA A;  2GCF A;  3AHP A;  1QM9 A;  3Q8V A;  2V2V A;  4J37 A;  2W5V A;  1E3C P;  1XK8 A;  3UWT A;  5FLX Y;  3M6X A;  2LQ5 A;  3ONQ A;  3MEG B;  1HNZ J;  2DHX A;  2XWX A;  1YRU A;  2CPF A;  1VQN S;  3QGI A;  4NX9 A;  1YBU A;  1SL2 A;  2ATL A;  1IJF B;  1S9G A;  1K9M T;  2M0G B;  2DGV A;  1URR A;  3SMZ A;  4F3M A;  4CLU A;  4EYH B;  1Q81 T;  1NJX A;  1NK8 A;  4ZCK A;  5KG7 A;  4Y2I A;  1O98 A;  4KY3 A;  3IS9 B;  2Q6B A;  3E2E A;  1N36 F;  2CQD A;  2HHU A;  4UOH A;  1RHU B;  4KGM A;  2N4D A;  4HLB A;  1IR0 A;  3TAM A;  1WD6 A;  2NUH A;  1FF2 A;  3POT B;  3G96 A;  1EW2 A;  1F2G A;  4PG6 A;  1KVK A;  1SC6 A;  5J2P A;  3I0R B;  3WX8 A;  2KH9 A;  1CJV B;  1KHK A;  1NME B;  3MM5 B;  4DFK A;  2AQ4 A;  1EP4 A;  2DNL A;  3GII A;  2EFP A;  4OYI A;  2BJ7 A;  2RH3 A;  3A3N B;  5DM6 Q;  2ZH6 A;  4CCH A;  4Q8E A;  3I56 S;  3GG1 A;  3PW4 A;  3PEH A;  5D4L A;  5DZ6 A;  1F9H A;  3SCJ E;  2XMJ A;  4ENO A;  1MWZ A;  2RIL A;  5JVG Q;  1HNI A;  1O6X A;  1WC5 A;  3MM7 A;  1Y9O A;  4OMF G;  4XK8 C;  2MKK A;  2QLX A;  3K17 A;  5SUH A;  3TW0 A;  3UNY A;  5HO4 A;  2QYC A;  1RWX B;  2YH0 A;  4EUV A;  1X4B A;  4M5K A;  2PE8 A;  4DX8 H;  1T94 A;  2GML A;  3BGR B;  4WCE Q;  2BOP A;  1X5O A;  3FEY B;  2ZH9 A;  1Y5N B;  5K9F A;  3Q8Q B;  1NB2 A;  4TYB A;  4ZP9 A;  1WC0 A;  2CFX A;  4O3O A;  3GWC A;  4Q0B B;  1B70 B;  1RHR B;  2B6A A;  3DLE A;  3HHL B;  3MAA A;  2YWG A;  4J9N A;  2HK2 A;  5D77 A;  2JWN A;  3BYP A;  2JDJ A;  3CJR A;  4MYT A;  3IG1 A;  1R8P A;  4CLZ A;  2N3O A;  2UVV A;  1MNE A;  4IYQ A;  3OR1 A;  4L3N A;  2HNZ B;  4Y28 C;  3DDI A;  3W7B A;  1T05 B;  4DR7 F;  3MCM A;  3NKR A;  2HWH A;  2HK3 A;  2HHX A;  2IY5 B;  4IO1 A;  4DV4 J;  4O4R A;  8RUC A;  2B8Q A;  3ZZR A;  5HRO B;  1ZM3 A;  2G2Z A;  3AJ2 A;  1S10 A;  2G9Y A;  5CAA A;  5A8W A;  4NAS A;  3IRW P;  2L9D A;  2P5V A;  4NZ0 A;  1B99 A;  3NP5 A;  1TL7 B;  2KU7 A;  3MMC B;  4ZPC A;  5ADZ A;  4ZIT A;  2CPZ A;  2QV6 A;  1RWO B;  3MM7 B;  5FDL B;  4CLF A;  3T5J A;  3CCL S;  4KPC A;  3AOA A;  5F8G A;  1REV B;  2YNI B;  3KLE B;  1CJK B;  1Q4R A;  1WI8 A;  3M8P B;  3AOD A;  3D0H E;  3W8G A;  1GNK A;  2V8D A;  3NOC A;  1N6Q A;  4KJG A;  4MKA A;  1NJY A;  2F8E X;  1R8C A;  2CDR B;  4XTT A;  5A0Y A;  4HI2 A;  1MWY A;  5J2P B;  4ECS A;  5DO2 A;  4DSL A;  4JV0 A;  3W1Y C;  2RUS A;  2XEX A;  5KFT A;  1URB A;  3H2V E;  4JYA F;  2YNF B;  2H5I B;  1AA1 B;  5LIA A;  3RJM B;  3I5A A;  1BE4 A;  3LWL A;  2ZD1 B;  4P7V A;  3QAE A;  4ZCM A;  4I2P A;  4G3I A;  4F0H A;  4C0O C;  1JLC B;  4JI7 F;  3TZW A;  1JLF A;  2G1D A;  3BZQ A;  2IC3 A;  4U7U K;  4J9P A;  4KE5 A;  1S9G B;  3CDE A;  2HZC A;  3GFH A;  2XQC A;  1J5E F;  1HNW J;  3N28 A;  2GA7 A;  3VCD A;  2RHQ B;  1ANJ A;  3FCH A;  2AZ1 A;  1K8A T;  4RU2 A;  3GYN A;  3M2U B;  1FES A;  1N52 B;  5KT6 A;  5LRN A;  2D1C A;  3PJ9 A;  1NSA A;  1R0C B;  2XBP A;  2WVC A;  3A52 A;  1HD0 A;  3E3X A;  1XC9 A;  1D8Y A;  4C3K A;  1Q53 A;  1R6V A;  3UVJ B;  2M8H A;  4D3H A;  4EO6 A;  1DLO A;  1WC6 A;  2PSZ A;  3PNI A;  4RNN A;  4X4T A;  3IWX A;  1K0V A;  3BJY A;  2GIQ A;  2QO3 A;  4Y2A A;  2PFD A;  1RHJ B;  1QTN B;  1IM4 A;  5KOX A;  3ET6 B;  4L3K A;  2OTL S;  1PO6 A;  1M90 T;  3H2L A;  2WZ1 A;  3K8V A;  2Q1L A;  3FK4 A;  1IUJ A;  4J90 A;  3WZ0 A;  4OYB A;  1EZZ B;  2W2O P;  1ZBT A;  3BQ0 A;  2EBE A;  4JI6 F;  4YY3 J;  1GX6 A;  4X4P A;  2WON B;  5J2N A;  1KHN A;  4DOZ A;  2HHH J;  4DR3 F;  1EAR A;  3UW1 A;  5AJ3 J;  2UP1 A;  4I64 A;  3GSD A;  1VQ5 S;  3CD0 A;  3DRS A;  3RB4 A;  1FEH A;  4KHP J;  3C19 A;  4IUF A;  5KFO A;  1WC1 A;  5HLF B;  1ZA1 B;  3FRZ A;  3OD2 A;  2ZJQ Q;  1J2V A;  4Y2C A;  4EBD A;  3QO9 A;  1ZTW A;  3NOG A;  2RAQ A;  4NEY A;  4OJG A;  1UJ4 A;  3CIZ A;  3MUR P;  1SH2 A;  1URN A;  4OX8 A;  1WOS A;  4ZPW R;  2FZG B;  3DCA A;  4LSL B;  3P45 B;  1YJ9 S;  1NU4 A;  3ZZY A;  3SSR A;  5DDQ C;  4BC7 A;  4JI2 F;  2MZQ A;  1XNR J;  3ADA C;  1VK3 A;  2DH7 A;  3WAY A;  4EBC A;  2O01 C;  2QMX A;  4HTJ A;  4RW6 A;  4LFC J;  5F8J A;  4NLT A;  3NL0 A;  3N9U C;  4DFM A;  1SHN A;  3JB9 k;  3NXZ A;  3CW2 C;  4CXU A;  1YK9 A;  3ZZU A;  4ES3 A;  4P9S A;  3PW0 A;  3R5B A;  3PX4 A;  2ADC A;  2KZM A;  4GTW A;  1JB0 C;  2YWE A;  3EXC X;  4B9M A;  1Y00 A;  1WG4 A;  2G2O A;  5IM0 A;  5EDW A;  3QSY B;  4UPK A;  4RW7 B;  3V6D B;  2DJW A;  3HMJ G;  1R3N A;  2Z58 B;  8ATC B;  1G6B A;  2W2M P;  4BS2 A;  1O99 A;  3F41 A;  2HZV A;  1CS4 A;  2DNY A;  1XMQ F;  1VJQ A;  3M1V B;  1C1C B;  1EKR A;  4E2F B;  2FLN A;  3N6M A;  3QID A;  5EGY A;  4JYA J;  1VHF A;  2H4Y B;  3I87 A;  2DNK A;  4Q2M A;  4B17 A;  4LFC F;  3QFW A;  3SCL E;  5KFJ A;  4CM2 A;  1U1N A;  3B78 A;  4V1A k;  3HHL D;  4U7U D;  1Y3K A;  1IVZ A;  3RRG A;  2W01 A;  5DG9 A;  3OLA A;  4K2J A;  4FDI A;  3K2Y A;  5J1E B;  3MF5 A;  1FRJ A;  3Q8P B;  2AU0 A;  2OML A;  5KT7 A;  1S0O A;  2AV5 A;  3S01 A;  1YHQ S;  1SBR A;  3KJN B;  1V3S A;  2KM8 C;  3OHB A;  2IVM A;  2AYE A;  1EIY B;  4WYL A;  2KHC A;  3FMB A;  1DTT A;  5LM7 E;  1FHT A;  1RT3 A;  5KFX A;  1C1B A;  2BE2 A;  4F3O A;  4OHX A;  1YGY A;  4YHH J;  4JI4 F;  1N5S A;  4M5L A;  2FJE B;  2J0W A;  1X4H A;  1TL3 B;  4ZPV R;  1D9A A;  2ZFH A;  4HHH A;  4ALZ A;  4MT1 A;  4X64 F;  1TKD A;  2NQP A;  1AW0 A;  1JLF B;  3RB0 A;  1WEY A;  2V2Q A;  1HYS B;  1RT7 B;  3CDW A;  4I1T A;  3JQJ A;  3QBC A;  3IDD A;  2Z2M A;  4TU7 A;  4C48 A;  1IJE B;  1SPB P;  2C2O B;  2Y1R I;  4KT0 C;  4ED7 A;  3HHL C;  5FDL A;  7FDR A;  3WX4 A;  1XMO F;  2IMW P;  1KH4 A;  4N7T A;  3EYZ A;  1SKW A;  2RKI A;  4A8F A;  2MHE A;  3TQ1 A;  2VG5 A;  3UR3 C;  4J9M A;  1LKZ A;  1X31 C;  3MXH P;  2BW2 A;  1E6V A;  3IAM 9;  2MJU A;  4LRE A;  2ROE A;  3UPF A;  1RTD B;  2FLP A;  3MK1 A;  3LAL A;  4UOO A;  1AXQ A;  5HRO A;  4G1Q B;  2ATC B;  1D0E A;  1FXR A;  3SQO P;  4HHU A;  2VBY A;  2QGF B;  1CQM A;  2WTF A;  2CVI A;  3LUY A;  3MOZ A;  2JFD A;  4LF7 F;  4IR9 A;  1TV6 A;  1DUR A;  1WC3 A;  4P75 A;  3N5F A;  1UPP A;  4KAV A;  3IG1 B;  3E01 A;  3NS7 B;  1FX2 A;  2J8A A;  1UZH A;  5H9F K;  1OSC A;  3CB4 A;  3DYA A;  1KQF B;  1S0V A;  1MRO B;  1LXJ A;  2P6S A;  1EAY C;  3AAW B;  2CNL B;  1HWL A;  1FSU A;  2P9G A;  3QRQ A;  2IDL A;  4V19 J;  1RLC L;  3QGH A;  2ZHO A;  3Q23 A;  4KV8 B;  3HP6 A;  5LMU F;  4BDP A;  4FF4 A;  2B4U A;  4ECU A;  2JEI A;  3NKM A;  3ITH B;  4IRC A;  2RRB A;  2H51 B;  4YR0 A;  3OUY B;  5KFM A;  2RU3 A;  3SV3 A;  2UVW A;  1DAR A;  1FO1 A;  1VMB A;  3CCQ S;  2FHJ A;  2XSJ A;  3AB2 B;  1HFE L;  3TWZ A;  1A9N B;  1FKO B;  4IFY B;  3TG0 A;  5ETK A;  3VGT A;  1IM6 A;  5L46 A;  3ZZO A;  3CC4 S;  3M8S A;  2F7V A;  2J8S A;  1GT8 A;  4RKU C;  4M5H A;  4DSK A;  3HJF A;  4O44 A;  5BXI A;  3MWB A;  1BQN A;  2LMI A;  3HFK A;  1ELO A;  3W9I A;  4OJH A;  1Y7A A;  1VC5 A;  2LU2 A;  1I94 F;  4URS A;  2DKO B;  3CJS A;  5B0C A;  3CUL A;  5LMU J;  4KJD A;  3UNG C;  1UMJ A;  1NKC A;  2CQB A;  2FLO A;  3DOL B;  3PAC A;  3V4M A;  4Z7C A;  3LP0 B;  3IM8 A;  2E9T A;  2ALZ A;  3ZNU A;  5LXR A;  4WFB Q;  1R8A A;  1X5S A;  2E1P A;  4DSI A;  4CO5 A;  4DBQ A;  3QZ8 A;  2PC6 A;  2XMV A;  4QQB A;  3TX8 A;  1S59 A;  4MIA A;  3BN4 A;  4USH A;  3M30 A;  4JUZ A;  1W7W A;  5K20 B;  1DQ9 A;  1IR1 A;  4C4W A;  2NZC A;  3G6X A;  5J2M B;  3PY8 A;  3QMQ A;  4RBT A;  3OFF A;  4X66 J;  3MPD A;  4PCQ A;  4LF4 J;  3D66 A;  2MZS A;  2C22 A;  1FRI A;  3OLB A;  1RZM A;  2B0G A;  2LU1 A;  3MR5 A;  4C8Z A;  2BRL A;  2NZ4 A;  3IFE A;  1ACM B;  3HJV A;  4RW7 A;  3LOU A;  2HND B;  4RJV A;  5IM0 B;  2UVU A;  1OPZ A;  3M6U A;  2N4C A;  1JQG A;  1TUG B;  3MR7 A;  1RJJ A;  5KTQ A;  1U4B A;  3DPC A;  2VOO A;  3ZZ0 A;  2NSC A;  4P52 A;  4CRJ A;  5EGH A;  1VIO A;  1WF1 A;  1RB0 A;  3QLH A;  3BDH A;  1WUU A;  1NSQ A;  3HD1 A;  4MIV A;  4RBV A;  2HG4 A;  4Y2K A;  2I6W A;  1JJ2 R;  2OIH A;  1DBD A;  1TU0 B;  3R5A A;  1H7W A;  1CJU A;  4M1K A;  4RU9 A;  1H6K X;  1LWF B;  1TL4 A;  2CQ4 A;  2HVZ A;  4ZIV A;  5B08 A;  2X7I A;  3PHE A;  2VKR A;  4PG4 A;  4WFY A;  3WAV A;  2MXY A;  3M4X A;  1Z1Z A;  2B4O A;  2ACM A;  1C0U A;  4LRC A;  1CG2 A;  4ZA1 A;  1LWX A;  5C24 A;  1TTH B;  4PYA A;  1PJ6 A;  2FJD B;  3OHA A;  3M9O B;  2KFN A;  1IQT A;  1NDL A;  4USU A;  2BUN A;  2Y0S D;  3VZI A;  3Q2T C;  1KTV A;  1EJ7 L;  1HNV A;  3BKU A;  3L95 X;  3DLH A;  5GOV A;  2R8I A;  4CO1 A;  2ERR A;  3AOC A;  3UQS A;  1ZS6 A;  2F4V F;  4C8Y A;  4WXW A;  3GCW P;  1FD8 A;  2W7A A;  3F44 A;  1JXE A;  3M6W A;  3P4U B;  4JI0 F;  5A8K B;  1Q79 A;  1HHQ A;  3WDO A;  4ZLJ A;  4C8O A;  2MSS A;  2W5T A;  1IKY A;  2VIC A;  2XMK A;  1RWU A;  2BAN A;  5DG7 A;  4NXN J;  3QO9 B;  1FER A;  2ZHB A;  3DRR B;  2DGT A;  1C2P A;  1FXD A;  3DLG A;  5L9N A;  3VAJ A;  5U47 A;  4B9L A;  4JV1 A;  4LMZ A;  1YSJ A;  2C3M A;  2XTJ P;  3HZE A;  6FDR A;  1S99 A;  1IXK A;  3CCT A;  1X5P A;  5JMN A;  2ZH7 A;  3PO4 A;  1MLA A;  4DSF A;  1YJT A;  4Q5V A;  3OL9 A;  2IBK A;  1HBU A;  3V81 A;  4CH7 A;  5A6W A;  3M8Z A;  3OPK A;  3JYT A;  4LRF A;  4GO7 X;  4ID8 A;  3CWJ A;  2EG1 A;  5BJR A;  4LBH A;  2KM8 B;  2DY1 A;  2KVQ E;  2WBM A;  4DX7 A;  1PSD A;  2NCK L;  1U25 A;  4PWU A;  1N8R T;  4ZKA A;  2VOD A;  2HHS A;  5KT5 A;  4OLP A;  4DS5 A;  4DSJ A;  4NXM F;  1UVN A;  4A8K A;  3S1T A;  3UVJ A;  4QWB A;  2HNY A;  4DR4 F;  3LP1 A;  4UW2 A;  3Q22 A;  2AJ0 A;  2UV8 G;  3MM9 A;  3C15 A;  3DRP B;  4ICL B;  3PX0 A;  2PI5 A;  1TAU A;  1HJK A;  1GAO A;  2BJD A;  2JVR A;  3M2U A;  3L09 A;  3ZTS A;  3ILL A;  2R2T A;  2XB2 D;  1KHL A;  3ENV A;  4WII A;  1J5O B;  1XNQ J;  4KPY A;  2NPI A;  1GMU A;  2F9J A;  2ROP A;  4PAA A;  1TK8 A;  3CME S;  3JAM U;  2JLF A;  2X51 A;  4DEZ A;  5DET A;  2K8G A;  4X4V A;  1XNQ F;  1Q7Y T;  2IFY A;  1RWP B;  3NKO A;  3FQK A;  1X5T A;  4KO0 A;  2NLW A;  4AE5 A;  1R0A B;  4I7F B;  1KFS A;  4UOP A;  4GTY A;  3A1Y G;  3LAN A;  4CLP A;  1QTM A;  4UST A;  1VK8 A;  5D0R A;  4K4V A;  1FRK A;  2BAN B;  2EWH A;  3DLK B;  3DOK B;  5K8P A;  2DR5 A;  4KM4 A;  1HWJ A;  1CLF A;  3C6T A;  3MM6 A;  4PXC A;  4DR2 J;  1CJT B;  1HPZ B;  4USK A;  3KKF A;  2DBB A;  4FF1 A;  2ACY A;  1R31 A;  1WKL A;  3T1H J;  2V2Z A;  3UE2 A;  3WAX A;  2UXD J;  1YJR A;  3ETO A;  2DR7 A;  3V5R A;  3KLE A;  1M5V C;  3V6K A;  4DS4 A;  1JLG A;  1G7C B;  1HBO B;  1HWU A;  2M7S A;  4O0N A;  1UW4 A;  4K50 A;  1PYO B;  2PEH A;  3ZO7 A;  2F9D A;  2G1H A;  5HVF A;  3HHL A;  3MAA B;  1U48 A;  1HNZ F;  2WHO A;  4EFA C;  3MR6 A;  2JZ5 A;  3CXC R;  4OIX A;  4U6P A;  4NEZ A;  3T1Y J;  1TK0 A;  3C2P A;  3IR7 B;  1CJU B;  3I96 A;  3M2R B;  4AQY F;  1MRO A;  2EK1 A;  2ZVS A;  4X84 A;  5B0F A;  2XS2 A;  4QR1 A;  3D0G E;  4FYW B;  1AJB A;  2V94 A;  3BS9 A;  1Y0H A;  2E1M C;  1EJJ A;  2R7S A;  4ER8 A;  1ZAX A;  1U24 A;  1JLE A;  2GVZ A;  1DQ8 A;  3V4I A;  1E1Z P;  1S9E B;  2QSF A;  1CPZ A;  1GX5 A;  2AZ3 A;  2MKY A;  4GO5 X;  1R89 A;  2QLW A;  1SL0 A;  4LFB J;  4B9N A;  1GXL A;  2W9C A;  2VZ9 A;  4XPC A;  1UZD A;  3A8E A;  4NLX A;  4PG5 A;  1ROF A;  4CNY A;  2B5J B;  2ZH4 A;  1HNX J;  2LQJ A;  1F9E B;  2PD1 A;  4OYO A;  4F0K A;  3L3C A;  3POT A;  4IO9 Q;  2JEJ A;  1ALJ A;  1P9Y A;  1U02 A;  2RVJ A;  2AJ2 A;  1MN7 A;  3S6E A;  5C25 A;  3T1Y F;  1HW8 A;  5D4O A;  1VBY A;  2A2D A;  4DQP A;  3DN9 A;  2E1R A;  2MZJ A;  1P27 B;  1X0P A;  2NSB A;  2YVS A;  3MCO A;  1V3Z A;  3TEH B;  5J2M A;  1JLA A;  1NJI T;  4MK7 A;  3GE9 A;  2ZZM A;  2DK2 A;  4DV4 F;  3BDP A;  4AFF A;  3W8P A;  3G82 A;  1XN9 A;  4E8U A;  1VQY A;  4C2M A;  3K57 A;  3QJP A;  4P73 A;  1ZPV A;  4WKY A;  4K7Q A;  1IKX B;  1NK5 A;  2C3P A;  2FUG 9;  5HK4 A;  2FVP A;  1FKP A;  3RW6 A;  2CQ2 A;  4Y6I A;  5KFY A;  4OI3 A;  4DR5 J;  4ZGA A;  1N5Y A;  4RL1 A;  2DYA A;  4KJI A;  1QE1 A;  2G2Y A;  1Y7P A;  4MIW A;  4CT8 A;  4WE1 B;  2CKW A;  1S48 A;  3AT1 B;  5J2Q B;  3R6L B;  4CO4 A;  2RQK A;  4LF4 F;  4FYX B;  5GAH U;  1I51 B;  2CG8 A;  2FVR A;  1U0H A;  3UN3 A;  2AHO B;  2N7C A;  2UUA F;  3N6L A;  1H7X A;  9ATC B;  2FJB B;  3BDF A;  1G3O A;  5CYM B;  5DGA A;  3J7Y U;  1V5V A;  4DR2 F;  2FHJ D;  3BBF A;  2GVZ B;  1JLE B;  1NM2 A;  2OPP A;  3M2V A;  4FKY A;  4DV2 J;  1WOO A;  4X65 F;  3V4I B;  2UUW A;  3NRB A;  5A6P A;  3OUY A;  4GKK F;  3IGZ B;  1CS4 B;  2X1B A;  1RHK B;  3KJF B;  4S0M A;  1I94 J;  3KDN A;  1KTQ A;  2XMM A;  3MZI A;  3R9L A;  4OZJ A;  1PAU B;  4UOR A;  4RPF A;  4TN0 A;  1ZM4 A;  2JRS A;  1T9X A;  3TA0 A;  1YJV A;  4C6A A;  4LR2 A;  1FTR A;  1HQE B;  1U2F A;  2KRR A;  3PYE A;  2JL9 A;  2IJF A;  4DV0 F;  3TVY A;  3MFI A;  2GIR A;  1IKY B;  3GLJ A;  2OHD A;  4PUO B;  1JJH A;  1HW9 A;  2ILZ A;  5EN1 A;  3HT0 A;  4J9S A;  1SJ1 A;  5MAO A;  4RW6 B;  2KXF A;  5F9L A;  1ZOT A;  3A4T A;  3BR9 A;  3MMB B;  4FF2 A;  2V9W A;  1HNV B;  3TZY A;  4OLO A;  1HQ2 A;  4YN3 B;  2N3L A;  3OVA A;  5K14 B;  1E6V B;  1RTD A;  2AF6 A;  2QJ3 A;  1HNW F;  2HHV A;  1XJW B;  4NZ6 A;  2VG5 B;  5L9X A;  2VG6 B;  4IOA Q;  4UPH A;  3QWP A;  3HFV A;  1BXN A;  2QA4 S;  1R0B G;  1N36 J;  4GTZ A;  1ANI A;  3FBC A;  2HW3 A;  4ZJL A;  3LW5 C;  2A10 A;  4DPT A;  2XS7 A;  4OHW A;  3OQ2 A;  1RAF B;  3M8Q A;  2QA2 A;  3EE3 A;  3B4D A;  3K8W A;  2R8J A;  3MI7 X;  3DI6 B;  2FLL A;  1FE4 A;  2CA9 A;  2H1Y A;  1TVR A;  2RS8 A;  3BBB A;  2Y0B B;  3IGV A;  4TY8 B;  5K5M A;  1RCO B;  3UN2 A;  3CJ3 A;  2MLZ A;  1VLY A;  3EGN A;  3JSB A;  1L3K A;  3SQG B;  1N6Q B;  4X4U A;  1U1Q A;  5LT5 A;  4PQU A;  1S1V A;  1TUV A;  2C2Z B;  2MQQ A;  3WBH A;  2DH8 A;  4JI3 F;  1RTZ A;  3S8S A;  1UFK A;  2HHW A;  2DPJ A;  3NGD A;  4H4M B;  3QT5 A;  4N56 A;  1SJ4 P;  1S1T B;  1ZM2 A;  4Y2M A;  3CUN A;  2Y1I A;  5IT9 U;  2HLT A;  2WW4 A;  1GK8 A;  3KJQ B;  1T03 A;  2CQC A;  3CJ0 A;  2HHH F;  4NCB A;  3HX9 A;  2V0N A;  2W5W A;  2L9W A;  2J5A A;  1H74 A;  2K06 A;  5I3U B;  1RXO B;  2C2R A;  5DRK A;  4PPZ A;  1M5O C;  3B5Q A;  3HZG A;  2KL8 A;  3Q8Y A;  4KFB A;  2D3U A;  2CJK A;  5CAB A;  3NMA A;  4MFB A;  4U67 Q;  3RRK A;  1RWW B;  3QJL A;  4XIU A;  3THT A;  2IM1 A;  3O44 A;  3MGJ A;  1Y3J A;  3WIV A;  2XI3 A;  1IKW B;  5C2G A;  4H4M A;  4N8O A;  3H25 A;  2OPR B;  1NKB A;  1RIS A;  3K5O A;  3BQ2 A;  1FDA A;  5HMW A;  3JYT B;  2ASJ A;  1EQ0 A;  1CQN A;  2C2E A;  3AFG A;  3GV8 B;  1ALK A;  3LH2 S;  1TFW A;  3GR0 A;  4C8N A;  2LXU A;  4O0I A;  2VPY B;  3LP0 A;  4CLK A;  3M8R A;  2R2R A;  5ETO A;  4RNO A;  4CYR A;  4HT5 A;  2ZD1 A;  2UXC F;  4DZD A;  5GAG I;  1B8J A;  1PC4 A;  3D28 A;  3DLL Q;  2EK6 A;  3KG0 A;  3PEJ A;  1RTH B;  1Z2Z A;  3BGO P;  1LWC B;  5KFG A;  4AL6 A;  5KG5 A;  3LTO A;  1Y11 A;  2LQ8 A;  5B0B A;  1ELY A;  4GVB B;  4F25 A;  4A8O A;  5HMZ A;  1F6T A;  4NML A;  4A48 A;  1XEZ A;  3BSA A;  5CZX A;  4FZV A;  4DR3 J;  4YEA A;  1GFW B;  1S97 A;  1SC3 B;  2DNM A;  3IC1 A;  2BW7 A;  4NE9 C;  3KHH A;  1IBK F;  1REV A;  2YNI A;  1NDP A;  2HHQ A;  2F4F A;  2OSR A;  4U7C A;  3DU5 A;  3HHD A;  3NBP A;  2MY7 A;  4F7V A;  4OI0 A;  3M9N B;  2MQM A;  4OHY A;  2U1A A;  4AD6 A;  5I3P A;  3RRH A;  1H0H B;  1NH7 A;  2GVD A;  2QFI A;  1QDU B;  1K47 A;  2VBX A;  4JBC A;  1KHW A;  4LF2 A;  2V63 A;  3OSP A;  4C8L A;  1UVI A;  4C11 B;  4YHH F;  1TKZ B;  4JI4 J;  2KFY A;  2ZM6 J;  4X4Q A;  1QUV A;  2VG7 A;  5HMX A;  3Q3Q A;  4JB8 B;  6FD1 A;  1VC6 A;  3KG4 A;  4GKJ J;  2YWK A;  2XLJ A;  1C4A A;  4OZL A;  2E66 A;  5HVH A;  1B0P A;  1RT5 A;  2WON A;  5HBM A;  1RBO B;  3OR1 B;  1RT2 A;  5IOL A;  5J2N B;  1HBN A;  3VQS A;  4MH8 A;  5KG3 A;  1HAR A;  1UL3 A;  3BSC A;  3MEK A;  4DG1 B;  1U1K A;  4LFA F;  4B3R F;  4M5D B;  1P1T A;  2R3V A;  2B6A B;  3DLE B;  1RAD B;  2FIU A;  3FFI A;  5KG1 A;  2BKN A;  3J7Z 5;  1JKH B;  2F5G A;  1WKJ A;  3OL7 A;  1WOP A;  3OTO F;  3VWS A;  3T5L A;  3BH7 B;  3ILO A;  4KBI A;  1E6Y B;  3EGZ A;  2D3O R;  3R7S B;  4L76 A;  2DEI A;  3G86 A;  4J7C A;  4ZPA A;  2W4P A;  5KFB A;  3ELH A;  3TUP A;  3KLH B;  2M2B A;  2IJN A;  2CWX A;  4HAC B;  3EX7 B;  2WVF A;  4ED5 A;  1RDR A;  3IWL A;  3SSQ A;  1IBC B;  2CQ3 A;  5GVQ A;  1SIW B;  3AJD A;  2GA3 A;  1LW2 B;  5JXS A;  2R2U A;  4HDH A;  3NCR A;  2BDP A;  4MJK A;  4W98 A;  4ZDN A;  5A2Q U;  3HF5 A;  3KLG A;  3RAM A;  3MOJ B;  4RUH A;  4K0K J;  1TFY A;  3ENQ A;  4UUW A;  3DOL A;  1FEE A;  2CJY B;  1MG7 A;  3LP2 B;  2ALY B;  4I2P B;  4WIQ A;  2RQC A;  4B3O B;  1O8B A;  2V67 A;  5KFN A;  4DLE A;  1VBX A;  4LF6 F;  2RU9 A;  3D4J A;  2BJ9 A;  3OTC A;  2BAB A;  2CPX A;  2WAQ D;  3KK2 A;  4P2X A;  2C42 A;  5ETQ A;  4RWX A;  1XMB A;  2Y1J A;  5DDP C;  1X4G A;  4LUB A;  2VQE J;  4OZN A;  4XPE A;  3D1O A;  3Q0A A;  3SV4 A;  1T3N A;  4B3T J;  3SZY A;  2FTR A;  2FVC A;  3I82 A;  5HQL A;  2CZ4 A;  4Q45 A;  1JKH A;  3RBE A;  1IBM J;  2DR8 A;  2KRB A;  1NHU A;  3DU6 A;  2YQ3 A;  3M8P A;  1CJK A;  4P6Q A;  3UDC A;  1U1M A;  3FEX B;  3MM8 A;  4DUY F;  1FKA F;  4L72 B;  2GHP A;  2AKW B;  2R8G A;  1IWA A;  1RT2 B;  4U8V A;  3CMQ A;  4ZVE A;  4ANE A;  4CM0 A;  1KEK A;  2EPI A;  3MFH A;  1XMO J;  2GO9 A;  4GKJ F;  3MTK A;  2G13 A;  2YKO A;  5K4P A;  3D1Q A;  1VQ4 S;  4ZP8 A;  4I6Y A;  2ZZN A;  2VG7 B;  2KJV A;  2MQL A;  2F40 A;  4Y65 A;  3W9H A;  1TKZ A;  4EEY A;  2H3E B;  2IPO B;  1B7F A;  1D1U A;  2WRM A;  5GME A;  1RAO A;  3KWM A;  1ED9 A;  2AYB A;  1FXL A;  2MKJ A;  1P49 A;  5L0K A;  1X4F A;  3OR2 A;  4A46 A;  2ANH A;  1F1B B;  1UCN A;  2D3Z A;  4QOT A;  2HBY B;  1F0X A;  2WSE C;  3CCV S;  4DLG A;  3T9N A;  3LWM A;  3MEC A;  1IKV A;  2WW8 A;  3AOB A;  4DUY J;  1O51 A;  3C6U B;  2I9S A;  3CO9 A;  3H8Y A;  4BWJ A;  3ULH A;  1SHQ A;  3IGY B;  3NCP A;  4NWX A;  1VQL S;  4C3M A;  3G8T A;  3HSD A;  3PRV A;  3BO3 A;  4RW4 B;  2W9B B;  2EKN A;  2I5J B;  5HP1 A;  3H0P A;  2YQ1 A;  1LWE B;  4IOB A;  4LSN B;  5IQQ A;  3BRE A;  5D0E A;  3KLF B;  2VIH A;  1FVQ A;  1QY7 A;  2BJ1 A;  2IM3 A;  2PT0 A;  4IR1 A;  5I4M A;  5HAO A;  4CP5 A;  2H5E A;  3D68 A;  3DRS B;  3PYF A;  2C28 A;  2BYC A;  4NLD A;  4ZG6 A;  3H5S A;  3EMT A;  5E33 A;  1SKR A;  2RH6 A;  1FNO A;  4HVZ A;  4EWT A;  1C1B B;  2BE2 B;  3GIL A;  3R5G A;  3F56 A;  1QVF R;  1Q8K A;  1FA0 A;  4PQA A;  2GIF A;  2C2N A;  1SV5 A;  3QAU A;  4RO0 A;  1RT1 A;  1KQG B;  1YJU A;  2CUY A;  3K89 A;  2DNR A;  2FZK B;  2W1B A;  3DRP A;  4FYY B;  2L08 A;  5LMN J;  1X9S A;  2DVI A;  3LP1 B;  4NMX A;  1LW0 A;  4UOC A;  3I32 A;  5ETT A;  3W61 A;  4CH0 S;  2BEF A;  4EZ6 A;  4JP8 A;  5J1E A;  2MB0 B;  4TYA A;  2C3Y A;  2YY3 A;  1LOU A;  5I3U A;  4LF5 F;  4ES1 A;  3T3F A;  2HHT A;  2QLF B;  2E5I A;  2LP4 A;  4F2S A;  2BE9 B;  3CD5 A;  1XMQ J;  3CD6 S;  1FJG F;  1AZS A;  1GMW D;  2V2K A;  2HGM A;  1UWA A;  2ZDO A;  2B7C B;  3AQO A;  4UOF A;  1NHK L;  2FB0 A;  2GO8 A;  2P8I A;  3C14 B;  2DGS A;  3CT9 A;  3DRX A;  4NLW A;  1ZH5 A;  2LQB A;  1FRX A;  3DGP B;  2J6T A;  4PQU B;  4LFB F;  1Z4U A;  3SIP B;  2KDO A;  2VBZ A;  1S1U A;  2M8D B;  1S1X B;  8AT1 B;  1N33 J;  3MK0 A;  2E7V A;  5LMN F;  3UCU P;  3EJM A;  4WFA Q;  3RBX A;  3RB6 A;  1L5U A;  1V5I B;  1JJC B;  1OWX A;  1D8Z A;  3FQL A;  2CAJ A;  2HFZ A;  3BYR A;  1RAJ A;  4DUT A;  1TL1 B;  5GAH I;  3MR2 A;  5GAE U;  1DFD A;  5D15 A;  4LRA A;  5DZ7 A;  4DUZ J;  2E5J A;  2J6U A;  2RQM A;  1B4S A;  4PYD A;  2HS0 A;  4QJV A;  5EHH A;  2AJ4 A;  2VU5 A;  2AJ1 A;  3FVY A;  5H1S V;  3A8J A;  1Q16 B;  1NK6 A;  3BQ1 A;  5B0G A;  3EDQ B;  3I6P A;  3R7N B;  1KSP A;  4B9T A;  2VFR A;  3JQK A;  3HVA A;  4RNH A;  3GCX P;  3NVL A;  2XLI A;  3UD5 A;  5DM7 Q;  1GH8 A;  3E8O A;  1WSR A;  4KIA A;  1SXL A;  2GZO A;  5EWE A;  3PW7 A;  1R27 B;  2XGQ A;  3PW2 A;  3U1N A;  2NXJ A;  5E3Q A;  1N56 A;  4KKO B;  3G87 A;  2NXC A;  3EPI A;  1LFW A;  1I1G A;  3NCQ A;  3FZ2 A;  4PG7 A;  1JNZ B;  3QZ7 A;  4JI1 F;  1YWX A;  1BWV A;  2DR6 A;  4C97 A;  3OTB A;  1T9T A;  3GFY A;  5K8O A;  1YJN S;  5AXN A;  5DG8 A;  4A8Q A;  4M95 A;  4ID5 B;  3W2W A;  3G6E S;  5A8W B;  3PRD A;  2EI5 A;  4ZN3 A;  4KAI A;  4QWA A;  1RWK B;  4DQI A;  1YG0 A;  4ES2 A;  4GMK A;  2VQF F;  1H2T Z;  1WEZ A;  2FC8 A;  1NPK A;  3OFH A;  3BM7 A;  3CJQ A;  3B4M A;  3FJ2 A;  4QYZ J;  2MZT A;  4LBP A;  1HMV A;  5HJX A;  4LVO P;  2QRR A;  4H54 A;  4XAK A;  2H54 B;  5M2U A;  4DL7 A;  1REG X;  2BJE A;  3D1H A;  1WJ9 A;  3J7Y I;  3I31 A;  3HVT B;  4B3M F;  1AUK A;  4LF5 J;  3DGV A;  1QAJ A;  1A7G E;  3HK2 A;  2QT7 A;  2HWI A;  4DSE A;  1EQM A;  3AD8 C;  5KXA A;  1H2V Z;  1OPI A;  2BOA A;  2B9Y A;  3AB4 B;  4K4W A;  3DLB A;  2J0S D;  3HSJ A;  1FWL A;  2IDE A;  4MK9 A;  2APO A;  5CA5 A;  4CLY A;  2Z2L A;  4L6V 3;  1JK9 B;  2BV3 A;  3K5P A;  5IT9 Y;  2B56 A;  5KFA A;  2OPQ B;  1RU1 A;  3QIP A;  3J80 Y;  2W5S A;  1SJQ A;  4F4X A;  1HNI B;  2J0Q D;  3P49 B;  1U45 A;  3PG9 A;  2CPY A;  3PM9 A;  5D4N A;  2HHP A;  4L73 A;  4ED3 A;  2QFJ A;  1YI2 S;  5C5J A;  1NK0 A;  2HS3 A;  2JSX A;  2HMI B;  3KNG A;  2R7O A;  2OFG X;  4DV3 J;  1CJV A;  1RWV B;  2ZOG A;  4NI2 B;  2R9L A;  4HI1 A;  4DX5 A;  1EQJ A;  3ZTO A;  5IQ6 A;  1JNR B;  2WSF C;  2W2P P;  3A8K A;  3PYG A;  2PMZ D;  1P9Q C;  1JLA B;  4C7Q A;  3KYL A;  3TI0 A;  3L7P A;  4ELU A;  1YIT S;  4DV7 F;  1UWB A;  2FYX A;  2MKH A;  2LVW A;  2P9E A;  2J7K A;  3UD4 P;  3D3C J;  1KON A;  5BYS A;  3PIO Q;  1ZTT A;  2CNK B;  1RTH A;  3KTQ A;  1FT8 A;  1V9O A;  2MEW A;  3TYT A;  5HL7 Q;  5TJ3 A;  2HQI A;  3ENW A;  1X4A A;  3MPV A;  4PXE A;  4F67 A;  3SDE B;  3VF0 B;  5AXL A;  4NXM J;  1OIA A;  5CXT A;  5T7L B;  2KN4 A;  3HVW A;  3CCS S;  2G0I A;  1NAQ A;  4IG3 A;  2FJX A;  1Q8I A;  1O0P A;  3IGN A;  3OJS A;  2MMY A;  3KLV A;  6AT1 B;  3HPO A;  4A4J A;  1RKJ A;  1D9F A;  2ZEJ A;  3D6H B;  3GZ7 A;  4NLQ A;  1D9D A;  2IRU A;  4O23 A;  4P7T A;  4JI5 F;  1HWK A;  4M94 A;  3QFH A;  1ZYQ A;  3BSN A;  1IKW A;  1PBA A;  2UXB J;  4WZM A;  1MU2 B;  4GRS A;  3EWG A;  4KV8 A;  2ZIT A;  2V5H G;  3EM1 A;  1VDH A;  3GJT B;  4QIV A;  2I2Y A;  4F3Q A;  2ZC4 A;  4I56 A;  4DR6 J;  4KH0 B;  1U1O A;  4NZ7 A;  2EFG A;  5IJQ A;  4R5P B;  1O5J A;  1T11 A;  3DYA B;  4PWW A;  2JX2 A;  3VGS A;  3O8W A;  2HGL A;  4ED4 A;  5LQQ A;  2ZKU A;  2KI2 A;  1T05 A;  3E01 B;  4H4K A;  3W66 A;  4EO8 A;  1T3O A;  1YJ7 A;  3DOM B;  1VQ9 S;  3W65 A;  1SQE A;  4HTI A;  2OH2 A;  3T6B A;  4QYZ K;  1XQI A;  1VGY A;  2YKN A;  3TAQ A;  2OEK A;  4DPU A;  3HT3 A;  4C98 A;  2O66 A;  5E7O B;  4QBU A;  2VFT A;  3EXY A;  1KDN A;  2UUA J;  2I1R A;  1N34 F;  2IBO A;  4NLS A;  4OZ0 A;  4DL3 A;  4OL8 A;  4QW9 A;  1RWN B;  2A1B A;  1MN9 A;  1Q95 G;  2Z56 B;  4JV2 A;  1TVR B;  3EZO A;  4NCG B;  3IBW A;  4NA3 A;  3RTV A;  5EUH A;  3KHR A;  5HQM A;  2VC1 A;  4M5M A;  2LEP A;  5GAG U;  1JMT A;  5IV3 A;  2KYX A;  3M8W A;  4RR5 A;  4KGK A;  1KNZ A;  4ECT A;  4UY8 5;  1RCX B;  2I5J A;  1P1L A;  1S7H A;  4DJB A;  3C16 B;  2NXU A;  2D41 A;  5G0R A;  3MMJ A;  2IA0 A;  1CSJ A;  2UZA A;  1TL3 A;  3W60 A;  4RUA A;  1OYD A;  1L3T A;  3I0R A;  4C8K A;  4F8R A;  1UP1 A;  1U2C A;  3AQP A;  1FDN A;  3CED A;  1KR4 A;  3MMB A;  2FC9 A;  4CDI A;  5HN0 A;  1OSD A;  1MML A;  4OI2 A;  1VC0 A;  2YKN B;  2ADB A;  4W90 B;  3P8B B;  3VAI A;  1U47 A;  2YNG A;  3CMA S;  2E5L F;  3SZZ A;  3MHY A;  4USV A;  4ED6 A;  4F4W A;  2KXN B;  4I6A A;  2DNO A;  2FPH X;  4IKA A;  4ZP6 A;  4LSZ B;  5ITH A;  3AY0 A;  3MMA A;  5T14 A;  5B0E A;  3BO4 A;  2E9R X;  4QYR A;  4O3P A;  4ZCI A;  4FPI A;  3TZX A;  4FNI A;  4RUB A;  4X2B A;  2ZBI A;  4EK2 A;  1YVF A;  5AJ3 F;  4ECW A;  3OT9 A;  2PMH A;  4DF4 A;  5HQ8 A;  1Q86 T;  1HQA A;  1UET A;  2BX6 A;  3VV2 B;  2FGC A;  2M4M A;  4DN0 A;  2UV8 A;  4AYB D;  2YKQ A;  3CCE S;  2AT1 B;  2O1P A;  1VI7 A;  3M2V B;  1NRK A;  3EVO A;  2B4V A;  3OFE A;  3QRP A;  5ETV A;  1N5V A;  3LGH A;  2MKS A;  3NWG A;  4OX6 A;  1VFJ A;  5KFI A;  4A8S A;  3UD3 P;  4FYV B;  4N76 A;  2P2C B;  4NYP A;  4DUZ F;  2DH9 A;  3OXF A;  4OV1 A;  4AT1 B;  3KUG A;  4YFU A;  1RKI A;  1TEL A;  1W25 A;  4NLU A;  3GV7 B;  3EDR B;  5DQH A;  1N0U A;  2YWF A;  1KOH A;  4NL5 A;  4DV1 J;  1VLO A;  2LEC A;  4JV5 J;  2Z2Y B;  2Y1L B;  3IO1 A;  3VHQ A;  1N32 J;  3AH6 A;  4QWD A;  2JLE A;  1BWE A;  2GHW A;  4UTG A;  1HQU A;  4KHR A;  2VQR A;  2QMU B;  5C66 A;  1R7I A;  1NDC A;  2BMB A;  2LDY A;  3B54 A;  4AXJ A;  1FKP B;  4WXO A;  4PWD A;  2OPS B;  4OHV A;  4BBY A;  5LSR A;  1OQ3 A;  1AUD A;  3T5H A;  3SBM A;  3EZ5 A;  1RT4 B;  2XNR A;  1AYE A;  4CI0 B;  3D67 A;  4N5S A;  3T1H F;  5KFC A;  1N4L A;  1XER A;  2OUG A;  4DV5 F;  1KD1 T;  2KVI A;  1CUL B;  2FQQ B;  1OY6 A;  5HI7 A;  3UR0 A;  3G4S S;  2W4D A;  4QIG A;  2GW8 A;  2HRU A;  3QQC D;  4G6V B;  2QZU A;  2IJR A;  4RW8 A;  2H48 B;  1TAQ A;  3SFG A;  3TRG A;  3GIK A;  1FK9 B;  2UUT A;  4MTP A;  3CCJ S;  3KOA A;  4B02 A;  1S6Q A;  2YPY A;  2DIS A;  4N77 A;  1TKX B;  2J9C A;  2JC1 A;  1GXU A;  1GMW A;  1FE0 A;  2M70 A;  3NGS A;  4LQ9 A;  4TNO A;  4CNZ A;  2BR0 A;  3SFU A;  3OTD A;  3OTE A;  2XHW A;  1RHM B;  1XBW A;  5KFE A;  1OS5 A;  2W9C B;  1Y4Z B;  4MMO A;  1CC7 A;  3CCZ A;  4RBU A;  5E3A A;  2ZZT A;  1J5E J;  1KP6 A;  1NZ8 A;  1UEU A;  1XWL A;  4OQJ A;  2RDJ A;  4LF9 F;  4ITS A;  2ZJP Q;  3MCN A;  5LRM A;  1X0F A;  2A3J A;  3ETM A;  2GSU A;  3MK2 A;  1WDD A;  2WB4 A;  4NPO A;  3I4H X;  1M5S A;  5RUB A;  2IUC B;  4N41 A;  3THP A;  2CJA A;  2GMH A;  4C11 A;  2XY7 A;  5DQI A;  3C3L A;  1U7L A;  5CCM A;  1Q7L B;  1NH8 A;  2ZUA A;  2A6O A;  2UU9 F;  1EI6 A;  3P5B P;  5AE1 A;  4FPR A;  2Q3P A;  1UFW A;  4FXV A;  1TL5 A;  4O4G A;  1IN0 A;  2BKO A;  2MJN A;  2XWY A;  2XMT A;  2XI2 A;  5HJY A;  2HRT A;  5GAE I;  3VAM A;  1F3F A;  1MMD A;  2YH1 A;  1P6T A;  2IC3 B;  2M52 A;  2HFV A;  4OI6 A;  3K5L A;  2DPI A;  4CTA B;  4RLE A;  4X62 J;  3NS5 A;  3PHT A;  3SCK E;  5CYQ A;  1WNE A;  2DXE A;  4WJB A;  2OP5 A;  3PX6 A;  3MM6 B;  4J9V A;  3PIP Q;  5A8R B;  4DR1 F;  4DCP B;  4PRF A;  2VOP A;  4P74 A;  4FXW A;  2Q79 A;  1RAI B;  1JJ4 A;  5E3R A;  5DDR C;  1RU2 A;  4O44 B;  2DHG A;  2L9N A;  1S5Z A;  2NXE A;  1SI9 A;  2RF2 B;  4K5S A;  5KG2 A;  4I7F A;  2CQI A;  2EVZ A;  3VAG A;  1IWG A;  1JLQ A;  2HFO A;  4ELV A;  4U96 A;  1NSP A;  4KTQ A;  4ATN A;  2ZH5 A;  3GJQ B;  5D3G A;  2C3U A;  2VPZ B;  1NDK A;  2UXC J;  3VVT A;  3QPI A;  4DHV A;  4JI1 J;  2UUB J;  3BV8 A;  3GMG A;  4MKY A;  2EC0 A;  3DM2 B;  3K7R A;  4USI A;  2C2D A;  1F2H A;  3VAK A;  4O3R A;  4TVA B;  2E1A A;  2VFV A;  2KHD A;  3MM9 B;  3Q8R B;  3RR7 A;  2HNY B;  3DXS X;  1FDD A;  4H4O A;  4WKR A;  3CSK A;  5HAT A;  2M9K A;  4Q7A A;  4UPL A;  1QSS A;  1XTZ A;  2HQC A;  1BHN A;  2CAD A;  4I69 A;  1M0S A;  5DGB A;  3OL8 A;  1QSL A;  1FJG J;  4ELT A;  1T95 A;  2RE1 A;  1LQ9 A;  2V68 A;  4LRB A;  4IG0 B;  3WQP A;  4XDC A;  2YNG B;  3P6Y C;  4M63 A;  4Y00 A;  1KLM A;  5DDO C;  4NA1 A;  4CO0 A;  3PYD A;  3KUH A;  3TX0 A;  2AGP A;  1SQF A;  2KYZ A;  1SCJ B;  3BB5 A;  5FII A;  5KG4 A;  2CJB A;  3IR5 B;  1KLN A;  2GAG C;  3V81 B;  2AYG A;  2AEJ A;  3BGR A;  4YR3 A;  3DFE A;  3BDG A;  3C66 A;  2CRL A;  3NS6 A;  1HL6 A;  1FTC A;  1DHM A;  3RW7 A;  3UI3 A;  1FK9 A;  3U7J A;  1JXV A;  4TLR A;  4YR1 A;  3ISN D;  1KFD A;  3VGU A;  1WTF A;  4EU0 A;  2B43 A;  3FBF A;  2XMW A;  2V6A A;  1W2I A;  3DRR A;  1KH7 A;  2ABY A;  3QRR A;  5CYJ A;  4IQM A;  1T9U A;  5JJB A;  3LGM A;  4JOU A;  4I68 A;  2RSQ A;  4P2M A;  4ECX A;  4HH0 A;  4RW4 A;  1AT1 B;  2Y3Y A;  2VQE F;  2VG6 A;  2JEF A;  2GSO A;  4ECZ A;  4GTX A;  4XDD A;  1DZ5 A;  4WTO B;  2R7T A;  1HI8 A;  3GJR B;  4I2Q A;  4QPT A;  4IH6 A;  2IAJ A;  1ZEF A;  3KK1 B;  3BEG B;  2BM0 A;  2UU9 J;  3MEE B;  2X1G A;  2AYM A;  2PII A;  3W5X A;  5IWA F;  1V6H A;  2QA4 G;  3N01 A;  3QSI A;  2R42 A;  4YB5 A;  2XSF A;  4OJ3 A;  5LOQ A;  4CO3 A;  1FRL A;  4DQR A;  4ERD A;  1X8D A;  2MLX A;  2QG9 B;  5E41 A;  1UVK A;  2DGX A;  1TL1 A;  2YNH B;  1MWQ A;  4WK3 A;  3CJK A;  3IBC B;  4CO2 A;  3HLU A;  4FVM A;  1RTJ B;  3OSN A;  2C3O A;  3TA2 A;  4AND A;  1SIZ A;  4MK8 A;  2JNJ A;  2Q43 A;  4LIW A;  1KHJ A;  4C9D A;  2C2K B;  1UAW A;  2B7B B;  3DC2 A;  5CD4 A;  4NXN F;  4QAX A;  1DQA A;  1PYS B;  2HVH A;  4IH7 A;  4B3M J;  1FD2 A;  2VB6 A;  2WVB A;  4JI3 J;  1Q1K A;  2R8H A;  5BR8 F;  3M1V A;  3VVU A;  3QLH B;  5ETS A;  5F41 A;  1S9F A;  4YQW A;  2DIU A;  2XUL A;  2DHH A;  4LF7 J;  3R1H A;  2JJ4 D;  3DMJ B;  3PRB A;  5IC4 B;  3TVZ A;  5C42 B;  3K5M A;  1AZS B;  1U1L A;  2ILY A;  3T1A A;  2RHS B;  2MYF A;  1H38 A;  4WP9 A;  2VBW A;  3KDO A;  3PR4 A;  2UUB F;  1AJC A;  3ISN C;  1RAE B;  4G65 A;  4A47 A;  2HIQ A;  3IWN C;  1Y5I B;  2CZV C;  3JS9 A;  4TQR A;  3MUV P;  4WE1 A;  1RTI A;  2YKM B;  1QE1 B;  3MCS A;  3HSZ A;  4UZC A;  1FFG B;  5ETN A;  4ZCL A;  1VRU B;  1KBR A;  1SC4 B;  2XY6 A;  2V8P A;  4DR5 F;  4USM A;  1K73 T;  4JI0 J;  3B6B A;  3W63 A;  2DEJ A;  3MED B;  1ALH A;  3LAK A;  3LP2 A;  3I4P A;  3D5M A;  4UT4 A;  3SCI E;  3KHL A;  3JXO A;  3H4B A;  1GMV A;  1TMJ A;  4ED0 A;  1RTJ A;  2Z8Q A;  1EET A;  2OSQ A;  4NI2 A;  2YNH A;  3NGT A;  3QAT A;  1S6P A;  4IFV B;  4WFZ A;  2OLW A;  1LW2 A;  3SZ2 A;  1RUS A;  4H4K C;  2GAH C;  2XLK A;  3OXG A;  3VQT A;  2J76 E;  4NWB A;  3R97 A;  2MKI A;  3NGR A;  3BBC A;  1M5P C;  5C2C A;  4YDD B;  1X60 A;  4OZ1 A;  5KT2 A;  2W8D A;  2F3J A;  2ASD A;  1U8W A;  2ZUG A;  1LWE A;  3HI9 A;  4LSN A;  2R7X A;  5AXM A;  3UDL A;  4WFN Q;  5AE2 A;  4YP3 A;  3HD2 A;  2A6M A;  1VBK A;  1QAY A;  2RRN A;  2W9B A;  2V8H A;  1ZZN A;  4EBE A;  3TO8 A;  3O1L A;  3MUM P;  5F0W A;  4O3S A;  3US5 A;  4KRW A;  2WCX A;  2H65 B;  3G6Y A;  4YB1 P;  2P9C A;  3RR8 A;  4B9V A;  2HVE A;  5EGE A;  4KYZ A;  2Z4P A;  4NCA A;  1IKV B;  1FI4 A;  2QEX S;  4IRK A;  4LF6 J;  3BKF A;  1FNX H;  1S6U A;  1N5Q A;  3KJV A;  2DCU B;  4KH1 B;  4BLG A;  4WBF A;  4B3R J;  4KHP F;  2CVE A;  5DQG A;  1T7P A;  2UXB F;  2BAC A;  1CBK A;  3FBB A;  4B3T F;  4XO0 A;  1KS2 A;  1WG1 A;  3JTO A;  5IWA J;  2DXD A;  3BPD A;  2JLG A;  2MY8 A;  2MQO A;  1TK5 A;  3FCW A;  3M2R A;  4H4O B;  1R8B A;  2R7Q A;  3HCX A;  1KC8 T;  2H4W B;  4A8M P;  3CD7 A;  3CJ5 A;  1JLB B;  4G1I A;  4WWS A;  2V4R A;  3EUN A;  2LLZ A;  5D4P A;  1RBL A;  4KKO A;  3OL6 A;  5LL6 d;  1L3U A;  1OMS A;  3IAS 9;  2IM0 A;  1VR6 A;  4C3L A;  4OV6 A;  3N4W A;  4UPI A;  1YQH A;  4Y3C A;  2EC2 A;  4YOE A;  3KK3 A;  3FMW A;  5AT1 B;  1JLC A;  1U2R A;  3QNW B;  1U6B A;  2LFV A;  2DR9 A;  2Y8Y A;  3SDE A;  2XRG A;  1NPP A;  2W4C A;  3FNN A;  3Q83 A;  4LRD A;  1S49 A;  1I5O B;  2DIV A;  1HBM A;  3VZH A;  4J9Q A;  4A8W A;  3TEG A;  2U2F A;  4RW9 B;  4RW9 A;  4X64 J;  3DOK A;  3GSI A;  4ZG7 A;  3P3D A;  3JSR A;  3ZTR A;  1FFS B;  1NCL A;  2WBR A;  3X3U A;  3T19 A;  2AEF A;  5CD4 H;  3AD9 C;  5INH A;  3HFZ B;  5IS2 A;  3GP9 A;  2RIJ A;  1HYS A;  4CTA A;  2Z30 B;  2YX4 A;  4ZN1 A;  1QVG R;  1S1X A;  1PGZ A;  1RAG B;  4X62 F;  1QAX A;  4WU3 A;  3KJV B;  3G71 S;  1HR0 J;  1NK4 A;  4OZ5 A;  5L1J A;  1RA7 A;  2LA6 A;  4NYZ A;  4ILR A;  1J5O A;  2XYP B;  2FHO B;  1UEV A;  5BYQ A;  4ILL A;  4KAY A;  3MMC A;  5KFH A;  1DTT B;  4GC7 A;  2W8K A;  4QU7 A;  3LQV A;  2HEK A;  1MW7 A;  4WZQ A;  3HM9 A;  1H3D A;  2HIY A;  1PJ5 A;  2NXN A;  2W24 A;  3D0I E;  3Q89 A;  4HAC A;  2OEL A;  4C0H A;  4GKK J;  3KK3 B;  2D9O A;  2F8H A;  3W62 A;  2LA4 A;  4Z7Y A;  3KG1 A;  2EKY A;  3TJ9 A;  4ZVP B;  2ZHA A;  4X66 F;  3FSY A;  1RHQ B;  1WKK A;  4RZR A;  3GPA A;  4PPD A;  3PKY A;  1HI0 P;  1LW0 B;  4J9U E;  2HVD A;  2W9A A;  4OI4 A;  3PTW A;  3TUJ C;  3UN5 A;  1WAC A;  1APS A;  3FFI B;  2VA2 A;  2GC8 A;  2PMW A;  2ZVI A;  3HVT A;  4DX6 A;  5KFL A;  2HZA A;  2DO0 A;  3FSX A;  4J5O A;  4CLW A;  3JSM B;  3NNC A;  2VFU A;  1BD6 A;  4IDK B;  2JOQ A;  3Q24 A;  3V6H A;  2GLQ A;  3O3L A;  1S6Q B;  1WHY A;  4LT6 A;  2VAS A;  3V6D A;  1ELZ A;  4JI8 J;  2QX0 A;  2GQC A;  5EWF A;  2W5R A;  3FCV A;  2OEM A;  3BO2 A;  2FVQ A;  3J81 U;  2HBR B;  1VRQ C;  3NKY A;  1PC5 A;  4L74 A;  2OD4 A;  3OVS A;  2Q66 A;  2KFZ A;  4FBU A;  3IMQ J;  4ZMM A;  4U95 A;  2XMU A;  2QA1 A;  1FWP A;  4HDG A;  1C0T B;  1WHV A;  3NAI A;  3H5X A;  2PDA A;  5JVH Q;  2GJF A;  3K0J A;  3QGP A;  1N54 B;  2RD5 C;  2OPS A;  4CYU B;  3TAM B;  1HI1 A;  1TQL A;  1FX4 A;  4ZPB A;  1VBZ A;  1QAI A;  1F60 B;  3PXG a;  3JAM Y;  3M6V A;  4ZVS B;  2VON A;  4ILM A;  3Q8U A;  3AJ1 A;  2MLY A;  4OZ3 A;  2QSW A;  4Z37 A;  3HO1 A;  3QJJ A;  1W26 A;  1GXT A;  1TKT A;  4CYS A;  4DN9 A;  2EFN A;  3J81 Y;  1S4E A;  3K59 A;  2HQD A;  4Q2L A;  1LWF A;  3O6Q A;  2O3D A;  2V4Q A;  2F65 A;  3GON A;  4QIF A;  4A8X A;  4DL2 A;  2R7V A;  1QSY A;  4ZVT B;  1Z2L A;  4ETX A;  1X4E A;  2HFN A;  1ZA2 B;  2K1R A;  3IRX B;  4IH5 A;  4Q43 A;  2CXE A;  2OPP B;  2IYG A;  1WEL A;  1TMM A;  1KN6 A;  3G6V A;  2YKM A;  5SZT A;  4WYW A;  2RQ4 A;  2OJ3 A;  2EFO A;  4I6W A;  1DRZ A;  1QLN A;  3CCM S;  3ET6 A;  3AXM A;  5EX0 A;  1T9Y A;  2J9D E;  4ED8 A;  3LXQ A;  3NWR A;  2VQF J;  4MFB B;  1YTY A;  2HND A;  4FXD A;  5C7P A;  4KFB B;  3TUI C;  3J81 j;  3ILJ A;  2R8K A;  2HLU A;  3UO0 A;  2HVI A;  2XYG B;  3PW5 A;  3RG6 A;  1KOO A;  2BE7 D;  3DRY A;  3R6G B;  1T9V A;  1UKU A;  2XZT B;  4K59 A;  4PZV A;  4DDF A;  7AT1 B;  1T03 B;  1NKE A;  4B9U A;  4URG A;  4KB7 A;  3CCR S;  1NJZ A;  4K2X A;  3E2D A;  2KKH A;  4PAB A;  3WC0 A;  3TA1 A;  4EZ9 A;  3T01 A;  2WSC C;  2Z57 B;  3MPW A;  4NWJ A;  2BXJ A;  2DGU A;  4WF9 Q;  3R1L A;  2W5X A;  2VDH A;  2X3G A;  3FDS A;  3GTY X;  3IA0 A;  4ETZ A;  4ED1 A;  1UW9 A;  2QTW A;  1R8H A;  3FGV A;  3CJK B;  1LFP A;  3T41 A;  3MMA B;  4EI2 A;  1IBM F;  1PIE A;  2FJW A;  1H2U X;  3KMQ A;  2GJ2 A;  3C16 A;  2M3D A;  3D6T B;  1QJH A;  4ZJO A;  2OEJ A;  1S77 D;  2AX0 A;  1S7I A;  1IQZ A;  1HHT P;  3NKP A;  1YRT A;  1QUP A;  3BKT A;  2RML A;  3GYX B;  1LK7 A;  3CDU A;  4GC6 A;  4CLS A;  3CE8 A;  2YNF A;  1ZET A;  4OX9 J;  2OKQ A;  2G0J A;  4G1P A;  3KLH A;  2G9O A;  5HVG A;  4NCG A;  5ETR A;  1ALI A;  2NYI A;  3M32 A;  1HLW A;  3MPY A;  1S79 A;  4WK1 A;  2E29 A;  1VOM A;  3AXK A;  4OFZ A;  3T6J A;  4YME A;  2XM3 A;  3N5B A;  2A0F B;  1SKS A;  3BDG B;  3GIR A;  1IR2 A;  2F1F A;  2LXF A;  5AE3 A;  3T00 A;  2FD2 A;  4DU8 A;  3OJU A;  3DDN A;  1YKW A;  1F9F A;  4TXS A;  5DS7 A;  4C0B A;  3D3B J;  2VF3 A;  3GQC A;  4K4T A;  3PVX A;  3BDE A;  4IG0 A;  2GNK A;  3IM9 A;  3J7A N;  2ZBP A;  2CQG A;  4R8U B;  5I42 B;  2Y8W A;  1VIX A;  1I3O B;  2K3I A;  3OFG A;  3T9Z A;  5MLC V;  2YWW A;  2MGZ A;  2V69 A;  2B3T B;  1F5C A;  4ZVH A;  3QWU A;  3JSM A;  5FLX U;  1JXL A;  2E9Z A;  1HDH A;  2DO4 A;  1PJ7 A;  1ULR A;  4HHJ A;  3FUY A;  1M5H A;  4HR2 A;  2CNN B;  3U02 A;  2IVF B;  3DYC A;  4OYP A;  1YIJ S;  4U9R A;  2NPF A;  2W7P A;  2YQ0 A;  2BZ2 A;  1I6J A;  3HHE A;  2L48 A;  4PXB A;  2J7U A;  3K58 A;  4F26 A;  3WAW A;  2HYI B;  3NNA A;  3H98 A;  3W5Z A;  1X4C A;  1B0T A;  1NLK L;  3DHX A;  5HSP A;  4R5P A;  1T9W A;  1KWM A;  2FZC B;  5CYM A;  1S1W B;  4UQT A;  1N5T A;  5T41 A;  3UDV A;  1XR6 A;  1JLQ B;  4DL5 A;  4OYX A;  3A8I A;  4HKQ A;  2L41 A;  4MYU A;  2AX1 A;  4QPX A;  2A2C A;  3H20 A;  5KT4 A;  2MZR A;  3OW2 R;  2ROG A;  3BGL A;  4KR0 B;  2VH7 A;  1VQ6 S;  3KK2 B;  1LWC A;  5L1L A;  3HKZ D;  3TOQ A;  4ZIW A;  1N5Y B;  2XS5 A;  2DNG A;  2X1A A;  1VQK S;  4NA2 A;  2R7W A;  4IG3 B;  4ED2 A;  3CCW A;  2OI2 A;  1RA6 A;  3ZXW A;  3PKM A;  3DNC A;  1BQM A;  1BQM B;  1N34 J;  1EW9 A;  2F8M A;  2LDI A;  2ZBQ A;  3ICL A;  4NYO A;  3KLG B;  2CQP A;  2B9E A;  2RDI A;  4F4A A;  1U0S A;  2E5G A;  3CDB A;  5F9N A;  4FDF A;  2RF2 A;  3I9Z A;  4OX9 F;  3MUT P;  4OYZ A;  1RLD A;  2H9Z A;  2MPU A;  2WOM A;  2IVY A;  2OTJ S;  1SUQ B;  2FY8 A;  4R0E A;  4LR7 A;  1NK7 A;  1EW8 A;  4J91 A;  4UY8 T;  2MQN A;  2GS8 A;  2HPU A;  1RP5 A;  2UXD F;  4JI5 J;  3RGI A;  5IFM A;  3IS9 A;  2DGO A;  2LKZ A;  3O2I A;  2KB2 A;  4P2S A;  1S1W A;  3ZTQ A;  2BQ3 A;  2EBG A;  3EIC A;  3ISZ A;  3CC2 S;  1NUE A;  3NG8 A;  2HGN A;  1RAH B;  3ENA A;  4RWW A;  5KFQ A;  2B5J A;  2N82 B;  3GIM A;  3RB3 A;  3G2X A;  1OJ4 A;  4B9S A;  2P6T A;  4N47 A;  3NAH A;  1YZ6 A;  1FJE B;  4DU7 A;  5GAD I;  3MEG A;  3VAL A;  3X1L B;  2CQ0 A;  2HRY A;  4KGV B;  5GMD A;  5BR8 J;  5F8N A;  4M5D A;  5L0B A;  1RAB B;  1S9E A;  2D69 A;  4DWI A;  5GMK a;  4R0J A;  4J9O A;  3ZZZ A;  5LSO A;  4I4B A;  4K4S A;  1E2S P;  3QGG A;  3FZB A;  3SQG A;  1GTH A;  3JTN A;  4DPO A;  2MGZ B;  4TY8 A;  2FHK A;  2OD6 A;  3H7H B;  4DR6 F;  4R8U A;  2KXH A;  4MIB A;  4IDK A;  1N2K A;  1HWI A;  4F36 A;  1KKH A;  4ID5 A;  3W2W B;  2G0C A;  1EHW A;  4DQS A;  3LO3 A;  2V8G A;  4IRD A;  2GVD B;  1TR0 A;  2K3K A;  4O3Q A;  2VJV A;  1KVJ A;  2H5J B;  2AEM A;  4K0K F;  3UCG A;  4ZVF A;  3OXL A;  5CQG A;  1HMV B;  1NEE A;  4B3S J;  5K14 A;  4F50 A;  1RGV A;  2M5Y A;  4OZ2 A;  1FFW B;  4ZPT R;  3KMS A;  2GQQ A;  2Z2Z A;  4KC5 A;  2IA6 A;  1H98 A;  1G2E A;  1K1Q A;  4ZOS A;  1RT6 A;  1DTQ A;  1AB8 A;  1MMN A;  4RW8 B;  3DKD A;  4ZVG A;  1KQK A;  5K8M A;  2GGP B;  3FSI A;  2EG2 A;  2R7U A;  1Y10 A;  4F4Z A;  1TP7 A;  3BH6 B;  4PUO A;  5KFP A;  2E5L J;  2HS4 A;  1SUQ A;  2SXL A;  5CZV A;  1M5K C;  4BC9 A;  1ZAV A;  3EPG A;  3SYZ A;  3FC9 A;  2VUG A;  4PXD A;  2BRK A;  2EW9 A;  2VD3 A;  3R2D J;  4AL5 A;  3H5U A;  1WC4 A;  2A18 A;  5ETM A;  4FS2 A;  2ASL A;  2HSE B;  2WVD A;  1VQM S;  4YS2 A;  5IT0 A;  1EB0 A;  1KHV A;  2NUU G;  3IR6 B;  2IRX A;  2B9W A;  2OPR A;  2YTC A;  2CDQ A;  2OMO A;  1HBM B;  4WPA A;  5THW A;  3RYL A;  2F4V J;  3E51 A;  4DR7 J;  3GR1 A;  4OJ1 A;  9RUB A;  4KGX B; 
#chains in the Genus database with same CATH homology
 1EI6 A;  3DYC A;  3WAY A;  4UOP A;  2GA3 A;  4GTY A;  5IJS A;  1ED9 A;  1SHN A;  4CXU A;  2IUC A;  4UPH A;  3UNY A;  2GLQ A;  3WAW A;  4LRA A;  4KM4 A;  1ANI A;  4GTZ A;  2W5R A;  5DLW A;  1ZEB A;  4GTW A;  2XRG A;  1ALH A;  3M8W A;  1AJC A;  3WAX A;  2X98 A;  3NVL A;  4UPK A;  1ZED A;  1ED8 A;  3NKO A;  1O99 A;  3UN2 A;  4CXS A;  3WBH A;  3KD8 A;  3SZY A;  2W8D A;  1E33 P;  2G9Y A;  5GRR A;  3NKN A;  4MY4 A;  1URA A;  1EW9 A;  3DPC A;  4LQY A;  3SZZ A;  2W8S A;  1ELX A;  2GSN A;  5EGH A;  2W5W A;  3BDH A;  1AJB A;  1Y6V A;  1EJJ A;  4FDI A;  4MIV A;  5EGE A;  3B5Q A;  4LR7 A;  3CMR A;  4CYS A;  1AUK A;  1E1Z P;  1EW8 A;  5K4P A;  4KJG A;  5KXA A;  3OT9 A;  3WAV A;  4UPL A;  1HQA A;  1AJD A;  4LRC A;  5L0E A;  4LRB A;  1KH9 A;  4B56 A;  1P49 A;  1ALJ A;  5L0K A;  1URB A;  2ANH A;  2W5S A;  4ZG9 A;  3T02 A;  2D1G A;  5GOV A;  5LIA A;  3LXQ A;  5L0B A;  3IDD A;  4CYR A;  3TX0 A;  1B8J A;  3NKR A;  2W5Q A;  1SHQ A;  3UO0 A;  1E2S P;  3IGY B;  1KH4 A;  3BDG A;  4NWX A;  4N7T A;  1K7H A;  2W5T A;  1EQJ A;  1ELY A;  3M7V A;  4YR1 A;  3E2D A;  4LRE A;  1ANJ A;  4UPI A;  2VQR A;  1N2L A;  3MK1 A;  5C66 A;  1KH7 A;  4UOO A;  5LRN A;  3T01 A;  4NWJ A;  3A52 A;  2W5X A;  4FDJ A;  4ZGA A;  5DLV A;  4LRD A;  4GTX A;  2GSO A;  1ALK A;  4LR8 A;  4KAV A;  4ZG7 A;  2RH6 A;  3M8Z A;  5TJ3 A;  4LRF A;  3UN3 A;  1ZEF A;  5INH A;  3M8Y A;  2W5V A;  3NKP A;  1FSU A;  1E3C P;  3BDF A;  2QZU A;  3Q3Q A;  1ALI A;  5LQQ A;  4ZG6 A;  3NKM A;  3IGZ B;  3BDG B;  1KHN A;  5DLT A;  4KAY A;  1KH5 A;  3ED4 A;  2GSU A;  3T00 A;  1O98 A;  4UOR A;  1HJK A;  1KHJ A;  3NKQ A;  4TN0 A;  3TWZ A;  3TG0 A;  4QAX A;  2ZKT A;  4LR2 A;  1ELZ A;  1KHL A;  1EW2 A;  1N2K A;  5AJ9 A;  5LRM A;  5IJQ A;  4CXK A;  3MK2 A;  2XR9 A;  4MHX A;  1KHK A;  2IUC B;  4LR9 A;  1Y7A A;  1HDH A;  3UN5 A;  3MK0 A;  5HRT A;  4KJD A;  2IFY A;  1AJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...