3UN3A

Phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un3A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un3A01
1URAA 4GTXA 4CYSA 2GSOA 4LR7A 3LXQA 1Y7AA 5EGEA 2W5TA 3BDHA 2VQRA 3MK0A 1KHJA 4LRAA 4KAYA 2XR9A 3WAYA 5LRMA 5LIAA 2G9YA 4LRBA 1SHNA 3B5QA 4KJDA 5TJ3A 3UN3A 1ANIA 4UOOA 1EQJA 2W8DA 4TN0A 4UPKA 3Q3QA 1O98A 4UORA 3NKOA 1HJKA 2QZUA 4GTWA 5C66A 3ED4A 4ZG7A 2IUCA 4MHXA 1KH9A 3TX0A 2IFYA 1EI6A 1ALKA 3OT9A 2W5VA 1EW8A 2W8SA 3WBHA 1ZEDA 3CMRA 1O99A 3T00A 1E1ZP 3A52A 3WAXA 4LRDA 4FDJA 4N7TA 2W5QA 4NWJA 4MIVA 3UO0A 3NKPA 2GSNA 3BDGA 4CYRA 3UN5A 1E3CP 4MY4A 1ELZA 4CXSA 1B8JA 1AJCA 3WAVA 4FDIA 4ZG6A 5HRTA 1EW2A 5LQQA 4LR2A 3IDDA 1AUKA 5L0BA 1ELXA 3M8ZA 3NKNA 4NWXA 5L0KA 4CXKA 4UPIA 3TWZA 1SHQA 5INHA 1KHLA 1AJAA 4UOPA 3MK2A 4GTZA 4UPLA 1KH7A 5L0EA 5IJSA 2W5SA 1P49A 2RH6A 3DYCA 3M7VA 4LRFA 1KHKA 1ZEBA 5IJQA 1HDHA 3TG0A 4KAVA 1URBA 5K4PA 5DLVA 3NKQA 3SZYA 3SZZA 5GRRA 1N2KA 2W5RA 1AJBA 3T01A 3NKRA 3UN2A 2IUCB 4ZG9A 5LRNA 3NVLA 5DLWA 2D1GA 4LR9A 3IGYB 4KM4A 1ELYA 4QAXA 5KXAA 2GA3A 3DPCA 1HQAA 4LREA 1N2LA 1EJJA 1ANJA 3UNYA 1E2SP 2GLQA 2ANHA 2W5XA 4UPHA 4ZGAA 1KHNA 1KH5A 4KJGA 3WAWA 1E33P 3BDGB 4LR8A 1ED9A 4LRCA 3M8WA 5GOVA 1EW9A 1FSUA 3E2DA 5AJ9A 1AJDA 3IGZB 3NKMA 1ALJA 3M8YA 2W5WA 2XRGA 1ALIA 4GTYA 3T02A 4CXUA 2ZKTA 4YR1A 1KH4A 1Y6VA 4LQYA 1K7HA 3BDFA 2GSUA 5EGHA 1ALHA 3KD8A 2X98A 1ZEFA 4B56A 3MK1A 5DLTA 1ED8A
chains in the Genus database with same CATH superfamily
2MKIA 3CD7A 3Q8SB 2YWKA 3NGRA 5ETVA 2FC9A 2AGPA 4BS2A 3CVKA 1H74A 4IDKB 2CRLA 3VZHA 4J9VA 5LSLA 3QIDA 4HT5A 3GSIA 2RDIA 4DV4J 1HLWA 1JJHA 3KUGA 1FERA 3DOLB 4DV3J 1KOHA 3HVAA 1ELXA 4V1Ak 2F4VJ 2GHPA 4DV3F 4PQAA 2RS2A 2V4JA 2G9OA 3E51A 3U1NA 7FDRA 1FESA 1NK9A 4OZLA 3MI7X 1ZBTA 1UWBB 1ELYA 5KXAA 3ZZOA 2YWEA 4J9SA 2BXJA 3VAKA 1H7WA 1HWUA 3FBCA 1N2LA 2BYCA 2VJUA 2GLQA 4AXIA 1KNZA 1RTIA 3WAWA 3I4PA 2DH9A 3EYZA 2QL7B 3NNAA 3PIPQ 3OFFA 3GP9A 3V4IB 5DQHA 2DB1A 1RU1A 4PG6A 4ZVPB 2ACMA 4GTXA 2KFYA 4DV5J 1UVJA 3SFGA 4C11A 1RT2B 5FLXU 2OPRB 4UPKA 3UDLA 4DV5F 5GAEI 3CCMS 1FWLA 4CQ1A 2XMMA 1X8DA 1BWEA 2IA6A 4CNYA 3UCGA 1S76D 2ZEJA 4DQRA 2PC6A 2UUTA 1KHWA 2GQCA 4AQYJ 4DI6A 1N54B 1AUKA 2IM3A 4RUBA 1AUSL 1F9HA 3ILJA 2XGQA 1AZSB 4KKOA 2Z4PA 1HQEB 2WVBA 3MEEB 5HBMA 3SZZA 4R0EA 4Y2KA 2DGQA 3G9CA 1H0HB 2GJ2A 2J76E 3R1LA 4OI1A 2W7OA 2XI2A 2FY8A 3PRVA 4OZ1A 1MWYA 2ZH8A 4ZVRB 4CLZA 3LW5C 3G8SA 1Y6VA 5KFHA 5LXYA 2QMXA 1H38A 1FWKA 2HQCA 1IKYA 2IVYA 3FMBA 4UW2A 1NAQA 4JV1A 3TI0A 1EQJA 2XWYA 2LMIA 1NZ8A 5FD1A 3C6TB 3UR0A 2XNQA 3H40A 4YHHJ 3PIOQ 2OSQA 2R7UA 2IDLA 4NLYA 2UUBJ 5F8LA 1HW9A 3W9IA 3GWCA 2EFPA 2UUBF 4MYUA 4IG0B 2B56A 5CZVA 3OQ2A 3MMCB 1E6VB 2HNYA 4DPOA 5HP1A 4UPLA 3WZ0A 3W2WB 4KIAA 1AYEA 1SXLA 1GK8A 1M1GA 3PW5A 2HIQA 3HMJG 3KJQB 2YNHB 2NSBA 1VHIA 3NG8A 1S97A 3D3BJ 2DJWA 3D3CJ 1VQLS 3Q24A 3SFUA 6FDRA 4W90B 4OZNA 4ZVUB 1X4GA 3DM2A 3OLBA 5F9LA 2CZVC 5F0WA 4I6AA 4KC5A 2JVOA 1K1QA 4RW9A 3HT3A 4DPTA 1UVLA 1EP4A 2Y9HA 3ICLA 2W8LA 1S6QB 1WELA 1TKDA 4J9UE 1S1WB 4KH0B 1Q82T 2E7VA 2F5GA 4A46A 5BR8J 1RTDB 3GMGA 2VC1A 2AIRB 5E5NA 3DHXA 5DLFA 4B3TF 5BR8F 2DXEA 3J81j 1PG5B 4YN3B 4UPIA 4K4XA 5KFJA 1JLEA 4B3OB 3DGVA 3CE8A 3ZZZA 3I9V9 3J7ZT 2IIHA 4DCJB 2JX2A 2JEFA 2QYCA 5AXKA 2XYHB 1KN6A 3D2WA 2VPYB 2ZHBA 1LW0B 3CJ4A 1JXVA 3LO3A 1ZZNA 1DRZA 4C8NA 4F0HA 2V9KA 1YHQS 4IR9A 1SJ1A 3HZEA 2LA6A 4MIAA 1HYSB 3KK2B 1NDCA 1FTCA 4ETXA 2OEKA 3S8SA 2L9WA 2XYGB 5L9NA 5T14A 4ZG7A 1CBKA 3D7SB 3O1LA 2MQQA 1XC9A 1SKWA 2GW8A 3HPOA 4DQSA 1E1ZP 5L1JA 2ZUAA 2IHR1 2D7SA 3VGUA 2HNDB 4U8YA 5ETRA 3CJSA 1PC5A 3ZNJ1 2G2ZA 1RU2A 2MHEA 2V8HA 3D54A 3MM9A 1U2FA 2Y1IA 5DETA 4WU2A 1RYSA 4J9OA 5IT9U 3MM7B 5KFZA 3W65A 1YIJS 2VDIA 1PYTA 4JBCA 2DIUA 2AYGA 2A0FB 2VBXA 2XCAA 5IOLA 5THWA 1JLAB 1NB2A 3U27A 1EX8A 3PJXA 1WNEA 1K7HA 2Q6CA 4C0OC 3R9LA 4KY3A 3VCDA 2I9SA 2G9YA 4R25A 2QRRA 3P3DA 2E5GA 4GTWA 2WRMA 3OVBA 1RE1B 1DTQA 1WC3A 4YB5A 3UVJA 2ZZTA 2BDPA 4N7TA 1WKJA 1KQFB 3DLBA 1NU4A 1GXTA 3K59A 5LQQA 3MPWA 2GAGC 1YRXA 1D3WA 3SCLE 4RBTA 4DHVA 3A8EA 1C4AA 1C2PA 4UOPA 3H5SA 3QJJA 2GA7A 3C19A 3U02A 4KO0B 4FP9A 3LWLA 4FXVA 4JV0A 3N4WA 1FEEA 4DFKA 1Q53A 1RTHB 3BGRB 1TKZB 2DGOA 1UMJA 5K14B 2GS8A 1NH8A 3MPVA 3PNIA 1C0TA 5D3GA 2C3OA 3PRBA 2QGFB 2P6SA 1VI7A 2IC3A 3F44A 3VTIA 3ELHA 2BUNA 3CC2S 4P10A 5H9EK 4PWDA 2AX0A 3B82A 3J7Z5 1U1OA 1DARA 3TNVA 2OELA 2E1MC 4KAIA 2QLJB 3LP1A 1VQSA 4I1TA 5D4LA 3BJYA 2R8GA 3AFGA 1J2VA 3R7NB 2KJVA 2PT0A 3PV8A 2L3MA 1R3NA 2VJVA 3PDNA 4Y6IA 5FIIA 5J1EA 2GJFA 3V2UC 2ZKUA 2FJAB 3QGIA 3AD9C 3OL7A 3KLVA 2CQPA 2DVIA 3G8QA 4EYIB 2MQPA 1UW4A 2KDOA 4FVCA 4NPOA 1TL5A 1SQGA 3JQKA 5AXNA 4P71A 2D74B 1LWEA 3LQVA 3DHWC 4PG7A 1PGZA 1YJUA 5L39A 4ZJOA 1RAHB 3W1YC 2LECA 4YR1A 1ZPVA 4P74A 1LXNA 5CZXA 1VQYA 3HJVA 3ISND 1U24A 3M2RA 4YR0A 4DUZJ 2JEJA 3DLJA 3ILIA 3R6GB 3B5QA 5SUHA 1GX5A 3ENVA 4F4YA 4HYKA 3DXSX 3R7BB 3OT9A 3GG1A 2XS7A 2D69A 4WZQA 2ZJRQ 4B9MA 3DRRA 4ZLJA 3H0PA 3L7OA 4B9UA 2L08A 3JSMB 2LYVA 5E2QA 2DNQA 2XLIA 4ID5B 3UD3P 3H2UB 2MQNA 3R2CJ 4C6AA 5D8HB 2M4MA 3DGPA 5EUHA 2RB7A 2GVZB 1VS3A 4PWWA 3KJFB 1R6YA 3KG0A 3DOKB 4QR1A 2GJIA 5DJBA 3PJ9A 3DC2A 2VF3A 2Z2ZA 1S48A 2MQ8A 3HZGA 1D0EA 5ETTA 3KLIA 2X98A 2EBEA 4K4ZA 2YTCA 2DNNA 1BQXA 1RT5B 4HACA 2Y3YA 1X5TA 3PACA 1U09A 1JLFB 3DI6A 3NGSA 1F6TA 4X84A 3ITHB 3E01B 3GIRA 5IQ6A 2HFZA 3LPEA 1M0SA 4XAKA 3G6XA 1VMBA 3I31A 1S1UA 2CPEA 2CQHA 1EHWA 2W24A 2MJUA 1F9FA 2P9CA 1SBRA 4NLRA 3HD1A 4LF2A 2EK6A 2HRYA 4O44A 3US5A 5ETOA 4LUBA 2J7KA 2JEGA 2KKHA 2IUCB 4A8FA 3OHBA 1CS4A 1ANJA 1Q16B 4PR6A 4DUTA 4OX8A 3ET6A 1X0FA 4B9NA 1D09B 5FDLA 5CAAA 4LBHA 5IV4A 2DR5A 2AD9A 4ZMMA 3FDSA 1RTIB 1YJ9S 1NSKL 1KVJA 2MLXA 5ETPA 2VD3A 3WAYA 1UEVA 2W8DA 3LF0A 3S01A 5H9FK 2I0XA 4OMFG 4YP3A 3Q0AA 2DHHA 3BGLA 3HHLD 4C11B 4G65A 3NLCA 1QAYA 3IWLA 5DG7A 4PCQA 1N88A 3K5LA 4NCBA 3KJVB 3UDVA 1K1SA 1X4HA 1XERA 5D6GA 2W7AA 5JUMA 2J0QD 4DDFA 2XY5A 3U7JA 2ZUGA 4X4PA 4QYZJ 2BE7D 1IKXA 2LDIA 2ZBCA 2GNKA 2DNKA 4JB8B 3HVTA 3EZ5A 5K8NA 3BV8A 3EVMA 2AJ4A 2OP5A 4K4UA 1CQMA 5F9NA 4UOHA 2D3O1 4UOFA 2W5XA 5HBMB 2H9ZA 4AT1B 2MJNA 2ZKTA 4PEOA 3BGOP 1HHSA 4TYBA 1D9FA 1Q8BA 3ZFVA 5I3QA 3UR3C 2BJEA 4KTQA 1J5OA 1REVA 3ILOA 2CWKA 2V0NA 1HARA 4WKRA 3FBEA 2JLGA 2FIUA 2CQ0A 3RB6A 2DO0A 2MKYA 3TA1A 1A0OB 3W62A 1PAUB 2H65B 2Q1LA 1JJ4A 3OXGA 2C2OB 5KFOA 1X4AA 2BQRA 5KFSA 3M9OB 1QSYA 5GAGU 5HJYA 3RGIA 4G6VB 5M2PA 2DNLA 3Q89A 3HFKA 4RJVA 4DCOB 5K8PA 4BC9A 2F65A 5FJ4A 1PILA 5E3QA 1NK4A 2ALYB 5LSRA 4DV7J 4RU2A 2RKIA 3CCVS 2HHHJ 2IYGA 3BF4A 3UN2A 4DV7F 2HNYB 3GIIA 2HHHF 2E66A 3SV3A 1TR0A 1N36J 3KMSA 1VQ4S 2FDNA 3C6UB 1SC1B 4EZ6A 1IKVB 3J81Y 1U49A 3OTDA 4AE5A 1ZEFA 1OSDA 1TUVA 3WQPA 2WOMA 4DWIA 3KNGA 2X1FA 2W5TA 1CPZA 3M8PB 4LRAA 1KOOA 3H20A 5BYQA 3ENWA 1DTTB 3N6NA 1BC6A 4EZ9A 4Y00A 3DM2B 3AQPA 1WSRA 4V19X 1HHQA 2MMYA 3BB5A 3A52A 4PPZA 2ZZNA 3CF5Q 4C2MA 2HQ3A 2CJYB 1KD1T 4U95A 3HSGA 3OFGA 4NLDA 5KFYA 1UFWA 3R1HA 1VBZA 1K0TA 4P72A 3GILA 4B08A 1Q78A 1S72S 5L1IA 3R97A 3LAKA 2YXLA 4Y28C 3HFZB 1HWIA 2W4DA 4XDCA 2CQ3A 4ETZA 4LREA 3L7UA 1ZM2A 1DJ0A 3MWBA 2DO4A 1TELA 4ECWA 4N76A 2R7WA 1TFYA 2QTWA 1U45A 2QFIA 1IKWA 5LMNJ 3W66A 4OZ2A 4OHZA 4BC7A 5B0DA 3AJDA 4ECZA 3Q8UA 1HI0P 3A3OB 3DOMB 1I6JA 5LMNF 5IWAJ 2Z2MA 3M1VB 2VHGA 3UW1A 1UJ4A 5D4PA 4CLFA 2XTJP 1N56A 4PABA 1Q79A 5ETKA 5IWAF 2CVIA 2G4BA 2BZ2A 4UY8T 4JI4J 1FVSA 4CLLA 1VQNS 1NRKA 4DQPA 4JI4F 3UCZP 5I3UA 2R2SA 4B17A 3I9ZA 2DXDA 2PIIA 2EFGA 2JSXA 3FEZA 3EGVA 2J6UA 3DYCA 3AB2B 1VRUA 2MKCA 5C25A 2M7SA 2M3DA 3G4SS 4ZG9A 2GZOA 2W2NP 5HMWA 4XTTA 3DRSB 3MM9B 1N5SA 3H25A 4YDXA 4J9RA 1RTJA 3CD5A 4CRJA 4A8QA 5CCMA 2J8SA 5T7LA 1X5SA 1EW9A 1PYOB 1YJTA 3I0SA 3NEKA 5D0EA 1HPZA 4PXEA 2ZBIA 2FJEB 2W9BA 2Z30B 3QZ8A 1YX2A 2D3UA 2ZWPA 3C15A 5J2QB 1PBAA 2A1BA 1NHUA 4RPFA 4ECSA 3IG1B 2GCFA 3TVKA 1KHJA 1LK5A 3SCJE 4O3NA 1K73T 3AA9A 2NXCA 4I2QA 3KJNB 4USHA 2MDAA 3RRKA 4F3MA 1LWFA 3PKYA 1SB6A 3EE3A 5HATA 5KG2A 1X5PA 3I5CA 2NUUG 3R3TA 3RRHA 3VVTA 1W2IA 4EBEA 3G2XA 4M5IA 2HWHA 3IMQJ 3PFOA 1SH2A 2HK3A 2QIFA 3QBCA 1SQFA 3UVJB 3QNWB 1N33J 2QMWA 2OHDA 2IMWP 4W92B 3T41A 4I7FB 1NUEA 5D0RA 4O0IA 4ZPBA 3NGKA 4DSFA 3IGYB 4I64A 2HZAA 2AYMA 1S5ZA 4J9PA 4OYZA 4QJVA 4Y65A 4CLTA 2YH1A 2R7TA 3GPAA 2J6SA 3VWSA 4ZVEA 2M8DB 1UZHA 4KRWA 4ITSA 1NSAA 1AROP 2DNPA 4NRTA 5DDQC 3B54A 2CQGA 1NZAA 5K8OA 2FHMA 1W25A 3CULA 4M5DA 5LIAA 3V5RA 1C0TB 3M8QA 5D3GB 4CLUA 4NE9C 4KJDA 1FD8A 3MHYA 2BRKA 5KFPA 1SJFA 1UEUA 3GV8B 3MR3A 4WE1A 1ZPWX 1TKXA 1W26A 2QV6A 2L41A 1S7HA 3C14A 3CO9A 3QSYB 1VBXA 1TMMA 2G1DA 4M5NA 5GADU 3F56A 4ZVHA 3NS7B 1DLOA 1FVQA 1FKAF 3RR7A 2VOPA 4FYXB 4XDDA 1FRJA 1SHQA 3CDUA 4F26A 3OV7A 2VZ9A 5B0EA 3IBWA 5KG1A 2MQMA 2I5JB 2WVEA 5GAGI 2CPFA 2LQJA 1BXNA 4I0WA 1B3TA 3NNCA 5EWEA 4QWCA 3R5DA 3BPSP 4N8OA 4C8MA 1MROA 2MXYA 4OQJA 2N4DA 1ZOTA 4UY85 5K20B 2V4RA 4DX7A 3KLGB 3K8WA 4LSNB 5KT2A 4K8RA 1TKTA 1HNVB 1WD6A 4CO3A 2IRYA 3Q2SC 2QEXS 2FZGB 3MM8B 3M05A 1LWEB 3MR6A 5ETNA 1U1MA 2B5JA 3W8PA 1YVFA 4QR2A 4QIEA 2GMJA 2NUHA 2DH7A 3K5OA 5C24A 2AZ3A 4N77A 2HVDA 2FHKA 4HDHA 1YRTA 1PC4A 2G2OA 1REGX 3M2RB 3W9HA 3OSNA 4H4KA 1P9YA 5E3AA 3MCMA 2MZ1A 3BDGA 1SKRA 1ULRA 5E3PA 3HD2A 3QAUA 3FCVA 1JIHA 3G87A 4YR3A 1GMVA 1OQ6A 2XSJB 2GHWA 4F02A 2B8QA 2VIHA 4MIWA 1FRKA 1NSPA 1NM2A 3ZZTA 2W5RA 2AEJA 3JSRA 3RBXA 2AZ1A 1KWMA 4O3RA 1IM6A 3DGPB 3MXHP 2C2NA 5F8HA 4IR1A 3U1MA 2VG7A 2B51A 1IM4A 4FS2A 3OXFA 4CYUB 1LW2A 4BDPA 1O51A 3FK4A 4HLBA 1HBMA 3BQ2A 1SVDA 1ACMB 2ZH1A 3O8WA 5LRMA 1X4DA 2D41A 3KLIB 3NKOA 1FXRA 4HTIA 5C66A 1PBUA 4HACB 3AQOA 1TK0A 4K0KJ 4WTYA 4CO5A 3MFIA 1R8CA 4K0KF 2K1RA 5KFVA 5AE1A 2DBBA 4DFPA 4MH8A 1YQHA 5EWGA 5F8NA 1YBUA 5BYRA 4FS1A 3T6BA 4QPTA 4ZP8A 2BOAA 1RABB 3HVWA 2B4VA 3ULHA 4KAVA 3SZYA 4YR2A 1SC3B 3IAS9 2AJ1A 4KM4A 1X4EA 2AYEA 2DNGA 1NB7A 1I3OB 4F4XA 5B0FA 3KLEB 3E2DA 3T02A 4P7TA 1QTNB 5KAKA 2KRRA 5HLFA 2Q3PA 1CS4B 2ZM6J 2K06A 4O3SA 2CPHA 2YKNA 4JI3J 3JYTA 2ZM6F 3BR9A 1U1LA 5TJ3A 4P6QA 2V4QA 5FDLB 1CJUA 2MZQA 3CNQP 1TK8A 1WHWA 1WKLA 1F3FA 4E98A 1WC4A 2MYFA 1U8SA 1T05B 1ITPA 1VBKA 1O99A 2XWXA 5DDPC 3CMQA 4WP8A 2FGOA 2HVHA 3I82A 2ASJA 2HHTA 3DLEA 1BLUA 1QVFR 3DLGB 2RU3A 1RWPB 2WB4A 3M4XA 1WHXA 2W5SA 1YITS 3K5NA 1U1KA 2KL8A 4HH0A 4H54A 4CH0S 5B0CA 4DSIA 5KOWA 1WG1A 1YSJA 1HW8A 4JOUA 4A8XA 3PFEA 1L3KA 4LR9A 3IGVA 1QE1A 1T95A 2XHCA 3DCAA 1T9VA 5E0OA 4QIWD 4L72B 2QLWA 3Q8PB 1XTZA 2P2CB 3IGZB 3HVTB 3EPGA 1F2GA 3KTQA 4QYRA 1HNIA 3LWMA 2EG1A 4GRSA 3LP2B 2AT1B 3F41A 4LVOP 3BKTA 1TL4A 2C3UA 4I2PA 4ZIWA 2GIFA 4QPXA 4A8OA 2XLKA 3TX0A 2WCXA 3IWXA 2B0GA 2OIHA 1SC6A 4IOAQ 2M88A 1REVB 4NCAA 1TFWA 3TRGA 4C3MA 1T0TV 4DV0J 2C3PA 4MY4A 1CULA 1BD6A 1U1NA 3NCQA 3NAIA 5T41A 3GJQB 1HNZF 4A8KA 1KFSA 2R7OA 2DH8A 1AW0A 1HI8A 1U0SA 3TZYA 1N6QB 1VLOA 4IDKA 2Y1LB 3RJMB 1QSSA 4OFZA 1NBEB 3HDSA 1Y5IB 1WTFA 2YKPA 3T6JA 5JVGQ 2RKIB 3OTOJ 2L48A 4PAAA 3DOLA 2A6MA 1T8EA 4LQYA 5KFXA 3OTOF 1S77D 2CPDA 3EZUA 2ATCB 4YUDA 7FD1A 3IN5A 4NLXA 3QLHB 3PX6A 4DV2J 3WIVA 1S1TB 4M94A 1AXQA 2Z2LA 4X4QA 2OJ3A 1XNQF 4C8YA 4DV2F 2AJ0A 3FQLA 2RRNA 2U2FA 1Y4ZB 2M9KA 4OI3A 3QATA 3RYLA 4M5LA 3EVWA 2JOQA 4CO4A 2ROPA 1QSLA 2WVFA 1QY7A 2YY3A 5EN1A 1NJIT 1FFSB 3I32A 2Z57B 1U48A 3GFHA 2OPRA 3TUJC 1AJBA 5B7WA 1VISA 1GNKA 4G3IA 1U25A 2CJQA 3QT6A 4WFBQ 4DSLA 3G71S 4M5JA 4KGMA 2HHPA 4RW4A 1R8AA 3OTBA 3HI9A 5ETSA 1PSDA 2CUYA 3G82B 4RO0A 4MAKA 2LQ5A 3FUYA 2IDEA 3PTWA 1AZSA 3CJQA 2J0SD 1RHQB 1HQEA 3CT9A 1R0BG 2GVDB 3QT7A 1WOPA 1BQMB 4HH1A 2KHDA 3AXKA 4K2JA 4GO7X 2MKJA 1GAOA 2H5JB 3B8HA 2VFTA 1U1RA 1FT8A 3I4HX 1FA0A 1TUGB 3H2VE 3FSIA 2M70A 4PKDB 2VFSA 5I3UB 1URBA 3NKQA 2G0IA 2VKRA 4LQ3A 3CD0A 2DTJA 3NKRA 1JK9B 2N82B 4ILLA 4IRDA 2QSFA 2ATLA 3FVYA 1GX6A 2DKOB 3VAJA 1IR2A 1RAOA 1RTJB 4IG0A 4TY9A 2CXEA 3J81U 3WDOA 1E6VA 5T7LB 5J2PA 4EFAC 1RT6B 3OFEA 4TQSA 3UWTA 4UOOA 2M8HA 5CABA 3AOCA 2W9BB 2PA3A 2YWFA 1N5YA 2YNHA 2XSFA 4WIIA 2IAJB 1ZZFA 4NMXA 3KNAA 4WZMA 1SC4B 3GYNA 3GJRB 4UUXA 2VG6A 4PXDA 4I2QB 2BJ3A 1B8JA 4NLOA 1LWFB 3WX8A 4F4KA 2NZ4A 4ZIVA 1JQGA 5L0EA 2W2MP 2ALZA 3N5BA 1HDHA 3HHEA 1C0UB 2H5IB 3R5AA 1F3VA 1OY8A 5HVFA 3ETOA 1S6QA 3GIKA 2HFUA 1LKZA 1YJNS 3DRXA 1C1BA 1S1WA 2YWGA 1HBUA 4A8YA 1CVJA 4WFXA 2KZMA 2E7WA 4OX6A 5KG7A 3BYPA 4MYTA 2I8EA 3E8OA 1DURA 3N01A 1FSUA 1FJ7A 2DHXA 3PCOB 2HZCA 3A8IA 1WI8A 1KQKA 1WC0A 3X1LB 2BX6A 3LGHA 3VAMA 1VC6A 1U0HA 1ZM9A 2FJBB 3CJKA 3L95X 4HHHA 1FFWB 4XO0A 2HFNA 1FDNA 2CJKA 3CJ2A 4JP8A 4J37A 5GMKa 2PFDA 3IS9A 1QUVA 3KHGA 4DS4A 1IR0A 2M0GB 3M8QB 3JTOA 2UVUA 2V5HG 2RE1A 4HDGA 3QZ7A 4WE1B 4WBFA 1TKXB 2AX1A 2LXFA 2DGXA 5AXMA 3C14B 1FHTA 2VV5A 3GIMA 2KI2A 3MK2A 1QM9A 1HYSA 3KK2A 4W98A 1HMVB 3OTEA 3RAMA 1R43A 2BE9B 4JUZA 2QA4S 1DLOB 1N2KA 1RHRB 3W8GA 5HANA 1JNRB 4ED7A 2F7VA 4CH7A 4FPRA 4FYYB 1IUJA 5K5MA 5AE2A 1CJVB 3NKYA 1HQUA 5F8JA 3ENAA 3H5UA 2CPJA 5HN0A 3MUMP 2FJWA 3O3LA 3BSOA 4Q7AA 3POTA 3NS5A 4NYOA 1JWWA 4O4RA 4NX9A 2YPYA 4BWMA 5H9EJ 1JLQB 4QIGA 4DF4A 1XMOJ 1F9EB 3VALA 1TKTB 1TL7A 1HD1A 3MM7A 4BCAA 5G4DA 4UT4A 2IFYA 2MQLA 4WTOB 2GQQA 3NCRA 4X4SA 1SV5B 2FYXA 4CLWA 4H4KC 1RA6A 3KHHA 4OV1A 1RT3A 2DYAA 4LFAJ 2XQCA 1E3CP 5LXRA 4FBUA 2LEAA 3CCTA 2P8IA 3PYFA 1FX2A 1RWOB 2BQ3A 4LFAF 1TP7A 3D9BA 2HHVA 2MY7A 2NS1B 2E9RX 1HR0J 2XZTB 3R8YA 4USVA 1SIZA 4OYWA 2HW3A 2Z56B 1BQNB 4N47A 1HR0F 4KGXB 4J9NA 1TZ0A 4LRCA 4C98A 2VPWB 1OJ4A 3OR2A 3AXMA 2BOPA 1RUSA 1SI9A 1ED8A 1WF2A 5EGEA 3TYTA 2VQRA 5M2UA 1RA7A 2F40A 2AV5A 1JJCB 1RAJA 5LL6d 1WG4A 1UAWA 1H2VZ 1LW2B 5A8KB 2RIJA 5KT7A 1HJKA 2PA8D 1V3ZA 2DHSA 4C0HA 2B9WA 2QYGA 2XS5A 5AXLA 3G6YA 4X4RA 2CYYA 4OHXA 2C3MA 2LKZA 3LA0A 1Y0HA 3CDBA 3ZO7A 4CXKA 3TWZA 3R27A 1PJ7A 5CYQB 1H6KX 2HS4A 2ZOGA 1RHKB 4ZPDA 4GMKA 1LEOA 2WVDA 1OWXA 2EXUA 3LAMA 3MAHA 1Q8LA 5J2NB 1IJFB 2HGNA 4NLQA 4ED4A 3N28A 2YNGA 4C3KA 4TU9A 1EB0A 4AL5A 4GKJJ 2JL9A 3BPDA 4ZPWR 4CT8A 3VR1A 4MT1A 3BSCA 2LXIA 1MSWD 3CGIA 4KSEB 3OFHA 1VQ5S 3N79A 1RZMA 4JV5J 4AXJA 1VQ9S 3V81B 2WW8A 1Q1KA 2POKA 4JV5F 1UVKA 3DNCA 4MFBA 2MKHA 2XMAA 3LXQA 2ROEA 2SXLA 5DZ6A 2RD5C 4F4WA 1CJKA 2KJWA 3BBCA 1VC5A 2RJZA 4JI1J 3K58A 2ZH4A 3LOUA 5HLFB 1AT1B 2H48B 2MY8A 1BUXA 3KHLA 1KR4A 4JI1F 3RUBL 5IV3A 2GAHC 1VLYA 3JQJA 1NK6A 3PYGA 1CJUB 4DJBA 3UCUP 2KYXA 4QWAA 3D68A 4CM2A 3GFYA 2QL9B 2G2YA 5KT6A 2VQEJ 4M5MA 1UFKA 5IC6B 2R7VA 3QJPA 1F5CA 4IYQA 1RWMB 4C7QA 3TG0A 3DLEB 2HHUA 2O5DA 1KRPA 1N5VA 3KLFA 4N5SA 3QFHA 3R7SB 2LDYA 1N34F 2LXUA 2VG5B 2W01A 2XBPA 1S0NA 1UPMB 2RUGA 1PAEX 2DR7A 1URNA 3MAAB 5LSOA 1TAQA 4ID5A 4P9SA 1JMTA 4C0BA 4NLGA 4ZITA 4F2RA 1MMNA 4J7CA 2ILZA 5H9FJ 2MHNA 2ERRA 2OAUA 3SI8A 2R7SA 2VOOA 2B4OA 3HSJA 2XG8A 4Y2AA 2E7XA 3TP2A 2WZ1A 4ILRA 4NEYA 4TXSA 2DRBA 3OL8A 1KH9A 4RX6A 1GMWA 3FCHA 5B09A 2W7PA 5EX3A 2Q6BA 4FDJA 2CQ4A 1W2BR 1GH8A 2F4FA 4NWJA 4X65J 3OXLA 3LPYA 1ZETA 3QPIA 3OSPA 3GYXB 5L0KA 4X65F 1P8GA 4AUKA 1RT5A 4CWBA 3GZ7A 3R5JB 1XIQA 1G3OA 1DQ9A 3F0NA 1CULB 1WC5A 3ZTRA 3ITHA 3M9NB 1KEKA 2HEKA 4DR3J 1M5OC 5KFEA 1QLNA 3FC9A 3GR0A 2DGSA 2B6AA 4DR3F 3J7YU 3VZIA 3CDWA 3NL0A 3CDEA 1IBMJ 3ZZPA 4A47A 4LJMA 2BRLA 2VU5A 4K4VA 5CQGA 5LT5A 1FRMA 3M8SA 1IBMF 1R89A 1TTHB 1U1PA 4MJKA 4RWWA 3V6DB 4DV4F 1EIYB 2QZUA 5E7OB 2IUCA 2DEJA 3NAHA 3Q8YA 4M8LA 3T1AA 1S9GB 1T3NA 4MIVA 2F4VF 4IRCA 1HNXJ 2ZBRA 4I68A 3QGHA 4NL5A 2EC0A 5KFCA 4EEYA 2NZCA 3ZZRA 4QBUA 1NK5A 1HNXF 1HWLA 3TARA 3ZTQA 4ECRA 3CCES 1WHVA 1U4BA 3GU0A 4QWDA 3BS9A 2R3VA 4S0MA 3DDNA 2NPFA 1WACA 4P2FA 1KKHA 2C2ZB 4OYAA 4M63A 4IRKA 1KH5A 3CCSS 3J80Y 5BXIA 2JNJA 5IZHA 2DNMA 3SXLA 3PXGa 3V4MA 1HIYA 4DN0A 3KJVA 1A9NB 3TJ9A 3AH6A 4USKA 4LR7A 3JSYA 3THVA 3NP5A 2JFDA 4RW4B 2ZBQA 4KAYA 1Q81T 5U47A 3RTVA 2JWNA 3TX8A 1ZEDA 1WC1A 1WI6A 4RW6A 4AQYF 2KT3A 3CMRA 4QWBA 1WOOA 4F8RA 5FLXY 2JC1A 4QW9A 1S0VA 4ZP6A 2CJ9A 4NZ7A 2Z8QA 5HMYA 1FRLA 1H7XA 2UXCJ 3QGPA 4F4ZA 1B0TA 3H98A 1MWQA 1NK8A 4QR0A 3MR5A 2UXCF 3LGNA 3CPWR 2YX4A 1NKCA 3P5BP 1S6PB 1VJQA 2C2RA 1S79A 4UQGA 1HWKA 1Y00A 5ETMA 4K7QA 2WONB 3M6XA 1ZYQA 1RAFB 3D67A 3TAPA 5L9XA 3TVYA 5H1SV 3D6FB 3M8YA 3W9JA 1NCLA 3PX0A 4WFZA 1VCTA 1N0VC 3BGUA 2E1PA 4OYOA 1JLGB 2YKAA 2K8GA 4USTA 1FX4A 3KXDA 4W4MA 3IFEA 4JI8J 4YHHF 4DFJA 1YGYA 4DV6J 1APSA 5AJ3J 4KHRA 5DO2A 4JI8F 4EU0A 1EI6A 3BN4A 4RKUC 4Q0BA 1WKKA 4O4GA 5J2PB 4PG8A 4OJGA 4DV6F 4ED3A 4PQUA 5AJ3F 4WPAA 4RNNA 3BQ0A 4ELUA 1CG2A 1FD2A 1ELZA 1N5YB 4LF1A 4WKYA 1X4CA 2LVWA 3C6UA 2K7KA 1IKVA 3TR5A 3NBPB 2ZD1A 5F41A 1PYSB 2YKMB 2O67A 8ATCB 2VG6B 3M8PA 4LIWA 1RB0A 2V50A 5DG9A 1DTTA 2GX8A 2Y1RI 5F3TA 2QT7A 2EEYA 4F67A 5KFWA 1SJQA 1EJJA 5HVGA 2ANHA 2OPQA 2OD6A 4RLEA 3IRXA 4AFFA 2I38A 4FF1A 1C1BB 3GCWP 3SYZA 1HBUB 3C3LA 2FJXA 4RNOA 1JX4A 4HR2A 3VHQA 3QO9B 2LQ9A 4DPXA 1T9WA 1M5VC 1IWGA 2PFFB 4KT0C 4X66J 1F2HA 1UKUA 2OTLS 1U0HB 1ALKA 2YQ0A 3CJKB 2DGWA 3MMJA 2AU0A 4X66F 1FNOA 1KFDA 2CQBA 4RWXA 2F8HA 2I2YA 3H59A 2JEIA 4NA2A 2J9CA 1U47A 1Y7PA 3IS9B 1Y9OA 3ISZA 4C4WA 1KHVA 3RW6A 4DOZA 1N8RT 4D3HA 5C5JA 4RBVA 5C2CA 2BANA 2BA9A 3M7VA 2VPXB 2XZDB 5CYJA 3DOMA 2KXFA 3M1VA 2VA3A 1PJ5A 2YX1A 8AT1B 3CJ0A 2IVMA 2GA3A 3AJ1A 2BV3A 4LSLA 4TY8B 3ADAC 1GTEA 1KSPA 2H4WB 3FZ2A 4K4WA 1S1VB 2V8GA 2EW9A 2HS0A 3SCKE 4UUWA 2UXDJ 4FBTA 4U96A 1NJXA 4RL1A 1HBNA 1HQUB 2UUAJ 2ZH9A 5EWFA 4Y2CA 3EDQB 2WB1D 3AAWB 3TW0A 3HF5A 3BO3A 2UUAF 2HLTA 3POTB 2ASDA 4PZVA 2FLLA 3RRGA 3V6HA 2ZOMA 3CCRS 3THPA 2R7QA 1FEHA 3DRSA 2AQ4A 2E1AA 4EUVA 3TEGA 3DRYA 3O6QA 2YNIA 4ANEA 1HHTP 3VAFA 4IOCQ 1TL7B 2DNOA 3K89A 1ZM4A 2PEHA 4GO5X 1RT3B 5J2QA 4DSKA 2A10A 3IG1A 2XB2D 1KLMB 1T11A 2I6WA 3HKZD 2ZBPA 1FKOB 3VGSA 2BR0A 4ZDNA 3AT1B 3NNHA 4DLEA 3TANA 5F0UA 4WCEQ 4GTYA 4CXUA 1RBOB 4ZVOB 4U9RA 2V94A 3EDRB 1NHKL 1KS2A 1IQZA 3K0JA 3RB0A 4OYPA 5JJBA 4F50A 2GHVC 2XZWA 2P5VA 3G8TA 5A8RA 3EM1A 3OR2B 3CMES 2L9NA 2IA0A 4I7FA 4E0DA 4ZCIA 4Y3CA 3CC7S 3Q8RB 3QRPA 5F8GA 2MQOA 3WAVA 4DR6J 1SUQA 1OPIA 1S57A 2ZHOA 4PRFA 5JMNA 1HBOB 4DR6F 2COLA 2CDQA 2HIYA 5GMDA 4CI0B 2BKOA 4DFMA 4QU7A 3M2VB 4WIQA 4TQRA 5EX0A 4B9SA 4RNMA 1DFDA 3NVLA 4U67Q 1OMSA 3C2PA 1MLAA 2YWHA 2EBGA 3HP6A 3A13A 2FTRA 3NXZA 1WF1A 2YNGB 4LR8A 3ZZUA 3W3SA 4DPWA 3UPFA 1LV5A 3AD8C 2CDRB 2YQ1A 2P9GA 1Q8KA 3L09A 4PG4A 4B3MJ 4ZOSA 5C7PA 2YX7A 4UTGA 4LF6J 1FKPB 1SCJB 3AOAA 4WP9A 2I5JA 4B3MF 3OUYB 4E2FB 2QG9B 3QT5A 2EC2A 3TO8A 1FFGB 4JYAJ 1FDDA 2NCKL 3KOAA 2ZHAA 4IFYB 2WAQD 1S1XA 4MFBB 2W5VA 3MDFA 3MAQA 3ZZ0A 4JYAF 1CJKB 6AT1B 5ADZA 4Z7CA 1YKWA 1JXLA 4WXWA 1X9MA 3CXCR 2BQUA 3RBEA 3HFVA 3KLGA 4LSNA 4UQTA 1HNVA 3HXMA 3JQMA 2CWXA 1KH7A 4DQIA 3MM8A 4IH5A 2HSEB 1JLBA 5DDRC 3OTCA 4I6YA 4RNHA 5K8MA 5KFIA 4DR4J 1VIOA 2FPHX 3SBMA 4ZLNA 4ED8A 3TJAA 4X62J 2X3GA 5KFAA 4G1QB 2R8JA 4DR4F 2QMUB 2GMLA 3S1TA 3RB3A 4X62F 4P2SA 4DR2J 1I5OB 1ZM3A 4NA1A 3KLFB 3NKMA 4NYZA 1C1CA 3PRDA 4DUZF 4DR2F 2AJFE 2PE8A 1B4SA 4ANCA 1X0PA 2VUGA 3DLKB 2XSJA 2O3DA 2QLXA 4CP5A 4U7UD 3R2DJ 4GC7A 4O3OA 3EXYA 5CD4A 5KFNA 4PXCA 2EKNA 4MKVA 2DNZA 2RMLA 5GAEU 2W8SA 4M5KA 2PSZA 4DUYJ 4ES3A 3UO0A 5A8WA 1FO1A 2CQIA 2CA9A 2OPPA 4DUYF 1X4FA 4HI1A 4CYUA 1JLCB 3MOZA 2UXBJ 1KLNA 4ID8A 5ETQA 2AGOA 2UXBF 4NOHA 2A3JA 1M90T 1JJ2R 1YJVA 5RUBA 1RAIB 1XNRJ 4NLVA 2YKQA 5DS7A 1KVIA 3UE2A 5KT5A 4ES1A 2N7YA 1IR1A 4IG3A 3FZBA 4Q8EA 2XRGA 4F25A 3LUYA 2C42A 1RGVA 5IM0B 1CLFA 3RU0A 3TAQA 2B6AB 4B56A 5D4OA 3MK1A 1AB8A 3NS6A 5A2QY 3Q83A 3GLJA 4DZDA 3BDHA 1PJ6A 2MLYA 2WW4A 3TOQA 4DR7J 5KFMA 4DR7F 1V3SA 1Y3KA 4M5GA 4GVLA 2JHEA 3TEHB 3CW2C 2C28A 2HVZA 2KVIA 2BABA 3CEDA 1VGYA 1OPZA 3KLEA 3CIMA 4FDIA 1Q5VA 2V2ZA 2NYHA 1UP1A 2HHSA 5KG0A 4F36A 1S6OA 2DHAA 4C97A 3KDNA 1K0VA 2GIRA 4ZN3A 1RT1A 2NXEA 3MPYA 3OL6A 4OIXA 4K50A 1T05A 2FJDB 3FJ2A 2OKQA 1U26A 4RW8A 4Z2XA 3AB4B 4OI2A 1C4CA 2V8PA 2QC3A 3KLHB 4IFVA 4DX5A 4J90A 3DLGA 2XI3A 3I6PA 1L3SA 2GSOA 1ZAWA 4C8LA 1G7CB 4NA3A 3CB4A 3UN3A 3Q3QA 1DAXA 3A3PB 3R6LB 5LMUJ 2FQQB 1GXLA 4F0MA 3UDCA 2YH0A 2X1AA 2JC0A 3W64A 4U8VA 4YY3J 5LMUF 3UN5A 3C16B 1OSCA 1N5TA 3L7PA 4IQXA 2B4PA 2QA2A 4RW6B 1D9DA 3GCXP 2Y1JA 2DNRA 2GGPB 3LP2A 2MLZA 3ISNC 3KK1A 1WEYA 1S6UA 2EK1A 4LBPA 3EJMA 3K8VA 1VRQC 1RQ0A 2KYZA 3W5XA 1SIWB 2J9EA 5F8MA 2CZ9A 1AJDA 2IM1A 2ZWOA 3MOJB 4U6PA 1R31A 2V63A 4ED2A 4X4OA 3EUNA 1N5QA 2AW0A 4P75A 4CM0A 3M2UB 1EETA 3BEGB 2MZJA 2L9DA 1N6QA 2MGZA 2CAJA 3WX4A 3IXQA 3ED4A 4P52A 2HQIA 2V69A 3OBIA 2AKWB 4OYIA 2BW2A 2RSQA 1FJGJ 2KXHA 3N5FA 3NMRA 4Q8FA 2J9DA 1QJHA 2BJ8A 2RAQA 2CPXA 1Y5LB 1XR6A 2W4CA 1ZH5A 1FJGF 4Q0BB 4O4GB 1RBLA 3H2LA 2C2EA 3T5JA 4PQUB 2FB0A 1P49A 1Z2ZA 1TMJA 2XC9A 3QLHA 5J2MA 3S7RA 1N36F 1RCXB 1N52B 2E5LJ 1NLKL 1S1TA 2BW7A 3B6BA 2HBYB 1SH0A 3VF0B 4Q44A 4MKAA 2PMHA 2B7BB 4QAXA 4YDDB 2ZD1B 2XLJA 4ED0A 2E5LF 3HX9A 1E2SP 3PR4A 1KONA 4WK3A 1RISA 4HI2A 1ALJA 4I56A 1ZS6A 3J80U 1CQNA 3IC1A 1H2TZ 1ALHA 1YBTA 4X4VA 2G0JA 1G4CA 3IBFB 2OSRA 4DR5J 2OPQB 5HO4A 3FFIB 4LIRA 3MK0A 4ZA1A 3IRXB 2PN6A 1SQEA 5L1KA 2CKWA 2PI4A 4DR5F 4ZVQB 3OVAA 3W2VA 1FCAA 2KU7A 3KG1A 4TNOA 4A8SA 1NPPA 2VBYA 2DR9A 2W2PP 4GKKJ 3DMJA 3EICA 1SH3A 2E5JA 2R2UA 3HSDA 5L1LA 3F73A 4YFUA 4KHMA 4GKKF 4L3NA 1NJYA 1S99A 2EFOA 1MN9A 1FNMA 4DV1J 3SV4A 2YQ3A 4K5SA 3G82A 4Q2LA 2DHGA 1UA0A 4ZCLA 3MM5B 2ZZMA 4ECQA 5I3PA 4FNIA 4DV1F 2B4UA 5JXSA 5CHCB 1ZAXA 2GVDA 3G86A 3HSZA 4HHJA 4XPEA 2E1CA 3X3UA 4X4NA 1BQMA 3ZZYA 3PM9A 4EBCA 4B02A 1EAYC 2BANB 4X4TA 3N9UC 1Z4UA 3HJFA 3GSDA 1UW9A 3OD2A 2DY1A 9ATCB 2J0WA 2V67A 4FXDA 4DQQA 2Y8WA 3HHLC 1RHUB 4ZJLA 3PO5A 5HQLA 1XMBA 3TJ8A 2A18A 4LSLB 1T9UA 5E41A 1TAUA 2N3OA 4ECYA 1T9XA 1S59A 1VQKS 4LSZB 3MCNA 3DRPB 3HHLB 4UORA 5I4MA 2U1AA 3GTYX 5MLCV 3T1HJ 2CZ4A 1HBNB 1AUDA 2GO8A 1MNEA 1TK5A 1Q0NA 4IQMA 3T1HF 3IA0A 3K57A 1WEXA 1BY9A 4AL7A 3CDAA 2FHJD 2FZKB 4HHUA 3BKFA 2BE2B 2HYIB 3D6HB 4NLUA 2YNIB 4QOTA 1KBRA 2K2PA 1IBCB 1N0UA 1S7IA 2OPSA 2GQ2A 3C8YA 3BBBA 1RT6A 4MK7A 2W2QP 1YTYA 4BWJA 5G0RB 4B9VA 2BJ7A 1VBYA 2IAJA 2CNNB 1YLXA 3TZXA 3MMAB 4NMLA 1GTHA 1V3RA 4YOEA 1GEHA 2DR6A 2Z2YB 2ZFHA 2CG8A 1RJJA 3ZTOA 4HEA9 1C0UA 2HAFA 1MW7A 3FMWA 3T5LA 3TAMA 4CLSA 2RS8A 1X31C 3SQGB 4DU8A 1QTMA 3TA2A 4FDFA 3OR1B 5A8RB 4NRUA 4YB1P 4CYRA 3HT0A 1N33F 1EW2A 4DX8H 1YK9A 4BHQA 2IM0A 2XCPA 2X3DA 1P9QC 4F3QA 4B3TJ 2A2CA 3UD4P 3BKUA 2N3LA 3A8JA 3PY8A 4QIFA 3VGTA 4DU7A 5E3CA 1SUQB 3ZC4A 3KK3A 4KV8A 3PKMA 4C3LA 2CADA 3ZTSA 2FY1A 2H1YA 3KWMA 2ZDPA 5LOQA 3L9ZA 2B9YA 1NKEA 1EQMA 2V8VA 3CCJS 3WBZA 3MTKA 3DYAB 4WU3A 2PO4A 5DGBA 4P2XA 5KT3A 1TV6B 2OEMA 4V19J 1OIAA 3ENQA 1HMVA 2F63A 1ANIA 2VICA 3MF5A 2F9DA 1VDHA 4J91A 4MHXA 1IN0A 1S10A 1K8AT 1XWLA 2OFHX 3MR7A 2RDJA 1IBKJ 2ZH5A 2RQMA 2ZH3A 1CJVA 2OH2A 4PG5A 1LNQA 5DRKA 3D28A 4KGZB 3SSQA 4L6V3 3M9MB 1IBKF 5KFTA 1S1XB 3HHKA 3R5GA 3G6VA 2CPIA 4EMDA 4UF4A 1RSCA 3MD3A 3DN9A 1U6BA 2Z0GA 1JKHB 1JLQA 2J7WA 3EWGA 2APOA 4M5HA 5DLGA 2VONA 1RP5A 2KTQA 3MECA 2MEWA 1RTZA 1T7PA 1JLBB 1WUUA 3LP0B 1SV5A 1MN7A 1XK8A 4OL8A 1R27B 4ZVGA 1GMWD 1RXOB 3H4DA 1YDLA 2RT3A 3PEHA 1NJWA 4RNFA 4XIUA 3BREA 4ZP9A 4CNZA 4R8UB 4F04B 2K3IA 1Y7AA 4ZP7A 1S49A 1Q86T 1OQ3A 1NMEB 2FHOB 1C1CB 3THTA 3CSKA 2HURA 2QJ3A 3TUPA 2O1PA 3NWRA 1SL2A 4OLPA 3BQ1A 2DNYA 1PIEA 3FSYA 3BR8A 5CH7B 5KFRA 1VQMS 2H54B 4J9QA 4H4MB 1BQNA 4F0KA 1MU2B 2WTFA 2UZAA 1UETA 1NXIA 3FQKA 4EK2A 3JS9A 4CCHA 4WYLA 3MUTP 1X9SA 3PEJA 2DCUB 4H4OA 2J8AA 5IFMA 5A6WA 2IPOB 1R0CB 3AD7C 4Q5VA 2HFOA 5A8WB 4LBIA 4K5RA 2OPPB 1L3VA 1O8BA 3WIUA 3T01A 5B08A 5A8KA 4NLTA 2VC0A 1QDUB 1WF0A 4PYAA 2CG4A 2VODA 3HHNB 2CPYA 3M8RA 2IYIA 3CJ5A 5SZTA 4R5PA 5AJ9A 3M32A 3EGNA 4OHWA 2DCLA 3QIPA 2AP6A 5DLTA 5C2GA 5CYQA 3Q22A 4IG3B 1J5EJ 1GFWB 2ZC4A 4FN5A 2XR9A 3CJ8A 4C9DA 2F9JA 5J2NA 3M30A 4LRBA 3P5TL 4TYAA 5L8RC 1J5EF 3MEKA 1FE0A 4K4TA 2XO7A 2UVVA 1QVGR 1NDKA 5KFLA 2GC8A 1LOUA 3SEOA 4CTAA 2NYIA 2ZE2B 1H98A 3EX7B 4ES2A 4NEZA 4GVBB 3V81A 2NREA 1B0VA 2HQDA 4RUAA 3PYEA 3JTNA 2AGQA 2BVZA 2B43A 1KDNA 4DL7A 1T02A 2RVJA 3I5BA 3BGFA 2RUSA 2YWWA 4BLGA 5D78A 3W63A 1XEZA 2VQFJ 3H42A 1RT1B 2QZ8A 1R7IA 2IRUA 4DG1B 2LQ8A 1NJZA 2QA4G 2VQFF 2YNFA 4JI3F 3MMBA 4N56A 2UP1A 4IH6A 1WOSA 4RW8B 1VHFA 3FSXA 4CH1A 4ICLA 3BBFA 4IFVB 4TN2A 2DY9A 4ZN1A 1FJEB 2YPZA 3VAGA 1VQ6S 2AWZA 2GIQA 2VG5A 4LRDA 2RQKA 4F7VA 4CXSA 1CJTA 3H7HB 3EXCX 2HFVA 1HNWJ 3MAAA 2F1FA 3TQ1A 3DLHA 1NK0A 2W9CB 2DR8A 5IJSA 1HNWF 5CA5A 3NMAA 1FK9A 3I96A 1RHMB 1XBWA 4KBIA 1RT7B 4I69A 3FEYB 4PWUA 1B64A 1RDRA 1VC0A 4OI0A 1ROFA 2LU2A 2MPUA 2HZVA 2EVZA 5B0GA 4FNHA 4NCGA 4NI2B 1Y3JA 3WHIA 1T03A 3S6EA 2GV1A 2R7RA 1RLDA 3KK1B 4UZCA 2HBRB 2HMIB 5EGHA 3CTRA 1RT4B 4TU7A 4KPYA 4CYSA 4RU9A 2WSFC 1X5OA 5A2QU 3Q23A 3D1OA 1N32J 4WFAQ 5KT4A 3B78A 2DT9A 2KG1A 1Q7LB 1TVRA 2KO1A 4DV0F 1N32F 2HNZA 2MKSA 3A12A 5GADI 1EETB 4B3SJ 1M5SA 1VR6A 2XGPA 2OD4A 2MGZB 1XJWB 2AHOB 4B3SF 5HRTA 3MPDA 4L3KA 1ELOA 4FKYA 1XMQJ 2BJ9A 3LANA 4Z37A 4B3RJ 3Q2TC 1OY6A 1XMQF 3D6MB 2DISA 1VQ8S 1O5JA 2RILA 3V6DA 3WC0A 4B3RF 4U7CA 2J5AA 1FJCA 1VYAA 1EKRA 2BJ1A 4KB7A 5DG8A 4ATNA 5J2MB 2QFJA 2ZH2A 4NASA 1DZ5A 2IBKA 1S9GA 1X60A 2LFVA 4YQWA 3CMAS 2RF2A 4LFBJ 2PMZD 2E9ZA 1LK7A 2KM8C 2WSEC 4TU8A 3KG4A 4LFBF 4OYBA 2V4JB 4ELVA 2JRSA 3K17A 2LA4A 1TUWA 2OLWA 2KH9A 4ZPTR 2W25A 5J1NA 4FXWA 2ASYA 3EMTA 4NXMJ 1XR5A 1DQAA 2FLNA 1EARA 4ELTA 2KM8B 4USWA 5HMXA 4UOGA 1Q7YT 4NXMF 2DXFA 3SDEA 1T9TA 2XMUA 4JI2J 4WWSA 4FF2A 3W2VB 4WK1A 3M8ZA 5DZ7A 1M5PC 2RNEA 1RWXB 4JI2F 5HROA 2IJFA 4PPDA 1TQLA 3MEDA 1NDLA 3DMJB 4RUHA 4MKYA 5DLVA 2DNHA 4BBYA 4QCLA 2PEBA 3QGGA 3QJLA 2CPZA 2FLPA 3R5CA 2B9EA 1FDBA 4OHYA 1T9YA 3DXBA 4ER8A 2I1RA 1VQ7S 2R8IA 2RQCA 1S9EA 1UTAA 3VAIA 4F2SA 4Q45A 4OX9J 2XULA 5HL7Q 2PD1A 1KC8T 2X7IA 3CD6S 2R2RA 4KKOB 4OX9F 2OTJS 2HHQA 1S6PA 2FGCA 3PYDA 4J5OA 2JVRA 2HGLA 1FRHA 1TL1A 3GE9A 4ANDA 3GQCA 2WONA 4OZ3A 4N41A 4J9MA 2FLOA 1FRIA 3GJTB 3HCXA 1IVZA 1VQPS 3A4TA 2EWHA 3MM6A 4DS5A 1NEEA 1RADB 1NSQA 3NKNA 2WVCA 4FKXA 1E6YA 2D9OA 2VBZA 1IKYB 1JLGA 1SKSA 4P7VA 1T94A 3GR1A 2DRDA 3I56S 4M95A 1OS5A 3IP0A 4UOCA 4P2MA 1UWAA 2OPSB 3BH6B 1YG0A 2KZZA 2P9EA 2NXJA 2AEFA 1V5IB 1LFPA 1SPBP 4HVZA 3VVUA 2M5YA 5HP1B 3PW4A 3NBPA 4TLRA 1YRUA 3NWGA 2YKMA 4TVAB 3PZPA 1XN9A 4TN0A 3MGJA 1FXLA 1B70B 1HKAA 4UZBA 1KTQA 3VV2B 5M2RA 1I1GA 2VH7A 5D0GA 4KHPJ 1CSJA 1OY9A 3VQTA 4ENOA 2XHWA 4IH7A 2ZVSA 2NQPA 3BSAA 3FRYA 4KHPF 2HVEA 2KVQE 3H4BA 1D8YA 3TAMB 4ZG6A 1MWZA 1VRTA 3MZIA 3UD5A 4F3OA 1BGXT 2IM2A 4WFNQ 1WHYA 3NRBA 1JXEA 5CCLA 4RW9B 2W9AA 1B0PA 3QO9A 2V68A 5KG5A 2BJDA 5F3ZA 1EP4B 4ECUA 2HWTA 3M6VA 5D77A 5DLWA 3JSBA 3OLAA 2HWIA 1WDTA 3D5MA 2Y8YA 1RI7A 1U6FA 3KK3B 4KV8B 2J9DE 1B99A 5LM7E 4DSEA 2WSCC 4CO0A 2FVQA 1JLEB 5KG6A 1A7GE 1H73A 1L5UA 4ECVA 3ILLA 1VOMA 1YBAA 3O2IA 5D4NA 5BJRA 1SHNA 4LF7J 3AHPA 2RHQB 4Y34A 4DX6A 2DGTA 1LWCA 3KMQA 4LF7F 4TY8A 4A4JA 1GXUA 3M6UA 4LVNP 1S1VA 3I0RA 3H5XA 4NLSA 8RUCA 4ZKAA 2DRAA 3QAEA 4DR1J 4DPUA 5I42A 2QN6B 4KR0B 3ZTPA 4ECTA 4N8NA 2XM3A 2J0XA 3GIJA 1V9OA 2EG2A 2H51B 3G96A 4DR1F 3B4DA 3EPIA 2HGMA 3IR7B 2FC8A 2WBRA 4FYDA 4NZ0A 4ZLPA 5A76A 2UVRA 2G1HA 1FXDA 5CYMA 5K9FA 4O0NA 2C2MB 5HSPA 1S4FA 4XPCA 3RG6A 4WP3A 5GAHU 4A8WA 2UV8G 1ALIA 4G1IA 2RRBA 2Y0SD 3RZAA 1O0PA 3RAQA 3MECB 1XMOF 2GSUA 3QWPA 1RAAB 2CVEA 2IMOA 2LCWA 1MMDA 3JAMY 2EPIA 2NSCA 4LF4J 4WYWA 2CIMA 4USIA 4ALZA 3FBFA 4KGKA 5KOXA 4LF4F 2KFZA 1KLMA 4AYBD 1RYRA 3EGWB 2NXUA 2W1BA 1FKOA 3T9NA 3HK2A 3FRZA 4QW8A 2HPUA 2HHWA 4ECXA 1N4LA 1NO8A 3NGDA 2HRUA 4K4YA 4YEAA 2FVSA 3ONQA 3D1QA 2AYBA 2F3JA 4L76A 2MTLA 1K47A 3CJRA 3HHDA 3I5AA 2QA1A 1PCAA 4L73A 5LRNA 3K5PA 4H4OB 1RWKB 2B9XA 1DTQB 2DPJA 2BACA 1HQAA 4KH1B 1G2EA 1R8BA 1H3DA 4Z7YA 3A8KA 2ZJPQ 3SIPB 1QD1A 3MFHA 4URGA 3TUIC 1R8HA 1R0AA 1RACB 2V8DA 1HBOA 1UJ5A 2HBQB 4R5PB 1HFEL 3M32B 4OJ3A 1P1TA 3NOGA 1UJ6A 3M2VA 3K7RA 3QIPB 3VAHA 4CO2A 4F4AA 4CIOA 1VIXA 1EQ0A 1Q5YA 2OEJA 2XMVA 2AMCB 4NYPA 3U1LA 1YWXA 1GMUA 3GFZA 1F5BA 3NGTA 4Y0FA 3M30B 5KG3A 5L46A 2DITA 2JJ4D 4FZVA 3SQOP 2R7XA 5HI7A 1U2CA 2JFKA 1A6LA 5DM6Q 3K2YA 4G1PA 1AJAA 2W4PA 2IC3B 4GTZA 4GKJF 2ACYA 4CTAB 3N0VA 1FKPA 5K4PA 1RWNB 4ZHRA 4PWDB 5KFQA 4D3GA 3OUYA 4ZPVR 3CCZA 4ZLLA 1FRXA 4IFYA 1P6TA 3LP1B 3QWUA 2DGVA 4ZGAA 5GMEA 1KHNA 2NLWA 5E3RA 4DEZA 1GT8A 4O3QA 1KTVA 3P49B 3CC4S 2UU9J 4ED5A 1B7YB 3BDFA 5J1EB 2E5HA 1ZA1B 2FD2A 5KFFA 2UU9F 2ABYA 3BDPA 3HVRA 2FVCA 2BM0A 1HA1A 4O23A 4DZ6A 3PR5B 4PYDA 2GMHA 2YNFB 3UDEA 1HI1A 3MMBB 2H4YB 4KQZA 3TUZC 1EW8A 3BH7B 1KVKA 4HKQA 4KGVB 4G1QA 1RK8A 4ICLB 1UEKA 2VQEF 1NDPA 3T3FA 3P45B 3JB9k 1ZA2B 3DU6A 4FPIA 3PHEA 4ZCMA 4LQ9A 3DLKA 1FF2A 1CJTB 4PUOA 3PG9A 2FVRA 2R8HA 5GRRA 5HVHA 4EBDA 1GQEA 4K2XA 1IJEB 2KB2A 1ZTWA 3L3CA 3IM8A 3DLLQ 1S4EA 4M1KA 4ERDA 1FK9B 3R5BA 3DRRB 4HL9A 2EFNA 2ADCA 2MZTA 1BE4A 1ED9A 1OYDA 2HK2A 1D9AA 3W61A 2MZSA 2XMTA 1JLCA 1U02A 2FVPA 4ILMA 1NK7A 3TZZA 3OJSA 4NCGB 2HS3A 3CJTA 1T03B 2PDAA 2C2KB 4NLWA 2XMWA 4TLQA 2V6AA 1N48A 3CCUS 5C42A 3N6MA 1F60B 2YVSA 2CNKB 4DF8A 1TVRB 5IT0A 1Z2LA 3D0GE 3IM9A 3M6WA 4YS2A 3N6LA 5IM0A 1P1LA 2HNZB 3GFXA 1NPRA 3QMQA 2LQBA 4XK8C 3DI6B 1UL3A 3IAM9 1P27B 3NCPA 2R42A 3JXOA 3PVXA 2OMLA 3RAXA 4Q43A 3T5HA 3NGUA 1SL1A 4MMOA 1HWJA 5CD4H 1Y5NB 3GYGA 3LH2S 1HD0A 4C8KA 1S1UB 3UQSA 5IXUA 2XY7A 5AE3A 2ZNYA 4FYWB 4EWTA 4JI0J 2VB6A 3EVOA 2KFNA 1KH4A 1S0MA 2FJVA 2RRAA 2R2TA 4JI0F 4CZCA 3KKFA 5EHHA 3SSSA 2UVWA 4O44B 5GAHI 2CNLB 2RF2B 4RBUA 1RBAA 3AY0A 3CO0P 3SSRA 5E33A 1TL3A 2YBVA 4OZ0A 4HT7A 3P6YC 4RW7A 1WDDA 4KE5A 3ET6B 2O01C 4CLKA 1YZ6A 3KLHA 4I4BA 3FGVA 2IJNA 4Q2MA 1L3UA 3GONA 2GO9A 4KFBA 4Y2MA 1WJ9A 2B8PA 2HG4A 3T19A 4ED1A 1UA1A 3VQSA 5F8IA 1S0OA 4L74A 3SDEB 4ZVSB 3IWNC 2E5IA 2LP4A 1RWVB 1QAIA 2AJ2A 1U8WA 3DU5A 4ZPAA 2UV8A 5HROB 4U7UK 4IUFA 3MEDB 2EKYA 3O44A 1WTBA 3CCWA 3QSIA 2C1EB 1G1XA 1UVMA 3L4BC 3KUEA 1U6ZA 3C16A 3TZWA 5HMZA 2HFSA 4OZJA 1SL0A 2A2DA 5ETLA 2ZNZA 1URAA 4CDIA 1FDAA 3E2EA 1IKXB 1S9EB 2GGPA 1RWWB 5IQQA 1SKUB 5IT4A 4WXOA 2IVFB 4KYZA 1QUPA 1O98A 2R8KA 1SJ4P 2G0CA 3MEGA 1S12A 4JV2A 1FNXH 4URQU 2DPIA 5A0YA 4RZRA 4FVMA 1TL1B 1EZZB 3KFWX 1H72C 3ETMA 2B3TB 2OO4A 4RUCA 1J5OB 1DQ8A 3MM6B 1RHJB 4OX7A 1MMLA 3M2UA 1HNZJ 4EO8A 4FYVB 2ASLA 2Q79A 2FZCB 1WC6A 1E6YB 4C8OA 1CC8A 4QIVA 2OI2A 4WFYA 4P73A 2ROGA 2K3KA 4QU6A 2CQ1A 4ZVFA 1WSVA 1NKBA 5CXTA 2KRBA 5GOVA 4KPCA 4DL6A 3OPKA 5B0AA 1D8ZA 2XY6A 3QRQA 1I51B 4YMEA 3P4UB 1RKJA 2MSSA 1KP6A 3MUVP 2XEXA 3T1YJ 4ZK7M 2CJAA 3DDIA 3IRWP 2XO6A 4LMZA 4O3PA 3T1YF 2X1BA 3KHRA 1WG5A 3MTJA 1XNQJ 3KYLA 2JDJA 1O6XA 3QT8A 2JLEA 3D66A 3HO1A 4AD6A 2WOMB 1MG7A 2UUCJ 2RHSB 1UWBA 5LJ5Y 2UUWA 2K7JA 2VFVA 3OHAA 1IQTA 4OHVA 1ZEBA 1B7FA 1CEZA 3FFIA 2UUCF 4IOBA 1BWVA 1M1KT 1VRTB 4QYZK 4DBQA 2VFUA 3V4IA 2ZJQQ 3WC2A 5BYSA 2BKPA 2J7UA 3IR6B 1HL6A 2MSTA 3HM9A 3O5TB 1E33P 1OYEA 4ZCKA 1RT2A 1KQGB 2V2VA 3TVZA 2F8EX 1URRA 3HLUA 3SZ2A 1ICEB 4NZ6A 1U7LA 3QRRA 3A1YG 4DL2A 3MM5A 3BZQA 2A6OA 3AJ2A 4K4SA 1DBDA 2KXNB 3J7A1 1SJ3P 1BMQB 2H3EB 5EGYA 1NHVA 2EI5A 2BEFA 2BKNA 3P96A 4NWBA 4CLPA 1WWHA 4MKBA 1UPPA 3MPUB 5HAOA 2XS2A 4JI5J 2LEBA 4A48A 3MEEA 2LLZA 2IRXA 5IS2A 5L0BA 2DGUA 4C48A 4EGLA 2IBOA 3ZNUA 1LWCB 1IKWB 2V2KA 2W8KA 1NH7A 4JI5F 3A3NB 2MKKA 1KHLA 3PO4A 2QLBB 2Y0BB 2QO3A 1IWAA 1VJWA 3I0RB 2Z58B 3C46A 2HVIA 2E44A 2G13A 3OVSA 4DL4A 3PW0A 2N4CA 3DFEA 5I42B 3DRPA 3HHLA 1F0XA 1QAXA 2NR0A 2X51A 3J7YI 3MD1A 2VASA 3I87A 2UXDF 2MB0B 3D4JA 2ZOFA 2F8MA 3FCWA 1UVIA 4FF4A 4OYXA 4ZPCA 2RQ4A 4HTJA 1W7WA 4DN9A 2CQDA 3C6TA 5CYMB 4X2BA 3OL9A 2V2QA 2BE2A 4DXLA 4DL3A 3BO4A 3SMZA 2D1CA 3H90A 3HKWA 3JTPA 1VRUB 2R4FA 9RUBA 4QQBA 5C25B 1Y11A 4DLGA 1XR7A 2HKEA 2IFXA 3BSNA 2VPZB 1F5AA 2ZH7A 4J9LA 1JB0C 4OV6A 5G0RA 3RW7A 4ED6A 5B0BA 3MR2A 3TQEA 3RBZA 2J6TA 2RH3A 4I6WA 4LF8J 3MMCA 2GFFA 2V9WA 1H2UX 3W2WA 3AODA 3E3XA 3I0SB 3D1HA 1YI2S 1HPZB 4LF8F 2HQFA 3MMAA 2EFQA 1D1UA 1SJRA 1X4BA 3GJSB 2KT2A 1M5HA 2IJRA 3C15B 4CO1A 2RH6A 1V5VA 2D9PA 3GV7B 5IJQA 2VL1A 2QLFB 1WORA 5IT9Y 4LF5J 3K5MA 5D15A 7AT1B 3V6KA 1BHNA 2Q66A 4JI7J 2VFRA 5IC4B 5EDWA 1QAJA 3D6TB 4LF5F 3CCQS 3GV5B 5MAOA 4QWEA 3SQGA 1X9WA 4JI7F 3OR1A 3J7AN 3EGZA 5J1PA 4USJC 1RLCL 1M1HA 4C8ZA 2DD8S 3RR8A 6FD1A 4B9LA 2X1GA 2M52A 3W60A 4Y2IA 5KFBA 2JLFA 3FBBA 2EFVA 5AT1B 1RTDA 3Q8QB 2QX0A 5HQMA 1PO6A 4IKAA 2BM1A 2IY5B 2XNRA 4WF9Q 1JNZB 4ZJQA 5DM7Q 1R0AB 3T00A 3C66A 4B3OA 3UI3A 2VDHA 2MZRA 2OUGA 2OGUA 2HLUA 2GSNA 2ZH6A 1DY3A 4KJIA 3AA8A 3DYAA 4DL5A 2WHOA 4ZS6A 5KFGA 2KHCA 3H5YA 1TV6A 1LWXA 3B4MA 2E9TA 4M5DB 2PMWA 1LW0A 2AF6A 3CWJA 2HQGA 1UVNA 4LT6A 1NNDA 2D1GA 1X7VA 3W5YA 3NOCA 4UPHA 4AL6A 4ZHRB 3PJWA 4QZVB 2CJXB 1U2RA 2ZITA 3GB0A 4LF6F 2ZDOA 3KD8A 1R6VA 1Q95G 2BMBA 1AA1B 2H5EA 2V34A 3JAMU 1JKHA 2HNDA 3QQCD 1K44A 2KN4A 1G6BA 3MURP 1YJRA 5DDOC 1MROB 3LP0A 5KTQA 1RWUA 4WJBA 4DPYA 3CIZA 3NKPA 3LGMA 2CFXA 2D3ZA 3KDOA 5KFUA 2XMJA 4OYMA 3BDEA 3IDDA 5DQIA 1R8PA 4NWXA 1UFLA 2NXNA 2O66A 2HAIA 1LFWA 2OFGX 3UNGC 4I67A 1RCOB 4R8UA 2B5JB 1KHKA 3D0IE 2HRTA 2QL5B 5C24B 5KFDA 1AFIA 1JLAA 1FI4A 1T3OA 5A6PA 3LALA 1K9MT 2E1RA 2N7CA 1J27A 2NPIA 4PUOB 4KJGA 1RAEB 3CCLS 3BDGB 3IBCB 4H4MA 3CUNA 2QE5A 1M5KC 5HJXA 3T9ZA 1MU2A 1IBLJ 2VA2A 5JVHQ 3EZOA 1VQOS 2HHXA 2BBEA 2JZ5A 4MIBA 1L3TA 1VFJA 3NY0A 4DCPB 4CT9A 1IBLF 1VK8A 2FHJA 1YJ7A 2KG0A 1EKSA 3RB4A 5GVQA 2R9LA 4J9KA 3AOBA 1RKIA 1YZ7A 2DIVA 3OJUA 4OZ5A 3BM7A 1UCNA 1V6HA 4KO0A 4RR5A 2W5QA 5D0HA 3W7BA 2VG7B 3UFCX 4DL0C 5DQGA 1RAGB 3ZXWA 4LR2A 3BO2A 4R0JA 4E8UA 2JH3A 4USMA 2P6TA 1TU0B 5C42B 5INHA 1HBMB 2LU1A 2WK4A 3MCSA 1RTHA 3BGRA 1TKZA 2HBZB 2AEMA 1XNRF 3TA0A 5K14A 4OI6A 3SCIE 4EO6A 3DKDA 4TKTA 5LJ3Y 1EJ7L 3UNYA 2OMOA 3Q8VA 3HULA 3M8WA 2ZE2A 2W5WA 2K1RB 2CJBA 1Q4RA 3DDKA 4GVBA 1ZAVA 4MK8A 4IO1A 1Q8IA 4IO9Q 3P8BB 1NPKA 1LXJA 4PXBA 1Y10A 4MK9A 3WBHA 2WBMA 1UZDA 2DK2A 5DGAA 2CNOB 2ZVIA 3FKBA 2PI5A 1DHMA 2LEPA 3FNNA 1U1QA 4DG1A 1AJCA 4CLYA 1I94J 3LTOA 1CC7A 1TL3B 4L75A 1YJWS 2D3OR 3PW7A 3IR5B 3FEXB 2XMKA 2XYPB 4RW7B 1I94F 2RDDA 2CQ2A 2YKNB 4JI6J 3JYTB 5KFKA 5HQ8A 3G6ES 2Q43A 1XQIA 4KFBB 2C3YA 2ILYA 4JI6F 5ITHA 3V6JA 4YB6A 4A8MP 3CJ3A 3I55S 1Z1ZA 4LF9J 3PX4A 2W2OP 1WEZA 4MTPA 2C22A 3W5ZA 1N34J 5HK4A 2RU9A 4LF9F 2W9CA 3QFWA 1LQ9A 3MCOA 1ZTTA 3QYYA 4DSJA 1FE4A 2KT5A 2VKZG 3RBDA 2DEIA 1RT7A 4DMZA 3JSMA 4YY3F 4YB7A 1HQ2A 1QE1B 4OJHA 3D0HE 1F1BB 1S9FA 4NXNJ 5KG4A 4USUA 2CQCA 3WAXA 1PKUA 3T5KA 1IXKA 2GVZA 4NI2A 4NXNF 1VK3A 3MEGB 1HNIB 3IGNA 2HMIA 2VBWA 3H8YA 4B9TA 4X4UA 4OJ1A 2M2BA 1RT4A 4EYHB 2ZC3A 4EI2A 2C2DA 3DOKA 4X64J 5A0YB 4K59A 4LRFA 3PW2A 4ZVTB 4URSA 1AFJA 4I2PB 3VGVA 4LFCJ 2ADBA 4GC6A 4X64F 3IO1A 2E29A 3GG0A 3OW2R 4FF3A 2AJQA 5L38A 4LFCF 2FUG9 3DPCA 2B7CB 2PGCA 4OI4A 3Q86A 3BYRA 1JLFA 1FWPA 2YKOA 3PHTA 2QSWA 3KUHA 3E01A 1KQSR 4OLOA 1FTRA 3BN7A 1OO0B 4NLPA
chains in the Genus database with same CATH topology
1URAA 4GTXA 4CYSA 2GSOA 4LR7A 3LXQA 1Y7AA 5EGEA 2W5TA 3BDHA 2VQRA 3MK0A 1KHJA 4LRAA 4KAYA 2XR9A 3WAYA 5LRMA 5LIAA 2G9YA 4LRBA 1SHNA 3B5QA 4KJDA 5TJ3A 3UN3A 1ANIA 4UOOA 1EQJA 2W8DA 4TN0A 4UPKA 3Q3QA 1O98A 4UORA 3NKOA 1HJKA 2QZUA 4GTWA 5C66A 3ED4A 4ZG7A 2IUCA 4MHXA 1KH9A 3TX0A 2IFYA 1EI6A 1ALKA 3OT9A 2W5VA 1EW8A 2W8SA 3WBHA 1ZEDA 3CMRA 1O99A 3T00A 1E1ZP 3A52A 3WAXA 4LRDA 4FDJA 4N7TA 2W5QA 4NWJA 4MIVA 3UO0A 3NKPA 2GSNA 3BDGA 4CYRA 3UN5A 1E3CP 4MY4A 1ELZA 4CXSA 1B8JA 1AJCA 3WAVA 4FDIA 4ZG6A 5HRTA 1EW2A 5LQQA 4LR2A 3IDDA 1AUKA 5L0BA 1ELXA 3M8ZA 3NKNA 4NWXA 5L0KA 4CXKA 4UPIA 3TWZA 1SHQA 5INHA 1KHLA 1AJAA 4UOPA 3MK2A 4GTZA 4UPLA 1KH7A 5L0EA 5IJSA 2W5SA 1P49A 2RH6A 3DYCA 3M7VA 4LRFA 1KHKA 1ZEBA 5IJQA 1HDHA 3TG0A 4KAVA 1URBA 5K4PA 5DLVA 3NKQA 3SZYA 3SZZA 5GRRA 1N2KA 2W5RA 1AJBA 3T01A 3NKRA 3UN2A 2IUCB 4ZG9A 5LRNA 3NVLA 5DLWA 2D1GA 4LR9A 3IGYB 4KM4A 1ELYA 4QAXA 5KXAA 2GA3A 3DPCA 1HQAA 4LREA 1N2LA 1EJJA 1ANJA 3UNYA 1E2SP 2GLQA 2ANHA 2W5XA 4UPHA 4ZGAA 1KHNA 1KH5A 4KJGA 3WAWA 1E33P 3BDGB 4LR8A 1ED9A 4LRCA 3M8WA 5GOVA 1EW9A 1FSUA 3E2DA 5AJ9A 1AJDA 3IGZB 3NKMA 1ALJA 3M8YA 2W5WA 2XRGA 1ALIA 4GTYA 3T02A 4CXUA 2ZKTA 4YR1A 1KH4A 1Y6VA 4LQYA 1K7HA 3BDFA 2GSUA 5EGHA 1ALHA 3KD8A 2X98A 1ZEFA 4B56A 3MK1A 5DLTA 1ED8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URA A;  4GTX A;  4CYS A;  2GSO A;  4LR7 A;  3LXQ A;  1Y7A A;  5EGE A;  2W5T A;  3BDH A;  2VQR A;  3MK0 A;  1KHJ A;  4LRA A;  4KAY A;  2XR9 A;  3WAY A;  5LRM A;  5LIA A;  2G9Y A;  4LRB A;  1SHN A;  3B5Q A;  4KJD A;  5TJ3 A;  3UN3 A;  1ANI A;  4UOO A;  1EQJ A;  2W8D A;  4TN0 A;  4UPK A;  3Q3Q A;  1O98 A;  4UOR A;  3NKO A;  1HJK A;  2QZU A;  4GTW A;  5C66 A;  3ED4 A;  4ZG7 A;  2IUC A;  4MHX A;  1KH9 A;  3TX0 A;  2IFY A;  1EI6 A;  1ALK A;  3OT9 A;  2W5V A;  1EW8 A;  2W8S A;  3WBH A;  1ZED A;  3CMR A;  1O99 A;  3T00 A;  1E1Z P;  3A52 A;  3WAX A;  4LRD A;  4FDJ A;  4N7T A;  2W5Q A;  4NWJ A;  4MIV A;  3UO0 A;  3NKP A;  2GSN A;  3BDG A;  4CYR A;  3UN5 A;  1E3C P;  4MY4 A;  1ELZ A;  4CXS A;  1B8J A;  1AJC A;  3WAV A;  4FDI A;  4ZG6 A;  5HRT A;  1EW2 A;  5LQQ A;  4LR2 A;  3IDD A;  1AUK A;  5L0B A;  1ELX A;  3M8Z A;  3NKN A;  4NWX A;  5L0K A;  4CXK A;  4UPI A;  3TWZ A;  1SHQ A;  5INH A;  1KHL A;  1AJA A;  4UOP A;  3MK2 A;  4GTZ A;  4UPL A;  1KH7 A;  5L0E A;  5IJS A;  2W5S A;  1P49 A;  2RH6 A;  3DYC A;  3M7V A;  4LRF A;  1KHK A;  1ZEB A;  5IJQ A;  1HDH A;  3TG0 A;  4KAV A;  1URB A;  5K4P A;  5DLV A;  3NKQ A;  3SZY A;  3SZZ A;  5GRR A;  1N2K A;  2W5R A;  1AJB A;  3T01 A;  3NKR A;  3UN2 A;  2IUC B;  4ZG9 A;  5LRN A;  3NVL A;  5DLW A;  2D1G A;  4LR9 A;  3IGY B;  4KM4 A;  1ELY A;  4QAX A;  5KXA A;  2GA3 A;  3DPC A;  1HQA A;  4LRE A;  1N2L A;  1EJJ A;  1ANJ A;  3UNY A;  1E2S P;  2GLQ A;  2ANH A;  2W5X A;  4UPH A;  4ZGA A;  1KHN A;  1KH5 A;  4KJG A;  3WAW A;  1E33 P;  3BDG B;  4LR8 A;  1ED9 A;  4LRC A;  3M8W A;  5GOV A;  1EW9 A;  1FSU A;  3E2D A;  5AJ9 A;  1AJD A;  3IGZ B;  3NKM A;  1ALJ A;  3M8Y A;  2W5W A;  2XRG A;  1ALI A;  4GTY A;  3T02 A;  4CXU A;  2ZKT A;  4YR1 A;  1KH4 A;  1Y6V A;  4LQY A;  1K7H A;  3BDF A;  2GSU A;  5EGH A;  1ALH A;  3KD8 A;  2X98 A;  1ZEF A;  4B56 A;  3MK1 A;  5DLT A;  1ED8 A; 
#chains in the Genus database with same CATH topology
 2MKI A;  3CD7 A;  3Q8S B;  2YWK A;  3NGR A;  5ETV A;  2FC9 A;  2AGP A;  4BS2 A;  3CVK A;  1H74 A;  4IDK B;  2CRL A;  3VZH A;  4J9V A;  5LSL A;  3QID A;  4HT5 A;  3GSI A;  2RDI A;  4DV4 J;  1HLW A;  1JJH A;  3KUG A;  1FER A;  3DOL B;  4DV3 J;  1KOH A;  3HVA A;  1ELX A;  4V1A k;  2F4V J;  2GHP A;  4DV3 F;  4PQA A;  2RS2 A;  2V4J A;  2G9O A;  3E51 A;  3U1N A;  7FDR A;  1FES A;  1NK9 A;  4OZL A;  3MI7 X;  1ZBT A;  1UWB B;  1ELY A;  5KXA A;  3ZZO A;  2YWE A;  4J9S A;  2BXJ A;  3VAK A;  1H7W A;  1HWU A;  3FBC A;  1N2L A;  2BYC A;  2VJU A;  2GLQ A;  4AXI A;  1KNZ A;  1RTI A;  3WAW A;  3I4P A;  2DH9 A;  3EYZ A;  2QL7 B;  3NNA A;  3PIP Q;  3OFF A;  3GP9 A;  3V4I B;  5DQH A;  2DB1 A;  1RU1 A;  4PG6 A;  4ZVP B;  2ACM A;  4GTX A;  2KFY A;  4DV5 J;  1UVJ A;  3SFG A;  4C11 A;  1RT2 B;  5FLX U;  2OPR B;  4UPK A;  3UDL A;  4DV5 F;  5GAE I;  3CCM S;  1FWL A;  4CQ1 A;  2XMM A;  1X8D A;  1BWE A;  2IA6 A;  4CNY A;  3UCG A;  1S76 D;  2ZEJ A;  4DQR A;  2PC6 A;  2UUT A;  1KHW A;  2GQC A;  4AQY J;  4DI6 A;  1N54 B;  1AUK A;  2IM3 A;  4RUB A;  1AUS L;  1F9H A;  3ILJ A;  2XGQ A;  1AZS B;  4KKO A;  2Z4P A;  1HQE B;  2WVB A;  3MEE B;  5HBM A;  3SZZ A;  4R0E A;  4Y2K A;  2DGQ A;  3G9C A;  1H0H B;  2GJ2 A;  2J76 E;  3R1L A;  4OI1 A;  2W7O A;  2XI2 A;  2FY8 A;  3PRV A;  4OZ1 A;  1MWY A;  2ZH8 A;  4ZVR B;  4CLZ A;  3LW5 C;  3G8S A;  1Y6V A;  5KFH A;  5LXY A;  2QMX A;  1H38 A;  1FWK A;  2HQC A;  1IKY A;  2IVY A;  3FMB A;  4UW2 A;  1NAQ A;  4JV1 A;  3TI0 A;  1EQJ A;  2XWY A;  2LMI A;  1NZ8 A;  5FD1 A;  3C6T B;  3UR0 A;  2XNQ A;  3H40 A;  4YHH J;  3PIO Q;  2OSQ A;  2R7U A;  2IDL A;  4NLY A;  2UUB J;  5F8L A;  1HW9 A;  3W9I A;  3GWC A;  2EFP A;  2UUB F;  4MYU A;  4IG0 B;  2B56 A;  5CZV A;  3OQ2 A;  3MMC B;  1E6V B;  2HNY A;  4DPO A;  5HP1 A;  4UPL A;  3WZ0 A;  3W2W B;  4KIA A;  1AYE A;  1SXL A;  1GK8 A;  1M1G A;  3PW5 A;  2HIQ A;  3HMJ G;  3KJQ B;  2YNH B;  2NSB A;  1VHI A;  3NG8 A;  1S97 A;  3D3B J;  2DJW A;  3D3C J;  1VQL S;  3Q24 A;  3SFU A;  6FDR A;  4W90 B;  4OZN A;  4ZVU B;  1X4G A;  3DM2 A;  3OLB A;  5F9L A;  2CZV C;  5F0W A;  4I6A A;  4KC5 A;  2JVO A;  1K1Q A;  4RW9 A;  3HT3 A;  4DPT A;  1UVL A;  1EP4 A;  2Y9H A;  3ICL A;  2W8L A;  1S6Q B;  1WEL A;  1TKD A;  4J9U E;  1S1W B;  4KH0 B;  1Q82 T;  2E7V A;  2F5G A;  4A46 A;  5BR8 J;  1RTD B;  3GMG A;  2VC1 A;  2AIR B;  5E5N A;  3DHX A;  5DLF A;  4B3T F;  5BR8 F;  2DXE A;  3J81 j;  1PG5 B;  4YN3 B;  4UPI A;  4K4X A;  5KFJ A;  1JLE A;  4B3O B;  3DGV A;  3CE8 A;  3ZZZ A;  3I9V 9;  3J7Z T;  2IIH A;  4DCJ B;  2JX2 A;  2JEF A;  2QYC A;  5AXK A;  2XYH B;  1KN6 A;  3D2W A;  2VPY B;  2ZHB A;  1LW0 B;  3CJ4 A;  1JXV A;  3LO3 A;  1ZZN A;  1DRZ A;  4C8N A;  4F0H A;  2V9K A;  1YHQ S;  4IR9 A;  1SJ1 A;  3HZE A;  2LA6 A;  4MIA A;  1HYS B;  3KK2 B;  1NDC A;  1FTC A;  4ETX A;  2OEK A;  3S8S A;  2L9W A;  2XYG B;  5L9N A;  5T14 A;  4ZG7 A;  1CBK A;  3D7S B;  3O1L A;  2MQQ A;  1XC9 A;  1SKW A;  2GW8 A;  3HPO A;  4DQS A;  1E1Z P;  5L1J A;  2ZUA A;  2IHR 1;  2D7S A;  3VGU A;  2HND B;  4U8Y A;  5ETR A;  3CJS A;  1PC5 A;  3ZNJ 1;  2G2Z A;  1RU2 A;  2MHE A;  2V8H A;  3D54 A;  3MM9 A;  1U2F A;  2Y1I A;  5DET A;  4WU2 A;  1RYS A;  4J9O A;  5IT9 U;  3MM7 B;  5KFZ A;  3W65 A;  1YIJ S;  2VDI A;  1PYT A;  4JBC A;  2DIU A;  2AYG A;  2A0F B;  2VBX A;  2XCA A;  5IOL A;  5THW A;  1JLA B;  1NB2 A;  3U27 A;  1EX8 A;  3PJX A;  1WNE A;  1K7H A;  2Q6C A;  4C0O C;  3R9L A;  4KY3 A;  3VCD A;  2I9S A;  2G9Y A;  4R25 A;  2QRR A;  3P3D A;  2E5G A;  4GTW A;  2WRM A;  3OVB A;  1RE1 B;  1DTQ A;  1WC3 A;  4YB5 A;  3UVJ A;  2ZZT A;  2BDP A;  4N7T A;  1WKJ A;  1KQF B;  3DLB A;  1NU4 A;  1GXT A;  3K59 A;  5LQQ A;  3MPW A;  2GAG C;  1YRX A;  1D3W A;  3SCL E;  4RBT A;  4DHV A;  3A8E A;  1C4A A;  1C2P A;  4UOP A;  3H5S A;  3QJJ A;  2GA7 A;  3C19 A;  3U02 A;  4KO0 B;  4FP9 A;  3LWL A;  4FXV A;  4JV0 A;  3N4W A;  1FEE A;  4DFK A;  1Q53 A;  1RTH B;  3BGR B;  1TKZ B;  2DGO A;  1UMJ A;  5K14 B;  2GS8 A;  1NH8 A;  3MPV A;  3PNI A;  1C0T A;  5D3G A;  2C3O A;  3PRB A;  2QGF B;  2P6S A;  1VI7 A;  2IC3 A;  3F44 A;  3VTI A;  3ELH A;  2BUN A;  3CC2 S;  4P10 A;  5H9E K;  4PWD A;  2AX0 A;  3B82 A;  3J7Z 5;  1U1O A;  1DAR A;  3TNV A;  2OEL A;  2E1M C;  4KAI A;  2QLJ B;  3LP1 A;  1VQS A;  4I1T A;  5D4L A;  3BJY A;  2R8G A;  3AFG A;  1J2V A;  3R7N B;  2KJV A;  2PT0 A;  3PV8 A;  2L3M A;  1R3N A;  2VJV A;  3PDN A;  4Y6I A;  5FII A;  5J1E A;  2GJF A;  3V2U C;  2ZKU A;  2FJA B;  3QGI A;  3AD9 C;  3OL7 A;  3KLV A;  2CQP A;  2DVI A;  3G8Q A;  4EYI B;  2MQP A;  1UW4 A;  2KDO A;  4FVC A;  4NPO A;  1TL5 A;  1SQG A;  3JQK A;  5AXN A;  4P71 A;  2D74 B;  1LWE A;  3LQV A;  3DHW C;  4PG7 A;  1PGZ A;  1YJU A;  5L39 A;  4ZJO A;  1RAH B;  3W1Y C;  2LEC A;  4YR1 A;  1ZPV A;  4P74 A;  1LXN A;  5CZX A;  1VQY A;  3HJV A;  3ISN D;  1U24 A;  3M2R A;  4YR0 A;  4DUZ J;  2JEJ A;  3DLJ A;  3ILI A;  3R6G B;  3B5Q A;  5SUH A;  1GX5 A;  3ENV A;  4F4Y A;  4HYK A;  3DXS X;  3R7B B;  3OT9 A;  3GG1 A;  2XS7 A;  2D69 A;  4WZQ A;  2ZJR Q;  4B9M A;  3DRR A;  4ZLJ A;  3H0P A;  3L7O A;  4B9U A;  2L08 A;  3JSM B;  2LYV A;  5E2Q A;  2DNQ A;  2XLI A;  4ID5 B;  3UD3 P;  3H2U B;  2MQN A;  3R2C J;  4C6A A;  5D8H B;  2M4M A;  3DGP A;  5EUH A;  2RB7 A;  2GVZ B;  1VS3 A;  4PWW A;  3KJF B;  1R6Y A;  3KG0 A;  3DOK B;  4QR1 A;  2GJI A;  5DJB A;  3PJ9 A;  3DC2 A;  2VF3 A;  2Z2Z A;  1S48 A;  2MQ8 A;  3HZG A;  1D0E A;  5ETT A;  3KLI A;  2X98 A;  2EBE A;  4K4Z A;  2YTC A;  2DNN A;  1BQX A;  1RT5 B;  4HAC A;  2Y3Y A;  1X5T A;  3PAC A;  1U09 A;  1JLF B;  3DI6 A;  3NGS A;  1F6T A;  4X84 A;  3ITH B;  3E01 B;  3GIR A;  5IQ6 A;  2HFZ A;  3LPE A;  1M0S A;  4XAK A;  3G6X A;  1VMB A;  3I31 A;  1S1U A;  2CPE A;  2CQH A;  1EHW A;  2W24 A;  2MJU A;  1F9F A;  2P9C A;  1SBR A;  4NLR A;  3HD1 A;  4LF2 A;  2EK6 A;  2HRY A;  4O44 A;  3US5 A;  5ETO A;  4LUB A;  2J7K A;  2JEG A;  2KKH A;  2IUC B;  4A8F A;  3OHB A;  1CS4 A;  1ANJ A;  1Q16 B;  4PR6 A;  4DUT A;  4OX8 A;  3ET6 A;  1X0F A;  4B9N A;  1D09 B;  5FDL A;  5CAA A;  4LBH A;  5IV4 A;  2DR5 A;  2AD9 A;  4ZMM A;  3FDS A;  1RTI B;  1YJ9 S;  1NSK L;  1KVJ A;  2MLX A;  5ETP A;  2VD3 A;  3WAY A;  1UEV A;  2W8D A;  3LF0 A;  3S01 A;  5H9F K;  2I0X A;  4OMF G;  4YP3 A;  3Q0A A;  2DHH A;  3BGL A;  3HHL D;  4C11 B;  4G65 A;  3NLC A;  1QAY A;  3IWL A;  5DG7 A;  4PCQ A;  1N88 A;  3K5L A;  4NCB A;  3KJV B;  3UDV A;  1K1S A;  1X4H A;  1XER A;  5D6G A;  2W7A A;  5JUM A;  2J0Q D;  4DDF A;  2XY5 A;  3U7J A;  2ZUG A;  4X4P A;  4QYZ J;  2BE7 D;  1IKX A;  2LDI A;  2ZBC A;  2GNK A;  2DNK A;  4JB8 B;  3HVT A;  3EZ5 A;  5K8N A;  3BV8 A;  3EVM A;  2AJ4 A;  2OP5 A;  4K4U A;  1CQM A;  5F9N A;  4UOH A;  2D3O 1;  4UOF A;  2W5X A;  5HBM B;  2H9Z A;  4AT1 B;  2MJN A;  2ZKT A;  4PEO A;  3BGO P;  1HHS A;  4TYB A;  1D9F A;  1Q8B A;  3ZFV A;  5I3Q A;  3UR3 C;  2BJE A;  4KTQ A;  1J5O A;  1REV A;  3ILO A;  2CWK A;  2V0N A;  1HAR A;  4WKR A;  3FBE A;  2JLG A;  2FIU A;  2CQ0 A;  3RB6 A;  2DO0 A;  2MKY A;  3TA1 A;  1A0O B;  3W62 A;  1PAU B;  2H65 B;  2Q1L A;  1JJ4 A;  3OXG A;  2C2O B;  5KFO A;  1X4A A;  2BQR A;  5KFS A;  3M9O B;  1QSY A;  5GAG U;  5HJY A;  3RGI A;  4G6V B;  5M2P A;  2DNL A;  3Q89 A;  3HFK A;  4RJV A;  4DCO B;  5K8P A;  4BC9 A;  2F65 A;  5FJ4 A;  1PIL A;  5E3Q A;  1NK4 A;  2ALY B;  5LSR A;  4DV7 J;  4RU2 A;  2RKI A;  3CCV S;  2HHH J;  2IYG A;  3BF4 A;  3UN2 A;  4DV7 F;  2HNY B;  3GII A;  2HHH F;  2E66 A;  3SV3 A;  1TR0 A;  1N36 J;  3KMS A;  1VQ4 S;  2FDN A;  3C6U B;  1SC1 B;  4EZ6 A;  1IKV B;  3J81 Y;  1U49 A;  3OTD A;  4AE5 A;  1ZEF A;  1OSD A;  1TUV A;  3WQP A;  2WOM A;  4DWI A;  3KNG A;  2X1F A;  2W5T A;  1CPZ A;  3M8P B;  4LRA A;  1KOO A;  3H20 A;  5BYQ A;  3ENW A;  1DTT B;  3N6N A;  1BC6 A;  4EZ9 A;  4Y00 A;  3DM2 B;  3AQP A;  1WSR A;  4V19 X;  1HHQ A;  2MMY A;  3BB5 A;  3A52 A;  4PPZ A;  2ZZN A;  3CF5 Q;  4C2M A;  2HQ3 A;  2CJY B;  1KD1 T;  4U95 A;  3HSG A;  3OFG A;  4NLD A;  5KFY A;  1UFW A;  3R1H A;  1VBZ A;  1K0T A;  4P72 A;  3GIL A;  4B08 A;  1Q78 A;  1S72 S;  5L1I A;  3R97 A;  3LAK A;  2YXL A;  4Y28 C;  3HFZ B;  1HWI A;  2W4D A;  4XDC A;  2CQ3 A;  4ETZ A;  4LRE A;  3L7U A;  1ZM2 A;  1DJ0 A;  3MWB A;  2DO4 A;  1TEL A;  4ECW A;  4N76 A;  2R7W A;  1TFY A;  2QTW A;  1U45 A;  2QFI A;  1IKW A;  5LMN J;  3W66 A;  4OZ2 A;  4OHZ A;  4BC7 A;  5B0D A;  3AJD A;  4ECZ A;  3Q8U A;  1HI0 P;  3A3O B;  3DOM B;  1I6J A;  5LMN F;  5IWA J;  2Z2M A;  3M1V B;  2VHG A;  3UW1 A;  1UJ4 A;  5D4P A;  4CLF A;  2XTJ P;  1N56 A;  4PAB A;  1Q79 A;  5ETK A;  5IWA F;  2CVI A;  2G4B A;  2BZ2 A;  4UY8 T;  4JI4 J;  1FVS A;  4CLL A;  1VQN S;  1NRK A;  4DQP A;  4JI4 F;  3UCZ P;  5I3U A;  2R2S A;  4B17 A;  3I9Z A;  2DXD A;  2PII A;  2EFG A;  2JSX A;  3FEZ A;  3EGV A;  2J6U A;  3DYC A;  3AB2 B;  1VRU A;  2MKC A;  5C25 A;  2M7S A;  2M3D A;  3G4S S;  4ZG9 A;  2GZO A;  2W2N P;  5HMW A;  4XTT A;  3DRS B;  3MM9 B;  1N5S A;  3H25 A;  4YDX A;  4J9R A;  1RTJ A;  3CD5 A;  4CRJ A;  4A8Q A;  5CCM A;  2J8S A;  5T7L A;  1X5S A;  1EW9 A;  1PYO B;  1YJT A;  3I0S A;  3NEK A;  5D0E A;  1HPZ A;  4PXE A;  2ZBI A;  2FJE B;  2W9B A;  2Z30 B;  3QZ8 A;  1YX2 A;  2D3U A;  2ZWP A;  3C15 A;  5J2Q B;  1PBA A;  2A1B A;  1NHU A;  4RPF A;  4ECS A;  3IG1 B;  2GCF A;  3TVK A;  1KHJ A;  1LK5 A;  3SCJ E;  4O3N A;  1K73 T;  3AA9 A;  2NXC A;  4I2Q A;  3KJN B;  4USH A;  2MDA A;  3RRK A;  4F3M A;  1LWF A;  3PKY A;  1SB6 A;  3EE3 A;  5HAT A;  5KG2 A;  1X5P A;  3I5C A;  2NUU G;  3R3T A;  3RRH A;  3VVT A;  1W2I A;  4EBE A;  3G2X A;  4M5I A;  2HWH A;  3IMQ J;  3PFO A;  1SH2 A;  2HK3 A;  2QIF A;  3QBC A;  1SQF A;  3UVJ B;  3QNW B;  1N33 J;  2QMW A;  2OHD A;  2IMW P;  4W92 B;  3T41 A;  4I7F B;  1NUE A;  5D0R A;  4O0I A;  4ZPB A;  3NGK A;  4DSF A;  3IGY B;  4I64 A;  2HZA A;  2AYM A;  1S5Z A;  4J9P A;  4OYZ A;  4QJV A;  4Y65 A;  4CLT A;  2YH1 A;  2R7T A;  3GPA A;  2J6S A;  3VWS A;  4ZVE A;  2M8D B;  1UZH A;  4KRW A;  4ITS A;  1NSA A;  1ARO P;  2DNP A;  4NRT A;  5DDQ C;  3B54 A;  2CQG A;  1NZA A;  5K8O A;  2FHM A;  1W25 A;  3CUL A;  4M5D A;  5LIA A;  3V5R A;  1C0T B;  3M8Q A;  5D3G B;  4CLU A;  4NE9 C;  4KJD A;  1FD8 A;  3MHY A;  2BRK A;  5KFP A;  1SJF A;  1UEU A;  3GV8 B;  3MR3 A;  4WE1 A;  1ZPW X;  1TKX A;  1W26 A;  2QV6 A;  2L41 A;  1S7H A;  3C14 A;  3CO9 A;  3QSY B;  1VBX A;  1TMM A;  2G1D A;  4M5N A;  5GAD U;  3F56 A;  4ZVH A;  3NS7 B;  1DLO A;  1FVQ A;  1FKA F;  3RR7 A;  2VOP A;  4FYX B;  4XDD A;  1FRJ A;  1SHQ A;  3CDU A;  4F26 A;  3OV7 A;  2VZ9 A;  5B0E A;  3IBW A;  5KG1 A;  2MQM A;  2I5J B;  2WVE A;  5GAG I;  2CPF A;  2LQJ A;  1BXN A;  4I0W A;  1B3T A;  3NNC A;  5EWE A;  4QWC A;  3R5D A;  3BPS P;  4N8O A;  4C8M A;  1MRO A;  2MXY A;  4OQJ A;  2N4D A;  1ZOT A;  4UY8 5;  5K20 B;  2V4R A;  4DX7 A;  3KLG B;  3K8W A;  4LSN B;  5KT2 A;  4K8R A;  1TKT A;  1HNV B;  1WD6 A;  4CO3 A;  2IRY A;  3Q2S C;  2QEX S;  2FZG B;  3MM8 B;  3M05 A;  1LWE B;  3MR6 A;  5ETN A;  1U1M A;  2B5J A;  3W8P A;  1YVF A;  4QR2 A;  4QIE A;  2GMJ A;  2NUH A;  2DH7 A;  3K5O A;  5C24 A;  2AZ3 A;  4N77 A;  2HVD A;  2FHK A;  4HDH A;  1YRT A;  1PC4 A;  2G2O A;  1REG X;  3M2R B;  3W9H A;  3OSN A;  4H4K A;  1P9Y A;  5E3A A;  3MCM A;  2MZ1 A;  3BDG A;  1SKR A;  1ULR A;  5E3P A;  3HD2 A;  3QAU A;  3FCV A;  1JIH A;  3G87 A;  4YR3 A;  1GMV A;  1OQ6 A;  2XSJ B;  2GHW A;  4F02 A;  2B8Q A;  2VIH A;  4MIW A;  1FRK A;  1NSP A;  1NM2 A;  3ZZT A;  2W5R A;  2AEJ A;  3JSR A;  3RBX A;  2AZ1 A;  1KWM A;  4O3R A;  1IM6 A;  3DGP B;  3MXH P;  2C2N A;  5F8H A;  4IR1 A;  3U1M A;  2VG7 A;  2B51 A;  1IM4 A;  4FS2 A;  3OXF A;  4CYU B;  1LW2 A;  4BDP A;  1O51 A;  3FK4 A;  4HLB A;  1HBM A;  3BQ2 A;  1SVD A;  1ACM B;  2ZH1 A;  3O8W A;  5LRM A;  1X4D A;  2D41 A;  3KLI B;  3NKO A;  1FXR A;  4HTI A;  5C66 A;  1PBU A;  4HAC B;  3AQO A;  1TK0 A;  4K0K J;  4WTY A;  4CO5 A;  3MFI A;  1R8C A;  4K0K F;  2K1R A;  5KFV A;  5AE1 A;  2DBB A;  4DFP A;  4MH8 A;  1YQH A;  5EWG A;  5F8N A;  1YBU A;  5BYR A;  4FS1 A;  3T6B A;  4QPT A;  4ZP8 A;  2BOA A;  1RAB B;  3HVW A;  2B4V A;  3ULH A;  4KAV A;  3SZY A;  4YR2 A;  1SC3 B;  3IAS 9;  2AJ1 A;  4KM4 A;  1X4E A;  2AYE A;  2DNG A;  1NB7 A;  1I3O B;  4F4X A;  5B0F A;  3KLE B;  3E2D A;  3T02 A;  4P7T A;  1QTN B;  5KAK A;  2KRR A;  5HLF A;  2Q3P A;  1CS4 B;  2ZM6 J;  2K06 A;  4O3S A;  2CPH A;  2YKN A;  4JI3 J;  3JYT A;  2ZM6 F;  3BR9 A;  1U1L A;  5TJ3 A;  4P6Q A;  2V4Q A;  5FDL B;  1CJU A;  2MZQ A;  3CNQ P;  1TK8 A;  1WHW A;  1WKL A;  1F3F A;  4E98 A;  1WC4 A;  2MYF A;  1U8S A;  1T05 B;  1ITP A;  1VBK A;  1O99 A;  2XWX A;  5DDP C;  3CMQ A;  4WP8 A;  2FGO A;  2HVH A;  3I82 A;  2ASJ A;  2HHT A;  3DLE A;  1BLU A;  1QVF R;  3DLG B;  2RU3 A;  1RWP B;  2WB4 A;  3M4X A;  1WHX A;  2W5S A;  1YIT S;  3K5N A;  1U1K A;  2KL8 A;  4HH0 A;  4H54 A;  4CH0 S;  5B0C A;  4DSI A;  5KOW A;  1WG1 A;  1YSJ A;  1HW8 A;  4JOU A;  4A8X A;  3PFE A;  1L3K A;  4LR9 A;  3IGV A;  1QE1 A;  1T95 A;  2XHC A;  3DCA A;  1T9V A;  5E0O A;  4QIW D;  4L72 B;  2QLW A;  3Q8P B;  1XTZ A;  2P2C B;  3IGZ B;  3HVT B;  3EPG A;  1F2G A;  3KTQ A;  4QYR A;  1HNI A;  3LWM A;  2EG1 A;  4GRS A;  3LP2 B;  2AT1 B;  3F41 A;  4LVO P;  3BKT A;  1TL4 A;  2C3U A;  4I2P A;  4ZIW A;  2GIF A;  4QPX A;  4A8O A;  2XLK A;  3TX0 A;  2WCX A;  3IWX A;  2B0G A;  2OIH A;  1SC6 A;  4IOA Q;  2M88 A;  1REV B;  4NCA A;  1TFW A;  3TRG A;  4C3M A;  1T0T V;  4DV0 J;  2C3P A;  4MY4 A;  1CUL A;  1BD6 A;  1U1N A;  3NCQ A;  3NAI A;  5T41 A;  3GJQ B;  1HNZ F;  4A8K A;  1KFS A;  2R7O A;  2DH8 A;  1AW0 A;  1HI8 A;  1U0S A;  3TZY A;  1N6Q B;  1VLO A;  4IDK A;  2Y1L B;  3RJM B;  1QSS A;  4OFZ A;  1NBE B;  3HDS A;  1Y5I B;  1WTF A;  2YKP A;  3T6J A;  5JVG Q;  2RKI B;  3OTO J;  2L48 A;  4PAA A;  3DOL A;  2A6M A;  1T8E A;  4LQY A;  5KFX A;  3OTO F;  1S77 D;  2CPD A;  3EZU A;  2ATC B;  4YUD A;  7FD1 A;  3IN5 A;  4NLX A;  3QLH B;  3PX6 A;  4DV2 J;  3WIV A;  1S1T B;  4M94 A;  1AXQ A;  2Z2L A;  4X4Q A;  2OJ3 A;  1XNQ F;  4C8Y A;  4DV2 F;  2AJ0 A;  3FQL A;  2RRN A;  2U2F A;  1Y4Z B;  2M9K A;  4OI3 A;  3QAT A;  3RYL A;  4M5L A;  3EVW A;  2JOQ A;  4CO4 A;  2ROP A;  1QSL A;  2WVF A;  1QY7 A;  2YY3 A;  5EN1 A;  1NJI T;  1FFS B;  3I32 A;  2Z57 B;  1U48 A;  3GFH A;  2OPR A;  3TUJ C;  1AJB A;  5B7W A;  1VIS A;  1GNK A;  4G3I A;  1U25 A;  2CJQ A;  3QT6 A;  4WFB Q;  4DSL A;  3G71 S;  4M5J A;  4KGM A;  2HHP A;  4RW4 A;  1R8A A;  3OTB A;  3HI9 A;  5ETS A;  1PSD A;  2CUY A;  3G82 B;  4RO0 A;  4MAK A;  2LQ5 A;  3FUY A;  2IDE A;  3PTW A;  1AZS A;  3CJQ A;  2J0S D;  1RHQ B;  1HQE A;  3CT9 A;  1R0B G;  2GVD B;  3QT7 A;  1WOP A;  1BQM B;  4HH1 A;  2KHD A;  3AXK A;  4K2J A;  4GO7 X;  2MKJ A;  1GAO A;  2H5J B;  3B8H A;  2VFT A;  1U1R A;  1FT8 A;  3I4H X;  1FA0 A;  1TUG B;  3H2V E;  3FSI A;  2M70 A;  4PKD B;  2VFS A;  5I3U B;  1URB A;  3NKQ A;  2G0I A;  2VKR A;  4LQ3 A;  3CD0 A;  2DTJ A;  3NKR A;  1JK9 B;  2N82 B;  4ILL A;  4IRD A;  2QSF A;  2ATL A;  3FVY A;  1GX6 A;  2DKO B;  3VAJ A;  1IR2 A;  1RAO A;  1RTJ B;  4IG0 A;  4TY9 A;  2CXE A;  3J81 U;  3WDO A;  1E6V A;  5T7L B;  5J2P A;  4EFA C;  1RT6 B;  3OFE A;  4TQS A;  3UWT A;  4UOO A;  2M8H A;  5CAB A;  3AOC A;  2W9B B;  2PA3 A;  2YWF A;  1N5Y A;  2YNH A;  2XSF A;  4WII A;  2IAJ B;  1ZZF A;  4NMX A;  3KNA A;  4WZM A;  1SC4 B;  3GYN A;  3GJR B;  4UUX A;  2VG6 A;  4PXD A;  4I2Q B;  2BJ3 A;  1B8J A;  4NLO A;  1LWF B;  3WX8 A;  4F4K A;  2NZ4 A;  4ZIV A;  1JQG A;  5L0E A;  2W2M P;  2ALZ A;  3N5B A;  1HDH A;  3HHE A;  1C0U B;  2H5I B;  3R5A A;  1F3V A;  1OY8 A;  5HVF A;  3ETO A;  1S6Q A;  3GIK A;  2HFU A;  1LKZ A;  1YJN S;  3DRX A;  1C1B A;  1S1W A;  2YWG A;  1HBU A;  4A8Y A;  1CVJ A;  4WFX A;  2KZM A;  2E7W A;  4OX6 A;  5KG7 A;  3BYP A;  4MYT A;  2I8E A;  3E8O A;  1DUR A;  3N01 A;  1FSU A;  1FJ7 A;  2DHX A;  3PCO B;  2HZC A;  3A8I A;  1WI8 A;  1KQK A;  1WC0 A;  3X1L B;  2BX6 A;  3LGH A;  3VAM A;  1VC6 A;  1U0H A;  1ZM9 A;  2FJB B;  3CJK A;  3L95 X;  4HHH A;  1FFW B;  4XO0 A;  2HFN A;  1FDN A;  2CJK A;  3CJ2 A;  4JP8 A;  4J37 A;  5GMK a;  2PFD A;  3IS9 A;  1QUV A;  3KHG A;  4DS4 A;  1IR0 A;  2M0G B;  3M8Q B;  3JTO A;  2UVU A;  2V5H G;  2RE1 A;  4HDG A;  3QZ7 A;  4WE1 B;  4WBF A;  1TKX B;  2AX1 A;  2LXF A;  2DGX A;  5AXM A;  3C14 B;  1FHT A;  2VV5 A;  3GIM A;  2KI2 A;  3MK2 A;  1QM9 A;  1HYS A;  3KK2 A;  4W98 A;  1HMV B;  3OTE A;  3RAM A;  1R43 A;  2BE9 B;  4JUZ A;  2QA4 S;  1DLO B;  1N2K A;  1RHR B;  3W8G A;  5HAN A;  1JNR B;  4ED7 A;  2F7V A;  4CH7 A;  4FPR A;  4FYY B;  1IUJ A;  5K5M A;  5AE2 A;  1CJV B;  3NKY A;  1HQU A;  5F8J A;  3ENA A;  3H5U A;  2CPJ A;  5HN0 A;  3MUM P;  2FJW A;  3O3L A;  3BSO A;  4Q7A A;  3POT A;  3NS5 A;  4NYO A;  1JWW A;  4O4R A;  4NX9 A;  2YPY A;  4BWM A;  5H9E J;  1JLQ B;  4QIG A;  4DF4 A;  1XMO J;  1F9E B;  3VAL A;  1TKT B;  1TL7 A;  1HD1 A;  3MM7 A;  4BCA A;  5G4D A;  4UT4 A;  2IFY A;  2MQL A;  4WTO B;  2GQQ A;  3NCR A;  4X4S A;  1SV5 B;  2FYX A;  4CLW A;  4H4K C;  1RA6 A;  3KHH A;  4OV1 A;  1RT3 A;  2DYA A;  4LFA J;  2XQC A;  1E3C P;  5LXR A;  4FBU A;  2LEA A;  3CCT A;  2P8I A;  3PYF A;  1FX2 A;  1RWO B;  2BQ3 A;  4LFA F;  1TP7 A;  3D9B A;  2HHV A;  2MY7 A;  2NS1 B;  2E9R X;  1HR0 J;  2XZT B;  3R8Y A;  4USV A;  1SIZ A;  4OYW A;  2HW3 A;  2Z56 B;  1BQN B;  4N47 A;  1HR0 F;  4KGX B;  4J9N A;  1TZ0 A;  4LRC A;  4C98 A;  2VPW B;  1OJ4 A;  3OR2 A;  3AXM A;  2BOP A;  1RUS A;  1SI9 A;  1ED8 A;  1WF2 A;  5EGE A;  3TYT A;  2VQR A;  5M2U A;  1RA7 A;  2F40 A;  2AV5 A;  1JJC B;  1RAJ A;  5LL6 d;  1WG4 A;  1UAW A;  1H2V Z;  1LW2 B;  5A8K B;  2RIJ A;  5KT7 A;  1HJK A;  2PA8 D;  1V3Z A;  2DHS A;  4C0H A;  2B9W A;  2QYG A;  2XS5 A;  5AXL A;  3G6Y A;  4X4R A;  2CYY A;  4OHX A;  2C3M A;  2LKZ A;  3LA0 A;  1Y0H A;  3CDB A;  3ZO7 A;  4CXK A;  3TWZ A;  3R27 A;  1PJ7 A;  5CYQ B;  1H6K X;  2HS4 A;  2ZOG A;  1RHK B;  4ZPD A;  4GMK A;  1LEO A;  2WVD A;  1OWX A;  2EXU A;  3LAM A;  3MAH A;  1Q8L A;  5J2N B;  1IJF B;  2HGN A;  4NLQ A;  4ED4 A;  3N28 A;  2YNG A;  4C3K A;  4TU9 A;  1EB0 A;  4AL5 A;  4GKJ J;  2JL9 A;  3BPD A;  4ZPW R;  4CT8 A;  3VR1 A;  4MT1 A;  3BSC A;  2LXI A;  1MSW D;  3CGI A;  4KSE B;  3OFH A;  1VQ5 S;  3N79 A;  1RZM A;  4JV5 J;  4AXJ A;  1VQ9 S;  3V81 B;  2WW8 A;  1Q1K A;  2POK A;  4JV5 F;  1UVK A;  3DNC A;  4MFB A;  2MKH A;  2XMA A;  3LXQ A;  2ROE A;  2SXL A;  5DZ6 A;  2RD5 C;  4F4W A;  1CJK A;  2KJW A;  3BBC A;  1VC5 A;  2RJZ A;  4JI1 J;  3K58 A;  2ZH4 A;  3LOU A;  5HLF B;  1AT1 B;  2H48 B;  2MY8 A;  1BUX A;  3KHL A;  1KR4 A;  4JI1 F;  3RUB L;  5IV3 A;  2GAH C;  1VLY A;  3JQJ A;  1NK6 A;  3PYG A;  1CJU B;  4DJB A;  3UCU P;  2KYX A;  4QWA A;  3D68 A;  4CM2 A;  3GFY A;  2QL9 B;  2G2Y A;  5KT6 A;  2VQE J;  4M5M A;  1UFK A;  5IC6 B;  2R7V A;  3QJP A;  1F5C A;  4IYQ A;  1RWM B;  4C7Q A;  3TG0 A;  3DLE B;  2HHU A;  2O5D A;  1KRP A;  1N5V A;  3KLF A;  4N5S A;  3QFH A;  3R7S B;  2LDY A;  1N34 F;  2LXU A;  2VG5 B;  2W01 A;  2XBP A;  1S0N A;  1UPM B;  2RUG A;  1PAE X;  2DR7 A;  1URN A;  3MAA B;  5LSO A;  1TAQ A;  4ID5 A;  4P9S A;  1JMT A;  4C0B A;  4NLG A;  4ZIT A;  4F2R A;  1MMN A;  4J7C A;  2ILZ A;  5H9F J;  2MHN A;  2ERR A;  2OAU A;  3SI8 A;  2R7S A;  2VOO A;  2B4O A;  3HSJ A;  2XG8 A;  4Y2A A;  2E7X A;  3TP2 A;  2WZ1 A;  4ILR A;  4NEY A;  4TXS A;  2DRB A;  3OL8 A;  1KH9 A;  4RX6 A;  1GMW A;  3FCH A;  5B09 A;  2W7P A;  5EX3 A;  2Q6B A;  4FDJ A;  2CQ4 A;  1W2B R;  1GH8 A;  2F4F A;  4NWJ A;  4X65 J;  3OXL A;  3LPY A;  1ZET A;  3QPI A;  3OSP A;  3GYX B;  5L0K A;  4X65 F;  1P8G A;  4AUK A;  1RT5 A;  4CWB A;  3GZ7 A;  3R5J B;  1XIQ A;  1G3O A;  1DQ9 A;  3F0N A;  1CUL B;  1WC5 A;  3ZTR A;  3ITH A;  3M9N B;  1KEK A;  2HEK A;  4DR3 J;  1M5O C;  5KFE A;  1QLN A;  3FC9 A;  3GR0 A;  2DGS A;  2B6A A;  4DR3 F;  3J7Y U;  3VZI A;  3CDW A;  3NL0 A;  3CDE A;  1IBM J;  3ZZP A;  4A47 A;  4LJM A;  2BRL A;  2VU5 A;  4K4V A;  5CQG A;  5LT5 A;  1FRM A;  3M8S A;  1IBM F;  1R89 A;  1TTH B;  1U1P A;  4MJK A;  4RWW A;  3V6D B;  4DV4 F;  1EIY B;  2QZU A;  5E7O B;  2IUC A;  2DEJ A;  3NAH A;  3Q8Y A;  4M8L A;  3T1A A;  1S9G B;  1T3N A;  4MIV A;  2F4V F;  4IRC A;  1HNX J;  2ZBR A;  4I68 A;  3QGH A;  4NL5 A;  2EC0 A;  5KFC A;  4EEY A;  2NZC A;  3ZZR A;  4QBU A;  1NK5 A;  1HNX F;  1HWL A;  3TAR A;  3ZTQ A;  4ECR A;  3CCE S;  1WHV A;  1U4B A;  3GU0 A;  4QWD A;  3BS9 A;  2R3V A;  4S0M A;  3DDN A;  2NPF A;  1WAC A;  4P2F A;  1KKH A;  2C2Z B;  4OYA A;  4M63 A;  4IRK A;  1KH5 A;  3CCS S;  3J80 Y;  5BXI A;  2JNJ A;  5IZH A;  2DNM A;  3SXL A;  3PXG a;  3V4M A;  1HIY A;  4DN0 A;  3KJV A;  1A9N B;  3TJ9 A;  3AH6 A;  4USK A;  4LR7 A;  3JSY A;  3THV A;  3NP5 A;  2JFD A;  4RW4 B;  2ZBQ A;  4KAY A;  1Q81 T;  5U47 A;  3RTV A;  2JWN A;  3TX8 A;  1ZED A;  1WC1 A;  1WI6 A;  4RW6 A;  4AQY F;  2KT3 A;  3CMR A;  4QWB A;  1WOO A;  4F8R A;  5FLX Y;  2JC1 A;  4QW9 A;  1S0V A;  4ZP6 A;  2CJ9 A;  4NZ7 A;  2Z8Q A;  5HMY A;  1FRL A;  1H7X A;  2UXC J;  3QGP A;  4F4Z A;  1B0T A;  3H98 A;  1MWQ A;  1NK8 A;  4QR0 A;  3MR5 A;  2UXC F;  3LGN A;  3CPW R;  2YX4 A;  1NKC A;  3P5B P;  1S6P B;  1VJQ A;  2C2R A;  1S79 A;  4UQG A;  1HWK A;  1Y00 A;  5ETM A;  4K7Q A;  2WON B;  3M6X A;  1ZYQ A;  1RAF B;  3D67 A;  3TAP A;  5L9X A;  3TVY A;  5H1S V;  3D6F B;  3M8Y A;  3W9J A;  1NCL A;  3PX0 A;  4WFZ A;  1VCT A;  1N0V C;  3BGU A;  2E1P A;  4OYO A;  1JLG B;  2YKA A;  2K8G A;  4UST A;  1FX4 A;  3KXD A;  4W4M A;  3IFE A;  4JI8 J;  4YHH F;  4DFJ A;  1YGY A;  4DV6 J;  1APS A;  5AJ3 J;  4KHR A;  5DO2 A;  4JI8 F;  4EU0 A;  1EI6 A;  3BN4 A;  4RKU C;  4Q0B A;  1WKK A;  4O4G A;  5J2P B;  4PG8 A;  4OJG A;  4DV6 F;  4ED3 A;  4PQU A;  5AJ3 F;  4WPA A;  4RNN A;  3BQ0 A;  4ELU A;  1CG2 A;  1FD2 A;  1ELZ A;  1N5Y B;  4LF1 A;  4WKY A;  1X4C A;  2LVW A;  3C6U A;  2K7K A;  1IKV A;  3TR5 A;  3NBP B;  2ZD1 A;  5F41 A;  1PYS B;  2YKM B;  2O67 A;  8ATC B;  2VG6 B;  3M8P A;  4LIW A;  1RB0 A;  2V50 A;  5DG9 A;  1DTT A;  2GX8 A;  2Y1R I;  5F3T A;  2QT7 A;  2EEY A;  4F67 A;  5KFW A;  1SJQ A;  1EJJ A;  5HVG A;  2ANH A;  2OPQ A;  2OD6 A;  4RLE A;  3IRX A;  4AFF A;  2I38 A;  4FF1 A;  1C1B B;  3GCW P;  3SYZ A;  1HBU B;  3C3L A;  2FJX A;  4RNO A;  1JX4 A;  4HR2 A;  3VHQ A;  3QO9 B;  2LQ9 A;  4DPX A;  1T9W A;  1M5V C;  1IWG A;  2PFF B;  4KT0 C;  4X66 J;  1F2H A;  1UKU A;  2OTL S;  1U0H B;  1ALK A;  2YQ0 A;  3CJK B;  2DGW A;  3MMJ A;  2AU0 A;  4X66 F;  1FNO A;  1KFD A;  2CQB A;  4RWX A;  2F8H A;  2I2Y A;  3H59 A;  2JEI A;  4NA2 A;  2J9C A;  1U47 A;  1Y7P A;  3IS9 B;  1Y9O A;  3ISZ A;  4C4W A;  1KHV A;  3RW6 A;  4DOZ A;  1N8R T;  4D3H A;  5C5J A;  4RBV A;  5C2C A;  2BAN A;  2BA9 A;  3M7V A;  2VPX B;  2XZD B;  5CYJ A;  3DOM A;  2KXF A;  3M1V A;  2VA3 A;  1PJ5 A;  2YX1 A;  8AT1 B;  3CJ0 A;  2IVM A;  2GA3 A;  3AJ1 A;  2BV3 A;  4LSL A;  4TY8 B;  3ADA C;  1GTE A;  1KSP A;  2H4W B;  3FZ2 A;  4K4W A;  1S1V B;  2V8G A;  2EW9 A;  2HS0 A;  3SCK E;  4UUW A;  2UXD J;  4FBT A;  4U96 A;  1NJX A;  4RL1 A;  1HBN A;  1HQU B;  2UUA J;  2ZH9 A;  5EWF A;  4Y2C A;  3EDQ B;  2WB1 D;  3AAW B;  3TW0 A;  3HF5 A;  3BO3 A;  2UUA F;  2HLT A;  3POT B;  2ASD A;  4PZV A;  2FLL A;  3RRG A;  3V6H A;  2ZOM A;  3CCR S;  3THP A;  2R7Q A;  1FEH A;  3DRS A;  2AQ4 A;  2E1A A;  4EUV A;  3TEG A;  3DRY A;  3O6Q A;  2YNI A;  4ANE A;  1HHT P;  3VAF A;  4IOC Q;  1TL7 B;  2DNO A;  3K89 A;  1ZM4 A;  2PEH A;  4GO5 X;  1RT3 B;  5J2Q A;  4DSK A;  2A10 A;  3IG1 A;  2XB2 D;  1KLM B;  1T11 A;  2I6W A;  3HKZ D;  2ZBP A;  1FKO B;  3VGS A;  2BR0 A;  4ZDN A;  3AT1 B;  3NNH A;  4DLE A;  3TAN A;  5F0U A;  4WCE Q;  4GTY A;  4CXU A;  1RBO B;  4ZVO B;  4U9R A;  2V94 A;  3EDR B;  1NHK L;  1KS2 A;  1IQZ A;  3K0J A;  3RB0 A;  4OYP A;  5JJB A;  4F50 A;  2GHV C;  2XZW A;  2P5V A;  3G8T A;  5A8R A;  3EM1 A;  3OR2 B;  3CME S;  2L9N A;  2IA0 A;  4I7F A;  4E0D A;  4ZCI A;  4Y3C A;  3CC7 S;  3Q8R B;  3QRP A;  5F8G A;  2MQO A;  3WAV A;  4DR6 J;  1SUQ A;  1OPI A;  1S57 A;  2ZHO A;  4PRF A;  5JMN A;  1HBO B;  4DR6 F;  2COL A;  2CDQ A;  2HIY A;  5GMD A;  4CI0 B;  2BKO A;  4DFM A;  4QU7 A;  3M2V B;  4WIQ A;  4TQR A;  5EX0 A;  4B9S A;  4RNM A;  1DFD A;  3NVL A;  4U67 Q;  1OMS A;  3C2P A;  1MLA A;  2YWH A;  2EBG A;  3HP6 A;  3A13 A;  2FTR A;  3NXZ A;  1WF1 A;  2YNG B;  4LR8 A;  3ZZU A;  3W3S A;  4DPW A;  3UPF A;  1LV5 A;  3AD8 C;  2CDR B;  2YQ1 A;  2P9G A;  1Q8K A;  3L09 A;  4PG4 A;  4B3M J;  4ZOS A;  5C7P A;  2YX7 A;  4UTG A;  4LF6 J;  1FKP B;  1SCJ B;  3AOA A;  4WP9 A;  2I5J A;  4B3M F;  3OUY B;  4E2F B;  2QG9 B;  3QT5 A;  2EC2 A;  3TO8 A;  1FFG B;  4JYA J;  1FDD A;  2NCK L;  3KOA A;  2ZHA A;  4IFY B;  2WAQ D;  1S1X A;  4MFB B;  2W5V A;  3MDF A;  3MAQ A;  3ZZ0 A;  4JYA F;  1CJK B;  6AT1 B;  5ADZ A;  4Z7C A;  1YKW A;  1JXL A;  4WXW A;  1X9M A;  3CXC R;  2BQU A;  3RBE A;  3HFV A;  3KLG A;  4LSN A;  4UQT A;  1HNV A;  3HXM A;  3JQM A;  2CWX A;  1KH7 A;  4DQI A;  3MM8 A;  4IH5 A;  2HSE B;  1JLB A;  5DDR C;  3OTC A;  4I6Y A;  4RNH A;  5K8M A;  5KFI A;  4DR4 J;  1VIO A;  2FPH X;  3SBM A;  4ZLN A;  4ED8 A;  3TJA A;  4X62 J;  2X3G A;  5KFA A;  4G1Q B;  2R8J A;  4DR4 F;  2QMU B;  2GML A;  3S1T A;  3RB3 A;  4X62 F;  4P2S A;  4DR2 J;  1I5O B;  1ZM3 A;  4NA1 A;  3KLF B;  3NKM A;  4NYZ A;  1C1C A;  3PRD A;  4DUZ F;  4DR2 F;  2AJF E;  2PE8 A;  1B4S A;  4ANC A;  1X0P A;  2VUG A;  3DLK B;  2XSJ A;  2O3D A;  2QLX A;  4CP5 A;  4U7U D;  3R2D J;  4GC7 A;  4O3O A;  3EXY A;  5CD4 A;  5KFN A;  4PXC A;  2EKN A;  4MKV A;  2DNZ A;  2RML A;  5GAE U;  2W8S A;  4M5K A;  2PSZ A;  4DUY J;  4ES3 A;  3UO0 A;  5A8W A;  1FO1 A;  2CQI A;  2CA9 A;  2OPP A;  4DUY F;  1X4F A;  4HI1 A;  4CYU A;  1JLC B;  3MOZ A;  2UXB J;  1KLN A;  4ID8 A;  5ETQ A;  2AGO A;  2UXB F;  4NOH A;  2A3J A;  1M90 T;  1JJ2 R;  1YJV A;  5RUB A;  1RAI B;  1XNR J;  4NLV A;  2YKQ A;  5DS7 A;  1KVI A;  3UE2 A;  5KT5 A;  4ES1 A;  2N7Y A;  1IR1 A;  4IG3 A;  3FZB A;  4Q8E A;  2XRG A;  4F25 A;  3LUY A;  2C42 A;  1RGV A;  5IM0 B;  1CLF A;  3RU0 A;  3TAQ A;  2B6A B;  4B56 A;  5D4O A;  3MK1 A;  1AB8 A;  3NS6 A;  5A2Q Y;  3Q83 A;  3GLJ A;  4DZD A;  3BDH A;  1PJ6 A;  2MLY A;  2WW4 A;  3TOQ A;  4DR7 J;  5KFM A;  4DR7 F;  1V3S A;  1Y3K A;  4M5G A;  4GVL A;  2JHE A;  3TEH B;  3CW2 C;  2C28 A;  2HVZ A;  2KVI A;  2BAB A;  3CED A;  1VGY A;  1OPZ A;  3KLE A;  3CIM A;  4FDI A;  1Q5V A;  2V2Z A;  2NYH A;  1UP1 A;  2HHS A;  5KG0 A;  4F36 A;  1S6O A;  2DHA A;  4C97 A;  3KDN A;  1K0V A;  2GIR A;  4ZN3 A;  1RT1 A;  2NXE A;  3MPY A;  3OL6 A;  4OIX A;  4K50 A;  1T05 A;  2FJD B;  3FJ2 A;  2OKQ A;  1U26 A;  4RW8 A;  4Z2X A;  3AB4 B;  4OI2 A;  1C4C A;  2V8P A;  2QC3 A;  3KLH B;  4IFV A;  4DX5 A;  4J90 A;  3DLG A;  2XI3 A;  3I6P A;  1L3S A;  2GSO A;  1ZAW A;  4C8L A;  1G7C B;  4NA3 A;  3CB4 A;  3UN3 A;  3Q3Q A;  1DAX A;  3A3P B;  3R6L B;  5LMU J;  2FQQ B;  1GXL A;  4F0M A;  3UDC A;  2YH0 A;  2X1A A;  2JC0 A;  3W64 A;  4U8V A;  4YY3 J;  5LMU F;  3UN5 A;  3C16 B;  1OSC A;  1N5T A;  3L7P A;  4IQX A;  2B4P A;  2QA2 A;  4RW6 B;  1D9D A;  3GCX P;  2Y1J A;  2DNR A;  2GGP B;  3LP2 A;  2MLZ A;  3ISN C;  3KK1 A;  1WEY A;  1S6U A;  2EK1 A;  4LBP A;  3EJM A;  3K8V A;  1VRQ C;  1RQ0 A;  2KYZ A;  3W5X A;  1SIW B;  2J9E A;  5F8M A;  2CZ9 A;  1AJD A;  2IM1 A;  2ZWO A;  3MOJ B;  4U6P A;  1R31 A;  2V63 A;  4ED2 A;  4X4O A;  3EUN A;  1N5Q A;  2AW0 A;  4P75 A;  4CM0 A;  3M2U B;  1EET A;  3BEG B;  2MZJ A;  2L9D A;  1N6Q A;  2MGZ A;  2CAJ A;  3WX4 A;  3IXQ A;  3ED4 A;  4P52 A;  2HQI A;  2V69 A;  3OBI A;  2AKW B;  4OYI A;  2BW2 A;  2RSQ A;  1FJG J;  2KXH A;  3N5F A;  3NMR A;  4Q8F A;  2J9D A;  1QJH A;  2BJ8 A;  2RAQ A;  2CPX A;  1Y5L B;  1XR6 A;  2W4C A;  1ZH5 A;  1FJG F;  4Q0B B;  4O4G B;  1RBL A;  3H2L A;  2C2E A;  3T5J A;  4PQU B;  2FB0 A;  1P49 A;  1Z2Z A;  1TMJ A;  2XC9 A;  3QLH A;  5J2M A;  3S7R A;  1N36 F;  1RCX B;  1N52 B;  2E5L J;  1NLK L;  1S1T A;  2BW7 A;  3B6B A;  2HBY B;  1SH0 A;  3VF0 B;  4Q44 A;  4MKA A;  2PMH A;  2B7B B;  4QAX A;  4YDD B;  2ZD1 B;  2XLJ A;  4ED0 A;  2E5L F;  3HX9 A;  1E2S P;  3PR4 A;  1KON A;  4WK3 A;  1RIS A;  4HI2 A;  1ALJ A;  4I56 A;  1ZS6 A;  3J80 U;  1CQN A;  3IC1 A;  1H2T Z;  1ALH A;  1YBT A;  4X4V A;  2G0J A;  1G4C A;  3IBF B;  2OSR A;  4DR5 J;  2OPQ B;  5HO4 A;  3FFI B;  4LIR A;  3MK0 A;  4ZA1 A;  3IRX B;  2PN6 A;  1SQE A;  5L1K A;  2CKW A;  2PI4 A;  4DR5 F;  4ZVQ B;  3OVA A;  3W2V A;  1FCA A;  2KU7 A;  3KG1 A;  4TNO A;  4A8S A;  1NPP A;  2VBY A;  2DR9 A;  2W2P P;  4GKK J;  3DMJ A;  3EIC A;  1SH3 A;  2E5J A;  2R2U A;  3HSD A;  5L1L A;  3F73 A;  4YFU A;  4KHM A;  4GKK F;  4L3N A;  1NJY A;  1S99 A;  2EFO A;  1MN9 A;  1FNM A;  4DV1 J;  3SV4 A;  2YQ3 A;  4K5S A;  3G82 A;  4Q2L A;  2DHG A;  1UA0 A;  4ZCL A;  3MM5 B;  2ZZM A;  4ECQ A;  5I3P A;  4FNI A;  4DV1 F;  2B4U A;  5JXS A;  5CHC B;  1ZAX A;  2GVD A;  3G86 A;  3HSZ A;  4HHJ A;  4XPE A;  2E1C A;  3X3U A;  4X4N A;  1BQM A;  3ZZY A;  3PM9 A;  4EBC A;  4B02 A;  1EAY C;  2BAN B;  4X4T A;  3N9U C;  1Z4U A;  3HJF A;  3GSD A;  1UW9 A;  3OD2 A;  2DY1 A;  9ATC B;  2J0W A;  2V67 A;  4FXD A;  4DQQ A;  2Y8W A;  3HHL C;  1RHU B;  4ZJL A;  3PO5 A;  5HQL A;  1XMB A;  3TJ8 A;  2A18 A;  4LSL B;  1T9U A;  5E41 A;  1TAU A;  2N3O A;  4ECY A;  1T9X A;  1S59 A;  1VQK S;  4LSZ B;  3MCN A;  3DRP B;  3HHL B;  4UOR A;  5I4M A;  2U1A A;  3GTY X;  5MLC V;  3T1H J;  2CZ4 A;  1HBN B;  1AUD A;  2GO8 A;  1MNE A;  1TK5 A;  1Q0N A;  4IQM A;  3T1H F;  3IA0 A;  3K57 A;  1WEX A;  1BY9 A;  4AL7 A;  3CDA A;  2FHJ D;  2FZK B;  4HHU A;  3BKF A;  2BE2 B;  2HYI B;  3D6H B;  4NLU A;  2YNI B;  4QOT A;  1KBR A;  2K2P A;  1IBC B;  1N0U A;  1S7I A;  2OPS A;  2GQ2 A;  3C8Y A;  3BBB A;  1RT6 A;  4MK7 A;  2W2Q P;  1YTY A;  4BWJ A;  5G0R B;  4B9V A;  2BJ7 A;  1VBY A;  2IAJ A;  2CNN B;  1YLX A;  3TZX A;  3MMA B;  4NML A;  1GTH A;  1V3R A;  4YOE A;  1GEH A;  2DR6 A;  2Z2Y B;  2ZFH A;  2CG8 A;  1RJJ A;  3ZTO A;  4HEA 9;  1C0U A;  2HAF A;  1MW7 A;  3FMW A;  3T5L A;  3TAM A;  4CLS A;  2RS8 A;  1X31 C;  3SQG B;  4DU8 A;  1QTM A;  3TA2 A;  4FDF A;  3OR1 B;  5A8R B;  4NRU A;  4YB1 P;  4CYR A;  3HT0 A;  1N33 F;  1EW2 A;  4DX8 H;  1YK9 A;  4BHQ A;  2IM0 A;  2XCP A;  2X3D A;  1P9Q C;  4F3Q A;  4B3T J;  2A2C A;  3UD4 P;  3BKU A;  2N3L A;  3A8J A;  3PY8 A;  4QIF A;  3VGT A;  4DU7 A;  5E3C A;  1SUQ B;  3ZC4 A;  3KK3 A;  4KV8 A;  3PKM A;  4C3L A;  2CAD A;  3ZTS A;  2FY1 A;  2H1Y A;  3KWM A;  2ZDP A;  5LOQ A;  3L9Z A;  2B9Y A;  1NKE A;  1EQM A;  2V8V A;  3CCJ S;  3WBZ A;  3MTK A;  3DYA B;  4WU3 A;  2PO4 A;  5DGB A;  4P2X A;  5KT3 A;  1TV6 B;  2OEM A;  4V19 J;  1OIA A;  3ENQ A;  1HMV A;  2F63 A;  1ANI A;  2VIC A;  3MF5 A;  2F9D A;  1VDH A;  4J91 A;  4MHX A;  1IN0 A;  1S10 A;  1K8A T;  1XWL A;  2OFH X;  3MR7 A;  2RDJ A;  1IBK J;  2ZH5 A;  2RQM A;  2ZH3 A;  1CJV A;  2OH2 A;  4PG5 A;  1LNQ A;  5DRK A;  3D28 A;  4KGZ B;  3SSQ A;  4L6V 3;  3M9M B;  1IBK F;  5KFT A;  1S1X B;  3HHK A;  3R5G A;  3G6V A;  2CPI A;  4EMD A;  4UF4 A;  1RSC A;  3MD3 A;  3DN9 A;  1U6B A;  2Z0G A;  1JKH B;  1JLQ A;  2J7W A;  3EWG A;  2APO A;  4M5H A;  5DLG A;  2VON A;  1RP5 A;  2KTQ A;  3MEC A;  2MEW A;  1RTZ A;  1T7P A;  1JLB B;  1WUU A;  3LP0 B;  1SV5 A;  1MN7 A;  1XK8 A;  4OL8 A;  1R27 B;  4ZVG A;  1GMW D;  1RXO B;  3H4D A;  1YDL A;  2RT3 A;  3PEH A;  1NJW A;  4RNF A;  4XIU A;  3BRE A;  4ZP9 A;  4CNZ A;  4R8U B;  4F04 B;  2K3I A;  1Y7A A;  4ZP7 A;  1S49 A;  1Q86 T;  1OQ3 A;  1NME B;  2FHO B;  1C1C B;  3THT A;  3CSK A;  2HUR A;  2QJ3 A;  3TUP A;  2O1P A;  3NWR A;  1SL2 A;  4OLP A;  3BQ1 A;  2DNY A;  1PIE A;  3FSY A;  3BR8 A;  5CH7 B;  5KFR A;  1VQM S;  2H54 B;  4J9Q A;  4H4M B;  1BQN A;  4F0K A;  1MU2 B;  2WTF A;  2UZA A;  1UET A;  1NXI A;  3FQK A;  4EK2 A;  3JS9 A;  4CCH A;  4WYL A;  3MUT P;  1X9S A;  3PEJ A;  2DCU B;  4H4O A;  2J8A A;  5IFM A;  5A6W A;  2IPO B;  1R0C B;  3AD7 C;  4Q5V A;  2HFO A;  5A8W B;  4LBI A;  4K5R A;  2OPP B;  1L3V A;  1O8B A;  3WIU A;  3T01 A;  5B08 A;  5A8K A;  4NLT A;  2VC0 A;  1QDU B;  1WF0 A;  4PYA A;  2CG4 A;  2VOD A;  3HHN B;  2CPY A;  3M8R A;  2IYI A;  3CJ5 A;  5SZT A;  4R5P A;  5AJ9 A;  3M32 A;  3EGN A;  4OHW A;  2DCL A;  3QIP A;  2AP6 A;  5DLT A;  5C2G A;  5CYQ A;  3Q22 A;  4IG3 B;  1J5E J;  1GFW B;  2ZC4 A;  4FN5 A;  2XR9 A;  3CJ8 A;  4C9D A;  2F9J A;  5J2N A;  3M30 A;  4LRB A;  3P5T L;  4TYA A;  5L8R C;  1J5E F;  3MEK A;  1FE0 A;  4K4T A;  2XO7 A;  2UVV A;  1QVG R;  1NDK A;  5KFL A;  2GC8 A;  1LOU A;  3SEO A;  4CTA A;  2NYI A;  2ZE2 B;  1H98 A;  3EX7 B;  4ES2 A;  4NEZ A;  4GVB B;  3V81 A;  2NRE A;  1B0V A;  2HQD A;  4RUA A;  3PYE A;  3JTN A;  2AGQ A;  2BVZ A;  2B43 A;  1KDN A;  4DL7 A;  1T02 A;  2RVJ A;  3I5B A;  3BGF A;  2RUS A;  2YWW A;  4BLG A;  5D78 A;  3W63 A;  1XEZ A;  2VQF J;  3H42 A;  1RT1 B;  2QZ8 A;  1R7I A;  2IRU A;  4DG1 B;  2LQ8 A;  1NJZ A;  2QA4 G;  2VQF F;  2YNF A;  4JI3 F;  3MMB A;  4N56 A;  2UP1 A;  4IH6 A;  1WOS A;  4RW8 B;  1VHF A;  3FSX A;  4CH1 A;  4ICL A;  3BBF A;  4IFV B;  4TN2 A;  2DY9 A;  4ZN1 A;  1FJE B;  2YPZ A;  3VAG A;  1VQ6 S;  2AWZ A;  2GIQ A;  2VG5 A;  4LRD A;  2RQK A;  4F7V A;  4CXS A;  1CJT A;  3H7H B;  3EXC X;  2HFV A;  1HNW J;  3MAA A;  2F1F A;  3TQ1 A;  3DLH A;  1NK0 A;  2W9C B;  2DR8 A;  5IJS A;  1HNW F;  5CA5 A;  3NMA A;  1FK9 A;  3I96 A;  1RHM B;  1XBW A;  4KBI A;  1RT7 B;  4I69 A;  3FEY B;  4PWU A;  1B64 A;  1RDR A;  1VC0 A;  4OI0 A;  1ROF A;  2LU2 A;  2MPU A;  2HZV A;  2EVZ A;  5B0G A;  4FNH A;  4NCG A;  4NI2 B;  1Y3J A;  3WHI A;  1T03 A;  3S6E A;  2GV1 A;  2R7R A;  1RLD A;  3KK1 B;  4UZC A;  2HBR B;  2HMI B;  5EGH A;  3CTR A;  1RT4 B;  4TU7 A;  4KPY A;  4CYS A;  4RU9 A;  2WSF C;  1X5O A;  5A2Q U;  3Q23 A;  3D1O A;  1N32 J;  4WFA Q;  5KT4 A;  3B78 A;  2DT9 A;  2KG1 A;  1Q7L B;  1TVR A;  2KO1 A;  4DV0 F;  1N32 F;  2HNZ A;  2MKS A;  3A12 A;  5GAD I;  1EET B;  4B3S J;  1M5S A;  1VR6 A;  2XGP A;  2OD4 A;  2MGZ B;  1XJW B;  2AHO B;  4B3S F;  5HRT A;  3MPD A;  4L3K A;  1ELO A;  4FKY A;  1XMQ J;  2BJ9 A;  3LAN A;  4Z37 A;  4B3R J;  3Q2T C;  1OY6 A;  1XMQ F;  3D6M B;  2DIS A;  1VQ8 S;  1O5J A;  2RIL A;  3V6D A;  3WC0 A;  4B3R F;  4U7C A;  2J5A A;  1FJC A;  1VYA A;  1EKR A;  2BJ1 A;  4KB7 A;  5DG8 A;  4ATN A;  5J2M B;  2QFJ A;  2ZH2 A;  4NAS A;  1DZ5 A;  2IBK A;  1S9G A;  1X60 A;  2LFV A;  4YQW A;  3CMA S;  2RF2 A;  4LFB J;  2PMZ D;  2E9Z A;  1LK7 A;  2KM8 C;  2WSE C;  4TU8 A;  3KG4 A;  4LFB F;  4OYB A;  2V4J B;  4ELV A;  2JRS A;  3K17 A;  2LA4 A;  1TUW A;  2OLW A;  2KH9 A;  4ZPT R;  2W25 A;  5J1N A;  4FXW A;  2ASY A;  3EMT A;  4NXM J;  1XR5 A;  1DQA A;  2FLN A;  1EAR A;  4ELT A;  2KM8 B;  4USW A;  5HMX A;  4UOG A;  1Q7Y T;  4NXM F;  2DXF A;  3SDE A;  1T9T A;  2XMU A;  4JI2 J;  4WWS A;  4FF2 A;  3W2V B;  4WK1 A;  3M8Z A;  5DZ7 A;  1M5P C;  2RNE A;  1RWX B;  4JI2 F;  5HRO A;  2IJF A;  4PPD A;  1TQL A;  3MED A;  1NDL A;  3DMJ B;  4RUH A;  4MKY A;  5DLV A;  2DNH A;  4BBY A;  4QCL A;  2PEB A;  3QGG A;  3QJL A;  2CPZ A;  2FLP A;  3R5C A;  2B9E A;  1FDB A;  4OHY A;  1T9Y A;  3DXB A;  4ER8 A;  2I1R A;  1VQ7 S;  2R8I A;  2RQC A;  1S9E A;  1UTA A;  3VAI A;  4F2S A;  4Q45 A;  4OX9 J;  2XUL A;  5HL7 Q;  2PD1 A;  1KC8 T;  2X7I A;  3CD6 S;  2R2R A;  4KKO B;  4OX9 F;  2OTJ S;  2HHQ A;  1S6P A;  2FGC A;  3PYD A;  4J5O A;  2JVR A;  2HGL A;  1FRH A;  1TL1 A;  3GE9 A;  4AND A;  3GQC A;  2WON A;  4OZ3 A;  4N41 A;  4J9M A;  2FLO A;  1FRI A;  3GJT B;  3HCX A;  1IVZ A;  1VQP S;  3A4T A;  2EWH A;  3MM6 A;  4DS5 A;  1NEE A;  1RAD B;  1NSQ A;  3NKN A;  2WVC A;  4FKX A;  1E6Y A;  2D9O A;  2VBZ A;  1IKY B;  1JLG A;  1SKS A;  4P7V A;  1T94 A;  3GR1 A;  2DRD A;  3I56 S;  4M95 A;  1OS5 A;  3IP0 A;  4UOC A;  4P2M A;  1UWA A;  2OPS B;  3BH6 B;  1YG0 A;  2KZZ A;  2P9E A;  2NXJ A;  2AEF A;  1V5I B;  1LFP A;  1SPB P;  4HVZ A;  3VVU A;  2M5Y A;  5HP1 B;  3PW4 A;  3NBP A;  4TLR A;  1YRU A;  3NWG A;  2YKM A;  4TVA B;  3PZP A;  1XN9 A;  4TN0 A;  3MGJ A;  1FXL A;  1B70 B;  1HKA A;  4UZB A;  1KTQ A;  3VV2 B;  5M2R A;  1I1G A;  2VH7 A;  5D0G A;  4KHP J;  1CSJ A;  1OY9 A;  3VQT A;  4ENO A;  2XHW A;  4IH7 A;  2ZVS A;  2NQP A;  3BSA A;  3FRY A;  4KHP F;  2HVE A;  2KVQ E;  3H4B A;  1D8Y A;  3TAM B;  4ZG6 A;  1MWZ A;  1VRT A;  3MZI A;  3UD5 A;  4F3O A;  1BGX T;  2IM2 A;  4WFN Q;  1WHY A;  3NRB A;  1JXE A;  5CCL A;  4RW9 B;  2W9A A;  1B0P A;  3QO9 A;  2V68 A;  5KG5 A;  2BJD A;  5F3Z A;  1EP4 B;  4ECU A;  2HWT A;  3M6V A;  5D77 A;  5DLW A;  3JSB A;  3OLA A;  2HWI A;  1WDT A;  3D5M A;  2Y8Y A;  1RI7 A;  1U6F A;  3KK3 B;  4KV8 B;  2J9D E;  1B99 A;  5LM7 E;  4DSE A;  2WSC C;  4CO0 A;  2FVQ A;  1JLE B;  5KG6 A;  1A7G E;  1H73 A;  1L5U A;  4ECV A;  3ILL A;  1VOM A;  1YBA A;  3O2I A;  5D4N A;  5BJR A;  1SHN A;  4LF7 J;  3AHP A;  2RHQ B;  4Y34 A;  4DX6 A;  2DGT A;  1LWC A;  3KMQ A;  4LF7 F;  4TY8 A;  4A4J A;  1GXU A;  3M6U A;  4LVN P;  1S1V A;  3I0R A;  3H5X A;  4NLS A;  8RUC A;  4ZKA A;  2DRA A;  3QAE A;  4DR1 J;  4DPU A;  5I42 A;  2QN6 B;  4KR0 B;  3ZTP A;  4ECT A;  4N8N A;  2XM3 A;  2J0X A;  3GIJ A;  1V9O A;  2EG2 A;  2H51 B;  3G96 A;  4DR1 F;  3B4D A;  3EPI A;  2HGM A;  3IR7 B;  2FC8 A;  2WBR A;  4FYD A;  4NZ0 A;  4ZLP A;  5A76 A;  2UVR A;  2G1H A;  1FXD A;  5CYM A;  5K9F A;  4O0N A;  2C2M B;  5HSP A;  1S4F A;  4XPC A;  3RG6 A;  4WP3 A;  5GAH U;  4A8W A;  2UV8 G;  1ALI A;  4G1I A;  2RRB A;  2Y0S D;  3RZA A;  1O0P A;  3RAQ A;  3MEC B;  1XMO F;  2GSU A;  3QWP A;  1RAA B;  2CVE A;  2IMO A;  2LCW A;  1MMD A;  3JAM Y;  2EPI A;  2NSC A;  4LF4 J;  4WYW A;  2CIM A;  4USI A;  4ALZ A;  3FBF A;  4KGK A;  5KOX A;  4LF4 F;  2KFZ A;  1KLM A;  4AYB D;  1RYR A;  3EGW B;  2NXU A;  2W1B A;  1FKO A;  3T9N A;  3HK2 A;  3FRZ A;  4QW8 A;  2HPU A;  2HHW A;  4ECX A;  1N4L A;  1NO8 A;  3NGD A;  2HRU A;  4K4Y A;  4YEA A;  2FVS A;  3ONQ A;  3D1Q A;  2AYB A;  2F3J A;  4L76 A;  2MTL A;  1K47 A;  3CJR A;  3HHD A;  3I5A A;  2QA1 A;  1PCA A;  4L73 A;  5LRN A;  3K5P A;  4H4O B;  1RWK B;  2B9X A;  1DTQ B;  2DPJ A;  2BAC A;  1HQA A;  4KH1 B;  1G2E A;  1R8B A;  1H3D A;  4Z7Y A;  3A8K A;  2ZJP Q;  3SIP B;  1QD1 A;  3MFH A;  4URG A;  3TUI C;  1R8H A;  1R0A A;  1RAC B;  2V8D A;  1HBO A;  1UJ5 A;  2HBQ B;  4R5P B;  1HFE L;  3M32 B;  4OJ3 A;  1P1T A;  3NOG A;  1UJ6 A;  3M2V A;  3K7R A;  3QIP B;  3VAH A;  4CO2 A;  4F4A A;  4CIO A;  1VIX A;  1EQ0 A;  1Q5Y A;  2OEJ A;  2XMV A;  2AMC B;  4NYP A;  3U1L A;  1YWX A;  1GMU A;  3GFZ A;  1F5B A;  3NGT A;  4Y0F A;  3M30 B;  5KG3 A;  5L46 A;  2DIT A;  2JJ4 D;  4FZV A;  3SQO P;  2R7X A;  5HI7 A;  1U2C A;  2JFK A;  1A6L A;  5DM6 Q;  3K2Y A;  4G1P A;  1AJA A;  2W4P A;  2IC3 B;  4GTZ A;  4GKJ F;  2ACY A;  4CTA B;  3N0V A;  1FKP A;  5K4P A;  1RWN B;  4ZHR A;  4PWD B;  5KFQ A;  4D3G A;  3OUY A;  4ZPV R;  3CCZ A;  4ZLL A;  1FRX A;  4IFY A;  1P6T A;  3LP1 B;  3QWU A;  2DGV A;  4ZGA A;  5GME A;  1KHN A;  2NLW A;  5E3R A;  4DEZ A;  1GT8 A;  4O3Q A;  1KTV A;  3P49 B;  3CC4 S;  2UU9 J;  4ED5 A;  1B7Y B;  3BDF A;  5J1E B;  2E5H A;  1ZA1 B;  2FD2 A;  5KFF A;  2UU9 F;  2ABY A;  3BDP A;  3HVR A;  2FVC A;  2BM0 A;  1HA1 A;  4O23 A;  4DZ6 A;  3PR5 B;  4PYD A;  2GMH A;  2YNF B;  3UDE A;  1HI1 A;  3MMB B;  2H4Y B;  4KQZ A;  3TUZ C;  1EW8 A;  3BH7 B;  1KVK A;  4HKQ A;  4KGV B;  4G1Q A;  1RK8 A;  4ICL B;  1UEK A;  2VQE F;  1NDP A;  3T3F A;  3P45 B;  3JB9 k;  1ZA2 B;  3DU6 A;  4FPI A;  3PHE A;  4ZCM A;  4LQ9 A;  3DLK A;  1FF2 A;  1CJT B;  4PUO A;  3PG9 A;  2FVR A;  2R8H A;  5GRR A;  5HVH A;  4EBD A;  1GQE A;  4K2X A;  1IJE B;  2KB2 A;  1ZTW A;  3L3C A;  3IM8 A;  3DLL Q;  1S4E A;  4M1K A;  4ERD A;  1FK9 B;  3R5B A;  3DRR B;  4HL9 A;  2EFN A;  2ADC A;  2MZT A;  1BE4 A;  1ED9 A;  1OYD A;  2HK2 A;  1D9A A;  3W61 A;  2MZS A;  2XMT A;  1JLC A;  1U02 A;  2FVP A;  4ILM A;  1NK7 A;  3TZZ A;  3OJS A;  4NCG B;  2HS3 A;  3CJT A;  1T03 B;  2PDA A;  2C2K B;  4NLW A;  2XMW A;  4TLQ A;  2V6A A;  1N48 A;  3CCU S;  5C42 A;  3N6M A;  1F60 B;  2YVS A;  2CNK B;  4DF8 A;  1TVR B;  5IT0 A;  1Z2L A;  3D0G E;  3IM9 A;  3M6W A;  4YS2 A;  3N6L A;  5IM0 A;  1P1L A;  2HNZ B;  3GFX A;  1NPR A;  3QMQ A;  2LQB A;  4XK8 C;  3DI6 B;  1UL3 A;  3IAM 9;  1P27 B;  3NCP A;  2R42 A;  3JXO A;  3PVX A;  2OML A;  3RAX A;  4Q43 A;  3T5H A;  3NGU A;  1SL1 A;  4MMO A;  1HWJ A;  5CD4 H;  1Y5N B;  3GYG A;  3LH2 S;  1HD0 A;  4C8K A;  1S1U B;  3UQS A;  5IXU A;  2XY7 A;  5AE3 A;  2ZNY A;  4FYW B;  4EWT A;  4JI0 J;  2VB6 A;  3EVO A;  2KFN A;  1KH4 A;  1S0M A;  2FJV A;  2RRA A;  2R2T A;  4JI0 F;  4CZC A;  3KKF A;  5EHH A;  3SSS A;  2UVW A;  4O44 B;  5GAH I;  2CNL B;  2RF2 B;  4RBU A;  1RBA A;  3AY0 A;  3CO0 P;  3SSR A;  5E33 A;  1TL3 A;  2YBV A;  4OZ0 A;  4HT7 A;  3P6Y C;  4RW7 A;  1WDD A;  4KE5 A;  3ET6 B;  2O01 C;  4CLK A;  1YZ6 A;  3KLH A;  4I4B A;  3FGV A;  2IJN A;  4Q2M A;  1L3U A;  3GON A;  2GO9 A;  4KFB A;  4Y2M A;  1WJ9 A;  2B8P A;  2HG4 A;  3T19 A;  4ED1 A;  1UA1 A;  3VQS A;  5F8I A;  1S0O A;  4L74 A;  3SDE B;  4ZVS B;  3IWN C;  2E5I A;  2LP4 A;  1RWV B;  1QAI A;  2AJ2 A;  1U8W A;  3DU5 A;  4ZPA A;  2UV8 A;  5HRO B;  4U7U K;  4IUF A;  3MED B;  2EKY A;  3O44 A;  1WTB A;  3CCW A;  3QSI A;  2C1E B;  1G1X A;  1UVM A;  3L4B C;  3KUE A;  1U6Z A;  3C16 A;  3TZW A;  5HMZ A;  2HFS A;  4OZJ A;  1SL0 A;  2A2D A;  5ETL A;  2ZNZ A;  1URA A;  4CDI A;  1FDA A;  3E2E A;  1IKX B;  1S9E B;  2GGP A;  1RWW B;  5IQQ A;  1SKU B;  5IT4 A;  4WXO A;  2IVF B;  4KYZ A;  1QUP A;  1O98 A;  2R8K A;  1SJ4 P;  2G0C A;  3MEG A;  1S12 A;  4JV2 A;  1FNX H;  4URQ U;  2DPI A;  5A0Y A;  4RZR A;  4FVM A;  1TL1 B;  1EZZ B;  3KFW X;  1H72 C;  3ETM A;  2B3T B;  2OO4 A;  4RUC A;  1J5O B;  1DQ8 A;  3MM6 B;  1RHJ B;  4OX7 A;  1MML A;  3M2U A;  1HNZ J;  4EO8 A;  4FYV B;  2ASL A;  2Q79 A;  2FZC B;  1WC6 A;  1E6Y B;  4C8O A;  1CC8 A;  4QIV A;  2OI2 A;  4WFY A;  4P73 A;  2ROG A;  2K3K A;  4QU6 A;  2CQ1 A;  4ZVF A;  1WSV A;  1NKB A;  5CXT A;  2KRB A;  5GOV A;  4KPC A;  4DL6 A;  3OPK A;  5B0A A;  1D8Z A;  2XY6 A;  3QRQ A;  1I51 B;  4YME A;  3P4U B;  1RKJ A;  2MSS A;  1KP6 A;  3MUV P;  2XEX A;  3T1Y J;  4ZK7 M;  2CJA A;  3DDI A;  3IRW P;  2XO6 A;  4LMZ A;  4O3P A;  3T1Y F;  2X1B A;  3KHR A;  1WG5 A;  3MTJ A;  1XNQ J;  3KYL A;  2JDJ A;  1O6X A;  3QT8 A;  2JLE A;  3D66 A;  3HO1 A;  4AD6 A;  2WOM B;  1MG7 A;  2UUC J;  2RHS B;  1UWB A;  5LJ5 Y;  2UUW A;  2K7J A;  2VFV A;  3OHA A;  1IQT A;  4OHV A;  1ZEB A;  1B7F A;  1CEZ A;  3FFI A;  2UUC F;  4IOB A;  1BWV A;  1M1K T;  1VRT B;  4QYZ K;  4DBQ A;  2VFU A;  3V4I A;  2ZJQ Q;  3WC2 A;  5BYS A;  2BKP A;  2J7U A;  3IR6 B;  1HL6 A;  2MST A;  3HM9 A;  3O5T B;  1E33 P;  1OYE A;  4ZCK A;  1RT2 A;  1KQG B;  2V2V A;  3TVZ A;  2F8E X;  1URR A;  3HLU A;  3SZ2 A;  1ICE B;  4NZ6 A;  1U7L A;  3QRR A;  3A1Y G;  4DL2 A;  3MM5 A;  3BZQ A;  2A6O A;  3AJ2 A;  4K4S A;  1DBD A;  2KXN B;  3J7A 1;  1SJ3 P;  1BMQ B;  2H3E B;  5EGY A;  1NHV A;  2EI5 A;  2BEF A;  2BKN A;  3P96 A;  4NWB A;  4CLP A;  1WWH A;  4MKB A;  1UPP A;  3MPU B;  5HAO A;  2XS2 A;  4JI5 J;  2LEB A;  4A48 A;  3MEE A;  2LLZ A;  2IRX A;  5IS2 A;  5L0B A;  2DGU A;  4C48 A;  4EGL A;  2IBO A;  3ZNU A;  1LWC B;  1IKW B;  2V2K A;  2W8K A;  1NH7 A;  4JI5 F;  3A3N B;  2MKK A;  1KHL A;  3PO4 A;  2QLB B;  2Y0B B;  2QO3 A;  1IWA A;  1VJW A;  3I0R B;  2Z58 B;  3C46 A;  2HVI A;  2E44 A;  2G13 A;  3OVS A;  4DL4 A;  3PW0 A;  2N4C A;  3DFE A;  5I42 B;  3DRP A;  3HHL A;  1F0X A;  1QAX A;  2NR0 A;  2X51 A;  3J7Y I;  3MD1 A;  2VAS A;  3I87 A;  2UXD F;  2MB0 B;  3D4J A;  2ZOF A;  2F8M A;  3FCW A;  1UVI A;  4FF4 A;  4OYX A;  4ZPC A;  2RQ4 A;  4HTJ A;  1W7W A;  4DN9 A;  2CQD A;  3C6T A;  5CYM B;  4X2B A;  3OL9 A;  2V2Q A;  2BE2 A;  4DXL A;  4DL3 A;  3BO4 A;  3SMZ A;  2D1C A;  3H90 A;  3HKW A;  3JTP A;  1VRU B;  2R4F A;  9RUB A;  4QQB A;  5C25 B;  1Y11 A;  4DLG A;  1XR7 A;  2HKE A;  2IFX A;  3BSN A;  2VPZ B;  1F5A A;  2ZH7 A;  4J9L A;  1JB0 C;  4OV6 A;  5G0R A;  3RW7 A;  4ED6 A;  5B0B A;  3MR2 A;  3TQE A;  3RBZ A;  2J6T A;  2RH3 A;  4I6W A;  4LF8 J;  3MMC A;  2GFF A;  2V9W A;  1H2U X;  3W2W A;  3AOD A;  3E3X A;  3I0S B;  3D1H A;  1YI2 S;  1HPZ B;  4LF8 F;  2HQF A;  3MMA A;  2EFQ A;  1D1U A;  1SJR A;  1X4B A;  3GJS B;  2KT2 A;  1M5H A;  2IJR A;  3C15 B;  4CO1 A;  2RH6 A;  1V5V A;  2D9P A;  3GV7 B;  5IJQ A;  2VL1 A;  2QLF B;  1WOR A;  5IT9 Y;  4LF5 J;  3K5M A;  5D15 A;  7AT1 B;  3V6K A;  1BHN A;  2Q66 A;  4JI7 J;  2VFR A;  5IC4 B;  5EDW A;  1QAJ A;  3D6T B;  4LF5 F;  3CCQ S;  3GV5 B;  5MAO A;  4QWE A;  3SQG A;  1X9W A;  4JI7 F;  3OR1 A;  3J7A N;  3EGZ A;  5J1P A;  4USJ C;  1RLC L;  1M1H A;  4C8Z A;  2DD8 S;  3RR8 A;  6FD1 A;  4B9L A;  2X1G A;  2M52 A;  3W60 A;  4Y2I A;  5KFB A;  2JLF A;  3FBB A;  2EFV A;  5AT1 B;  1RTD A;  3Q8Q B;  2QX0 A;  5HQM A;  1PO6 A;  4IKA A;  2BM1 A;  2IY5 B;  2XNR A;  4WF9 Q;  1JNZ B;  4ZJQ A;  5DM7 Q;  1R0A B;  3T00 A;  3C66 A;  4B3O A;  3UI3 A;  2VDH A;  2MZR A;  2OUG A;  2OGU A;  2HLU A;  2GSN A;  2ZH6 A;  1DY3 A;  4KJI A;  3AA8 A;  3DYA A;  4DL5 A;  2WHO A;  4ZS6 A;  5KFG A;  2KHC A;  3H5Y A;  1TV6 A;  1LWX A;  3B4M A;  2E9T A;  4M5D B;  2PMW A;  1LW0 A;  2AF6 A;  3CWJ A;  2HQG A;  1UVN A;  4LT6 A;  1NND A;  2D1G A;  1X7V A;  3W5Y A;  3NOC A;  4UPH A;  4AL6 A;  4ZHR B;  3PJW A;  4QZV B;  2CJX B;  1U2R A;  2ZIT A;  3GB0 A;  4LF6 F;  2ZDO A;  3KD8 A;  1R6V A;  1Q95 G;  2BMB A;  1AA1 B;  2H5E A;  2V34 A;  3JAM U;  1JKH A;  2HND A;  3QQC D;  1K44 A;  2KN4 A;  1G6B A;  3MUR P;  1YJR A;  5DDO C;  1MRO B;  3LP0 A;  5KTQ A;  1RWU A;  4WJB A;  4DPY A;  3CIZ A;  3NKP A;  3LGM A;  2CFX A;  2D3Z A;  3KDO A;  5KFU A;  2XMJ A;  4OYM A;  3BDE A;  3IDD A;  5DQI A;  1R8P A;  4NWX A;  1UFL A;  2NXN A;  2O66 A;  2HAI A;  1LFW A;  2OFG X;  3UNG C;  4I67 A;  1RCO B;  4R8U A;  2B5J B;  1KHK A;  3D0I E;  2HRT A;  2QL5 B;  5C24 B;  5KFD A;  1AFI A;  1JLA A;  1FI4 A;  1T3O A;  5A6P A;  3LAL A;  1K9M T;  2E1R A;  2N7C A;  1J27 A;  2NPI A;  4PUO B;  4KJG A;  1RAE B;  3CCL S;  3BDG B;  3IBC B;  4H4M A;  3CUN A;  2QE5 A;  1M5K C;  5HJX A;  3T9Z A;  1MU2 A;  1IBL J;  2VA2 A;  5JVH Q;  3EZO A;  1VQO S;  2HHX A;  2BBE A;  2JZ5 A;  4MIB A;  1L3T A;  1VFJ A;  3NY0 A;  4DCP B;  4CT9 A;  1IBL F;  1VK8 A;  2FHJ A;  1YJ7 A;  2KG0 A;  1EKS A;  3RB4 A;  5GVQ A;  2R9L A;  4J9K A;  3AOB A;  1RKI A;  1YZ7 A;  2DIV A;  3OJU A;  4OZ5 A;  3BM7 A;  1UCN A;  1V6H A;  4KO0 A;  4RR5 A;  2W5Q A;  5D0H A;  3W7B A;  2VG7 B;  3UFC X;  4DL0 C;  5DQG A;  1RAG B;  3ZXW A;  4LR2 A;  3BO2 A;  4R0J A;  4E8U A;  2JH3 A;  4USM A;  2P6T A;  1TU0 B;  5C42 B;  5INH A;  1HBM B;  2LU1 A;  2WK4 A;  3MCS A;  1RTH A;  3BGR A;  1TKZ A;  2HBZ B;  2AEM A;  1XNR F;  3TA0 A;  5K14 A;  4OI6 A;  3SCI E;  4EO6 A;  3DKD A;  4TKT A;  5LJ3 Y;  1EJ7 L;  3UNY A;  2OMO A;  3Q8V A;  3HUL A;  3M8W A;  2ZE2 A;  2W5W A;  2K1R B;  2CJB A;  1Q4R A;  3DDK A;  4GVB A;  1ZAV A;  4MK8 A;  4IO1 A;  1Q8I A;  4IO9 Q;  3P8B B;  1NPK A;  1LXJ A;  4PXB A;  1Y10 A;  4MK9 A;  3WBH A;  2WBM A;  1UZD A;  2DK2 A;  5DGA A;  2CNO B;  2ZVI A;  3FKB A;  2PI5 A;  1DHM A;  2LEP A;  3FNN A;  1U1Q A;  4DG1 A;  1AJC A;  4CLY A;  1I94 J;  3LTO A;  1CC7 A;  1TL3 B;  4L75 A;  1YJW S;  2D3O R;  3PW7 A;  3IR5 B;  3FEX B;  2XMK A;  2XYP B;  4RW7 B;  1I94 F;  2RDD A;  2CQ2 A;  2YKN B;  4JI6 J;  3JYT B;  5KFK A;  5HQ8 A;  3G6E S;  2Q43 A;  1XQI A;  4KFB B;  2C3Y A;  2ILY A;  4JI6 F;  5ITH A;  3V6J A;  4YB6 A;  4A8M P;  3CJ3 A;  3I55 S;  1Z1Z A;  4LF9 J;  3PX4 A;  2W2O P;  1WEZ A;  4MTP A;  2C22 A;  3W5Z A;  1N34 J;  5HK4 A;  2RU9 A;  4LF9 F;  2W9C A;  3QFW A;  1LQ9 A;  3MCO A;  1ZTT A;  3QYY A;  4DSJ A;  1FE4 A;  2KT5 A;  2VKZ G;  3RBD A;  2DEI A;  1RT7 A;  4DMZ A;  3JSM A;  4YY3 F;  4YB7 A;  1HQ2 A;  1QE1 B;  4OJH A;  3D0H E;  1F1B B;  1S9F A;  4NXN J;  5KG4 A;  4USU A;  2CQC A;  3WAX A;  1PKU A;  3T5K A;  1IXK A;  2GVZ A;  4NI2 A;  4NXN F;  1VK3 A;  3MEG B;  1HNI B;  3IGN A;  2HMI A;  2VBW A;  3H8Y A;  4B9T A;  4X4U A;  4OJ1 A;  2M2B A;  1RT4 A;  4EYH B;  2ZC3 A;  4EI2 A;  2C2D A;  3DOK A;  4X64 J;  5A0Y B;  4K59 A;  4LRF A;  3PW2 A;  4ZVT B;  4URS A;  1AFJ A;  4I2P B;  3VGV A;  4LFC J;  2ADB A;  4GC6 A;  4X64 F;  3IO1 A;  2E29 A;  3GG0 A;  3OW2 R;  4FF3 A;  2AJQ A;  5L38 A;  4LFC F;  2FUG 9;  3DPC A;  2B7C B;  2PGC A;  4OI4 A;  3Q86 A;  3BYR A;  1JLF A;  1FWP A;  2YKO A;  3PHT A;  2QSW A;  3KUH A;  3E01 A;  1KQS R;  4OLO A;  1FTR A;  3BN7 A;  1OO0 B;  4NLP A; 
#chains in the Genus database with same CATH homology
 1URA A;  4GTX A;  4CYS A;  2GSO A;  4LR7 A;  3LXQ A;  1Y7A A;  5EGE A;  2W5T A;  3BDH A;  2VQR A;  3MK0 A;  1KHJ A;  4LRA A;  4KAY A;  2XR9 A;  3WAY A;  5LRM A;  5LIA A;  2G9Y A;  4LRB A;  1SHN A;  3B5Q A;  4KJD A;  5TJ3 A;  3UN3 A;  1ANI A;  4UOO A;  1EQJ A;  2W8D A;  4TN0 A;  4UPK A;  3Q3Q A;  1O98 A;  4UOR A;  3NKO A;  1HJK A;  2QZU A;  4GTW A;  5C66 A;  3ED4 A;  4ZG7 A;  2IUC A;  4MHX A;  1KH9 A;  3TX0 A;  2IFY A;  1EI6 A;  1ALK A;  3OT9 A;  2W5V A;  1EW8 A;  2W8S A;  3WBH A;  1ZED A;  3CMR A;  1O99 A;  3T00 A;  1E1Z P;  3A52 A;  3WAX A;  4LRD A;  4FDJ A;  4N7T A;  2W5Q A;  4NWJ A;  4MIV A;  3UO0 A;  3NKP A;  2GSN A;  3BDG A;  4CYR A;  3UN5 A;  1E3C P;  4MY4 A;  1ELZ A;  4CXS A;  1B8J A;  1AJC A;  3WAV A;  4FDI A;  4ZG6 A;  5HRT A;  1EW2 A;  5LQQ A;  4LR2 A;  3IDD A;  1AUK A;  5L0B A;  1ELX A;  3M8Z A;  3NKN A;  4NWX A;  5L0K A;  4CXK A;  4UPI A;  3TWZ A;  1SHQ A;  5INH A;  1KHL A;  1AJA A;  4UOP A;  3MK2 A;  4GTZ A;  4UPL A;  1KH7 A;  5L0E A;  5IJS A;  2W5S A;  1P49 A;  2RH6 A;  3DYC A;  3M7V A;  4LRF A;  1KHK A;  1ZEB A;  5IJQ A;  1HDH A;  3TG0 A;  4KAV A;  1URB A;  5K4P A;  5DLV A;  3NKQ A;  3SZY A;  3SZZ A;  5GRR A;  1N2K A;  2W5R A;  1AJB A;  3T01 A;  3NKR A;  3UN2 A;  2IUC B;  4ZG9 A;  5LRN A;  3NVL A;  5DLW A;  2D1G A;  4LR9 A;  3IGY B;  4KM4 A;  1ELY A;  4QAX A;  5KXA A;  2GA3 A;  3DPC A;  1HQA A;  4LRE A;  1N2L A;  1EJJ A;  1ANJ A;  3UNY A;  1E2S P;  2GLQ A;  2ANH A;  2W5X A;  4UPH A;  4ZGA A;  1KHN A;  1KH5 A;  4KJG A;  3WAW A;  1E33 P;  3BDG B;  4LR8 A;  1ED9 A;  4LRC A;  3M8W A;  5GOV A;  1EW9 A;  1FSU A;  3E2D A;  5AJ9 A;  1AJD A;  3IGZ B;  3NKM A;  1ALJ A;  3M8Y A;  2W5W A;  2XRG A;  1ALI A;  4GTY A;  3T02 A;  4CXU A;  2ZKT A;  4YR1 A;  1KH4 A;  1Y6V A;  4LQY A;  1K7H A;  3BDF A;  2GSU A;  5EGH A;  1ALH A;  3KD8 A;  2X98 A;  1ZEF A;  4B56 A;  3MK1 A;  5DLT A;  1ED8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...