3UN3A

Phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un3A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un3A01
2W5SA 5INHA 5L0BA 1KH9A 3DYCA 5LRNA 3IGZB 1K7HA 4UORA 1N2LA 4UOOA 3UN3A 1FSUA 5GOVA 2W5WA 3NVLA 1ED9A 4NWJA 3BDGA 1ELZA 3WAXA 2GA3A 4CXKA 3T02A 5GRRA 3TWZA 1O99A 1SHNA 4MIVA 4TN0A 4UPIA 2W8DA 4N7TA 2W5QA 3M8YA 1URBA 3T00A 3IGYB 1ALIA 1AUKA 3MK2A 4LRFA 3UN5A 1AJCA 1P49A 4KM4A 2W5VA 2XR9A 4CXUA 2QZUA 5DLTA 1ALJA 4LR7A 4UOPA 3B5QA 3NKQA 4MHXA 3SZZA 1ELXA 2ANHA 2RH6A 4LR9A 1ELYA 3KD8A 1N2KA 2W5RA 5EGHA 1ANIA 4UPLA 4CYRA 1AJDA 1EI6A 5C66A 4FDJA 5TJ3A 1HQAA 5KXAA 5LIAA 3ED4A 4KJGA 4GTZA 3IDDA 3CMRA 5DLWA 3WAWA 3TX0A 4GTYA 4KAVA 3NKOA 3NKNA 1ZEFA 4FDIA 4QAXA 3UNYA 1KHNA 4LREA 1E1ZP 1AJBA 4KJDA 1EQJA 4ZG7A 1SHQA 5HRTA 3UO0A 1B8JA 3E2DA 4LRCA 3A52A 1EW9A 1HJKA 3WAVA 3WBHA 5L0KA 4LR2A 5LQQA 1KHJA 1ANJA 3LXQA 2W5XA 3BDGB 4CXSA 4LRBA 1EJJA 4GTWA 3T01A 3DPCA 4MY4A 3M8ZA 2G9YA 2IUCB 4B56A 2ZKTA 5AJ9A 1KH7A 3NKRA 2IFYA 1ALKA 4LQYA 5IJSA 1Y7AA 3WAYA 2X98A 5IJQA 3SZYA 2VQRA 1Y6VA 1ALHA 4LR8A 2W8SA 3BDFA 3MK1A 4NWXA 4UPKA 1E33P 4YR1A 5LRMA 1KH4A 3BDHA 3TG0A 2W5TA 1KH5A 1E3CP 1URAA 2GLQA 3UN2A 5EGEA 4LRAA 1ZEDA 3NKPA 2GSUA 2GSNA 2GSOA 2D1GA 2XRGA 4LRDA 3MK0A 1EW2A 1O98A 4UPHA 4KAYA 1EW8A 3NKMA 5L0EA 5DLVA 3OT9A 1KHKA 5K4PA 3M8WA 4ZG6A 1ZEBA 3Q3QA 1AJAA 4CYSA 3M7VA 2IUCA 1E2SP 1KHLA 1ED8A 4GTXA 4ZGAA 4ZG9A 1HDHA
chains in the Genus database with same CATH superfamily
1JKHA 1U49A 1UEUA 2WOMB 3K5LA 1Q8IA 5KOWA 1RADB 1ZPWX 2B6AB 4CO0A 3BSNA 1J5OB 1M1GA 2RHSB 1KQSR 4WK3A 1X4AA 3R6GB 1T03A 4ZP9A 4YB7A 5FDLB 2WVCA 3J81j 1T0TV 3VZHA 3AA8A 3NAIA 3MOZA 3VQTA 2KXHA 2QFIA 3SFGA 1JJ4A 1VLOA 1WC5A 4GTXA 2HHVA 2XHWA 4MT1A 1FFSB 1SPBP 2M52A 3I96A 4TLRA 2ZWOA 4HL9A 4Z7YA 2N3LA 4IRCA 3CC7S 2CZ9A 1MW7A 2CXEA 3DDNA 4ZP7A 1U4BA 2ZNZA 3HFKA 4L6V3 2E44A 3AODA 1BD6A 3CT9A 1AA1B 1Q5YA 4UOFA 1S1TA 3LGNA 1SH2A 4RNOA 2FJEB 4OHZA 3R5GA 2CUYA 1NHUA 3DOMB 3GCWP 2C42A 3HKWA 4M5NA 4N8OA 5IT9U 1JLQB 5RUBA 1N54B 1VQ6S 3KJVA 1F0XA 3W3SA 4LF7F 1ELXA 2KT3A 3QQCD 2DCUB 4W90B 5M2PA 4KGZB 2DIVA 3BS9A 4HDGA 4L75A 1WKJA 3M8PB 2W4DA 3AH6A 4PXBA 2XGPA 4J9QA 2HQDA 4DUZJ 4CYRA 1HARA 1UWBB 2AX1A 3A3OB 3PRVA 1GMWA 3JQJA 4E2FB 5DG8A 4FF4A 4O3OA 1TKXA 2DGVA 2UVUA 4DR4J 3JSYA 2HLTA 2IDLA 1SJ4P 2DRAA 1HHSA 3S7RA 3C6TB 3BN7A 4OIXA 5ETOA 4C98A 5J1EB 1HYSA 4QAXA 4ZJOA 1F2GA 1FVSA 2MB0B 2M0GB 4DL3A 3O3LA 2MHEA 1PBUA 3BDEA 4NA2A 1E6VB 1SIZA 2CIMA 2HAFA 3B8HA 1DQAA 1N8RT 3VGVA 4OYOA 4CIOA 3IN5A 4IRKA 3PJWA 3C2PA 3EVWA 4ZITA 2BR0A 3MAAA 1OY9A 1HQAA 3CDAA 3MD1A 4XO0A 3R7BB 1HLWA 5LXRA 4ZOSA 2H1YA 5A2QU 1L3VA 4A8OA 4Q2MA 3M9MB 4N41A 2MQMA 5J2QB 3QFWA 5EWFA 2FHMA 2IHR1 3W5YA 1R43A 1RT5B 2UUTA 5HBMA 5HROB 4YR0A 2VBYA 4PG6A 5ETTA 4JB8B 4F4YA 5CCLA 3PY8A 3M2VB 4DU8A 1SL0A 2V8VA 4IH5A 2YNFA 2J0WA 4KH0B 4DPWA 2QSFA 4WKYA 1VK8A 2MZ1A 3SV4A 5L8RC 4LR8A 1R8CA 5IFMA 4CLPA 1T05A 2F8HA 1RT4A 1Q53A 1GXLA 4JP8A 2BJEA 3BYPA 2V0NA 1H2UX 3SQGB 4DX5A 2ZE2B 5ETQA 2RE1A 2J76E 3PW0A 2AP6A 2GO9A 4FYWB 3KTQA 4DR4F 4RPFA 3H2UB 3QT7A 3KYLA 2UXBJ 1IKXB 2BJ7A 2VDHA 1KLMA 5KFAA 4NRTA 1WG1A 2JDJA 2RKIB 4NLGA 1CJKB 1RAAB 1JLFB 2KO1A 3IM9A 4C4WA 1D1UA 3PHEA 1Q95G 2E5LF 2WB4A 5B0GA 4IR1A 1C0TB 2D3OR 4PWDA 1RP5A 2VC0A 2QO3A 4YR2A 2EFGA 1UPPA 2HZCA 3QAEA 2VICA 3CJSA 2VPZB 3SIPB 3DYAB 2U1AA 4EYIB 4YFUA 4ZG6A 2DNKA 3ZTRA 2G13A 5L9NA 4Y0FA 1NO8A 3PJXA 3IWLA 4U8YA 2CQGA 2XSJA 4KHPJ 3T5HA 3N6NA 1UPMB 3P8BB 5E41A 2IJFA 1QD1A 3TP2A 3NG8A 1TMJA 3ENQA 1UVLA 4ID8A 4JUZA 3BQ1A 4UOOA 4ILRA 1TUVA 1FSUA 1TL3A 2Y1IA 2LCWA 1N0UA 3EGZA 3PIOQ 4WTYA 4X4SA 2AHOB 4F0HA 1S1VA 1ELZA 3WAXA 1NSKL 4FBUA 3ENWA 2GX8A 2BACA 4PG4A 1S9FA 3F44A 1I3OB 3PV8A 2ZH9A 4DQPA 3UW1A 2ZM6F 2HNYB 2ZVIA 4NLQA 2V9KA 3DLGB 1D9FA 4Z2XA 3EGNA 2PA8D 5KFHA 4ELTA 2DB1A 1IKXA 4YB5A 3MK2A 4OLPA 5E7OB 3LF0A 1RTDB 4DV2F 3A4TA 2AJ0A 3OPKA 4ICLA 4UUXA 1H98A 1J2VA 2QL7B 3CJ0A 4A8SA 4UOPA 1NK6A 2HURA 3GP9A 4PEOA 2RH6A 2OPQB 2HW3A 2J5AA 2CNNB 1DY3A 3FFIB 1RWNB 3KUHA 2PFDA 3N9UC 4GMKA 4ITSA 4YDXA 4ANEA 5KTQA 1WHYA 1JLCB 4ERDA 1UETA 3C14A 3RW6A 3IR5B 1FHTA 1Q0NA 2HWIA 2OFGX 2UUBF 1LOUA 3LOUA 3GG0A 3OTDA 4NRUA 3EXYA 4RW9A 2IJNA 4J90A 1T3OA 3U02A 1XNQF 5C42A 1QSYA 1RT3B 3P5BP 4JI3F 3OTOJ 2NZ4A 2BA9A 4P52A 1N33F 1D8YA 2JFKA 3RR7A 4KJDA 1ACMB 3GONA 4ZPAA 2CRLA 1EARA 2Z2LA 1LFPA 1U2FA 5E33A 4ECTA 4LF4F 1EQJA 1SHQA 1GQEA 4LRCA 2VIHA 2HMIA 2F4VJ 1Y10A 3DRXA 3SBMA 2GFFA 2OMLA 4DLEA 2OP5A 4CLKA 3OSNA 1S57A 4FYVB 1F5CA 2KN4A 3OLAA 2ZBPA 3BO2A 3ONQA 2HNZB 2BQUA 2V9WA 1ZM4A 2IM3A 2ZC4A 3AY0A 3T01A 4JI8F 4DQQA 2A6MA 4DPOA 2BDPA 1PC4A 2BX6A 5KFDA 3TAQA 3KMSA 3RU0A 3QRPA 5EWGA 3CDEA 2XG8A 3K5PA 1NHKL 5A2QY 5AJ9A 2HWTA 2DVIA 1P8GA 2M5YA 4RNFA 3T19A 5F3ZA 4ED3A 5E3QA 2EFNA 2QFJA 1VYAA 2J7UA 5DJBA 3ZFVA 5B0CA 1DZ5A 4B02A 5LMUJ 3ZXWA 2AWZA 4OI2A 2OTJS 5CHCB 5B0EA 3KOAA 3KK2A 4UZBA 3V6KA 2X1GA 4H4MA 4UF4A 5EX0A 4KHMA 2RUGA 3FNNA 4JI7J 5IM0A 3FQKA 2IY5B 2R2TA 2M70A 4ZVHA 4FPIA 2MTLA 2RRNA 1TV6A 3BGRB 1Z4UA 4C6AA 1S1TB 1YLXA 2WBMA 1FRIA 2KG0A 3D2WA 3NGUA 4DR1F 2Q6BA 2JH3A 2HFZA 2YWWA 2PFFB 3I5BA 2JHEA 1SH0A 2MQLA 3RBXA 2UUWA 4ZP6A 4CT9A 3PJ9A 2VG7B 3I9V9 4MKAA 4X65J 2CQIA 1FA0A 3OT9A 3RAXA 1BQMB 3MR2A 1C1BB 2BJDA 3M9NB 2QX0A 4LSZB 5KFLA 1YITS 3ZZTA 2UXBF 4A8KA 1T95A 4QWDA 3KK3A 2EG1A 3MEGB 4FKXA 2DGOA 2HHTA 2F3JA 3CW2C 4M1KA 2XMKA 4RZRA 4C8KA 2XULA 4USIA 5KFRA 2DH7A 2B8QA 3W63A 1FD8A 2DNHA 2HYIB 1N2LA 4IH6A 4LFAF 1G7CB 3CJ2A 3CMQA 2FJDB 5L39A 2R7VA 1S9EB 1SJ3P 2BE9B 3KJQB 2G1DA 4DUTA 4USWA 1WG4A 4X66J 3G6ES 1RBOB 3C19A 4BS2A 2V6AA 4HACB 3VVUA 3T02A 5L46A 2EK6A 3M1VA 3HHLA 3D4JA 4W4MA 3KDNA 2RQKA 4KGVB 2MZSA 3Q24A 3LUYA 3GIIA 1AUKA 1HQ2A 2IBKA 4LF2A 3Q8SB 4Z7CA 1DTQB 5AJ3J 4EZ9A 1XTZA 5DLTA 2N3OA 3D6HB 1UFLA 4KGKA 1MN9A 2F5GA 2I9SA 3UR3C 3EPGA 2I1RA 2RHQB 2V68A 3QNWB 5FIIA 3SZ2A 4X4PA 3TUZC 1ANIA 2X3DA 2X7IA 5HN0A 4ECQA 2OPRB 3P96A 2FHKA 5F8HA 2JX2A 2W25A 3C16A 3IR7B 2ZWPA 3N4WA 4IKAA 5I4MA 5DDPC 1QAIA 4IO9Q 4LF9J 1C0UA 2D3UA 3IBWA 1UCNA 4GTZA 1S12A 3W2WB 3CWJA 4NXMJ 2APOA 2CNOB 4X62J 5KOXA 3EM1A 4RUHA 5H9EK 4NLWA 1HI0P 2UUCF 4DUZF 2V8GA 4TY8A 3SCIE 2HVHA 4OFZA 2Q79A 3J7ZT 4RR5A 2J8SA 1ZPVA 4KQZA 3ZC4A 3L7UA 3GJSB 3UO0A 4WFNQ 3GQCA 4DV0J 1BE4A 3QFHA 5CCMA 1RT7A 1YBUA 3DKDA 3WBHA 2RUSA 2VFRA 4DL6A 5LQQA 1HBNA 3AD7C 3D3CJ 2CKWA 4NMXA 3TZXA 3K8VA 2AW0A 3KLVA 1RWMB 1XR7A 2DHAA 2MSTA 2O5DA 3M6XA 2CJBA 5JXSA 4IOAQ 3MEKA 4G6VB 5AJ3F 2MQNA 1CC8A 4AYBD 2Z0GA 3J7YI 3T41A 4DV3F 1FFGB 4ZK7M 2FJVA 2F63A 1YX2A 2XBPA 5IJSA 2LA4A 1D09B 1JLGA 2WW4A 1J27A 3WX8A 1KVKA 4RW6A 4ECZA 3FK4A 3LA0A 2OPRA 3BO4A 1TTHB 3T1YF 1V5VA 4G3IA 4WFBQ 4QW8A 1T9YA 1Y5LB 4JI3J 5HP1A 1TVRB 2KT2A 4KPCA 2H51B 3R9LA 1VR6A 1KN6A 2PMWA 3TEHB 3H5XA 3CD6S 4USKA 2MKIA 3PEHA 1EW8A 2YWEA 2W5TA 3TJAA 4DSEA 1Q4RA 2C3PA 2VHGA 2FIUA 4HVZA 4PR6A 2VFVA 5EGEA 2VFUA 3KFWX 2C3MA 1IN0A 4EZ6A 3AJ1A 2GSNA 2NXEA 2MDAA 3NOCA 2KZMA 3DOKA 1RAIB 5A8KB 1OJ4A 3DLEA 2YNFB 1GMUA 5K14A 4U7UK 7AT1B 4NXNF 3DMJA 3IRWP 5HLFB 4LFCF 4YQWA 4YN3B 5JMNA 4LF8F 3OR2B 2C2OB 3K5NA 3PW7A 1I1GA 1QSLA 2FLPA 3HHNB 1WTFA 2E5HA 4YEAA 5GAEU 1P27B 1FNXH 2M8DB 5K4PA 3DLGA 3P45B 4YS2A 4DV3J 5J2QA 1KHLA 1SC6A 2HGMA 3HX9A 4D3GA 1SQFA 4XIUA 2NLWA 1S5ZA 4JI4F 4LQ3A 5M2RA 2HBQB 1ZM9A 1FESA 2CWKA 2N4DA 4PXEA 4WXWA 4C3LA 4DV4F 3VGSA 4OZ2A 5J1PA 4OI4A 3MEDB 3FZBA 4ZVTB 1SXLA 1CJUA 5ITHA 4URQU 4TQSA 3PW5A 4X65F 2AYBA 5D0HA 5GAGI 3T5KA 3KG4A 4H4KC 1BUXA 3WC2A 1LKZA 2BKOA 4DR2J 2BABA 2ZDOA 4J9VA 3N5BA 2O66A 1X9WA 3S6EA 2V4QA 1RSCA 1GX5A 3CB4A 3HHEA 4HHHA 3ZTQA 4ENOA 2VDIA 2PMZD 1I6JA 4IRDA 2V2VA 1T11A 1TKZA 3O1LA 3NBPB 4X4OA 3LTOA 3BKFA 4OYPA 2GMJA 4HT7A 4WP3A 3R7SB 1Q82T 4EBEA 2OTLS 2LXIA 4ES2A 1UW9A 3R1LA 1RAJA 2WAQD 3R3TA 2WB1D 1QDUB 3EE3A 4E8UA 3KKFA 2XM3A 4C9DA 1S1XB 2HHQA 2ADBA 4ZVOB 1BMQB 2OLWA 3NOGA 1N48A 3NNCA 1TAUA 3HF5A 2W5VA 2XR9A 4IDKA 1SIWB 4BLGA 3P6YC 2V8PA 2WVBA 3KJVB 2HHWA 2LXFA 4TU9A 1ZM2A 2UXCJ 2LQBA 4ZVGA 3U1LA 4LR9A 1MN7A 4FNIA 5GADI 1U2CA 3BKTA 1FEHA 2MMYA 1S9GA 3LP1B 1W2IA 4RWXA 1JXEA 5HMXA 4A48A 2ZJPQ 3RAQA 3L7OA 1V6HA 2CFXA 2YQ0A 4X4NA 3ADAC 2ZITA 4Y2CA 1YK9A 5BYQA 4NLYA 1FCAA 3GR1A 1FRHA 4TVAB 1CJTA 3VZIA 4MK9A 4J9KA 4KAVA 4ZMMA 3NKOA 5THWA 3MMBB 3CXCR 1WTBA 1LW0B 1N34F 3HO1A 5D0GA 4NMLA 4ZA1A 3HSJA 1UVJA 2ZBCA 1FKPA 4A8YA 4R5PA 2VOPA 2YX4A 1T9XA 3UCZP 4ZLPA 2CADA 1ZAXA 4ZN3A 1IKWB 2Z30B 4C11A 3QWPA 3WAVA 3W8GA 2QL9B 2NSBA 3M30B 5CZXA 4V19X 1VHIA 5L0KA 3ENAA 3O5TB 2DITA 2VG7A 4RW8A 4K5RA 3U27A 3FSIA 1ZAWA 3G6XA 1X5TA 1Q1KA 2HIQA 4Y2AA 4TKTA 4DSIA 2CJXB 3LQVA 2DNMA 1HW8A 2FGOA 3HHDA 5IV4A 1T9TA 3HHLD 1NKBA 2KRRA 5B0FA 3UCUP 5KFZA 2XNRA 2ADCA 2HNDB 1SBRA 1SH3A 3UVJA 5C42B 1VQOS 3BDPA 2XCAA 1TFWA 3I4PA 4DR7F 3QT5A 3NKRA 4B9VA 4KHRA 1QE1B 1R8HA 4FF1A 4ATNA 1QJHA 3MTJA 3ILJA 3CCZA 2COLA 1HNZJ 4KYZA 2HS3A 1IBMJ 2QLWA 1VOMA 1O5JA 1BQMA 5IC6B 4K2XA 1QVFR 4OYWA 1TQLA 3BPSP 3MCSA 4N77A 3D54A 2RDIA 2RQMA 4O4GB 4ZVFA 2H65B 1HNIA 2K1RB 4X84A 3UDCA 1IUJA 3O44A 4JI2J 4FBTA 4GVBB 1XIQA 4HKQA 5F0UA 3FBEA 1KH5A 3P3DA 2IC3A 3M8SA 1TKXB 2WSEC 4C8ZA 4ZPTR 1N5YA 2XEXA 2Y9HA 3D9BA 4QJVA 3GFYA 2LP4A 4ZLLA 3T5JA 1FERA 1KDNA 2HVZA 2YH0A 4DX6A 2AJ1A 3NKPA 2EPIA 4LSLB 2R7SA 1VMBA 2IRYA 4G1QA 2L3MA 1N6QA 1RCXB 1TELA 3R1HA 2QMWA 2KT5A 2XTJP 2AKWB 1JQGA 4LQ9A 3JB9k 1HMVB 4O4RA 2MLYA 4FVMA 1VDHA 1WKKA 3T6BA 1N6QB 1REGX 4PYDA 1S6PA 5M2UA 3BYRA 1TUGB 2E7VA 1H74A 2FLNA 2E1RA 1FRXA 3I0RB 1KOHA 2VBXA 2MKCA 3MM7B 4FYYB 4ZPDA 3TZZA 2E5GA 2OKQA 3N5FA 4HTIA 3VAFA 4DPUA 1H6KX 1IR1A 4CLLA 3FEYB 4PWUA 3HVWA 3JSMB 1YBTA 3OR1A 3TAMB 4B3MJ 1O6XA 5F8JA 3DYCA 5LRNA 1C2PA 1LNQA 2JL9A 3H7HB 4UUWA 4DV1J 5ETRA 5D4NA 4KT0C 3UWTA 1M1HA 1FX4A 1X8DA 1HPZA 4A47A 3UNGC 3G96A 4J9LA 4CH7A 3NVLA 5GOVA 2X51A 3BM7A 3IG1A 1N36F 1S0VA 3E3XA 2RS8A 3M8QB 1N33J 2DGQA 2WRMA 1IXKA 2MZRA 1E6YA 3PW4A 3J7A1 1IQZA 2FVQA 3LW5C 4LFBJ 1REVB 3OTBA 4ECVA 4RO0A 5KFGA 4J9PA 2MQ8A 1VRUB 3IAS9 2NS1B 1R0AB 1FDBA 1R7IA 2X1BA 3R97A 2JEFA 1P49A 5L1IA 3E2EA 1FF2A 2AV5A 4DCPB 2CZVC 5DG9A 1NZAA 4P7TA 4YY3F 2AGQA 4KKOB 2VD3A 3V81A 3GPAA 2P8IA 2W7PA 1FK9B 3GJQB 4LR7A 3UI3A 1CPZA 4ANDA 5G0RA 3LWLA 2GHPA 2ANHA 4WYLA 3BKUA 1RT2B 3LPEA 3CJTA 2XY6A 3GIRA 4NLPA 1T7PA 1JLCA 3PTWA 1U45A 1HFEL 3TX8A 2RQCA 1Y6VA 3IG1B 1HNWJ 2E1MC 5TJ3A 2MYFA 2R7QA 2DGWA 3A1YG 2LEPA 2H3EB 2PA3A 3AA9A 4GRSA 3PXGa 5B7WA 2B56A 5CH7B 1IBLJ 2YNGA 5CA5A 4BHQA 1R8PA 2GVDB 2HVDA 3NKNA 4FDIA 3L7PA 2DGSA 1RA6A 4EK2A 1NJYA 1SUQB 2R8IA 2GV1A 1U24A 2W2PP 2CNLB 3HD1A 3B54A 1PKUA 2CQHA 3THVA 1C4CA 3NCRA 1RAHB 1P1LA 2YWFA 3H2LA 4K7QA 1EW9A 2M3DA 3AJDA 2VOOA 2OH2A 2CPFA 1B0VA 1H2TZ 2YKQA 3F0NA 2GS8A 4OV6A 1XC9A 1N56A 3U1MA 2ASYA 1OSCA 4AL5A 1KP6A 1UZHA 2E7XA 3FDSA 1RABB 3G8QA 5HATA 2RD5C 3ET6B 9ATCB 1YZ7A 3HHLC 3BBFA 4NI2A 2D9PA 2LLZA 2YXLA 4I6YA 5D78A 2DY9A 5KFWA 4MY4A 2IM0A 1WEXA 2QGFB 1AB8A 3MECA 3MUMP 2HIYA 4DFPA 1CEZA 5LIAA 1RYSA 3H4BA 5F8IA 1X4EA 4JOUA 2UZAA 2GVDA 1YJ9S 2DT9A 3MECB 1LK5A 3PRDA 3RAMA 3N28A 4LF7J 4OJGA 2YWGA 3DDIA 2QC3A 2CWXA 2EEYA 4MKBA 5LMNJ 1VQKS 2ZOMA 2YBVA 2P6SA 3M8PA 3QMQA 4Q2LA 2QZUA 3VGTA 4A8XA 2D41A 2IFXA 2B8PA 1SI9A 5B0AA 1OY8A 3SQOP 3IWXA 2FLOA 1MMLA 2AT1B 4DSFA 3QGIA 2E7WA 2FD2A 3MM8A 4KKOA 2W5XA 2VV5A 1FXDA 2DK2A 5HROA 4KPYA 4LF6J 4OZ0A 3LP2A 5KFNA 2FJBB 2XC9A 1TU0B 1W25A 1NDLA 1EETA 2W2MP 3PRBA 1JB0C 2OHDA 2W9CA 1N32F 4Y00A 1O98A 1SKUB 4CH1A 1VBYA 2AJFE 5H9FJ 2J6SA 5A8KA 3AT1B 1HHQA 2IIHA 1ROFA 3QT8A 3T3FA 3RBDA 3HHKA 4RLEA 2DHHA 4B9NA 1VRTA 1PO6A 2C2NA 2DEJA 3QGHA 4LF1A 4DV4J 4UY8T 1K1SA 2RF2B 4MYUA 5KG6A 1DHMA 5KFOA 2NZCA 2OSQA 3GZ7A 4ZGAA 3MPYA 5BYRA 3ELHA 3QLHA 5C2GA 5H9EJ 2VA3A 2ZBQA 2UUBJ 3GTYX 2WOMA 3AOCA 1GTEA 3Q8QB 2ATCB 3MEEB 3OR1B 2OELA 3D6MB 4OV1A 2Z2ZA 2ZUGA 2CVEA 4JV0A 2J0XA 2NXJA 3TQEA 2NYIA 4M5LA 5J2NA 4C8MA 3Q23A 1B99A 1KS2A 4RW6B 1ED9A 1UP1A 5HMZA 1S9GB 1X60A 2AYEA 2F40A 2QMUB 5CQGA 2UVVA 1OSDA 3HMJG 1RYRA 3RYLA 3DU6A 4CXKA 2ZFHA 2DNLA 4UPIA 2R8KA 2CDRB 1DTTA 4R0JA 3MEGA 2KM8B 3W9HA 2G2OA 3M8YA 5CD4A 4F4ZA 4NCBA 1NRKA 3D1QA 2UV8G 4P6QA 4IDKB 1IJEB 2HG4A 2W9BB 1P9YA 4OI1A 3UDVA 2D9OA 4LRFA 1ZM3A 4MIAA 1PC5A 2CQ0A 4F4AA 5A0YB 4J9OA 4PQUB 3RRHA 4MJKA 3SSRA 1AJCA 3QATA 5HI7A 3TVYA 1YIJS 2EBEA 3P4UB 4Q45A 2Y8YA 4DCJB 2DHGA 2ZH4A 4Z37A 3THTA 1OMSA 3WZ0A 5JVHQ 2DGUA 2GJIA 2HEKA 3DLKB 4USTA 4J5OA 4J9RA 1T9WA 1FT8A 1T9VA 2RILA 2VC1A 1S49A 5EUHA 1AYEA 1A9NB 1QAXA 4PG7A 5C66A 3CJ4A 3RB0A 2OEMA 3L09A 2IBOA 4I68A 4M5GA 2ZH2A 3DLHA 3GIJA 1TAQA 3PO4A 1WNEA 1Q78A 3L95X 4UZCA 5IM0B 3A8JA 2XGQA 3EX7B 5CZVA 1VFJA 1K0VA 1JMTA 1EIYB 1JJHA 2RDDA 1VQNS 4F2RA 3M6VA 1HBOA 4GKKF 1FJ7A 4LBPA 2Y1LB 1S1XA 1V5IB 4B3TJ 2QA2A 2NXNA 4XPEA 2XLJA 2W2NP 4WPAA 3GFXA 1FI4A 1KONA 1R27B 2HWHA 4B17A 4DLGA 3ZTPA 3GYNA 4YUDA 2M7SA 3FJ2A 4O3QA 3QBCA 2VQEJ 4E98A 3DLKA 4WFYA 5KFIA 3PHTA 1VK3A 4QR1A 2DHSA 4QWBA 2KZZA 3OFHA 3A13A 1HNIB 2ZHAA 3VWSA 2IA0A 4O4GA 5CYQB 1FTRA 5C7PA 4E0DA 2E1PA 3QLHB 4NYPA 1TL1B 4DJBA 2E9ZA 5HSPA 2W9BA 2QZ8A 3JTPA 3O2IA 4KO0A 2FB0A 2R2UA 4QWAA 4MIWA 3TEGA 4X2BA 4PCQA 1FFWB 4EI2A 2R2SA 2ZKTA 4I2PA 4YR3A 2B6AA 3H42A 1NKCA 5D15A 4PAAA 1GMVA 1VC6A 1HWKA 1CJVA 2MJUA 4LQYA 1RHQB 4IG0A 3TAPA 1VQLS 4H4OA 2J7KA 1V3ZA 2J7WA 5L1KA 5L1JA 1LWXA 3UD4P 4ED2A 5IJQA 1ALHA 3E8OA 5H9FK 3MZIA 3RJMB 1PJ5A 1LWFB 1WI6A 1HQUB 4AFFA 3HFZB 4CLSA 4Y2MA 1O51A 4D3HA 2HHPA 4RU2A 1NZ8A 3CVKA 2ZZMA 1UJ5A 5LRMA 4OYMA 1X4DA 1URRA 2HQ3A 4B3OA 3NGTA 4LRAA 2L48A 4O44B 2GA7A 4TLQA 2HGLA 5AE1A 1U1QA 2V8DA 4IFYA 1U1LA 1A0OB 1HPZB 2OGUA 2F65A 4RW4A 4ZVEA 1TKTA 1X5OA 2IAJA 5ADZA 5KFYA 2VL1A 4TU7A 5A8RB 1SKRA 3M8RA 1YKWA 1KNZA 3KLEB 1EZZB 3AD9C 2RS2A 3U1NA 5F3TA 2RAQA 1N88A 3SCKE 2VJUA 1HA1A 8RUCA 4OZ1A 3VAGA 1IKYB 4ZLJA 2EG2A 2G0CA 1ZEBA 4WWSA 2I8EA 2BZ2A 2C2DA 4NZ6A 1S6PB 3ISNC 4FP9A 4BC7A 3QZ7A 1DRZA 5L0BA 1RTJA 4RJVA 5F9LA 2W01A 3I9ZA 4M5HA 2CQ1A 1H7WA 5F9NA 1RISA 4X4TA 4NPOA 3UN3A 3R5DA 2IVFB 4G1PA 2XI3A 3JYTB 1S0MA 2IA6A 4IR9A 1QSSA 4G1IA 5HANA 3ZTSA 3CGIA 4M5MA 3IO1A 3T9NA 4HLBA 2L9DA 5IWAJ 1HBNB 2GMLA 1PSDA 3FSXA 1UFWA 4URSA 1ZZFA 5KFBA 3QRQA 1TKZB 4FNHA 3CCJS 5EN1A 5F8MA 4L76A 1I5OB 2JOQA 1CQMA 2YNGB 3TO8A 3BQ0A 5DG7A 1K8AT 3RG6A 5HVHA 2HRUA 2NUUG 2YTCA 3OXLA 4DHVA 1WC1A 3KK1B 2HHSA 3BBCA 4KFBB 4UPLA 4TY8B 1H38A 2X3GA 1TK0A 4O3NA 2ALZA 2GCFA 2HKEA 4UOHA 3AFGA 4Y2KA 5JJBA 1O0PA 4A8FA 3H59A 3JSRA 2E5IA 4ALZA 4M95A 3B5QA 3QWUA 4OHVA 3W5ZA 3MR3A 2XZDB 3KUEA 2D7SA 4QOTA 2XY7A 2W5RA 1Y00A 3LO3A 1DJ0A 2AX0A 2KU7A 3DXBA 3QIPA 2FVPA 1EI6A 2ZEJA 1UZDA 1SB6A 4ZPWR 1KEKA 4CO5A 4RKUC 5ETKA 2HZAA 3N0VA 3DDKA 4USVA 1REVA 2DPIA 3WAWA 1VI7A 1WD6A 2A6OA 1D8ZA 1XMBA 2DY1A 4KH1B 4CQ1A 2LQJA 2HK3A 2R8JA 2ZH6A 4ILLA 5H1SV 3CCWA 1NK5A 1ZH5A 4C0BA 3DN9A 3FBCA 4ECWA 1G6BA 3DFEA 5JUMA 1BXNA 3OQ2A 2C28A 4XPCA 1C1BA 3CCLS 1QY7A 4JYAJ 1WOSA 4WFAQ 4AQYF 2JSXA 5E0OA 4LR2A 3CO9A 1L3KA 4WYWA 1W26A 3VQSA 5I42B 3PIPQ 1L3SA 1NB7A 1UVMA 2Z2YB 4Q0BA 1G1XA 3GMGA 4JI2F 5ETMA 5E5NA 3MGJA 4GO7X 2G9YA 4YP3A 3MM8B 1XNQJ 2O3DA 1IM6A 1LXJA 1M0SA 3CPWR 4DWIA 5T41A 4M94A 1U6BA 2E9RX 2ZKUA 3CUNA 4CLYA 2B3TB 5E3AA 1ZS6A 2MZTA 3BGFA 3OV7A 3KHRA 3WAYA 3EVMA 1YI2S 4QYZJ 3EGWB 1NCLA 3RRGA 1S77D 4YHHJ 1RTHA 1TL3B 4WBFA 3SSSA 2L41A 5KFCA 3GIMA 3Q22A 4JI1F 1PAUB 2I38A 3RZAA 3B78A 1M5PC 2PE8A 1F3FA 3M2UB 2VG6B 1RKJA 4TQRA 4AXIA 2B9EA 5KFPA 1UA0A 1U1OA 1WEYA 2UXDJ 4B3SF 1E3CP 1NB2A 1RKIA 2V2ZA 2K3IA 3CJKA 2C3YA 4JV5F 2BJ8A 5C5JA 4MKVA 3AQOA 3QAUA 2QV6A 2BOAA 3F56A 3QO9B 3KLGB 1EQMA 2CQPA 2WCXA 2YKMB 3O6QA 4HH1A 2RRBA 5D0RA 5C2CA 3H98A 3DRRB 1NKEA 1N36J 3DOLA 3LGHA 1SL1A 2NQPA 4X4UA 4H4MB 4DDFA 1RTIA 3PCOB 1TR0A 1A7GE 2A0FB 1P1TA 3ILIA 2VZ9A 3VF0B 1WG5A 4OYIA 3MMCB 3EGVA 4YOEA 3ZZUA 4J9NA 1RHMB 4KGXB 5HVFA 3TANA 1YHQS 1FD2A 3HKZD 4DSLA 1WSVA 3ZZRA 2H4YB 2W5SA 1G3OA 1RLDA 3S1TA 5A6PA 4RUCA 3IM8A 2PMHA 5IQQA 4A4JA 2D69A 4DL2A 2R42A 4RW4B 3NGKA 3ZZYA 4F36A 3H5SA 2YNHB 4CTAA 4I2PB 4F3QA 5HQLA 4O3RA 2R7TA 4I2QB 1M5SA 1FDDA 5K5MA 1VRQC 4ED0A 1M5HA 2JRSA 4F3OA 1QE1A 2VH7A 4QPTA 4ETXA 2HFVA 2ZDPA 1F5AA 3CIMA 1GAOA 5KFSA 2GGPA 4K2JA 3ETMA 4JI0F 5J2MB 1SHNA 1B3TA 2QTWA 1SJRA 4NLSA 1QUVA 4ZN1A 3OJSA 1R0AA 5A8WA 5LOQA 4DV6F 2YNIB 1U8SA 3J81Y 1XK8A 2OPPB 2HNYA 2J9CA 3BF4A 3MEEA 3UDLA 1NPKA 1IKVA 3NCQA 5MLCV 1GNKA 1SC4B 4Y2IA 3M30A 2P9EA 1UL3A 2AJ2A 1IKWA 1IJFB 2D1CA 3KNGA 3R7NB 5FLXU 3LWMA 3T1HJ 3ZTOA 5MAOA 2KJWA 2V5HG 2ERRA 3C66A 1MWYA 1QM9A 1NNDA 1Z2ZA 2B4UA 3BSOA 1VRTB 3BH6B 3OFEA 4WIQA 2EC2A 2HSEB 2LKZA 4KJGA 1PAEX 2IPOB 3MMJA 3CJKB 3HFVA 5DGBA 3K59A 1KTQA 1U26A 1ZTWA 2V63A 1RWXB 2OSRA 2XYGB 1U6ZA 5K9FA 1WACA 1OQ3A 3DHWC 2JC1A 3GFZA 1S7HA 5KFXA 2OI2A 4IG3A 4CLUA 4TY9A 5BR8J 2WTFA 2H5EA 2DJWA 2MQQA 2DYAA 2D74B 1RTDA 1LWCB 4OI3A 1UMJA 4BWJA 1DFDA 2Y1RI 1FKOB 3ZZOA 5HMWA 2HNZA 1FWPA 2AYGA 1L3TA 3N79A 4B9UA 1CBKA 1DTTB 2L08A 2YX7A 2Z56B 3IGNA 4IFVB 4U67Q 1ANJA 3LXQA 4LMZA 1RTZA 2J8AA 1VQPS 1EJJA 1KTVA 1D9DA 1TL4A 3CJ5A 3M8ZA 1N5YB 4OL8A 2BANA 3AXKA 4IH7A 1K9MT 4LFBF 4MMOA 1SUQA 1M1KT 1NSPA 4WP9A 1RI7A 1SV5B 2OPSB 3GYXB 2YKNA 2G4BA 2GW8A 5AE3A 4AQYJ 3K5OA 1Y7AA 5A8RA 5D77A 2FY1A 1OQ6A 3GWCA 3K7RA 4M5DB 3TA1A 3ENVA 1FXLA 4ZCIA 3KLFA 5JVGQ 1T05B 1RZMA 4DR1J 3H2VE 2VQFJ 4WE1A 4F04B 1VJQA 1S1UB 2CQBA 4RBVA 4USUA 1U0HB 4M5JA 1RJJA 4LF5F 1FKAF 2DO4A 4YB6A 4XK8C 1YJWS 1N5SA 1S0OA 4FS2A 2WZ1A 4JI7F 1YJUA 2EXUA 2DNZA 3DLJA 1XJWB 1EP4B 2ZBRA 3GCXP 2BUNA 1KLMB 2ABYA 4I6AA 3MM5B 3J7YU 1TK8A 3E51A 5GMDA 4C0HA 4DQRA 1X0FA 1J5EJ 1IBCB 5I3QA 3FCVA 3FCWA 3DMJB 3QPIA 3PYDA 4NYOA 4C0OC 1Y0HA 5HLFA 2HQFA 4KAYA 4FVCA 4C11B 1S6UA 2V34A 4L3KA 3HVRA 4CCHA 3NKMA 2OEKA 3AQPA 4P73A 4OJHA 4KY3A 3MXHP 1S7IA 1NU4A 2HHHF 3RW7A 5KT3A 1FE4A 3I82A 1FJEB 3QJLA 2R4FA 1RLCL 3GSDA 4L3NA 3Q3QA 3V4IB 2ZBIA 3K89A 4KFBA 1S48A 2HS4A 2DR6A 3OXGA 5KT7A 4B3SJ 1VC5A 2XY5A 3KUGA 2HBYB 2FZCB 4AXJA 1FXRA 3C6TA 1HYSB 3WQPA 4CRJA 2Z57B 1WJ9A 4NLXA 4CYUA 1SV5A 2HBRB 3MM5A 4DF8A 1IBMF 5IWAF 5KFQA 3QSYB 5F8LA 2VKRA 3QIPB 4OX7A 3PG9A 5IS2A 1L5UA 2D3O1 1I94F 3OVBA 1OYDA 1RT6A 1IQTA 4L73A 3DYAA 1IM4A 5GRRA 1SC3B 1O99A 1KLNA 4TN0A 1KFSA 3CE8A 1S6QB 2J0QD 4HTJA 1AFIA 2QMXA 3W2WA 3I56S 3JSBA 2RU3A 2ZC3A 3FRZA 4FYDA 1JIHA 3RB3A 1HNXJ 3T00A 4MIBA 4O23A 1ALIA 1WORA 3I0SB 3RRKA 1P6TA 2B4VA 3UN5A 3D6FB 3RUBL 3H0PA 1RHRB 2DR7A 4RU9A 2CJ9A 3A8KA 1HR0F 3DRSA 1RT7B 5D4PA 4GC6A 4CNZA 1T94A 1APSA 3NKQA 2ZH8A 4GC7A 3AJ2A 1ULRA 3G4SS 1RAGB 4DUYF 5CYMA 5GAGU 2HHUA 2ZJQQ 2FQQB 1FDNA 2A2CA 3BGUA 4BC9A 4ZCMA 5E3PA 3JYTA 4ECSA 4ED7A 4DF4A 1FO1A 1U8WA 2BRKA 2RT3A 4P10A 1GFWB 3Q8YA 2ROPA 4OHYA 3H25A 3BN4A 1XEZA 2G2YA 4ES3A 1SJFA 1QLNA 1C4AA 3FEZA 4FF2A 3IDDA 2GVZA 4MAKA 1RGVA 3HHLB 5GMKa 3HCXA 3R2DJ 2J9EA 2GHVC 4LJMA 2EFPA 1IKVB 2O1PA 3NGRA 3CDBA 1K1QA 2HNDA 2W2QP 3UVJB 2DNOA 5B0BA 1I94J 2Z2MA 1H0HB 1PYOB 3NRBA 5KFKA 5EWEA 4JYAF 1TK5A 3T1HF 3HULA 2R8GA 2FJWA 3THPA 5J2NB 3V6HA 2J9DE 4H4OB 4DFKA 4EWTA 3BR8A 2KH9A 2LDIA 2ASJA 2LEBA 2AJ4A 1BLUA 2KXFA 2QSWA 1Z2LA 1WDDA 1X9MA 3D7SB 4OLOA 4MKYA 2VONA 4CXSA 1YJNS 1YJ7A 4PQAA 1EB0A 5C25B 1KRPA 3MUTP 4AL7A 4KHPF 3TOQA 2ZJRQ 2MXYA 5EHHA 4A8WA 2HFUA 2VBWA 3H90A 3QYYA 2PN6A 3V81B 4N47A 2OPSA 3HJFA 3RTVA 2VG5A 2CZ4A 3CDWA 5HK4A 2HBZB 3PFEA 4DFMA 5K8OA 4C8YA 1HI8A 2W9AA 3KHHA 1CS4B 1AZSB 1YWXA 3M6WA 2XO7A 4NWXA 3G87A 2GIRA 3CMAS 4F4XA 2AJQA 5IT4A 2W4CA 4KAIA 2K2PA 1R31A 4DG1B 4MFBA 4WE1B 5J2MA 4I69A 4X4RA 2EC0A 5AE2A 1ELOA 2I0XA 2WK4A 3FBBA 1LXNA 4NE9C 4WU2A 1RUSA 1VLYA 9RUBA 5I3UB 3KK3B 1JLQA 1B4SA 2B4PA 4RBTA 4UOCA 1SQGA 2LFVA 3DRPB 4I2QA 1FE0A 2NR0A 2YNHA 4CTAB 2A2DA 4QIGA 2MEWA 4FN5A 1Q7YT 1PILA 3HT0A 4LRDA 2P2CB 5LJ3Y 3DC2A 3NP5A 4B9MA 3IGVA 3IS9B 1A6LA 1DURA 2FHOB 4FKYA 4QIFA 4RNHA 2XNQA 2ZZTA 3MCOA 5J1NA 1KQKA 4DL0C 3OXFA 2KG1A 3HPOA 2NREA 4JI5J 1MSWD 1OS5A 5DLVA 4CWBA 3OHBA 2VODA 4JV1A 4OYXA 2DR9A 3G6VA 1NBEB 2H5IB 4J91A 2B7CB 2V2QA 1LK7A 1WHXA 2CG8A 1TV6B 2MZJA 2MZQA 3BGRA 4K50A 2BXJA 2DISA 3SCJE 2KM8C 3GIKA 4Q8FA 3DGVA 2F9JA 2VKZG 4C97A 4DR5J 2AD9A 4KV8B 1KH9A 1ZBTA 1K73T 2HQCA 1TUWA 4J9MA 1VQ7S 4IYQA 2DR8A 4CLFA 3HP6A 1S4FA 3BQ2A 2DXEA 3DNCA 2BJ1A 3L3CA 1ZETA 1JLFA 1WF2A 1CS4A 2RMLA 5AXNA 5LL6d 3HSZA 1FWLA 2JNJA 4FZVA 5F41A 1RHJB 4UT4A 2XLKA 3HSGA 4PXDA 4ED8A 3DLLQ 3NWRA 3JS9A 1YRTA 3DU5A 3MTKA 3TWZA 3R6LB 5G4DA 5LM7E 5K8NA 5F0WA 4B9LA 1XWLA 4WJBA 4KIAA 2H54B 3PKYA 3VHQA 2CPXA 2H5JB 1OPZA 2L9NA 4S0MA 3JQMA 1GT8A 3CMES 3OSPA 3G9CA 1X0PA 1X4BA 2LQ5A 2RF2A 2YPZA 2YVSA 3A3PB 3D3BJ 3I32A 4O0IA 4IUFA 2RQ4A 4F26A 2OIHA 3DM2B 4DQIA 4EYHB 2CA9A 5LMNF 2UV8A 1S79A 5D0EA 3WBZA 4KGMA 4A8MP 4WXOA 2VPWB 1U2RA 4F7VA 2HZVA 1MROA 2OEJA 4F25A 2BBEA 2C1EB 4JI6F 2XMWA 4DS4A 1S4EA 4ZVUB 1M90T 3BB5A 3MFHA 1HWIA 1NDPA 5GAHU 3CCMS 1CSJA 3OTEA 3G71S 1RT3A 3MURP 1VRUA 4HEA9 4K4WA 1AUSL 1H3DA 2CAJA 5B09A 4TU8A 2HS0A 1IBKF 2W8SA 1KR4A 4U95A 4X64J 1GXUA 3B4DA 1U0HA 4GTYA 4UTGA 4F0MA 4YB1P 3DOKB 3WX4A 1VBZA 1Q7LB 4HI1A 2DR5A 2RB7A 3KLGA 3D68A 1YG0A 3GV7B 1PGZA 1E6VA 3IFEA 1RCOB 1ZAVA 1FRLA 4Y3CA 4ZG7A 1U1RA 4L74A 4B3RF 4RUAA 1SKSA 2AEMA 5D6GA 4DL4A 1JJCB 1WC4A 3MUVP 3K5MA 2LECA 2CQ2A 1MWZA 3DGPB 2G0IA 2AU0A 4I67A 1S1WA 4R8UA 5BR8F 3MPVA 1HHTP 3W9IA 3CO0P 3ULHA 3OFFA 4M63A 4P9SA 3M2RA 3K8WA 5HJYA 2C22A 4U7UD 1KVJA 1NK9A 3MM7A 4G65A 4FXDA 3DI6A 4ZJLA 3FRYA 2CJKA 4C8LA 1VHFA 2HLUA 5DRKA 2AQ4A 1Y5NB 2YKOA 1HNZF 1LFWA 1VC0A 3C15A 3BBBA 3QGGA 1VIXA 4ED6A 1S1VB 1UVIA 4QZVB 5CD4H 1FJCA 3FCHA 1JLBA 1NJZA 3MM6A 5HVGA 2AZ1A 5KT4A 4OZJA 3RGIA 1H7XA 1BHNA 4K4YA 4LFAJ 3J80Y 2FJXA 1K44A 1N5VA 4OQJA 1OIAA 1NSQA 4UPKA 2NUHA 3PACA 2FGCA 3W62A 1H73A 3A12A 3M4XA 3VAHA 3BDHA 1HBMA 4FXVA 4DXLA 4PUOB 3CD5A 2GLQA 3V6DB 3GJTB 4NLVA 2PI5A 3FBFA 1CVJA 2FLLA 1DTQA 1RE1B 3WIVA 4N76A 3LALA 2FHJD 1JNRB 2B43A 3GE9A 2FDNA 3C15B 1FJGF 1M5OC 2QE5A 3T5LA 3MK0A 4Y34A 1RT2A 3TYTA 3FMWA 2FC8A 2JLFA 2HMIB 4HH0A 3V4MA 2Q66A 2J6UA 1U02A 1AJDA 3UQSA 1KHKA 3LP0B 3WIUA 3K17A 5HQMA 3BH7B 4UY85 4GKJJ 3CCTA 4RNMA 2UVWA 1ED8A 3LPYA 3TUIC 4K4XA 4CYUB 2HRYA 2LQ8A 1S0NA 3MCMA 3D0GE 4I56A 5SZTA 3R5CA 3K0JA 1IWAA 5GADU 2XMAA 3ILLA 4N56A 3CC4S 2VUGA 1LEOA 4FXWA 1V3SA 3DM2A 5EDWA 1N32J 3KLHA 5LMUF 1HW9A 1RHUB 1HNVB 2DBBA 2BVZA 4ZKAA 1FX2A 1VQMS 4QWEA 1AW0A 4ER8A 2GA3A 3KDOA 2ILZA 2QYGA 4K0KF 4TYAA 3PKMA 4MIVA 4EO8A 4KE5A 4DFJA 3GV8B 2PDAA 2YX1A 1URBA 4ECUA 4Q43A 3B6BA 3ICLA 1EP4A 4CP5A 2PT0A 1U0SA 1HL6A 2K7JA 2ASDA 4I7FA 4KM4A 4JV5J 3N6MA 4IG0B 1WELA 3BGOP 4CXUA 1B0PA 3CJ3A 3EDRB 4OHWA 2OUGA 1ALJA 2E1CA 2DRDA 3BPDA 3MAAB 1DAXA 1UJ6A 2PC6A 1WOPA 1WC6A 4U8VA 1ELYA 1IR0A 3QO9A 1FKOA 3SCLE 4DSJA 2LU2A 1T3NA 1JLEA 3MR5A 1U1MA 1P9QC 4QR2A 3MPDA 4FDJA 3NCPA 3CD7A 4NZ7A 2XMMA 3BO3A 1N4LA 3W7BA 3JSMA 2W2OP 4F02A 3CMRA 3QZ8A 3ETOA 4QIVA 1YTYA 1HQEA 4K4VA 3PYEA 3OL6A 1LQ9A 4EBCA 1ZEFA 2RIJA 1MLAA 1MU2B 1KD1T 4CO3A 4O3SA 4LREA 2ZHBA 5L38A 2MGZA 4X66F 3C46A 2EFOA 1PJ6A 2QT7A 5HRTA 1G4CA 2V67A 1BQXA 2N82B 3C3LA 2V50A 4P2SA 5LJ5Y 1SC1B 3LH2S 4X4QA 2E5LJ 1NUEA 4KSEB 1RT1B 1VQ4S 2X1FA 1Z1ZA 1FRMA 5DZ7A 3KK2B 3MMAB 5F8GA 3C16B 2IVYA 3BGLA 2N7YA 1NJIT 1HQUA 2H4WB 3VV2B 4F8RA 1JK9B 3QJPA 1NDCA 3M2RB 2E1AA 5DQGA 1KSPA 2YQ1A 1RWVB 2Z58B 4IG3B 4HI2A 2EWHA 4J7CA 2IC3B 1ICEB 1WHWA 5KFTA 1S99A 1W7WA 4JBCA 4DEZA 2U2FA 4F0KA 2VFSA 5CABA 2E29A 4JI6J 1CG2A 3IS9A 5A6WA 1CJVB 2IFYA 2N4CA 4HHJA 5IV3A 3EJMA 2HFNA 3NLCA 5DETA 1BC6A 2MSSA 5K14B 2I2YA 4EU0A 4WZQA 1X31C 3KLIB 3EWGA 4RL1A 2R7UA 1JLEB 5IOLA 4WFZA 3EICA 4NLTA 3T6JA 3ZZZA 1X5SA 2DIUA 2W7AA 2ZH1A 1Q8LA 2QYCA 1PBAA 4NASA 3ITHA 1V3RA 5I3UA 3KLIA 3FFIA 4C3MA 4H54A 1KH4A 1RQ0A 2FZGB 5KT5A 3BDGA 3IP0A 2UUCJ 2Q6CA 2IDEA 2GIQA 2OAUA 2VA2A 2DCLA 1VGYA 2YNIA 4NEZA 4ZVPB 4EMDA 2R2RA 3PDNA 3PNIA 5A8WB 4JV2A 2GZOA 4NYZA 2JJ4D 4K59A 3SMZA 3W9JA 2ZH3A 4R25A 1HBOB 4AUKA 1AUDA 1G2EA 3SDEA 5D3GB 4F2SA 2OD4A 2NXUA 5HAOA 3P49B 3IBCB 4CO4A 3SYZA 2RVJA 2QLFB 4LIWA 1HNVA 2YKMA 4LUBA 3W60A 4HYKA 3C14B 3X3UA 3AB2B 3MFIA 2KTQA 1YQHA 2W1BA 1U1PA 2Z4PA 1AJAA 3CCRS 3MD3A 4ECYA 2E66A 5J1EA 3TR5A 4ZG9A 2UUAJ 2DH9A 1MU2A 2BKNA 2D3ZA 3PX4A 2W4PA 3E01B 4DN0A 3MR6A 2C3OA 1XR6A 2Y0BB 4ICLB 2JEGA 1K7HA 4CZCA 2HPUA 3BSCA 1RWKB 1YBAA 2LMIA 2QJ3A 4IOBA 4QYRA 4RWWA 5AXKA 2KVIA 4DPYA 5IC4B 2BW2A 3V2UC 3MHYA 1QVGR 1XBWA 2NPFA 4CM0A 2XS2A 2W5WA 1YJRA 3NXZA 2QA1A 3LGMA 3CULA 2R7RA 4QU6A 3MAQA 1F1BB 1HR0J 1BWVA 3ET6A 4UOGA 4OI0A 4ED1A 1RACB 1S6QA 1NPRA 5IQ6A 2VPYB 4N7TA 4L72B 1X4CA 4O0NA 4KC5A 3QGPA 8ATCB 2GHWA 5AT1B 2M88A 4ZLNA 4UQTA 5EGYA 2FVRA 4IQXA 1R6VA 4EO6A 1CJKA 2M2BA 2P6TA 2OJ3A 4W92B 2IYGA 2RKIA 1N5QA 3CEDA 3G82B 5KFFA 2AEJA 4CH0S 4JI1J 3GR0A 4XAKA 3JAMU 1GMWD 1AXQA 2JFDA 1JNZB 2FHJA 1OPIA 3QSIA 4KRWA 1H2VZ 1U6FA 1WDTA 2LEAA 5ETSA 3T9ZA 3W8PA 4NXNJ 3NMAA 4MHXA 2CPYA 5DLGA 5EGHA 1IWGA 1WSRA 1NXIA 1TKTB 2IAJB 3KHGA 1SKWA 3OTOF 2DGTA 1Y3JA 3BREA 8AT1B 2F4FA 5ETVA 3NS5A 4CLZA 4QW9A 2CYYA 2XSFA 3SSQA 3W66A 4EEYA 1JWWA 1HBUB 5KG5A 2GQQA 2CVIA 1UW4A 2IMOA 1S59A 3OL7A 1SJQA 4M5IA 2UU9F 1IBKJ 1LW2B 1VJWA 2EVZA 2XB2D 1NK7A 2DHXA 3GG1A 4ZVQB 2AIRB 3TW0A 1C1CB 3R2CJ 1S6OA 3FEXB 3GLJA 4U96A 5BJRA 3ISZA 4IO1A 4OZNA 5B0DA 1WHVA 1UJ4A 1JLGB 4AD6A 3NL0A 3CCES 2BOPA 2Q3PA 1IVZA 3G86A 3ZZPA 2A1BA 4LF6F 2UUAF 4QPXA 1RT4B 5T14A 3SV3A 1X4HA 2CPHA 5E3RA 4DN9A 3F41A 2KHCA 1JXVA 3GU0A 1V9OA 2UVRA 3PFOA 3D1OA 4W98A 3MCNA 1YVFA 2XWYA 3KG1A 2R9LA 4KR0B 2KXNB 1XN9A 3PYGA 1S10A 3GFHA 1KH7A 5E3CA 2PEBA 3M2VA 4DV0F 1VQ9S 4DR3F 1RHKB 2IMWP 4PWWA 2ROGA 4ILMA 3QIDA 2BE2B 3POTA 3KXDA 2UXCF 4KB7A 1HD1A 3W1YC 3M9OB 2PGCA 1NPPA 1LWEA 2XHCA 5GAHI 4RNNA 3NNHA 1TL7A 1S72S 4ZPVR 3D28A 1E33P 1BWEA 2B9WA 3HZEA 4P74A 2KJVA 4J9UE 3IWNC 2C2MB 3K58A 4ZJQA 4NZ0A 4ZDNA 1NJWA 4ID5B 4IFVA 3FVYA 3IAM9 1B70B 5B08A 1QAJA 2L9WA 1RTJB 2H48B 4NCGA 1C0UB 3GSIA 4DV5F 1EKSA 3MI7X 3ZNUA 3I4HX 3GILA 2R7XA 1YRXA 4WU3A 3HK2A 3D0HE 1KKHA 1X7VA 1XERA 4ZHRA 5KT2A 1VS3A 2XYPB 3V6DA 1VCTA 1DLOA 2XRGA 3FKBA 3Q8VA 2MKKA 5FLXY 3B82A 5DM7Q 2AGPA 2XS7A 1EW2A 2JWNA 4U7CA 2QRRA 4A8QA 1S1WB 4R8UB 1RA7A 2AGOA 5CXTA 3KD8A 1DLOB 2RH3A 3PW2A 4C2MA 1Y4ZB 2XZWA 1EAYC 4K5SA 4MK8A 3TNVA 3EPIA 2DXFA 1VQ5S 2DNGA 2UXDF 5KG3A 1KFDA 1RWUA 3R5BA 1T03B 3JXOA 1Y11A 3HZGA 1AROP 2XZTB 3KWMA 5K8MA 1JX4A 4QCLA 1FK9A 3G8SA 4LFCJ 1PCAA 2B9XA 4LSLA 5SUHA 4ECXA 2F9DA 4OX9J 2O67A 4DPXA 2FVSA 1ITPA 4NWJA 3K2YA 1VBKA 2G1HA 4I1TA 4RUBA 2ALYB 2NSCA 2PI4A 1XNRF 3KMQA 1KQGB 1N52B 4BWMA 2B51A 2MY8A 2VF3A 3ZZ0A 1MROB 3DRYA 4FYXB 2B5JA 6AT1B 4OJ1A 3ILOA 5HQ8A 4OZ5A 2KVQE 1NH7A 2IYIA 4F4KA 2QN6B 3EYZA 1BQNA 5DZ6A 2F8EX 3V4IA 3I6PA 2VJVA 4O44A 3FC9A 2IRUA 1ZA1B 4WIIA 3PR4A 4DQSA 5K8PA 4NOHA 5KG1A 2RSQA 2YKAA 1Q8BA 2DNQA 3R5JB 4I0WA 2GNKA 3MMBA 4V19J 1KC8T 1IR2A 2XWXA 2FY8A 3SZZA 2WONB 1RWOB 3OLBA 1LWFA 3K57A 2EI5A 4TN2A 3Q83A 1URNA 1S9EA 3ZO7A 5KXAA 1JLAA 3HD2A 3H4DA 3TVZA 3OL8A 2NXCA 3D0IE 3MM9A 4DV6J 4DL7A 4DV5J 2QL5B 2GJFA 4K0KJ 3W64A 2BM1A 3LAMA 3SXLA 1R6YA 2G2ZA 2XMUA 3TX0A 1RU2A 4QBUA 2XO6A 2WVFA 1CULA 1ZOTA 1Q81T 4HDHA 4P2FA 3A8IA 3FZ2A 1FKPB 2IRXA 3DOMA 1AJBA 2C2RA 3MF5A 3QT6A 3OL9A 5DM6Q 4CLTA 4TXSA 1FNMA 3A3NB 3AXMA 2POKA 1NDKA 2ZM6J 5KFJA 3CCVS 4WP8A 2B9YA 3A52A 4NLUA 4CDIA 3U7JA 5LXYA 2BE7D 1WEZA 2QEXS 4GVLA 1NEEA 2DNRA 4OI6A 4RX6A 4LRBA 1FTCA 3M32B 4ZIWA 3R8YA 4PABA 2M4MA 3TA0A 5KG7A 1F6TA 3Q8PB 2QG9B 2V69A 3TZWA 4CI0B 2K3KA 4MTPA 2V8HA 4FS1A 3DRPA 2FZKB 4USMA 4KBIA 4NCGB 5KFVA 1F2HA 3D67A 1CJUB 2P9GA 3OTCA 1RWWB 3M05A 3HT3A 4DL5A 5HMYA 4MK7A 1C0TA 4P2MA 4K4ZA 3JTOA 2MGZB 2ZHOA 1VQYA 2MJNA 2LQ9A 4I64A 3MK1A 1WUUA 3TJ9A 2UU9J 3S01A 5KFUA 4DR6F 2V94A 2J0SD 4YR1A 4PXCA 1F60B 3OVAA 4Q0BB 3EXCX 3NBPA 3E01A 3NWGA 4Y65A 3Q2TC 1QUPA 2ATLA 3C6UA 3M2UA 2XMVA 1RK8A 4C8OA 3SQGA 3EZ5A 5A0YA 3DLEB 4PQUA 1WI8A 3OBIA 3UN2A 2WHOA 1OY6A 5FJ4A 5DS7A 3QRRA 4ED5A 4QYZK 5IT9Y 2KL8A 2GSUA 2IVMA 4RBUA 3EDQB 3V6JA 6FDRA 1LW0A 3CDUA 1UTAA 1U09A 4CM2A 3G8TA 2UP1A 2ZD1A 1MMNA 2OPQA 1MWQA 3KJFB 1XMQF 1T02A 2ZVSA 1SJ1A 4LF4J 3CJRA 3FGVA 4B9TA 3CJ8A 3MM9B 2C2ZB 4HT5A 1RT6B 1FRJA 1EETB 1AZSA 1F5BA 2BJ3A 2MKSA 2YY3A 3M6UA 2EW9A 2W9CB 1TVRA 2YWKA 1Y7PA 4TYBA 3UPFA 1U48A 4DSKA 1WC3A 2CJYB 2FTRA 1K47A 3LP1A 3M7VA 3SI8A 3NNAA 3OR2A 2GC8A 4Y6IA 3TI0A 4K8RA 2W8KA 5KFEA 3H20A 5DLWA 2HVIA 4WKRA 1GX6A 1RAFB 3IXQA 1UVKA 3KJNB 4LBHA 2KDOA 2WW8A 2O01C 2XS5A 5F8NA 2DEIA 4UORA 3PEJA 1R8AA 3CJQA 2ZNYA 4OMFG 5D4LA 1PYSB 4CYSA 3KLHB 2GIFA 4K4TA 4ECRA 1Y9OA 2B4OA 4IOCQ 2VQEF 3IBFB 1YJTA 2JLGA 2WSCC 2KKHA 3BR9A 3IRXB 4GO5X 5HO4A 4F50A 4ED4A 4OHXA 5BYSA 4DOZA 4LVNP 1UWAA 2W5QA 4K4UA 5FD1A 3WC0A 2OMOA 1XQIA 4RW7A 2ZOFA 2PSZA 3QJJA 1TP7A 3OUYB 3G82A 3HVTA 3J7Z5 4Q7AA 4WZMA 2GO8A 5T7LA 1KVIA 4KJIA 4DX8H 1LW2A 3I0SA 4P71A 1NK4A 2GQ2A 2ROEA 2V4JB 3H8YA 4OZLA 3R27A 3WDOA 4NEYA 2KYXA 2V4RA 1QTMA 3MEDA 5I3PA 4NL5A 2Y3YA 4PWDB 2BJ9A 2MQOA 2K06A 1KBRA 4U6PA 3MWBA 4FPRA 2JLEA 2IM2A 3MOJB 1TL7B 2VU5A 2LU1A 1LWEB 3W61A 2BMBA 3VCDA 3CIZA 2I5JB 3Q86A 4WCEQ 3IR6B 3M32A 3NEKA 4RW7B 4Q8EA 1H72C 4IQMA 3IMQJ 4GKJF 1I51B 3UFCX 1XMOF 2KFYA 3H5YA 3J80U 1TFYA 1EQ0A 1XMQJ 2MKYA 4QU7A 3BSAA 3PX6A 2H9ZA 3OFGA 2YH1A 1GXTA 1JLBB 4OJ3A 3W65A 5KG2A 4N5SA 4F4WA 5D4OA 1MNEA 1RBAA 3W5XA 3WHIA 4USJC 2HFOA 1DARA 2DTJA 5FDLA 1HJKA 2OO4A 4QWCA 2KFNA 3AAWB 1NMEB 1KHJA 3FQLA 1FNOA 5AXLA 4YDDB 1N34J 4AT1B 2R7OA 4XTTA 2GAGC 3IA0A 2DGXA 2KRBA 2OD6A 2W8LA 2KFZA 4GTWA 5T7LB 4DV2J 3ZNJ1 1VQ8S 1RT5A 2CDQA 5HBMB 4WFXA 3OUYA 4NA1A 4PZVA 2JVOA 2CJQA 4NLDA 2N7CA 3JQKA 3IC1A 1FEEA 4UQGA 4LVOP 4LF8J 3KNAA 1UEVA 4XDDA 5J2PA 3W2VA 2VASA 4LSNB 2BYCA 3GYGA 2WBRA 4U9RA 1MMDA 1CLFA 2DNNA 4WTOB 3UR0A 4PG8A 5LT5A 4ZP8A 2ZZNA 3I5AA 4ZCKA 4C48A 2GMHA 1B7YB 4WK1A 4ZPBA 4DBQA 5CAAA 2LA6A 2MHNA 4K4SA 4UPHA 2YQ3A 2BKPA 2DPJA 1YJVA 2HAIA 5DDRC 1KHVA 3CD0A 1NAQA 3MPWA 4AE5A 3CCQS 3HJVA 4UW2A 1TMMA 2V2KA 3VAMA 3UD3P 3C6UB 5CYQA 1S76D 2BEFA 3TAMA 3DHXA 3DLBA 3PX0A 1URAA 5DQIA 1UVNA 3X1LB 5GAEI 1ZA2B 4DCOB 1KHWA 4CNYA 3PZPA 4F3MA 2FC9A 1QTNB 2RJZA 4JI0J 1ZEDA 2WVDA 5DDOC 1SCJB 3NGDA 1X4GA 2D1GA 3NAHA 2R8HA 2GAHC 5DQHA 3L4BC 4QIEA 3M8QA 1R0CB 3FMBA 3TA2A 1F9HA 5C24B 2FJAB 3DRRA 1RXOB 2HVEA 4B3MF 1SQEA 3KLFB 1U1KA 2KB2A 4A46A 4NX9A 3Q8UA 3KK1A 1R8BA 3HM9A 1TL1A 3EZOA 2IUCA 3D5MA 5KG4A 1E2SP 4NWBA 4R0EA 1RBLA 5HJXA 2FPHX 4URGA 3Q8RB 5ETNA 1L3UA 4PUOA 2AZ3A 3BEGB 1ZYQA 5INHA 1HBMB 2MY7A 2XLIA 3CCSS 4LF9F 1YGYA 2W24A 1B0TA 3IGZB 4M5KA 2NCKL 4ETZA 3MR7A 1XNRJ 1GK8A 1UFKA 4JI5F 7FD1A 1Q8KA 4TNOA 4C8NA 3OW2R 2JEIA 3PR5B 3NKYA 1NLKL 2DO0A 3MM6B 4ZHRB 2FYXA 3LANA 3T1AA 1M5VC 4DV7J 1HMVA 3O8WA 1WWHA 5C24A 2JZ5A 3VVTA 1W2BR 3GV5B 1NM2A 2ACYA 2KYZA 1R89A 1RU1A 4EFAC 2EBGA 3CC2S 1T8EA 1SL2A 3IGYB 1IKYA 3RB6A 1UAWA 4PKDB 3HVTB 2BQRA 4NCAA 2Y0SD 1Q79A 3FUYA 4CLWA 1HWJA 3KHLA 6FD1A 4DUYJ 1B7FA 4DMZA 1EHWA 1WF0A 1JXLA 1OO0B 5LSLA 1TZ0A 2VG5B 2LVWA 1MG7A 1U25A 2XI2A 4XDCA 2XQCA 3EVOA 4J9SA 1FJGJ 2ZOGA 3AOBA 2AF6A 3EUNA 4YHHF 2ACMA 3NY0A 1R3NA 1T9UA 2GGPB 3P5TL 3R5AA 4LBIA 4PG5A 1RWPB 2DKOB 4HHUA 4FDFA 4Y28C 1RTHB 3ITHB 4ZS6A 2BV3A 4NLOA 5U47A 4DR7J 3PM9A 4YY3J 4DX7A 1B64A 1GH8A 2R7WA 5C25A 4ZCLA 3M1VB 4ES1A 1ZTTA 1BQNB 4DG1A 4EGLA 2JC0A 2E9TA 3HI9A 1JKHB 2DNYA 3N01A 1CJTB 2OPPA 2QLBB 3NS7B 4PRFA 4I7FB 3UNYA 4BBYA 4OX8A 1WF1A 3LP2B 2J6TA 1K0TA 4MH8A 1FVQA 3SFUA 2KHDA 1CC7A 2QA4G 1B8JA 2G9OA 1PJ7A 4DR3J 4BDPA 1D9AA 1RTIB 2ZD1B 2EKNA 3DOLB 3ISND 4O3PA 1S97A 1VISA 5KFMA 1F9EB 1SVDA 4H4KA 4C7QA 5IT0A 1HBUA 5KT6A 3TARA 3BDGB 3TRGA 4OYBA 4KO0B 2HFSA 4AL6A 4OZ3A 1XR5A 5L1LA 3CSKA 4P72A 1UKUA 4LF5J 4X64F 2HQIA 3BV8A 2SXLA 1RDRA 1YSJA 2CQDA 4LSNA 2HHHJ 4BCAA 5J2PB 1HQEB 4DZDA 2ZUAA 4B08A 3DRSB 4B3RJ 1O8BA 2X98A 4C3KA 3SZYA 4DR2F 2VQRA 2VG6A 2F4VF 3VALA 4B9SA 3PVXA 2Q43A 4EBDA 4EUVA 3BDFA 2C2EA 3NMRA 4V1Ak 3VR1A 1RT1A 2PD1A 1EKRA 1GEHA 3DXSX 2WVEA 4JI8J 2CQCA 4USHA 4DPTA 5DDQC 1PIEA 4CO2A 4ID5A 3VAKA 4NXMF 2EK1A 4OYAA 3I5CA 5L9XA 3OHAA 3G6YA 5KG0A 2DH8A 1FWKA 3I87A 4DR6J 2HGNA 2NYHA 1NK0A 2QA4S 2GSOA 3CNQP 1Q5VA 2AMCB 5IXUA 2CNKB 2JEJA 5IZHA 1Y5IB 3EZUA 3US5A 2WSFC 2B7BB 2MQPA 1M5KC 5I42A 2JVRA 3KLEA 5L0EA 3DCAA 1PG5B 3J7AN 1D3WA 2XMTA 2G0JA 3C8YA 4ZPCA 3TZYA 2LXUA 4NI2B 4Q5VA 2C2KB 3AB4B 4DR5F 2K7KA 4X62F 3MPUB 2A3JA 2PEHA 3UD5A 2B0GA 1CULB 2HQGA 3EMTA 3HSDA 4B3OB 5GMEA 1PYTA 1X5PA 2CQ3A 2LDYA 4MFBB 4DU7A 4F67A 3Q2SC 2I6WA 3CCUS 2HHXA 3MAHA 1BGXT 5ETLA 2BQ3A 2LYVA 4X4VA 4DS5A 1UEKA 3DI6B 1X4FA 1Q16B 2MLZA 2X1AA 3G2XA 4WF9Q 4LT6A 2VPXB 3Q0AA 4LIRA 2EKYA 1R0BG 1C1CA 2RNEA 4ZVRB 1KQFB 3T1YJ 2C3UA 1DQ8A 2BE2A 3AOAA 3POTB 2WONA 3RBEA 2MKHA 2ASLA 4ELUA 4KTQA 1NK8A 3PO5A 2EFQA 1YDLA 1AT1B 4RW9B 5KAKA 2F8MA 2NPIA 2MPUA 2QLXA 5AXMA 1E6YB 3OD2A 3IRXA 1HKAA 2PIIA 3UE2A 2W8DA 2CPJA 1HNWF 2BRLA 2J9DA 3D66A 1JJ2R 4ZVSB 4I4BA 2A18A 3AHPA 1YRUA 1Y3KA 3D6TB 3GB0A 2XYHB 3HLUA 3PYFA 4QIWD 5BXIA 1YZ6A 4J37A 4M8LA 2DD8S 3VAJA 2QIFA 3CTRA 2Y1JA 3AD8C 1RAOA 1ZZNA 3W2VB 2YWHA 4DV7F 1EJ7L 2FUG9 2YKNB 3RR8A 4ELVA 1DBDA 2YPYA 5HP1B 1N2KA 2CPZA 2PO4A 4PPZA 5ETPA 1U1NA 5LSRA 4NLRA 2I5JA 3GJRB 2OFHX 5EX3A 3UDEA 1XMOJ 5A76A 2IJRA 1UWBA 4P7VA 3TUJC 3ED4A 4OX6A 4P75A 2ZH5A 1N0VC 3JAMY 3OVSA 3S8SA 7FDRA 3MMAA 2GVZB 1OWXA 1S1UA 2VBZA 5GVQA 4DI6A 1UA1A 3TUPA 1NHVA 4PYAA 1KOOA 2HRTA 1WKLA 2ZH7A 2FVCA 2VQFF 2CQ4A 4KV8A 3RBZA 3NGSA 3BJYA 1VBXA 1U47A 3V5RA 1IBLF 1DQ9A 3HXMA 3F73A 1E1ZP 4G1QB 4M5DA 4YMEA 1KHNA 1HI1A 3SEOA 5CYMB 3CF5Q 4OYZA 4DV1F 3E2DA 5K20B 2GJ2A 1VQSA 1EX8A 2KI2A 1TKDA 1J5EF 4B3TF 2EFVA 2BM0A 1FDAA 4GKKJ 4GVBA 2XCPA 1AFJA 2DXDA 2XSJB 4ZIVA 2K1RA 2BANB 3HDSA 3VTIA 1HIYA 3A8EA 4Q44A 3Q89A 3I0RA 4DZ6A 2CPIA 1HWLA 4MYTA 3TJ8A 1KWMA 2AYMA 2HK2A 3LAKA 1LV5A 3DPCA 2IUCB 5HL7Q 4B56A 2F1FA 1U7LA 2AEFA 3H5UA 3HVAA 3N6LA 4I6WA 2M8HA 1Q86T 2XMJA 2V4JA 3OJUA 4QQBA 1J5OA 4ANCA 1D0EA 1ALKA 3B4MA 2R3VA 2VFTA 4NA3A 4CO1A 3TVKA 2W7OA 3JTNA 3MDFA 1LWCA 3NS6A 1FRKA 2CG4A 4QR0A 1RAEB 3VGUA 1NJXA 4OX9F 3VAIA 5CYJA 1X9SA 5DO2A 1HWUA 2Q1LA 2P9CA 5E2QA 1F3VA 2DRBA 2ILYA 3DGPA 3TG0A 1VIOA 2ZE2A 2M9KA 4RW8B 3TQ1A 5LSOA 3BZQA 4CT8A 4PPDA 1GTHA 1F9FA 2IM1A 2MKJA 4IFYB 1HNXF 2Y8WA 1OYEA 2F7VA 1NSAA 1QAYA 4JI4J 2K8GA 1WC0A 4R5PB 1BY9A 3J81U 1HD0A 3UCGA 1TL5A 1WOOA 3I31A 1N5TA 3KG0A 4P2XA 2A10A 2P5VA 4HR2A 1CQNA 5G0RB 3I55S 3L9ZA 4HACA 3SDEB 5D3GA 2RRAA 3RB4A 1RB0A 4FF3A 2Z8QA 2VB6A 3H40A 2B5JB 3D1HA 3FSYA 5DGAA 2YKPA 2DNPA 1JLAB 1NH8A 2BW7A 2CPEA 2CJAA 3M8WA 2QLJB 2MLXA 2CPDA 2RDJA 2RU9A 2GQCA 3MMCA 5DLFA 2E5JA 4N8NA 5D8HB 3LP0A 1HDHA
chains in the Genus database with same CATH topology
2W5SA 5INHA 5L0BA 1KH9A 3DYCA 5LRNA 3IGZB 1K7HA 4UORA 1N2LA 4UOOA 3UN3A 1FSUA 5GOVA 2W5WA 3NVLA 1ED9A 4NWJA 3BDGA 1ELZA 3WAXA 2GA3A 4CXKA 3T02A 5GRRA 3TWZA 1O99A 1SHNA 4MIVA 4TN0A 4UPIA 2W8DA 4N7TA 2W5QA 3M8YA 1URBA 3T00A 3IGYB 1ALIA 1AUKA 3MK2A 4LRFA 3UN5A 1AJCA 1P49A 4KM4A 2W5VA 2XR9A 4CXUA 2QZUA 5DLTA 1ALJA 4LR7A 4UOPA 3B5QA 3NKQA 4MHXA 3SZZA 1ELXA 2ANHA 2RH6A 4LR9A 1ELYA 3KD8A 1N2KA 2W5RA 5EGHA 1ANIA 4UPLA 4CYRA 1AJDA 1EI6A 5C66A 4FDJA 5TJ3A 1HQAA 5KXAA 5LIAA 3ED4A 4KJGA 4GTZA 3IDDA 3CMRA 5DLWA 3WAWA 3TX0A 4GTYA 4KAVA 3NKOA 3NKNA 1ZEFA 4FDIA 4QAXA 3UNYA 1KHNA 4LREA 1E1ZP 1AJBA 4KJDA 1EQJA 4ZG7A 1SHQA 5HRTA 3UO0A 1B8JA 3E2DA 4LRCA 3A52A 1EW9A 1HJKA 3WAVA 3WBHA 5L0KA 4LR2A 5LQQA 1KHJA 1ANJA 3LXQA 2W5XA 3BDGB 4CXSA 4LRBA 1EJJA 4GTWA 3T01A 3DPCA 4MY4A 3M8ZA 2G9YA 2IUCB 4B56A 2ZKTA 5AJ9A 1KH7A 3NKRA 2IFYA 1ALKA 4LQYA 5IJSA 1Y7AA 3WAYA 2X98A 5IJQA 3SZYA 2VQRA 1Y6VA 1ALHA 4LR8A 2W8SA 3BDFA 3MK1A 4NWXA 4UPKA 1E33P 4YR1A 5LRMA 1KH4A 3BDHA 3TG0A 2W5TA 1KH5A 1E3CP 1URAA 2GLQA 3UN2A 5EGEA 4LRAA 1ZEDA 3NKPA 2GSUA 2GSNA 2GSOA 2D1GA 2XRGA 4LRDA 3MK0A 1EW2A 1O98A 4UPHA 4KAYA 1EW8A 3NKMA 5L0EA 5DLVA 3OT9A 1KHKA 5K4PA 3M8WA 4ZG6A 1ZEBA 3Q3QA 1AJAA 4CYSA 3M7VA 2IUCA 1E2SP 1KHLA 1ED8A 4GTXA 4ZGAA 4ZG9A 1HDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5S A;  5INH A;  5L0B A;  1KH9 A;  3DYC A;  5LRN A;  3IGZ B;  1K7H A;  4UOR A;  1N2L A;  4UOO A;  3UN3 A;  1FSU A;  5GOV A;  2W5W A;  3NVL A;  1ED9 A;  4NWJ A;  3BDG A;  1ELZ A;  3WAX A;  2GA3 A;  4CXK A;  3T02 A;  5GRR A;  3TWZ A;  1O99 A;  1SHN A;  4MIV A;  4TN0 A;  4UPI A;  2W8D A;  4N7T A;  2W5Q A;  3M8Y A;  1URB A;  3T00 A;  3IGY B;  1ALI A;  1AUK A;  3MK2 A;  4LRF A;  3UN5 A;  1AJC A;  1P49 A;  4KM4 A;  2W5V A;  2XR9 A;  4CXU A;  2QZU A;  5DLT A;  1ALJ A;  4LR7 A;  4UOP A;  3B5Q A;  3NKQ A;  4MHX A;  3SZZ A;  1ELX A;  2ANH A;  2RH6 A;  4LR9 A;  1ELY A;  3KD8 A;  1N2K A;  2W5R A;  5EGH A;  1ANI A;  4UPL A;  4CYR A;  1AJD A;  1EI6 A;  5C66 A;  4FDJ A;  5TJ3 A;  1HQA A;  5KXA A;  5LIA A;  3ED4 A;  4KJG A;  4GTZ A;  3IDD A;  3CMR A;  5DLW A;  3WAW A;  3TX0 A;  4GTY A;  4KAV A;  3NKO A;  3NKN A;  1ZEF A;  4FDI A;  4QAX A;  3UNY A;  1KHN A;  4LRE A;  1E1Z P;  1AJB A;  4KJD A;  1EQJ A;  4ZG7 A;  1SHQ A;  5HRT A;  3UO0 A;  1B8J A;  3E2D A;  4LRC A;  3A52 A;  1EW9 A;  1HJK A;  3WAV A;  3WBH A;  5L0K A;  4LR2 A;  5LQQ A;  1KHJ A;  1ANJ A;  3LXQ A;  2W5X A;  3BDG B;  4CXS A;  4LRB A;  1EJJ A;  4GTW A;  3T01 A;  3DPC A;  4MY4 A;  3M8Z A;  2G9Y A;  2IUC B;  4B56 A;  2ZKT A;  5AJ9 A;  1KH7 A;  3NKR A;  2IFY A;  1ALK A;  4LQY A;  5IJS A;  1Y7A A;  3WAY A;  2X98 A;  5IJQ A;  3SZY A;  2VQR A;  1Y6V A;  1ALH A;  4LR8 A;  2W8S A;  3BDF A;  3MK1 A;  4NWX A;  4UPK A;  1E33 P;  4YR1 A;  5LRM A;  1KH4 A;  3BDH A;  3TG0 A;  2W5T A;  1KH5 A;  1E3C P;  1URA A;  2GLQ A;  3UN2 A;  5EGE A;  4LRA A;  1ZED A;  3NKP A;  2GSU A;  2GSN A;  2GSO A;  2D1G A;  2XRG A;  4LRD A;  3MK0 A;  1EW2 A;  1O98 A;  4UPH A;  4KAY A;  1EW8 A;  3NKM A;  5L0E A;  5DLV A;  3OT9 A;  1KHK A;  5K4P A;  3M8W A;  4ZG6 A;  1ZEB A;  3Q3Q A;  1AJA A;  4CYS A;  3M7V A;  2IUC A;  1E2S P;  1KHL A;  1ED8 A;  4GTX A;  4ZGA A;  4ZG9 A;  1HDH A; 
#chains in the Genus database with same CATH topology
 1JKH A;  1U49 A;  1UEU A;  2WOM B;  3K5L A;  1Q8I A;  5KOW A;  1RAD B;  1ZPW X;  2B6A B;  4CO0 A;  3BSN A;  1J5O B;  1M1G A;  2RHS B;  1KQS R;  4WK3 A;  1X4A A;  3R6G B;  1T03 A;  4ZP9 A;  4YB7 A;  5FDL B;  2WVC A;  3J81 j;  1T0T V;  3VZH A;  3AA8 A;  3NAI A;  3MOZ A;  3VQT A;  2KXH A;  2QFI A;  3SFG A;  1JJ4 A;  1VLO A;  1WC5 A;  4GTX A;  2HHV A;  2XHW A;  4MT1 A;  1FFS B;  1SPB P;  2M52 A;  3I96 A;  4TLR A;  2ZWO A;  4HL9 A;  4Z7Y A;  2N3L A;  4IRC A;  3CC7 S;  2CZ9 A;  1MW7 A;  2CXE A;  3DDN A;  4ZP7 A;  1U4B A;  2ZNZ A;  3HFK A;  4L6V 3;  2E44 A;  3AOD A;  1BD6 A;  3CT9 A;  1AA1 B;  1Q5Y A;  4UOF A;  1S1T A;  3LGN A;  1SH2 A;  4RNO A;  2FJE B;  4OHZ A;  3R5G A;  2CUY A;  1NHU A;  3DOM B;  3GCW P;  2C42 A;  3HKW A;  4M5N A;  4N8O A;  5IT9 U;  1JLQ B;  5RUB A;  1N54 B;  1VQ6 S;  3KJV A;  1F0X A;  3W3S A;  4LF7 F;  1ELX A;  2KT3 A;  3QQC D;  2DCU B;  4W90 B;  5M2P A;  4KGZ B;  2DIV A;  3BS9 A;  4HDG A;  4L75 A;  1WKJ A;  3M8P B;  2W4D A;  3AH6 A;  4PXB A;  2XGP A;  4J9Q A;  2HQD A;  4DUZ J;  4CYR A;  1HAR A;  1UWB B;  2AX1 A;  3A3O B;  3PRV A;  1GMW A;  3JQJ A;  4E2F B;  5DG8 A;  4FF4 A;  4O3O A;  1TKX A;  2DGV A;  2UVU A;  4DR4 J;  3JSY A;  2HLT A;  2IDL A;  1SJ4 P;  2DRA A;  1HHS A;  3S7R A;  3C6T B;  3BN7 A;  4OIX A;  5ETO A;  4C98 A;  5J1E B;  1HYS A;  4QAX A;  4ZJO A;  1F2G A;  1FVS A;  2MB0 B;  2M0G B;  4DL3 A;  3O3L A;  2MHE A;  1PBU A;  3BDE A;  4NA2 A;  1E6V B;  1SIZ A;  2CIM A;  2HAF A;  3B8H A;  1DQA A;  1N8R T;  3VGV A;  4OYO A;  4CIO A;  3IN5 A;  4IRK A;  3PJW A;  3C2P A;  3EVW A;  4ZIT A;  2BR0 A;  3MAA A;  1OY9 A;  1HQA A;  3CDA A;  3MD1 A;  4XO0 A;  3R7B B;  1HLW A;  5LXR A;  4ZOS A;  2H1Y A;  5A2Q U;  1L3V A;  4A8O A;  4Q2M A;  3M9M B;  4N41 A;  2MQM A;  5J2Q B;  3QFW A;  5EWF A;  2FHM A;  2IHR 1;  3W5Y A;  1R43 A;  1RT5 B;  2UUT A;  5HBM A;  5HRO B;  4YR0 A;  2VBY A;  4PG6 A;  5ETT A;  4JB8 B;  4F4Y A;  5CCL A;  3PY8 A;  3M2V B;  4DU8 A;  1SL0 A;  2V8V A;  4IH5 A;  2YNF A;  2J0W A;  4KH0 B;  4DPW A;  2QSF A;  4WKY A;  1VK8 A;  2MZ1 A;  3SV4 A;  5L8R C;  4LR8 A;  1R8C A;  5IFM A;  4CLP A;  1T05 A;  2F8H A;  1RT4 A;  1Q53 A;  1GXL A;  4JP8 A;  2BJE A;  3BYP A;  2V0N A;  1H2U X;  3SQG B;  4DX5 A;  2ZE2 B;  5ETQ A;  2RE1 A;  2J76 E;  3PW0 A;  2AP6 A;  2GO9 A;  4FYW B;  3KTQ A;  4DR4 F;  4RPF A;  3H2U B;  3QT7 A;  3KYL A;  2UXB J;  1IKX B;  2BJ7 A;  2VDH A;  1KLM A;  5KFA A;  4NRT A;  1WG1 A;  2JDJ A;  2RKI B;  4NLG A;  1CJK B;  1RAA B;  1JLF B;  2KO1 A;  3IM9 A;  4C4W A;  1D1U A;  3PHE A;  1Q95 G;  2E5L F;  2WB4 A;  5B0G A;  4IR1 A;  1C0T B;  2D3O R;  4PWD A;  1RP5 A;  2VC0 A;  2QO3 A;  4YR2 A;  2EFG A;  1UPP A;  2HZC A;  3QAE A;  2VIC A;  3CJS A;  2VPZ B;  3SIP B;  3DYA B;  2U1A A;  4EYI B;  4YFU A;  4ZG6 A;  2DNK A;  3ZTR A;  2G13 A;  5L9N A;  4Y0F A;  1NO8 A;  3PJX A;  3IWL A;  4U8Y A;  2CQG A;  2XSJ A;  4KHP J;  3T5H A;  3N6N A;  1UPM B;  3P8B B;  5E41 A;  2IJF A;  1QD1 A;  3TP2 A;  3NG8 A;  1TMJ A;  3ENQ A;  1UVL A;  4ID8 A;  4JUZ A;  3BQ1 A;  4UOO A;  4ILR A;  1TUV A;  1FSU A;  1TL3 A;  2Y1I A;  2LCW A;  1N0U A;  3EGZ A;  3PIO Q;  4WTY A;  4X4S A;  2AHO B;  4F0H A;  1S1V A;  1ELZ A;  3WAX A;  1NSK L;  4FBU A;  3ENW A;  2GX8 A;  2BAC A;  4PG4 A;  1S9F A;  3F44 A;  1I3O B;  3PV8 A;  2ZH9 A;  4DQP A;  3UW1 A;  2ZM6 F;  2HNY B;  2ZVI A;  4NLQ A;  2V9K A;  3DLG B;  1D9F A;  4Z2X A;  3EGN A;  2PA8 D;  5KFH A;  4ELT A;  2DB1 A;  1IKX A;  4YB5 A;  3MK2 A;  4OLP A;  5E7O B;  3LF0 A;  1RTD B;  4DV2 F;  3A4T A;  2AJ0 A;  3OPK A;  4ICL A;  4UUX A;  1H98 A;  1J2V A;  2QL7 B;  3CJ0 A;  4A8S A;  4UOP A;  1NK6 A;  2HUR A;  3GP9 A;  4PEO A;  2RH6 A;  2OPQ B;  2HW3 A;  2J5A A;  2CNN B;  1DY3 A;  3FFI B;  1RWN B;  3KUH A;  2PFD A;  3N9U C;  4GMK A;  4ITS A;  4YDX A;  4ANE A;  5KTQ A;  1WHY A;  1JLC B;  4ERD A;  1UET A;  3C14 A;  3RW6 A;  3IR5 B;  1FHT A;  1Q0N A;  2HWI A;  2OFG X;  2UUB F;  1LOU A;  3LOU A;  3GG0 A;  3OTD A;  4NRU A;  3EXY A;  4RW9 A;  2IJN A;  4J90 A;  1T3O A;  3U02 A;  1XNQ F;  5C42 A;  1QSY A;  1RT3 B;  3P5B P;  4JI3 F;  3OTO J;  2NZ4 A;  2BA9 A;  4P52 A;  1N33 F;  1D8Y A;  2JFK A;  3RR7 A;  4KJD A;  1ACM B;  3GON A;  4ZPA A;  2CRL A;  1EAR A;  2Z2L A;  1LFP A;  1U2F A;  5E33 A;  4ECT A;  4LF4 F;  1EQJ A;  1SHQ A;  1GQE A;  4LRC A;  2VIH A;  2HMI A;  2F4V J;  1Y10 A;  3DRX A;  3SBM A;  2GFF A;  2OML A;  4DLE A;  2OP5 A;  4CLK A;  3OSN A;  1S57 A;  4FYV B;  1F5C A;  2KN4 A;  3OLA A;  2ZBP A;  3BO2 A;  3ONQ A;  2HNZ B;  2BQU A;  2V9W A;  1ZM4 A;  2IM3 A;  2ZC4 A;  3AY0 A;  3T01 A;  4JI8 F;  4DQQ A;  2A6M A;  4DPO A;  2BDP A;  1PC4 A;  2BX6 A;  5KFD A;  3TAQ A;  3KMS A;  3RU0 A;  3QRP A;  5EWG A;  3CDE A;  2XG8 A;  3K5P A;  1NHK L;  5A2Q Y;  5AJ9 A;  2HWT A;  2DVI A;  1P8G A;  2M5Y A;  4RNF A;  3T19 A;  5F3Z A;  4ED3 A;  5E3Q A;  2EFN A;  2QFJ A;  1VYA A;  2J7U A;  5DJB A;  3ZFV A;  5B0C A;  1DZ5 A;  4B02 A;  5LMU J;  3ZXW A;  2AWZ A;  4OI2 A;  2OTJ S;  5CHC B;  5B0E A;  3KOA A;  3KK2 A;  4UZB A;  3V6K A;  2X1G A;  4H4M A;  4UF4 A;  5EX0 A;  4KHM A;  2RUG A;  3FNN A;  4JI7 J;  5IM0 A;  3FQK A;  2IY5 B;  2R2T A;  2M70 A;  4ZVH A;  4FPI A;  2MTL A;  2RRN A;  1TV6 A;  3BGR B;  1Z4U A;  4C6A A;  1S1T B;  1YLX A;  2WBM A;  1FRI A;  2KG0 A;  3D2W A;  3NGU A;  4DR1 F;  2Q6B A;  2JH3 A;  2HFZ A;  2YWW A;  2PFF B;  3I5B A;  2JHE A;  1SH0 A;  2MQL A;  3RBX A;  2UUW A;  4ZP6 A;  4CT9 A;  3PJ9 A;  2VG7 B;  3I9V 9;  4MKA A;  4X65 J;  2CQI A;  1FA0 A;  3OT9 A;  3RAX A;  1BQM B;  3MR2 A;  1C1B B;  2BJD A;  3M9N B;  2QX0 A;  4LSZ B;  5KFL A;  1YIT S;  3ZZT A;  2UXB F;  4A8K A;  1T95 A;  4QWD A;  3KK3 A;  2EG1 A;  3MEG B;  4FKX A;  2DGO A;  2HHT A;  2F3J A;  3CW2 C;  4M1K A;  2XMK A;  4RZR A;  4C8K A;  2XUL A;  4USI A;  5KFR A;  2DH7 A;  2B8Q A;  3W63 A;  1FD8 A;  2DNH A;  2HYI B;  1N2L A;  4IH6 A;  4LFA F;  1G7C B;  3CJ2 A;  3CMQ A;  2FJD B;  5L39 A;  2R7V A;  1S9E B;  1SJ3 P;  2BE9 B;  3KJQ B;  2G1D A;  4DUT A;  4USW A;  1WG4 A;  4X66 J;  3G6E S;  1RBO B;  3C19 A;  4BS2 A;  2V6A A;  4HAC B;  3VVU A;  3T02 A;  5L46 A;  2EK6 A;  3M1V A;  3HHL A;  3D4J A;  4W4M A;  3KDN A;  2RQK A;  4KGV B;  2MZS A;  3Q24 A;  3LUY A;  3GII A;  1AUK A;  1HQ2 A;  2IBK A;  4LF2 A;  3Q8S B;  4Z7C A;  1DTQ B;  5AJ3 J;  4EZ9 A;  1XTZ A;  5DLT A;  2N3O A;  3D6H B;  1UFL A;  4KGK A;  1MN9 A;  2F5G A;  2I9S A;  3UR3 C;  3EPG A;  2I1R A;  2RHQ B;  2V68 A;  3QNW B;  5FII A;  3SZ2 A;  4X4P A;  3TUZ C;  1ANI A;  2X3D A;  2X7I A;  5HN0 A;  4ECQ A;  2OPR B;  3P96 A;  2FHK A;  5F8H A;  2JX2 A;  2W25 A;  3C16 A;  3IR7 B;  2ZWP A;  3N4W A;  4IKA A;  5I4M A;  5DDP C;  1QAI A;  4IO9 Q;  4LF9 J;  1C0U A;  2D3U A;  3IBW A;  1UCN A;  4GTZ A;  1S12 A;  3W2W B;  3CWJ A;  4NXM J;  2APO A;  2CNO B;  4X62 J;  5KOX A;  3EM1 A;  4RUH A;  5H9E K;  4NLW A;  1HI0 P;  2UUC F;  4DUZ F;  2V8G A;  4TY8 A;  3SCI E;  2HVH A;  4OFZ A;  2Q79 A;  3J7Z T;  4RR5 A;  2J8S A;  1ZPV A;  4KQZ A;  3ZC4 A;  3L7U A;  3GJS B;  3UO0 A;  4WFN Q;  3GQC A;  4DV0 J;  1BE4 A;  3QFH A;  5CCM A;  1RT7 A;  1YBU A;  3DKD A;  3WBH A;  2RUS A;  2VFR A;  4DL6 A;  5LQQ A;  1HBN A;  3AD7 C;  3D3C J;  2CKW A;  4NMX A;  3TZX A;  3K8V A;  2AW0 A;  3KLV A;  1RWM B;  1XR7 A;  2DHA A;  2MST A;  2O5D A;  3M6X A;  2CJB A;  5JXS A;  4IOA Q;  3MEK A;  4G6V B;  5AJ3 F;  2MQN A;  1CC8 A;  4AYB D;  2Z0G A;  3J7Y I;  3T41 A;  4DV3 F;  1FFG B;  4ZK7 M;  2FJV A;  2F63 A;  1YX2 A;  2XBP A;  5IJS A;  2LA4 A;  1D09 B;  1JLG A;  2WW4 A;  1J27 A;  3WX8 A;  1KVK A;  4RW6 A;  4ECZ A;  3FK4 A;  3LA0 A;  2OPR A;  3BO4 A;  1TTH B;  3T1Y F;  1V5V A;  4G3I A;  4WFB Q;  4QW8 A;  1T9Y A;  1Y5L B;  4JI3 J;  5HP1 A;  1TVR B;  2KT2 A;  4KPC A;  2H51 B;  3R9L A;  1VR6 A;  1KN6 A;  2PMW A;  3TEH B;  3H5X A;  3CD6 S;  4USK A;  2MKI A;  3PEH A;  1EW8 A;  2YWE A;  2W5T A;  3TJA A;  4DSE A;  1Q4R A;  2C3P A;  2VHG A;  2FIU A;  4HVZ A;  4PR6 A;  2VFV A;  5EGE A;  2VFU A;  3KFW X;  2C3M A;  1IN0 A;  4EZ6 A;  3AJ1 A;  2GSN A;  2NXE A;  2MDA A;  3NOC A;  2KZM A;  3DOK A;  1RAI B;  5A8K B;  1OJ4 A;  3DLE A;  2YNF B;  1GMU A;  5K14 A;  4U7U K;  7AT1 B;  4NXN F;  3DMJ A;  3IRW P;  5HLF B;  4LFC F;  4YQW A;  4YN3 B;  5JMN A;  4LF8 F;  3OR2 B;  2C2O B;  3K5N A;  3PW7 A;  1I1G A;  1QSL A;  2FLP A;  3HHN B;  1WTF A;  2E5H A;  4YEA A;  5GAE U;  1P27 B;  1FNX H;  2M8D B;  5K4P A;  3DLG A;  3P45 B;  4YS2 A;  4DV3 J;  5J2Q A;  1KHL A;  1SC6 A;  2HGM A;  3HX9 A;  4D3G A;  1SQF A;  4XIU A;  2NLW A;  1S5Z A;  4JI4 F;  4LQ3 A;  5M2R A;  2HBQ B;  1ZM9 A;  1FES A;  2CWK A;  2N4D A;  4PXE A;  4WXW A;  4C3L A;  4DV4 F;  3VGS A;  4OZ2 A;  5J1P A;  4OI4 A;  3MED B;  3FZB A;  4ZVT B;  1SXL A;  1CJU A;  5ITH A;  4URQ U;  4TQS A;  3PW5 A;  4X65 F;  2AYB A;  5D0H A;  5GAG I;  3T5K A;  3KG4 A;  4H4K C;  1BUX A;  3WC2 A;  1LKZ A;  2BKO A;  4DR2 J;  2BAB A;  2ZDO A;  4J9V A;  3N5B A;  2O66 A;  1X9W A;  3S6E A;  2V4Q A;  1RSC A;  1GX5 A;  3CB4 A;  3HHE A;  4HHH A;  3ZTQ A;  4ENO A;  2VDI A;  2PMZ D;  1I6J A;  4IRD A;  2V2V A;  1T11 A;  1TKZ A;  3O1L A;  3NBP B;  4X4O A;  3LTO A;  3BKF A;  4OYP A;  2GMJ A;  4HT7 A;  4WP3 A;  3R7S B;  1Q82 T;  4EBE A;  2OTL S;  2LXI A;  4ES2 A;  1UW9 A;  3R1L A;  1RAJ A;  2WAQ D;  3R3T A;  2WB1 D;  1QDU B;  3EE3 A;  4E8U A;  3KKF A;  2XM3 A;  4C9D A;  1S1X B;  2HHQ A;  2ADB A;  4ZVO B;  1BMQ B;  2OLW A;  3NOG A;  1N48 A;  3NNC A;  1TAU A;  3HF5 A;  2W5V A;  2XR9 A;  4IDK A;  1SIW B;  4BLG A;  3P6Y C;  2V8P A;  2WVB A;  3KJV B;  2HHW A;  2LXF A;  4TU9 A;  1ZM2 A;  2UXC J;  2LQB A;  4ZVG A;  3U1L A;  4LR9 A;  1MN7 A;  4FNI A;  5GAD I;  1U2C A;  3BKT A;  1FEH A;  2MMY A;  1S9G A;  3LP1 B;  1W2I A;  4RWX A;  1JXE A;  5HMX A;  4A48 A;  2ZJP Q;  3RAQ A;  3L7O A;  1V6H A;  2CFX A;  2YQ0 A;  4X4N A;  3ADA C;  2ZIT A;  4Y2C A;  1YK9 A;  5BYQ A;  4NLY A;  1FCA A;  3GR1 A;  1FRH A;  4TVA B;  1CJT A;  3VZI A;  4MK9 A;  4J9K A;  4KAV A;  4ZMM A;  3NKO A;  5THW A;  3MMB B;  3CXC R;  1WTB A;  1LW0 B;  1N34 F;  3HO1 A;  5D0G A;  4NML A;  4ZA1 A;  3HSJ A;  1UVJ A;  2ZBC A;  1FKP A;  4A8Y A;  4R5P A;  2VOP A;  2YX4 A;  1T9X A;  3UCZ P;  4ZLP A;  2CAD A;  1ZAX A;  4ZN3 A;  1IKW B;  2Z30 B;  4C11 A;  3QWP A;  3WAV A;  3W8G A;  2QL9 B;  2NSB A;  3M30 B;  5CZX A;  4V19 X;  1VHI A;  5L0K A;  3ENA A;  3O5T B;  2DIT A;  2VG7 A;  4RW8 A;  4K5R A;  3U27 A;  3FSI A;  1ZAW A;  3G6X A;  1X5T A;  1Q1K A;  2HIQ A;  4Y2A A;  4TKT A;  4DSI A;  2CJX B;  3LQV A;  2DNM A;  1HW8 A;  2FGO A;  3HHD A;  5IV4 A;  1T9T A;  3HHL D;  1NKB A;  2KRR A;  5B0F A;  3UCU P;  5KFZ A;  2XNR A;  2ADC A;  2HND B;  1SBR A;  1SH3 A;  3UVJ A;  5C42 B;  1VQO S;  3BDP A;  2XCA A;  1TFW A;  3I4P A;  4DR7 F;  3QT5 A;  3NKR A;  4B9V A;  4KHR A;  1QE1 B;  1R8H A;  4FF1 A;  4ATN A;  1QJH A;  3MTJ A;  3ILJ A;  3CCZ A;  2COL A;  1HNZ J;  4KYZ A;  2HS3 A;  1IBM J;  2QLW A;  1VOM A;  1O5J A;  1BQM A;  5IC6 B;  4K2X A;  1QVF R;  4OYW A;  1TQL A;  3BPS P;  3MCS A;  4N77 A;  3D54 A;  2RDI A;  2RQM A;  4O4G B;  4ZVF A;  2H65 B;  1HNI A;  2K1R B;  4X84 A;  3UDC A;  1IUJ A;  3O44 A;  4JI2 J;  4FBT A;  4GVB B;  1XIQ A;  4HKQ A;  5F0U A;  3FBE A;  1KH5 A;  3P3D A;  2IC3 A;  3M8S A;  1TKX B;  2WSE C;  4C8Z A;  4ZPT R;  1N5Y A;  2XEX A;  2Y9H A;  3D9B A;  4QJV A;  3GFY A;  2LP4 A;  4ZLL A;  3T5J A;  1FER A;  1KDN A;  2HVZ A;  2YH0 A;  4DX6 A;  2AJ1 A;  3NKP A;  2EPI A;  4LSL B;  2R7S A;  1VMB A;  2IRY A;  4G1Q A;  2L3M A;  1N6Q A;  1RCX B;  1TEL A;  3R1H A;  2QMW A;  2KT5 A;  2XTJ P;  2AKW B;  1JQG A;  4LQ9 A;  3JB9 k;  1HMV B;  4O4R A;  2MLY A;  4FVM A;  1VDH A;  1WKK A;  3T6B A;  1N6Q B;  1REG X;  4PYD A;  1S6P A;  5M2U A;  3BYR A;  1TUG B;  2E7V A;  1H74 A;  2FLN A;  2E1R A;  1FRX A;  3I0R B;  1KOH A;  2VBX A;  2MKC A;  3MM7 B;  4FYY B;  4ZPD A;  3TZZ A;  2E5G A;  2OKQ A;  3N5F A;  4HTI A;  3VAF A;  4DPU A;  1H6K X;  1IR1 A;  4CLL A;  3FEY B;  4PWU A;  3HVW A;  3JSM B;  1YBT A;  3OR1 A;  3TAM B;  4B3M J;  1O6X A;  5F8J A;  3DYC A;  5LRN A;  1C2P A;  1LNQ A;  2JL9 A;  3H7H B;  4UUW A;  4DV1 J;  5ETR A;  5D4N A;  4KT0 C;  3UWT A;  1M1H A;  1FX4 A;  1X8D A;  1HPZ A;  4A47 A;  3UNG C;  3G96 A;  4J9L A;  4CH7 A;  3NVL A;  5GOV A;  2X51 A;  3BM7 A;  3IG1 A;  1N36 F;  1S0V A;  3E3X A;  2RS8 A;  3M8Q B;  1N33 J;  2DGQ A;  2WRM A;  1IXK A;  2MZR A;  1E6Y A;  3PW4 A;  3J7A 1;  1IQZ A;  2FVQ A;  3LW5 C;  4LFB J;  1REV B;  3OTB A;  4ECV A;  4RO0 A;  5KFG A;  4J9P A;  2MQ8 A;  1VRU B;  3IAS 9;  2NS1 B;  1R0A B;  1FDB A;  1R7I A;  2X1B A;  3R97 A;  2JEF A;  1P49 A;  5L1I A;  3E2E A;  1FF2 A;  2AV5 A;  4DCP B;  2CZV C;  5DG9 A;  1NZA A;  4P7T A;  4YY3 F;  2AGQ A;  4KKO B;  2VD3 A;  3V81 A;  3GPA A;  2P8I A;  2W7P A;  1FK9 B;  3GJQ B;  4LR7 A;  3UI3 A;  1CPZ A;  4AND A;  5G0R A;  3LWL A;  2GHP A;  2ANH A;  4WYL A;  3BKU A;  1RT2 B;  3LPE A;  3CJT A;  2XY6 A;  3GIR A;  4NLP A;  1T7P A;  1JLC A;  3PTW A;  1U45 A;  1HFE L;  3TX8 A;  2RQC A;  1Y6V A;  3IG1 B;  1HNW J;  2E1M C;  5TJ3 A;  2MYF A;  2R7Q A;  2DGW A;  3A1Y G;  2LEP A;  2H3E B;  2PA3 A;  3AA9 A;  4GRS A;  3PXG a;  5B7W A;  2B56 A;  5CH7 B;  1IBL J;  2YNG A;  5CA5 A;  4BHQ A;  1R8P A;  2GVD B;  2HVD A;  3NKN A;  4FDI A;  3L7P A;  2DGS A;  1RA6 A;  4EK2 A;  1NJY A;  1SUQ B;  2R8I A;  2GV1 A;  1U24 A;  2W2P P;  2CNL B;  3HD1 A;  3B54 A;  1PKU A;  2CQH A;  3THV A;  1C4C A;  3NCR A;  1RAH B;  1P1L A;  2YWF A;  3H2L A;  4K7Q A;  1EW9 A;  2M3D A;  3AJD A;  2VOO A;  2OH2 A;  2CPF A;  1B0V A;  1H2T Z;  2YKQ A;  3F0N A;  2GS8 A;  4OV6 A;  1XC9 A;  1N56 A;  3U1M A;  2ASY A;  1OSC A;  4AL5 A;  1KP6 A;  1UZH A;  2E7X A;  3FDS A;  1RAB B;  3G8Q A;  5HAT A;  2RD5 C;  3ET6 B;  9ATC B;  1YZ7 A;  3HHL C;  3BBF A;  4NI2 A;  2D9P A;  2LLZ A;  2YXL A;  4I6Y A;  5D78 A;  2DY9 A;  5KFW A;  4MY4 A;  2IM0 A;  1WEX A;  2QGF B;  1AB8 A;  3MEC A;  3MUM P;  2HIY A;  4DFP A;  1CEZ A;  5LIA A;  1RYS A;  3H4B A;  5F8I A;  1X4E A;  4JOU A;  2UZA A;  2GVD A;  1YJ9 S;  2DT9 A;  3MEC B;  1LK5 A;  3PRD A;  3RAM A;  3N28 A;  4LF7 J;  4OJG A;  2YWG A;  3DDI A;  2QC3 A;  2CWX A;  2EEY A;  4MKB A;  5LMN J;  1VQK S;  2ZOM A;  2YBV A;  2P6S A;  3M8P A;  3QMQ A;  4Q2L A;  2QZU A;  3VGT A;  4A8X A;  2D41 A;  2IFX A;  2B8P A;  1SI9 A;  5B0A A;  1OY8 A;  3SQO P;  3IWX A;  2FLO A;  1MML A;  2AT1 B;  4DSF A;  3QGI A;  2E7W A;  2FD2 A;  3MM8 A;  4KKO A;  2W5X A;  2VV5 A;  1FXD A;  2DK2 A;  5HRO A;  4KPY A;  4LF6 J;  4OZ0 A;  3LP2 A;  5KFN A;  2FJB B;  2XC9 A;  1TU0 B;  1W25 A;  1NDL A;  1EET A;  2W2M P;  3PRB A;  1JB0 C;  2OHD A;  2W9C A;  1N32 F;  4Y00 A;  1O98 A;  1SKU B;  4CH1 A;  1VBY A;  2AJF E;  5H9F J;  2J6S A;  5A8K A;  3AT1 B;  1HHQ A;  2IIH A;  1ROF A;  3QT8 A;  3T3F A;  3RBD A;  3HHK A;  4RLE A;  2DHH A;  4B9N A;  1VRT A;  1PO6 A;  2C2N A;  2DEJ A;  3QGH A;  4LF1 A;  4DV4 J;  4UY8 T;  1K1S A;  2RF2 B;  4MYU A;  5KG6 A;  1DHM A;  5KFO A;  2NZC A;  2OSQ A;  3GZ7 A;  4ZGA A;  3MPY A;  5BYR A;  3ELH A;  3QLH A;  5C2G A;  5H9E J;  2VA3 A;  2ZBQ A;  2UUB J;  3GTY X;  2WOM A;  3AOC A;  1GTE A;  3Q8Q B;  2ATC B;  3MEE B;  3OR1 B;  2OEL A;  3D6M B;  4OV1 A;  2Z2Z A;  2ZUG A;  2CVE A;  4JV0 A;  2J0X A;  2NXJ A;  3TQE A;  2NYI A;  4M5L A;  5J2N A;  4C8M A;  3Q23 A;  1B99 A;  1KS2 A;  4RW6 B;  1ED9 A;  1UP1 A;  5HMZ A;  1S9G B;  1X60 A;  2AYE A;  2F40 A;  2QMU B;  5CQG A;  2UVV A;  1OSD A;  3HMJ G;  1RYR A;  3RYL A;  3DU6 A;  4CXK A;  2ZFH A;  2DNL A;  4UPI A;  2R8K A;  2CDR B;  1DTT A;  4R0J A;  3MEG A;  2KM8 B;  3W9H A;  2G2O A;  3M8Y A;  5CD4 A;  4F4Z A;  4NCB A;  1NRK A;  3D1Q A;  2UV8 G;  4P6Q A;  4IDK B;  1IJE B;  2HG4 A;  2W9B B;  1P9Y A;  4OI1 A;  3UDV A;  2D9O A;  4LRF A;  1ZM3 A;  4MIA A;  1PC5 A;  2CQ0 A;  4F4A A;  5A0Y B;  4J9O A;  4PQU B;  3RRH A;  4MJK A;  3SSR A;  1AJC A;  3QAT A;  5HI7 A;  3TVY A;  1YIJ S;  2EBE A;  3P4U B;  4Q45 A;  2Y8Y A;  4DCJ B;  2DHG A;  2ZH4 A;  4Z37 A;  3THT A;  1OMS A;  3WZ0 A;  5JVH Q;  2DGU A;  2GJI A;  2HEK A;  3DLK B;  4UST A;  4J5O A;  4J9R A;  1T9W A;  1FT8 A;  1T9V A;  2RIL A;  2VC1 A;  1S49 A;  5EUH A;  1AYE A;  1A9N B;  1QAX A;  4PG7 A;  5C66 A;  3CJ4 A;  3RB0 A;  2OEM A;  3L09 A;  2IBO A;  4I68 A;  4M5G A;  2ZH2 A;  3DLH A;  3GIJ A;  1TAQ A;  3PO4 A;  1WNE A;  1Q78 A;  3L95 X;  4UZC A;  5IM0 B;  3A8J A;  2XGQ A;  3EX7 B;  5CZV A;  1VFJ A;  1K0V A;  1JMT A;  1EIY B;  1JJH A;  2RDD A;  1VQN S;  4F2R A;  3M6V A;  1HBO A;  4GKK F;  1FJ7 A;  4LBP A;  2Y1L B;  1S1X A;  1V5I B;  4B3T J;  2QA2 A;  2NXN A;  4XPE A;  2XLJ A;  2W2N P;  4WPA A;  3GFX A;  1FI4 A;  1KON A;  1R27 B;  2HWH A;  4B17 A;  4DLG A;  3ZTP A;  3GYN A;  4YUD A;  2M7S A;  3FJ2 A;  4O3Q A;  3QBC A;  2VQE J;  4E98 A;  3DLK A;  4WFY A;  5KFI A;  3PHT A;  1VK3 A;  4QR1 A;  2DHS A;  4QWB A;  2KZZ A;  3OFH A;  3A13 A;  1HNI B;  2ZHA A;  3VWS A;  2IA0 A;  4O4G A;  5CYQ B;  1FTR A;  5C7P A;  4E0D A;  2E1P A;  3QLH B;  4NYP A;  1TL1 B;  4DJB A;  2E9Z A;  5HSP A;  2W9B A;  2QZ8 A;  3JTP A;  3O2I A;  4KO0 A;  2FB0 A;  2R2U A;  4QWA A;  4MIW A;  3TEG A;  4X2B A;  4PCQ A;  1FFW B;  4EI2 A;  2R2S A;  2ZKT A;  4I2P A;  4YR3 A;  2B6A A;  3H42 A;  1NKC A;  5D15 A;  4PAA A;  1GMV A;  1VC6 A;  1HWK A;  1CJV A;  2MJU A;  4LQY A;  1RHQ B;  4IG0 A;  3TAP A;  1VQL S;  4H4O A;  2J7K A;  1V3Z A;  2J7W A;  5L1K A;  5L1J A;  1LWX A;  3UD4 P;  4ED2 A;  5IJQ A;  1ALH A;  3E8O A;  5H9F K;  3MZI A;  3RJM B;  1PJ5 A;  1LWF B;  1WI6 A;  1HQU B;  4AFF A;  3HFZ B;  4CLS A;  4Y2M A;  1O51 A;  4D3H A;  2HHP A;  4RU2 A;  1NZ8 A;  3CVK A;  2ZZM A;  1UJ5 A;  5LRM A;  4OYM A;  1X4D A;  1URR A;  2HQ3 A;  4B3O A;  3NGT A;  4LRA A;  2L48 A;  4O44 B;  2GA7 A;  4TLQ A;  2HGL A;  5AE1 A;  1U1Q A;  2V8D A;  4IFY A;  1U1L A;  1A0O B;  1HPZ B;  2OGU A;  2F65 A;  4RW4 A;  4ZVE A;  1TKT A;  1X5O A;  2IAJ A;  5ADZ A;  5KFY A;  2VL1 A;  4TU7 A;  5A8R B;  1SKR A;  3M8R A;  1YKW A;  1KNZ A;  3KLE B;  1EZZ B;  3AD9 C;  2RS2 A;  3U1N A;  5F3T A;  2RAQ A;  1N88 A;  3SCK E;  2VJU A;  1HA1 A;  8RUC A;  4OZ1 A;  3VAG A;  1IKY B;  4ZLJ A;  2EG2 A;  2G0C A;  1ZEB A;  4WWS A;  2I8E A;  2BZ2 A;  2C2D A;  4NZ6 A;  1S6P B;  3ISN C;  4FP9 A;  4BC7 A;  3QZ7 A;  1DRZ A;  5L0B A;  1RTJ A;  4RJV A;  5F9L A;  2W01 A;  3I9Z A;  4M5H A;  2CQ1 A;  1H7W A;  5F9N A;  1RIS A;  4X4T A;  4NPO A;  3UN3 A;  3R5D A;  2IVF B;  4G1P A;  2XI3 A;  3JYT B;  1S0M A;  2IA6 A;  4IR9 A;  1QSS A;  4G1I A;  5HAN A;  3ZTS A;  3CGI A;  4M5M A;  3IO1 A;  3T9N A;  4HLB A;  2L9D A;  5IWA J;  1HBN B;  2GML A;  1PSD A;  3FSX A;  1UFW A;  4URS A;  1ZZF A;  5KFB A;  3QRQ A;  1TKZ B;  4FNH A;  3CCJ S;  5EN1 A;  5F8M A;  4L76 A;  1I5O B;  2JOQ A;  1CQM A;  2YNG B;  3TO8 A;  3BQ0 A;  5DG7 A;  1K8A T;  3RG6 A;  5HVH A;  2HRU A;  2NUU G;  2YTC A;  3OXL A;  4DHV A;  1WC1 A;  3KK1 B;  2HHS A;  3BBC A;  4KFB B;  4UPL A;  4TY8 B;  1H38 A;  2X3G A;  1TK0 A;  4O3N A;  2ALZ A;  2GCF A;  2HKE A;  4UOH A;  3AFG A;  4Y2K A;  5JJB A;  1O0P A;  4A8F A;  3H59 A;  3JSR A;  2E5I A;  4ALZ A;  4M95 A;  3B5Q A;  3QWU A;  4OHV A;  3W5Z A;  3MR3 A;  2XZD B;  3KUE A;  2D7S A;  4QOT A;  2XY7 A;  2W5R A;  1Y00 A;  3LO3 A;  1DJ0 A;  2AX0 A;  2KU7 A;  3DXB A;  3QIP A;  2FVP A;  1EI6 A;  2ZEJ A;  1UZD A;  1SB6 A;  4ZPW R;  1KEK A;  4CO5 A;  4RKU C;  5ETK A;  2HZA A;  3N0V A;  3DDK A;  4USV A;  1REV A;  2DPI A;  3WAW A;  1VI7 A;  1WD6 A;  2A6O A;  1D8Z A;  1XMB A;  2DY1 A;  4KH1 B;  4CQ1 A;  2LQJ A;  2HK3 A;  2R8J A;  2ZH6 A;  4ILL A;  5H1S V;  3CCW A;  1NK5 A;  1ZH5 A;  4C0B A;  3DN9 A;  3FBC A;  4ECW A;  1G6B A;  3DFE A;  5JUM A;  1BXN A;  3OQ2 A;  2C28 A;  4XPC A;  1C1B A;  3CCL S;  1QY7 A;  4JYA J;  1WOS A;  4WFA Q;  4AQY F;  2JSX A;  5E0O A;  4LR2 A;  3CO9 A;  1L3K A;  4WYW A;  1W26 A;  3VQS A;  5I42 B;  3PIP Q;  1L3S A;  1NB7 A;  1UVM A;  2Z2Y B;  4Q0B A;  1G1X A;  3GMG A;  4JI2 F;  5ETM A;  5E5N A;  3MGJ A;  4GO7 X;  2G9Y A;  4YP3 A;  3MM8 B;  1XNQ J;  2O3D A;  1IM6 A;  1LXJ A;  1M0S A;  3CPW R;  4DWI A;  5T41 A;  4M94 A;  1U6B A;  2E9R X;  2ZKU A;  3CUN A;  4CLY A;  2B3T B;  5E3A A;  1ZS6 A;  2MZT A;  3BGF A;  3OV7 A;  3KHR A;  3WAY A;  3EVM A;  1YI2 S;  4QYZ J;  3EGW B;  1NCL A;  3RRG A;  1S77 D;  4YHH J;  1RTH A;  1TL3 B;  4WBF A;  3SSS A;  2L41 A;  5KFC A;  3GIM A;  3Q22 A;  4JI1 F;  1PAU B;  2I38 A;  3RZA A;  3B78 A;  1M5P C;  2PE8 A;  1F3F A;  3M2U B;  2VG6 B;  1RKJ A;  4TQR A;  4AXI A;  2B9E A;  5KFP A;  1UA0 A;  1U1O A;  1WEY A;  2UXD J;  4B3S F;  1E3C P;  1NB2 A;  1RKI A;  2V2Z A;  2K3I A;  3CJK A;  2C3Y A;  4JV5 F;  2BJ8 A;  5C5J A;  4MKV A;  3AQO A;  3QAU A;  2QV6 A;  2BOA A;  3F56 A;  3QO9 B;  3KLG B;  1EQM A;  2CQP A;  2WCX A;  2YKM B;  3O6Q A;  4HH1 A;  2RRB A;  5D0R A;  5C2C A;  3H98 A;  3DRR B;  1NKE A;  1N36 J;  3DOL A;  3LGH A;  1SL1 A;  2NQP A;  4X4U A;  4H4M B;  4DDF A;  1RTI A;  3PCO B;  1TR0 A;  1A7G E;  2A0F B;  1P1T A;  3ILI A;  2VZ9 A;  3VF0 B;  1WG5 A;  4OYI A;  3MMC B;  3EGV A;  4YOE A;  3ZZU A;  4J9N A;  1RHM B;  4KGX B;  5HVF A;  3TAN A;  1YHQ S;  1FD2 A;  3HKZ D;  4DSL A;  1WSV A;  3ZZR A;  2H4Y B;  2W5S A;  1G3O A;  1RLD A;  3S1T A;  5A6P A;  4RUC A;  3IM8 A;  2PMH A;  5IQQ A;  4A4J A;  2D69 A;  4DL2 A;  2R42 A;  4RW4 B;  3NGK A;  3ZZY A;  4F36 A;  3H5S A;  2YNH B;  4CTA A;  4I2P B;  4F3Q A;  5HQL A;  4O3R A;  2R7T A;  4I2Q B;  1M5S A;  1FDD A;  5K5M A;  1VRQ C;  4ED0 A;  1M5H A;  2JRS A;  4F3O A;  1QE1 A;  2VH7 A;  4QPT A;  4ETX A;  2HFV A;  2ZDP A;  1F5A A;  3CIM A;  1GAO A;  5KFS A;  2GGP A;  4K2J A;  3ETM A;  4JI0 F;  5J2M B;  1SHN A;  1B3T A;  2QTW A;  1SJR A;  4NLS A;  1QUV A;  4ZN1 A;  3OJS A;  1R0A A;  5A8W A;  5LOQ A;  4DV6 F;  2YNI B;  1U8S A;  3J81 Y;  1XK8 A;  2OPP B;  2HNY A;  2J9C A;  3BF4 A;  3MEE A;  3UDL A;  1NPK A;  1IKV A;  3NCQ A;  5MLC V;  1GNK A;  1SC4 B;  4Y2I A;  3M30 A;  2P9E A;  1UL3 A;  2AJ2 A;  1IKW A;  1IJF B;  2D1C A;  3KNG A;  3R7N B;  5FLX U;  3LWM A;  3T1H J;  3ZTO A;  5MAO A;  2KJW A;  2V5H G;  2ERR A;  3C66 A;  1MWY A;  1QM9 A;  1NND A;  1Z2Z A;  2B4U A;  3BSO A;  1VRT B;  3BH6 B;  3OFE A;  4WIQ A;  2EC2 A;  2HSE B;  2LKZ A;  4KJG A;  1PAE X;  2IPO B;  3MMJ A;  3CJK B;  3HFV A;  5DGB A;  3K59 A;  1KTQ A;  1U26 A;  1ZTW A;  2V63 A;  1RWX B;  2OSR A;  2XYG B;  1U6Z A;  5K9F A;  1WAC A;  1OQ3 A;  3DHW C;  2JC1 A;  3GFZ A;  1S7H A;  5KFX A;  2OI2 A;  4IG3 A;  4CLU A;  4TY9 A;  5BR8 J;  2WTF A;  2H5E A;  2DJW A;  2MQQ A;  2DYA A;  2D74 B;  1RTD A;  1LWC B;  4OI3 A;  1UMJ A;  4BWJ A;  1DFD A;  2Y1R I;  1FKO B;  3ZZO A;  5HMW A;  2HNZ A;  1FWP A;  2AYG A;  1L3T A;  3N79 A;  4B9U A;  1CBK A;  1DTT B;  2L08 A;  2YX7 A;  2Z56 B;  3IGN A;  4IFV B;  4U67 Q;  1ANJ A;  3LXQ A;  4LMZ A;  1RTZ A;  2J8A A;  1VQP S;  1EJJ A;  1KTV A;  1D9D A;  1TL4 A;  3CJ5 A;  3M8Z A;  1N5Y B;  4OL8 A;  2BAN A;  3AXK A;  4IH7 A;  1K9M T;  4LFB F;  4MMO A;  1SUQ A;  1M1K T;  1NSP A;  4WP9 A;  1RI7 A;  1SV5 B;  2OPS B;  3GYX B;  2YKN A;  2G4B A;  2GW8 A;  5AE3 A;  4AQY J;  3K5O A;  1Y7A A;  5A8R A;  5D77 A;  2FY1 A;  1OQ6 A;  3GWC A;  3K7R A;  4M5D B;  3TA1 A;  3ENV A;  1FXL A;  4ZCI A;  3KLF A;  5JVG Q;  1T05 B;  1RZM A;  4DR1 J;  3H2V E;  2VQF J;  4WE1 A;  4F04 B;  1VJQ A;  1S1U B;  2CQB A;  4RBV A;  4USU A;  1U0H B;  4M5J A;  1RJJ A;  4LF5 F;  1FKA F;  2DO4 A;  4YB6 A;  4XK8 C;  1YJW S;  1N5S A;  1S0O A;  4FS2 A;  2WZ1 A;  4JI7 F;  1YJU A;  2EXU A;  2DNZ A;  3DLJ A;  1XJW B;  1EP4 B;  2ZBR A;  3GCX P;  2BUN A;  1KLM B;  2ABY A;  4I6A A;  3MM5 B;  3J7Y U;  1TK8 A;  3E51 A;  5GMD A;  4C0H A;  4DQR A;  1X0F A;  1J5E J;  1IBC B;  5I3Q A;  3FCV A;  3FCW A;  3DMJ B;  3QPI A;  3PYD A;  4NYO A;  4C0O C;  1Y0H A;  5HLF A;  2HQF A;  4KAY A;  4FVC A;  4C11 B;  1S6U A;  2V34 A;  4L3K A;  3HVR A;  4CCH A;  3NKM A;  2OEK A;  3AQP A;  4P73 A;  4OJH A;  4KY3 A;  3MXH P;  1S7I A;  1NU4 A;  2HHH F;  3RW7 A;  5KT3 A;  1FE4 A;  3I82 A;  1FJE B;  3QJL A;  2R4F A;  1RLC L;  3GSD A;  4L3N A;  3Q3Q A;  3V4I B;  2ZBI A;  3K89 A;  4KFB A;  1S48 A;  2HS4 A;  2DR6 A;  3OXG A;  5KT7 A;  4B3S J;  1VC5 A;  2XY5 A;  3KUG A;  2HBY B;  2FZC B;  4AXJ A;  1FXR A;  3C6T A;  1HYS B;  3WQP A;  4CRJ A;  2Z57 B;  1WJ9 A;  4NLX A;  4CYU A;  1SV5 A;  2HBR B;  3MM5 A;  4DF8 A;  1IBM F;  5IWA F;  5KFQ A;  3QSY B;  5F8L A;  2VKR A;  3QIP B;  4OX7 A;  3PG9 A;  5IS2 A;  1L5U A;  2D3O 1;  1I94 F;  3OVB A;  1OYD A;  1RT6 A;  1IQT A;  4L73 A;  3DYA A;  1IM4 A;  5GRR A;  1SC3 B;  1O99 A;  1KLN A;  4TN0 A;  1KFS A;  3CE8 A;  1S6Q B;  2J0Q D;  4HTJ A;  1AFI A;  2QMX A;  3W2W A;  3I56 S;  3JSB A;  2RU3 A;  2ZC3 A;  3FRZ A;  4FYD A;  1JIH A;  3RB3 A;  1HNX J;  3T00 A;  4MIB A;  4O23 A;  1ALI A;  1WOR A;  3I0S B;  3RRK A;  1P6T A;  2B4V A;  3UN5 A;  3D6F B;  3RUB L;  3H0P A;  1RHR B;  2DR7 A;  4RU9 A;  2CJ9 A;  3A8K A;  1HR0 F;  3DRS A;  1RT7 B;  5D4P A;  4GC6 A;  4CNZ A;  1T94 A;  1APS A;  3NKQ A;  2ZH8 A;  4GC7 A;  3AJ2 A;  1ULR A;  3G4S S;  1RAG B;  4DUY F;  5CYM A;  5GAG U;  2HHU A;  2ZJQ Q;  2FQQ B;  1FDN A;  2A2C A;  3BGU A;  4BC9 A;  4ZCM A;  5E3P A;  3JYT A;  4ECS A;  4ED7 A;  4DF4 A;  1FO1 A;  1U8W A;  2BRK A;  2RT3 A;  4P10 A;  1GFW B;  3Q8Y A;  2ROP A;  4OHY A;  3H25 A;  3BN4 A;  1XEZ A;  2G2Y A;  4ES3 A;  1SJF A;  1QLN A;  1C4A A;  3FEZ A;  4FF2 A;  3IDD A;  2GVZ A;  4MAK A;  1RGV A;  3HHL B;  5GMK a;  3HCX A;  3R2D J;  2J9E A;  2GHV C;  4LJM A;  2EFP A;  1IKV B;  2O1P A;  3NGR A;  3CDB A;  1K1Q A;  2HND A;  2W2Q P;  3UVJ B;  2DNO A;  5B0B A;  1I94 J;  2Z2M A;  1H0H B;  1PYO B;  3NRB A;  5KFK A;  5EWE A;  4JYA F;  1TK5 A;  3T1H F;  3HUL A;  2R8G A;  2FJW A;  3THP A;  5J2N B;  3V6H A;  2J9D E;  4H4O B;  4DFK A;  4EWT A;  3BR8 A;  2KH9 A;  2LDI A;  2ASJ A;  2LEB A;  2AJ4 A;  1BLU A;  2KXF A;  2QSW A;  1Z2L A;  1WDD A;  1X9M A;  3D7S B;  4OLO A;  4MKY A;  2VON A;  4CXS A;  1YJN S;  1YJ7 A;  4PQA A;  1EB0 A;  5C25 B;  1KRP A;  3MUT P;  4AL7 A;  4KHP F;  3TOQ A;  2ZJR Q;  2MXY A;  5EHH A;  4A8W A;  2HFU A;  2VBW A;  3H90 A;  3QYY A;  2PN6 A;  3V81 B;  4N47 A;  2OPS A;  3HJF A;  3RTV A;  2VG5 A;  2CZ4 A;  3CDW A;  5HK4 A;  2HBZ B;  3PFE A;  4DFM A;  5K8O A;  4C8Y A;  1HI8 A;  2W9A A;  3KHH A;  1CS4 B;  1AZS B;  1YWX A;  3M6W A;  2XO7 A;  4NWX A;  3G87 A;  2GIR A;  3CMA S;  4F4X A;  2AJQ A;  5IT4 A;  2W4C A;  4KAI A;  2K2P A;  1R31 A;  4DG1 B;  4MFB A;  4WE1 B;  5J2M A;  4I69 A;  4X4R A;  2EC0 A;  5AE2 A;  1ELO A;  2I0X A;  2WK4 A;  3FBB A;  1LXN A;  4NE9 C;  4WU2 A;  1RUS A;  1VLY A;  9RUB A;  5I3U B;  3KK3 B;  1JLQ A;  1B4S A;  2B4P A;  4RBT A;  4UOC A;  1SQG A;  2LFV A;  3DRP B;  4I2Q A;  1FE0 A;  2NR0 A;  2YNH A;  4CTA B;  2A2D A;  4QIG A;  2MEW A;  4FN5 A;  1Q7Y T;  1PIL A;  3HT0 A;  4LRD A;  2P2C B;  5LJ3 Y;  3DC2 A;  3NP5 A;  4B9M A;  3IGV A;  3IS9 B;  1A6L A;  1DUR A;  2FHO B;  4FKY A;  4QIF A;  4RNH A;  2XNQ A;  2ZZT A;  3MCO A;  5J1N A;  1KQK A;  4DL0 C;  3OXF A;  2KG1 A;  3HPO A;  2NRE A;  4JI5 J;  1MSW D;  1OS5 A;  5DLV A;  4CWB A;  3OHB A;  2VOD A;  4JV1 A;  4OYX A;  2DR9 A;  3G6V A;  1NBE B;  2H5I B;  4J91 A;  2B7C B;  2V2Q A;  1LK7 A;  1WHX A;  2CG8 A;  1TV6 B;  2MZJ A;  2MZQ A;  3BGR A;  4K50 A;  2BXJ A;  2DIS A;  3SCJ E;  2KM8 C;  3GIK A;  4Q8F A;  3DGV A;  2F9J A;  2VKZ G;  4C97 A;  4DR5 J;  2AD9 A;  4KV8 B;  1KH9 A;  1ZBT A;  1K73 T;  2HQC A;  1TUW A;  4J9M A;  1VQ7 S;  4IYQ A;  2DR8 A;  4CLF A;  3HP6 A;  1S4F A;  3BQ2 A;  2DXE A;  3DNC A;  2BJ1 A;  3L3C A;  1ZET A;  1JLF A;  1WF2 A;  1CS4 A;  2RML A;  5AXN A;  5LL6 d;  3HSZ A;  1FWL A;  2JNJ A;  4FZV A;  5F41 A;  1RHJ B;  4UT4 A;  2XLK A;  3HSG A;  4PXD A;  4ED8 A;  3DLL Q;  3NWR A;  3JS9 A;  1YRT A;  3DU5 A;  3MTK A;  3TWZ A;  3R6L B;  5G4D A;  5LM7 E;  5K8N A;  5F0W A;  4B9L A;  1XWL A;  4WJB A;  4KIA A;  2H54 B;  3PKY A;  3VHQ A;  2CPX A;  2H5J B;  1OPZ A;  2L9N A;  4S0M A;  3JQM A;  1GT8 A;  3CME S;  3OSP A;  3G9C A;  1X0P A;  1X4B A;  2LQ5 A;  2RF2 A;  2YPZ A;  2YVS A;  3A3P B;  3D3B J;  3I32 A;  4O0I A;  4IUF A;  2RQ4 A;  4F26 A;  2OIH A;  3DM2 B;  4DQI A;  4EYH B;  2CA9 A;  5LMN F;  2UV8 A;  1S79 A;  5D0E A;  3WBZ A;  4KGM A;  4A8M P;  4WXO A;  2VPW B;  1U2R A;  4F7V A;  2HZV A;  1MRO A;  2OEJ A;  4F25 A;  2BBE A;  2C1E B;  4JI6 F;  2XMW A;  4DS4 A;  1S4E A;  4ZVU B;  1M90 T;  3BB5 A;  3MFH A;  1HWI A;  1NDP A;  5GAH U;  3CCM S;  1CSJ A;  3OTE A;  3G71 S;  1RT3 A;  3MUR P;  1VRU A;  4HEA 9;  4K4W A;  1AUS L;  1H3D A;  2CAJ A;  5B09 A;  4TU8 A;  2HS0 A;  1IBK F;  2W8S A;  1KR4 A;  4U95 A;  4X64 J;  1GXU A;  3B4D A;  1U0H A;  4GTY A;  4UTG A;  4F0M A;  4YB1 P;  3DOK B;  3WX4 A;  1VBZ A;  1Q7L B;  4HI1 A;  2DR5 A;  2RB7 A;  3KLG A;  3D68 A;  1YG0 A;  3GV7 B;  1PGZ A;  1E6V A;  3IFE A;  1RCO B;  1ZAV A;  1FRL A;  4Y3C A;  4ZG7 A;  1U1R A;  4L74 A;  4B3R F;  4RUA A;  1SKS A;  2AEM A;  5D6G A;  4DL4 A;  1JJC B;  1WC4 A;  3MUV P;  3K5M A;  2LEC A;  2CQ2 A;  1MWZ A;  3DGP B;  2G0I A;  2AU0 A;  4I67 A;  1S1W A;  4R8U A;  5BR8 F;  3MPV A;  1HHT P;  3W9I A;  3CO0 P;  3ULH A;  3OFF A;  4M63 A;  4P9S A;  3M2R A;  3K8W A;  5HJY A;  2C22 A;  4U7U D;  1KVJ A;  1NK9 A;  3MM7 A;  4G65 A;  4FXD A;  3DI6 A;  4ZJL A;  3FRY A;  2CJK A;  4C8L A;  1VHF A;  2HLU A;  5DRK A;  2AQ4 A;  1Y5N B;  2YKO A;  1HNZ F;  1LFW A;  1VC0 A;  3C15 A;  3BBB A;  3QGG A;  1VIX A;  4ED6 A;  1S1V B;  1UVI A;  4QZV B;  5CD4 H;  1FJC A;  3FCH A;  1JLB A;  1NJZ A;  3MM6 A;  5HVG A;  2AZ1 A;  5KT4 A;  4OZJ A;  3RGI A;  1H7X A;  1BHN A;  4K4Y A;  4LFA J;  3J80 Y;  2FJX A;  1K44 A;  1N5V A;  4OQJ A;  1OIA A;  1NSQ A;  4UPK A;  2NUH A;  3PAC A;  2FGC A;  3W62 A;  1H73 A;  3A12 A;  3M4X A;  3VAH A;  3BDH A;  1HBM A;  4FXV A;  4DXL A;  4PUO B;  3CD5 A;  2GLQ A;  3V6D B;  3GJT B;  4NLV A;  2PI5 A;  3FBF A;  1CVJ A;  2FLL A;  1DTQ A;  1RE1 B;  3WIV A;  4N76 A;  3LAL A;  2FHJ D;  1JNR B;  2B43 A;  3GE9 A;  2FDN A;  3C15 B;  1FJG F;  1M5O C;  2QE5 A;  3T5L A;  3MK0 A;  4Y34 A;  1RT2 A;  3TYT A;  3FMW A;  2FC8 A;  2JLF A;  2HMI B;  4HH0 A;  3V4M A;  2Q66 A;  2J6U A;  1U02 A;  1AJD A;  3UQS A;  1KHK A;  3LP0 B;  3WIU A;  3K17 A;  5HQM A;  3BH7 B;  4UY8 5;  4GKJ J;  3CCT A;  4RNM A;  2UVW A;  1ED8 A;  3LPY A;  3TUI C;  4K4X A;  4CYU B;  2HRY A;  2LQ8 A;  1S0N A;  3MCM A;  3D0G E;  4I56 A;  5SZT A;  3R5C A;  3K0J A;  1IWA A;  5GAD U;  2XMA A;  3ILL A;  4N56 A;  3CC4 S;  2VUG A;  1LEO A;  4FXW A;  1V3S A;  3DM2 A;  5EDW A;  1N32 J;  3KLH A;  5LMU F;  1HW9 A;  1RHU B;  1HNV B;  2DBB A;  2BVZ A;  4ZKA A;  1FX2 A;  1VQM S;  4QWE A;  1AW0 A;  4ER8 A;  2GA3 A;  3KDO A;  2ILZ A;  2QYG A;  4K0K F;  4TYA A;  3PKM A;  4MIV A;  4EO8 A;  4KE5 A;  4DFJ A;  3GV8 B;  2PDA A;  2YX1 A;  1URB A;  4ECU A;  4Q43 A;  3B6B A;  3ICL A;  1EP4 A;  4CP5 A;  2PT0 A;  1U0S A;  1HL6 A;  2K7J A;  2ASD A;  4I7F A;  4KM4 A;  4JV5 J;  3N6M A;  4IG0 B;  1WEL A;  3BGO P;  4CXU A;  1B0P A;  3CJ3 A;  3EDR B;  4OHW A;  2OUG A;  1ALJ A;  2E1C A;  2DRD A;  3BPD A;  3MAA B;  1DAX A;  1UJ6 A;  2PC6 A;  1WOP A;  1WC6 A;  4U8V A;  1ELY A;  1IR0 A;  3QO9 A;  1FKO A;  3SCL E;  4DSJ A;  2LU2 A;  1T3N A;  1JLE A;  3MR5 A;  1U1M A;  1P9Q C;  4QR2 A;  3MPD A;  4FDJ A;  3NCP A;  3CD7 A;  4NZ7 A;  2XMM A;  3BO3 A;  1N4L A;  3W7B A;  3JSM A;  2W2O P;  4F02 A;  3CMR A;  3QZ8 A;  3ETO A;  4QIV A;  1YTY A;  1HQE A;  4K4V A;  3PYE A;  3OL6 A;  1LQ9 A;  4EBC A;  1ZEF A;  2RIJ A;  1MLA A;  1MU2 B;  1KD1 T;  4CO3 A;  4O3S A;  4LRE A;  2ZHB A;  5L38 A;  2MGZ A;  4X66 F;  3C46 A;  2EFO A;  1PJ6 A;  2QT7 A;  5HRT A;  1G4C A;  2V67 A;  1BQX A;  2N82 B;  3C3L A;  2V50 A;  4P2S A;  5LJ5 Y;  1SC1 B;  3LH2 S;  4X4Q A;  2E5L J;  1NUE A;  4KSE B;  1RT1 B;  1VQ4 S;  2X1F A;  1Z1Z A;  1FRM A;  5DZ7 A;  3KK2 B;  3MMA B;  5F8G A;  3C16 B;  2IVY A;  3BGL A;  2N7Y A;  1NJI T;  1HQU A;  2H4W B;  3VV2 B;  4F8R A;  1JK9 B;  3QJP A;  1NDC A;  3M2R B;  2E1A A;  5DQG A;  1KSP A;  2YQ1 A;  1RWV B;  2Z58 B;  4IG3 B;  4HI2 A;  2EWH A;  4J7C A;  2IC3 B;  1ICE B;  1WHW A;  5KFT A;  1S99 A;  1W7W A;  4JBC A;  4DEZ A;  2U2F A;  4F0K A;  2VFS A;  5CAB A;  2E29 A;  4JI6 J;  1CG2 A;  3IS9 A;  5A6W A;  1CJV B;  2IFY A;  2N4C A;  4HHJ A;  5IV3 A;  3EJM A;  2HFN A;  3NLC A;  5DET A;  1BC6 A;  2MSS A;  5K14 B;  2I2Y A;  4EU0 A;  4WZQ A;  1X31 C;  3KLI B;  3EWG A;  4RL1 A;  2R7U A;  1JLE B;  5IOL A;  4WFZ A;  3EIC A;  4NLT A;  3T6J A;  3ZZZ A;  1X5S A;  2DIU A;  2W7A A;  2ZH1 A;  1Q8L A;  2QYC A;  1PBA A;  4NAS A;  3ITH A;  1V3R A;  5I3U A;  3KLI A;  3FFI A;  4C3M A;  4H54 A;  1KH4 A;  1RQ0 A;  2FZG B;  5KT5 A;  3BDG A;  3IP0 A;  2UUC J;  2Q6C A;  2IDE A;  2GIQ A;  2OAU A;  2VA2 A;  2DCL A;  1VGY A;  2YNI A;  4NEZ A;  4ZVP B;  4EMD A;  2R2R A;  3PDN A;  3PNI A;  5A8W B;  4JV2 A;  2GZO A;  4NYZ A;  2JJ4 D;  4K59 A;  3SMZ A;  3W9J A;  2ZH3 A;  4R25 A;  1HBO B;  4AUK A;  1AUD A;  1G2E A;  3SDE A;  5D3G B;  4F2S A;  2OD4 A;  2NXU A;  5HAO A;  3P49 B;  3IBC B;  4CO4 A;  3SYZ A;  2RVJ A;  2QLF B;  4LIW A;  1HNV A;  2YKM A;  4LUB A;  3W60 A;  4HYK A;  3C14 B;  3X3U A;  3AB2 B;  3MFI A;  2KTQ A;  1YQH A;  2W1B A;  1U1P A;  2Z4P A;  1AJA A;  3CCR S;  3MD3 A;  4ECY A;  2E66 A;  5J1E A;  3TR5 A;  4ZG9 A;  2UUA J;  2DH9 A;  1MU2 A;  2BKN A;  2D3Z A;  3PX4 A;  2W4P A;  3E01 B;  4DN0 A;  3MR6 A;  2C3O A;  1XR6 A;  2Y0B B;  4ICL B;  2JEG A;  1K7H A;  4CZC A;  2HPU A;  3BSC A;  1RWK B;  1YBA A;  2LMI A;  2QJ3 A;  4IOB A;  4QYR A;  4RWW A;  5AXK A;  2KVI A;  4DPY A;  5IC4 B;  2BW2 A;  3V2U C;  3MHY A;  1QVG R;  1XBW A;  2NPF A;  4CM0 A;  2XS2 A;  2W5W A;  1YJR A;  3NXZ A;  2QA1 A;  3LGM A;  3CUL A;  2R7R A;  4QU6 A;  3MAQ A;  1F1B B;  1HR0 J;  1BWV A;  3ET6 A;  4UOG A;  4OI0 A;  4ED1 A;  1RAC B;  1S6Q A;  1NPR A;  5IQ6 A;  2VPY B;  4N7T A;  4L72 B;  1X4C A;  4O0N A;  4KC5 A;  3QGP A;  8ATC B;  2GHW A;  5AT1 B;  2M88 A;  4ZLN A;  4UQT A;  5EGY A;  2FVR A;  4IQX A;  1R6V A;  4EO6 A;  1CJK A;  2M2B A;  2P6T A;  2OJ3 A;  4W92 B;  2IYG A;  2RKI A;  1N5Q A;  3CED A;  3G82 B;  5KFF A;  2AEJ A;  4CH0 S;  4JI1 J;  3GR0 A;  4XAK A;  3JAM U;  1GMW D;  1AXQ A;  2JFD A;  1JNZ B;  2FHJ A;  1OPI A;  3QSI A;  4KRW A;  1H2V Z;  1U6F A;  1WDT A;  2LEA A;  5ETS A;  3T9Z A;  3W8P A;  4NXN J;  3NMA A;  4MHX A;  2CPY A;  5DLG A;  5EGH A;  1IWG A;  1WSR A;  1NXI A;  1TKT B;  2IAJ B;  3KHG A;  1SKW A;  3OTO F;  2DGT A;  1Y3J A;  3BRE A;  8AT1 B;  2F4F A;  5ETV A;  3NS5 A;  4CLZ A;  4QW9 A;  2CYY A;  2XSF A;  3SSQ A;  3W66 A;  4EEY A;  1JWW A;  1HBU B;  5KG5 A;  2GQQ A;  2CVI A;  1UW4 A;  2IMO A;  1S59 A;  3OL7 A;  1SJQ A;  4M5I A;  2UU9 F;  1IBK J;  1LW2 B;  1VJW A;  2EVZ A;  2XB2 D;  1NK7 A;  2DHX A;  3GG1 A;  4ZVQ B;  2AIR B;  3TW0 A;  1C1C B;  3R2C J;  1S6O A;  3FEX B;  3GLJ A;  4U96 A;  5BJR A;  3ISZ A;  4IO1 A;  4OZN A;  5B0D A;  1WHV A;  1UJ4 A;  1JLG B;  4AD6 A;  3NL0 A;  3CCE S;  2BOP A;  2Q3P A;  1IVZ A;  3G86 A;  3ZZP A;  2A1B A;  4LF6 F;  2UUA F;  4QPX A;  1RT4 B;  5T14 A;  3SV3 A;  1X4H A;  2CPH A;  5E3R A;  4DN9 A;  3F41 A;  2KHC A;  1JXV A;  3GU0 A;  1V9O A;  2UVR A;  3PFO A;  3D1O A;  4W98 A;  3MCN A;  1YVF A;  2XWY A;  3KG1 A;  2R9L A;  4KR0 B;  2KXN B;  1XN9 A;  3PYG A;  1S10 A;  3GFH A;  1KH7 A;  5E3C A;  2PEB A;  3M2V A;  4DV0 F;  1VQ9 S;  4DR3 F;  1RHK B;  2IMW P;  4PWW A;  2ROG A;  4ILM A;  3QID A;  2BE2 B;  3POT A;  3KXD A;  2UXC F;  4KB7 A;  1HD1 A;  3W1Y C;  3M9O B;  2PGC A;  1NPP A;  1LWE A;  2XHC A;  5GAH I;  4RNN A;  3NNH A;  1TL7 A;  1S72 S;  4ZPV R;  3D28 A;  1E33 P;  1BWE A;  2B9W A;  3HZE A;  4P74 A;  2KJV A;  4J9U E;  3IWN C;  2C2M B;  3K58 A;  4ZJQ A;  4NZ0 A;  4ZDN A;  1NJW A;  4ID5 B;  4IFV A;  3FVY A;  3IAM 9;  1B70 B;  5B08 A;  1QAJ A;  2L9W A;  1RTJ B;  2H48 B;  4NCG A;  1C0U B;  3GSI A;  4DV5 F;  1EKS A;  3MI7 X;  3ZNU A;  3I4H X;  3GIL A;  2R7X A;  1YRX A;  4WU3 A;  3HK2 A;  3D0H E;  1KKH A;  1X7V A;  1XER A;  4ZHR A;  5KT2 A;  1VS3 A;  2XYP B;  3V6D A;  1VCT A;  1DLO A;  2XRG A;  3FKB A;  3Q8V A;  2MKK A;  5FLX Y;  3B82 A;  5DM7 Q;  2AGP A;  2XS7 A;  1EW2 A;  2JWN A;  4U7C A;  2QRR A;  4A8Q A;  1S1W B;  4R8U B;  1RA7 A;  2AGO A;  5CXT A;  3KD8 A;  1DLO B;  2RH3 A;  3PW2 A;  4C2M A;  1Y4Z B;  2XZW A;  1EAY C;  4K5S A;  4MK8 A;  3TNV A;  3EPI A;  2DXF A;  1VQ5 S;  2DNG A;  2UXD F;  5KG3 A;  1KFD A;  1RWU A;  3R5B A;  1T03 B;  3JXO A;  1Y11 A;  3HZG A;  1ARO P;  2XZT B;  3KWM A;  5K8M A;  1JX4 A;  4QCL A;  1FK9 A;  3G8S A;  4LFC J;  1PCA A;  2B9X A;  4LSL A;  5SUH A;  4ECX A;  2F9D A;  4OX9 J;  2O67 A;  4DPX A;  2FVS A;  1ITP A;  4NWJ A;  3K2Y A;  1VBK A;  2G1H A;  4I1T A;  4RUB A;  2ALY B;  2NSC A;  2PI4 A;  1XNR F;  3KMQ A;  1KQG B;  1N52 B;  4BWM A;  2B51 A;  2MY8 A;  2VF3 A;  3ZZ0 A;  1MRO B;  3DRY A;  4FYX B;  2B5J A;  6AT1 B;  4OJ1 A;  3ILO A;  5HQ8 A;  4OZ5 A;  2KVQ E;  1NH7 A;  2IYI A;  4F4K A;  2QN6 B;  3EYZ A;  1BQN A;  5DZ6 A;  2F8E X;  3V4I A;  3I6P A;  2VJV A;  4O44 A;  3FC9 A;  2IRU A;  1ZA1 B;  4WII A;  3PR4 A;  4DQS A;  5K8P A;  4NOH A;  5KG1 A;  2RSQ A;  2YKA A;  1Q8B A;  2DNQ A;  3R5J B;  4I0W A;  2GNK A;  3MMB A;  4V19 J;  1KC8 T;  1IR2 A;  2XWX A;  2FY8 A;  3SZZ A;  2WON B;  1RWO B;  3OLB A;  1LWF A;  3K57 A;  2EI5 A;  4TN2 A;  3Q83 A;  1URN A;  1S9E A;  3ZO7 A;  5KXA A;  1JLA A;  3HD2 A;  3H4D A;  3TVZ A;  3OL8 A;  2NXC A;  3D0I E;  3MM9 A;  4DV6 J;  4DL7 A;  4DV5 J;  2QL5 B;  2GJF A;  4K0K J;  3W64 A;  2BM1 A;  3LAM A;  3SXL A;  1R6Y A;  2G2Z A;  2XMU A;  3TX0 A;  1RU2 A;  4QBU A;  2XO6 A;  2WVF A;  1CUL A;  1ZOT A;  1Q81 T;  4HDH A;  4P2F A;  3A8I A;  3FZ2 A;  1FKP B;  2IRX A;  3DOM A;  1AJB A;  2C2R A;  3MF5 A;  3QT6 A;  3OL9 A;  5DM6 Q;  4CLT A;  4TXS A;  1FNM A;  3A3N B;  3AXM A;  2POK A;  1NDK A;  2ZM6 J;  5KFJ A;  3CCV S;  4WP8 A;  2B9Y A;  3A52 A;  4NLU A;  4CDI A;  3U7J A;  5LXY A;  2BE7 D;  1WEZ A;  2QEX S;  4GVL A;  1NEE A;  2DNR A;  4OI6 A;  4RX6 A;  4LRB A;  1FTC A;  3M32 B;  4ZIW A;  3R8Y A;  4PAB A;  2M4M A;  3TA0 A;  5KG7 A;  1F6T A;  3Q8P B;  2QG9 B;  2V69 A;  3TZW A;  4CI0 B;  2K3K A;  4MTP A;  2V8H A;  4FS1 A;  3DRP A;  2FZK B;  4USM A;  4KBI A;  4NCG B;  5KFV A;  1F2H A;  3D67 A;  1CJU B;  2P9G A;  3OTC A;  1RWW B;  3M05 A;  3HT3 A;  4DL5 A;  5HMY A;  4MK7 A;  1C0T A;  4P2M A;  4K4Z A;  3JTO A;  2MGZ B;  2ZHO A;  1VQY A;  2MJN A;  2LQ9 A;  4I64 A;  3MK1 A;  1WUU A;  3TJ9 A;  2UU9 J;  3S01 A;  5KFU A;  4DR6 F;  2V94 A;  2J0S D;  4YR1 A;  4PXC A;  1F60 B;  3OVA A;  4Q0B B;  3EXC X;  3NBP A;  3E01 A;  3NWG A;  4Y65 A;  3Q2T C;  1QUP A;  2ATL A;  3C6U A;  3M2U A;  2XMV A;  1RK8 A;  4C8O A;  3SQG A;  3EZ5 A;  5A0Y A;  3DLE B;  4PQU A;  1WI8 A;  3OBI A;  3UN2 A;  2WHO A;  1OY6 A;  5FJ4 A;  5DS7 A;  3QRR A;  4ED5 A;  4QYZ K;  5IT9 Y;  2KL8 A;  2GSU A;  2IVM A;  4RBU A;  3EDQ B;  3V6J A;  6FDR A;  1LW0 A;  3CDU A;  1UTA A;  1U09 A;  4CM2 A;  3G8T A;  2UP1 A;  2ZD1 A;  1MMN A;  2OPQ A;  1MWQ A;  3KJF B;  1XMQ F;  1T02 A;  2ZVS A;  1SJ1 A;  4LF4 J;  3CJR A;  3FGV A;  4B9T A;  3CJ8 A;  3MM9 B;  2C2Z B;  4HT5 A;  1RT6 B;  1FRJ A;  1EET B;  1AZS A;  1F5B A;  2BJ3 A;  2MKS A;  2YY3 A;  3M6U A;  2EW9 A;  2W9C B;  1TVR A;  2YWK A;  1Y7P A;  4TYB A;  3UPF A;  1U48 A;  4DSK A;  1WC3 A;  2CJY B;  2FTR A;  1K47 A;  3LP1 A;  3M7V A;  3SI8 A;  3NNA A;  3OR2 A;  2GC8 A;  4Y6I A;  3TI0 A;  4K8R A;  2W8K A;  5KFE A;  3H20 A;  5DLW A;  2HVI A;  4WKR A;  1GX6 A;  1RAF B;  3IXQ A;  1UVK A;  3KJN B;  4LBH A;  2KDO A;  2WW8 A;  2O01 C;  2XS5 A;  5F8N A;  2DEI A;  4UOR A;  3PEJ A;  1R8A A;  3CJQ A;  2ZNY A;  4OMF G;  5D4L A;  1PYS B;  4CYS A;  3KLH B;  2GIF A;  4K4T A;  4ECR A;  1Y9O A;  2B4O A;  4IOC Q;  2VQE F;  3IBF B;  1YJT A;  2JLG A;  2WSC C;  2KKH A;  3BR9 A;  3IRX B;  4GO5 X;  5HO4 A;  4F50 A;  4ED4 A;  4OHX A;  5BYS A;  4DOZ A;  4LVN P;  1UWA A;  2W5Q A;  4K4U A;  5FD1 A;  3WC0 A;  2OMO A;  1XQI A;  4RW7 A;  2ZOF A;  2PSZ A;  3QJJ A;  1TP7 A;  3OUY B;  3G82 A;  3HVT A;  3J7Z 5;  4Q7A A;  4WZM A;  2GO8 A;  5T7L A;  1KVI A;  4KJI A;  4DX8 H;  1LW2 A;  3I0S A;  4P71 A;  1NK4 A;  2GQ2 A;  2ROE A;  2V4J B;  3H8Y A;  4OZL A;  3R27 A;  3WDO A;  4NEY A;  2KYX A;  2V4R A;  1QTM A;  3MED A;  5I3P A;  4NL5 A;  2Y3Y A;  4PWD B;  2BJ9 A;  2MQO A;  2K06 A;  1KBR A;  4U6P A;  3MWB A;  4FPR A;  2JLE A;  2IM2 A;  3MOJ B;  1TL7 B;  2VU5 A;  2LU1 A;  1LWE B;  3W61 A;  2BMB A;  3VCD A;  3CIZ A;  2I5J B;  3Q86 A;  4WCE Q;  3IR6 B;  3M32 A;  3NEK A;  4RW7 B;  4Q8E A;  1H72 C;  4IQM A;  3IMQ J;  4GKJ F;  1I51 B;  3UFC X;  1XMO F;  2KFY A;  3H5Y A;  3J80 U;  1TFY A;  1EQ0 A;  1XMQ J;  2MKY A;  4QU7 A;  3BSA A;  3PX6 A;  2H9Z A;  3OFG A;  2YH1 A;  1GXT A;  1JLB B;  4OJ3 A;  3W65 A;  5KG2 A;  4N5S A;  4F4W A;  5D4O A;  1MNE A;  1RBA A;  3W5X A;  3WHI A;  4USJ C;  2HFO A;  1DAR A;  2DTJ A;  5FDL A;  1HJK A;  2OO4 A;  4QWC A;  2KFN A;  3AAW B;  1NME B;  1KHJ A;  3FQL A;  1FNO A;  5AXL A;  4YDD B;  1N34 J;  4AT1 B;  2R7O A;  4XTT A;  2GAG C;  3IA0 A;  2DGX A;  2KRB A;  2OD6 A;  2W8L A;  2KFZ A;  4GTW A;  5T7L B;  4DV2 J;  3ZNJ 1;  1VQ8 S;  1RT5 A;  2CDQ A;  5HBM B;  4WFX A;  3OUY A;  4NA1 A;  4PZV A;  2JVO A;  2CJQ A;  4NLD A;  2N7C A;  3JQK A;  3IC1 A;  1FEE A;  4UQG A;  4LVO P;  4LF8 J;  3KNA A;  1UEV A;  4XDD A;  5J2P A;  3W2V A;  2VAS A;  4LSN B;  2BYC A;  3GYG A;  2WBR A;  4U9R A;  1MMD A;  1CLF A;  2DNN A;  4WTO B;  3UR0 A;  4PG8 A;  5LT5 A;  4ZP8 A;  2ZZN A;  3I5A A;  4ZCK A;  4C48 A;  2GMH A;  1B7Y B;  4WK1 A;  4ZPB A;  4DBQ A;  5CAA A;  2LA6 A;  2MHN A;  4K4S A;  4UPH A;  2YQ3 A;  2BKP A;  2DPJ A;  1YJV A;  2HAI A;  5DDR C;  1KHV A;  3CD0 A;  1NAQ A;  3MPW A;  4AE5 A;  3CCQ S;  3HJV A;  4UW2 A;  1TMM A;  2V2K A;  3VAM A;  3UD3 P;  3C6U B;  5CYQ A;  1S76 D;  2BEF A;  3TAM A;  3DHX A;  3DLB A;  3PX0 A;  1URA A;  5DQI A;  1UVN A;  3X1L B;  5GAE I;  1ZA2 B;  4DCO B;  1KHW A;  4CNY A;  3PZP A;  4F3M A;  2FC9 A;  1QTN B;  2RJZ A;  4JI0 J;  1ZED A;  2WVD A;  5DDO C;  1SCJ B;  3NGD A;  1X4G A;  2D1G A;  3NAH A;  2R8H A;  2GAH C;  5DQH A;  3L4B C;  4QIE A;  3M8Q A;  1R0C B;  3FMB A;  3TA2 A;  1F9H A;  5C24 B;  2FJA B;  3DRR A;  1RXO B;  2HVE A;  4B3M F;  1SQE A;  3KLF B;  1U1K A;  2KB2 A;  4A46 A;  4NX9 A;  3Q8U A;  3KK1 A;  1R8B A;  3HM9 A;  1TL1 A;  3EZO A;  2IUC A;  3D5M A;  5KG4 A;  1E2S P;  4NWB A;  4R0E A;  1RBL A;  5HJX A;  2FPH X;  4URG A;  3Q8R B;  5ETN A;  1L3U A;  4PUO A;  2AZ3 A;  3BEG B;  1ZYQ A;  5INH A;  1HBM B;  2MY7 A;  2XLI A;  3CCS S;  4LF9 F;  1YGY A;  2W24 A;  1B0T A;  3IGZ B;  4M5K A;  2NCK L;  4ETZ A;  3MR7 A;  1XNR J;  1GK8 A;  1UFK A;  4JI5 F;  7FD1 A;  1Q8K A;  4TNO A;  4C8N A;  3OW2 R;  2JEI A;  3PR5 B;  3NKY A;  1NLK L;  2DO0 A;  3MM6 B;  4ZHR B;  2FYX A;  3LAN A;  3T1A A;  1M5V C;  4DV7 J;  1HMV A;  3O8W A;  1WWH A;  5C24 A;  2JZ5 A;  3VVT A;  1W2B R;  3GV5 B;  1NM2 A;  2ACY A;  2KYZ A;  1R89 A;  1RU1 A;  4EFA C;  2EBG A;  3CC2 S;  1T8E A;  1SL2 A;  3IGY B;  1IKY A;  3RB6 A;  1UAW A;  4PKD B;  3HVT B;  2BQR A;  4NCA A;  2Y0S D;  1Q79 A;  3FUY A;  4CLW A;  1HWJ A;  3KHL A;  6FD1 A;  4DUY J;  1B7F A;  4DMZ A;  1EHW A;  1WF0 A;  1JXL A;  1OO0 B;  5LSL A;  1TZ0 A;  2VG5 B;  2LVW A;  1MG7 A;  1U25 A;  2XI2 A;  4XDC A;  2XQC A;  3EVO A;  4J9S A;  1FJG J;  2ZOG A;  3AOB A;  2AF6 A;  3EUN A;  4YHH F;  2ACM A;  3NY0 A;  1R3N A;  1T9U A;  2GGP B;  3P5T L;  3R5A A;  4LBI A;  4PG5 A;  1RWP B;  2DKO B;  4HHU A;  4FDF A;  4Y28 C;  1RTH B;  3ITH B;  4ZS6 A;  2BV3 A;  4NLO A;  5U47 A;  4DR7 J;  3PM9 A;  4YY3 J;  4DX7 A;  1B64 A;  1GH8 A;  2R7W A;  5C25 A;  4ZCL A;  3M1V B;  4ES1 A;  1ZTT A;  1BQN B;  4DG1 A;  4EGL A;  2JC0 A;  2E9T A;  3HI9 A;  1JKH B;  2DNY A;  3N01 A;  1CJT B;  2OPP A;  2QLB B;  3NS7 B;  4PRF A;  4I7F B;  3UNY A;  4BBY A;  4OX8 A;  1WF1 A;  3LP2 B;  2J6T A;  1K0T A;  4MH8 A;  1FVQ A;  3SFU A;  2KHD A;  1CC7 A;  2QA4 G;  1B8J A;  2G9O A;  1PJ7 A;  4DR3 J;  4BDP A;  1D9A A;  1RTI B;  2ZD1 B;  2EKN A;  3DOL B;  3ISN D;  4O3P A;  1S97 A;  1VIS A;  5KFM A;  1F9E B;  1SVD A;  4H4K A;  4C7Q A;  5IT0 A;  1HBU A;  5KT6 A;  3TAR A;  3BDG B;  3TRG A;  4OYB A;  4KO0 B;  2HFS A;  4AL6 A;  4OZ3 A;  1XR5 A;  5L1L A;  3CSK A;  4P72 A;  1UKU A;  4LF5 J;  4X64 F;  2HQI A;  3BV8 A;  2SXL A;  1RDR A;  1YSJ A;  2CQD A;  4LSN A;  2HHH J;  4BCA A;  5J2P B;  1HQE B;  4DZD A;  2ZUA A;  4B08 A;  3DRS B;  4B3R J;  1O8B A;  2X98 A;  4C3K A;  3SZY A;  4DR2 F;  2VQR A;  2VG6 A;  2F4V F;  3VAL A;  4B9S A;  3PVX A;  2Q43 A;  4EBD A;  4EUV A;  3BDF A;  2C2E A;  3NMR A;  4V1A k;  3VR1 A;  1RT1 A;  2PD1 A;  1EKR A;  1GEH A;  3DXS X;  2WVE A;  4JI8 J;  2CQC A;  4USH A;  4DPT A;  5DDQ C;  1PIE A;  4CO2 A;  4ID5 A;  3VAK A;  4NXM F;  2EK1 A;  4OYA A;  3I5C A;  5L9X A;  3OHA A;  3G6Y A;  5KG0 A;  2DH8 A;  1FWK A;  3I87 A;  4DR6 J;  2HGN A;  2NYH A;  1NK0 A;  2QA4 S;  2GSO A;  3CNQ P;  1Q5V A;  2AMC B;  5IXU A;  2CNK B;  2JEJ A;  5IZH A;  1Y5I B;  3EZU A;  3US5 A;  2WSF C;  2B7B B;  2MQP A;  1M5K C;  5I42 A;  2JVR A;  3KLE A;  5L0E A;  3DCA A;  1PG5 B;  3J7A N;  1D3W A;  2XMT A;  2G0J A;  3C8Y A;  4ZPC A;  3TZY A;  2LXU A;  4NI2 B;  4Q5V A;  2C2K B;  3AB4 B;  4DR5 F;  2K7K A;  4X62 F;  3MPU B;  2A3J A;  2PEH A;  3UD5 A;  2B0G A;  1CUL B;  2HQG A;  3EMT A;  3HSD A;  4B3O B;  5GME A;  1PYT A;  1X5P A;  2CQ3 A;  2LDY A;  4MFB B;  4DU7 A;  4F67 A;  3Q2S C;  2I6W A;  3CCU S;  2HHX A;  3MAH A;  1BGX T;  5ETL A;  2BQ3 A;  2LYV A;  4X4V A;  4DS5 A;  1UEK A;  3DI6 B;  1X4F A;  1Q16 B;  2MLZ A;  2X1A A;  3G2X A;  4WF9 Q;  4LT6 A;  2VPX B;  3Q0A A;  4LIR A;  2EKY A;  1R0B G;  1C1C A;  2RNE A;  4ZVR B;  1KQF B;  3T1Y J;  2C3U A;  1DQ8 A;  2BE2 A;  3AOA A;  3POT B;  2WON A;  3RBE A;  2MKH A;  2ASL A;  4ELU A;  4KTQ A;  1NK8 A;  3PO5 A;  2EFQ A;  1YDL A;  1AT1 B;  4RW9 B;  5KAK A;  2F8M A;  2NPI A;  2MPU A;  2QLX A;  5AXM A;  1E6Y B;  3OD2 A;  3IRX A;  1HKA A;  2PII A;  3UE2 A;  2W8D A;  2CPJ A;  1HNW F;  2BRL A;  2J9D A;  3D66 A;  1JJ2 R;  4ZVS B;  4I4B A;  2A18 A;  3AHP A;  1YRU A;  1Y3K A;  3D6T B;  3GB0 A;  2XYH B;  3HLU A;  3PYF A;  4QIW D;  5BXI A;  1YZ6 A;  4J37 A;  4M8L A;  2DD8 S;  3VAJ A;  2QIF A;  3CTR A;  2Y1J A;  3AD8 C;  1RAO A;  1ZZN A;  3W2V B;  2YWH A;  4DV7 F;  1EJ7 L;  2FUG 9;  2YKN B;  3RR8 A;  4ELV A;  1DBD A;  2YPY A;  5HP1 B;  1N2K A;  2CPZ A;  2PO4 A;  4PPZ A;  5ETP A;  1U1N A;  5LSR A;  4NLR A;  2I5J A;  3GJR B;  2OFH X;  5EX3 A;  3UDE A;  1XMO J;  5A76 A;  2IJR A;  1UWB A;  4P7V A;  3TUJ C;  3ED4 A;  4OX6 A;  4P75 A;  2ZH5 A;  1N0V C;  3JAM Y;  3OVS A;  3S8S A;  7FDR A;  3MMA A;  2GVZ B;  1OWX A;  1S1U A;  2VBZ A;  5GVQ A;  4DI6 A;  1UA1 A;  3TUP A;  1NHV A;  4PYA A;  1KOO A;  2HRT A;  1WKL A;  2ZH7 A;  2FVC A;  2VQF F;  2CQ4 A;  4KV8 A;  3RBZ A;  3NGS A;  3BJY A;  1VBX A;  1U47 A;  3V5R A;  1IBL F;  1DQ9 A;  3HXM A;  3F73 A;  1E1Z P;  4G1Q B;  4M5D A;  4YME A;  1KHN A;  1HI1 A;  3SEO A;  5CYM B;  3CF5 Q;  4OYZ A;  4DV1 F;  3E2D A;  5K20 B;  2GJ2 A;  1VQS A;  1EX8 A;  2KI2 A;  1TKD A;  1J5E F;  4B3T F;  2EFV A;  2BM0 A;  1FDA A;  4GKK J;  4GVB A;  2XCP A;  1AFJ A;  2DXD A;  2XSJ B;  4ZIV A;  2K1R A;  2BAN B;  3HDS A;  3VTI A;  1HIY A;  3A8E A;  4Q44 A;  3Q89 A;  3I0R A;  4DZ6 A;  2CPI A;  1HWL A;  4MYT A;  3TJ8 A;  1KWM A;  2AYM A;  2HK2 A;  3LAK A;  1LV5 A;  3DPC A;  2IUC B;  5HL7 Q;  4B56 A;  2F1F A;  1U7L A;  2AEF A;  3H5U A;  3HVA A;  3N6L A;  4I6W A;  2M8H A;  1Q86 T;  2XMJ A;  2V4J A;  3OJU A;  4QQB A;  1J5O A;  4ANC A;  1D0E A;  1ALK A;  3B4M A;  2R3V A;  2VFT A;  4NA3 A;  4CO1 A;  3TVK A;  2W7O A;  3JTN A;  3MDF A;  1LWC A;  3NS6 A;  1FRK A;  2CG4 A;  4QR0 A;  1RAE B;  3VGU A;  1NJX A;  4OX9 F;  3VAI A;  5CYJ A;  1X9S A;  5DO2 A;  1HWU A;  2Q1L A;  2P9C A;  5E2Q A;  1F3V A;  2DRB A;  2ILY A;  3DGP A;  3TG0 A;  1VIO A;  2ZE2 A;  2M9K A;  4RW8 B;  3TQ1 A;  5LSO A;  3BZQ A;  4CT8 A;  4PPD A;  1GTH A;  1F9F A;  2IM1 A;  2MKJ A;  4IFY B;  1HNX F;  2Y8W A;  1OYE A;  2F7V A;  1NSA A;  1QAY A;  4JI4 J;  2K8G A;  1WC0 A;  4R5P B;  1BY9 A;  3J81 U;  1HD0 A;  3UCG A;  1TL5 A;  1WOO A;  3I31 A;  1N5T A;  3KG0 A;  4P2X A;  2A10 A;  2P5V A;  4HR2 A;  1CQN A;  5G0R B;  3I55 S;  3L9Z A;  4HAC A;  3SDE B;  5D3G A;  2RRA A;  3RB4 A;  1RB0 A;  4FF3 A;  2Z8Q A;  2VB6 A;  3H40 A;  2B5J B;  3D1H A;  3FSY A;  5DGA A;  2YKP A;  2DNP A;  1JLA B;  1NH8 A;  2BW7 A;  2CPE A;  2CJA A;  3M8W A;  2QLJ B;  2MLX A;  2CPD A;  2RDJ A;  2RU9 A;  2GQC A;  3MMC A;  5DLF A;  2E5J A;  4N8N A;  5D8H B;  3LP0 A;  1HDH A; 
#chains in the Genus database with same CATH homology
 2W5S A;  5INH A;  5L0B A;  1KH9 A;  3DYC A;  5LRN A;  3IGZ B;  1K7H A;  4UOR A;  1N2L A;  4UOO A;  3UN3 A;  1FSU A;  5GOV A;  2W5W A;  3NVL A;  1ED9 A;  4NWJ A;  3BDG A;  1ELZ A;  3WAX A;  2GA3 A;  4CXK A;  3T02 A;  5GRR A;  3TWZ A;  1O99 A;  1SHN A;  4MIV A;  4TN0 A;  4UPI A;  2W8D A;  4N7T A;  2W5Q A;  3M8Y A;  1URB A;  3T00 A;  3IGY B;  1ALI A;  1AUK A;  3MK2 A;  4LRF A;  3UN5 A;  1AJC A;  1P49 A;  4KM4 A;  2W5V A;  2XR9 A;  4CXU A;  2QZU A;  5DLT A;  1ALJ A;  4LR7 A;  4UOP A;  3B5Q A;  3NKQ A;  4MHX A;  3SZZ A;  1ELX A;  2ANH A;  2RH6 A;  4LR9 A;  1ELY A;  3KD8 A;  1N2K A;  2W5R A;  5EGH A;  1ANI A;  4UPL A;  4CYR A;  1AJD A;  1EI6 A;  5C66 A;  4FDJ A;  5TJ3 A;  1HQA A;  5KXA A;  5LIA A;  3ED4 A;  4KJG A;  4GTZ A;  3IDD A;  3CMR A;  5DLW A;  3WAW A;  3TX0 A;  4GTY A;  4KAV A;  3NKO A;  3NKN A;  1ZEF A;  4FDI A;  4QAX A;  3UNY A;  1KHN A;  4LRE A;  1E1Z P;  1AJB A;  4KJD A;  1EQJ A;  4ZG7 A;  1SHQ A;  5HRT A;  3UO0 A;  1B8J A;  3E2D A;  4LRC A;  3A52 A;  1EW9 A;  1HJK A;  3WAV A;  3WBH A;  5L0K A;  4LR2 A;  5LQQ A;  1KHJ A;  1ANJ A;  3LXQ A;  2W5X A;  3BDG B;  4CXS A;  4LRB A;  1EJJ A;  4GTW A;  3T01 A;  3DPC A;  4MY4 A;  3M8Z A;  2G9Y A;  2IUC B;  4B56 A;  2ZKT A;  5AJ9 A;  1KH7 A;  3NKR A;  2IFY A;  1ALK A;  4LQY A;  5IJS A;  1Y7A A;  3WAY A;  2X98 A;  5IJQ A;  3SZY A;  2VQR A;  1Y6V A;  1ALH A;  4LR8 A;  2W8S A;  3BDF A;  3MK1 A;  4NWX A;  4UPK A;  1E33 P;  4YR1 A;  5LRM A;  1KH4 A;  3BDH A;  3TG0 A;  2W5T A;  1KH5 A;  1E3C P;  1URA A;  2GLQ A;  3UN2 A;  5EGE A;  4LRA A;  1ZED A;  3NKP A;  2GSU A;  2GSN A;  2GSO A;  2D1G A;  2XRG A;  4LRD A;  3MK0 A;  1EW2 A;  1O98 A;  4UPH A;  4KAY A;  1EW8 A;  3NKM A;  5L0E A;  5DLV A;  3OT9 A;  1KHK A;  5K4P A;  3M8W A;  4ZG6 A;  1ZEB A;  3Q3Q A;  1AJA A;  4CYS A;  3M7V A;  2IUC A;  1E2S P;  1KHL A;  1ED8 A;  4GTX A;  4ZGA A;  4ZG9 A;  1HDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...