3UN3A

Phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un3A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un3A01
3DPCA 4B56A 3IGYB 2XR9A 4LR8A 1ED8A 3M8YA 1ELYA 1SHNA 3NKRA 1AJAA 2W5WA 4MIVA 2IUCB 3CMRA 4UORA 4UPLA 4FDIA 4FDJA 5AJ9A 3WAYA 5L0KA 1ZEDA 3NKPA 5INHA 3E2DA 1HJKA 1ELZA 3MK1A 1HDHA 4CYSA 1ALKA 2GLQA 4LRBA 1ED9A 1EI6A 3UN5A 1K7HA 4KAVA 2IFYA 2QZUA 3A52A 5LRMA 1FSUA 1KHKA 3LXQA 4LRDA 4QAXA 3UO0A 1AJCA 5K4PA 1ZEBA 4CXUA 3Q3QA 3IGZB 2XRGA 4LRAA 5L0BA 1HQAA 3M8ZA 1URAA 3BDHA 5EGHA 1E2SP 2W5QA 1ANJA 4NWXA 1ALHA 4LREA 5EGEA 3UNYA 3T01A 1AJDA 5KXAA 3NKQA 4GTXA 1ALIA 1URBA 1O99A 4KAYA 4ZG6A 2W5XA 2W5VA 3BDGA 3NKNA 1N2KA 1KH7A 3NKOA 3TX0A 3UN2A 4KM4A 2W8SA 4MHXA 3SZYA 1KH5A 3B5QA 4GTWA 1KHNA 2G9YA 1ELXA 5LQQA 1EW9A 3UN3A 4UOOA 2W5RA 5DLWA 1B8JA 2GSOA 2D1GA 1E3CP 5HRTA 4ZG7A 4CXKA 2W8DA 3NVLA 4ZGAA 3OT9A 2ANHA 5L0EA 3MK0A 3ED4A 4LR7A 3BDFA 4CYRA 2X98A 1KH9A 1ZEFA 4NWJA 1P49A 4GTYA 3DYCA 4YR1A 4CXSA 5IJSA 3M8WA 5DLVA 1EW2A 5LRNA 1N2LA 4ZG9A 1KH4A 2IUCA 1SHQA 1EJJA 1Y7AA 1AJBA 1E33P 1O98A 3SZZA 3T00A 2W5SA 4KJGA 4LQYA 4KJDA 1KHJA 3WAXA 2VQRA 2ZKTA 3IDDA 2GA3A 4LRFA 4N7TA 1EW8A 4MY4A 5DLTA 1AUKA 2GSNA 3BDGB 4UOPA 4LR9A 4TN0A 3WAWA 3TG0A 5LIAA 4GTZA 3NKMA 1KHLA 4UPKA 4LRCA 5IJQA 5GRRA 1ANIA 1Y6VA 3TWZA 4UPIA 3M7VA 1E1ZP 3MK2A 2GSUA 5TJ3A 1ALJA 1EQJA 4UPHA 2W5TA 3KD8A 5GOVA 3WAVA 5C66A 4LR2A 3T02A 3WBHA 2RH6A
chains in the Genus database with same CATH superfamily
3TUIC 2ASLA 1N6QA 2FJXA 5HMZA 1U2FA 4DS5A 5CHCB 3MM9B 1U1RA 1T9UA 4MH8A 5DZ6A 2FJBB 1OY9A 4WFXA 3DYAA 4KH0B 3THPA 4BDPA 3CCUS 5K4PA 3GIJA 2Y0SD 1C0UB 3MCSA 5MAOA 4P52A 4TXSA 2NXJA 1GMUA 1E2SP 2HIQA 2IVYA 1B0PA 5ETKA 4EZ9A 4NXMF 3MR3A 4K4SA 4DV4J 1KHNA 4GMKA 3DLEB 3OD2A 3VGSA 2AYGA 2RB7A 2R7QA 4NL5A 2WOMB 2XLKA 3UCUP 1LQ9A 2NXEA 2V2QA 1UFKA 1IBKJ 4NA2A 1H2TZ 4KHMA 1IR0A 2YQ0A 3IG1B 2WCXA 3M6UA 4JB8B 5AJ3J 3MR7A 2F63A 3MMBA 1EW8A 1Z1ZA 4KKOA 1KHWA 4CO2A 1U6ZA 2WRMA 3AXKA 4ZVQB 4NLTA 2FVRA 5KG0A 4Q8FA 1C1BA 3OVAA 2IDLA 2WW8A 4JP8A 3K17A 5HQLA 2PO4A 1VQ9S 3KD8A 1MLAA 4JI3F 3FCVA 3HKWA 3W2VA 5CH7B 4CDIA 3FRYA 2HFUA 5CQGA 1XMBA 3HHEA 4QWCA 3QFWA 2F9JA 1RP5A 3OL8A 2GAHC 1TKZB 5HMYA 1BXNA 4CO4A 3OTBA 2DGWA 3I32A 1E6VB 1JLBA 3FK4A 4NCBA 1O5JA 2ZBIA 3DLGA 2UVVA 1TZ0A 4YY3J 2VASA 3MM7A 3L7OA 4UOOA 2HNYA 1YJWS 4A48A 2E1MC 2LA4A 4DS4A 3ED4A 3QMQA 5EGYA 1X4HA 2X98A 2BRKA 3BH7B 1UMJA 4OHZA 3D68A 1X9MA 1KH4A 3V6DB 2YX7A 5M2RA 3NLCA 2QLWA 2UUBJ 1TL5A 1X5OA 1PYTA 4UT4A 3BQ0A 1WC6A 4C2MA 3W65A 2BACA 3PY8A 3OFHA 1SH3A 2ZH6A 3B54A 4YOEA 2FVQA 2QTWA 4AYBD 3T02A 4KR0B 4FYYB 3RRKA 2MLXA 3C66A 1GMWD 2FDNA 2DRAA 2BYCA 3KK1A 3I4HX 2YKMA 3HP6A 5FIIA 1RAIB 3NKPA 1EZZB 2DD8S 2Q3PA 3V81A 1S0MA 2FY8A 1QAXA 4YB7A 1FXDA 3FJ2A 2HWTA 4IDKA 2D69A 2QYGA 2FLNA 2GHPA 3MECB 1S10A 3ZFVA 4P73A 3PYFA 3MM9A 5KFAA 2VPYB 1HBNB 2RQCA 5KFMA 3EXYA 4LR7A 3LP2B 2VG6B 2Q79A 3HF5A 4KPCA 1C0UA 2MKJA 3QT8A 4IRCA 4X2BA 5EWEA 1JLFB 3G4SS 4DR5J 2V69A 2XY6A 4H54A 4ZVTB 2GMHA 4RWWA 1T9VA 3PCOB 4ZVSB 2QSFA 2ZOGA 3EZUA 4ETXA 1O6XA 2K3KA 1YJTA 4FS2A 1HMVB 1N52B 2CQ0A 3IR5B 4V1Ak 2GJIA 3QT6A 1X4GA 4RW9B 4WFYA 4B3OA 8RUCA 2FHJD 4M5HA 2W24A 1K73T 2VH7A 5GADI 4LF5F 4OZ3A 2RQ4A 2C2RA 3KJVA 4K4ZA 3M2UB 1S7IA 2IYIA 4LRBA 1NB2A 1JK9B 3I9V9 2VG5B 1XNQJ 2XNRA 3TZZA 1P8GA 4RU9A 1N34J 3FZBA 3KLGB 3QLHA 1VQ5S 3BQ2A 4NWXA 4IOAQ 1URBA 1DHMA 3EXCX 4HHHA 2G0JA 3FNNA 1UETA 1OYEA 2ZH3A 2RRAA 3EX7B 3DLKA 3M32B 4WU3A 3IWNC 3PW4A 2FVSA 2IMWP 3BKFA 3PJXA 4WIQA 3IAM9 4CH0S 3HHLD 4M5LA 2ROEA 3V4IA 1RYSA 2XG8A 3PYGA 3SZZA 1NZ8A 4DI6A 2QFJA 2QIFA 4GVBA 3FDSA 3H40A 3BYPA 4AXJA 4UOPA 1NHVA 3A1YG 3PACA 1YKWA 2ZHOA 3OXLA 3V2UC 4KAIA 5HN0A 2MZ1A 4DN0A 4RUCA 1FKPA 2RDIA 5IOLA 5HROB 3DLJA 1Y00A 2J7UA 5DQGA 4UOCA 2DEIA 2BOPA 2W9CB 1EKSA 2N7YA 4ZP7A 1YDLA 2GZOA 3TA1A 1VBKA 2QA2A 3N6MA 3NRBA 4A8FA 1M5VC 3H20A 4ER8A 1ZEBA 1G7CB 1L3SA 3SSRA 5FLXU 4D3HA 2RDDA 1APSA 1HI0P 5KXAA 4ZN1A 1NRKA 2DGUA 2VC0A 2XMMA 5FJ4A 5AJ3F 2QG9B 4RNMA 3LWMA 4QIFA 4LVOP 4ED3A 4RW6A 4YQWA 2E9ZA 2DXEA 4KB7A 4DV0J 1LXJA 2VDHA 5AT1B 2V4JA 1HW9A 4TY8B 2JFKA 1QDUB 5DLFA 5DLGA 4CH7A 4IOCQ 3TEHB 5IV3A 3PZPA 1VISA 1RCXB 1VLYA 1UVLA 3MK2A 4P2MA 2ROGA 2PI4A 3ZZ0A 4M5DA 4IH6A 1JLFA 4LBIA 2QLXA 2HRYA 2OI2A 1KSPA 3EWGA 4RU2A 2RD5C 1WF0A 3W8PA 2Z2MA 3MI7X 4TKTA 3SI8A 5SZTA 4ALZA 1N4LA 4OX8A 2KHCA 1URAA 2H4WB 3PEHA 1S1XB 3SCLE 1B99A 4ZG6A 2MSSA 1RT4B 2DHHA 1SC6A 3M2UA 1JLCA 2XZWA 4OZ1A 4ZG7A 2DNOA 4KGZB 2ZFHA 5KG5A 3NVLA 5K14A 3LF0A 3I0SB 3QZ7A 1KLNA 2PFDA 2VPWB 4ENOA 4MK8A 2PMHA 2DCLA 2VB6A 4J9RA 1LW2B 2EFNA 4BC7A 4J9MA 4DLGA 4AFFA 4EI2A 2C3OA 1NJIT 5HP1B 3K5LA 2ZWPA 3RBDA 1UZHA 3OR2A 1NDPA 1TR0A 1JJ2R 4Q2MA 1VQYA 1F2HA 5KFXA 4G1PA 3D1OA 3VZHA 1N48A 2UXBJ 1UVNA 2QRRA 2HVIA 4P7TA 4A8YA 3PW5A 4LIWA 3FQKA 4NLSA 4M95A 5T14A 5F8NA 1U1KA 1BMQB 2HBZB 2CNLB 3MMCA 1FFWB 3GR0A 3GV8B 1QAIA 1H74A 4I7FA 1U2RA 4ANDA 2YBVA 3HX9A 5ETMA 4OV1A 1Q8BA 3DXBA 5ETNA 5J2PA 2CQ3A 3S1TA 4ZPBA 2NS1B 3CJ4A 2OFGX 2QL5B 3U7JA 2AHOB 2RF2B 1AJDA 4MT1A 2AD9A 2QMUB 4C3KA 3I6PA 3DXSX 3H5YA 1LWFA 4O4RA 3QJJA 4M1KA 5GADU 5A8RA 1G2EA 1RCOB 3W63A 2FZGB 2AGOA 3M8PB 2CPYA 2KT3A 4GTYA 3M2VA 3EGNA 5IJSA 4EYHB 4QIVA 1IBCB 2RHQB 1WEXA 1P9YA 1XQIA 1AJBA 1KS2A 1N5QA 3BN4A 4MFBB 4Q8EA 2ZJPQ 3BDGB 3G6VA 1H2VZ 4LRCA 4N56A 2VV5A 3AD7C 2L3MA 2V8GA 1Q7YT 4ILMA 4LSNB 3ZZOA 2UXCF 4FXWA 2R7SA 1FCAA 1XNQF 4H4OB 3K8WA 4LR8A 2VPXB 1PJ6A 2HVDA 1N34F 3BYRA 1IXKA 3KLEA 2CAJA 4HVZA 5IV4A 4CYSA 5ADZA 3H7HB 4KO0B 1K7HA 2ZZNA 5CXTA 1U1MA 3GJQB 4P71A 2R4FA 3P45B 4NLVA 1FJGJ 3GLJA 2W5QA 4DPYA 5A8WA 2E5LJ 2HS0A 9RUBA 3NGRA 4MIWA 2F1FA 4P2SA 3EPIA 4J9VA 2VODA 2R2RA 2UV8A 1CJUA 2RIJA 4KGMA 3M6XA 2VG7B 3G96A 1JQGA 2J8SA 3PIPQ 4DV1J 1IKXB 2N3LA 3G71S 1VC0A 3CJKA 4EGLA 5A2QY 2K2PA 4E0DA 2WAQD 3MCOA 2ZKTA 4CLLA 2CFXA 5BR8J 4ZVEA 1DQ8A 2ZOFA 4DL7A 2BZ2A 1IVZA 2AWZA 5AXNA 1Q8IA 2H3EB 2QE5A 4PR6A 5HP1A 1RKIA 5AXMA 3M6WA 3H5UA 1KOOA 2U1AA 4Y2AA 1R0AB 3R5GA 3AJ1A 1RHQB 3OHAA 4N8OA 3ONQA 2ZEJA 3N01A 4B9MA 2GO8A 3A3PB 4UTGA 1V9OA 2QV6A 1ELOA 3VAMA 2G0CA 2ZM6F 1ANJA 4EK2A 1WORA 3RYLA 4DV0F 1VQ8S 4ED1A 3G82B 1U48A 3NKOA 3KHRA 1B64A 3RAXA 2WB4A 1BE4A 4Y3CA 3ZC4A 4Y00A 3MPYA 4I64A 4O4GB 2IDEA 2AF6A 4ZPWR 4DV7F 3OFFA 4F25A 1EW2A 5J2MA 1QVGR 1WEZA 2CRLA 5B0FA 3CJ0A 1RLDA 5KOXA 2J0QD 4OI0A 2GA3A 2BQRA 2AIRB 3NOGA 3QYYA 3BO3A 1HBOB 1CJVA 4QYRA 4B9TA 4HDGA 3HI9A 2VU5A 3PRVA 4MYTA 3FFIB 1FRMA 1U0SA 4WK3A 4QWDA 4DDFA 1ZYQA 3BGRA 3DOKA 1JLGA 2F8EX 4WFNQ 4J9OA 2OEMA 2ZKUA 3GIIA 3OPKA 2FZCB 5AE3A 1Y10A 1NZAA 4NEZA 2NSCA 1KHVA 1HQEB 4L3KA 4LSNA 4X65J 3PR4A 4PZVA 2ZD1A 5CD4H 1S4FA 3SYZA 3ZTSA 2M8HA 2P8IA 1HARA 4KO0A 2HRTA 3FSYA 3CSKA 3A4TA 1NH7A 1SQFA 3FCWA 3ZTOA 3LGHA 1ZTWA 3NOCA 5KFHA 2KFYA 2DEJA 2EVZA 3W2WB 1LFWA 3MEGB 2AP6A 1S9GA 1WEYA 3GE9A 2V8HA 1KD1T 3V6KA 4DCOB 2OAUA 2HIYA 2B0GA 3M30B 2B9EA 3WC0A 2VG7A 3PKYA 2R7WA 3KMQA 4ZCMA 4W90B 1CBKA 3RAQA 4G3IA 3AJDA 1SH2A 4QWBA 2JVRA 2ZWOA 3CC2S 4X84A 4OJHA 4DR1J 4DFKA 2XY5A 4Y0FA 3CMRA 1HPZB 3MPVA 3OTOF 1UJ5A 1RWPB 2YKPA 1CULB 2IFYA 5K5MA 4DUZJ 4PXDA 4J9QA 2V6AA 2JEFA 2MZSA 1WKKA 3JYTB 3J81Y 2XRGA 3DNCA 1S59A 1NJZA 2IA6A 1SBRA 1BHNA 2HHUA 4PQUA 4URQU 2M4MA 1VBXA 1TKDA 4RR5A 2HS3A 5LXYA 1NPRA 1E3CP 3MR5A 2GVDA 4DUTA 2VIHA 2PT0A 1I51B 3TAQA 1FF2A 2QSWA 2U2FA 3L3CA 2V8VA 1NCLA 4JUZA 3G82A 4B9LA 2G9OA 4N41A 4TQSA 1WG4A 2JC0A 2BJ9A 4M8LA 1TFYA 2MQ8A 5G0RA 5HVFA 2R8IA 1FE4A 1R0CB 2N4DA 4ELVA 1FJGF 2HS4A 1S0NA 2HZVA 2ZDPA 5DG9A 1UFLA 4YFUA 3IGVA 3EM1A 1F60B 1FT8A 3LO3A 2HG4A 1FSUA 4ID5A 5LMNJ 2ZHAA 4AUKA 3QNWB 1R0BG 1ZM2A 2IVFB 3MM5B 4QPXA 1W2IA 4PWUA 3DRPB 3PVXA 3CUNA 1NPKA 3UI3A 5BR8F 1MU2A 4JV1A 3JAMY 1I94F 4J9SA 4LFCJ 4V19X 1CSJA 2XB2D 1NK5A 3PNIA 4K4UA 4ES1A 2K7JA 4PPDA 5HMWA 4LFAF 2KVQE 2DH7A 2H65B 2R8HA 1VIOA 3IGNA 1ANIA 2R8GA 1Y6VA 1KBRA 4IG3A 2ZUGA 4N77A 2M0GB 5KFWA 3H5XA 1TL1B 1Y3KA 3AA8A 1FD2A 4WU2A 3KJNB 1OY6A 9ATCB 3Q0AA 1OJ4A 3GIMA 1XNRJ 4AXIA 4FKXA 1RI7A 4CXUA 2D41A 2E7XA 3IWXA 1TL3A 1RWKB 2MQPA 1ZTTA 2XULA 1T03A 4MHXA 2DNZA 8ATCB 3NNCA 1CG2A 2LDIA 2K1RA 1RHJB 1ZEFA 1ZM9A 4R5PA 2AEFA 1RTHB 2B7CB 3JSBA 3UDEA 2R2SA 3ZZUA 1EQ0A 4ZPVR 4DPWA 3KFWX 5HBMB 1Y7AA 1N8RT 1RUSA 3RRHA 3K7RA 3AD9C 1YHQS 3M4XA 1UPPA 4CNZA 2QO3A 2A6MA 2FHMA 1S77D 4KT0C 1HNXJ 3TVZA 1SL1A 1NKCA 1C2PA 1BQXA 3EZOA 1BD6A 4WFZA 7FDRA 2HQ3A 1NB7A 2FZKB 2L9WA 1ALKA 5IM0A 2AV5A 3SCJE 4AQYJ 2IJRA 3G2XA 3W66A 2DR8A 1U1QA 4WK1A 3QT5A 2C28A 2CQIA 2DBBA 3GYXB 3NKQA 5D15A 1KFSA 2HHXA 1XN9A 2I5JB 4Z7CA 4EBCA 1YBAA 4LF8F 3W8GA 2YTCA 2CVIA 4CTAB 1LWCA 3MURP 4WPAA 3J81j 2NXUA 1VQ6S 3C6TA 5HL7Q 4I69A 5EUHA 3MM5A 2A2CA 2DVIA 1Q16B 4DUYF 3OFGA 4DQRA 1SKUB 1VRQC 1W26A 3T00A 3D0HE 1RWUA 3Q83A 4DR6J 1Z2LA 2CJAA 1RGVA 1MNEA 1TL7A 1JLEB 1F3FA 5MLCV 4UPIA 3T6BA 3OQ2A 1E1ZP 4DL4A 4JI0J 2BKNA 2F4FA 1RT1A 2PN6A 1JIHA 1F9HA 1YJRA 4F2RA 4ECTA 4OYXA 2IRXA 4PG6A 5KFPA 2HBRB 5M2UA 4MAKA 3V6JA 1CLFA 1YRTA 1CJTA 4UZBA 2W2QP 5DG8A 1S49A 5HATA 1G4CA 3MPWA 1YJUA 2UXDJ 5F8LA 2C2KB 1RAAB 4ZMMA 3C15A 1GFWB 3PDNA 1RHKB 3NGDA 1KRPA 8AT1B 4Z37A 3FBEA 3B78A 4CXKA 5B0DA 2LEAA 1WDDA 3MK0A 1OO0B 2ZVSA 3VWSA 3RBXA 3MR6A 4RUAA 2KH9A 4CM2A 2JC1A 4I6YA 4DZDA 2E5GA 1LK5A 5K8PA 1HNWJ 3C3LA 2YWHA 1JLAA 1RT2B 1Q78A 3P6YC 3PR5B 4F4WA 1Q53A 2F3JA 3O8WA 1FWLA 4ZP6A 5LMNF 1RTHA 2V5HG 1RAOA 3W64A 2R7UA 2IBOA 3UR3C 2E66A 4UORA 4XAKA 1CS4A 4AT1B 3K59A 2UP1A 3BF4A 5DG7A 1DTTA 3GFZA 1XERA 1IKWB 1E6YB 4CLWA 4F2SA 1HWUA 1NXIA 4R8UA 4IFYB 2F8HA 2C1EB 4LFCF 1PCAA 4RNHA 1HR0J 1O99A 3TOQA 4NRTA 1WKLA 2HVEA 2IC3A 2J7WA 2D1GA 4DJBA 3P8BB 1SH0A 2WVDA 1B7FA 2YKAA 1I3OB 3PFEA 5D77A 4YR2A 4C0OC 1SKRA 4NASA 1PYOB 4Y2MA 5A0YA 1NPPA 1DURA 2BUNA 1PGZA 4ZDNA 1X0FA 2OTJS 4PEOA 5KG1A 3OL7A 2EKYA 1GNKA 4LQ9A 4KHRA 4GTZA 4C6AA 1KHLA 5A2QU 4NA3A 5H9FK 5J1PA 1ALJA 2KG0A 1U47A 2FY1A 3KK3B 4X62J 2DO0A 2MPUA 1HYSB 2XZDB 1ELYA 3NCPA 3DC2A 4YUDA 1M5PC 3GJSB 5INHA 5J1NA 1WOSA 2CDQA 5HAOA 2RDJA 4X4PA 3J7Z5 3D0IE 1YJVA 2CJBA 5F8IA 2X3GA 2MZJA 1REVA 2HFZA 2MHEA 5DDOC 1YRXA 3KJQB 1GX6A 3ITHA 2QN6B 5KFIA 2A6OA 1QE1B 3UVJB 2ZBQA 5JMNA 1YK9A 3OV7A 1U24A 2YNHA 3BPDA 2P9EA 1IKYB 3OBIA 1IUJA 3RBZA 4LQ3A 3BGFA 1F9FA 1RYRA 3P5TL 1ZM4A 5B0BA 1YJNS 1Y5IB 3KHGA 3IDDA 4MY4A 1X0PA 1J27A 2XY7A 3EYZA 4B3RJ 1UAWA 2DCUB 3DN9A 3HMJG 3LQVA 3M1VB 2GSUA 1KNZA 5GOVA 1TK8A 4DF4A 3A8JA 4B56A 2XR9A 2DH9A 5D0HA 2BXJA 2OO4A 4A46A 4RNOA 1UVMA 4IG0A 2FHOB 4XIUA 3DHWC 2HNDB 4B3MJ 2DHXA 2QMWA 1T8EA 3MOJB 4K4YA 3QSYB 1N0VC 1ROFA 3D2WA 5HSPA 4O3RA 1YBUA 1VBZA 1NSKL 4OQJA 2IM3A 1FKAF 1WJ9A 3DMJB 2O3DA 4JYAJ 4JI4J 4DR6F 5CZXA 4KH1B 5JJBA 1U2CA 2JLGA 2DGXA 3BBFA 4OV6A 1X4DA 3C16A 2GW8A 2W5SA 4AL7A 2POKA 4JI7F 4U8VA 3HVTB 4PRFA 2PMWA 2AZ3A 2HK2A 2HGNA 4F36A 6FD1A 5C42A 4UZCA 2KZMA 1VHIA 3D7SB 3MMAA 2GMLA 2XMVA 1KQGB 3HLUA 2LCWA 4CO1A 1R8CA 2UXDF 2XWXA 4E98A 3PKMA 5KT2A 1N5YA 2VFTA 2AYBA 1RT3B 4NI2B 5DRKA 3M2RA 1RTDB 4PWDA 4YEAA 1VIXA 1IR1A 4DX8H 2PFFB 1EP4B 4U6PA 3UNYA 4GTXA 1S1WA 3DM2A 3M9OB 1ITPA 3TX0A 1G1XA 2EFVA 2QC3A 3CJ2A 3J81U 3UN3A 1HNZF 3T1YJ 3R5BA 4QBUA 3IWLA 3R5AA 5KT7A 1LKZA 4Y34A 3CEDA 1NDCA 3R2CJ 2YNIA 1C0TB 4ZP9A 3GFXA 4YR3A 2BA9A 5BYRA 1SQEA 4LMZA 3GIKA 2UZAA 1XBWA 5HANA 3D28A 2V68A 4J9NA 4YB6A 3UVJA 4TNOA 3FSXA 4DSIA 4NLRA 3NGUA 2OEKA 4ZA1A 5KFZA 2GVZB 5ETQA 4NMXA 3LP1A 3LA0A 3KLIA 2CNOB 5AE1A 3TZYA 1L3VA 3HHLB 2BJ3A 5L0KA 2MDAA 2Z2LA 1XR7A 2XYHB 4CYUA 2J0XA 3A52A 2CPFA 4FNIA 5HLFA 4ELTA 3K8VA 2EFPA 3A13A 2MSTA 4OI2A 1YG0A 2NXNA 2EBGA 4QIEA 3UPFA 4F02A 3D4JA 3BSOA 3RW6A 3SQGA 1WC3A 1QAYA 1YI2S 3UE2A 2R9LA 2QMXA 2GQQA 3DHXA 1WHVA 4JI2J 3MXHP 3RUBL 3JSMB 3NGKA 3TA0A 3HHNB 3RBEA 1P1TA 2RMLA 1T9YA 1N2LA 4FDFA 4EO6A 2P9GA 4RUBA 2MGZB 3VQTA 4A8OA 1OSCA 1RHRB 4B9SA 3WAXA 3MDFA 3JAMU 2ZNZA 2WK4A 3W7BA 2Z4PA 1SXLA 1HHSA 4F7VA 1A0OB 4B3SF 1FDDA 3CD5A 4FYXB 3CMAS 3D54A 2ADCA 2OKQA 2LEBA 2FC8A 1HI1A 1OIAA 2DGOA 2H48B 1SV5A 4NCGA 2H5IB 4HKQA 3N28A 4X64J 2C2ZB 2P5VA 4ZITA 2APOA 3BSNA 2BV3A 3MF5A 1IKVB 2ZBCA 4IQXA 1PG5B 3Q8VA 5B09A 2KB2A 1M5KC 4N8NA 3P4UB 4WP3A 2EWHA 4F67A 2V4RA 4PG4A 4I1TA 3TZXA 3FQLA 2F4VJ 5L1JA 3DOLB 4PPZA 2HK3A 3FEXB 1UFWA 5F9LA 1KEKA 4JI5J 1ZS6A 4OHYA 2RRNA 3MM8A 2DNPA 2IAJB 1TKXB 5DLVA 3KLFB 2CJ9A 4J9LA 1MROA 2YH0A 1R6YA 4DV3J 4QPTA 3JXOA 1FERA 4NYZA 3KLHA 2NUUG 4B3MF 4DV2F 4PXEA 2OPRA 4FF3A 2RUGA 3UNGC 5IC4B 3M8QA 4FYDA 3ETOA 5DZ7A 1C4AA 4ED6A 5EN1A 3NP5A 2HFNA 4NOHA 2LECA 5KT3A 3RJMB 2OLWA 2B6AB 4G6VB 4UUWA 3TP2A 3CD6S 3QSIA 1DLOA 3RZAA 2MEWA 4ED7A 3KNAA 2MQOA 1RT5B 2HZAA 2VONA 2GFFA 2GVZA 3ILLA 2GGPA 3JQMA 2LA6A 4FPRA 2BW7A 3DGVA 2BANA 4KM4A 2WVCA 1RDRA 1ELXA 3L7PA 5CYQB 3TVKA 4PWWA 3OR1B 4RZRA 4I0WA 5CYMB 5CZVA 2G2YA 4FPIA 2YKNB 2DGVA 3DRSB 3F44A 2KFZA 2CZVC 1Z4UA 2WW4A 5D0GA 4F26A 3HD1A 2VUGA 1X4BA 3Q8QB 1X9SA 2CUYA 5B0AA 4P72A 4M5GA 5FDLB 2J9EA 3KDNA 1TUWA 2DNHA 2VBXA 3DRXA 1N0UA 3PO4A 1WOOA 1JKHA 3LGMA 2L9NA 3GPAA 1R3NA 4X4NA 2KZZA 2LQ9A 3I82A 1HKAA 4C98A 2WSEC 5M2PA 5D3GA 1RABB 2ZBPA 4C3LA 4FZVA 3HPOA 1HA1A 2ZZTA 5LMUF 4PQAA 5K9FA 3IRWP 1Q8LA 1GH8A 1GAOA 3DGPB 1TAQA 2HGLA 5DJBA 3LP0A 1RBOB 4DFPA 3DRYA 1Q5VA 3HHKA 1TTHB 5E3CA 1ZPWX 2HLUA 4X4TA 3BGLA 1M5SA 1IKVA 2CQ4A 3GILA 1X7VA 4WP9A 1HHQA 2ALZA 5I3PA 2ACYA 1VQOS 1JJ4A 3HJVA 2IHR1 1U09A 4CYRA 4RW4B 4GO5X 4TY9A 7AT1B 2XI3A 1R8HA 5HO4A 4DSFA 2GQ2A 1AT1B 4KJGA 4OYWA 4DU8A 1S6PA 1F3VA 2W2OP 5IS2A 1FDNA 4ZVGA 3SSQA 2EPIA 2BKPA 1LEOA 2CJXB 3H4DA 1EQJA 4LR2A 3OL9A 4DV6F 4A8QA 3GR1A 5GAGI 1QUVA 4L72B 4I2QA 4USUA 1D3WA 3DDIA 3AOAA 1FRXA 2AU0A 3FEZA 3LOUA 1JLQB 4DF8A 1M1HA 3MCMA 1X4FA 5L1LA 3UO0A 1L3UA 3KUHA 4QR1A 4JI2F 1AB8A 2L41A 3B4DA 2IBKA 5E3RA 4X4UA 1PIEA 1SIWB 3NEKA 3ZZPA 1RTIA 1T3OA 3CD7A 1QVFR 1UW4A 3A3OB 2HVHA 3BKTA 1RAGB 4H4MA 5J2NA 2RU9A 3Q8UA 5J1EB 5A8KB 4K0KF 2KRBA 2DNMA 4L76A 4J9UE 1YVFA 4B9UA 3CVKA 5U47A 2KG1A 2PD1A 3ENAA 2MYFA 3RB3A 1S9EA 2AQ4A 4I68A 5KAKA 3MCNA 5DDQC 1CPZA 5CYQA 3OR1A 2YWFA 1C1CA 4MTPA 4LF2A 3ULHA 5TJ3A 3BR8A 1N5VA 1VRTA 2AKWB 1SQGA 2UUAJ 1WOPA 4YB5A 3HFVA 2G0IA 4F3QA 4B3TF 1HQUA 1YTYA 1GMVA 3VAGA 3NWGA 2A3JA 3I0RA 1N32F 4MKBA 1D09B 2LDYA 3R7NB 2X1GA 4ZLPA 2KJWA 2LXIA 1DRZA 3DOMB 5THWA 1X4EA 4IO9Q 2EK6A 1N36F 1FRIA 1FTRA 1UP1A 1N6QB 1ZETA 2CNKB 1H98A 3MM6A 4GKJJ 2YPYA 3DYAB 2HWIA 2V8DA 1VHFA 1XC9A 1HNIA 2BQ3A 3TQ1A 2AZ1A 4BWJA 3HSDA 3R3TA 3K5OA 4OJ3A 2ZC3A 5JUMA 1F5CA 5L1KA 3E3XA 4C7QA 2Y1LB 3QIDA 2FJAB 1Y0HA 5C2CA 2H51B 2EXUA 2XLJA 2FQQB 3QO9A 1N33J 2VJUA 1WTFA 2DHGA 3F56A 2ZJQQ 2HRUA 2BMBA 1Y5LB 1VBYA 4HHJA 3M05A 1JJHA 3MMBB 4KKOB 2OJ3A 4M5NA 3UDLA 4K7QA 2YPZA 3CCWA 1FJEB 1S1TA 1C1BB 2CA9A 3HXMA 3CJQA 4L73A 4WE1A 2CPDA 2X1BA 1TFWA 4IH7A 1Q4RA 4UOGA 4DPOA 3W2VB 4JBCA 5F3ZA 2FLPA 2HNZA 5GAEI 3Q86A 1MG7A 1MMLA 4DL3A 1V3SA 4CXSA 3M8WA 3CCTA 4DR4F 1FFGB 1SJ4P 1P6TA 1WSVA 4FVCA 1JLBB 1B70B 3ILIA 2HHPA 4QW8A 2ZE2A 3DLGB 4OMFG 2EI5A 4OZLA 1XIQA 5DLTA 2ZH5A 3MM7B 1OWXA 1XK8A 5J1EA 5A8KA 5DS7A 4DX6A 5CABA 2BE9B 2B8QA 3MAQA 3BR9A 1KWMA 2CWXA 4NLGA 2M9KA 2MQLA 3IRXA 3CDWA 1QD1A 1JMTA 2VL1A 3DRRA 3TJAA 1RWMB 4HACB 3ET6B 4DN9A 4ZCLA 3IBFB 4O3NA 1JX4A 3FBFA 5LL6d 1NHKL 1FO1A 1XJWB 4LVNP 2H5JB 3TJ9A 2YNFB 3CC7S 2WVFA 3SQOP 4CLYA 3B6BA 2RE1A 4CT9A 2C2NA 5I4MA 3Q89A 4CO3A 1SL0A 1VK3A 3AAWB 3NY0A 4Q44A 3KK1B 1T3NA 1NLKL 2YKMB 3PW7A 1FVQA 4ZIWA 5GAGU 2X3DA 3V81B 4WTYA 1WC1A 2DTJA 3JSYA 2CZ9A 3KWMA 2EW9A 2MJUA 2V94A 5LJ5Y 4IDKB 1CQMA 1RWXB 4JI8F 4CLKA 1RT7B 1U0HA 4PXBA 4LF6F 3TUPA 5KFOA 3MD1A 1EETA 2LQ8A 3PX0A 1SJFA 4XTTA 2HQCA 3IP0A 2GHVC 1SKWA 3OFEA 3RW7A 1O0PA 2G2OA 1NK9A 2VBWA 1AFJA 5L9NA 5KFJA 5E5NA 4NZ7A 4U7UK 5AXLA 3QBCA 5IZHA 3W62A 5K8OA 4LF9J 1DY3A 3KTQA 1S0OA 5EGHA 4B3OB 3PJWA 1R8AA 1WF1A 4JV2A 4WFBQ 4ICLA 4ZPTR 1HBUA 3VAFA 4Z2XA 2MLYA 1VI7A 4M5IA 2W8SA 3EJMA 3UD4P 1SC3B 3GG0A 3TW0A 3QGPA 2MZTA 5D4NA 3KJVB 4HHUA 4AL6A 1Y9OA 2OPPA 1Y3JA 3FKBA 4K4XA 5E3AA 1T9XA 1REGX 4ZG9A 2QGFB 4QOTA 3R5DA 3QLHB 2XLIA 4DG1A 2JOQA 3TO8A 1SL2A 4L75A 3PJ9A 2DPIA 1LFPA 5I3UB 3IBWA 5K8NA 1MWQA 2AYMA 2JLEA 3DLKB 3GG1A 4DSJA 2D3OR 1FXRA 3W1YC 3V4IB 3DCAA 2IVMA 4RW7A 1FFSB 4GVBB 2BW2A 1IBMF 4LF7J 3K2YA 4PXCA 4QIGA 1TKTA 2HGMA 1WHXA 2RJZA 1HBMA 4IUFA 3MEDA 1FKPB 2J6SA 3HDSA 3DU6A 4D3GA 4HACA 3ET6A 5F0UA 2HFVA 2HHTA 4RNNA 2Z56B 1SJRA 2YNFA 4F4XA 1XMQF 4OX7A 2W7OA 4DXLA 4JI1F 2IY5B 4YHHF 1N33F 3LPYA 4PCQA 2J8AA 4KV8A 3GSDA 1NJYA 4QIWD 3I4PA 3HHDA 4KGKA 3N6LA 1UCNA 2G1HA 4RPFA 4FKYA 4ZCIA 1EX8A 1XWLA 2FC9A 4JOUA 1RZMA 1PYSB 2GQCA 2BM1A 4RW6B 1OPZA 3R5CA 3MGJA 1RADB 2V2VA 5GAEU 2GX8A 4KFBA 1RT7A 5ETSA 3UR0A 4KRWA 4FDJA 4WXWA 2K8GA 2V4JB 1BC6A 1FWKA 1VRUA 2COLA 2HQFA 2KTQA 3HFKA 1TUGB 3R5JB 4MK7A 2D3ZA 1M0SA 4Q0BA 4KC5A 1PSDA 1VMBA 3KK2A 4M5DB 2KXFA 3BKUA 4RO0A 2OGUA 2RHSB 1VR6A 1UVIA 3NKNA 5DO2A 2V2ZA 3B5QA 1CQNA 3VGVA 3KUEA 1RXOB 2DGQA 2XTJP 4EYIB 4USHA 3VVTA 1NK6A 5KG4A 3J7ZT 3TARA 2YWGA 1TQLA 2MLZA 5B08A 4DLEA 2E9RX 3KHHA 4LF1A 3CJ8A 4LFBJ 3ILJA 4FNHA 4WIIA 5H9EK 3NKMA 2JEIA 1JLCB 3HSGA 5K14B 3CDUA 2W5TA 2K06A 4CLZA 2AX1A 3GZ7A 3GYNA 4FP9A 1RHUB 2JDJA 2ZNYA 2H54B 1TMJA 4KJIA 1X5PA 4HYKA 1RT6A 2IRUA 3LW5C 3WHIA 5F9NA 4NXNF 3UD5A 2ZH1A 3H2LA 3OR2B 5I3UA 4KAVA 3N5BA 4O23A 3CTRA 2XSJB 4LRDA 1AJCA 2RT3A 5LJ3Y 4UQGA 3HT0A 1R8BA 3C6UA 2DK2A 2FJVA 2WSFC 3R1LA 1U25A 3CCSS 3HD2A 3UQSA 3MMCB 5LQQA 2VBZA 5HRTA 1ZM3A 5K20B 2IYGA 4I7FB 3OT9A 2PGCA 4DR3J 1J5EJ 4FXDA 2XNQA 5J2PB 3OUYA 2DPJA 3CCVS 5KFYA 4HR2A 1RU1A 2HBYB 3ISNC 1DQAA 2DHSA 4O0NA 4CT8A 3SEOA 1LWFB 4Y6IA 3HO1A 4B9NA 3ZZZA 4DV4F 3UW1A 1RE1B 3F0NA 4DV5J 5A8RB 4P2XA 1K1SA 4DX5A 5KFSA 2ROPA 1FDBA 4LF9F 3DLHA 3SSSA 3M2VB 5CA5A 3H2UB 3M8YA 5DM7Q 4F8RA 2VHGA 2OUGA 3ENQA 1IBKF 4OYZA 3H2VE 3WQPA 2VQFJ 1HD1A 1SUQA 2C2EA 4ZPDA 4ILLA 5LOQA 2AW0A 3BZQA 2VOOA 5L0BA 1WG1A 2CPHA 3VTIA 1X4CA 1YQHA 1P1LA 3JQKA 3R7BB 4IKAA 4J37A 4GTWA 3W60A 3UCZP 1FI4A 4TVAB 3KLEB 3TNVA 2OFHX 3T9NA 2JZ5A 1MWYA 2CJYB 3LUYA 2DH8A 4QYZK 1YJ9S 3VALA 4M5MA 1BWEA 3FC9A 2H9ZA 1NSQA 4OI6A 5J2QA 3KMSA 3CO9A 4JV5J 3F73A 5A8WB 3GV5B 3NS5A 4N7TA 4QWAA 3VZIA 2BM0A 2DT9A 1K0VA 4YY3F 4OZJA 4F3MA 2DIUA 1CJUB 3S8SA 4OX6A 2B9WA 3SCKE 3VAJA 4YP3A 4ZVFA 4LF7F 1X8DA 5D4OA 4KPYA 3BM7A 3AJ2A 3CJKB 4URGA 1RAJA 5BJRA 3MAAA 2Y1RI 1AROP 2VQEJ 4KE5A 3WX8A 2Y1JA 2UUBF 4XDDA 4HL9A 1RU2A 3W9IA 3SXLA 2R42A 3IXQA 1LW0A 3EVWA 3CIZA 2Q43A 4IQMA 1NSAA 4DQIA 2P6TA 2DHAA 2FGOA 2P9CA 1WDTA 4WWSA 3ZZYA 1KN6A 2FVCA 2J6UA 5HI7A 3MEKA 4DZ6A 2XSJA 1S99A 1UEVA 4DHVA 4NE9C 4OL8A 3DYCA 3D6TB 4YMEA 3J7YI 1UWBA 5ETRA 2EFQA 4ES3A 3BB5A 3PYDA 4NEYA 4USJC 5GAHI 1XR5A 4ZOSA 3D3CJ 3VV2B 4DFJA 4ETZA 3AFGA 4O44B 4IYQA 5J2MB 1QUPA 4U9RA 4OI4A 4Y2IA 1RWVB 4ECVA 4DR5F 2GLQA 5AE2A 5C25A 2B8PA 2YWKA 3ELHA 4J5OA 2XS7A 3J80Y 2O01C 1CJVB 3MPDA 1TVRB 3IO1A 4R25A 3PIOQ 2VFRA 1M1KT 3KUGA 2MZQA 3NNAA 2V9KA 3HSZA 3NNHA 4B02A 1HD0A 2KYZA 3BGRB 3DOKB 4WF9Q 2WVBA 1JLGB 1PC5A 3A3NB 1VQPS 1T0TV 2W01A 2QX0A 2IUCA 2XO6A 1UEKA 2V4QA 1R27B 4ZHRA 2ZD1B 3U1NA 1JJCB 2VKRA 3RAMA 5H9FJ 2GO9A 3S6EA 1PO6A 3T5HA 2RNEA 1S6QA 2KFNA 4O3SA 4NXMJ 4Y2CA 2JRSA 1N56A 2JEGA 4URSA 1U1NA 1RWWB 1S97A 5KT6A 1S9GB 3EDRB 3MK1A 2R7OA 4I4BA 3H25A 3L7UA 4C3MA 1HHTP 4ERDA 4OX9J 2VDIA 4HTIA 2XO7A 2LMIA 1D9DA 3Q3QA 1KQSR 3QWPA 3KG1A 1NO8A 2LKZA 4GC7A 5L39A 3MTKA 4YDDB 4ED8A 3OTDA 3MD3A 3W9HA 1ZAVA 3UFCX 2LQ5A 3LH2S 4ZLNA 1SCJB 4HTJA 1EW9A 2RVJA 3SCIE 4RUHA 4JI3J 4W4MA 1WHYA 2HBQB 3V5RA 5E7OB 4XDCA 3KOAA 4P9SA 3NMAA 1R43A 5E33A 2J7KA 3M8RA 4PQUB 1FXLA 5DGAA 4OZNA 3NS6A 3OSPA 1BQMA 2GJ2A 4HH0A 3D9BA 2VQFF 1IJEB 2GVDB 2ALYB 2ZH7A 5JVGQ 2YNGA 4N5SA 3CF5Q 4BC9A 3C14A 2IMOA 4WBFA 5AJ9A 4ZPCA 4IFVA 5C24A 4NLXA 2MKSA 1FNMA 1I5OB 1FK9A 2RQKA 4O44A 2AJ4A 1UWAA 5G0RB 2ABYA 3EMTA 2DR7A 4LREA 2XSFA 4BCAA 4USVA 2YWEA 2CQ2A 3GV7B 4FS1A 1MMDA 2SXLA 1GK8A 1FKOA 2BABA 1YIJS 3CJ3A 5C7PA 4ID5B 5IC6B 2XMAA 1TVRA 4A8WA 2PMZD 1N54B 1Y5NB 1QTNB 5A6WA 4ECWA 4F50A 3PW2A 1XMOJ 2KO1A 1VC5A 2PEBA 2XEXA 4NWBA 1MU2B 3QAUA 4DU7A 3DPCA 3KYLA 2EC0A 4TU8A 2LP4A 5KOWA 3BPSP 1AJAA 5F0WA 3DI6A 4PYAA 1ZA1B 4A47A 3J7YU 2XYPB 1B4SA 1PAUB 2RUSA 4WZQA 3AT1B 4ECUA 3IS9A 5GAHU 4DL2A 5KFUA 5T7LA 4IG3B 2UXBF 3QRRA 5KG3A 3D6FB 2IM0A 3P96A 3WBZA 2AJ2A 1SC1B 2CQHA 4CCHA 4RL1A 2MQNA 2DITA 2ZZMA 4LF5J 2B4PA 3D0GE 2V9WA 4G1QA 5HMXA 3PRDA 1O98A 4NMLA 1TL3B 1HL6A 3D6MB 1RISA 1T03B 1FRLA 1YLXA 1X5SA 3FSIA 2PSZA 3R97A 2DR5A 2K1RB 2DGSA 3JQJA 1HI8A 4R5PB 3BSCA 3SIPB 4NLQA 2VFUA 2HPUA 2KU7A 2R7VA 3R6LB 3QGIA 5RUBA 4KY3A 3UDVA 3BS9A 2RKIA 3TR5A 1KHKA 1MN9A 1FNXH 3H4BA 3BGOP 2ILZA 2Y1IA 1U45A 4NRUA 2QA4S 2BQUA 4LSLA 2KI2A 2UV8G 3OVBA 3M8SA 1NNDA 1UZDA 3GONA 3SZYA 4TU7A 3N9UC 2B9YA 2WBMA 1SKSA 1OPIA 5IQQA 4OLOA 4WKRA 1S4EA 5IM0B 1FHTA 2OTLS 2QA4G 3R2DJ 1KP6A 4U96A 5KFCA 1DFDA 1SI9A 4LSZB 3BDEA 2J0SD 4LRFA 4DEZA 1HNVA 3JB9k 2R7RA 1XTZA 3Q2SC 2E5LF 2GIRA 1SVDA 3TG0A 5IJQA 3KG4A 4OX9F 3VAIA 1KFDA 1LWCB 4F4ZA 1S72S 1FDAA 1DARA 2HQIA 3C6TB 3RR8A 2OSQA 1JXVA 1RA6A 4DV1F 1DAXA 2RSQA 2HZCA 3TI0A 1ED9A 5B0CA 4N76A 3LANA 1T9TA 4J90A 3T5LA 1TL7B 4ED5A 2HQDA 3I5AA 3R7SB 1RT1B 2PEHA 3HKZD 3T3FA 2CPXA 2VPZB 1O8BA 1BLUA 2PA8D 1JNRB 3SDEA 1Q82T 4J91A 1DTQA 2BJ1A 4ZCKA 1CJTB 3HZGA 2W9BA 4V19J 4MK9A 6FDRA 3C15B 5LIAA 2IRYA 2E44A 4WYLA 2Q66A 3MWBA 3POTA 1Y11A 2B4OA 1S1VA 2QJ3A 2Q6CA 2E29A 4B9VA 4USMA 1ED8A 1WNEA 3OSNA 4GVLA 2HMIB 3NKRA 1I1GA 1LV5A 2KN4A 3OJSA 1JLAB 2N3OA 4ZVPB 1EI6A 1RWNB 1F6TA 4WXOA 4UQTA 3PW0A 5E3QA 4G1IA 1AZSA 1VDHA 2N7CA 3S01A 2R2UA 1CEZA 1CS4B 4LJMA 5DDRC 1Z2ZA 2E9TA 3MOZA 5D6GA 3C19A 2KT2A 1XMOF 1DTTB 2NXCA 1KH9A 5K8MA 2H5EA 3AB2B 1D9AA 3TAMB 2XZTB 1LOUA 5IT4A 3LWLA 4JI6J 3FMWA 4R8UB 4HI1A 1RWOB 4X65F 1RAEB 2KKHA 4KBIA 3G87A 1UJ4A 2UUCJ 4F0HA 3CD0A 3RB6A 1OS5A 2IC3B 4Q5VA 3M7VA 3OLAA 2OPSB 3B82A 3HVRA 1OQ3A 3CCMS 3ZTQA 5A0YB 3I31A 4A4JA 1W25A 3DLEA 1WHWA 3GCXP 3EGWB 3GFHA 1VQKS 1F5BA 3FBCA 1PBAA 2WOMA 4KTQA 1ZA2B 4UOHA 2YVSA 2V67A 2E1PA 2C42A 2MTLA 3HZEA 3IG1A 2CYYA 4YS2A 3T01A 1Q5YA 1T7PA 3I5CA 3MPUB 4NLYA 5LM7E 4F4KA 4DR1F 3BQ1A 2NCKL 2UXCJ 2J9CA 3VVUA 2GSOA 5CAAA 2IM1A 4OI1A 5KFLA 1BQNB 2DB1A 1HFEL 2EBEA 4N47A 1EQMA 4DUZF 2E1CA 1REVB 2Z57B 1KHJA 4EUVA 2RAQA 2BDPA 1TKZA 1MMNA 3ITHB 4O3QA 3CPWR 2K3IA 1E6VA 3IM8A 1H38A 4NA1A 3MUMP 2YNHB 3ZZRA 2IJNA 2C3MA 3FGVA 1WELA 2NUHA 5D0RA 4IRDA 4FF4A 4ZS6A 3LALA 5F3TA 4F04B 1L5UA 4X4OA 3MHYA 2JEJA 5KTQA 2AJQA 1PJ5A 4Q45A 3V6DA 4DX7A 1U8WA 2PA3A 1H7WA 2CG4A 2HMIA 2VBYA 3FBBA 2RS8A 3J80U 1CJKB 2NPFA 3GYGA 2AJFE 4IG0B 4C8LA 4EWTA 4J7CA 2NREA 1TK0A 2GAGC 3MUVP 4FXVA 3KDOA 2M70A 3ISND 1SC4B 3FEYB 4U7UD 3RB4A 1JXEA 2DR6A 1WSRA 2ASDA 4MKVA 2ZM6J 2FIUA 4OHWA 3VAKA 2O1PA 1U4BA 3CULA 2CQGA 4WYWA 3MECA 4HH1A 3E2EA 3P3DA 3RG6A 1RTJB 3N5FA 3UCGA 1ICEB 3CMQA 3TAMA 3MZIA 5G4DA 5BYSA 3CJ5A 3IA0A 2JHEA 3NBPB 4MIAA 3GCWP 1NK7A 4UPLA 1HBNA 2Y8YA 1HJKA 3C16B 1HDHA 4MJKA 3QFHA 1HLWA 4DV7J 3LP2A 2VG6A 1YGYA 3RU0A 3D1HA 1IBLJ 3AQOA 2QEXS 3EE3A 1HWJA 2OPSA 1B7YB 5C42B 4ECSA 1D8YA 3MMAB 5ETOA 4ZVOB 3PTWA 3CC4S 2WBRA 3CCES 3TRGA 1HMVA 1AXQA 3HVWA 4ZJLA 5DQHA 2W2MP 1S0VA 6AT1B 1H2UX 5HQMA 1FRHA 2R7XA 2DJWA 3CCLS 2ADBA 4RW9A 1N5YB 2B56A 4Y2KA 3H59A 1BUXA 4UY85 3G8QA 2VFSA 3M2RB 3LTOA 4PWDB 4K50A 2YX1A 1XNRF 1NEEA 4OYMA 4A8MP 2AGQA 2BJ7A 4NLUA 4ECQA 1ZZNA 2ZDOA 1S1WB 3DM2B 1ZPVA 4DSKA 1JWWA 1AYEA 1U1OA 5KT5A 2VG5A 3RTVA 3BGUA 2ZITA 2J76E 4AE5A 1IM4A 1BQNA 2F7VA 3KLGA 4P75A 2FJDB 4YN3B 1Q86T 3BV8A 4ANCA 5DETA 2D1CA 5I3QA 3UWTA 4ZLLA 2YNIB 4C8OA 5FD1A 4ZKAA 2W25A 2H4YB 2VZ9A 1ZEDA 4PG7A 1UTAA 1PC4A 4USWA 3M32A 5KFQA 2MXYA 2YQ1A 4U7CA 5GMEA 2M5YA 3QWUA 2IPOB 4K59A 2WB1D 3ADAC 4CP5A 2DISA 4PUOB 4LF4J 4BWMA 3CCZA 4PG5A 2BJ8A 3J7AN 4JI6F 3LP1B 2HQGA 1HNXF 4ZJQA 2B9XA 3KLIB 3TX8A 1YITS 3QJLA 4NLDA 1NH8A 1BWVA 4H4KC 4NYPA 2I9SA 4F4AA 2UUCF 2HYIB 5HROA 2Z2ZA 4CYUB 3OTOJ 5HLFB 2W9CA 2AJ0A 4ECZA 3BDPA 4DMZA 4Y65A 1S6OA 2RU3A 4AQYF 5F8GA 1FRKA 2BE2B 3NGTA 1CJKA 3ZZTA 3NWRA 3WC2A 3VQSA 3IC1A 3SQGB 3UDCA 3KNGA 4K2XA 2JSXA 1MN7A 4PG8A 3IFEA 5GRRA 2W4CA 4RBVA 3WAVA 2R7TA 3ILOA 5IT9Y 4DPTA 3M6VA 3DLLQ 5D4PA 2DNYA 2OMLA 3Q2TC 4KQZA 3WAYA 2V50A 1K47A 3TAPA 1WF2A 4O3PA 2CQCA 4ZPAA 2UU9J 2NZ4A 1IN0A 2WVEA 4EBDA 1R6VA 2Z0GA 1RTJA 1U7LA 2ASYA 1Q8KA 4TY8A 4ES2A 2VOPA 4WTOB 5EGEA 2DKOB 2R2TA 1GXUA 4IH5A 1ALIA 1AW0A 3U1MA 4JI0F 2OPQB 2W5VA 4L6V3 3NBPA 2YKOA 1SV5B 2MY7A 4NCGB 4DQSA 2J6TA 3HJFA 3K5MA 1SPBP 3I87A 1FNOA 4LT6A 3E01B 2W8DA 3DKDA 4ZGAA 3BJYA 3BDFA 1T11A 3I96A 3G6YA 3FRZA 2FLOA 1D9FA 3CT9A 2CXEA 3D5MA 2UVRA 3GIRA 3AOBA 2FD2A 3OXFA 3DLBA 2WTFA 2C2DA 2P6SA 1VK8A 2I0XA 1EJ7L 2KJVA 1QSYA 1T95A 4J9PA 3ZXWA 1QSLA 1S1XA 3NAHA 3MM8B 1I6JA 3ZNJ1 4EEYA 1RT4A 1NSPA 2KYXA 1Q79A 1A7GE 1MROB 3BO2A 5LSOA 2Z58B 4Z7YA 3EGZA 7FD1A 3I0SA 1I94J 1IJFB 1HNWF 1K8AT 2XBPA 3KLHB 3KHLA 5AXKA 1LW2A 2OPRB 4LFAJ 3M8QB 3M8ZA 4K4TA 2DNGA 4H4KA 4I67A 5DGBA 3CCJS 3O6QA 1VJWA 2BRLA 3BH6B 2UUWA 4ID8A 4KGXB 4F4YA 4X66J 4FBUA 4CO5A 1DLOB 4PUOA 3FMBA 1EJJA 3CJTA 2GGPB 3AB4B 4OYPA 4S0MA 1KOHA 3T41A 2EK1A 3L4BC 2FLLA 1AFIA 2BANB 4M5KA 1PBUA 2DRDA 1HR0F 3ENVA 2GV1A 5L38A 2IFXA 1IBLF 2PI5A 2RF2A 5A76A 4AL5A 5EX3A 3WBHA 3SFUA 2CWKA 1WUUA 3CMES 4YDXA 5B0EA 2BE2A 2VF3A 3SV3A 4C0HA 2M2BA 4WCEQ 3B8HA 1EIYB 1NK4A 3M8PA 4P6QA 2B4VA 1RAFB 1IQTA 3O44A 4OI3A 3WZ0A 2XMTA 2PE8A 2MY8A 2DXFA 2MB0B 4NX9A 1K44A 4MFBA 1JKHB 1WKJA 3BDGA 3HT3A 3FVYA 4X62F 3T6JA 1IQZA 2MHNA 3HK2A 5D3GB 1GTEA 2X1FA 2MKYA 1D8ZA 4H4OA 3C2PA 2XC9A 1EB0A 1QSSA 3CCRS 3LAKA 2BKOA 3LP0B 2VICA 2KRRA 5ETTA 1QLNA 2B5JB 3US5A 2OPQA 1UW9A 2PC6A 3CE8A 4C11B 1L3KA 4DBQA 4I56A 2IM2A 3IR7B 2L08A 3E01A 4P2FA 3RGIA 3C46A 4DL0C 1HQ2A 3CDBA 4LF8J 1FEEA 4LF4F 3A8EA 2JJ4D 3Q22A 4W98A 2ERRA 4RBUA 1S6PB 2MJNA 5HVHA 1IKXA 2V8PA 1TAUA 4DUYJ 1F1BB 4B3RF 2C3PA 3BBBA 2G2ZA 1FESA 2XCPA 4GO7X 4X4QA 4UOFA 3T9ZA 1X4AA 2AT1B 1WI6A 1X5TA 4I2QB 3VAHA 3V4MA 1TV6B 4YR1A 4EO8A 1X31C 5ETPA 4NZ0A 1AUSL 1R0AA 4OYOA 1UA1A 5H9EJ 1V5VA 4OZ5A 1VS3A 4PAAA 2CIMA 2GSNA 4DWIA 1RTIB 2LXFA 2J0WA 3NL0A 4H4MB 5J2NB 1N5SA 2UU9F 4JYAF 4JI4F 1IWGA 1VQ7S 2DY9A 3W3SA 3HM9A 2V34A 3HFZB 3JTPA 1S9EB 1U02A 4O4GA 5F8MA 1MSWD 2GS8A 3LXQA 3QGHA 3CIMA 3SFGA 3ENWA 1C1CB 3CWJA 4QZVB 3PX4A 3M9MB 3WDOA 4DFMA 5T41A 1VRTB 1UJ6A 3Q8SB 5KFRA 2CQDA 2W5XA 2AJ1A 2YKQA 2I38A 3QGGA 5EWFA 4U67Q 4DR7J 1HBOA 1HQUB 1ACMB 2N82B 5D78A 3JTNA 5KFNA 4USTA 3I0RB 2GNKA 3FFIA 5BXIA 4E2FB 4M5JA 2HW3A 1KC8T 2W2PP 3R8YA 1S6UA 4ELUA 2WONB 3QATA 3Q24A 5DDPC 3SBMA 1RB0A 4UUXA 4QR0A 1AUKA 3WAWA 1WC0A 3OL6A 1HQEA 2DNLA 3MM6B 4Q7AA 1B0VA 5EWGA 3T1YF 3MTJA 2VA3A 3SMZA 5KFEA 1EKRA 3BEGB 2VA2A 1HNIB 4QU6A 2B5JA 2GC8A 2J9DE 1M90T 2XYGB 4C11A 1M1GA 2E5HA 2GIQA 2Y8WA 4LBPA 3GU0A 4QR2A 4X66F 2C2MB 3W2WA 4KSEB 2IJFA 3MEGA 3P49B 1S12A 1HQAA 1RACB 3G86A 1TUVA 3QO9B 1RKJA 3D67A 3PRBA 1FTCA 3M30A 2MZRA 1AA1B 4QYZJ 5CD4A 2E7WA 4IR9A 2PIIA 1W7WA 1RQ0A 3CNQP 1FX4A 2MQQA 2B7BB 1HW8A 1D0EA 2W9AA 2V0NA 3CDEA 4ITSA 5LRNA 4ZVHA 3W5YA 3O2IA 1HPZA 4BHQA 3CXCR 1S1TB 2XCAA 1FD8A 3H42A 1QTMA 2A10A 3UD3P 4WE1B 2YX4A 2M3DA 1PILA 5CCLA 1CULA 2VFVA 2KL8A 2ATLA 3CDAA 1UA0A 3NKYA 5JXSA 3JYTA 2DNRA 2HNZB 4U95A 3TZWA 4KGVB 1RAHB 4CLPA 1TV6A 2RQMA 2L9DA 1URNA 1WC4A 2CDRB 1MWZA 3IGYB 4C0BA 2A1BA 3HVAA 3J7A1 1VCTA 3G6ES 2ACMA 4F3OA 4P74A 4ZP8A 2DNNA 1ELZA 2W4PA 2ZE2B 2OH2A 2DYAA 2IA0A 2FGCA 1YZ6A 1UPMB 1RA7A 2HAIA 3GB0A 2BBEA 1LNQA 4ZVRB 2NQPA 2NPIA 5KFTA 3BDHA 2OEJA 2AYEA 3NGSA 2BOAA 5C5JA 3NMRA 2CQ1A 3IRXB 2CPJA 1QJHA 1KLMB 3DRRB 4HT7A 3GJTB 1K0TA 4X64F 4HEA9 2ANHA 3H0PA 3BN7A 2VC1A 4NPOA 1EAYC 1NAQA 4L3NA 4MIBA 2Q1LA 2G4BA 2ILYA 3Q8YA 1T9WA 4RW8B 4RBTA 2CNNB 1Y4ZB 4CNYA 5EX0A 2F4VF 4TLQA 3MR2A 4QU7A 5I42B 2Z8QA 3CW2C 3A8KA 4JI5F 3MFIA 3DRPA 2HHSA 1XEZA 3NXZA 2WONA 3H5SA 3PEJA 4EMDA 5KG2A 2V2KA 1U0HB 3UN5A 4DV3F 5LRMA 4W92B 1DZ5A 1NK8A 4C97A 2AEJA 1EETB 4JI7J 2W2NP 3TANA 3THTA 1Q7LB 1WACA 3ICLA 1RLCL 3EDQB 1OQ6A 3PG9A 4TLRA 2XHWA 4K5SA 2CZ4A 1M5HA 3AXMA 4A8KA 4OLPA 3MMJA 5D8HB 3MAHA 1Y7PA 2A2DA 2PDAA 1FVSA 2YWWA 1TL1A 1HWLA 1G6BA 4OYIA 3CJSA 2D3UA 2P2CB 2F9DA 3IM9A 4C8NA 5B0GA 1IM6A 2KHDA 1FA0A 4ICLB 4NLPA 1HBUB 4FF2A 4C9DA 3K5NA 2DNQA 4TN0A 4ATNA 1CC8A 5ETLA 1KTQA 2LQBA 3TWZA 2O5DA 4UPHA 3HCXA 4F0KA 2F5GA 1NJXA 2OPPB 2HHHJ 1HNZJ 3T5JA 2DGTA 2C2OB 2XQCA 2E5IA 1J2VA 2D9PA 3ZO7A 4DG1B 4FN5A 4DR7F 4B08A 5IT9U 5F8JA 3GSIA 2MMYA 2UVUA 3GFYA 1OMSA 2AMCB 5HBMA 2YXLA 3QZ8A 2ZHBA 1LK7A 2X51A 2OD6A 2HFSA 4DPXA 1R89A 5LSLA 1GEHA 2HKEA 1NKEA 2EG2A 1QAJA 4UF4A 1K1QA 2W5RA 1U6FA 3CCQS 4RW7B 3D66A 4NLWA 1N88A 3T1AA 4WZMA 1TKTB 1HBMB 3Q8PB 1GTHA 3E8OA 2B4UA 4KJDA 3MEDB 5GMDA 1ZH5A 1KLMA 4NYOA 2QL7B 3NG8A 2DIVA 2KM8B 1TP7A 3IN5A 5ITHA 3EVOA 4RW8A 2I5JA 1U1LA 1VGYA 3G9CA 4NCAA 1DBDA 4CTAA 4KV8B 1WD6A 1O51A 1YWXA 3MUTP 2OHDA 4X4SA 2ZH8A 5I42A 2ZOMA 3MFHA 2DXDA 5JVHQ 2WHOA 2DRBA 2EC2A 2KM8C 2ZC4A 4FYWB 4B3SJ 4YB1P 4WFAQ 1KH7A 1NHUA 4KFBB 3UN2A 2YY3A 3BSAA 3TUJC 1KH5A 1Q0NA 2UVWA 2G9YA 3K5PA 2DNKA 1JLEA 5DLWA 2OSRA 2BEFA 1VRUB 2BR0A 3ZNUA 2F8MA 4RKUC 2UUTA 3R1HA 4M63A 4Q0BB 4ZVUB 1YBTA 2YQ3A 1CVJA 3MEEB 2VQRA 3KK2B 3IAS9 4DSLA 3U1LA 2XMKA 1UKUA 4XO0A 2W7PA 4LR9A 2AGPA 4NZ6A 3G6XA 3A8IA 4KIAA 1SIZA 3TA2A 2W1BA 5KFFA 3S7RA 1VOMA 2BX6A 3K57A 2B51A 5F41A 3FCHA 4A8XA 4ECRA 4I2PB 4PYDA 1WI8A 5BYQA 1C4CA 4FBTA 3TQEA 1RJJA 1U8SA 4C8MA 4C8ZA 3SV4A 1FRJA 4K5RA 4K4WA 5ETVA 2VJVA 3X1LB 1VQNS 2JL9A 4EFAC 1RT2A 4OHXA 1H3DA 3EPGA 4DV2J 2UUAF 1VQSA 3R6GB 1QY7A 2R3VA 2AX0A 4ZJOA 1CC7A 1RT6B 1F2GA 4R0JA 4P10A 1TMMA 4IO1A 1ZAXA 5E0OA 5E2QA 1RBAA 5KFKA 4ZN3A 2KXNB 5B7WA 2BVZA 2QZ8A 1E33P 3PYEA 1S57A 3C6UB 3I5BA 3WX4A 2G13A 2M52A 5KG6A 5KT4A 1IKWA 1E6YA 4E8UA 2YH1A 1WG5A 1RSCA 1BGXT 4ZLJA 1WWHA 3IR6B 4HDHA 3VGTA 1KQFB 4IFYA 4KHPJ 2X1AA 2OELA 2WZ1A 2HHWA 2FJWA 4GKJF 1JNZB 4PKDB 3VR1A 4ECXA 2D9OA 3AY0A 4O3OA 1U6BA 1SHNA 3PV8A 1BY9A 4C48A 5LSRA 3W5ZA 3OUYB 3GQCA 3I56S 3RR7A 1B3TA 1H72C 3SZ2A 3PM9A 2GA7A 3GMGA 3ISZA 4G65A 3N6NA 2EFOA 1K9MT 3TEGA 1LXNA 3GP9A 2HHVA 1R8PA 2GMJA 2XGQA 1N2KA 3E51A 5L46A 3QQCD 4U8YA 4IR1A 2JVOA 1DQ9A 1SJQA 3KK3A 2NSBA 2KT5A 1V6HA 1SUQB 1HYSA 3L95X 4UW2A 2FHKA 4F0MA 2EKNA 5KFVA 1A6LA 2NYHA 3TJ8A 2HHHF 5LMUJ 1GQEA 4DCJB 1TU0B 3VGUA 2O66A 3AODA 3D1QA 4CZCA 1SB6A 2AEMA 4CIOA 1Q95G 1TK5A 1D1UA 2O67A 5E41A 4CI0B 5J2QB 4B17A 2HWHA 3D3BJ 3MEEA 4UY8T 1QE1A 4FVMA 4XK8C 4ED4A 1DJ0A 3PHTA 5LXRA 1IKYA 3BBCA 1NDKA 1N5TA 2V63A 2I2YA 2A0FB 2GCFA 2CQPA 5IWAJ 2E7VA 1RBLA 1VFJA 2I6WA 2DR9A 3OLBA 2Z30B 4I2PA 5L1IA 1ZAWA 1WC5A 3MAAB 4HLBA 3M1VA 3Q23A 1KR4A 5SUHA 4DV6J 3G8TA 4FF1A 1OSDA 4USKA 5KG7A 1S5ZA 1B0TA 2LFVA 1NM2A 3QIPB 4DOZA 4FYVB 2R8JA 3OXGA 2W7AA 1LW0B 1GXLA 2HNDA 2M7SA 3ETMA 1VJQA 3HHLC 4O0IA 4R0EA 3F41A 3ZTRA 2FTRA 2BJDA 2X7IA 4K8RA 1FWPA 2I8EA 2E1RA 3G8SA 1U26A 1W2BR 4QWEA 1GMWA 2RRBA 3AD8C 3R9LA 4DR2J 1G3OA 3V6HA 2FB0A 1SJ1A 3AOCA 1WTBA 1UWBB 3DMJA 4RX6A 5HQ8A 4K0KJ 1LWEB 2B3TB 4OZ2A 1FJCA 1HWKA 2HSEB 1UL3A 3H98A 1GT8A 4QAXA 4MYUA 4QQBA 2LEPA 2L48A 3QPIA 3ZTPA 4GC6A 1H6KX 2D7SA 4CLUA 1T94A 3HVTA 4DSEA 2VKZG 3CO0P 2CPZA 1VQMS 2G1DA 5C25B 4B3TJ 2RS2A 3WIUA 2XMUA 5LT5A 1N32J 3PFOA 3W5XA 4C8KA 1RT3A 4NI2A 2HEKA 2Q6BA 2MKCA 1RTDA 1RHMB 3QAEA 4EBEA 1GXTA 4UPKA 2QFIA 3T19A 1N36J 2OD4A 3OTCA 1EP4A 1H73A 3VHQA 2FHJA 1EARA 4XPCA 4J9KA 1U49A 2IUCB 4MMOA 2DO4A 3KJFB 3E2DA 3CJRA 4DL5A 2OIHA 4ZHRB 1TELA 2E1AA 2XMWA 4LUBA 2FVPA 1C0TA 3IGZB 2ZUAA 2QLFB 1S6QB 1T02A 5GVQA 1VLOA 3T1HJ 1ALHA 2LVWA 4Q43A 2WSCC 4GKKJ 2HFOA 3L09A 4DCPB 4OYBA 1KTVA 2F65A 2LQJA 5CCMA 2HHQA 3AH6A 2JX2A 5L0EA 5KFBA 3THVA 1P49A 5HJYA 3B4MA 4KHPF 3HHLA 4RJVA 1RTZA 2LYVA 3JS9A 5L8RC 1NUEA 1PAEX 2R8KA 5E3PA 1RK8A 5A6PA 3QRQA 4KYZA 3P5BP 4IOBA 1EHWA 3TUZC 3O1LA 1OYDA 2HURA 4TYBA 3QIPA 2LLZA 2QL9B 3OJUA 2EFGA 3OVSA 2HVZA 2QYCA 2RILA 2W5WA 3K0JA 4QCLA 2MKIA 2XI2A 2D3O1 1X9WA 3N0VA 3NCRA 5H1SV 2JWNA 3KG0A 1V3RA 2FJEB 4DR4J 3JSMA 3HSJA 1FEHA 3JTOA 1BQMB 2LU1A 3FUYA 2CKWA 1X60A 2Y3YA 2MGZA 3DDKA 3PXGa 3KKFA 1P27B 2N4CA 2CJQA 4GRSA 4AD6A 2YNGB 1VQLS 1LWEA 3C14B 2MKKA 4CLSA 3N4WA 1B8JA 2CPIA 4HI2A 4IFVB 5C24B 1S1UB 1F9EB 2JH3A 2KVIA 2IIHA 3NAIA 1NJWA 4Y28C 1FK9B 3IMQJ 4MKAA 2XGPA 4LQYA 2ATCB 3M9NB 1PJ7A 1KDNA 4OJGA 1FE0A 4OYAA 3CB4A 4ED0A 2VD3A 5HVGA 3H8YA 1FKOB 2FUG9 1KVJA 3O5TB 5IFMA 1L3TA 3U02A 2RH6A 1NDLA 4MKYA 3A12A 3LAMA 3GJRB 2A18A 5IWAF 4TQRA 4MIVA 3DOLA 5GMKa 5FLXY 1R7IA 3JSRA 4RNFA 5F8HA 4ED2A 1AUDA 2NZCA 2QZUA 2JLFA 4JI8J 1ZZFA 5KFDA 2IAJA 2Z2YB 1TKXA 3LGNA 3KLFA 3CGIA 1KONA 1GX5A 4LFBF 2GJFA 3OHBA 4EU0A 2BE7D 4LF6J 2E5JA 1LWXA 3VCDA 4KAYA 4C4WA 3O3LA 3K58A 2LU2A 2ZJRQ 3BO4A 4ILRA 4BLGA 1S48A 4DQPA 3DI6B 1VYAA 1UVJA 2K7KA 3EZ5A 3AA9A 3PHEA 3N79A 1IWAA 3HULA 2C22A 1KVIA 4WJBA 4OFZA 3IS9B 5KFGA 1H0HB 1SHQA 2XHCA 3IBCB 4Q2LA 5EDWA 3NS7B 5T7LB 4BBYA 4USIA 1ZBTA 4DR2F 5DQIA 3BREA 2MKHA 2B6AA 4RLEA 4LIRA 4X4RA 2OP5A 4DL6A 4L74A 3LPEA 5D4LA 1RT5A 1R31A 3I55S 3TYTA 2HLTA 3DU5A 5C66A 1ULRA 2W8KA 4LBHA 4DR3F 5IQ6A 2XS2A 5IT0A 3PO5A 1J5EF 4FDIA 4G1QB 1J5OB 2CPEA 4A8SA 1SJ3P 1JXLA 5CYMA 4ZIVA 3QJPA 1S7HA 3H90A 3OW2R 2ZH9A 2YKNA 2ASJA 3DRSA 3QT7A 1M5OC 2LXUA 3GWCA 3DFEA 1V3ZA 4CLTA 1T05B 4ANEA 4OHVA 4YR0A 2CG8A 3OTEA 4DV5F 3K89A 2W8LA 2HAFA 2EEYA 4DPUA 5FDLA 4C8YA 2M8DB 1VC6A 2CVEA 1YSJA 2QLBB 2J9DA 1F0XA 3EGVA 3AHPA 4OJ1A 1JB0C 4I6WA 2RKIB 3WIVA 2C3YA 3PX6A 4X4VA 2NR0A 2GIFA 4CO0A 4TYAA 4CWBA 1NMEB 3W9JA 4M94A 2M88A 2RH3A 1IBMJ 4LSLB 4DQQA 3Q8RB 4XPEA 3DGPA 1KKHA 1XR6A 1S1UA 1IR2A 4K4VA 4WKYA 2W4DA 3DDNA 2NYIA 4WP8A 2XWYA 1VQ4S 5EHHA 3T1HF 4ECYA 1PKUA 4GKKF 1S79A 4NLOA 1FX2A 1NBEB 5L9XA 1XMQJ 4JV5F 3I9ZA 4ZK7M 4QJVA 4JI1J 4RW4A 1HNVB 4YHHJ 3RRGA 3FZ2A 3EUNA 4LRAA 4P7VA 1Q81T 1UVKA 3T5KA 3TVYA 3RB0A 4OZ0A 4K2JA 2ZVIA 2MQMA 1TL4A 2JFDA 1UEUA 1KQKA 2KXHA 2Y9HA 5C2GA 3EVMA 4CLFA 2VQEF 4HT5A 2KDOA 1Q1KA 2EG1A 2BJEA 1S76D 2D74B 2B43A 3KXDA 1URRA 2FPHX 1YZ7A 1NU4A 4BS2A 1F5AA 1JLQA 3D6HB 5HK4A 1P9QC 1OY8A 1KVKA 2DY1A 1V5IB 2ZH4A 1MW7A 2NLWA 3NCQA 2QT7A 1U1PA 1A9NB 2FYXA 3R27A 4RWXA 3SDEB 2Y0BB 2GHWA 4CQ1A 1DTQB 4CRJA 4CH1A 2CADA 2W9BB 2QLJB 2CQBA 2HNYB 2JNJA 4TN2A 5IXUA 3C8YA 1FJ7A 3AQPA 4I6AA 2I1RA 1S9FA 3QRPA 2CJKA 4PABA 2XS5A 3X3UA 3POTB 2J5AA 1S1VB 1HIYA 1J5OA 4IRKA 3VF0B 2F40A 4QW9A 1YJ7A 1QM9A 5CYJA 2ZBRA 1NKBA 2H1YA 1NK0A 3W61A 3KLVA 3EICA 4NWJA 4TU9A 1T05A 4EZ6A 4JV0A 4OIXA 1YRUA 1YX2A 4NXNJ 2XMJA 4CM0A 5HJXA 1HWIA 5D0EA 3GTYX 1AZSB 3DOMA 2QA1A 2XM3A 2C3UA 1ZOTA 5DM6Q 2OMOA 2ZH2A 3U27A 1H7XA 3L9ZA
chains in the Genus database with same CATH topology
3DPCA 4B56A 3IGYB 2XR9A 4LR8A 1ED8A 3M8YA 1ELYA 1SHNA 3NKRA 1AJAA 2W5WA 4MIVA 2IUCB 3CMRA 4UORA 4UPLA 4FDIA 4FDJA 5AJ9A 3WAYA 5L0KA 1ZEDA 3NKPA 5INHA 3E2DA 1HJKA 1ELZA 3MK1A 1HDHA 4CYSA 1ALKA 2GLQA 4LRBA 1ED9A 1EI6A 3UN5A 1K7HA 4KAVA 2IFYA 2QZUA 3A52A 5LRMA 1FSUA 1KHKA 3LXQA 4LRDA 4QAXA 3UO0A 1AJCA 5K4PA 1ZEBA 4CXUA 3Q3QA 3IGZB 2XRGA 4LRAA 5L0BA 1HQAA 3M8ZA 1URAA 3BDHA 5EGHA 1E2SP 2W5QA 1ANJA 4NWXA 1ALHA 4LREA 5EGEA 3UNYA 3T01A 1AJDA 5KXAA 3NKQA 4GTXA 1ALIA 1URBA 1O99A 4KAYA 4ZG6A 2W5XA 2W5VA 3BDGA 3NKNA 1N2KA 1KH7A 3NKOA 3TX0A 3UN2A 4KM4A 2W8SA 4MHXA 3SZYA 1KH5A 3B5QA 4GTWA 1KHNA 2G9YA 1ELXA 5LQQA 1EW9A 3UN3A 4UOOA 2W5RA 5DLWA 1B8JA 2GSOA 2D1GA 1E3CP 5HRTA 4ZG7A 4CXKA 2W8DA 3NVLA 4ZGAA 3OT9A 2ANHA 5L0EA 3MK0A 3ED4A 4LR7A 3BDFA 4CYRA 2X98A 1KH9A 1ZEFA 4NWJA 1P49A 4GTYA 3DYCA 4YR1A 4CXSA 5IJSA 3M8WA 5DLVA 1EW2A 5LRNA 1N2LA 4ZG9A 1KH4A 2IUCA 1SHQA 1EJJA 1Y7AA 1AJBA 1E33P 1O98A 3SZZA 3T00A 2W5SA 4KJGA 4LQYA 4KJDA 1KHJA 3WAXA 2VQRA 2ZKTA 3IDDA 2GA3A 4LRFA 4N7TA 1EW8A 4MY4A 5DLTA 1AUKA 2GSNA 3BDGB 4UOPA 4LR9A 4TN0A 3WAWA 3TG0A 5LIAA 4GTZA 3NKMA 1KHLA 4UPKA 4LRCA 5IJQA 5GRRA 1ANIA 1Y6VA 3TWZA 4UPIA 3M7VA 1E1ZP 3MK2A 2GSUA 5TJ3A 1ALJA 1EQJA 4UPHA 2W5TA 3KD8A 5GOVA 3WAVA 5C66A 4LR2A 3T02A 3WBHA 2RH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPC A;  4B56 A;  3IGY B;  2XR9 A;  4LR8 A;  1ED8 A;  3M8Y A;  1ELY A;  1SHN A;  3NKR A;  1AJA A;  2W5W A;  4MIV A;  2IUC B;  3CMR A;  4UOR A;  4UPL A;  4FDI A;  4FDJ A;  5AJ9 A;  3WAY A;  5L0K A;  1ZED A;  3NKP A;  5INH A;  3E2D A;  1HJK A;  1ELZ A;  3MK1 A;  1HDH A;  4CYS A;  1ALK A;  2GLQ A;  4LRB A;  1ED9 A;  1EI6 A;  3UN5 A;  1K7H A;  4KAV A;  2IFY A;  2QZU A;  3A52 A;  5LRM A;  1FSU A;  1KHK A;  3LXQ A;  4LRD A;  4QAX A;  3UO0 A;  1AJC A;  5K4P A;  1ZEB A;  4CXU A;  3Q3Q A;  3IGZ B;  2XRG A;  4LRA A;  5L0B A;  1HQA A;  3M8Z A;  1URA A;  3BDH A;  5EGH A;  1E2S P;  2W5Q A;  1ANJ A;  4NWX A;  1ALH A;  4LRE A;  5EGE A;  3UNY A;  3T01 A;  1AJD A;  5KXA A;  3NKQ A;  4GTX A;  1ALI A;  1URB A;  1O99 A;  4KAY A;  4ZG6 A;  2W5X A;  2W5V A;  3BDG A;  3NKN A;  1N2K A;  1KH7 A;  3NKO A;  3TX0 A;  3UN2 A;  4KM4 A;  2W8S A;  4MHX A;  3SZY A;  1KH5 A;  3B5Q A;  4GTW A;  1KHN A;  2G9Y A;  1ELX A;  5LQQ A;  1EW9 A;  3UN3 A;  4UOO A;  2W5R A;  5DLW A;  1B8J A;  2GSO A;  2D1G A;  1E3C P;  5HRT A;  4ZG7 A;  4CXK A;  2W8D A;  3NVL A;  4ZGA A;  3OT9 A;  2ANH A;  5L0E A;  3MK0 A;  3ED4 A;  4LR7 A;  3BDF A;  4CYR A;  2X98 A;  1KH9 A;  1ZEF A;  4NWJ A;  1P49 A;  4GTY A;  3DYC A;  4YR1 A;  4CXS A;  5IJS A;  3M8W A;  5DLV A;  1EW2 A;  5LRN A;  1N2L A;  4ZG9 A;  1KH4 A;  2IUC A;  1SHQ A;  1EJJ A;  1Y7A A;  1AJB A;  1E33 P;  1O98 A;  3SZZ A;  3T00 A;  2W5S A;  4KJG A;  4LQY A;  4KJD A;  1KHJ A;  3WAX A;  2VQR A;  2ZKT A;  3IDD A;  2GA3 A;  4LRF A;  4N7T A;  1EW8 A;  4MY4 A;  5DLT A;  1AUK A;  2GSN A;  3BDG B;  4UOP A;  4LR9 A;  4TN0 A;  3WAW A;  3TG0 A;  5LIA A;  4GTZ A;  3NKM A;  1KHL A;  4UPK A;  4LRC A;  5IJQ A;  5GRR A;  1ANI A;  1Y6V A;  3TWZ A;  4UPI A;  3M7V A;  1E1Z P;  3MK2 A;  2GSU A;  5TJ3 A;  1ALJ A;  1EQJ A;  4UPH A;  2W5T A;  3KD8 A;  5GOV A;  3WAV A;  5C66 A;  4LR2 A;  3T02 A;  3WBH A;  2RH6 A; 
#chains in the Genus database with same CATH topology
 3TUI C;  2ASL A;  1N6Q A;  2FJX A;  5HMZ A;  1U2F A;  4DS5 A;  5CHC B;  3MM9 B;  1U1R A;  1T9U A;  4MH8 A;  5DZ6 A;  2FJB B;  1OY9 A;  4WFX A;  3DYA A;  4KH0 B;  3THP A;  4BDP A;  3CCU S;  5K4P A;  3GIJ A;  2Y0S D;  1C0U B;  3MCS A;  5MAO A;  4P52 A;  4TXS A;  2NXJ A;  1GMU A;  1E2S P;  2HIQ A;  2IVY A;  1B0P A;  5ETK A;  4EZ9 A;  4NXM F;  3MR3 A;  4K4S A;  4DV4 J;  1KHN A;  4GMK A;  3DLE B;  3OD2 A;  3VGS A;  2AYG A;  2RB7 A;  2R7Q A;  4NL5 A;  2WOM B;  2XLK A;  3UCU P;  1LQ9 A;  2NXE A;  2V2Q A;  1UFK A;  1IBK J;  4NA2 A;  1H2T Z;  4KHM A;  1IR0 A;  2YQ0 A;  3IG1 B;  2WCX A;  3M6U A;  4JB8 B;  5AJ3 J;  3MR7 A;  2F63 A;  3MMB A;  1EW8 A;  1Z1Z A;  4KKO A;  1KHW A;  4CO2 A;  1U6Z A;  2WRM A;  3AXK A;  4ZVQ B;  4NLT A;  2FVR A;  5KG0 A;  4Q8F A;  1C1B A;  3OVA A;  2IDL A;  2WW8 A;  4JP8 A;  3K17 A;  5HQL A;  2PO4 A;  1VQ9 S;  3KD8 A;  1MLA A;  4JI3 F;  3FCV A;  3HKW A;  3W2V A;  5CH7 B;  4CDI A;  3FRY A;  2HFU A;  5CQG A;  1XMB A;  3HHE A;  4QWC A;  3QFW A;  2F9J A;  1RP5 A;  3OL8 A;  2GAH C;  1TKZ B;  5HMY A;  1BXN A;  4CO4 A;  3OTB A;  2DGW A;  3I32 A;  1E6V B;  1JLB A;  3FK4 A;  4NCB A;  1O5J A;  2ZBI A;  3DLG A;  2UVV A;  1TZ0 A;  4YY3 J;  2VAS A;  3MM7 A;  3L7O A;  4UOO A;  2HNY A;  1YJW S;  4A48 A;  2E1M C;  2LA4 A;  4DS4 A;  3ED4 A;  3QMQ A;  5EGY A;  1X4H A;  2X98 A;  2BRK A;  3BH7 B;  1UMJ A;  4OHZ A;  3D68 A;  1X9M A;  1KH4 A;  3V6D B;  2YX7 A;  5M2R A;  3NLC A;  2QLW A;  2UUB J;  1TL5 A;  1X5O A;  1PYT A;  4UT4 A;  3BQ0 A;  1WC6 A;  4C2M A;  3W65 A;  2BAC A;  3PY8 A;  3OFH A;  1SH3 A;  2ZH6 A;  3B54 A;  4YOE A;  2FVQ A;  2QTW A;  4AYB D;  3T02 A;  4KR0 B;  4FYY B;  3RRK A;  2MLX A;  3C66 A;  1GMW D;  2FDN A;  2DRA A;  2BYC A;  3KK1 A;  3I4H X;  2YKM A;  3HP6 A;  5FII A;  1RAI B;  3NKP A;  1EZZ B;  2DD8 S;  2Q3P A;  3V81 A;  1S0M A;  2FY8 A;  1QAX A;  4YB7 A;  1FXD A;  3FJ2 A;  2HWT A;  4IDK A;  2D69 A;  2QYG A;  2FLN A;  2GHP A;  3MEC B;  1S10 A;  3ZFV A;  4P73 A;  3PYF A;  3MM9 A;  5KFA A;  2VPY B;  1HBN B;  2RQC A;  5KFM A;  3EXY A;  4LR7 A;  3LP2 B;  2VG6 B;  2Q79 A;  3HF5 A;  4KPC A;  1C0U A;  2MKJ A;  3QT8 A;  4IRC A;  4X2B A;  5EWE A;  1JLF B;  3G4S S;  4DR5 J;  2V69 A;  2XY6 A;  4H54 A;  4ZVT B;  2GMH A;  4RWW A;  1T9V A;  3PCO B;  4ZVS B;  2QSF A;  2ZOG A;  3EZU A;  4ETX A;  1O6X A;  2K3K A;  1YJT A;  4FS2 A;  1HMV B;  1N52 B;  2CQ0 A;  3IR5 B;  4V1A k;  2GJI A;  3QT6 A;  1X4G A;  4RW9 B;  4WFY A;  4B3O A;  8RUC A;  2FHJ D;  4M5H A;  2W24 A;  1K73 T;  2VH7 A;  5GAD I;  4LF5 F;  4OZ3 A;  2RQ4 A;  2C2R A;  3KJV A;  4K4Z A;  3M2U B;  1S7I A;  2IYI A;  4LRB A;  1NB2 A;  1JK9 B;  3I9V 9;  2VG5 B;  1XNQ J;  2XNR A;  3TZZ A;  1P8G A;  4RU9 A;  1N34 J;  3FZB A;  3KLG B;  3QLH A;  1VQ5 S;  3BQ2 A;  4NWX A;  4IOA Q;  1URB A;  1DHM A;  3EXC X;  4HHH A;  2G0J A;  3FNN A;  1UET A;  1OYE A;  2ZH3 A;  2RRA A;  3EX7 B;  3DLK A;  3M32 B;  4WU3 A;  3IWN C;  3PW4 A;  2FVS A;  2IMW P;  3BKF A;  3PJX A;  4WIQ A;  3IAM 9;  4CH0 S;  3HHL D;  4M5L A;  2ROE A;  3V4I A;  1RYS A;  2XG8 A;  3PYG A;  3SZZ A;  1NZ8 A;  4DI6 A;  2QFJ A;  2QIF A;  4GVB A;  3FDS A;  3H40 A;  3BYP A;  4AXJ A;  4UOP A;  1NHV A;  3A1Y G;  3PAC A;  1YKW A;  2ZHO A;  3OXL A;  3V2U C;  4KAI A;  5HN0 A;  2MZ1 A;  4DN0 A;  4RUC A;  1FKP A;  2RDI A;  5IOL A;  5HRO B;  3DLJ A;  1Y00 A;  2J7U A;  5DQG A;  4UOC A;  2DEI A;  2BOP A;  2W9C B;  1EKS A;  2N7Y A;  4ZP7 A;  1YDL A;  2GZO A;  3TA1 A;  1VBK A;  2QA2 A;  3N6M A;  3NRB A;  4A8F A;  1M5V C;  3H20 A;  4ER8 A;  1ZEB A;  1G7C B;  1L3S A;  3SSR A;  5FLX U;  4D3H A;  2RDD A;  1APS A;  1HI0 P;  5KXA A;  4ZN1 A;  1NRK A;  2DGU A;  2VC0 A;  2XMM A;  5FJ4 A;  5AJ3 F;  2QG9 B;  4RNM A;  3LWM A;  4QIF A;  4LVO P;  4ED3 A;  4RW6 A;  4YQW A;  2E9Z A;  2DXE A;  4KB7 A;  4DV0 J;  1LXJ A;  2VDH A;  5AT1 B;  2V4J A;  1HW9 A;  4TY8 B;  2JFK A;  1QDU B;  5DLF A;  5DLG A;  4CH7 A;  4IOC Q;  3TEH B;  5IV3 A;  3PZP A;  1VIS A;  1RCX B;  1VLY A;  1UVL A;  3MK2 A;  4P2M A;  2ROG A;  2PI4 A;  3ZZ0 A;  4M5D A;  4IH6 A;  1JLF A;  4LBI A;  2QLX A;  2HRY A;  2OI2 A;  1KSP A;  3EWG A;  4RU2 A;  2RD5 C;  1WF0 A;  3W8P A;  2Z2M A;  3MI7 X;  4TKT A;  3SI8 A;  5SZT A;  4ALZ A;  1N4L A;  4OX8 A;  2KHC A;  1URA A;  2H4W B;  3PEH A;  1S1X B;  3SCL E;  1B99 A;  4ZG6 A;  2MSS A;  1RT4 B;  2DHH A;  1SC6 A;  3M2U A;  1JLC A;  2XZW A;  4OZ1 A;  4ZG7 A;  2DNO A;  4KGZ B;  2ZFH A;  5KG5 A;  3NVL A;  5K14 A;  3LF0 A;  3I0S B;  3QZ7 A;  1KLN A;  2PFD A;  2VPW B;  4ENO A;  4MK8 A;  2PMH A;  2DCL A;  2VB6 A;  4J9R A;  1LW2 B;  2EFN A;  4BC7 A;  4J9M A;  4DLG A;  4AFF A;  4EI2 A;  2C3O A;  1NJI T;  5HP1 B;  3K5L A;  2ZWP A;  3RBD A;  1UZH A;  3OR2 A;  1NDP A;  1TR0 A;  1JJ2 R;  4Q2M A;  1VQY A;  1F2H A;  5KFX A;  4G1P A;  3D1O A;  3VZH A;  1N48 A;  2UXB J;  1UVN A;  2QRR A;  2HVI A;  4P7T A;  4A8Y A;  3PW5 A;  4LIW A;  3FQK A;  4NLS A;  4M95 A;  5T14 A;  5F8N A;  1U1K A;  1BMQ B;  2HBZ B;  2CNL B;  3MMC A;  1FFW B;  3GR0 A;  3GV8 B;  1QAI A;  1H74 A;  4I7F A;  1U2R A;  4AND A;  2YBV A;  3HX9 A;  5ETM A;  4OV1 A;  1Q8B A;  3DXB A;  5ETN A;  5J2P A;  2CQ3 A;  3S1T A;  4ZPB A;  2NS1 B;  3CJ4 A;  2OFG X;  2QL5 B;  3U7J A;  2AHO B;  2RF2 B;  1AJD A;  4MT1 A;  2AD9 A;  2QMU B;  4C3K A;  3I6P A;  3DXS X;  3H5Y A;  1LWF A;  4O4R A;  3QJJ A;  4M1K A;  5GAD U;  5A8R A;  1G2E A;  1RCO B;  3W63 A;  2FZG B;  2AGO A;  3M8P B;  2CPY A;  2KT3 A;  4GTY A;  3M2V A;  3EGN A;  5IJS A;  4EYH B;  4QIV A;  1IBC B;  2RHQ B;  1WEX A;  1P9Y A;  1XQI A;  1AJB A;  1KS2 A;  1N5Q A;  3BN4 A;  4MFB B;  4Q8E A;  2ZJP Q;  3BDG B;  3G6V A;  1H2V Z;  4LRC A;  4N56 A;  2VV5 A;  3AD7 C;  2L3M A;  2V8G A;  1Q7Y T;  4ILM A;  4LSN B;  3ZZO A;  2UXC F;  4FXW A;  2R7S A;  1FCA A;  1XNQ F;  4H4O B;  3K8W A;  4LR8 A;  2VPX B;  1PJ6 A;  2HVD A;  1N34 F;  3BYR A;  1IXK A;  3KLE A;  2CAJ A;  4HVZ A;  5IV4 A;  4CYS A;  5ADZ A;  3H7H B;  4KO0 B;  1K7H A;  2ZZN A;  5CXT A;  1U1M A;  3GJQ B;  4P71 A;  2R4F A;  3P45 B;  4NLV A;  1FJG J;  3GLJ A;  2W5Q A;  4DPY A;  5A8W A;  2E5L J;  2HS0 A;  9RUB A;  3NGR A;  4MIW A;  2F1F A;  4P2S A;  3EPI A;  4J9V A;  2VOD A;  2R2R A;  2UV8 A;  1CJU A;  2RIJ A;  4KGM A;  3M6X A;  2VG7 B;  3G96 A;  1JQG A;  2J8S A;  3PIP Q;  4DV1 J;  1IKX B;  2N3L A;  3G71 S;  1VC0 A;  3CJK A;  4EGL A;  5A2Q Y;  2K2P A;  4E0D A;  2WAQ D;  3MCO A;  2ZKT A;  4CLL A;  2CFX A;  5BR8 J;  4ZVE A;  1DQ8 A;  2ZOF A;  4DL7 A;  2BZ2 A;  1IVZ A;  2AWZ A;  5AXN A;  1Q8I A;  2H3E B;  2QE5 A;  4PR6 A;  5HP1 A;  1RKI A;  5AXM A;  3M6W A;  3H5U A;  1KOO A;  2U1A A;  4Y2A A;  1R0A B;  3R5G A;  3AJ1 A;  1RHQ B;  3OHA A;  4N8O A;  3ONQ A;  2ZEJ A;  3N01 A;  4B9M A;  2GO8 A;  3A3P B;  4UTG A;  1V9O A;  2QV6 A;  1ELO A;  3VAM A;  2G0C A;  2ZM6 F;  1ANJ A;  4EK2 A;  1WOR A;  3RYL A;  4DV0 F;  1VQ8 S;  4ED1 A;  3G82 B;  1U48 A;  3NKO A;  3KHR A;  1B64 A;  3RAX A;  2WB4 A;  1BE4 A;  4Y3C A;  3ZC4 A;  4Y00 A;  3MPY A;  4I64 A;  4O4G B;  2IDE A;  2AF6 A;  4ZPW R;  4DV7 F;  3OFF A;  4F25 A;  1EW2 A;  5J2M A;  1QVG R;  1WEZ A;  2CRL A;  5B0F A;  3CJ0 A;  1RLD A;  5KOX A;  2J0Q D;  4OI0 A;  2GA3 A;  2BQR A;  2AIR B;  3NOG A;  3QYY A;  3BO3 A;  1HBO B;  1CJV A;  4QYR A;  4B9T A;  4HDG A;  3HI9 A;  2VU5 A;  3PRV A;  4MYT A;  3FFI B;  1FRM A;  1U0S A;  4WK3 A;  4QWD A;  4DDF A;  1ZYQ A;  3BGR A;  3DOK A;  1JLG A;  2F8E X;  4WFN Q;  4J9O A;  2OEM A;  2ZKU A;  3GII A;  3OPK A;  2FZC B;  5AE3 A;  1Y10 A;  1NZA A;  4NEZ A;  2NSC A;  1KHV A;  1HQE B;  4L3K A;  4LSN A;  4X65 J;  3PR4 A;  4PZV A;  2ZD1 A;  5CD4 H;  1S4F A;  3SYZ A;  3ZTS A;  2M8H A;  2P8I A;  1HAR A;  4KO0 A;  2HRT A;  3FSY A;  3CSK A;  3A4T A;  1NH7 A;  1SQF A;  3FCW A;  3ZTO A;  3LGH A;  1ZTW A;  3NOC A;  5KFH A;  2KFY A;  2DEJ A;  2EVZ A;  3W2W B;  1LFW A;  3MEG B;  2AP6 A;  1S9G A;  1WEY A;  3GE9 A;  2V8H A;  1KD1 T;  3V6K A;  4DCO B;  2OAU A;  2HIY A;  2B0G A;  3M30 B;  2B9E A;  3WC0 A;  2VG7 A;  3PKY A;  2R7W A;  3KMQ A;  4ZCM A;  4W90 B;  1CBK A;  3RAQ A;  4G3I A;  3AJD A;  1SH2 A;  4QWB A;  2JVR A;  2ZWO A;  3CC2 S;  4X84 A;  4OJH A;  4DR1 J;  4DFK A;  2XY5 A;  4Y0F A;  3CMR A;  1HPZ B;  3MPV A;  3OTO F;  1UJ5 A;  1RWP B;  2YKP A;  1CUL B;  2IFY A;  5K5M A;  4DUZ J;  4PXD A;  4J9Q A;  2V6A A;  2JEF A;  2MZS A;  1WKK A;  3JYT B;  3J81 Y;  2XRG A;  3DNC A;  1S59 A;  1NJZ A;  2IA6 A;  1SBR A;  1BHN A;  2HHU A;  4PQU A;  4URQ U;  2M4M A;  1VBX A;  1TKD A;  4RR5 A;  2HS3 A;  5LXY A;  1NPR A;  1E3C P;  3MR5 A;  2GVD A;  4DUT A;  2VIH A;  2PT0 A;  1I51 B;  3TAQ A;  1FF2 A;  2QSW A;  2U2F A;  3L3C A;  2V8V A;  1NCL A;  4JUZ A;  3G82 A;  4B9L A;  2G9O A;  4N41 A;  4TQS A;  1WG4 A;  2JC0 A;  2BJ9 A;  4M8L A;  1TFY A;  2MQ8 A;  5G0R A;  5HVF A;  2R8I A;  1FE4 A;  1R0C B;  2N4D A;  4ELV A;  1FJG F;  2HS4 A;  1S0N A;  2HZV A;  2ZDP A;  5DG9 A;  1UFL A;  4YFU A;  3IGV A;  3EM1 A;  1F60 B;  1FT8 A;  3LO3 A;  2HG4 A;  1FSU A;  4ID5 A;  5LMN J;  2ZHA A;  4AUK A;  3QNW B;  1R0B G;  1ZM2 A;  2IVF B;  3MM5 B;  4QPX A;  1W2I A;  4PWU A;  3DRP B;  3PVX A;  3CUN A;  1NPK A;  3UI3 A;  5BR8 F;  1MU2 A;  4JV1 A;  3JAM Y;  1I94 F;  4J9S A;  4LFC J;  4V19 X;  1CSJ A;  2XB2 D;  1NK5 A;  3PNI A;  4K4U A;  4ES1 A;  2K7J A;  4PPD A;  5HMW A;  4LFA F;  2KVQ E;  2DH7 A;  2H65 B;  2R8H A;  1VIO A;  3IGN A;  1ANI A;  2R8G A;  1Y6V A;  1KBR A;  4IG3 A;  2ZUG A;  4N77 A;  2M0G B;  5KFW A;  3H5X A;  1TL1 B;  1Y3K A;  3AA8 A;  1FD2 A;  4WU2 A;  3KJN B;  1OY6 A;  9ATC B;  3Q0A A;  1OJ4 A;  3GIM A;  1XNR J;  4AXI A;  4FKX A;  1RI7 A;  4CXU A;  2D41 A;  2E7X A;  3IWX A;  1TL3 A;  1RWK B;  2MQP A;  1ZTT A;  2XUL A;  1T03 A;  4MHX A;  2DNZ A;  8ATC B;  3NNC A;  1CG2 A;  2LDI A;  2K1R A;  1RHJ B;  1ZEF A;  1ZM9 A;  4R5P A;  2AEF A;  1RTH B;  2B7C B;  3JSB A;  3UDE A;  2R2S A;  3ZZU A;  1EQ0 A;  4ZPV R;  4DPW A;  3KFW X;  5HBM B;  1Y7A A;  1N8R T;  1RUS A;  3RRH A;  3K7R A;  3AD9 C;  1YHQ S;  3M4X A;  1UPP A;  4CNZ A;  2QO3 A;  2A6M A;  2FHM A;  1S77 D;  4KT0 C;  1HNX J;  3TVZ A;  1SL1 A;  1NKC A;  1C2P A;  1BQX A;  3EZO A;  1BD6 A;  4WFZ A;  7FDR A;  2HQ3 A;  1NB7 A;  2FZK B;  2L9W A;  1ALK A;  5IM0 A;  2AV5 A;  3SCJ E;  4AQY J;  2IJR A;  3G2X A;  3W66 A;  2DR8 A;  1U1Q A;  4WK1 A;  3QT5 A;  2C28 A;  2CQI A;  2DBB A;  3GYX B;  3NKQ A;  5D15 A;  1KFS A;  2HHX A;  1XN9 A;  2I5J B;  4Z7C A;  4EBC A;  1YBA A;  4LF8 F;  3W8G A;  2YTC A;  2CVI A;  4CTA B;  1LWC A;  3MUR P;  4WPA A;  3J81 j;  2NXU A;  1VQ6 S;  3C6T A;  5HL7 Q;  4I69 A;  5EUH A;  3MM5 A;  2A2C A;  2DVI A;  1Q16 B;  4DUY F;  3OFG A;  4DQR A;  1SKU B;  1VRQ C;  1W26 A;  3T00 A;  3D0H E;  1RWU A;  3Q83 A;  4DR6 J;  1Z2L A;  2CJA A;  1RGV A;  1MNE A;  1TL7 A;  1JLE B;  1F3F A;  5MLC V;  4UPI A;  3T6B A;  3OQ2 A;  1E1Z P;  4DL4 A;  4JI0 J;  2BKN A;  2F4F A;  1RT1 A;  2PN6 A;  1JIH A;  1F9H A;  1YJR A;  4F2R A;  4ECT A;  4OYX A;  2IRX A;  4PG6 A;  5KFP A;  2HBR B;  5M2U A;  4MAK A;  3V6J A;  1CLF A;  1YRT A;  1CJT A;  4UZB A;  2W2Q P;  5DG8 A;  1S49 A;  5HAT A;  1G4C A;  3MPW A;  1YJU A;  2UXD J;  5F8L A;  2C2K B;  1RAA B;  4ZMM A;  3C15 A;  1GFW B;  3PDN A;  1RHK B;  3NGD A;  1KRP A;  8AT1 B;  4Z37 A;  3FBE A;  3B78 A;  4CXK A;  5B0D A;  2LEA A;  1WDD A;  3MK0 A;  1OO0 B;  2ZVS A;  3VWS A;  3RBX A;  3MR6 A;  4RUA A;  2KH9 A;  4CM2 A;  2JC1 A;  4I6Y A;  4DZD A;  2E5G A;  1LK5 A;  5K8P A;  1HNW J;  3C3L A;  2YWH A;  1JLA A;  1RT2 B;  1Q78 A;  3P6Y C;  3PR5 B;  4F4W A;  1Q53 A;  2F3J A;  3O8W A;  1FWL A;  4ZP6 A;  5LMN F;  1RTH A;  2V5H G;  1RAO A;  3W64 A;  2R7U A;  2IBO A;  3UR3 C;  2E66 A;  4UOR A;  4XAK A;  1CS4 A;  4AT1 B;  3K59 A;  2UP1 A;  3BF4 A;  5DG7 A;  1DTT A;  3GFZ A;  1XER A;  1IKW B;  1E6Y B;  4CLW A;  4F2S A;  1HWU A;  1NXI A;  4R8U A;  4IFY B;  2F8H A;  2C1E B;  4LFC F;  1PCA A;  4RNH A;  1HR0 J;  1O99 A;  3TOQ A;  4NRT A;  1WKL A;  2HVE A;  2IC3 A;  2J7W A;  2D1G A;  4DJB A;  3P8B B;  1SH0 A;  2WVD A;  1B7F A;  2YKA A;  1I3O B;  3PFE A;  5D77 A;  4YR2 A;  4C0O C;  1SKR A;  4NAS A;  1PYO B;  4Y2M A;  5A0Y A;  1NPP A;  1DUR A;  2BUN A;  1PGZ A;  4ZDN A;  1X0F A;  2OTJ S;  4PEO A;  5KG1 A;  3OL7 A;  2EKY A;  1GNK A;  4LQ9 A;  4KHR A;  4GTZ A;  4C6A A;  1KHL A;  5A2Q U;  4NA3 A;  5H9F K;  5J1P A;  1ALJ A;  2KG0 A;  1U47 A;  2FY1 A;  3KK3 B;  4X62 J;  2DO0 A;  2MPU A;  1HYS B;  2XZD B;  1ELY A;  3NCP A;  3DC2 A;  4YUD A;  1M5P C;  3GJS B;  5INH A;  5J1N A;  1WOS A;  2CDQ A;  5HAO A;  2RDJ A;  4X4P A;  3J7Z 5;  3D0I E;  1YJV A;  2CJB A;  5F8I A;  2X3G A;  2MZJ A;  1REV A;  2HFZ A;  2MHE A;  5DDO C;  1YRX A;  3KJQ B;  1GX6 A;  3ITH A;  2QN6 B;  5KFI A;  2A6O A;  1QE1 B;  3UVJ B;  2ZBQ A;  5JMN A;  1YK9 A;  3OV7 A;  1U24 A;  2YNH A;  3BPD A;  2P9E A;  1IKY B;  3OBI A;  1IUJ A;  3RBZ A;  4LQ3 A;  3BGF A;  1F9F A;  1RYR A;  3P5T L;  1ZM4 A;  5B0B A;  1YJN S;  1Y5I B;  3KHG A;  3IDD A;  4MY4 A;  1X0P A;  1J27 A;  2XY7 A;  3EYZ A;  4B3R J;  1UAW A;  2DCU B;  3DN9 A;  3HMJ G;  3LQV A;  3M1V B;  2GSU A;  1KNZ A;  5GOV A;  1TK8 A;  4DF4 A;  3A8J A;  4B56 A;  2XR9 A;  2DH9 A;  5D0H A;  2BXJ A;  2OO4 A;  4A46 A;  4RNO A;  1UVM A;  4IG0 A;  2FHO B;  4XIU A;  3DHW C;  2HND B;  4B3M J;  2DHX A;  2QMW A;  1T8E A;  3MOJ B;  4K4Y A;  3QSY B;  1N0V C;  1ROF A;  3D2W A;  5HSP A;  4O3R A;  1YBU A;  1VBZ A;  1NSK L;  4OQJ A;  2IM3 A;  1FKA F;  1WJ9 A;  3DMJ B;  2O3D A;  4JYA J;  4JI4 J;  4DR6 F;  5CZX A;  4KH1 B;  5JJB A;  1U2C A;  2JLG A;  2DGX A;  3BBF A;  4OV6 A;  1X4D A;  3C16 A;  2GW8 A;  2W5S A;  4AL7 A;  2POK A;  4JI7 F;  4U8V A;  3HVT B;  4PRF A;  2PMW A;  2AZ3 A;  2HK2 A;  2HGN A;  4F36 A;  6FD1 A;  5C42 A;  4UZC A;  2KZM A;  1VHI A;  3D7S B;  3MMA A;  2GML A;  2XMV A;  1KQG B;  3HLU A;  2LCW A;  4CO1 A;  1R8C A;  2UXD F;  2XWX A;  4E98 A;  3PKM A;  5KT2 A;  1N5Y A;  2VFT A;  2AYB A;  1RT3 B;  4NI2 B;  5DRK A;  3M2R A;  1RTD B;  4PWD A;  4YEA A;  1VIX A;  1IR1 A;  4DX8 H;  2PFF B;  1EP4 B;  4U6P A;  3UNY A;  4GTX A;  1S1W A;  3DM2 A;  3M9O B;  1ITP A;  3TX0 A;  1G1X A;  2EFV A;  2QC3 A;  3CJ2 A;  3J81 U;  3UN3 A;  1HNZ F;  3T1Y J;  3R5B A;  4QBU A;  3IWL A;  3R5A A;  5KT7 A;  1LKZ A;  4Y34 A;  3CED A;  1NDC A;  3R2C J;  2YNI A;  1C0T B;  4ZP9 A;  3GFX A;  4YR3 A;  2BA9 A;  5BYR A;  1SQE A;  4LMZ A;  3GIK A;  2UZA A;  1XBW A;  5HAN A;  3D28 A;  2V68 A;  4J9N A;  4YB6 A;  3UVJ A;  4TNO A;  3FSX A;  4DSI A;  4NLR A;  3NGU A;  2OEK A;  4ZA1 A;  5KFZ A;  2GVZ B;  5ETQ A;  4NMX A;  3LP1 A;  3LA0 A;  3KLI A;  2CNO B;  5AE1 A;  3TZY A;  1L3V A;  3HHL B;  2BJ3 A;  5L0K A;  2MDA A;  2Z2L A;  1XR7 A;  2XYH B;  4CYU A;  2J0X A;  3A52 A;  2CPF A;  4FNI A;  5HLF A;  4ELT A;  3K8V A;  2EFP A;  3A13 A;  2MST A;  4OI2 A;  1YG0 A;  2NXN A;  2EBG A;  4QIE A;  3UPF A;  4F02 A;  3D4J A;  3BSO A;  3RW6 A;  3SQG A;  1WC3 A;  1QAY A;  1YI2 S;  3UE2 A;  2R9L A;  2QMX A;  2GQQ A;  3DHX A;  1WHV A;  4JI2 J;  3MXH P;  3RUB L;  3JSM B;  3NGK A;  3TA0 A;  3HHN B;  3RBE A;  1P1T A;  2RML A;  1T9Y A;  1N2L A;  4FDF A;  4EO6 A;  2P9G A;  4RUB A;  2MGZ B;  3VQT A;  4A8O A;  1OSC A;  1RHR B;  4B9S A;  3WAX A;  3MDF A;  3JAM U;  2ZNZ A;  2WK4 A;  3W7B A;  2Z4P A;  1SXL A;  1HHS A;  4F7V A;  1A0O B;  4B3S F;  1FDD A;  3CD5 A;  4FYX B;  3CMA S;  3D54 A;  2ADC A;  2OKQ A;  2LEB A;  2FC8 A;  1HI1 A;  1OIA A;  2DGO A;  2H48 B;  1SV5 A;  4NCG A;  2H5I B;  4HKQ A;  3N28 A;  4X64 J;  2C2Z B;  2P5V A;  4ZIT A;  2APO A;  3BSN A;  2BV3 A;  3MF5 A;  1IKV B;  2ZBC A;  4IQX A;  1PG5 B;  3Q8V A;  5B09 A;  2KB2 A;  1M5K C;  4N8N A;  3P4U B;  4WP3 A;  2EWH A;  4F67 A;  2V4R A;  4PG4 A;  4I1T A;  3TZX A;  3FQL A;  2F4V J;  5L1J A;  3DOL B;  4PPZ A;  2HK3 A;  3FEX B;  1UFW A;  5F9L A;  1KEK A;  4JI5 J;  1ZS6 A;  4OHY A;  2RRN A;  3MM8 A;  2DNP A;  2IAJ B;  1TKX B;  5DLV A;  3KLF B;  2CJ9 A;  4J9L A;  1MRO A;  2YH0 A;  1R6Y A;  4DV3 J;  4QPT A;  3JXO A;  1FER A;  4NYZ A;  3KLH A;  2NUU G;  4B3M F;  4DV2 F;  4PXE A;  2OPR A;  4FF3 A;  2RUG A;  3UNG C;  5IC4 B;  3M8Q A;  4FYD A;  3ETO A;  5DZ7 A;  1C4A A;  4ED6 A;  5EN1 A;  3NP5 A;  2HFN A;  4NOH A;  2LEC A;  5KT3 A;  3RJM B;  2OLW A;  2B6A B;  4G6V B;  4UUW A;  3TP2 A;  3CD6 S;  3QSI A;  1DLO A;  3RZA A;  2MEW A;  4ED7 A;  3KNA A;  2MQO A;  1RT5 B;  2HZA A;  2VON A;  2GFF A;  2GVZ A;  3ILL A;  2GGP A;  3JQM A;  2LA6 A;  4FPR A;  2BW7 A;  3DGV A;  2BAN A;  4KM4 A;  2WVC A;  1RDR A;  1ELX A;  3L7P A;  5CYQ B;  3TVK A;  4PWW A;  3OR1 B;  4RZR A;  4I0W A;  5CYM B;  5CZV A;  2G2Y A;  4FPI A;  2YKN B;  2DGV A;  3DRS B;  3F44 A;  2KFZ A;  2CZV C;  1Z4U A;  2WW4 A;  5D0G A;  4F26 A;  3HD1 A;  2VUG A;  1X4B A;  3Q8Q B;  1X9S A;  2CUY A;  5B0A A;  4P72 A;  4M5G A;  5FDL B;  2J9E A;  3KDN A;  1TUW A;  2DNH A;  2VBX A;  3DRX A;  1N0U A;  3PO4 A;  1WOO A;  1JKH A;  3LGM A;  2L9N A;  3GPA A;  1R3N A;  4X4N A;  2KZZ A;  2LQ9 A;  3I82 A;  1HKA A;  4C98 A;  2WSE C;  5M2P A;  5D3G A;  1RAB B;  2ZBP A;  4C3L A;  4FZV A;  3HPO A;  1HA1 A;  2ZZT A;  5LMU F;  4PQA A;  5K9F A;  3IRW P;  1Q8L A;  1GH8 A;  1GAO A;  3DGP B;  1TAQ A;  2HGL A;  5DJB A;  3LP0 A;  1RBO B;  4DFP A;  3DRY A;  1Q5V A;  3HHK A;  1TTH B;  5E3C A;  1ZPW X;  2HLU A;  4X4T A;  3BGL A;  1M5S A;  1IKV A;  2CQ4 A;  3GIL A;  1X7V A;  4WP9 A;  1HHQ A;  2ALZ A;  5I3P A;  2ACY A;  1VQO S;  1JJ4 A;  3HJV A;  2IHR 1;  1U09 A;  4CYR A;  4RW4 B;  4GO5 X;  4TY9 A;  7AT1 B;  2XI3 A;  1R8H A;  5HO4 A;  4DSF A;  2GQ2 A;  1AT1 B;  4KJG A;  4OYW A;  4DU8 A;  1S6P A;  1F3V A;  2W2O P;  5IS2 A;  1FDN A;  4ZVG A;  3SSQ A;  2EPI A;  2BKP A;  1LEO A;  2CJX B;  3H4D A;  1EQJ A;  4LR2 A;  3OL9 A;  4DV6 F;  4A8Q A;  3GR1 A;  5GAG I;  1QUV A;  4L72 B;  4I2Q A;  4USU A;  1D3W A;  3DDI A;  3AOA A;  1FRX A;  2AU0 A;  3FEZ A;  3LOU A;  1JLQ B;  4DF8 A;  1M1H A;  3MCM A;  1X4F A;  5L1L A;  3UO0 A;  1L3U A;  3KUH A;  4QR1 A;  4JI2 F;  1AB8 A;  2L41 A;  3B4D A;  2IBK A;  5E3R A;  4X4U A;  1PIE A;  1SIW B;  3NEK A;  3ZZP A;  1RTI A;  1T3O A;  3CD7 A;  1QVF R;  1UW4 A;  3A3O B;  2HVH A;  3BKT A;  1RAG B;  4H4M A;  5J2N A;  2RU9 A;  3Q8U A;  5J1E B;  5A8K B;  4K0K F;  2KRB A;  2DNM A;  4L76 A;  4J9U E;  1YVF A;  4B9U A;  3CVK A;  5U47 A;  2KG1 A;  2PD1 A;  3ENA A;  2MYF A;  3RB3 A;  1S9E A;  2AQ4 A;  4I68 A;  5KAK A;  3MCN A;  5DDQ C;  1CPZ A;  5CYQ A;  3OR1 A;  2YWF A;  1C1C A;  4MTP A;  4LF2 A;  3ULH A;  5TJ3 A;  3BR8 A;  1N5V A;  1VRT A;  2AKW B;  1SQG A;  2UUA J;  1WOP A;  4YB5 A;  3HFV A;  2G0I A;  4F3Q A;  4B3T F;  1HQU A;  1YTY A;  1GMV A;  3VAG A;  3NWG A;  2A3J A;  3I0R A;  1N32 F;  4MKB A;  1D09 B;  2LDY A;  3R7N B;  2X1G A;  4ZLP A;  2KJW A;  2LXI A;  1DRZ A;  3DOM B;  5THW A;  1X4E A;  4IO9 Q;  2EK6 A;  1N36 F;  1FRI A;  1FTR A;  1UP1 A;  1N6Q B;  1ZET A;  2CNK B;  1H98 A;  3MM6 A;  4GKJ J;  2YPY A;  3DYA B;  2HWI A;  2V8D A;  1VHF A;  1XC9 A;  1HNI A;  2BQ3 A;  3TQ1 A;  2AZ1 A;  4BWJ A;  3HSD A;  3R3T A;  3K5O A;  4OJ3 A;  2ZC3 A;  5JUM A;  1F5C A;  5L1K A;  3E3X A;  4C7Q A;  2Y1L B;  3QID A;  2FJA B;  1Y0H A;  5C2C A;  2H51 B;  2EXU A;  2XLJ A;  2FQQ B;  3QO9 A;  1N33 J;  2VJU A;  1WTF A;  2DHG A;  3F56 A;  2ZJQ Q;  2HRU A;  2BMB A;  1Y5L B;  1VBY A;  4HHJ A;  3M05 A;  1JJH A;  3MMB B;  4KKO B;  2OJ3 A;  4M5N A;  3UDL A;  4K7Q A;  2YPZ A;  3CCW A;  1FJE B;  1S1T A;  1C1B B;  2CA9 A;  3HXM A;  3CJQ A;  4L73 A;  4WE1 A;  2CPD A;  2X1B A;  1TFW A;  4IH7 A;  1Q4R A;  4UOG A;  4DPO A;  3W2V B;  4JBC A;  5F3Z A;  2FLP A;  2HNZ A;  5GAE I;  3Q86 A;  1MG7 A;  1MML A;  4DL3 A;  1V3S A;  4CXS A;  3M8W A;  3CCT A;  4DR4 F;  1FFG B;  1SJ4 P;  1P6T A;  1WSV A;  4FVC A;  1JLB B;  1B70 B;  3ILI A;  2HHP A;  4QW8 A;  2ZE2 A;  3DLG B;  4OMF G;  2EI5 A;  4OZL A;  1XIQ A;  5DLT A;  2ZH5 A;  3MM7 B;  1OWX A;  1XK8 A;  5J1E A;  5A8K A;  5DS7 A;  4DX6 A;  5CAB A;  2BE9 B;  2B8Q A;  3MAQ A;  3BR9 A;  1KWM A;  2CWX A;  4NLG A;  2M9K A;  2MQL A;  3IRX A;  3CDW A;  1QD1 A;  1JMT A;  2VL1 A;  3DRR A;  3TJA A;  1RWM B;  4HAC B;  3ET6 B;  4DN9 A;  4ZCL A;  3IBF B;  4O3N A;  1JX4 A;  3FBF A;  5LL6 d;  1NHK L;  1FO1 A;  1XJW B;  4LVN P;  2H5J B;  3TJ9 A;  2YNF B;  3CC7 S;  2WVF A;  3SQO P;  4CLY A;  3B6B A;  2RE1 A;  4CT9 A;  2C2N A;  5I4M A;  3Q89 A;  4CO3 A;  1SL0 A;  1VK3 A;  3AAW B;  3NY0 A;  4Q44 A;  3KK1 B;  1T3N A;  1NLK L;  2YKM B;  3PW7 A;  1FVQ A;  4ZIW A;  5GAG U;  2X3D A;  3V81 B;  4WTY A;  1WC1 A;  2DTJ A;  3JSY A;  2CZ9 A;  3KWM A;  2EW9 A;  2MJU A;  2V94 A;  5LJ5 Y;  4IDK B;  1CQM A;  1RWX B;  4JI8 F;  4CLK A;  1RT7 B;  1U0H A;  4PXB A;  4LF6 F;  3TUP A;  5KFO A;  3MD1 A;  1EET A;  2LQ8 A;  3PX0 A;  1SJF A;  4XTT A;  2HQC A;  3IP0 A;  2GHV C;  1SKW A;  3OFE A;  3RW7 A;  1O0P A;  2G2O A;  1NK9 A;  2VBW A;  1AFJ A;  5L9N A;  5KFJ A;  5E5N A;  4NZ7 A;  4U7U K;  5AXL A;  3QBC A;  5IZH A;  3W62 A;  5K8O A;  4LF9 J;  1DY3 A;  3KTQ A;  1S0O A;  5EGH A;  4B3O B;  3PJW A;  1R8A A;  1WF1 A;  4JV2 A;  4WFB Q;  4ICL A;  4ZPT R;  1HBU A;  3VAF A;  4Z2X A;  2MLY A;  1VI7 A;  4M5I A;  2W8S A;  3EJM A;  3UD4 P;  1SC3 B;  3GG0 A;  3TW0 A;  3QGP A;  2MZT A;  5D4N A;  3KJV B;  4HHU A;  4AL6 A;  1Y9O A;  2OPP A;  1Y3J A;  3FKB A;  4K4X A;  5E3A A;  1T9X A;  1REG X;  4ZG9 A;  2QGF B;  4QOT A;  3R5D A;  3QLH B;  2XLI A;  4DG1 A;  2JOQ A;  3TO8 A;  1SL2 A;  4L75 A;  3PJ9 A;  2DPI A;  1LFP A;  5I3U B;  3IBW A;  5K8N A;  1MWQ A;  2AYM A;  2JLE A;  3DLK B;  3GG1 A;  4DSJ A;  2D3O R;  1FXR A;  3W1Y C;  3V4I B;  3DCA A;  2IVM A;  4RW7 A;  1FFS B;  4GVB B;  2BW2 A;  1IBM F;  4LF7 J;  3K2Y A;  4PXC A;  4QIG A;  1TKT A;  2HGM A;  1WHX A;  2RJZ A;  1HBM A;  4IUF A;  3MED A;  1FKP B;  2J6S A;  3HDS A;  3DU6 A;  4D3G A;  4HAC A;  3ET6 A;  5F0U A;  2HFV A;  2HHT A;  4RNN A;  2Z56 B;  1SJR A;  2YNF A;  4F4X A;  1XMQ F;  4OX7 A;  2W7O A;  4DXL A;  4JI1 F;  2IY5 B;  4YHH F;  1N33 F;  3LPY A;  4PCQ A;  2J8A A;  4KV8 A;  3GSD A;  1NJY A;  4QIW D;  3I4P A;  3HHD A;  4KGK A;  3N6L A;  1UCN A;  2G1H A;  4RPF A;  4FKY A;  4ZCI A;  1EX8 A;  1XWL A;  2FC9 A;  4JOU A;  1RZM A;  1PYS B;  2GQC A;  2BM1 A;  4RW6 B;  1OPZ A;  3R5C A;  3MGJ A;  1RAD B;  2V2V A;  5GAE U;  2GX8 A;  4KFB A;  1RT7 A;  5ETS A;  3UR0 A;  4KRW A;  4FDJ A;  4WXW A;  2K8G A;  2V4J B;  1BC6 A;  1FWK A;  1VRU A;  2COL A;  2HQF A;  2KTQ A;  3HFK A;  1TUG B;  3R5J B;  4MK7 A;  2D3Z A;  1M0S A;  4Q0B A;  4KC5 A;  1PSD A;  1VMB A;  3KK2 A;  4M5D B;  2KXF A;  3BKU A;  4RO0 A;  2OGU A;  2RHS B;  1VR6 A;  1UVI A;  3NKN A;  5DO2 A;  2V2Z A;  3B5Q A;  1CQN A;  3VGV A;  3KUE A;  1RXO B;  2DGQ A;  2XTJ P;  4EYI B;  4USH A;  3VVT A;  1NK6 A;  5KG4 A;  3J7Z T;  3TAR A;  2YWG A;  1TQL A;  2MLZ A;  5B08 A;  4DLE A;  2E9R X;  3KHH A;  4LF1 A;  3CJ8 A;  4LFB J;  3ILJ A;  4FNH A;  4WII A;  5H9E K;  3NKM A;  2JEI A;  1JLC B;  3HSG A;  5K14 B;  3CDU A;  2W5T A;  2K06 A;  4CLZ A;  2AX1 A;  3GZ7 A;  3GYN A;  4FP9 A;  1RHU B;  2JDJ A;  2ZNY A;  2H54 B;  1TMJ A;  4KJI A;  1X5P A;  4HYK A;  1RT6 A;  2IRU A;  3LW5 C;  3WHI A;  5F9N A;  4NXN F;  3UD5 A;  2ZH1 A;  3H2L A;  3OR2 B;  5I3U A;  4KAV A;  3N5B A;  4O23 A;  3CTR A;  2XSJ B;  4LRD A;  1AJC A;  2RT3 A;  5LJ3 Y;  4UQG A;  3HT0 A;  1R8B A;  3C6U A;  2DK2 A;  2FJV A;  2WSF C;  3R1L A;  1U25 A;  3CCS S;  3HD2 A;  3UQS A;  3MMC B;  5LQQ A;  2VBZ A;  5HRT A;  1ZM3 A;  5K20 B;  2IYG A;  4I7F B;  3OT9 A;  2PGC A;  4DR3 J;  1J5E J;  4FXD A;  2XNQ A;  5J2P B;  3OUY A;  2DPJ A;  3CCV S;  5KFY A;  4HR2 A;  1RU1 A;  2HBY B;  3ISN C;  1DQA A;  2DHS A;  4O0N A;  4CT8 A;  3SEO A;  1LWF B;  4Y6I A;  3HO1 A;  4B9N A;  3ZZZ A;  4DV4 F;  3UW1 A;  1RE1 B;  3F0N A;  4DV5 J;  5A8R B;  4P2X A;  1K1S A;  4DX5 A;  5KFS A;  2ROP A;  1FDB A;  4LF9 F;  3DLH A;  3SSS A;  3M2V B;  5CA5 A;  3H2U B;  3M8Y A;  5DM7 Q;  4F8R A;  2VHG A;  2OUG A;  3ENQ A;  1IBK F;  4OYZ A;  3H2V E;  3WQP A;  2VQF J;  1HD1 A;  1SUQ A;  2C2E A;  4ZPD A;  4ILL A;  5LOQ A;  2AW0 A;  3BZQ A;  2VOO A;  5L0B A;  1WG1 A;  2CPH A;  3VTI A;  1X4C A;  1YQH A;  1P1L A;  3JQK A;  3R7B B;  4IKA A;  4J37 A;  4GTW A;  3W60 A;  3UCZ P;  1FI4 A;  4TVA B;  3KLE B;  3TNV A;  2OFH X;  3T9N A;  2JZ5 A;  1MWY A;  2CJY B;  3LUY A;  2DH8 A;  4QYZ K;  1YJ9 S;  3VAL A;  4M5M A;  1BWE A;  3FC9 A;  2H9Z A;  1NSQ A;  4OI6 A;  5J2Q A;  3KMS A;  3CO9 A;  4JV5 J;  3F73 A;  5A8W B;  3GV5 B;  3NS5 A;  4N7T A;  4QWA A;  3VZI A;  2BM0 A;  2DT9 A;  1K0V A;  4YY3 F;  4OZJ A;  4F3M A;  2DIU A;  1CJU B;  3S8S A;  4OX6 A;  2B9W A;  3SCK E;  3VAJ A;  4YP3 A;  4ZVF A;  4LF7 F;  1X8D A;  5D4O A;  4KPY A;  3BM7 A;  3AJ2 A;  3CJK B;  4URG A;  1RAJ A;  5BJR A;  3MAA A;  2Y1R I;  1ARO P;  2VQE J;  4KE5 A;  3WX8 A;  2Y1J A;  2UUB F;  4XDD A;  4HL9 A;  1RU2 A;  3W9I A;  3SXL A;  2R42 A;  3IXQ A;  1LW0 A;  3EVW A;  3CIZ A;  2Q43 A;  4IQM A;  1NSA A;  4DQI A;  2P6T A;  2DHA A;  2FGO A;  2P9C A;  1WDT A;  4WWS A;  3ZZY A;  1KN6 A;  2FVC A;  2J6U A;  5HI7 A;  3MEK A;  4DZ6 A;  2XSJ A;  1S99 A;  1UEV A;  4DHV A;  4NE9 C;  4OL8 A;  3DYC A;  3D6T B;  4YME A;  3J7Y I;  1UWB A;  5ETR A;  2EFQ A;  4ES3 A;  3BB5 A;  3PYD A;  4NEY A;  4USJ C;  5GAH I;  1XR5 A;  4ZOS A;  3D3C J;  3VV2 B;  4DFJ A;  4ETZ A;  3AFG A;  4O44 B;  4IYQ A;  5J2M B;  1QUP A;  4U9R A;  4OI4 A;  4Y2I A;  1RWV B;  4ECV A;  4DR5 F;  2GLQ A;  5AE2 A;  5C25 A;  2B8P A;  2YWK A;  3ELH A;  4J5O A;  2XS7 A;  3J80 Y;  2O01 C;  1CJV B;  3MPD A;  1TVR B;  3IO1 A;  4R25 A;  3PIO Q;  2VFR A;  1M1K T;  3KUG A;  2MZQ A;  3NNA A;  2V9K A;  3HSZ A;  3NNH A;  4B02 A;  1HD0 A;  2KYZ A;  3BGR B;  3DOK B;  4WF9 Q;  2WVB A;  1JLG B;  1PC5 A;  3A3N B;  1VQP S;  1T0T V;  2W01 A;  2QX0 A;  2IUC A;  2XO6 A;  1UEK A;  2V4Q A;  1R27 B;  4ZHR A;  2ZD1 B;  3U1N A;  1JJC B;  2VKR A;  3RAM A;  5H9F J;  2GO9 A;  3S6E A;  1PO6 A;  3T5H A;  2RNE A;  1S6Q A;  2KFN A;  4O3S A;  4NXM J;  4Y2C A;  2JRS A;  1N56 A;  2JEG A;  4URS A;  1U1N A;  1RWW B;  1S97 A;  5KT6 A;  1S9G B;  3EDR B;  3MK1 A;  2R7O A;  4I4B A;  3H25 A;  3L7U A;  4C3M A;  1HHT P;  4ERD A;  4OX9 J;  2VDI A;  4HTI A;  2XO7 A;  2LMI A;  1D9D A;  3Q3Q A;  1KQS R;  3QWP A;  3KG1 A;  1NO8 A;  2LKZ A;  4GC7 A;  5L39 A;  3MTK A;  4YDD B;  4ED8 A;  3OTD A;  3MD3 A;  3W9H A;  1ZAV A;  3UFC X;  2LQ5 A;  3LH2 S;  4ZLN A;  1SCJ B;  4HTJ A;  1EW9 A;  2RVJ A;  3SCI E;  4RUH A;  4JI3 J;  4W4M A;  1WHY A;  2HBQ B;  3V5R A;  5E7O B;  4XDC A;  3KOA A;  4P9S A;  3NMA A;  1R43 A;  5E33 A;  2J7K A;  3M8R A;  4PQU B;  1FXL A;  5DGA A;  4OZN A;  3NS6 A;  3OSP A;  1BQM A;  2GJ2 A;  4HH0 A;  3D9B A;  2VQF F;  1IJE B;  2GVD B;  2ALY B;  2ZH7 A;  5JVG Q;  2YNG A;  4N5S A;  3CF5 Q;  4BC9 A;  3C14 A;  2IMO A;  4WBF A;  5AJ9 A;  4ZPC A;  4IFV A;  5C24 A;  4NLX A;  2MKS A;  1FNM A;  1I5O B;  1FK9 A;  2RQK A;  4O44 A;  2AJ4 A;  1UWA A;  5G0R B;  2ABY A;  3EMT A;  2DR7 A;  4LRE A;  2XSF A;  4BCA A;  4USV A;  2YWE A;  2CQ2 A;  3GV7 B;  4FS1 A;  1MMD A;  2SXL A;  1GK8 A;  1FKO A;  2BAB A;  1YIJ S;  3CJ3 A;  5C7P A;  4ID5 B;  5IC6 B;  2XMA A;  1TVR A;  4A8W A;  2PMZ D;  1N54 B;  1Y5N B;  1QTN B;  5A6W A;  4ECW A;  4F50 A;  3PW2 A;  1XMO J;  2KO1 A;  1VC5 A;  2PEB A;  2XEX A;  4NWB A;  1MU2 B;  3QAU A;  4DU7 A;  3DPC A;  3KYL A;  2EC0 A;  4TU8 A;  2LP4 A;  5KOW A;  3BPS P;  1AJA A;  5F0W A;  3DI6 A;  4PYA A;  1ZA1 B;  4A47 A;  3J7Y U;  2XYP B;  1B4S A;  1PAU B;  2RUS A;  4WZQ A;  3AT1 B;  4ECU A;  3IS9 A;  5GAH U;  4DL2 A;  5KFU A;  5T7L A;  4IG3 B;  2UXB F;  3QRR A;  5KG3 A;  3D6F B;  2IM0 A;  3P96 A;  3WBZ A;  2AJ2 A;  1SC1 B;  2CQH A;  4CCH A;  4RL1 A;  2MQN A;  2DIT A;  2ZZM A;  4LF5 J;  2B4P A;  3D0G E;  2V9W A;  4G1Q A;  5HMX A;  3PRD A;  1O98 A;  4NML A;  1TL3 B;  1HL6 A;  3D6M B;  1RIS A;  1T03 B;  1FRL A;  1YLX A;  1X5S A;  3FSI A;  2PSZ A;  3R97 A;  2DR5 A;  2K1R B;  2DGS A;  3JQJ A;  1HI8 A;  4R5P B;  3BSC A;  3SIP B;  4NLQ A;  2VFU A;  2HPU A;  2KU7 A;  2R7V A;  3R6L B;  3QGI A;  5RUB A;  4KY3 A;  3UDV A;  3BS9 A;  2RKI A;  3TR5 A;  1KHK A;  1MN9 A;  1FNX H;  3H4B A;  3BGO P;  2ILZ A;  2Y1I A;  1U45 A;  4NRU A;  2QA4 S;  2BQU A;  4LSL A;  2KI2 A;  2UV8 G;  3OVB A;  3M8S A;  1NND A;  1UZD A;  3GON A;  3SZY A;  4TU7 A;  3N9U C;  2B9Y A;  2WBM A;  1SKS A;  1OPI A;  5IQQ A;  4OLO A;  4WKR A;  1S4E A;  5IM0 B;  1FHT A;  2OTL S;  2QA4 G;  3R2D J;  1KP6 A;  4U96 A;  5KFC A;  1DFD A;  1SI9 A;  4LSZ B;  3BDE A;  2J0S D;  4LRF A;  4DEZ A;  1HNV A;  3JB9 k;  2R7R A;  1XTZ A;  3Q2S C;  2E5L F;  2GIR A;  1SVD A;  3TG0 A;  5IJQ A;  3KG4 A;  4OX9 F;  3VAI A;  1KFD A;  1LWC B;  4F4Z A;  1S72 S;  1FDA A;  1DAR A;  2HQI A;  3C6T B;  3RR8 A;  2OSQ A;  1JXV A;  1RA6 A;  4DV1 F;  1DAX A;  2RSQ A;  2HZC A;  3TI0 A;  1ED9 A;  5B0C A;  4N76 A;  3LAN A;  1T9T A;  4J90 A;  3T5L A;  1TL7 B;  4ED5 A;  2HQD A;  3I5A A;  3R7S B;  1RT1 B;  2PEH A;  3HKZ D;  3T3F A;  2CPX A;  2VPZ B;  1O8B A;  1BLU A;  2PA8 D;  1JNR B;  3SDE A;  1Q82 T;  4J91 A;  1DTQ A;  2BJ1 A;  4ZCK A;  1CJT B;  3HZG A;  2W9B A;  4V19 J;  4MK9 A;  6FDR A;  3C15 B;  5LIA A;  2IRY A;  2E44 A;  4WYL A;  2Q66 A;  3MWB A;  3POT A;  1Y11 A;  2B4O A;  1S1V A;  2QJ3 A;  2Q6C A;  2E29 A;  4B9V A;  4USM A;  1ED8 A;  1WNE A;  3OSN A;  4GVL A;  2HMI B;  3NKR A;  1I1G A;  1LV5 A;  2KN4 A;  3OJS A;  1JLA B;  2N3O A;  4ZVP B;  1EI6 A;  1RWN B;  1F6T A;  4WXO A;  4UQT A;  3PW0 A;  5E3Q A;  4G1I A;  1AZS A;  1VDH A;  2N7C A;  3S01 A;  2R2U A;  1CEZ A;  1CS4 B;  4LJM A;  5DDR C;  1Z2Z A;  2E9T A;  3MOZ A;  5D6G A;  3C19 A;  2KT2 A;  1XMO F;  1DTT B;  2NXC A;  1KH9 A;  5K8M A;  2H5E A;  3AB2 B;  1D9A A;  3TAM B;  2XZT B;  1LOU A;  5IT4 A;  3LWL A;  4JI6 J;  3FMW A;  4R8U B;  4HI1 A;  1RWO B;  4X65 F;  1RAE B;  2KKH A;  4KBI A;  3G87 A;  1UJ4 A;  2UUC J;  4F0H A;  3CD0 A;  3RB6 A;  1OS5 A;  2IC3 B;  4Q5V A;  3M7V A;  3OLA A;  2OPS B;  3B82 A;  3HVR A;  1OQ3 A;  3CCM S;  3ZTQ A;  5A0Y B;  3I31 A;  4A4J A;  1W25 A;  3DLE A;  1WHW A;  3GCX P;  3EGW B;  3GFH A;  1VQK S;  1F5B A;  3FBC A;  1PBA A;  2WOM A;  4KTQ A;  1ZA2 B;  4UOH A;  2YVS A;  2V67 A;  2E1P A;  2C42 A;  2MTL A;  3HZE A;  3IG1 A;  2CYY A;  4YS2 A;  3T01 A;  1Q5Y A;  1T7P A;  3I5C A;  3MPU B;  4NLY A;  5LM7 E;  4F4K A;  4DR1 F;  3BQ1 A;  2NCK L;  2UXC J;  2J9C A;  3VVU A;  2GSO A;  5CAA A;  2IM1 A;  4OI1 A;  5KFL A;  1BQN B;  2DB1 A;  1HFE L;  2EBE A;  4N47 A;  1EQM A;  4DUZ F;  2E1C A;  1REV B;  2Z57 B;  1KHJ A;  4EUV A;  2RAQ A;  2BDP A;  1TKZ A;  1MMN A;  3ITH B;  4O3Q A;  3CPW R;  2K3I A;  1E6V A;  3IM8 A;  1H38 A;  4NA1 A;  3MUM P;  2YNH B;  3ZZR A;  2IJN A;  2C3M A;  3FGV A;  1WEL A;  2NUH A;  5D0R A;  4IRD A;  4FF4 A;  4ZS6 A;  3LAL A;  5F3T A;  4F04 B;  1L5U A;  4X4O A;  3MHY A;  2JEJ A;  5KTQ A;  2AJQ A;  1PJ5 A;  4Q45 A;  3V6D A;  4DX7 A;  1U8W A;  2PA3 A;  1H7W A;  2CG4 A;  2HMI A;  2VBY A;  3FBB A;  2RS8 A;  3J80 U;  1CJK B;  2NPF A;  3GYG A;  2AJF E;  4IG0 B;  4C8L A;  4EWT A;  4J7C A;  2NRE A;  1TK0 A;  2GAG C;  3MUV P;  4FXV A;  3KDO A;  2M70 A;  3ISN D;  1SC4 B;  3FEY B;  4U7U D;  3RB4 A;  1JXE A;  2DR6 A;  1WSR A;  2ASD A;  4MKV A;  2ZM6 J;  2FIU A;  4OHW A;  3VAK A;  2O1P A;  1U4B A;  3CUL A;  2CQG A;  4WYW A;  3MEC A;  4HH1 A;  3E2E A;  3P3D A;  3RG6 A;  1RTJ B;  3N5F A;  3UCG A;  1ICE B;  3CMQ A;  3TAM A;  3MZI A;  5G4D A;  5BYS A;  3CJ5 A;  3IA0 A;  2JHE A;  3NBP B;  4MIA A;  3GCW P;  1NK7 A;  4UPL A;  1HBN A;  2Y8Y A;  1HJK A;  3C16 B;  1HDH A;  4MJK A;  3QFH A;  1HLW A;  4DV7 J;  3LP2 A;  2VG6 A;  1YGY A;  3RU0 A;  3D1H A;  1IBL J;  3AQO A;  2QEX S;  3EE3 A;  1HWJ A;  2OPS A;  1B7Y B;  5C42 B;  4ECS A;  1D8Y A;  3MMA B;  5ETO A;  4ZVO B;  3PTW A;  3CC4 S;  2WBR A;  3CCE S;  3TRG A;  1HMV A;  1AXQ A;  3HVW A;  4ZJL A;  5DQH A;  2W2M P;  1S0V A;  6AT1 B;  1H2U X;  5HQM A;  1FRH A;  2R7X A;  2DJW A;  3CCL S;  2ADB A;  4RW9 A;  1N5Y B;  2B56 A;  4Y2K A;  3H59 A;  1BUX A;  4UY8 5;  3G8Q A;  2VFS A;  3M2R B;  3LTO A;  4PWD B;  4K50 A;  2YX1 A;  1XNR F;  1NEE A;  4OYM A;  4A8M P;  2AGQ A;  2BJ7 A;  4NLU A;  4ECQ A;  1ZZN A;  2ZDO A;  1S1W B;  3DM2 B;  1ZPV A;  4DSK A;  1JWW A;  1AYE A;  1U1O A;  5KT5 A;  2VG5 A;  3RTV A;  3BGU A;  2ZIT A;  2J76 E;  4AE5 A;  1IM4 A;  1BQN A;  2F7V A;  3KLG A;  4P75 A;  2FJD B;  4YN3 B;  1Q86 T;  3BV8 A;  4ANC A;  5DET A;  2D1C A;  5I3Q A;  3UWT A;  4ZLL A;  2YNI B;  4C8O A;  5FD1 A;  4ZKA A;  2W25 A;  2H4Y B;  2VZ9 A;  1ZED A;  4PG7 A;  1UTA A;  1PC4 A;  4USW A;  3M32 A;  5KFQ A;  2MXY A;  2YQ1 A;  4U7C A;  5GME A;  2M5Y A;  3QWU A;  2IPO B;  4K59 A;  2WB1 D;  3ADA C;  4CP5 A;  2DIS A;  4PUO B;  4LF4 J;  4BWM A;  3CCZ A;  4PG5 A;  2BJ8 A;  3J7A N;  4JI6 F;  3LP1 B;  2HQG A;  1HNX F;  4ZJQ A;  2B9X A;  3KLI B;  3TX8 A;  1YIT S;  3QJL A;  4NLD A;  1NH8 A;  1BWV A;  4H4K C;  4NYP A;  2I9S A;  4F4A A;  2UUC F;  2HYI B;  5HRO A;  2Z2Z A;  4CYU B;  3OTO J;  5HLF B;  2W9C A;  2AJ0 A;  4ECZ A;  3BDP A;  4DMZ A;  4Y65 A;  1S6O A;  2RU3 A;  4AQY F;  5F8G A;  1FRK A;  2BE2 B;  3NGT A;  1CJK A;  3ZZT A;  3NWR A;  3WC2 A;  3VQS A;  3IC1 A;  3SQG B;  3UDC A;  3KNG A;  4K2X A;  2JSX A;  1MN7 A;  4PG8 A;  3IFE A;  5GRR A;  2W4C A;  4RBV A;  3WAV A;  2R7T A;  3ILO A;  5IT9 Y;  4DPT A;  3M6V A;  3DLL Q;  5D4P A;  2DNY A;  2OML A;  3Q2T C;  4KQZ A;  3WAY A;  2V50 A;  1K47 A;  3TAP A;  1WF2 A;  4O3P A;  2CQC A;  4ZPA A;  2UU9 J;  2NZ4 A;  1IN0 A;  2WVE A;  4EBD A;  1R6V A;  2Z0G A;  1RTJ A;  1U7L A;  2ASY A;  1Q8K A;  4TY8 A;  4ES2 A;  2VOP A;  4WTO B;  5EGE A;  2DKO B;  2R2T A;  1GXU A;  4IH5 A;  1ALI A;  1AW0 A;  3U1M A;  4JI0 F;  2OPQ B;  2W5V A;  4L6V 3;  3NBP A;  2YKO A;  1SV5 B;  2MY7 A;  4NCG B;  4DQS A;  2J6T A;  3HJF A;  3K5M A;  1SPB P;  3I87 A;  1FNO A;  4LT6 A;  3E01 B;  2W8D A;  3DKD A;  4ZGA A;  3BJY A;  3BDF A;  1T11 A;  3I96 A;  3G6Y A;  3FRZ A;  2FLO A;  1D9F A;  3CT9 A;  2CXE A;  3D5M A;  2UVR A;  3GIR A;  3AOB A;  2FD2 A;  3OXF A;  3DLB A;  2WTF A;  2C2D A;  2P6S A;  1VK8 A;  2I0X A;  1EJ7 L;  2KJV A;  1QSY A;  1T95 A;  4J9P A;  3ZXW A;  1QSL A;  1S1X A;  3NAH A;  3MM8 B;  1I6J A;  3ZNJ 1;  4EEY A;  1RT4 A;  1NSP A;  2KYX A;  1Q79 A;  1A7G E;  1MRO B;  3BO2 A;  5LSO A;  2Z58 B;  4Z7Y A;  3EGZ A;  7FD1 A;  3I0S A;  1I94 J;  1IJF B;  1HNW F;  1K8A T;  2XBP A;  3KLH B;  3KHL A;  5AXK A;  1LW2 A;  2OPR B;  4LFA J;  3M8Q B;  3M8Z A;  4K4T A;  2DNG A;  4H4K A;  4I67 A;  5DGB A;  3CCJ S;  3O6Q A;  1VJW A;  2BRL A;  3BH6 B;  2UUW A;  4ID8 A;  4KGX B;  4F4Y A;  4X66 J;  4FBU A;  4CO5 A;  1DLO B;  4PUO A;  3FMB A;  1EJJ A;  3CJT A;  2GGP B;  3AB4 B;  4OYP A;  4S0M A;  1KOH A;  3T41 A;  2EK1 A;  3L4B C;  2FLL A;  1AFI A;  2BAN B;  4M5K A;  1PBU A;  2DRD A;  1HR0 F;  3ENV A;  2GV1 A;  5L38 A;  2IFX A;  1IBL F;  2PI5 A;  2RF2 A;  5A76 A;  4AL5 A;  5EX3 A;  3WBH A;  3SFU A;  2CWK A;  1WUU A;  3CME S;  4YDX A;  5B0E A;  2BE2 A;  2VF3 A;  3SV3 A;  4C0H A;  2M2B A;  4WCE Q;  3B8H A;  1EIY B;  1NK4 A;  3M8P A;  4P6Q A;  2B4V A;  1RAF B;  1IQT A;  3O44 A;  4OI3 A;  3WZ0 A;  2XMT A;  2PE8 A;  2MY8 A;  2DXF A;  2MB0 B;  4NX9 A;  1K44 A;  4MFB A;  1JKH B;  1WKJ A;  3BDG A;  3HT3 A;  3FVY A;  4X62 F;  3T6J A;  1IQZ A;  2MHN A;  3HK2 A;  5D3G B;  1GTE A;  2X1F A;  2MKY A;  1D8Z A;  4H4O A;  3C2P A;  2XC9 A;  1EB0 A;  1QSS A;  3CCR S;  3LAK A;  2BKO A;  3LP0 B;  2VIC A;  2KRR A;  5ETT A;  1QLN A;  2B5J B;  3US5 A;  2OPQ A;  1UW9 A;  2PC6 A;  3CE8 A;  4C11 B;  1L3K A;  4DBQ A;  4I56 A;  2IM2 A;  3IR7 B;  2L08 A;  3E01 A;  4P2F A;  3RGI A;  3C46 A;  4DL0 C;  1HQ2 A;  3CDB A;  4LF8 J;  1FEE A;  4LF4 F;  3A8E A;  2JJ4 D;  3Q22 A;  4W98 A;  2ERR A;  4RBU A;  1S6P B;  2MJN A;  5HVH A;  1IKX A;  2V8P A;  1TAU A;  4DUY J;  1F1B B;  4B3R F;  2C3P A;  3BBB A;  2G2Z A;  1FES A;  2XCP A;  4GO7 X;  4X4Q A;  4UOF A;  3T9Z A;  1X4A A;  2AT1 B;  1WI6 A;  1X5T A;  4I2Q B;  3VAH A;  3V4M A;  1TV6 B;  4YR1 A;  4EO8 A;  1X31 C;  5ETP A;  4NZ0 A;  1AUS L;  1R0A A;  4OYO A;  1UA1 A;  5H9E J;  1V5V A;  4OZ5 A;  1VS3 A;  4PAA A;  2CIM A;  2GSN A;  4DWI A;  1RTI B;  2LXF A;  2J0W A;  3NL0 A;  4H4M B;  5J2N B;  1N5S A;  2UU9 F;  4JYA F;  4JI4 F;  1IWG A;  1VQ7 S;  2DY9 A;  3W3S A;  3HM9 A;  2V34 A;  3HFZ B;  3JTP A;  1S9E B;  1U02 A;  4O4G A;  5F8M A;  1MSW D;  2GS8 A;  3LXQ A;  3QGH A;  3CIM A;  3SFG A;  3ENW A;  1C1C B;  3CWJ A;  4QZV B;  3PX4 A;  3M9M B;  3WDO A;  4DFM A;  5T41 A;  1VRT B;  1UJ6 A;  3Q8S B;  5KFR A;  2CQD A;  2W5X A;  2AJ1 A;  2YKQ A;  2I38 A;  3QGG A;  5EWF A;  4U67 Q;  4DR7 J;  1HBO A;  1HQU B;  1ACM B;  2N82 B;  5D78 A;  3JTN A;  5KFN A;  4UST A;  3I0R B;  2GNK A;  3FFI A;  5BXI A;  4E2F B;  4M5J A;  2HW3 A;  1KC8 T;  2W2P P;  3R8Y A;  1S6U A;  4ELU A;  2WON B;  3QAT A;  3Q24 A;  5DDP C;  3SBM A;  1RB0 A;  4UUX A;  4QR0 A;  1AUK A;  3WAW A;  1WC0 A;  3OL6 A;  1HQE A;  2DNL A;  3MM6 B;  4Q7A A;  1B0V A;  5EWG A;  3T1Y F;  3MTJ A;  2VA3 A;  3SMZ A;  5KFE A;  1EKR A;  3BEG B;  2VA2 A;  1HNI B;  4QU6 A;  2B5J A;  2GC8 A;  2J9D E;  1M90 T;  2XYG B;  4C11 A;  1M1G A;  2E5H A;  2GIQ A;  2Y8W A;  4LBP A;  3GU0 A;  4QR2 A;  4X66 F;  2C2M B;  3W2W A;  4KSE B;  2IJF A;  3MEG A;  3P49 B;  1S12 A;  1HQA A;  1RAC B;  3G86 A;  1TUV A;  3QO9 B;  1RKJ A;  3D67 A;  3PRB A;  1FTC A;  3M30 A;  2MZR A;  1AA1 B;  4QYZ J;  5CD4 A;  2E7W A;  4IR9 A;  2PII A;  1W7W A;  1RQ0 A;  3CNQ P;  1FX4 A;  2MQQ A;  2B7B B;  1HW8 A;  1D0E A;  2W9A A;  2V0N A;  3CDE A;  4ITS A;  5LRN A;  4ZVH A;  3W5Y A;  3O2I A;  1HPZ A;  4BHQ A;  3CXC R;  1S1T B;  2XCA A;  1FD8 A;  3H42 A;  1QTM A;  2A10 A;  3UD3 P;  4WE1 B;  2YX4 A;  2M3D A;  1PIL A;  5CCL A;  1CUL A;  2VFV A;  2KL8 A;  2ATL A;  3CDA A;  1UA0 A;  3NKY A;  5JXS A;  3JYT A;  2DNR A;  2HNZ B;  4U95 A;  3TZW A;  4KGV B;  1RAH B;  4CLP A;  1TV6 A;  2RQM A;  2L9D A;  1URN A;  1WC4 A;  2CDR B;  1MWZ A;  3IGY B;  4C0B A;  2A1B A;  3HVA A;  3J7A 1;  1VCT A;  3G6E S;  2ACM A;  4F3O A;  4P74 A;  4ZP8 A;  2DNN A;  1ELZ A;  2W4P A;  2ZE2 B;  2OH2 A;  2DYA A;  2IA0 A;  2FGC A;  1YZ6 A;  1UPM B;  1RA7 A;  2HAI A;  3GB0 A;  2BBE A;  1LNQ A;  4ZVR B;  2NQP A;  2NPI A;  5KFT A;  3BDH A;  2OEJ A;  2AYE A;  3NGS A;  2BOA A;  5C5J A;  3NMR A;  2CQ1 A;  3IRX B;  2CPJ A;  1QJH A;  1KLM B;  3DRR B;  4HT7 A;  3GJT B;  1K0T A;  4X64 F;  4HEA 9;  2ANH A;  3H0P A;  3BN7 A;  2VC1 A;  4NPO A;  1EAY C;  1NAQ A;  4L3N A;  4MIB A;  2Q1L A;  2G4B A;  2ILY A;  3Q8Y A;  1T9W A;  4RW8 B;  4RBT A;  2CNN B;  1Y4Z B;  4CNY A;  5EX0 A;  2F4V F;  4TLQ A;  3MR2 A;  4QU7 A;  5I42 B;  2Z8Q A;  3CW2 C;  3A8K A;  4JI5 F;  3MFI A;  3DRP A;  2HHS A;  1XEZ A;  3NXZ A;  2WON A;  3H5S A;  3PEJ A;  4EMD A;  5KG2 A;  2V2K A;  1U0H B;  3UN5 A;  4DV3 F;  5LRM A;  4W92 B;  1DZ5 A;  1NK8 A;  4C97 A;  2AEJ A;  1EET B;  4JI7 J;  2W2N P;  3TAN A;  3THT A;  1Q7L B;  1WAC A;  3ICL A;  1RLC L;  3EDQ B;  1OQ6 A;  3PG9 A;  4TLR A;  2XHW A;  4K5S A;  2CZ4 A;  1M5H A;  3AXM A;  4A8K A;  4OLP A;  3MMJ A;  5D8H B;  3MAH A;  1Y7P A;  2A2D A;  2PDA A;  1FVS A;  2YWW A;  1TL1 A;  1HWL A;  1G6B A;  4OYI A;  3CJS A;  2D3U A;  2P2C B;  2F9D A;  3IM9 A;  4C8N A;  5B0G A;  1IM6 A;  2KHD A;  1FA0 A;  4ICL B;  4NLP A;  1HBU B;  4FF2 A;  4C9D A;  3K5N A;  2DNQ A;  4TN0 A;  4ATN A;  1CC8 A;  5ETL A;  1KTQ A;  2LQB A;  3TWZ A;  2O5D A;  4UPH A;  3HCX A;  4F0K A;  2F5G A;  1NJX A;  2OPP B;  2HHH J;  1HNZ J;  3T5J A;  2DGT A;  2C2O B;  2XQC A;  2E5I A;  1J2V A;  2D9P A;  3ZO7 A;  4DG1 B;  4FN5 A;  4DR7 F;  4B08 A;  5IT9 U;  5F8J A;  3GSI A;  2MMY A;  2UVU A;  3GFY A;  1OMS A;  2AMC B;  5HBM A;  2YXL A;  3QZ8 A;  2ZHB A;  1LK7 A;  2X51 A;  2OD6 A;  2HFS A;  4DPX A;  1R89 A;  5LSL A;  1GEH A;  2HKE A;  1NKE A;  2EG2 A;  1QAJ A;  4UF4 A;  1K1Q A;  2W5R A;  1U6F A;  3CCQ S;  4RW7 B;  3D66 A;  4NLW A;  1N88 A;  3T1A A;  4WZM A;  1TKT B;  1HBM B;  3Q8P B;  1GTH A;  3E8O A;  2B4U A;  4KJD A;  3MED B;  5GMD A;  1ZH5 A;  1KLM A;  4NYO A;  2QL7 B;  3NG8 A;  2DIV A;  2KM8 B;  1TP7 A;  3IN5 A;  5ITH A;  3EVO A;  4RW8 A;  2I5J A;  1U1L A;  1VGY A;  3G9C A;  4NCA A;  1DBD A;  4CTA A;  4KV8 B;  1WD6 A;  1O51 A;  1YWX A;  3MUT P;  2OHD A;  4X4S A;  2ZH8 A;  5I42 A;  2ZOM A;  3MFH A;  2DXD A;  5JVH Q;  2WHO A;  2DRB A;  2EC2 A;  2KM8 C;  2ZC4 A;  4FYW B;  4B3S J;  4YB1 P;  4WFA Q;  1KH7 A;  1NHU A;  4KFB B;  3UN2 A;  2YY3 A;  3BSA A;  3TUJ C;  1KH5 A;  1Q0N A;  2UVW A;  2G9Y A;  3K5P A;  2DNK A;  1JLE A;  5DLW A;  2OSR A;  2BEF A;  1VRU B;  2BR0 A;  3ZNU A;  2F8M A;  4RKU C;  2UUT A;  3R1H A;  4M63 A;  4Q0B B;  4ZVU B;  1YBT A;  2YQ3 A;  1CVJ A;  3MEE B;  2VQR A;  3KK2 B;  3IAS 9;  4DSL A;  3U1L A;  2XMK A;  1UKU A;  4XO0 A;  2W7P A;  4LR9 A;  2AGP A;  4NZ6 A;  3G6X A;  3A8I A;  4KIA A;  1SIZ A;  3TA2 A;  2W1B A;  5KFF A;  3S7R A;  1VOM A;  2BX6 A;  3K57 A;  2B51 A;  5F41 A;  3FCH A;  4A8X A;  4ECR A;  4I2P B;  4PYD A;  1WI8 A;  5BYQ A;  1C4C A;  4FBT A;  3TQE A;  1RJJ A;  1U8S A;  4C8M A;  4C8Z A;  3SV4 A;  1FRJ A;  4K5R A;  4K4W A;  5ETV A;  2VJV A;  3X1L B;  1VQN S;  2JL9 A;  4EFA C;  1RT2 A;  4OHX A;  1H3D A;  3EPG A;  4DV2 J;  2UUA F;  1VQS A;  3R6G B;  1QY7 A;  2R3V A;  2AX0 A;  4ZJO A;  1CC7 A;  1RT6 B;  1F2G A;  4R0J A;  4P10 A;  1TMM A;  4IO1 A;  1ZAX A;  5E0O A;  5E2Q A;  1RBA A;  5KFK A;  4ZN3 A;  2KXN B;  5B7W A;  2BVZ A;  2QZ8 A;  1E33 P;  3PYE A;  1S57 A;  3C6U B;  3I5B A;  3WX4 A;  2G13 A;  2M52 A;  5KG6 A;  5KT4 A;  1IKW A;  1E6Y A;  4E8U A;  2YH1 A;  1WG5 A;  1RSC A;  1BGX T;  4ZLJ A;  1WWH A;  3IR6 B;  4HDH A;  3VGT A;  1KQF B;  4IFY A;  4KHP J;  2X1A A;  2OEL A;  2WZ1 A;  2HHW A;  2FJW A;  4GKJ F;  1JNZ B;  4PKD B;  3VR1 A;  4ECX A;  2D9O A;  3AY0 A;  4O3O A;  1U6B A;  1SHN A;  3PV8 A;  1BY9 A;  4C48 A;  5LSR A;  3W5Z A;  3OUY B;  3GQC A;  3I56 S;  3RR7 A;  1B3T A;  1H72 C;  3SZ2 A;  3PM9 A;  2GA7 A;  3GMG A;  3ISZ A;  4G65 A;  3N6N A;  2EFO A;  1K9M T;  3TEG A;  1LXN A;  3GP9 A;  2HHV A;  1R8P A;  2GMJ A;  2XGQ A;  1N2K A;  3E51 A;  5L46 A;  3QQC D;  4U8Y A;  4IR1 A;  2JVO A;  1DQ9 A;  1SJQ A;  3KK3 A;  2NSB A;  2KT5 A;  1V6H A;  1SUQ B;  1HYS A;  3L95 X;  4UW2 A;  2FHK A;  4F0M A;  2EKN A;  5KFV A;  1A6L A;  2NYH A;  3TJ8 A;  2HHH F;  5LMU J;  1GQE A;  4DCJ B;  1TU0 B;  3VGU A;  2O66 A;  3AOD A;  3D1Q A;  4CZC A;  1SB6 A;  2AEM A;  4CIO A;  1Q95 G;  1TK5 A;  1D1U A;  2O67 A;  5E41 A;  4CI0 B;  5J2Q B;  4B17 A;  2HWH A;  3D3B J;  3MEE A;  4UY8 T;  1QE1 A;  4FVM A;  4XK8 C;  4ED4 A;  1DJ0 A;  3PHT A;  5LXR A;  1IKY A;  3BBC A;  1NDK A;  1N5T A;  2V63 A;  2I2Y A;  2A0F B;  2GCF A;  2CQP A;  5IWA J;  2E7V A;  1RBL A;  1VFJ A;  2I6W A;  2DR9 A;  3OLB A;  2Z30 B;  4I2P A;  5L1I A;  1ZAW A;  1WC5 A;  3MAA B;  4HLB A;  3M1V A;  3Q23 A;  1KR4 A;  5SUH A;  4DV6 J;  3G8T A;  4FF1 A;  1OSD A;  4USK A;  5KG7 A;  1S5Z A;  1B0T A;  2LFV A;  1NM2 A;  3QIP B;  4DOZ A;  4FYV B;  2R8J A;  3OXG A;  2W7A A;  1LW0 B;  1GXL A;  2HND A;  2M7S A;  3ETM A;  1VJQ A;  3HHL C;  4O0I A;  4R0E A;  3F41 A;  3ZTR A;  2FTR A;  2BJD A;  2X7I A;  4K8R A;  1FWP A;  2I8E A;  2E1R A;  3G8S A;  1U26 A;  1W2B R;  4QWE A;  1GMW A;  2RRB A;  3AD8 C;  3R9L A;  4DR2 J;  1G3O A;  3V6H A;  2FB0 A;  1SJ1 A;  3AOC A;  1WTB A;  1UWB B;  3DMJ A;  4RX6 A;  5HQ8 A;  4K0K J;  1LWE B;  2B3T B;  4OZ2 A;  1FJC A;  1HWK A;  2HSE B;  1UL3 A;  3H98 A;  1GT8 A;  4QAX A;  4MYU A;  4QQB A;  2LEP A;  2L48 A;  3QPI A;  3ZTP A;  4GC6 A;  1H6K X;  2D7S A;  4CLU A;  1T94 A;  3HVT A;  4DSE A;  2VKZ G;  3CO0 P;  2CPZ A;  1VQM S;  2G1D A;  5C25 B;  4B3T J;  2RS2 A;  3WIU A;  2XMU A;  5LT5 A;  1N32 J;  3PFO A;  3W5X A;  4C8K A;  1RT3 A;  4NI2 A;  2HEK A;  2Q6B A;  2MKC A;  1RTD A;  1RHM B;  3QAE A;  4EBE A;  1GXT A;  4UPK A;  2QFI A;  3T19 A;  1N36 J;  2OD4 A;  3OTC A;  1EP4 A;  1H73 A;  3VHQ A;  2FHJ A;  1EAR A;  4XPC A;  4J9K A;  1U49 A;  2IUC B;  4MMO A;  2DO4 A;  3KJF B;  3E2D A;  3CJR A;  4DL5 A;  2OIH A;  4ZHR B;  1TEL A;  2E1A A;  2XMW A;  4LUB A;  2FVP A;  1C0T A;  3IGZ B;  2ZUA A;  2QLF B;  1S6Q B;  1T02 A;  5GVQ A;  1VLO A;  3T1H J;  1ALH A;  2LVW A;  4Q43 A;  2WSC C;  4GKK J;  2HFO A;  3L09 A;  4DCP B;  4OYB A;  1KTV A;  2F65 A;  2LQJ A;  5CCM A;  2HHQ A;  3AH6 A;  2JX2 A;  5L0E A;  5KFB A;  3THV A;  1P49 A;  5HJY A;  3B4M A;  4KHP F;  3HHL A;  4RJV A;  1RTZ A;  2LYV A;  3JS9 A;  5L8R C;  1NUE A;  1PAE X;  2R8K A;  5E3P A;  1RK8 A;  5A6P A;  3QRQ A;  4KYZ A;  3P5B P;  4IOB A;  1EHW A;  3TUZ C;  3O1L A;  1OYD A;  2HUR A;  4TYB A;  3QIP A;  2LLZ A;  2QL9 B;  3OJU A;  2EFG A;  3OVS A;  2HVZ A;  2QYC A;  2RIL A;  2W5W A;  3K0J A;  4QCL A;  2MKI A;  2XI2 A;  2D3O 1;  1X9W A;  3N0V A;  3NCR A;  5H1S V;  2JWN A;  3KG0 A;  1V3R A;  2FJE B;  4DR4 J;  3JSM A;  3HSJ A;  1FEH A;  3JTO A;  1BQM B;  2LU1 A;  3FUY A;  2CKW A;  1X60 A;  2Y3Y A;  2MGZ A;  3DDK A;  3PXG a;  3KKF A;  1P27 B;  2N4C A;  2CJQ A;  4GRS A;  4AD6 A;  2YNG B;  1VQL S;  1LWE A;  3C14 B;  2MKK A;  4CLS A;  3N4W A;  1B8J A;  2CPI A;  4HI2 A;  4IFV B;  5C24 B;  1S1U B;  1F9E B;  2JH3 A;  2KVI A;  2IIH A;  3NAI A;  1NJW A;  4Y28 C;  1FK9 B;  3IMQ J;  4MKA A;  2XGP A;  4LQY A;  2ATC B;  3M9N B;  1PJ7 A;  1KDN A;  4OJG A;  1FE0 A;  4OYA A;  3CB4 A;  4ED0 A;  2VD3 A;  5HVG A;  3H8Y A;  1FKO B;  2FUG 9;  1KVJ A;  3O5T B;  5IFM A;  1L3T A;  3U02 A;  2RH6 A;  1NDL A;  4MKY A;  3A12 A;  3LAM A;  3GJR B;  2A18 A;  5IWA F;  4TQR A;  4MIV A;  3DOL A;  5GMK a;  5FLX Y;  1R7I A;  3JSR A;  4RNF A;  5F8H A;  4ED2 A;  1AUD A;  2NZC A;  2QZU A;  2JLF A;  4JI8 J;  1ZZF A;  5KFD A;  2IAJ A;  2Z2Y B;  1TKX A;  3LGN A;  3KLF A;  3CGI A;  1KON A;  1GX5 A;  4LFB F;  2GJF A;  3OHB A;  4EU0 A;  2BE7 D;  4LF6 J;  2E5J A;  1LWX A;  3VCD A;  4KAY A;  4C4W A;  3O3L A;  3K58 A;  2LU2 A;  2ZJR Q;  3BO4 A;  4ILR A;  4BLG A;  1S48 A;  4DQP A;  3DI6 B;  1VYA A;  1UVJ A;  2K7K A;  3EZ5 A;  3AA9 A;  3PHE A;  3N79 A;  1IWA A;  3HUL A;  2C22 A;  1KVI A;  4WJB A;  4OFZ A;  3IS9 B;  5KFG A;  1H0H B;  1SHQ A;  2XHC A;  3IBC B;  4Q2L A;  5EDW A;  3NS7 B;  5T7L B;  4BBY A;  4USI A;  1ZBT A;  4DR2 F;  5DQI A;  3BRE A;  2MKH A;  2B6A A;  4RLE A;  4LIR A;  4X4R A;  2OP5 A;  4DL6 A;  4L74 A;  3LPE A;  5D4L A;  1RT5 A;  1R31 A;  3I55 S;  3TYT A;  2HLT A;  3DU5 A;  5C66 A;  1ULR A;  2W8K A;  4LBH A;  4DR3 F;  5IQ6 A;  2XS2 A;  5IT0 A;  3PO5 A;  1J5E F;  4FDI A;  4G1Q B;  1J5O B;  2CPE A;  4A8S A;  1SJ3 P;  1JXL A;  5CYM A;  4ZIV A;  3QJP A;  1S7H A;  3H90 A;  3OW2 R;  2ZH9 A;  2YKN A;  2ASJ A;  3DRS A;  3QT7 A;  1M5O C;  2LXU A;  3GWC A;  3DFE A;  1V3Z A;  4CLT A;  1T05 B;  4ANE A;  4OHV A;  4YR0 A;  2CG8 A;  3OTE A;  4DV5 F;  3K89 A;  2W8L A;  2HAF A;  2EEY A;  4DPU A;  5FDL A;  4C8Y A;  2M8D B;  1VC6 A;  2CVE A;  1YSJ A;  2QLB B;  2J9D A;  1F0X A;  3EGV A;  3AHP A;  4OJ1 A;  1JB0 C;  4I6W A;  2RKI B;  3WIV A;  2C3Y A;  3PX6 A;  4X4V A;  2NR0 A;  2GIF A;  4CO0 A;  4TYA A;  4CWB A;  1NME B;  3W9J A;  4M94 A;  2M88 A;  2RH3 A;  1IBM J;  4LSL B;  4DQQ A;  3Q8R B;  4XPE A;  3DGP A;  1KKH A;  1XR6 A;  1S1U A;  1IR2 A;  4K4V A;  4WKY A;  2W4D A;  3DDN A;  2NYI A;  4WP8 A;  2XWY A;  1VQ4 S;  5EHH A;  3T1H F;  4ECY A;  1PKU A;  4GKK F;  1S79 A;  4NLO A;  1FX2 A;  1NBE B;  5L9X A;  1XMQ J;  4JV5 F;  3I9Z A;  4ZK7 M;  4QJV A;  4JI1 J;  4RW4 A;  1HNV B;  4YHH J;  3RRG A;  3FZ2 A;  3EUN A;  4LRA A;  4P7V A;  1Q81 T;  1UVK A;  3T5K A;  3TVY A;  3RB0 A;  4OZ0 A;  4K2J A;  2ZVI A;  2MQM A;  1TL4 A;  2JFD A;  1UEU A;  1KQK A;  2KXH A;  2Y9H A;  5C2G A;  3EVM A;  4CLF A;  2VQE F;  4HT5 A;  2KDO A;  1Q1K A;  2EG1 A;  2BJE A;  1S76 D;  2D74 B;  2B43 A;  3KXD A;  1URR A;  2FPH X;  1YZ7 A;  1NU4 A;  4BS2 A;  1F5A A;  1JLQ A;  3D6H B;  5HK4 A;  1P9Q C;  1OY8 A;  1KVK A;  2DY1 A;  1V5I B;  2ZH4 A;  1MW7 A;  2NLW A;  3NCQ A;  2QT7 A;  1U1P A;  1A9N B;  2FYX A;  3R27 A;  4RWX A;  3SDE B;  2Y0B B;  2GHW A;  4CQ1 A;  1DTQ B;  4CRJ A;  4CH1 A;  2CAD A;  2W9B B;  2QLJ B;  2CQB A;  2HNY B;  2JNJ A;  4TN2 A;  5IXU A;  3C8Y A;  1FJ7 A;  3AQP A;  4I6A A;  2I1R A;  1S9F A;  3QRP A;  2CJK A;  4PAB A;  2XS5 A;  3X3U A;  3POT B;  2J5A A;  1S1V B;  1HIY A;  1J5O A;  4IRK A;  3VF0 B;  2F40 A;  4QW9 A;  1YJ7 A;  1QM9 A;  5CYJ A;  2ZBR A;  1NKB A;  2H1Y A;  1NK0 A;  3W61 A;  3KLV A;  3EIC A;  4NWJ A;  4TU9 A;  1T05 A;  4EZ6 A;  4JV0 A;  4OIX A;  1YRU A;  1YX2 A;  4NXN J;  2XMJ A;  4CM0 A;  5HJX A;  1HWI A;  5D0E A;  3GTY X;  1AZS B;  3DOM A;  2QA1 A;  2XM3 A;  2C3U A;  1ZOT A;  5DM6 Q;  2OMO A;  2ZH2 A;  3U27 A;  1H7X A;  3L9Z A; 
#chains in the Genus database with same CATH homology
 3DPC A;  4B56 A;  3IGY B;  2XR9 A;  4LR8 A;  1ED8 A;  3M8Y A;  1ELY A;  1SHN A;  3NKR A;  1AJA A;  2W5W A;  4MIV A;  2IUC B;  3CMR A;  4UOR A;  4UPL A;  4FDI A;  4FDJ A;  5AJ9 A;  3WAY A;  5L0K A;  1ZED A;  3NKP A;  5INH A;  3E2D A;  1HJK A;  1ELZ A;  3MK1 A;  1HDH A;  4CYS A;  1ALK A;  2GLQ A;  4LRB A;  1ED9 A;  1EI6 A;  3UN5 A;  1K7H A;  4KAV A;  2IFY A;  2QZU A;  3A52 A;  5LRM A;  1FSU A;  1KHK A;  3LXQ A;  4LRD A;  4QAX A;  3UO0 A;  1AJC A;  5K4P A;  1ZEB A;  4CXU A;  3Q3Q A;  3IGZ B;  2XRG A;  4LRA A;  5L0B A;  1HQA A;  3M8Z A;  1URA A;  3BDH A;  5EGH A;  1E2S P;  2W5Q A;  1ANJ A;  4NWX A;  1ALH A;  4LRE A;  5EGE A;  3UNY A;  3T01 A;  1AJD A;  5KXA A;  3NKQ A;  4GTX A;  1ALI A;  1URB A;  1O99 A;  4KAY A;  4ZG6 A;  2W5X A;  2W5V A;  3BDG A;  3NKN A;  1N2K A;  1KH7 A;  3NKO A;  3TX0 A;  3UN2 A;  4KM4 A;  2W8S A;  4MHX A;  3SZY A;  1KH5 A;  3B5Q A;  4GTW A;  1KHN A;  2G9Y A;  1ELX A;  5LQQ A;  1EW9 A;  3UN3 A;  4UOO A;  2W5R A;  5DLW A;  1B8J A;  2GSO A;  2D1G A;  1E3C P;  5HRT A;  4ZG7 A;  4CXK A;  2W8D A;  3NVL A;  4ZGA A;  3OT9 A;  2ANH A;  5L0E A;  3MK0 A;  3ED4 A;  4LR7 A;  3BDF A;  4CYR A;  2X98 A;  1KH9 A;  1ZEF A;  4NWJ A;  1P49 A;  4GTY A;  3DYC A;  4YR1 A;  4CXS A;  5IJS A;  3M8W A;  5DLV A;  1EW2 A;  5LRN A;  1N2L A;  4ZG9 A;  1KH4 A;  2IUC A;  1SHQ A;  1EJJ A;  1Y7A A;  1AJB A;  1E33 P;  1O98 A;  3SZZ A;  3T00 A;  2W5S A;  4KJG A;  4LQY A;  4KJD A;  1KHJ A;  3WAX A;  2VQR A;  2ZKT A;  3IDD A;  2GA3 A;  4LRF A;  4N7T A;  1EW8 A;  4MY4 A;  5DLT A;  1AUK A;  2GSN A;  3BDG B;  4UOP A;  4LR9 A;  4TN0 A;  3WAW A;  3TG0 A;  5LIA A;  4GTZ A;  3NKM A;  1KHL A;  4UPK A;  4LRC A;  5IJQ A;  5GRR A;  1ANI A;  1Y6V A;  3TWZ A;  4UPI A;  3M7V A;  1E1Z P;  3MK2 A;  2GSU A;  5TJ3 A;  1ALJ A;  1EQJ A;  4UPH A;  2W5T A;  3KD8 A;  5GOV A;  3WAV A;  5C66 A;  4LR2 A;  3T02 A;  3WBH A;  2RH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...