3UN3A

Phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un3A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un3A01
1O98A 4FDJA 4KAYA 1FSUA 3TG0A 2W5RA 2X98A 4ZG6A 5INHA 4UOOA 1ED9A 4ZGAA 5C66A 1ANJA 5LQQA 1KHJA 1HQAA 1KH9A 3UO0A 1N2LA 4N7TA 5LIAA 2GSNA 3UNYA 4FDIA 1EI6A 2W5VA 4LR7A 3M8ZA 4UOPA 1ALIA 1Y6VA 1K7HA 1ZEBA 1EW2A 3E2DA 4LRFA 3LXQA 3OT9A 4KAVA 3NKPA 5L0EA 1Y7AA 2GSUA 3NKQA 4UPKA 4UORA 3UN3A 2W8SA 2QZUA 3ED4A 4LR2A 1EJJA 5DLTA 5HRTA 1KH4A 3NKRA 4CYRA 3WBHA 2IFYA 3DPCA 1ALHA 1ZEDA 3BDGA 5IJQA 3WAYA 5KXAA 2W5TA 4NWJA 3A52A 4GTYA 4KM4A 2G9YA 1ELXA 3DYCA 4QAXA 4UPHA 4KJGA 4TN0A 3T01A 5LRMA 5K4PA 1URAA 1ALKA 2XRGA 4KJDA 3TWZA 4UPIA 3MK1A 3M7VA 3UN5A 3M8WA 1E2SP 4MHXA 2ANHA 1KH7A 4LQYA 1E1ZP 2IUCA 3NVLA 1ANIA 1AJCA 3B5QA 1KH5A 4CXKA 1ED8A 1EW9A 2D1GA 4NWXA 5EGHA 4YR1A 1AUKA 4LRCA 3T02A 1URBA 3IDDA 2W5WA 1B8JA 1HJKA 5DLWA 4LRBA 5LRNA 4UPLA 3Q3QA 5L0KA 3BDFA 3BDHA 5AJ9A 3IGZB 3T00A 4GTZA 4MY4A 4CXSA 5DLVA 3KD8A 1ELZA 4LR8A 2ZKTA 5GOVA 1AJAA 3SZZA 3UN2A 4LRAA 1KHNA 1AJBA 3WAVA 5L0BA 2W5SA 3NKOA 2W5QA 3M8YA 1EQJA 4MIVA 1SHQA 2W5XA 1ELYA 2XR9A 3NKNA 4CXUA 4CYSA 2GSOA 3SZYA 2GLQA 3CMRA 1N2KA 1KHLA 1SHNA 2IUCB 3MK2A 3NKMA 3MK0A 1ZEFA 2VQRA 1AJDA 1E3CP 3WAWA 4B56A 3IGYB 4ZG9A 4LREA 1P49A 5EGEA 5GRRA 4ZG7A 4LR9A 2RH6A 5IJSA 1HDHA 4LRDA 4GTXA 1E33P 3TX0A 4GTWA 5TJ3A 1EW8A 3BDGB 1ALJA 1KHKA 2GA3A 1O99A 3WAXA 2W8DA
chains in the Genus database with same CATH superfamily
4FPIA 1VQSA 2P9GA 4ZS6A 4NZ7A 2AZ3A 2IA0A 2FHJD 3PKYA 3IFEA 4EBDA 5HVHA 3AQPA 3FFIB 2V0NA 2UZAA 2HQCA 4IFYB 5F0WA 2XYHB 2D41A 3IBWA 4C48A 2HLUA 1UJ5A 4HKQA 1UZHA 2KHCA 4KHMA 2F8HA 2MTLA 1YG0A 5DZ7A 3TUIC 4TY8A 4GVBA 1AUKA 3MUTP 1XWLA 3D66A 2A1BA 3AOAA 5ETOA 3BGLA 3BDHA 3UCUP 5BR8F 1VC0A 1JIHA 4OQJA 1ZS6A 2DRBA 3V6KA 4ZIWA 2HNZB 2G0CA 2W5QA 1KVJA 5C7PA 3H5XA 2OI2A 3C6UB 1X4CA 3ZZUA 4MK8A 3KYLA 3CCUS 3HI9A 1BGXT 1HWIA 5E3CA 1WC4A 1WI6A 4I7FA 3GIRA 5LMUF 1WDTA 2GMHA 1V3RA 4WE1A 4J9PA 4KTQA 1XQIA 4UOFA 3MCSA 3KJFB 4I2QA 2DJWA 2R7QA 2J6TA 1UL3A 4DS5A 1EARA 2APOA 3E2DA 1HWJA 1Y5LB 3D0HE 5EWGA 1C1BA 3U1LA 3DYAB 3SCIE 1QLNA 2W5TA 3BQ1A 1HNZJ 2RUSA 3J7AN 5E3AA 3ITHA 1UWBB 1YKWA 1F3FA 3W2VB 8AT1B 2MZQA 2ASLA 6AT1B 3BDPA 1I1GA 3BDFA 2HNYB 3HFZB 4FXWA 2FJVA 2O5DA 4PAAA 2PI4A 4B3TF 2OFGX 3ZZPA 3VV2B 1YRTA 5J1PA 1URNA 1XNQJ 2IYIA 2HG4A 2IUCB 4ZVTB 1FRHA 4ZG9A 4MTPA 2V2KA 2RH6A 1CBKA 4ZVRB 5HN0A 1E33P 2QMXA 2MQ8A 4OI0A 3BSOA 4UOOA 1IVZA 3T19A 4JI8F 1KDNA 2D3UA 5C5JA 1Y9OA 4USUA 3TJ9A 4DJBA 3BGRA 2CIMA 4Y28C 1M5PC 3PY8A 3MEDA 4CI0B 3VAFA 3N6LA 5F3ZA 2IHR1 2DXEA 1M90T 2QYGA 1QVGR 1LWEA 5CYMB 1S0VA 4I69A 4J37A 2KVQE 1S76D 3CTRA 4ICLB 2YWHA 3OL7A 2DRAA 2GIRA 1S9EA 3IS9B 3M4XA 5E41A 4RNHA 4C0HA 4FXDA 2K06A 1NDKA 2FJAB 3C14A 3J81j 1KD1T 2FJEB 1UVMA 2N3LA 3A3PB 4L74A 2K8GA 3UR3C 5G4DA 4F50A 3TEHB 1HA1A 2OSRA 3ENQA 2W4DA 1FNXH 1G3OA 3AY0A 4J9QA 1MWZA 4JI7J 1H2VZ 1SJFA 2VFVA 3DXBA 4DMZA 3MK0A 3KK3B 2DGQA 3JTPA 4ZHRB 2B7BB 4DV4J 2JC1A 1JLCA 3CJTA 2HRYA 1RT2A 3SSRA 2UVRA 3UNYA 3FUYA 1OIAA 1QAYA 1RQ0A 3H20A 2R7RA 4P6QA 4KC5A 4DU8A 4AL5A 4RWXA 4DQSA 3K57A 5KFAA 3ZTSA 1TL3B 3H40A 2IBKA 2Q1LA 1U0HB 3MGJA 3HZGA 3D0IE 2HBQB 1WC3A 1VCTA 1T9WA 2FHJA 5M2UA 1IQTA 4DL0C 3HHDA 3LA0A 1N6QB 2RJZA 5A76A 1NSPA 2YKMB 4LVNP 4UOCA 2VH7A 4DSJA 2BANB 1L3UA 2XHCA 2AD9A 5F8GA 2ROGA 4JUZA 2CPZA 5CYQB 4ED0A 3PJWA 1RT1B 2L9DA 3IG1A 5KT5A 4OYPA 4AL7A 4O0NA 5L8RC 1WF2A 3MZIA 1HQAA 3HULA 1TKZB 4ED7A 2W7OA 2UUCJ 4I6AA 1S48A 3RR8A 1H74A 4O4GB 4M1KA 3D6FB 4RBUA 3QGHA 2BABA 4D3HA 4Q8EA 3NCRA 1PJ5A 2MZ1A 1U1RA 1B7YB 1QE1A 4XO0A 1PCAA 2BE2A 3OBIA 3DU5A 2WVDA 4LF4F 2GGPB 1LW2B 2VBWA 1RCOB 5MLCV 4ED6A 7AT1B 2HFVA 3M8PA 2KB2A 2ZE2B 2CZ9A 4C8KA 5EGHA 2HS0A 3BQ0A 4DR3J 1Q16B 2KJVA 3CB4A 1T05B 1X8DA 2B43A 4DF8A 2HEKA 4L73A 1RWMB 2XS2A 2YKAA 4IR9A 1AA1B 3VWSA 3SZZA 1SPBP 1V3SA 2V4JA 3OLBA 4I2PA 2B4OA 4HEA9 4F0MA 4LF1A 2KFZA 1RWWB 2E5IA 3EGWB 1O0PA 2JLFA 2KKHA 2RSQA 2AYEA 1YRXA 1HI8A 4C98A 2MKJA 3ZZ0A 3PRDA 1S7IA 4ZPTR 3HVRA 3LP1A 4JP8A 1CPZA 3CJKA 2QYCA 2LQBA 4KGMA 2RQKA 4ALZA 1F9FA 2PE8A 3HK2A 2X51A 1KOHA 3OW2R 2LYVA 5I42B 4RBTA 1K7HA 1D3WA 2NPFA 4X84A 3Q24A 4NMXA 4L3NA 2GA7A 3RB6A 1U1NA 1X4BA 4OI4A 2HHTA 1QUPA 4ZLNA 4USMA 5GMDA 5KFOA 3EWGA 4KPYA 1WJ9A 1FKPA 1PBAA 4USTA 1KONA 1DZ5A 3OJUA 4C2MA 3DM2A 4DV0J 1ZH5A 4DCOB 2GVZA 3MMBB 4MY4A 3D1OA 3GFHA 3HJFA 1U47A 3MUVP 5C2CA 1HD0A 2AHOB 1NK9A 4MKAA 4RU2A 1SKSA 2DXDA 3DRPB 2BKPA 3M1VA 4KGZB 3Q22A 2QO3A 4MKYA 1LWFB 4LFCJ 3AQOA 4DV6F 1AUDA 2ACYA 2NUHA 4PG6A 1WKJA 1RKIA 2CDQA 4JI2J 4Q0BB 3P5BP 2Z4PA 4KAVA 2VL1A 2NYIA 3I0RB 4ILMA 3C16A 4LT6A 4L72B 3N6NA 1R0CB 3RRGA 3AHPA 1K0TA 3PTWA 3D0GE 2M2BA 3BO4A 3JTOA 4PCQA 3QIDA 1Q4RA 4AQYJ 3BR8A 4RZRA 3CJ3A 3KKFA 3AJ1A 2W1BA 4UOHA 1BE4A 3DU6A 3LP0B 3O44A 5DQHA 3I4HX 2PI5A 4RW9B 1HNWF 1PAEX 2WW8A 1HNVB 1V9OA 3R1HA 3FK4A 1RLDA 2M8DB 1RTHA 8RUCA 1EQJA 2YWEA 1VQNS 1FD8A 4KH1B 2H5JB 4YDXA 3ZTRA 4B9VA 5J1EB 3AD7C 2UUAJ 1C1CB 3C66A 2ZJQQ 1EZZB 2F1FA 3F56A 1TMJA 1NK5A 2HBYB 1A6LA 3HVTA 4PPDA 5F8JA 1R89A 2CQDA 3LOUA 2OAUA 1RU2A 2KXFA 2JSXA 2Z57B 3DLKA 3OT9A 1MU2B 2BJ8A 3MR7A 2VOPA 2D74B 3P96A 1MWQA 3NKRA 1VRTA 3PR4A 4RBVA 3KK1A 4H4MA 4KKOA 1RCXB 1BQNA 3I9ZA 5B0EA 3A52A 3QRPA 1XN9A 4QAXA 4IG3B 2CRLA 4NXMF 3T5JA 5BYSA 1GAOA 3VQTA 4DV7F 5HJXA 3M8WA 1FEEA 5EWFA 4ZVOB 1LWCB 3BGFA 4DV5J 4WK1A 3NAIA 3HHLC 5AXLA 4X62J 5HMXA 3T02A 2NXCA 3I4PA 2DNGA 4RUHA 4YUDA 5L0KA 1VGYA 3DMJA 1R8AA 3OJSA 4IO9Q 4ZCIA 1R8PA 3J7Z5 4DSEA 3OL8A 1H6KX 4DLGA 4TU9A 2GJIA 2KG1A 4F25A 4RU9A 1YGYA 1HHSA 3GSDA 1VQKS 4QU6A 1N5TA 2LXIA 4NYPA 3Q8QB 1S49A 4C7QA 1HHTP 1VISA 2B9XA 5IWAF 1PYTA 4DSKA 3ONQA 3VQSA 3VAGA 4FDJA 1LOUA 3KOAA 2OEJA 2EFQA 5CAAA 1YI2S 4LF8F 3LALA 3G6ES 2O66A 2IM0A 4OHXA 1BXNA 4DPYA 1ZAWA 4OLPA 3O6QA 1U2FA 2DHAA 2HRTA 4ZP8A 4UORA 2QZUA 4USWA 2GQ2A 1U48A 3W64A 3M6XA 3EPIA 1FNOA 2FDNA 2WK4A 3QT7A 1IKVA 4BBYA 1LK7A 2ATCB 1TELA 5BJRA 5D3GA 2B0GA 3B5QA 4KO0B 2HWHA 2WSCC 1HMVB 4RW7B 1FI4A 4TQSA 2ZKUA 4W4MA 3G6VA 2ZC4A 3FC9A 3GONA 4MKVA 2Z30B 3F0NA 4PPZA 3HDSA 1MN9A 4IQMA 1EB0A 3CULA 2DR8A 2HMIB 1HNXJ 4ANEA 3NNCA 1QAXA 3PRBA 4IUFA 1UEVA 2BVZA 3O1LA 3FRYA 5IT0A 5T14A 1TL1B 1TV6A 4FYWB 1NHVA 1RT3A 4DN0A 3PEHA 2ZH8A 4F3QA 3FBBA 4OYIA 2LXUA 1U25A 1FA0A 2E7WA 3UE2A 4PXBA 4ID5B 3UN3A 1N54B 4ID8A 4C3KA 2VUGA 1TL7B 1S1UA 3NGRA 1NKEA 2G9YA 5J2NB 2RQ4A 4OZ1A 3K8WA 1RHRB 5CH7B 2O67A 4DL5A 1H73A 4NWXA 3FSIA 2F4VF 2E1MC 2DIVA 1CJUA 3AJDA 4ED1A 1LWXA 1WC5A 1VC5A 1HYSB 4OHWA 4JI6J 3QWUA 2I0XA 5CABA 1LXJA 4USJC 4NLGA 2HHSA 1EHWA 1HR0J 2WTFA 1ZM2A 5L0BA 2OSQA 4XDCA 2FYXA 4MH8A 4B02A 1ELYA 2GLQA 3QJPA 2Y3YA 2AJFE 1UVNA 3PW2A 2ASYA 4DUZF 4QR2A 3BDGB 1OJ4A 3IA0A 1SC3B 2UXDF 5C66A 2DGOA 1O5JA 3B8HA 1U6FA 3DOLA 4DXLA 3EZ5A 3V4IA 4E2FB 4KHPJ 3GIMA 1JXEA 4IDKA 2YX4A 4YP3A 2UU9F 1KVIA 2I5JA 3D1HA 3GYGA 4M5JA 1L3VA 3PYFA 5IV3A 5J2MA 2FC9A 4WFZA 3DN9A 1OS5A 2UXBJ 2RIJA 1IM6A 3QFWA 2NREA 2IVYA 3PJ9A 1RP5A 1NU4A 1NSQA 5AXMA 2R42A 1M5VC 4DV2J 4CXSA 2JH3A 3NMRA 1MW7A 5AXNA 2BKOA 2W5XA 2M70A 2VBZA 2DNLA 3DRYA 4WFNQ 5GMKa 2C3YA 4KSEB 3M30B 3MM7A 5CA5A 4C3LA 4Q2LA 3BGUA 1IBLJ 5HMYA 3UO0A 2EVZA 2HQFA 4DSIA 3M8RA 2XY6A 1WG5A 2H65B 2GIFA 1GX6A 3B4MA 4YN3B 3TNVA 4DR7F 3KLEB 3R9LA 3VGUA 3RB3A 4X4VA 2CPFA 4ILRA 1EJJA 2DK2A 3DGPB 1QDUB 2IM3A 4JI4J 5IM0B 1WHYA 3M32A 3GZ7A 2LFVA 2ZHAA 1NJWA 3U02A 1HPZB 3X3UA 1RTJA 1HBUB 4TLQA 1ED8A 2B3TB 1GTEA 2BQRA 5KFMA 1Q5YA 3THTA 1BWVA 5LRNA 1RTIB 1SUQA 3NNHA 4P2XA 4ZVSB 4WK3A 1FTRA 2J9EA 2PIIA 3TZYA 1VIOA 3M2RB 5GAGU 1S1WA 2CQ4A 1HL6A 4F0HA 2HNDB 5B0GA 3IC1A 2Q79A 4D3GA 1JLGA 1WACA 4URGA 3ZC4A 2BRLA 2D69A 3UWTA 2G2OA 3HKWA 1VQPS 2BDPA 3VHQA 4K2JA 2CNLB 4CWBA 2KHDA 3MECB 2CVEA 3DLLQ 3PIOQ 2C3MA 1NHKL 1UMJA 5DETA 3SFGA 4OIXA 1J5OA 3KXDA 2COLA 5IFMA 2XLJA 4IRCA 2W4CA 1KFSA 1T03B 4CYRA 2B7CB 3A3NB 5KFHA 4HHUA 5IV4A 2F9DA 3NCQA 2OEMA 2XMTA 1ANIA 1NJIT 4CO3A 4WKYA 1IKYB 3UD5A 1RT6B 1Z2LA 2VA3A 2EEYA 2W2MP 1Y7PA 5FDLB 5E3PA 3QLHA 3GQCA 2LU1A 5L1IA 2XMMA 4DV3F 5JUMA 2ZKTA 1SXLA 1N33J 4XTTA 3VAJA 2V68A 3R7SB 1Y10A 2IYGA 1Y5IB 4NLYA 2GJ2A 2CPJA 3HHLB 5EX3A 3N9UC 2DNYA 4LF5J 4JI3F 4ED2A 1JJCB 4USKA 3SSSA 3VZIA 1RKJA 3IGNA 2MYFA 3TUPA 1EQMA 2B9YA 3A8KA 4RW4B 4OX7A 1PSDA 4K4ZA 5C24A 1N5YA 1JXVA 3BM7A 1S72S 3LPYA 1YRUA 2CDRB 4JV1A 4FZVA 2R7VA 2HAFA 3EXCX 1U2RA 3GLJA 1VQOS 5LSLA 4QWCA 1KKHA 2BMBA 1URAA 4B3MJ 1GXTA 1S97A 5D0RA 2AU0A 1F9EB 1L5UA 3M2UA 3B6BA 5L9XA 1Q78A 3H4BA 3IM8A 3TAMB 4QIGA 5DGBA 1HBNB 2RHQB 4PXDA 2CADA 2KI2A 4DX6A 2WRMA 3H90A 1UVJA 3NKOA 4PQUA 3QIPA 2W9BB 2W8LA 3SZYA 1NJYA 4X4SA 4PZVA 2QT7A 5K9FA 2DTJA 5L38A 3EYZA 3D2WA 1BD6A 3G82A 1KOOA 1LFWA 1MLAA 1NK7A 3UD4P 2GA3A 5H9EJ 4P52A 4NEYA 2K3IA 3HKZD 2DEJA 4M5KA 1QSLA 4I56A 5KFXA 1OYDA 1X9MA 2JDJA 3KLIA 2ZHBA 3MEKA 4WFAQ 3Q8UA 5I4MA 4X64F 3V81B 1SCJB 1KLMB 3IR6B 3ZZOA 4A8QA 4UZBA 1KS2A 3VF0B 3PW4A 1VHIA 3DOMA 4C8LA 4A8OA 2Y1LB 5BR8J 3M2VA 2DGWA 5GADU 2J5AA 3ZTPA 2R8JA 2XI2A 3KWMA 5IS2A 3FEZA 2ZH3A 4B3SJ 5HVFA 3B54A 2MKKA 2HWIA 2AJ1A 5HMZA 2Z0GA 3GU0A 2L9NA 1VR6A 5LMUJ 3AAWB 2R2SA 3Q89A 2BX6A 4L6V3 4A46A 2DNZA 1KEKA 1H7WA 3MK2A 4K2XA 2HVZA 4AFFA 5A2QY 3FQKA 1G6BA 3WAXA 1O98A 1WKLA 4B9SA 2HK2A 1ED9A 4X4UA 4K7QA 1KH9A 2Y1IA 3IM9A 3N28A 1OPIA 3POTB 3QBCA 3KJVA 1RHQB 1L3TA 4B3OA 3TVKA 1Q1KA 4NLUA 4R8UA 4QR1A 2NZ4A 2QMUB 3ED4A 2VQEF 2RT3A 4WTYA 5KFGA 2M4MA 5AJ3F 2YNIB 3A8IA 5D15A 5HLFA 4J7CA 4WU2A 3QGGA 1GFWB 4LMZA 4U8VA 1NCLA 3CCTA 2EI5A 3V6DB 1PBUA 1E2SP 2A2CA 2YWFA 4RW6A 5KG3A 4K4TA 1R6VA 1DTQB 4MK9A 3UDLA 4ZKAA 1GX5A 4B3TJ 3EGVA 3OR2A 3K7RA 3KDNA 1UJ4A 3R27A 1XMQJ 3I96A 2WBMA 2EKNA 2QEXS 4JV5J 4ZCMA 5K8PA 3CJ4A 5GOVA 2G1HA 2B8QA 2DR5A 4N5SA 1CQNA 1KHNA 4LBHA 4JI7F 3PZPA 3DCAA 4NI2B 2BV3A 1R7IA 1B64A 4JI8J 4DV4F 4A8FA 3O2IA 2PMHA 4Y2KA 4QPTA 2MHEA 5B0AA 1HI0P 1HW8A 1Y4ZB 2Z2YB 2AIRB 3MM9A 2PD1A 4CM0A 5A8KB 4X66F 3D6TB 2KZZA 5JVHQ 4PQAA 3HHNB 5L46A 1DQ8A 5HQMA 3QGIA 2MY7A 3PFOA 4F4AA 3JQJA 3BSCA 1XMBA 2F3JA 5ITHA 1KQFB 3ET6B 4DL7A 2IY5B 2MY8A 1UEKA 4F3OA 1U2CA 3MM6B 4GTYA 1ZA1B 4NMLA 2HRUA 3M8QA 3NCPA 2XMJA 5K14A 1HBMA 2AYMA 1WG1A 5F8IA 4HH0A 4OZLA 1EW9A 4KR0B 2QFIA 5C25A 4YOEA 3MM8B 2MSTA 1PYSB 5IQQA 2E1AA 1RAEB 2YPZA 4AT1B 2PMWA 4NZ0A 4O23A 1C0TB 3FGVA 2EBGA 1NPPA 1SQGA 4AXJA 3H5SA 4UY85 4IOBA 1CG2A 5ADZA 4IO1A 2HKEA 2OH2A 2CZ4A 4XPEA 4MYTA 2QFJA 3K5LA 2V69A 1VLYA 4UOPA 3OUYB 1Y6VA 1RWPB 4DR1J 3HXMA 2HFUA 2WAQD 1X4GA 4YDDB 4Y34A 1ZPVA 3CDAA 4DPOA 2B6AA 3W8GA 2XWYA 1RT7A 2WW4A 1T8EA 2OPRA 5KFKA 2XY7A 2G1DA 2BBEA 4HH1A 1U1MA 3K89A 4DR3F 1MMNA 3BB5A 3K5PA 1E6VA 3MCMA 3DDKA 3LWLA 2HFOA 2XY5A 4OYMA 1JLCB 3IP0A 5HROA 3QFHA 2YNGA 3MF5A 3G8SA 3N6MA 5H9FK 2K1RA 1NB7A 1ZYQA 4CYUB 3KG4A 1QAJA 2DY9A 1SHNA 2VQRA 2EXUA 4TU8A 2IIHA 3QJLA 1AXQA 4GKKF 3VAIA 3OXLA 4KGKA 3W2WA 2MQLA 3K8VA 2ZOMA 3Q8SB 3W9JA 2H4YB 2R2UA 5CYJA 3PNIA 1FKOA 1EETA 3CCRS 2RRAA 5KFBA 1GMVA 2ZBIA 2CJXB 1N5VA 3HLUA 5KT3A 3ILOA 4NLOA 2HFNA 3DOKA 2YY3A 4LF4J 3DRRA 2OPSB 2ASDA 3L4BC 1VOMA 2E29A 1JK9B 2DH8A 3CEDA 1ELXA 1RT4A 2VA2A 4WKRA 2E5HA 2ANHA 2R7TA 1SJ3P 1S57A 3G4SS 3MPWA 2ZJRQ 4DV0F 3M8SA 2AWZA 5HQ8A 3UDVA 9ATCB 2XWXA 2RHSB 4DPXA 2G2ZA 1UAWA 2J7WA 3T00A 2AF6A 4WCEQ 1GQEA 3L95X 5HP1B 2V6AA 2NUUG 4J9MA 1U49A 2PEBA 2XSJA 3FZBA 5F41A 2ZWOA 2C2OB 2KU7A 2BACA 1S0NA 5A0YB 4DI6A 2VQFJ 1NLKL 5HATA 3W61A 2QL7B 2LMIA 3M6UA 4PXCA 3TZWA 1S10A 3A8JA 1HLWA 1QE1B 4PYDA 3E01A 4C11B 4GTXA 2MKYA 4FF2A 2B4PA 2DISA 3R5AA 1KVKA 3H4DA 1RZMA 1S9GA 4ECVA 2HQ3A 2IC3B 3G8QA 3OQ2A 5L1KA 2UVUA 4LR7A 1ZBTA 3CCJS 1APSA 4ZVGA 4OZ3A 4IFVA 4OJ3A 4R0JA 2L48A 4A8XA 5HO4A 1FDBA 5KG7A 1FX2A 5T7LB 1OSDA 1RBAA 3P45B 4KJIA 2CG8A 3P49B 4UW2A 4DS4A 1AJCA 3UVJB 1UVKA 4ETXA 5BYRA 4NPOA 1F6TA 4OI3A 1FDNA 1Q8KA 3CDEA 4RL1A 4MKBA 2DGTA 2C28A 3GR0A 4LRAA 4DFJA 3NOCA 4DV6J 4LF7F 3DNCA 2ERRA 2M9KA 1UWAA 3OSNA 3WDOA 2WONA 5GAEI 4R5PB 2UUTA 4ZLJA 4XIUA 2DITA 2QMWA 1CJKA 4ATNA 2MKSA 2W9AA 2RS2A 2KM8C 1VHFA 2CFXA 2D3OR 4LJMA 1SV5B 3RW7A 1ZZFA 3OFHA 3QPIA 3UPFA 3KLFB 3L3CA 2LA6A 2XLKA 1BQMA 4MFBA 2B5JA 1F9HA 3DM2B 3SCJE 2FY1A 3EPGA 3ADAC 2FZKB 3NEKA 2BJ3A 1UVIA 4FS1A 1WG4A 4NLSA 1N0UA 4NWBA 3GV7B 5KFRA 2XMAA 1IKWB 2DGXA 3RW6A 2ZZNA 1SIZA 2Y0SD 3ICLA 1HNWJ 3Q2SC 4PUOA 5LL6d 4YY3F 2IAJB 1QY7A 2Z2LA 1N36F 2J9DA 4FF1A 1Y3JA 1VYAA 4DG1B 1IJFB 2ILZA 1ELZA 4QBUA 4O44B 4OV6A 4B17A 4LQ9A 2HYIB 3W7BA 1FDAA 2CKWA 1WKKA 3S7RA 5I3QA 1H98A 3G6XA 3SQGA 3P3DA 4B56A 4X4RA 2ZD1B 2AGQA 5EGEA 3J7A1 1MMLA 2YNHA 4DX5A 1KBRA 1FK9B 1TL4A 5DDRC 3D67A 5LIAA 4LSLA 1TKXA 2PA3A 2LKZA 4H4OB 1L3KA 1WUUA 1WHVA 3GG0A 5IQ6A 4MAKA 1J5EJ 2HQIA 2KYZA 2GV1A 3EZUA 4HYKA 4DV7J 3T1YF 1SC6A 1FF2A 5J2QB 2HLTA 2NLWA 3EICA 2VG7B 2EG2A 1ZTTA 3NG8A 2VODA 2R2TA 5LRMA 3LWMA 1S59A 2HAIA 4ES1A 3GR1A 2FUG9 1GT8A 1B3TA 1UKUA 4NXNF 2ATLA 4I1TA 4P75A 1DQAA 3OL9A 3H0PA 1BLUA 1ZM3A 3QSIA 3PIPQ 3PW7A 5IWAJ 2RUGA 4UT4A 4PWDB 4TN2A 1WEXA 1U6ZA 4FKYA 3OFGA 2KT5A 3U7JA 1UP1A 3SSQA 3J81U 4LF8J 1AJDA 2QLXA 2EFVA 2CQHA 3I32A 2W01A 3MCOA 4MYUA 4KKOB 2MKIA 1BQXA 1OMSA 4WYWA 4IOCQ 4FDIA 2JWNA 2GMLA 3HD1A 4ECTA 1RTZA 2G2YA 2CJ9A 2GVDA 4DR2F 2EFNA 4K4UA 5ETPA 1P1TA 1WI8A 3JSRA 2LEBA 3CCLS 1T02A 3A3OB 5J2PA 1HWKA 3EJMA 4DF4A 3L9ZA 4ZJOA 4M5LA 2M5YA 1U8WA 4MIAA 1B70B 1PJ6A 3K5MA 4LIWA 3HSZA 4ED4A 2EG1A 1B8JA 4R0EA 1DAXA 4OLOA 3CC2S 4JI6F 3QMQA 2VG5B 2WVBA 3Q8YA 5KG5A 5IZHA 2YKNB 4DU7A 3I6PA 3MAQA 3SFUA 1C0UB 1NSKL 3FFIA 3CMRA 1CC7A 2R7UA 2JLEA 5LJ3Y 3K17A 3OR1B 1P27B 4ZLPA 5E5NA 1XJWB 4WPAA 1J27A 1IKVB 3W5XA 2RH3A 4KAYA 2VONA 4LF6F 2AKWB 1RI7A 2FIUA 4NASA 2PT0A 4FNHA 3ILIA 1YZ6A 2BJDA 5DG7A 3QT8A 1SQEA 2RVJA 1TU0B 1FX4A 3TZXA 3T1AA 1Z1ZA 3V4MA 1TMMA 1K1QA 3H25A 1TVRB 3FDSA 2H4WB 2B4UA 3NLCA 4OZNA 2F4VJ 2ACMA 4ECSA 2HNZA 1QUVA 1RB0A 5U47A 4H54A 3C6UA 3D7SB 1RT5B 1P6TA 4J9OA 2QL9B 1DARA 3X1LB 1ACMB 2J0WA 3U1NA 4DV2F 1TV6B 3QJJA 4QIWD 4DX7A 3K5NA 1X0FA 3BKFA 3WC0A 1RT3B 4MMOA 3PRVA 4C8ZA 3F41A 2F65A 3RTVA 2YXLA 2GSOA 2UXDJ 1AZSB 1RE1B 3TR5A 2ZC3A 4X4NA 2CPYA 1P49A 1YVFA 4OZJA 3DYAA 1JJHA 2KN4A 5E33A 4W90B 3FQLA 1Q8LA 3IWXA 1NKCA 1RBOB 3DKDA 1UWBA 3EVWA 1F60B 4YR0A 1W25A 5H9FJ 2ALYB 1TR0A 2EKYA 5DLTA 2HNYA 1FRKA 4JI4F 3Q83A 5B0BA 4ERDA 2OPPB 2VDIA 2KH9A 1MROB 1FRMA 2VICA 2UUBF 1KRPA 4DR6J 2ZFHA 2IUCA 5KFIA 4MK7A 1JJ2R 1JB0C 4YR1A 1TK5A 3KLHB 2V94A 3DHXA 4X4TA 2HURA 5H1SV 2E5LF 4ZITA 4CM2A 1YJVA 4U96A 1WWHA 2X1BA 2GX8A 4DSFA 2XR9A 4FVCA 3O3LA 2OTLS 4RW8B 1U1OA 3WHIA 1R8BA 4LRDA 5RUBA 1MSWD 5CYMA 5J2MB 5DG9A 4ICLA 2VFUA 4U7CA 4CLYA 3K58A 2AV5A 2Z8QA 4YB1P 3GFYA 2Y9HA 1K73T 2XO6A 3NWGA 5KT7A 4C97A 2FQQB 5B08A 4LSZB 3R6GB 4OMFG 1IBMF 4NCBA 4FYXB 1FHTA 1KH7A 5CD4A 4CO5A 2NR0A 3KK3A 4I67A 3SYZA 4TU7A 1UW4A 4ZHRA 5ETMA 3N79A 3MD3A 2W24A 1T95A 4QOTA 4GTZA 2EFOA 2WVEA 3SMZA 2AEFA 1OWXA 3D9BA 4M5IA 1BWEA 2MSSA 4DOZA 2YQ1A 3W5YA 3A1YG 1TUVA 1UJ6A 2J8SA 2ZZTA 3I0SB 2X1GA 2VPXB 1RAJA 5IJSA 2RRNA 4A47A 1SC1B 3A12A 4OX6A 2W8DA 1TL3A 1U0HA 2KG0A 2XZWA 3PCOB 3AXKA 3S8SA 2J0XA 1ALIA 3AFGA 4N56A 1Q0NA 3P4UB 1N6QA 1RJJA 2HBRB 4YQWA 1VQ4S 2HK3A 1HQUB 4CO2A 2YKMA 3IXQA 1KHVA 4USHA 3WBHA 2BANA 3WBZA 4NWJA 3CSKA 2ZITA 1FWKA 5J1NA 5GAHI 2EW9A 1S1WB 4OZ2A 2FJDB 2HFZA 5CYQA 2MKCA 2WOMB 1QVFR 2WB1D 4CLLA 4DV3J 3QRQA 1Z2ZA 3QRRA 1IXKA 1VQMS 3MCNA 3SQOP 3L09A 2MGZB 3US5A 5E7OB 2CWXA 1TKZA 3I5BA 4K4VA 2ZNYA 3MAHA 2IDEA 3I9V9 4I64A 4ZPDA 4JI3J 4O4GA 2OIHA 4DZ6A 1HD1A 2ZM6F 3OTDA 3H5YA 2R4FA 2QSFA 1LKZA 2N3OA 1T11A 3DC2A 2GGPA 1LFPA 2EC2A 2Q6BA 2ZE2A 4L75A 2E44A 5D78A 2ZBRA 2VOOA 2VV5A 3AXMA 1FDDA 1L3SA 5FD1A 1T05A 1JLFA 1AFJA 3W9HA 2DHGA 5ETQA 2IMOA 3WAYA 2AX0A 4NRTA 3IAM9 1M5OC 3AB2B 1T94A 3NVLA 3ZTOA 3MURP 4B3SF 4KH0B 1URBA 2HPUA 1VQ9S 2HS4A 5B0DA 1H2UX 2JEJA 4XAKA 1R8CA 5KT4A 2J6SA 2NXJA 3NXZA 1T9UA 3MPYA 3CE8A 4XK8C 1FFGB 2NZCA 5I42A 2BR0A 4DR5J 1CLFA 1FE4A 2X3DA 3D54A 3T5HA 4PG7A 2A0FB 3GILA 5C24B 1SJ1A 1N5YB 2ADBA 4X2BA 4H4KA 4ZG7A 2MB0B 2B9EA 2CXEA 4QIVA 4K4YA 5HANA 3T9NA 1I3OB 1RHJB 3DRSA 1P1LA 4OHZA 4J9KA 4X64J 2CPIA 4NE9C 3M2UB 3CWJA 5M2PA 3HT0A 3W8PA 1S4FA 4P2FA 2U2FA 3GPAA 1ZEDA 3PJXA 5IT9Y 3C15B 3TZZA 3OFEA 4KJDA 4CTAA 3DRPA 4ENOA 1S1TB 2E7XA 3NWRA 2UXCJ 2YX1A 1XMQF 1LWFA 4HT5A 4LRCA 5B09A 2QA4S 3UR0A 3G82B 4JV5F 2VJVA 2GHWA 4J9NA 3DXSX 4FP9A 4A8KA 1SC4B 2DPIA 3JSMB 2LECA 1HQEB 2FJBB 1C4AA 5JJBA 2ZH4A 4Q0BA 3RRKA 4ECRA 4M5DB 1NDPA 5KFZA 4U95A 2Y1RI 4CT9A 2LQ5A 3I0RA 4QYZK 4ZVHA 3ENVA 4OHVA 1AB8A 2CQGA 3LAKA 3CCMS 2LVWA 4B9TA 1U45A 2H9ZA 4ZGAA 3OHBA 1YX2A 2J7KA 5D0EA 2VQEJ 3MFHA 3NBPB 2FVQA 1C4CA 2W5VA 1WOSA 5AJ3J 2YQ0A 2DNOA 4CLWA 3PW5A 3E3XA 3LGNA 4NLDA 3UW1A 2UV8A 4FVMA 3LP0A 1S6UA 4RW9A 1UETA 1HIYA 3WQPA 1D09B 2HSEB 3QAUA 3DLEB 2UVWA 1O51A 4OFZA 3A4TA 5DDQC 1RWUA 4IG0B 5J1EA 5AT1B 3L7OA 1T0TV 2G4BA 1C1CA 3NY0A 3KNAA 1RDRA 2CNOB 1HNIB 1YBAA 2V8DA 3DI6B 1SL2A 5E0OA 1R0AB 3UCGA 4O3RA 2D1CA 2ZNZA 2M3DA 4X66J 1W2IA 3O5TB 3VAKA 3ENWA 5A8WB 1SVDA 3EDQB 4NX9A 1X60A 4UOGA 3JSBA 4F04B 4RNNA 4IG3A 2RKIB 1KHJA 4ECXA 1ICEB 2YWWA 4DR1F 2EBEA 4RW6B 2M0GB 2X7IA 1LWCA 1S1VB 1SH2A 3OXGA 1OQ3A 5K20B 4DQIA 2PFFB 1W7WA 2XMUA 1GMUA 1REVB 2BJ1A 4JI5F 3A13A 3OTCA 1CS4B 1FO1A 2EFGA 5ETKA 1NNDA 2CNKB 4CRJA 4NLWA 4ZPWR 5LXRA 3IWNC 1EP4B 1I51B 4QR0A 4J9UE 3IO1A 3T9ZA 4F3MA 3H7HB 1KLNA 4CLKA 1NKBA 5GMEA 1IKXA 9RUBA 3MM9B 2V8VA 3EVMA 4ILLA 3EGZA 1VRUB 3HVWA 3MPUB 4WP8A 1XMOF 3NKNA 2CYYA 1B99A 1DLOB 4DPUA 1UFKA 5CXTA 2V63A 5BYQA 5CHCB 1AW0A 2CJAA 3KNGA 1YJUA 1X4DA 1N0VC 2VFRA 2EC0A 4KIAA 3TI0A 4F4XA 1F0XA 1YITS 1RHKB 2DO0A 2LU2A 5K14B 5DG8A 2C3UA 1XK8A 2R7OA 3UCZP 3M9OB 4RJVA 4KO0A 3R7BB 1P8GA 1HMVA 1S12A 4RW7A 1KTVA 2F4FA 3CC4S 1V3ZA 4LR2A 3SIPB 2C1EB 4DV1F 3IR5B 2HIYA 3G71S 3TVYA 2HMIA 2DCUB 5HSPA 1VMBA 4A8WA 5KFVA 2MJNA 2E1PA 1B7FA 4P71A 4F02A 4YS2A 3H8YA 1TUGB 1H2TZ 2VJUA 4J91A 3THPA 3OTBA 1TL1A 4IYQA 2VIHA 3Q3QA 1YSJA 1GH8A 3T1HF 2DHHA 4Y6IA 1D9DA 3R5JB 1VQ8S 2DR9A 3MR3A 4G1QA 4GKKJ 2VQFF 2W4PA 4DFMA 2FVCA 3CCWA 2RILA 4HDHA 2X1FA 3JQMA 4ID5A 3NKMA 3CD6S 1PG5B 1VQ6S 4M95A 3BYPA 1KNZA 2JFKA 4AD6A 2YQ3A 1TL7A 1XC9A 2HZVA 3TX0A 5ETTA 1SL1A 3LH2S 3KDOA 5INHA 2JEIA 2EK6A 5KFYA 4ZLLA 4BLGA 5LT5A 2GSNA 3JAMY 3JYTB 1R43A 2VC0A 3VCDA 1FFSB 2FGCA 2WSFC 3NGSA 1RUSA 2GSUA 2HBZB 1K9MT 1B0TA 3ULHA 1HYSA 4CNZA 2GJFA 4WJBA 3TQ1A 1Y0HA 1D0EA 2XYPB 2DXFA 4Q43A 2F8MA 2IRYA 3HD2A 5IT9U 5CZXA 1U0SA 1HWUA 4CXKA 4P73A 1RWNB 2K7KA 2HHPA 3FZ2A 3CMES 1U8SA 3W2WB 5EHHA 4QWAA 4TLRA 4ZPAA 5C42B 4IOAQ 4F2SA 2BKNA 3QNWB 1VRQC 3W9IA 4FXVA 1HHQA 4KB7A 4PXEA 5HQLA 5E2QA 2VDHA 3DRRB 2LQ9A 3BDEA 1WOPA 4O3SA 3T41A 1WC0A 2MLXA 3DLGB 5CD4H 4ZG6A 1JLBB 2N7YA 3CVKA 5LQQA 3NGKA 2OP5A 2MJUA 3GE9A 3TARA 2Y8WA 2W7AA 3UNGC 2HS3A 2A10A 4QYRA 3H5UA 4HHJA 5L0EA 1Y7AA 2CQBA 3MMCB 3GIJA 1B0PA 1VQLS 5D0GA 2DT9A 4C9DA 4DDFA 5K4PA 4I6YA 4FBTA 1URRA 4KY3A 2QGFB 3KK2A 1M1GA 4WZQA 3PFEA 3KJQB 3E01B 1IR0A 3MOZA 2IRUA 3M30A 3Q0AA 4LF7J 3CIMA 1D1UA 2UV8G 1JLQB 4UUWA 2YWKA 4HACB 3MR2A 4JI1F 2NSBA 4DCJB 3PO5A 2VPWB 3KLEA 1WORA 3IRWP 2G0IA 3DGPA 2DCLA 4QIFA 4FKXA 4ELUA 4PRFA 5LSRA 3VZHA 1PILA 2EK1A 3D3BJ 4WWSA 4GTWA 2LEAA 5IM0A 1NJXA 3FSXA 2A6MA 4Q8FA 4KT0C 1ITPA 1TQLA 4CH1A 2W9CB 2ZBPA 1TKTB 5F0UA 2VKZG 1DQ9A 1SJQA 3M05A 1HPZA 1J5EF 2VKRA 1HBUA 3WC2A 5D6GA 3DLBA 3FBFA 3HMJG 1VJQA 2H48B 3PACA 3CUNA 5F8HA 1RTIA 2V34A 1JLEA 1OY6A 2H5IB 3R2DJ 1R31A 5H9EK 2B4VA 1YJTA 2XSFA 2CVIA 3PHEA 2H54B 1U26A 3I5AA 4JOUA 5IJQA 4YY3J 3CD0A 2ZEJA 3M2RA 1N36J 4K59A 1VC6A 4KJGA 1M1HA 1HKAA 1O8BA 2HNDA 2XS7A 2DYAA 1WTBA 3PYGA 3LGHA 1VK3A 2P9EA 4A48A 2YKPA 2FY8A 2DNKA 2FD2A 2GW8A 2D9PA 1X5OA 4NYOA 3MECA 2EPIA 2DVIA 4M5MA 2GC8A 5KTQA 3MEGB 1M5SA 3VALA 3D68A 2GS8A 1CVJA 2DNMA 4ZJQA 4OJ1A 4U7UK 1FWLA 3CJ8A 3J7YI 2BQ3A 4JYAF 4MFBB 2B5JB 3H2LA 4PABA 4KV8B 3UDEA 1T03A 2IM1A 5GRRA 1O6XA 3TOQA 4LFAF 4Q7AA 4NRUA 5CCMA 4Z7CA 4F4ZA 1S6OA 2QC3A 2QSWA 4A8MP 2RD5C 4NCAA 3T1YJ 2B8PA 3LW5C 2ABYA 1LV5A 1IKYA 1RT6A 1WNEA 3ENAA 2XQCA 4HLBA 4U9RA 5JVGQ 3CDWA 3LQVA 4E8UA 2B56A 2FB0A 4DUYF 4QYZJ 3FEYB 4X65F 3KTQA 1NO8A 4NXNJ 5GVQA 2BJEA 2BM0A 3MK1A 5DZ6A 3TYTA 3HM9A 2DGVA 4DHVA 1F5AA 3GTYX 4J9LA 2N4DA 3UI3A 4M5NA 4ANCA 3W5ZA 1T7PA 2ZDOA 2RRBA 4ED3A 4QCLA 2AP6A 4K4WA 2LDYA 1U1PA 4EO6A 4UZCA 3DDIA 1U4BA 3TVZA 1I5OB 4WZMA 2PSZA 1N2KA 4ZDNA 2B51A 3GV5B 3V6HA 1A0OB 3HX9A 3ISND 1YJRA 4DR2J 3VR1A 4CO1A 2VF3A 1X5PA 3JSYA 2MZSA 1YDLA 2JVOA 4BHQA 3H59A 3JAMU 1SQFA 3R7NB 1DTTB 2HGLA 4MJKA 4RLEA 1ZEBA 3HFVA 1V6HA 5A8RB 2LEPA 3TAMA 2JRSA 3BV8A 2A18A 3P5TL 1HBNA 3BZQA 3OVBA 2QZ8A 3DPCA 4FS2A 1X0PA 1OY8A 2XTJP 3GP9A 2W9BA 3UN5A 2DO4A 5JMNA 3MOJB 2VU5A 1X4HA 4S0MA 3QWPA 1NMEB 3FCVA 3THVA 1WOOA 3CO9A 4LRBA 4CT8A 2V2VA 1X9SA 4CIOA 3LPEA 1RHMB 2YNFB 2MXYA 3F73A 1FT8A 4ZVEA 5K5MA 2PGCA 2F5GA 3R97A 3B82A 3SDEB 1BUXA 4LF6J 2YVSA 2ROPA 1DFDA 3WAWA 1YIJS 3V81A 2BOPA 3ZZTA 1H3DA 2F40A 2R8GA 3G6YA 2HHQA 3OLAA 2W5RA 4P7VA 2V2ZA 3LP2B 1GNKA 1EJ7L 5ETNA 4CP5A 2RF2B 3AD9C 3MD1A 3R5DA 1LEOA 3OV7A 4H4KC 1CSJA 5KFUA 2MQQA 4G6VB 3TO8A 1FXRA 2G9OA 5KT2A 2WVCA 2WCXA 2YKOA 2D9OA 2IPOB 4URSA 4ED5A 1JNZB 1H38A 2XB2D 1VDHA 1JLAB 4DR6F 1RAIB 1EX8A 1XNRF 2RU3A 3T5KA 1E1ZP 4Z2XA 1I6JA 1CJVA 2O3DA 2W25A 2MZJA 3ZNUA 4KFBB 1ZAXA 1Q7YT 3CNQP 3NGTA 2JJ4D 2CUYA 2D3ZA 3BKUA 4KBIA 1GTHA 3FBCA 4EEYA 3POTA 2RB7A 2P8IA 2Q43A 1RAHB 4P2MA 1Q7LB 3D6HB 4NLPA 1ZM4A 4M5GA 2XO7A 3NKYA 5KOXA 1UA0A 2W7PA 4V1Ak 3KHGA 2YNIA 1TAQA 1TP7A 4KGVB 2GHPA 3C6TB 3R3TA 2HHXA 2YKQA 3TEGA 3TANA 5AXKA 3EDRB 3V6DA 5L9NA 4V19X 1NRKA 2AEMA 3JS9A 1AYEA 1DTQA 3R5BA 7FDRA 3IBFB 3EX7B 3P8BB 3KG1A 2UUBJ 1RXOB 5DLGA 2ZH2A 5ETVA 4DQRA 1KP6A 2LA4A 4UPHA 5ETSA 2AJQA 4P7TA 4NI2A 2E5LJ 1U09A 2VD3A 4HHHA 4A8SA 4TQRA 2XYGB 4Y00A 3PM9A 1LXNA 2F7VA 4CLUA 5A8KA 2XCPA 3KHHA 2VPYB 1U1QA 4ANDA 4WXOA 3D4JA 1CJTB 3MMJA 4EBCA 4OZ5A 3F44A 4O4RA 1UVLA 4WTOB 4MT1A 2N4CA 1GXLA 5BXIA 2HZAA 3ET6A 1WEYA 1YLXA 4Z7YA 2W2NP 3MM6A 4XPCA 2R3VA 1B0VA 2XG8A 1N52B 2CQ2A 4NL5A 1S9FA 1RADB 2E7VA 2PC6A 2CJBA 1EKRA 3MM8A 2E9TA 1T9YA 1X4FA 1IBMJ 2R8IA 3KLGB 1C0TA 2UUWA 5IC6B 1S0MA 1YTYA 3H42A 1IR2A 2PA8D 1VFJA 3MMAB 4TN0A 5HJYA 3GG1A 5G0RB 3W60A 4UPIA 1X4AA 1TK8A 2MQMA 4CDIA 3NRBA 1ELOA 3BPDA 4LFBF 2AZ1A 4EMDA 1JJ4A 3HHEA 1DURA 2LP4A 4WU3A 1WC1A 2IFXA 1S1XB 3KFWX 2H51B 4F36A 3OUYA 2KRBA 4YB7A 3PR5B 3NGUA 4P2SA 1NK8A 2H5EA 3MEEB 4NLTA 4EK2A 3UFCX 4NLXA 3OTOF 1EQ0A 2XNQA 3T6BA 3QO9B 2BZ2A 5D4NA 1FXDA 2QE5A 2HHHF 5AE1A 4LSNA 2MQPA 1S99A 1IBKF 2KRRA 4DL3A 1QSSA 1VS3A 5CCLA 1N5SA 2V50A 3EM1A 2M8HA 4ZVFA 3NGDA 2NQPA 1LW0B 1TKDA 3G2XA 2ZJPQ 2JEFA 3TJ8A 3GCWP 1XERA 3GYNA 3RU0A 3CJ5A 1H0HB 1C2PA 3FMBA 3WIUA 1JX4A 3CW2C 3T01A 1RWKB 1NHUA 4CYUA 2G0JA 4IRDA 3JTNA 1KFDA 4YHHJ 4I68A 2IM2A 1S6PA 5KG0A 2XNRA 5MAOA 2AJ2A 2V4RA 4DPWA 2R7WA 2ZM6J 2QN6B 4DR5F 3IBCB 3J7ZT 3PVXA 2QIFA 2V8PA 1RWXB 2BXJA 3FSYA 3MM5B 2OPSA 3CCES 2VG6B 1I94J 1G4CA 2IDLA 3MAAB 3CC7S 1SJRA 4ZOSA 2FLOA 3U27A 2BRKA 3NS5A 1N56A 3HFKA 2XCAA 5FIIA 2ZZMA 1HBOB 3CMAS 4WFXA 4BC7A 1KQKA 1U7LA 4OYXA 5HP1A 1IN0A 4YR2A 3KLVA 2KT3A 2KZMA 2I8EA 2L9WA 3JQKA 4KHRA 3BS9A 2UXCF 5A0YA 4PWWA 1AROP 1T3OA 1XR6A 4C11A 4GMKA 2ALZA 2XI3A 5ETLA 1NJZA 2OGUA 1RTDA 3IGZB 2IC3A 3P6YC 4QIEA 1RHUB 2MDAA 3EGNA 3MWBA 3HPOA 1Q53A 2AW0A 2CQ0A 2YH1A 5DRKA 3TP2A 1N88A 4K0KF 4Y2AA 1NBEB 4OJHA 4TY8B 4GVBB 5LJ5Y 1JLFB 4LF9F 5T7LA 3TJAA 2E5JA 4B9UA 3M6WA 1RBLA 3QZ7A 1KHWA 3TA2A 3UVJA 2V8GA 3SBMA 1LK5A 3TA0A 3FVYA 4EUVA 3RGIA 4I7FB 1RSCA 1YBTA 2BW7A 3T6JA 5DDOC 4C8MA 2MMYA 1X5SA 4WE1B 4ZP6A 4DWIA 3CO0P 2QTWA 5D4OA 3AA8A 1VI7A 3RB4A 3DLHA 4R5PA 4I2QB 3ELHA 1UTAA 1Y11A 5I3UA 2A2DA 1VIXA 1XBWA 5EUHA 1C1BB 1HARA 3DRSB 3GJSB 2IJFA 1SV5A 4RUBA 1AJBA 2ZOGA 1SL0A 1WELA 3G86A 3KLFA 3VGTA 2JVRA 3ITHB 3W63A 1G2EA 1AUSL 4QW9A 2FLNA 4NLVA 3SEOA 2Z2MA 4QU7A 5LMNF 2VHGA 3LAMA 4Q45A 3PG9A 4NYZA 1IKWA 2VC1A 2LCWA 1ANJA 2DNQA 1PYOB 2XHWA 4CTAB 3BN7A 4N47A 4NA1A 2UP1A 4KRWA 2IAJA 4RUCA 3PX6A 4OX8A 4JBCA 1DJ0A 4DG1A 4FF4A 1K44A 3PXGa 3MR6A 1WHXA 4O44A 4DLEA 2AGOA 2X3GA 3PV8A 4TYBA 3HF5A 3NAHA 4PKDB 1YJ9S 3BGRB 2OO4A 4CCHA 2ZD1A 3MEDB 2EWHA 2BE9B 1HJKA 2IVMA 4UPLA 2K2PA 2GO9A 1FK9A 4AXIA 2QA1A 5HMWA 5EGYA 2DB1A 1OY9A 4ES2A 1LWEB 2VFSA 2NPIA 4H4OA 3CMQA 2QA4G 2KFNA 4AE5A 2OLWA 2B9WA 2DH9A 1S9EB 1FJCA 1S6QA 2QJ3A 5F3TA 2P2CB 5J2QA 3C14B 4YEAA 3ZTQA 3OFFA 2VG7A 1J2VA 3MHYA 1GMWD 3CPWR 4K4XA 5IT4A 3LGMA 3HT3A 2E66A 4JI5J 1MN7A 5LM7E 4EFAC 2FPHX 3NP5A 1PC4A 1EW2A 3EUNA 3HJVA 3BF4A 1DY3A 1G1XA 2POKA 3OL6A 2RE1A 1D9AA 3G9CA 2E9RX 4PWDA 2MKHA 1KC8T 3ETOA 3CCSS 1FVQA 1RT2B 2OPQA 4YMEA 1VK8A 2O01C 5KAKA 4LQYA 2BUNA 2K3KA 4Q2MA 2P5VA 5E3RA 3PEJA 5DJBA 1A7GE 2AYBA 3RAQA 1XMOJ 4TYAA 2IJRA 3GFXA 2DKOB 3BSAA 5B0FA 3RUBL 1QD1A 4B3RF 1JKHA 4FDFA 3QYYA 3WAVA 2DHXA 1FJ7A 2OD4A 3QT5A 3RAXA 4FYYB 2BW2A 4ES3A 1E6YA 2N7CA 2XULA 4J9RA 2KT2A 4DZDA 1B4SA 4F26A 3Q8VA 3OVSA 3NS6A 4DV1J 1FJGF 2M7SA 4LIRA 1NZAA 1QTNB 5KOWA 4NCGA 2HW3A 1IKXB 4FBUA 1YJWS 2VG5A 2CNNB 2DGSA 2R2RA 3IG1B 1CULA 1G7CB 1KTQA 2YKNA 2EFPA 4N8NA 4UQTA 3HSGA 4ELVA 4CLZA 2V2QA 2QLJB 1C0UA 2BM1A 3T1HJ 2BE7D 3V5RA 4FPRA 1PO6A 1FJEB 4LVOP 3OR1A 3R8YA 1FRIA 2XZDB 2HGMA 3HVAA 4GKJF 2YPYA 3I5CA 4NLQA 5A2QU 2XM3A 2DY1A 2PDAA 2OTJS 2CZVC 1WHWA 2BE2B 1RA6A 2AEJA 2CJYB 3FJ2A 2HHUA 3DGVA 1HI1A 3VAHA 4OI1A 1GEHA 3N01A 3IR7B 1K47A 4NEZA 3M8PB 3TW0A 4RX6A 2OEKA 3KUHA 3W65A 1JQGA 4LR9A 2DR6A 3KG0A 1VLOA 1TVRA 1FSUA 1Y3KA 6FDRA 1U6BA 2OFHX 1RT5A 2V4JB 4F4WA 4HVZA 4I2PB 3RG6A 3E2EA 4OYAA 4EBEA 1CC8A 4BDPA 2OMOA 4K8RA 4NA3A 3ZO7A 1Q5VA 3C8YA 1PAUB 3LP1B 4G1QB 3CJKB 1NK4A 4GC7A 3TWZA 4RNMA 4O0IA 1AZSA 2W2QP 3BBCA 3MDFA 3NNAA 3FCHA 3CCQS 2W5WA 1MG7A 2C22A 3GJRB 3W66A 1RLCL 3M9MB 5KG2A 1YK9A 3PX4A 3K5OA 3HSJA 2R8KA 5THWA 2P6SA 4DL6A 3C2PA 3CDBA 4E0DA 1FKPB 1WSVA 2OHDA 1SBRA 3K59A 2OPPA 4F4YA 1N4LA 1MROA 2J9CA 3MR5A 2GVZB 3EVOA 3DDNA 1BC6A 5GAGI 1HW9A 1RAOA 2PMZD 1XIQA 1REGX 4J9SA 2VBXA 3QAEA 3KLHA 4OV1A 3QQCD 3NKQA 1K1SA 2NXEA 3M1VB 1ROFA 4ECQA 2JL9A 3D6MB 2J76E 4HTIA 1FD2A 1QSYA 3D28A 1X4EA 2DHSA 3TAPA 2WB4A 1GMWA 1ALKA 3BBFA 1OO0B 4FNIA 3AOCA 1U1LA 3IRXA 3BH6B 4RW8A 4ZIVA 4K50A 1GK8A 3IDDA 4AUKA 1Q8IA 1JWWA 4JI1J 2WZ1A 2MLYA 2MEWA 1EAYC 4IH6A 1NSAA 3C16B 2J0QD 3UN2A 1D9FA 5HBMA 2DPJA 1YWXA 5M2RA 4MIVA 2P9CA 2XGPA 1F1BB 2XBPA 4QQBA 2VB6A 4DBQA 5KFFA 4C3MA 3VVTA 1D8YA 1O99A 4OHYA 4DR4F 4HTJA 4M94A 1Q81T 2BQUA 4K5SA 2BOAA 2W2PP 3ZFVA 2V9WA 4ZMMA 3KHRA 1WDDA 1RTHB 3KK2B 4R25A 2CPHA 1TTHB 2J6UA 1RGVA 1UPPA 2IVFB 3SZ2A 2ASJA 4XDDA 3ISZA 2JZ5A 4CLFA 1WC6A 3HVTB 5KFDA 1ZAVA 2CQPA 3I0SA 3BO2A 4MIBA 1PGZA 3BJYA 1IBCB 1N34J 4ZVPB 3IGVA 5GAEU 3DLKB 4TY9A 2W2OP 3HZEA 4AYBD 3WIVA 3ISNC 1VRTB 5DDPC 4JYAJ 3KK1B 1N32F 4H4MB 1M5KC 3PDNA 1BQNB 1KQSR 4CZCA 2J7UA 2GAHC 4ZP7A 3W3SA 2F63A 3VGSA 4LFAJ 4ELTA 1W2BR 5F9NA 4OX9F 1ZPWX 4ZPVR 4WIIA 3AJ2A 4O3OA 1JLEB 1HQUA 3OHAA 5D0HA 1RWOB 1FRLA 3GWCA 1EW8A 1LNQA 3G96A 3DMJB 5KG4A 3CJRA 3SV3A 2CPXA 2Y1JA 1UEUA 3EMTA 2WOMA 4DUYJ 2IA6A 4TKTA 1IJEB 3ILJA 4PG4A 4X65J 4OYWA 4ITSA 7FD1A 3CT9A 4JI0F 5KFQA 3VTIA 4PYAA 1Q86T 3OD2A 1VBZA 2A6OA 4X4PA 4J5OA 2MGZA 2XGQA 5LSOA 1HQ2A 5KFCA 3MPVA 3SI8A 5KFLA 3Q8PB 3C3LA 2CQCA 3PW0A 2DEIA 3TQEA 3AODA 1RK8A 3G87A 5HAOA 3PHTA 4FF3A 3TUZC 2GNKA 4IFYA 1U02A 1NK0A 5HI7A 1SB6A 4LR8A 5LOQA 2NYHA 2ZH1A 3DFEA 3HSDA 4CXUA 5GADI 4YB6A 5D3GB 1X7VA 3MFIA 3CJ0A 5EX0A 4Z37A 2P6TA 4UY8T 2L3MA 1X9WA 1EKSA 4ZVUB 1RYSA 1QAIA 1V5VA 3BYRA 2QG9B 1OQ6A 2AT1B 1RAAB 4W98A 1KH4A 1NUEA 4QPXA 4N76A 6FD1A 1NM2A 3AD8C 3QT6A 2KXNB 5SUHA 5ETRA 4ZJLA 2IJNA 2CWKA 1DBDA 1VQ5S 3QSYB 3W1YC 4NOHA 1IR1A 4UQGA 4EGLA 4Y2MA 1T9VA 4ER8A 2RQCA 1S1UB 1FVSA 4JV2A 3KHLA 4PG8A 3BSNA 1VJWA 4C8YA 2ZH5A 2PO4A 4CLTA 5KFEA 1S5ZA 4X4OA 3W2VA 1TL5A 1E3CP 2J0SD 3PKMA 2L08A 3GSIA 3G8TA 1F3VA 4ZN3A 2F9JA 4O3QA 1JXLA 1ALJA 1CJUB 2BJ7A 1XR7A 1NAQA 2RS8A 2OKQA 1WSRA 3C15A 4BWMA 2V67A 3R5GA 4OZ0A 2ZBCA 3RJMB 1KR4A 2FC8A 1S1TA 2VFTA 3CJ2A 2Z2ZA 3BH7B 4PG5A 2WVFA 4ZA1A 4RNFA 5HRTA 3E8OA 1VBYA 5FJ4A 1XNRJ 4OYOA 4G1IA 2WHOA 4WXWA 3JSMA 1X31C 3FBEA 1HQEA 4ETZA 2ZUAA 3DOLB 2GO8A 2C2NA 4M5DA 3ZZZA 3V4IB 1XTZA 2I2YA 2XZTB 4IH7A 5F8MA 3RYLA 1EIYB 1F2GA 2V8HA 2DNPA 1TAUA 2D1GA 1SIWB 4BCAA 2RDDA 3PX0A 4IDKB 1HNZF 4C8OA 1CEZA 1WTFA 3GIKA 3H2UB 2I5JB 5CQGA 4DSLA 3CF5Q 3NBPA 2AJ4A 2XEXA 4CO0A 3RAMA 3MI7X 3IS9A 2AYGA 2RNEA 2FGOA 3DHWC 5F8NA 5IOLA 1AT1B 1UCNA 3GMGA 4DL4A 2C2MB 2C2ZB 3H2VE 3HHKA 4USVA 5IC4B 4CLPA 1XNQF 1SKWA 5DLFA 4HI2A 5KFSA 4L76A 2CQ3A 2KXHA 3DLEA 3GFZA 3RBDA 5KFJA 2KM8B 4P10A 4IG0A 4U6PA 1CJVB 2W8SA 5C2GA 4EYIB 3I31A 3Q8RB 1HNIA 2IBOA 3MM7B 3DI6A 3MUMP 2JOQA 3EZOA 1CQMA 1R0AA 2ZVIA 3D5MA 4YB5A 3GIIA 3KMQA 2NXNA 4B9NA 5A8WA 4WP9A 2OUGA 4WIQA 1IWGA 1W26A 2N82B 3D3CJ 1OSCA 1S7HA 2RKIA 1KSPA 1S1VA 3CJSA 2GHVC 3VAMA 4QWEA 3M32B 2V4QA 4MIWA 1H72C 2L41A 1XR5A 1RTJB 1UFLA 2DGUA 4DFPA 2HWTA 4IR1A 4N8OA 4Q44A 1N5QA 1REVA 1TFYA 1CS4A 1FXLA 3LANA 3JB9k 5DM7Q 1SUQB 4GO7X 2X98A 3RB0A 1EP4A 4F7VA 2FJXA 2JC0A 4ZCLA 1YQHA 5KG1A 1FE0A 2UVVA 3NKPA 1R3NA 4KAIA 1RT1A 1JLGB 5A6WA 4KYZA 4CH0S 4ECZA 3NS7B 3ZXWA 1VRUA 4YHHF 4WYLA 4LFBJ 1FKAF 2H1YA 1DLOA 3GB0A 2DNRA 4U67Q 2VBYA 1J5OB 2MZTA 1M0SA 5I3PA 4P72A 2AQ4A 1IQZA 1YZ7A 3E51A 1TK0A 2GIQA 5DLVA 2MQOA 2GFFA 2FVRA 2GCFA 3GJTB 3OTOJ 3UQSA 4ZPCA 4NA2A 1SHQA 3CCZA 1I94F 4QJVA 4RWWA 1LW2A 2HHHJ 1Y5NB 2XMKA 2ZVSA 4EZ9A 1IBKJ 4QWBA 2I9SA 3BEGB 3QLHB 2LDIA 2ZH9A 2CJKA 2CA9A 1Q79A 1HWLA 3RR7A 1ZM9A 2RQMA 2GZOA 2Q3PA 2GQQA 2F8EX 1VQ7S 5HK4A 1MWYA 2KVIA 4HDGA 2CQIA 4N41A 4L3KA 5EN1A 3AA9A 2CQ1A 3FRZA 2UUCF 1BMQB 4ZP9A 2ZH7A 3CIZA 2W8KA 1U1KA 3SCKE 3I56S 4LBPA 1FWPA 3FNNA 2CJQA 2HVDA 1Q82T 4P74A 1LQ9A 3LF0A 5F8LA 1M1KT 2M52A 3WX8A 1NH8A 4I4BA 4ECUA 4LSNB 2AGPA 2K7JA 4DL2A 4F0KA 1T3NA 3JYTA 3B4DA 1P9QC 2H3EB 2QL5B 1N8RT 1D8ZA 3GCXP 4USIA 2JFDA 4M8LA 1UFWA 2OELA 5DO2A 2JHEA 4OYBA 2Q66A 8ATCB 1U24A 2VASA 3MMBA 3CD5A 3WX4A 1VBKA 4J90A 3FCWA 3B78A 3J81Y 5GAHU 4PQUB 3QIPB 1RAFB 4WFBQ 4ZN1A 4RKUC 3JXOA 1S6PB 2FZGB 2KJWA 2DH7A 2Q6CA 1FRXA 1RISA 5C42A 2HQDA 2IFYA 2QLWA 1ALHA 2YBVA 4DUTA 4FN5A 4WFYA 3UD3P 4RR5A 1PKUA 3DLJA 2C2EA 3TUJC 1S4EA 1ZTWA 4ED8A 3OXFA 3KLIB 4DFKA 4KPCA 5B0CA 2I6WA 1OPZA 2HVIA 3A8EA 3OSPA 2D7SA 3I87A 3DLGA 4K0KJ 1JLBA 2NS1B 2Y8YA 1BHNA 4LF9J 3DOMB 2DNNA 3CD7A 2FJWA 4EI2A 3MMCA 4CO4A 3M2VB 2ROEA 2FVSA 1DRZA 2HGNA 3LUYA 1RYRA 3BBBA 4CNYA 2NCKL 2DIUA 2AMCB 1HNVA 5EWEA 4LFCF 1N48A 2RU9A 4FYVB 4GO5X 1RU1A 4WP3A 2FZCB 2G13A 4KE5A 5HVGA 2ADCA 2O1PA 1JLQA 1RTDB 4Y2CA 2HZCA 4URQU 3J80Y 3BO3A 5KXAA 4Y65A 2ZWPA 4JI2F 4HACA 1ZZNA 4B08A 5D8HB 2FVPA 4QW8A 3KJVB 2RAQA 4B3OB 4R8UB 3MTKA 1MU2A 3FKBA 2JEGA 3TAQA 2W9CA 4NZ6A 1TKTA 4UTGA 4IRKA 2V9KA 1FERA 3ZZRA 5HLFB 1Q8BA 3ILLA 3PO4A 4AQYF 5LMNJ 4PWUA 2W5SA 4C4WA 3M8YA 3FEXB 5KFWA 1KWMA 2XC9A 4PR6A 5IXUA 5JXSA 1BY9A 2QV6A 2YH0A 3OR2B 2MLZA 2FLLA 5KFPA 1F5CA 4WBFA 3EE3A 2HIQA 4IQXA 4BC9A 1V5IB 1OYEA 3I82A 2X1AA 2ZDPA 2UUAF 5I3UB 3TA1A 1R0BG 2XMVA 1NEEA 1NDCA 4Y3CA 5EDWA 2V5HG 1T9XA 2LXFA 4P9SA 4OI2A 3AH6A 1DHMA 3BR9A 3MEGA 4GVLA 2LQ8A 2Z58B 2XRGA 2LQJA 3M6VA 2MZRA 3AB4B 3OPKA 4ECYA 2CPDA 2QX0A 1TUWA 1GXUA 4W92B 4KV8A 3AT1B 2Z56B 1SKRA 3NOGA 4M63A 4KQZA 4WF9Q 4DQPA 1K8AT 4DV5F 4LBIA 4X62F 2BYCA 4QZVB 3M8QB 3C19A 2NSCA 2R9LA 1HBMB 5AE3A 2OMLA 4JV0A 1KHLA 2AX1A 3SXLA 3FMWA 5C25B 2MHNA 2ZH6A 1TFWA 5TJ3A 4J9VA 3TG0A 3PYDA 3BREA 2FHMA 3T5LA 2CG4A 3M9NB 2QRRA 1N2LA 1F5BA 3R6LB 1IUJA 4GRSA 4G3IA 3SV4A 2HHWA 3GYXB 1S77D 2YTCA 3RRHA 4EO8A 4A4JA 3H98A 3L7UA 4YR3A 4GC6A 2ZHOA 3Q86A 4Y0FA 2DRDA 3AOBA 2AJ0A 1JMTA 4EWTA 3GJQB 1QM9A 4IKAA 4NXMJ 5DQIA 2RDJA 4RUAA 2C3OA 1S6QB 3K2YA 4B3RJ 1H7XA 3IN5A 2ZBQA 2B6AB 3R1LA 2GQCA 3PYEA 4I6WA 4UUXA 1RT7B 2HQGA 4I0WA 1AJAA 3DRXA 1QTMA 2OPRB 5J2NA 1ZA2B 1DTTA 2DBBA 2GMJA 5A8RA 2SXLA 3HHLD 2BJ9A 1E6VB 4LREA 1FJGJ 4LUBA 1WD6A 1HNXF 4JB8B 4EZ6A 2DNHA 2E5GA 3KJNB 3QGPA 1S0OA 5L1LA 5HROB 4LF2A 2KL8A 4KGXB 4V19J 2YNGB 2OPQB 3C46A 1S79A 3OTEA 1NB2A 2KYXA 2K1RB 3KUGA 3U1MA 4AL6A 4C6AA 3N4WA 4ZCKA 2OD6A 4F8RA 1T9TA 2ILYA 3D1QA 1NZ8A 2YNFA 4C8NA 1YJNS 2C2RA 2QLBB 3BDGA 4N77A 1JKHB 3CJQA 1IM4A 4GKJJ 5FLXY 3SDEA 1FKOB 3MTJA 4Y2IA 3R5CA 1EETB 1KH5A 3RBEA 3V2UC 1E6YB 3Q23A 3BPSP 4O3NA 3DOKB 5AJ9A 3HP6A 4BWJA 1Y00A 3KUEA 3IWLA 3LP2A 3O8WA 3CDUA 2D3O1 2HVEA 5DM6Q 2I1RA 3CGIA 1RT4B 4NCGB 1IWAA 2RF2A 4K4SA 4CYSA 3BKTA 1WF0A 2XS5A 3S01A 2PN6A 1HR0F 1UW9A 1CULB 2HVHA 2YWGA 4DPTA 2OJ3A 1NH7A 5KFNA 1JLAA 3BQ2A 3LTOA 3WZ0A 4N7TA 4ZPBA 4CQ1A 3Q2TC 1Q95G 2YX7A 2XSJB 1EI6A 1YBUA 3T3FA 1YHQS 4KFBA 4G65A 2A3JA 2C2KB 3SCLE 4KHPF 3TX8A 3J80U 5E3QA 4KM4A 1PIEA 1S9GB 3QATA 5D4LA 3RBXA 1F2HA 1TZ0A 3M7VA 4MHXA 2KDOA 1YJ7A 4M5HA 2E1RA 3EXYA 2VZ9A 4IFVB 5D4PA 2C3PA 2DR7A 2UXBF 1RABB 1WEZA 5LXYA 4OI6A 3NL0A 3C6TA 5HL7Q 4O3PA 2MQNA 3S1TA 2XMWA 4FYDA 2R8HA 4HR2A 3HCXA 2RDIA 2DD8S 3KMSA 1ZETA 2XLIA 1SH0A 5T41A 4BS2A 2I38A 4HI1A 1A9NB 1NXIA 4TNOA 4DUZJ 4IH5A 5DGAA 2JNJA 5AE2A 3RZAA 2WBRA 3CXCR 3M8ZA 4DN9A 4HT7A 3MPDA 1R8HA 2JX2A 4RPFA 3R2CJ 4LRFA 5SZTA 2FLPA 2M88A 1IBLF 2WONB 4B9MA 1SJ4P 5K8OA 4QWDA 4F4KA 1PJ7A 1FCAA 2HHVA 2JLGA 2UU9J 1RACB 1CJKB 1UA1A 4X4QA 2QA2A 1CJTA 1N34F 1XEZA 3N5FA 2NXUA 3TRGA 1NPRA 4CLSA 4U7UD 3N0VA 2CAJA 4YFUA 1BQMB 3VGVA 3GV8B 1P9YA 4DQQA 2C2DA 1RWVB 4EYHB 2U1AA 2E9ZA 2ZOFA 1AFIA 1SI9A 1PC5A 4DEZA 2KFYA 4DR4J 4ECWA 1ZEFA 5DQGA 4PUOB 1JNRB 3IGYB 2KTQA 3KLGA 1FTCA 5FDLA 3NMAA 2J9DE 3OVAA 3UDCA 5L1JA 2PFDA 3MMAA 1SH3A 5B7WA 3L7PA 5G0RA 2WSEC 4U8YA 4C0OC 3IRXB 2J8AA 3BN4A 1UZDA 5KT6A 1HFEL 3HHLA 3SQGB 4DR7J 1K0VA 2MPUA 2R7SA 3VVUA 2YNHB 3HO1A 5CZVA 1S1XA 2HFSA 5HBMB 4OL8A 1VQYA 3LO3A 3ETMA 1QJHA 4LSLB 1TKXB 3MEEA 1N32J 4F2RA 4RW4A 1FRJA 3BGOP 3QO9A 5KG6A 5DLWA 5D77A 1KQGB 5L39A 4OX9J 1KN6A 4G1PA 2FHOB 3ZZYA 4B9LA 4E98A 2E1CA 1RAGB 1FEHA 2GAGC 1UPMB 3IAS9 3RBZA 2BA9A 1LW0A 5DS7A 3K0JA 2R7XA 4TVAB 1N33F 1R6YA 2IMWP 1R27B 2FHKA 1SKUB 5K8MA 1KHKA 4NLRA 3I55S 4EU0A 3MXHP 4JI0J 4Q5VA 1RA7A 1ULRA 3QZ8A 3S6EA 1NPKA 4DX8H 1M5HA 4LF5F 4TXSA 3LXQA 2Y0BB 4UPKA 1MMDA 1MNEA 4ZK7M 4UF4A 2VPZB 5KFTA 3N5BA 4ZVQB 3V6JA 3CCVS 3ZNJ1 1NDLA 4OYZA 3DYCA 2KO1A 1X5TA 5FLXU 4DCPB 5F9LA 1Z4UA 2QLFB 3MM5A 3W62A 4RNOA 2CPEA 3IMQJ 4LQ3A 2VG6A 5K8NA 2IRXA 4CH7A 4OJGA 3J7YU 2BEFA 3MAAA 1VBXA 2GVDB 4B3MF 4F67A 1KLMA 4C0BA 1FESA 1FNMA 3KD8A 2PEHA 1HBOA 5A6PA 2RMLA 5J2PB 4HL9A 2LLZA 4RO0A 2FTRA 1WF1A 4PEOA 1ZOTA 1NK6A 2C42A 2ZUGA 1FFWB 1HDHA 4K5RA 4A8YA
chains in the Genus database with same CATH topology
1O98A 4FDJA 4KAYA 1FSUA 3TG0A 2W5RA 2X98A 4ZG6A 5INHA 4UOOA 1ED9A 4ZGAA 5C66A 1ANJA 5LQQA 1KHJA 1HQAA 1KH9A 3UO0A 1N2LA 4N7TA 5LIAA 2GSNA 3UNYA 4FDIA 1EI6A 2W5VA 4LR7A 3M8ZA 4UOPA 1ALIA 1Y6VA 1K7HA 1ZEBA 1EW2A 3E2DA 4LRFA 3LXQA 3OT9A 4KAVA 3NKPA 5L0EA 1Y7AA 2GSUA 3NKQA 4UPKA 4UORA 3UN3A 2W8SA 2QZUA 3ED4A 4LR2A 1EJJA 5DLTA 5HRTA 1KH4A 3NKRA 4CYRA 3WBHA 2IFYA 3DPCA 1ALHA 1ZEDA 3BDGA 5IJQA 3WAYA 5KXAA 2W5TA 4NWJA 3A52A 4GTYA 4KM4A 2G9YA 1ELXA 3DYCA 4QAXA 4UPHA 4KJGA 4TN0A 3T01A 5LRMA 5K4PA 1URAA 1ALKA 2XRGA 4KJDA 3TWZA 4UPIA 3MK1A 3M7VA 3UN5A 3M8WA 1E2SP 4MHXA 2ANHA 1KH7A 4LQYA 1E1ZP 2IUCA 3NVLA 1ANIA 1AJCA 3B5QA 1KH5A 4CXKA 1ED8A 1EW9A 2D1GA 4NWXA 5EGHA 4YR1A 1AUKA 4LRCA 3T02A 1URBA 3IDDA 2W5WA 1B8JA 1HJKA 5DLWA 4LRBA 5LRNA 4UPLA 3Q3QA 5L0KA 3BDFA 3BDHA 5AJ9A 3IGZB 3T00A 4GTZA 4MY4A 4CXSA 5DLVA 3KD8A 1ELZA 4LR8A 2ZKTA 5GOVA 1AJAA 3SZZA 3UN2A 4LRAA 1KHNA 1AJBA 3WAVA 5L0BA 2W5SA 3NKOA 2W5QA 3M8YA 1EQJA 4MIVA 1SHQA 2W5XA 1ELYA 2XR9A 3NKNA 4CXUA 4CYSA 2GSOA 3SZYA 2GLQA 3CMRA 1N2KA 1KHLA 1SHNA 2IUCB 3MK2A 3NKMA 3MK0A 1ZEFA 2VQRA 1AJDA 1E3CP 3WAWA 4B56A 3IGYB 4ZG9A 4LREA 1P49A 5EGEA 5GRRA 4ZG7A 4LR9A 2RH6A 5IJSA 1HDHA 4LRDA 4GTXA 1E33P 3TX0A 4GTWA 5TJ3A 1EW8A 3BDGB 1ALJA 1KHKA 2GA3A 1O99A 3WAXA 2W8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O98 A;  4FDJ A;  4KAY A;  1FSU A;  3TG0 A;  2W5R A;  2X98 A;  4ZG6 A;  5INH A;  4UOO A;  1ED9 A;  4ZGA A;  5C66 A;  1ANJ A;  5LQQ A;  1KHJ A;  1HQA A;  1KH9 A;  3UO0 A;  1N2L A;  4N7T A;  5LIA A;  2GSN A;  3UNY A;  4FDI A;  1EI6 A;  2W5V A;  4LR7 A;  3M8Z A;  4UOP A;  1ALI A;  1Y6V A;  1K7H A;  1ZEB A;  1EW2 A;  3E2D A;  4LRF A;  3LXQ A;  3OT9 A;  4KAV A;  3NKP A;  5L0E A;  1Y7A A;  2GSU A;  3NKQ A;  4UPK A;  4UOR A;  3UN3 A;  2W8S A;  2QZU A;  3ED4 A;  4LR2 A;  1EJJ A;  5DLT A;  5HRT A;  1KH4 A;  3NKR A;  4CYR A;  3WBH A;  2IFY A;  3DPC A;  1ALH A;  1ZED A;  3BDG A;  5IJQ A;  3WAY A;  5KXA A;  2W5T A;  4NWJ A;  3A52 A;  4GTY A;  4KM4 A;  2G9Y A;  1ELX A;  3DYC A;  4QAX A;  4UPH A;  4KJG A;  4TN0 A;  3T01 A;  5LRM A;  5K4P A;  1URA A;  1ALK A;  2XRG A;  4KJD A;  3TWZ A;  4UPI A;  3MK1 A;  3M7V A;  3UN5 A;  3M8W A;  1E2S P;  4MHX A;  2ANH A;  1KH7 A;  4LQY A;  1E1Z P;  2IUC A;  3NVL A;  1ANI A;  1AJC A;  3B5Q A;  1KH5 A;  4CXK A;  1ED8 A;  1EW9 A;  2D1G A;  4NWX A;  5EGH A;  4YR1 A;  1AUK A;  4LRC A;  3T02 A;  1URB A;  3IDD A;  2W5W A;  1B8J A;  1HJK A;  5DLW A;  4LRB A;  5LRN A;  4UPL A;  3Q3Q A;  5L0K A;  3BDF A;  3BDH A;  5AJ9 A;  3IGZ B;  3T00 A;  4GTZ A;  4MY4 A;  4CXS A;  5DLV A;  3KD8 A;  1ELZ A;  4LR8 A;  2ZKT A;  5GOV A;  1AJA A;  3SZZ A;  3UN2 A;  4LRA A;  1KHN A;  1AJB A;  3WAV A;  5L0B A;  2W5S A;  3NKO A;  2W5Q A;  3M8Y A;  1EQJ A;  4MIV A;  1SHQ A;  2W5X A;  1ELY A;  2XR9 A;  3NKN A;  4CXU A;  4CYS A;  2GSO A;  3SZY A;  2GLQ A;  3CMR A;  1N2K A;  1KHL A;  1SHN A;  2IUC B;  3MK2 A;  3NKM A;  3MK0 A;  1ZEF A;  2VQR A;  1AJD A;  1E3C P;  3WAW A;  4B56 A;  3IGY B;  4ZG9 A;  4LRE A;  1P49 A;  5EGE A;  5GRR A;  4ZG7 A;  4LR9 A;  2RH6 A;  5IJS A;  1HDH A;  4LRD A;  4GTX A;  1E33 P;  3TX0 A;  4GTW A;  5TJ3 A;  1EW8 A;  3BDG B;  1ALJ A;  1KHK A;  2GA3 A;  1O99 A;  3WAX A;  2W8D A; 
#chains in the Genus database with same CATH topology
 4FPI A;  1VQS A;  2P9G A;  4ZS6 A;  4NZ7 A;  2AZ3 A;  2IA0 A;  2FHJ D;  3PKY A;  3IFE A;  4EBD A;  5HVH A;  3AQP A;  3FFI B;  2V0N A;  2UZA A;  2HQC A;  4IFY B;  5F0W A;  2XYH B;  2D41 A;  3IBW A;  4C48 A;  2HLU A;  1UJ5 A;  4HKQ A;  1UZH A;  2KHC A;  4KHM A;  2F8H A;  2MTL A;  1YG0 A;  5DZ7 A;  3TUI C;  4TY8 A;  4GVB A;  1AUK A;  3MUT P;  1XWL A;  3D66 A;  2A1B A;  3AOA A;  5ETO A;  3BGL A;  3BDH A;  3UCU P;  5BR8 F;  1VC0 A;  1JIH A;  4OQJ A;  1ZS6 A;  2DRB A;  3V6K A;  4ZIW A;  2HNZ B;  2G0C A;  2W5Q A;  1KVJ A;  5C7P A;  3H5X A;  2OI2 A;  3C6U B;  1X4C A;  3ZZU A;  4MK8 A;  3KYL A;  3CCU S;  3HI9 A;  1BGX T;  1HWI A;  5E3C A;  1WC4 A;  1WI6 A;  4I7F A;  3GIR A;  5LMU F;  1WDT A;  2GMH A;  1V3R A;  4WE1 A;  4J9P A;  4KTQ A;  1XQI A;  4UOF A;  3MCS A;  3KJF B;  4I2Q A;  2DJW A;  2R7Q A;  2J6T A;  1UL3 A;  4DS5 A;  1EAR A;  2APO A;  3E2D A;  1HWJ A;  1Y5L B;  3D0H E;  5EWG A;  1C1B A;  3U1L A;  3DYA B;  3SCI E;  1QLN A;  2W5T A;  3BQ1 A;  1HNZ J;  2RUS A;  3J7A N;  5E3A A;  3ITH A;  1UWB B;  1YKW A;  1F3F A;  3W2V B;  8AT1 B;  2MZQ A;  2ASL A;  6AT1 B;  3BDP A;  1I1G A;  3BDF A;  2HNY B;  3HFZ B;  4FXW A;  2FJV A;  2O5D A;  4PAA A;  2PI4 A;  4B3T F;  2OFG X;  3ZZP A;  3VV2 B;  1YRT A;  5J1P A;  1URN A;  1XNQ J;  2IYI A;  2HG4 A;  2IUC B;  4ZVT B;  1FRH A;  4ZG9 A;  4MTP A;  2V2K A;  2RH6 A;  1CBK A;  4ZVR B;  5HN0 A;  1E33 P;  2QMX A;  2MQ8 A;  4OI0 A;  3BSO A;  4UOO A;  1IVZ A;  3T19 A;  4JI8 F;  1KDN A;  2D3U A;  5C5J A;  1Y9O A;  4USU A;  3TJ9 A;  4DJB A;  3BGR A;  2CIM A;  4Y28 C;  1M5P C;  3PY8 A;  3MED A;  4CI0 B;  3VAF A;  3N6L A;  5F3Z A;  2IHR 1;  2DXE A;  1M90 T;  2QYG A;  1QVG R;  1LWE A;  5CYM B;  1S0V A;  4I69 A;  4J37 A;  2KVQ E;  1S76 D;  3CTR A;  4ICL B;  2YWH A;  3OL7 A;  2DRA A;  2GIR A;  1S9E A;  3IS9 B;  3M4X A;  5E41 A;  4RNH A;  4C0H A;  4FXD A;  2K06 A;  1NDK A;  2FJA B;  3C14 A;  3J81 j;  1KD1 T;  2FJE B;  1UVM A;  2N3L A;  3A3P B;  4L74 A;  2K8G A;  3UR3 C;  5G4D A;  4F50 A;  3TEH B;  1HA1 A;  2OSR A;  3ENQ A;  2W4D A;  1FNX H;  1G3O A;  3AY0 A;  4J9Q A;  1MWZ A;  4JI7 J;  1H2V Z;  1SJF A;  2VFV A;  3DXB A;  4DMZ A;  3MK0 A;  3KK3 B;  2DGQ A;  3JTP A;  4ZHR B;  2B7B B;  4DV4 J;  2JC1 A;  1JLC A;  3CJT A;  2HRY A;  1RT2 A;  3SSR A;  2UVR A;  3UNY A;  3FUY A;  1OIA A;  1QAY A;  1RQ0 A;  3H20 A;  2R7R A;  4P6Q A;  4KC5 A;  4DU8 A;  4AL5 A;  4RWX A;  4DQS A;  3K57 A;  5KFA A;  3ZTS A;  1TL3 B;  3H40 A;  2IBK A;  2Q1L A;  1U0H B;  3MGJ A;  3HZG A;  3D0I E;  2HBQ B;  1WC3 A;  1VCT A;  1T9W A;  2FHJ A;  5M2U A;  1IQT A;  4DL0 C;  3HHD A;  3LA0 A;  1N6Q B;  2RJZ A;  5A76 A;  1NSP A;  2YKM B;  4LVN P;  4UOC A;  2VH7 A;  4DSJ A;  2BAN B;  1L3U A;  2XHC A;  2AD9 A;  5F8G A;  2ROG A;  4JUZ A;  2CPZ A;  5CYQ B;  4ED0 A;  3PJW A;  1RT1 B;  2L9D A;  3IG1 A;  5KT5 A;  4OYP A;  4AL7 A;  4O0N A;  5L8R C;  1WF2 A;  3MZI A;  1HQA A;  3HUL A;  1TKZ B;  4ED7 A;  2W7O A;  2UUC J;  4I6A A;  1S48 A;  3RR8 A;  1H74 A;  4O4G B;  4M1K A;  3D6F B;  4RBU A;  3QGH A;  2BAB A;  4D3H A;  4Q8E A;  3NCR A;  1PJ5 A;  2MZ1 A;  1U1R A;  1B7Y B;  1QE1 A;  4XO0 A;  1PCA A;  2BE2 A;  3OBI A;  3DU5 A;  2WVD A;  4LF4 F;  2GGP B;  1LW2 B;  2VBW A;  1RCO B;  5MLC V;  4ED6 A;  7AT1 B;  2HFV A;  3M8P A;  2KB2 A;  2ZE2 B;  2CZ9 A;  4C8K A;  5EGH A;  2HS0 A;  3BQ0 A;  4DR3 J;  1Q16 B;  2KJV A;  3CB4 A;  1T05 B;  1X8D A;  2B43 A;  4DF8 A;  2HEK A;  4L73 A;  1RWM B;  2XS2 A;  2YKA A;  4IR9 A;  1AA1 B;  3VWS A;  3SZZ A;  1SPB P;  1V3S A;  2V4J A;  3OLB A;  4I2P A;  2B4O A;  4HEA 9;  4F0M A;  4LF1 A;  2KFZ A;  1RWW B;  2E5I A;  3EGW B;  1O0P A;  2JLF A;  2KKH A;  2RSQ A;  2AYE A;  1YRX A;  1HI8 A;  4C98 A;  2MKJ A;  3ZZ0 A;  3PRD A;  1S7I A;  4ZPT R;  3HVR A;  3LP1 A;  4JP8 A;  1CPZ A;  3CJK A;  2QYC A;  2LQB A;  4KGM A;  2RQK A;  4ALZ A;  1F9F A;  2PE8 A;  3HK2 A;  2X51 A;  1KOH A;  3OW2 R;  2LYV A;  5I42 B;  4RBT A;  1K7H A;  1D3W A;  2NPF A;  4X84 A;  3Q24 A;  4NMX A;  4L3N A;  2GA7 A;  3RB6 A;  1U1N A;  1X4B A;  4OI4 A;  2HHT A;  1QUP A;  4ZLN A;  4USM A;  5GMD A;  5KFO A;  3EWG A;  4KPY A;  1WJ9 A;  1FKP A;  1PBA A;  4UST A;  1KON A;  1DZ5 A;  3OJU A;  4C2M A;  3DM2 A;  4DV0 J;  1ZH5 A;  4DCO B;  2GVZ A;  3MMB B;  4MY4 A;  3D1O A;  3GFH A;  3HJF A;  1U47 A;  3MUV P;  5C2C A;  1HD0 A;  2AHO B;  1NK9 A;  4MKA A;  4RU2 A;  1SKS A;  2DXD A;  3DRP B;  2BKP A;  3M1V A;  4KGZ B;  3Q22 A;  2QO3 A;  4MKY A;  1LWF B;  4LFC J;  3AQO A;  4DV6 F;  1AUD A;  2ACY A;  2NUH A;  4PG6 A;  1WKJ A;  1RKI A;  2CDQ A;  4JI2 J;  4Q0B B;  3P5B P;  2Z4P A;  4KAV A;  2VL1 A;  2NYI A;  3I0R B;  4ILM A;  3C16 A;  4LT6 A;  4L72 B;  3N6N A;  1R0C B;  3RRG A;  3AHP A;  1K0T A;  3PTW A;  3D0G E;  2M2B A;  3BO4 A;  3JTO A;  4PCQ A;  3QID A;  1Q4R A;  4AQY J;  3BR8 A;  4RZR A;  3CJ3 A;  3KKF A;  3AJ1 A;  2W1B A;  4UOH A;  1BE4 A;  3DU6 A;  3LP0 B;  3O44 A;  5DQH A;  3I4H X;  2PI5 A;  4RW9 B;  1HNW F;  1PAE X;  2WW8 A;  1HNV B;  1V9O A;  3R1H A;  3FK4 A;  1RLD A;  2M8D B;  1RTH A;  8RUC A;  1EQJ A;  2YWE A;  1VQN S;  1FD8 A;  4KH1 B;  2H5J B;  4YDX A;  3ZTR A;  4B9V A;  5J1E B;  3AD7 C;  2UUA J;  1C1C B;  3C66 A;  2ZJQ Q;  1EZZ B;  2F1F A;  3F56 A;  1TMJ A;  1NK5 A;  2HBY B;  1A6L A;  3HVT A;  4PPD A;  5F8J A;  1R89 A;  2CQD A;  3LOU A;  2OAU A;  1RU2 A;  2KXF A;  2JSX A;  2Z57 B;  3DLK A;  3OT9 A;  1MU2 B;  2BJ8 A;  3MR7 A;  2VOP A;  2D74 B;  3P96 A;  1MWQ A;  3NKR A;  1VRT A;  3PR4 A;  4RBV A;  3KK1 A;  4H4M A;  4KKO A;  1RCX B;  1BQN A;  3I9Z A;  5B0E A;  3A52 A;  3QRP A;  1XN9 A;  4QAX A;  4IG3 B;  2CRL A;  4NXM F;  3T5J A;  5BYS A;  1GAO A;  3VQT A;  4DV7 F;  5HJX A;  3M8W A;  1FEE A;  5EWF A;  4ZVO B;  1LWC B;  3BGF A;  4DV5 J;  4WK1 A;  3NAI A;  3HHL C;  5AXL A;  4X62 J;  5HMX A;  3T02 A;  2NXC A;  3I4P A;  2DNG A;  4RUH A;  4YUD A;  5L0K A;  1VGY A;  3DMJ A;  1R8A A;  3OJS A;  4IO9 Q;  4ZCI A;  1R8P A;  3J7Z 5;  4DSE A;  3OL8 A;  1H6K X;  4DLG A;  4TU9 A;  2GJI A;  2KG1 A;  4F25 A;  4RU9 A;  1YGY A;  1HHS A;  3GSD A;  1VQK S;  4QU6 A;  1N5T A;  2LXI A;  4NYP A;  3Q8Q B;  1S49 A;  4C7Q A;  1HHT P;  1VIS A;  2B9X A;  5IWA F;  1PYT A;  4DSK A;  3ONQ A;  3VQS A;  3VAG A;  4FDJ A;  1LOU A;  3KOA A;  2OEJ A;  2EFQ A;  5CAA A;  1YI2 S;  4LF8 F;  3LAL A;  3G6E S;  2O66 A;  2IM0 A;  4OHX A;  1BXN A;  4DPY A;  1ZAW A;  4OLP A;  3O6Q A;  1U2F A;  2DHA A;  2HRT A;  4ZP8 A;  4UOR A;  2QZU A;  4USW A;  2GQ2 A;  1U48 A;  3W64 A;  3M6X A;  3EPI A;  1FNO A;  2FDN A;  2WK4 A;  3QT7 A;  1IKV A;  4BBY A;  1LK7 A;  2ATC B;  1TEL A;  5BJR A;  5D3G A;  2B0G A;  3B5Q A;  4KO0 B;  2HWH A;  2WSC C;  1HMV B;  4RW7 B;  1FI4 A;  4TQS A;  2ZKU A;  4W4M A;  3G6V A;  2ZC4 A;  3FC9 A;  3GON A;  4MKV A;  2Z30 B;  3F0N A;  4PPZ A;  3HDS A;  1MN9 A;  4IQM A;  1EB0 A;  3CUL A;  2DR8 A;  2HMI B;  1HNX J;  4ANE A;  3NNC A;  1QAX A;  3PRB A;  4IUF A;  1UEV A;  2BVZ A;  3O1L A;  3FRY A;  5IT0 A;  5T14 A;  1TL1 B;  1TV6 A;  4FYW B;  1NHV A;  1RT3 A;  4DN0 A;  3PEH A;  2ZH8 A;  4F3Q A;  3FBB A;  4OYI A;  2LXU A;  1U25 A;  1FA0 A;  2E7W A;  3UE2 A;  4PXB A;  4ID5 B;  3UN3 A;  1N54 B;  4ID8 A;  4C3K A;  2VUG A;  1TL7 B;  1S1U A;  3NGR A;  1NKE A;  2G9Y A;  5J2N B;  2RQ4 A;  4OZ1 A;  3K8W A;  1RHR B;  5CH7 B;  2O67 A;  4DL5 A;  1H73 A;  4NWX A;  3FSI A;  2F4V F;  2E1M C;  2DIV A;  1CJU A;  3AJD A;  4ED1 A;  1LWX A;  1WC5 A;  1VC5 A;  1HYS B;  4OHW A;  4JI6 J;  3QWU A;  2I0X A;  5CAB A;  1LXJ A;  4USJ C;  4NLG A;  2HHS A;  1EHW A;  1HR0 J;  2WTF A;  1ZM2 A;  5L0B A;  2OSQ A;  4XDC A;  2FYX A;  4MH8 A;  4B02 A;  1ELY A;  2GLQ A;  3QJP A;  2Y3Y A;  2AJF E;  1UVN A;  3PW2 A;  2ASY A;  4DUZ F;  4QR2 A;  3BDG B;  1OJ4 A;  3IA0 A;  1SC3 B;  2UXD F;  5C66 A;  2DGO A;  1O5J A;  3B8H A;  1U6F A;  3DOL A;  4DXL A;  3EZ5 A;  3V4I A;  4E2F B;  4KHP J;  3GIM A;  1JXE A;  4IDK A;  2YX4 A;  4YP3 A;  2UU9 F;  1KVI A;  2I5J A;  3D1H A;  3GYG A;  4M5J A;  1L3V A;  3PYF A;  5IV3 A;  5J2M A;  2FC9 A;  4WFZ A;  3DN9 A;  1OS5 A;  2UXB J;  2RIJ A;  1IM6 A;  3QFW A;  2NRE A;  2IVY A;  3PJ9 A;  1RP5 A;  1NU4 A;  1NSQ A;  5AXM A;  2R42 A;  1M5V C;  4DV2 J;  4CXS A;  2JH3 A;  3NMR A;  1MW7 A;  5AXN A;  2BKO A;  2W5X A;  2M70 A;  2VBZ A;  2DNL A;  3DRY A;  4WFN Q;  5GMK a;  2C3Y A;  4KSE B;  3M30 B;  3MM7 A;  5CA5 A;  4C3L A;  4Q2L A;  3BGU A;  1IBL J;  5HMY A;  3UO0 A;  2EVZ A;  2HQF A;  4DSI A;  3M8R A;  2XY6 A;  1WG5 A;  2H65 B;  2GIF A;  1GX6 A;  3B4M A;  4YN3 B;  3TNV A;  4DR7 F;  3KLE B;  3R9L A;  3VGU A;  3RB3 A;  4X4V A;  2CPF A;  4ILR A;  1EJJ A;  2DK2 A;  3DGP B;  1QDU B;  2IM3 A;  4JI4 J;  5IM0 B;  1WHY A;  3M32 A;  3GZ7 A;  2LFV A;  2ZHA A;  1NJW A;  3U02 A;  1HPZ B;  3X3U A;  1RTJ A;  1HBU B;  4TLQ A;  1ED8 A;  2B3T B;  1GTE A;  2BQR A;  5KFM A;  1Q5Y A;  3THT A;  1BWV A;  5LRN A;  1RTI B;  1SUQ A;  3NNH A;  4P2X A;  4ZVS B;  4WK3 A;  1FTR A;  2J9E A;  2PII A;  3TZY A;  1VIO A;  3M2R B;  5GAG U;  1S1W A;  2CQ4 A;  1HL6 A;  4F0H A;  2HND B;  5B0G A;  3IC1 A;  2Q79 A;  4D3G A;  1JLG A;  1WAC A;  4URG A;  3ZC4 A;  2BRL A;  2D69 A;  3UWT A;  2G2O A;  3HKW A;  1VQP S;  2BDP A;  3VHQ A;  4K2J A;  2CNL B;  4CWB A;  2KHD A;  3MEC B;  2CVE A;  3DLL Q;  3PIO Q;  2C3M A;  1NHK L;  1UMJ A;  5DET A;  3SFG A;  4OIX A;  1J5O A;  3KXD A;  2COL A;  5IFM A;  2XLJ A;  4IRC A;  2W4C A;  1KFS A;  1T03 B;  4CYR A;  2B7C B;  3A3N B;  5KFH A;  4HHU A;  5IV4 A;  2F9D A;  3NCQ A;  2OEM A;  2XMT A;  1ANI A;  1NJI T;  4CO3 A;  4WKY A;  1IKY B;  3UD5 A;  1RT6 B;  1Z2L A;  2VA3 A;  2EEY A;  2W2M P;  1Y7P A;  5FDL B;  5E3P A;  3QLH A;  3GQC A;  2LU1 A;  5L1I A;  2XMM A;  4DV3 F;  5JUM A;  2ZKT A;  1SXL A;  1N33 J;  4XTT A;  3VAJ A;  2V68 A;  3R7S B;  1Y10 A;  2IYG A;  1Y5I B;  4NLY A;  2GJ2 A;  2CPJ A;  3HHL B;  5EX3 A;  3N9U C;  2DNY A;  4LF5 J;  4JI3 F;  4ED2 A;  1JJC B;  4USK A;  3SSS A;  3VZI A;  1RKJ A;  3IGN A;  2MYF A;  3TUP A;  1EQM A;  2B9Y A;  3A8K A;  4RW4 B;  4OX7 A;  1PSD A;  4K4Z A;  5C24 A;  1N5Y A;  1JXV A;  3BM7 A;  1S72 S;  3LPY A;  1YRU A;  2CDR B;  4JV1 A;  4FZV A;  2R7V A;  2HAF A;  3EXC X;  1U2R A;  3GLJ A;  1VQO S;  5LSL A;  4QWC A;  1KKH A;  2BMB A;  1URA A;  4B3M J;  1GXT A;  1S97 A;  5D0R A;  2AU0 A;  1F9E B;  1L5U A;  3M2U A;  3B6B A;  5L9X A;  1Q78 A;  3H4B A;  3IM8 A;  3TAM B;  4QIG A;  5DGB A;  1HBN B;  2RHQ B;  4PXD A;  2CAD A;  2KI2 A;  4DX6 A;  2WRM A;  3H90 A;  1UVJ A;  3NKO A;  4PQU A;  3QIP A;  2W9B B;  2W8L A;  3SZY A;  1NJY A;  4X4S A;  4PZV A;  2QT7 A;  5K9F A;  2DTJ A;  5L38 A;  3EYZ A;  3D2W A;  1BD6 A;  3G82 A;  1KOO A;  1LFW A;  1MLA A;  1NK7 A;  3UD4 P;  2GA3 A;  5H9E J;  4P52 A;  4NEY A;  2K3I A;  3HKZ D;  2DEJ A;  4M5K A;  1QSL A;  4I56 A;  5KFX A;  1OYD A;  1X9M A;  2JDJ A;  3KLI A;  2ZHB A;  3MEK A;  4WFA Q;  3Q8U A;  5I4M A;  4X64 F;  3V81 B;  1SCJ B;  1KLM B;  3IR6 B;  3ZZO A;  4A8Q A;  4UZB A;  1KS2 A;  3VF0 B;  3PW4 A;  1VHI A;  3DOM A;  4C8L A;  4A8O A;  2Y1L B;  5BR8 J;  3M2V A;  2DGW A;  5GAD U;  2J5A A;  3ZTP A;  2R8J A;  2XI2 A;  3KWM A;  5IS2 A;  3FEZ A;  2ZH3 A;  4B3S J;  5HVF A;  3B54 A;  2MKK A;  2HWI A;  2AJ1 A;  5HMZ A;  2Z0G A;  3GU0 A;  2L9N A;  1VR6 A;  5LMU J;  3AAW B;  2R2S A;  3Q89 A;  2BX6 A;  4L6V 3;  4A46 A;  2DNZ A;  1KEK A;  1H7W A;  3MK2 A;  4K2X A;  2HVZ A;  4AFF A;  5A2Q Y;  3FQK A;  1G6B A;  3WAX A;  1O98 A;  1WKL A;  4B9S A;  2HK2 A;  1ED9 A;  4X4U A;  4K7Q A;  1KH9 A;  2Y1I A;  3IM9 A;  3N28 A;  1OPI A;  3POT B;  3QBC A;  3KJV A;  1RHQ B;  1L3T A;  4B3O A;  3TVK A;  1Q1K A;  4NLU A;  4R8U A;  4QR1 A;  2NZ4 A;  2QMU B;  3ED4 A;  2VQE F;  2RT3 A;  4WTY A;  5KFG A;  2M4M A;  5AJ3 F;  2YNI B;  3A8I A;  5D15 A;  5HLF A;  4J7C A;  4WU2 A;  3QGG A;  1GFW B;  4LMZ A;  4U8V A;  1NCL A;  3CCT A;  2EI5 A;  3V6D B;  1PBU A;  1E2S P;  2A2C A;  2YWF A;  4RW6 A;  5KG3 A;  4K4T A;  1R6V A;  1DTQ B;  4MK9 A;  3UDL A;  4ZKA A;  1GX5 A;  4B3T J;  3EGV A;  3OR2 A;  3K7R A;  3KDN A;  1UJ4 A;  3R27 A;  1XMQ J;  3I96 A;  2WBM A;  2EKN A;  2QEX S;  4JV5 J;  4ZCM A;  5K8P A;  3CJ4 A;  5GOV A;  2G1H A;  2B8Q A;  2DR5 A;  4N5S A;  1CQN A;  1KHN A;  4LBH A;  4JI7 F;  3PZP A;  3DCA A;  4NI2 B;  2BV3 A;  1R7I A;  1B64 A;  4JI8 J;  4DV4 F;  4A8F A;  3O2I A;  2PMH A;  4Y2K A;  4QPT A;  2MHE A;  5B0A A;  1HI0 P;  1HW8 A;  1Y4Z B;  2Z2Y B;  2AIR B;  3MM9 A;  2PD1 A;  4CM0 A;  5A8K B;  4X66 F;  3D6T B;  2KZZ A;  5JVH Q;  4PQA A;  3HHN B;  5L46 A;  1DQ8 A;  5HQM A;  3QGI A;  2MY7 A;  3PFO A;  4F4A A;  3JQJ A;  3BSC A;  1XMB A;  2F3J A;  5ITH A;  1KQF B;  3ET6 B;  4DL7 A;  2IY5 B;  2MY8 A;  1UEK A;  4F3O A;  1U2C A;  3MM6 B;  4GTY A;  1ZA1 B;  4NML A;  2HRU A;  3M8Q A;  3NCP A;  2XMJ A;  5K14 A;  1HBM A;  2AYM A;  1WG1 A;  5F8I A;  4HH0 A;  4OZL A;  1EW9 A;  4KR0 B;  2QFI A;  5C25 A;  4YOE A;  3MM8 B;  2MST A;  1PYS B;  5IQQ A;  2E1A A;  1RAE B;  2YPZ A;  4AT1 B;  2PMW A;  4NZ0 A;  4O23 A;  1C0T B;  3FGV A;  2EBG A;  1NPP A;  1SQG A;  4AXJ A;  3H5S A;  4UY8 5;  4IOB A;  1CG2 A;  5ADZ A;  4IO1 A;  2HKE A;  2OH2 A;  2CZ4 A;  4XPE A;  4MYT A;  2QFJ A;  3K5L A;  2V69 A;  1VLY A;  4UOP A;  3OUY B;  1Y6V A;  1RWP B;  4DR1 J;  3HXM A;  2HFU A;  2WAQ D;  1X4G A;  4YDD B;  4Y34 A;  1ZPV A;  3CDA A;  4DPO A;  2B6A A;  3W8G A;  2XWY A;  1RT7 A;  2WW4 A;  1T8E A;  2OPR A;  5KFK A;  2XY7 A;  2G1D A;  2BBE A;  4HH1 A;  1U1M A;  3K89 A;  4DR3 F;  1MMN A;  3BB5 A;  3K5P A;  1E6V A;  3MCM A;  3DDK A;  3LWL A;  2HFO A;  2XY5 A;  4OYM A;  1JLC B;  3IP0 A;  5HRO A;  3QFH A;  2YNG A;  3MF5 A;  3G8S A;  3N6M A;  5H9F K;  2K1R A;  1NB7 A;  1ZYQ A;  4CYU B;  3KG4 A;  1QAJ A;  2DY9 A;  1SHN A;  2VQR A;  2EXU A;  4TU8 A;  2IIH A;  3QJL A;  1AXQ A;  4GKK F;  3VAI A;  3OXL A;  4KGK A;  3W2W A;  2MQL A;  3K8V A;  2ZOM A;  3Q8S B;  3W9J A;  2H4Y B;  2R2U A;  5CYJ A;  3PNI A;  1FKO A;  1EET A;  3CCR S;  2RRA A;  5KFB A;  1GMV A;  2ZBI A;  2CJX B;  1N5V A;  3HLU A;  5KT3 A;  3ILO A;  4NLO A;  2HFN A;  3DOK A;  2YY3 A;  4LF4 J;  3DRR A;  2OPS B;  2ASD A;  3L4B C;  1VOM A;  2E29 A;  1JK9 B;  2DH8 A;  3CED A;  1ELX A;  1RT4 A;  2VA2 A;  4WKR A;  2E5H A;  2ANH A;  2R7T A;  1SJ3 P;  1S57 A;  3G4S S;  3MPW A;  2ZJR Q;  4DV0 F;  3M8S A;  2AWZ A;  5HQ8 A;  3UDV A;  9ATC B;  2XWX A;  2RHS B;  4DPX A;  2G2Z A;  1UAW A;  2J7W A;  3T00 A;  2AF6 A;  4WCE Q;  1GQE A;  3L95 X;  5HP1 B;  2V6A A;  2NUU G;  4J9M A;  1U49 A;  2PEB A;  2XSJ A;  3FZB A;  5F41 A;  2ZWO A;  2C2O B;  2KU7 A;  2BAC A;  1S0N A;  5A0Y B;  4DI6 A;  2VQF J;  1NLK L;  5HAT A;  3W61 A;  2QL7 B;  2LMI A;  3M6U A;  4PXC A;  3TZW A;  1S10 A;  3A8J A;  1HLW A;  1QE1 B;  4PYD A;  3E01 A;  4C11 B;  4GTX A;  2MKY A;  4FF2 A;  2B4P A;  2DIS A;  3R5A A;  1KVK A;  3H4D A;  1RZM A;  1S9G A;  4ECV A;  2HQ3 A;  2IC3 B;  3G8Q A;  3OQ2 A;  5L1K A;  2UVU A;  4LR7 A;  1ZBT A;  3CCJ S;  1APS A;  4ZVG A;  4OZ3 A;  4IFV A;  4OJ3 A;  4R0J A;  2L48 A;  4A8X A;  5HO4 A;  1FDB A;  5KG7 A;  1FX2 A;  5T7L B;  1OSD A;  1RBA A;  3P45 B;  4KJI A;  2CG8 A;  3P49 B;  4UW2 A;  4DS4 A;  1AJC A;  3UVJ B;  1UVK A;  4ETX A;  5BYR A;  4NPO A;  1F6T A;  4OI3 A;  1FDN A;  1Q8K A;  3CDE A;  4RL1 A;  4MKB A;  2DGT A;  2C28 A;  3GR0 A;  4LRA A;  4DFJ A;  3NOC A;  4DV6 J;  4LF7 F;  3DNC A;  2ERR A;  2M9K A;  1UWA A;  3OSN A;  3WDO A;  2WON A;  5GAE I;  4R5P B;  2UUT A;  4ZLJ A;  4XIU A;  2DIT A;  2QMW A;  1CJK A;  4ATN A;  2MKS A;  2W9A A;  2RS2 A;  2KM8 C;  1VHF A;  2CFX A;  2D3O R;  4LJM A;  1SV5 B;  3RW7 A;  1ZZF A;  3OFH A;  3QPI A;  3UPF A;  3KLF B;  3L3C A;  2LA6 A;  2XLK A;  1BQM A;  4MFB A;  2B5J A;  1F9H A;  3DM2 B;  3SCJ E;  2FY1 A;  3EPG A;  3ADA C;  2FZK B;  3NEK A;  2BJ3 A;  1UVI A;  4FS1 A;  1WG4 A;  4NLS A;  1N0U A;  4NWB A;  3GV7 B;  5KFR A;  2XMA A;  1IKW B;  2DGX A;  3RW6 A;  2ZZN A;  1SIZ A;  2Y0S D;  3ICL A;  1HNW J;  3Q2S C;  4PUO A;  5LL6 d;  4YY3 F;  2IAJ B;  1QY7 A;  2Z2L A;  1N36 F;  2J9D A;  4FF1 A;  1Y3J A;  1VYA A;  4DG1 B;  1IJF B;  2ILZ A;  1ELZ A;  4QBU A;  4O44 B;  4OV6 A;  4B17 A;  4LQ9 A;  2HYI B;  3W7B A;  1FDA A;  2CKW A;  1WKK A;  3S7R A;  5I3Q A;  1H98 A;  3G6X A;  3SQG A;  3P3D A;  4B56 A;  4X4R A;  2ZD1 B;  2AGQ A;  5EGE A;  3J7A 1;  1MML A;  2YNH A;  4DX5 A;  1KBR A;  1FK9 B;  1TL4 A;  5DDR C;  3D67 A;  5LIA A;  4LSL A;  1TKX A;  2PA3 A;  2LKZ A;  4H4O B;  1L3K A;  1WUU A;  1WHV A;  3GG0 A;  5IQ6 A;  4MAK A;  1J5E J;  2HQI A;  2KYZ A;  2GV1 A;  3EZU A;  4HYK A;  4DV7 J;  3T1Y F;  1SC6 A;  1FF2 A;  5J2Q B;  2HLT A;  2NLW A;  3EIC A;  2VG7 B;  2EG2 A;  1ZTT A;  3NG8 A;  2VOD A;  2R2T A;  5LRM A;  3LWM A;  1S59 A;  2HAI A;  4ES1 A;  3GR1 A;  2FUG 9;  1GT8 A;  1B3T A;  1UKU A;  4NXN F;  2ATL A;  4I1T A;  4P75 A;  1DQA A;  3OL9 A;  3H0P A;  1BLU A;  1ZM3 A;  3QSI A;  3PIP Q;  3PW7 A;  5IWA J;  2RUG A;  4UT4 A;  4PWD B;  4TN2 A;  1WEX A;  1U6Z A;  4FKY A;  3OFG A;  2KT5 A;  3U7J A;  1UP1 A;  3SSQ A;  3J81 U;  4LF8 J;  1AJD A;  2QLX A;  2EFV A;  2CQH A;  3I32 A;  2W01 A;  3MCO A;  4MYU A;  4KKO B;  2MKI A;  1BQX A;  1OMS A;  4WYW A;  4IOC Q;  4FDI A;  2JWN A;  2GML A;  3HD1 A;  4ECT A;  1RTZ A;  2G2Y A;  2CJ9 A;  2GVD A;  4DR2 F;  2EFN A;  4K4U A;  5ETP A;  1P1T A;  1WI8 A;  3JSR A;  2LEB A;  3CCL S;  1T02 A;  3A3O B;  5J2P A;  1HWK A;  3EJM A;  4DF4 A;  3L9Z A;  4ZJO A;  4M5L A;  2M5Y A;  1U8W A;  4MIA A;  1B70 B;  1PJ6 A;  3K5M A;  4LIW A;  3HSZ A;  4ED4 A;  2EG1 A;  1B8J A;  4R0E A;  1DAX A;  4OLO A;  3CC2 S;  4JI6 F;  3QMQ A;  2VG5 B;  2WVB A;  3Q8Y A;  5KG5 A;  5IZH A;  2YKN B;  4DU7 A;  3I6P A;  3MAQ A;  3SFU A;  1C0U B;  1NSK L;  3FFI A;  3CMR A;  1CC7 A;  2R7U A;  2JLE A;  5LJ3 Y;  3K17 A;  3OR1 B;  1P27 B;  4ZLP A;  5E5N A;  1XJW B;  4WPA A;  1J27 A;  1IKV B;  3W5X A;  2RH3 A;  4KAY A;  2VON A;  4LF6 F;  2AKW B;  1RI7 A;  2FIU A;  4NAS A;  2PT0 A;  4FNH A;  3ILI A;  1YZ6 A;  2BJD A;  5DG7 A;  3QT8 A;  1SQE A;  2RVJ A;  1TU0 B;  1FX4 A;  3TZX A;  3T1A A;  1Z1Z A;  3V4M A;  1TMM A;  1K1Q A;  3H25 A;  1TVR B;  3FDS A;  2H4W B;  2B4U A;  3NLC A;  4OZN A;  2F4V J;  2ACM A;  4ECS A;  2HNZ A;  1QUV A;  1RB0 A;  5U47 A;  4H54 A;  3C6U A;  3D7S B;  1RT5 B;  1P6T A;  4J9O A;  2QL9 B;  1DAR A;  3X1L B;  1ACM B;  2J0W A;  3U1N A;  4DV2 F;  1TV6 B;  3QJJ A;  4QIW D;  4DX7 A;  3K5N A;  1X0F A;  3BKF A;  3WC0 A;  1RT3 B;  4MMO A;  3PRV A;  4C8Z A;  3F41 A;  2F65 A;  3RTV A;  2YXL A;  2GSO A;  2UXD J;  1AZS B;  1RE1 B;  3TR5 A;  2ZC3 A;  4X4N A;  2CPY A;  1P49 A;  1YVF A;  4OZJ A;  3DYA A;  1JJH A;  2KN4 A;  5E33 A;  4W90 B;  3FQL A;  1Q8L A;  3IWX A;  1NKC A;  1RBO B;  3DKD A;  1UWB A;  3EVW A;  1F60 B;  4YR0 A;  1W25 A;  5H9F J;  2ALY B;  1TR0 A;  2EKY A;  5DLT A;  2HNY A;  1FRK A;  4JI4 F;  3Q83 A;  5B0B A;  4ERD A;  2OPP B;  2VDI A;  2KH9 A;  1MRO B;  1FRM A;  2VIC A;  2UUB F;  1KRP A;  4DR6 J;  2ZFH A;  2IUC A;  5KFI A;  4MK7 A;  1JJ2 R;  1JB0 C;  4YR1 A;  1TK5 A;  3KLH B;  2V94 A;  3DHX A;  4X4T A;  2HUR A;  5H1S V;  2E5L F;  4ZIT A;  4CM2 A;  1YJV A;  4U96 A;  1WWH A;  2X1B A;  2GX8 A;  4DSF A;  2XR9 A;  4FVC A;  3O3L A;  2OTL S;  4RW8 B;  1U1O A;  3WHI A;  1R8B A;  4LRD A;  5RUB A;  1MSW D;  5CYM A;  5J2M B;  5DG9 A;  4ICL A;  2VFU A;  4U7C A;  4CLY A;  3K58 A;  2AV5 A;  2Z8Q A;  4YB1 P;  3GFY A;  2Y9H A;  1K73 T;  2XO6 A;  3NWG A;  5KT7 A;  4C97 A;  2FQQ B;  5B08 A;  4LSZ B;  3R6G B;  4OMF G;  1IBM F;  4NCB A;  4FYX B;  1FHT A;  1KH7 A;  5CD4 A;  4CO5 A;  2NR0 A;  3KK3 A;  4I67 A;  3SYZ A;  4TU7 A;  1UW4 A;  4ZHR A;  5ETM A;  3N79 A;  3MD3 A;  2W24 A;  1T95 A;  4QOT A;  4GTZ A;  2EFO A;  2WVE A;  3SMZ A;  2AEF A;  1OWX A;  3D9B A;  4M5I A;  1BWE A;  2MSS A;  4DOZ A;  2YQ1 A;  3W5Y A;  3A1Y G;  1TUV A;  1UJ6 A;  2J8S A;  2ZZT A;  3I0S B;  2X1G A;  2VPX B;  1RAJ A;  5IJS A;  2RRN A;  4A47 A;  1SC1 B;  3A12 A;  4OX6 A;  2W8D A;  1TL3 A;  1U0H A;  2KG0 A;  2XZW A;  3PCO B;  3AXK A;  3S8S A;  2J0X A;  1ALI A;  3AFG A;  4N56 A;  1Q0N A;  3P4U B;  1N6Q A;  1RJJ A;  2HBR B;  4YQW A;  1VQ4 S;  2HK3 A;  1HQU B;  4CO2 A;  2YKM A;  3IXQ A;  1KHV A;  4USH A;  3WBH A;  2BAN A;  3WBZ A;  4NWJ A;  3CSK A;  2ZIT A;  1FWK A;  5J1N A;  5GAH I;  2EW9 A;  1S1W B;  4OZ2 A;  2FJD B;  2HFZ A;  5CYQ A;  2MKC A;  2WOM B;  1QVF R;  2WB1 D;  4CLL A;  4DV3 J;  3QRQ A;  1Z2Z A;  3QRR A;  1IXK A;  1VQM S;  3MCN A;  3SQO P;  3L09 A;  2MGZ B;  3US5 A;  5E7O B;  2CWX A;  1TKZ A;  3I5B A;  4K4V A;  2ZNY A;  3MAH A;  2IDE A;  3I9V 9;  4I64 A;  4ZPD A;  4JI3 J;  4O4G A;  2OIH A;  4DZ6 A;  1HD1 A;  2ZM6 F;  3OTD A;  3H5Y A;  2R4F A;  2QSF A;  1LKZ A;  2N3O A;  1T11 A;  3DC2 A;  2GGP A;  1LFP A;  2EC2 A;  2Q6B A;  2ZE2 A;  4L75 A;  2E44 A;  5D78 A;  2ZBR A;  2VOO A;  2VV5 A;  3AXM A;  1FDD A;  1L3S A;  5FD1 A;  1T05 A;  1JLF A;  1AFJ A;  3W9H A;  2DHG A;  5ETQ A;  2IMO A;  3WAY A;  2AX0 A;  4NRT A;  3IAM 9;  1M5O C;  3AB2 B;  1T94 A;  3NVL A;  3ZTO A;  3MUR P;  4B3S F;  4KH0 B;  1URB A;  2HPU A;  1VQ9 S;  2HS4 A;  5B0D A;  1H2U X;  2JEJ A;  4XAK A;  1R8C A;  5KT4 A;  2J6S A;  2NXJ A;  3NXZ A;  1T9U A;  3MPY A;  3CE8 A;  4XK8 C;  1FFG B;  2NZC A;  5I42 A;  2BR0 A;  4DR5 J;  1CLF A;  1FE4 A;  2X3D A;  3D54 A;  3T5H A;  4PG7 A;  2A0F B;  3GIL A;  5C24 B;  1SJ1 A;  1N5Y B;  2ADB A;  4X2B A;  4H4K A;  4ZG7 A;  2MB0 B;  2B9E A;  2CXE A;  4QIV A;  4K4Y A;  5HAN A;  3T9N A;  1I3O B;  1RHJ B;  3DRS A;  1P1L A;  4OHZ A;  4J9K A;  4X64 J;  2CPI A;  4NE9 C;  3M2U B;  3CWJ A;  5M2P A;  3HT0 A;  3W8P A;  1S4F A;  4P2F A;  2U2F A;  3GPA A;  1ZED A;  3PJX A;  5IT9 Y;  3C15 B;  3TZZ A;  3OFE A;  4KJD A;  4CTA A;  3DRP A;  4ENO A;  1S1T B;  2E7X A;  3NWR A;  2UXC J;  2YX1 A;  1XMQ F;  1LWF A;  4HT5 A;  4LRC A;  5B09 A;  2QA4 S;  3UR0 A;  3G82 B;  4JV5 F;  2VJV A;  2GHW A;  4J9N A;  3DXS X;  4FP9 A;  4A8K A;  1SC4 B;  2DPI A;  3JSM B;  2LEC A;  1HQE B;  2FJB B;  1C4A A;  5JJB A;  2ZH4 A;  4Q0B A;  3RRK A;  4ECR A;  4M5D B;  1NDP A;  5KFZ A;  4U95 A;  2Y1R I;  4CT9 A;  2LQ5 A;  3I0R A;  4QYZ K;  4ZVH A;  3ENV A;  4OHV A;  1AB8 A;  2CQG A;  3LAK A;  3CCM S;  2LVW A;  4B9T A;  1U45 A;  2H9Z A;  4ZGA A;  3OHB A;  1YX2 A;  2J7K A;  5D0E A;  2VQE J;  3MFH A;  3NBP B;  2FVQ A;  1C4C A;  2W5V A;  1WOS A;  5AJ3 J;  2YQ0 A;  2DNO A;  4CLW A;  3PW5 A;  3E3X A;  3LGN A;  4NLD A;  3UW1 A;  2UV8 A;  4FVM A;  3LP0 A;  1S6U A;  4RW9 A;  1UET A;  1HIY A;  3WQP A;  1D09 B;  2HSE B;  3QAU A;  3DLE B;  2UVW A;  1O51 A;  4OFZ A;  3A4T A;  5DDQ C;  1RWU A;  4IG0 B;  5J1E A;  5AT1 B;  3L7O A;  1T0T V;  2G4B A;  1C1C A;  3NY0 A;  3KNA A;  1RDR A;  2CNO B;  1HNI B;  1YBA A;  2V8D A;  3DI6 B;  1SL2 A;  5E0O A;  1R0A B;  3UCG A;  4O3R A;  2D1C A;  2ZNZ A;  2M3D A;  4X66 J;  1W2I A;  3O5T B;  3VAK A;  3ENW A;  5A8W B;  1SVD A;  3EDQ B;  4NX9 A;  1X60 A;  4UOG A;  3JSB A;  4F04 B;  4RNN A;  4IG3 A;  2RKI B;  1KHJ A;  4ECX A;  1ICE B;  2YWW A;  4DR1 F;  2EBE A;  4RW6 B;  2M0G B;  2X7I A;  1LWC A;  1S1V B;  1SH2 A;  3OXG A;  1OQ3 A;  5K20 B;  4DQI A;  2PFF B;  1W7W A;  2XMU A;  1GMU A;  1REV B;  2BJ1 A;  4JI5 F;  3A13 A;  3OTC A;  1CS4 B;  1FO1 A;  2EFG A;  5ETK A;  1NND A;  2CNK B;  4CRJ A;  4NLW A;  4ZPW R;  5LXR A;  3IWN C;  1EP4 B;  1I51 B;  4QR0 A;  4J9U E;  3IO1 A;  3T9Z A;  4F3M A;  3H7H B;  1KLN A;  4CLK A;  1NKB A;  5GME A;  1IKX A;  9RUB A;  3MM9 B;  2V8V A;  3EVM A;  4ILL A;  3EGZ A;  1VRU B;  3HVW A;  3MPU B;  4WP8 A;  1XMO F;  3NKN A;  2CYY A;  1B99 A;  1DLO B;  4DPU A;  1UFK A;  5CXT A;  2V63 A;  5BYQ A;  5CHC B;  1AW0 A;  2CJA A;  3KNG A;  1YJU A;  1X4D A;  1N0V C;  2VFR A;  2EC0 A;  4KIA A;  3TI0 A;  4F4X A;  1F0X A;  1YIT S;  1RHK B;  2DO0 A;  2LU2 A;  5K14 B;  5DG8 A;  2C3U A;  1XK8 A;  2R7O A;  3UCZ P;  3M9O B;  4RJV A;  4KO0 A;  3R7B B;  1P8G A;  1HMV A;  1S12 A;  4RW7 A;  1KTV A;  2F4F A;  3CC4 S;  1V3Z A;  4LR2 A;  3SIP B;  2C1E B;  4DV1 F;  3IR5 B;  2HIY A;  3G71 S;  3TVY A;  2HMI A;  2DCU B;  5HSP A;  1VMB A;  4A8W A;  5KFV A;  2MJN A;  2E1P A;  1B7F A;  4P71 A;  4F02 A;  4YS2 A;  3H8Y A;  1TUG B;  1H2T Z;  2VJU A;  4J91 A;  3THP A;  3OTB A;  1TL1 A;  4IYQ A;  2VIH A;  3Q3Q A;  1YSJ A;  1GH8 A;  3T1H F;  2DHH A;  4Y6I A;  1D9D A;  3R5J B;  1VQ8 S;  2DR9 A;  3MR3 A;  4G1Q A;  4GKK J;  2VQF F;  2W4P A;  4DFM A;  2FVC A;  3CCW A;  2RIL A;  4HDH A;  2X1F A;  3JQM A;  4ID5 A;  3NKM A;  3CD6 S;  1PG5 B;  1VQ6 S;  4M95 A;  3BYP A;  1KNZ A;  2JFK A;  4AD6 A;  2YQ3 A;  1TL7 A;  1XC9 A;  2HZV A;  3TX0 A;  5ETT A;  1SL1 A;  3LH2 S;  3KDO A;  5INH A;  2JEI A;  2EK6 A;  5KFY A;  4ZLL A;  4BLG A;  5LT5 A;  2GSN A;  3JAM Y;  3JYT B;  1R43 A;  2VC0 A;  3VCD A;  1FFS B;  2FGC A;  2WSF C;  3NGS A;  1RUS A;  2GSU A;  2HBZ B;  1K9M T;  1B0T A;  3ULH A;  1HYS A;  4CNZ A;  2GJF A;  4WJB A;  3TQ1 A;  1Y0H A;  1D0E A;  2XYP B;  2DXF A;  4Q43 A;  2F8M A;  2IRY A;  3HD2 A;  5IT9 U;  5CZX A;  1U0S A;  1HWU A;  4CXK A;  4P73 A;  1RWN B;  2K7K A;  2HHP A;  3FZ2 A;  3CME S;  1U8S A;  3W2W B;  5EHH A;  4QWA A;  4TLR A;  4ZPA A;  5C42 B;  4IOA Q;  4F2S A;  2BKN A;  3QNW B;  1VRQ C;  3W9I A;  4FXV A;  1HHQ A;  4KB7 A;  4PXE A;  5HQL A;  5E2Q A;  2VDH A;  3DRR B;  2LQ9 A;  3BDE A;  1WOP A;  4O3S A;  3T41 A;  1WC0 A;  2MLX A;  3DLG B;  5CD4 H;  4ZG6 A;  1JLB B;  2N7Y A;  3CVK A;  5LQQ A;  3NGK A;  2OP5 A;  2MJU A;  3GE9 A;  3TAR A;  2Y8W A;  2W7A A;  3UNG C;  2HS3 A;  2A10 A;  4QYR A;  3H5U A;  4HHJ A;  5L0E A;  1Y7A A;  2CQB A;  3MMC B;  3GIJ A;  1B0P A;  1VQL S;  5D0G A;  2DT9 A;  4C9D A;  4DDF A;  5K4P A;  4I6Y A;  4FBT A;  1URR A;  4KY3 A;  2QGF B;  3KK2 A;  1M1G A;  4WZQ A;  3PFE A;  3KJQ B;  3E01 B;  1IR0 A;  3MOZ A;  2IRU A;  3M30 A;  3Q0A A;  4LF7 J;  3CIM A;  1D1U A;  2UV8 G;  1JLQ B;  4UUW A;  2YWK A;  4HAC B;  3MR2 A;  4JI1 F;  2NSB A;  4DCJ B;  3PO5 A;  2VPW B;  3KLE A;  1WOR A;  3IRW P;  2G0I A;  3DGP A;  2DCL A;  4QIF A;  4FKX A;  4ELU A;  4PRF A;  5LSR A;  3VZH A;  1PIL A;  2EK1 A;  3D3B J;  4WWS A;  4GTW A;  2LEA A;  5IM0 A;  1NJX A;  3FSX A;  2A6M A;  4Q8F A;  4KT0 C;  1ITP A;  1TQL A;  4CH1 A;  2W9C B;  2ZBP A;  1TKT B;  5F0U A;  2VKZ G;  1DQ9 A;  1SJQ A;  3M05 A;  1HPZ A;  1J5E F;  2VKR A;  1HBU A;  3WC2 A;  5D6G A;  3DLB A;  3FBF A;  3HMJ G;  1VJQ A;  2H48 B;  3PAC A;  3CUN A;  5F8H A;  1RTI A;  2V34 A;  1JLE A;  1OY6 A;  2H5I B;  3R2D J;  1R31 A;  5H9E K;  2B4V A;  1YJT A;  2XSF A;  2CVI A;  3PHE A;  2H54 B;  1U26 A;  3I5A A;  4JOU A;  5IJQ A;  4YY3 J;  3CD0 A;  2ZEJ A;  3M2R A;  1N36 J;  4K59 A;  1VC6 A;  4KJG A;  1M1H A;  1HKA A;  1O8B A;  2HND A;  2XS7 A;  2DYA A;  1WTB A;  3PYG A;  3LGH A;  1VK3 A;  2P9E A;  4A48 A;  2YKP A;  2FY8 A;  2DNK A;  2FD2 A;  2GW8 A;  2D9P A;  1X5O A;  4NYO A;  3MEC A;  2EPI A;  2DVI A;  4M5M A;  2GC8 A;  5KTQ A;  3MEG B;  1M5S A;  3VAL A;  3D68 A;  2GS8 A;  1CVJ A;  2DNM A;  4ZJQ A;  4OJ1 A;  4U7U K;  1FWL A;  3CJ8 A;  3J7Y I;  2BQ3 A;  4JYA F;  4MFB B;  2B5J B;  3H2L A;  4PAB A;  4KV8 B;  3UDE A;  1T03 A;  2IM1 A;  5GRR A;  1O6X A;  3TOQ A;  4LFA F;  4Q7A A;  4NRU A;  5CCM A;  4Z7C A;  4F4Z A;  1S6O A;  2QC3 A;  2QSW A;  4A8M P;  2RD5 C;  4NCA A;  3T1Y J;  2B8P A;  3LW5 C;  2ABY A;  1LV5 A;  1IKY A;  1RT6 A;  1WNE A;  3ENA A;  2XQC A;  4HLB A;  4U9R A;  5JVG Q;  3CDW A;  3LQV A;  4E8U A;  2B56 A;  2FB0 A;  4DUY F;  4QYZ J;  3FEY B;  4X65 F;  3KTQ A;  1NO8 A;  4NXN J;  5GVQ A;  2BJE A;  2BM0 A;  3MK1 A;  5DZ6 A;  3TYT A;  3HM9 A;  2DGV A;  4DHV A;  1F5A A;  3GTY X;  4J9L A;  2N4D A;  3UI3 A;  4M5N A;  4ANC A;  3W5Z A;  1T7P A;  2ZDO A;  2RRB A;  4ED3 A;  4QCL A;  2AP6 A;  4K4W A;  2LDY A;  1U1P A;  4EO6 A;  4UZC A;  3DDI A;  1U4B A;  3TVZ A;  1I5O B;  4WZM A;  2PSZ A;  1N2K A;  4ZDN A;  2B51 A;  3GV5 B;  3V6H A;  1A0O B;  3HX9 A;  3ISN D;  1YJR A;  4DR2 J;  3VR1 A;  4CO1 A;  2VF3 A;  1X5P A;  3JSY A;  2MZS A;  1YDL A;  2JVO A;  4BHQ A;  3H59 A;  3JAM U;  1SQF A;  3R7N B;  1DTT B;  2HGL A;  4MJK A;  4RLE A;  1ZEB A;  3HFV A;  1V6H A;  5A8R B;  2LEP A;  3TAM A;  2JRS A;  3BV8 A;  2A18 A;  3P5T L;  1HBN A;  3BZQ A;  3OVB A;  2QZ8 A;  3DPC A;  4FS2 A;  1X0P A;  1OY8 A;  2XTJ P;  3GP9 A;  2W9B A;  3UN5 A;  2DO4 A;  5JMN A;  3MOJ B;  2VU5 A;  1X4H A;  4S0M A;  3QWP A;  1NME B;  3FCV A;  3THV A;  1WOO A;  3CO9 A;  4LRB A;  4CT8 A;  2V2V A;  1X9S A;  4CIO A;  3LPE A;  1RHM B;  2YNF B;  2MXY A;  3F73 A;  1FT8 A;  4ZVE A;  5K5M A;  2PGC A;  2F5G A;  3R97 A;  3B82 A;  3SDE B;  1BUX A;  4LF6 J;  2YVS A;  2ROP A;  1DFD A;  3WAW A;  1YIJ S;  3V81 A;  2BOP A;  3ZZT A;  1H3D A;  2F40 A;  2R8G A;  3G6Y A;  2HHQ A;  3OLA A;  2W5R A;  4P7V A;  2V2Z A;  3LP2 B;  1GNK A;  1EJ7 L;  5ETN A;  4CP5 A;  2RF2 B;  3AD9 C;  3MD1 A;  3R5D A;  1LEO A;  3OV7 A;  4H4K C;  1CSJ A;  5KFU A;  2MQQ A;  4G6V B;  3TO8 A;  1FXR A;  2G9O A;  5KT2 A;  2WVC A;  2WCX A;  2YKO A;  2D9O A;  2IPO B;  4URS A;  4ED5 A;  1JNZ B;  1H38 A;  2XB2 D;  1VDH A;  1JLA B;  4DR6 F;  1RAI B;  1EX8 A;  1XNR F;  2RU3 A;  3T5K A;  1E1Z P;  4Z2X A;  1I6J A;  1CJV A;  2O3D A;  2W25 A;  2MZJ A;  3ZNU A;  4KFB B;  1ZAX A;  1Q7Y T;  3CNQ P;  3NGT A;  2JJ4 D;  2CUY A;  2D3Z A;  3BKU A;  4KBI A;  1GTH A;  3FBC A;  4EEY A;  3POT A;  2RB7 A;  2P8I A;  2Q43 A;  1RAH B;  4P2M A;  1Q7L B;  3D6H B;  4NLP A;  1ZM4 A;  4M5G A;  2XO7 A;  3NKY A;  5KOX A;  1UA0 A;  2W7P A;  4V1A k;  3KHG A;  2YNI A;  1TAQ A;  1TP7 A;  4KGV B;  2GHP A;  3C6T B;  3R3T A;  2HHX A;  2YKQ A;  3TEG A;  3TAN A;  5AXK A;  3EDR B;  3V6D A;  5L9N A;  4V19 X;  1NRK A;  2AEM A;  3JS9 A;  1AYE A;  1DTQ A;  3R5B A;  7FDR A;  3IBF B;  3EX7 B;  3P8B B;  3KG1 A;  2UUB J;  1RXO B;  5DLG A;  2ZH2 A;  5ETV A;  4DQR A;  1KP6 A;  2LA4 A;  4UPH A;  5ETS A;  2AJQ A;  4P7T A;  4NI2 A;  2E5L J;  1U09 A;  2VD3 A;  4HHH A;  4A8S A;  4TQR A;  2XYG B;  4Y00 A;  3PM9 A;  1LXN A;  2F7V A;  4CLU A;  5A8K A;  2XCP A;  3KHH A;  2VPY B;  1U1Q A;  4AND A;  4WXO A;  3D4J A;  1CJT B;  3MMJ A;  4EBC A;  4OZ5 A;  3F44 A;  4O4R A;  1UVL A;  4WTO B;  4MT1 A;  2N4C A;  1GXL A;  5BXI A;  2HZA A;  3ET6 A;  1WEY A;  1YLX A;  4Z7Y A;  2W2N P;  3MM6 A;  4XPC A;  2R3V A;  1B0V A;  2XG8 A;  1N52 B;  2CQ2 A;  4NL5 A;  1S9F A;  1RAD B;  2E7V A;  2PC6 A;  2CJB A;  1EKR A;  3MM8 A;  2E9T A;  1T9Y A;  1X4F A;  1IBM J;  2R8I A;  3KLG B;  1C0T A;  2UUW A;  5IC6 B;  1S0M A;  1YTY A;  3H42 A;  1IR2 A;  2PA8 D;  1VFJ A;  3MMA B;  4TN0 A;  5HJY A;  3GG1 A;  5G0R B;  3W60 A;  4UPI A;  1X4A A;  1TK8 A;  2MQM A;  4CDI A;  3NRB A;  1ELO A;  3BPD A;  4LFB F;  2AZ1 A;  4EMD A;  1JJ4 A;  3HHE A;  1DUR A;  2LP4 A;  4WU3 A;  1WC1 A;  2IFX A;  1S1X B;  3KFW X;  2H51 B;  4F36 A;  3OUY A;  2KRB A;  4YB7 A;  3PR5 B;  3NGU A;  4P2S A;  1NK8 A;  2H5E A;  3MEE B;  4NLT A;  4EK2 A;  3UFC X;  4NLX A;  3OTO F;  1EQ0 A;  2XNQ A;  3T6B A;  3QO9 B;  2BZ2 A;  5D4N A;  1FXD A;  2QE5 A;  2HHH F;  5AE1 A;  4LSN A;  2MQP A;  1S99 A;  1IBK F;  2KRR A;  4DL3 A;  1QSS A;  1VS3 A;  5CCL A;  1N5S A;  2V50 A;  3EM1 A;  2M8H A;  4ZVF A;  3NGD A;  2NQP A;  1LW0 B;  1TKD A;  3G2X A;  2ZJP Q;  2JEF A;  3TJ8 A;  3GCW P;  1XER A;  3GYN A;  3RU0 A;  3CJ5 A;  1H0H B;  1C2P A;  3FMB A;  3WIU A;  1JX4 A;  3CW2 C;  3T01 A;  1RWK B;  1NHU A;  4CYU A;  2G0J A;  4IRD A;  3JTN A;  1KFD A;  4YHH J;  4I68 A;  2IM2 A;  1S6P A;  5KG0 A;  2XNR A;  5MAO A;  2AJ2 A;  2V4R A;  4DPW A;  2R7W A;  2ZM6 J;  2QN6 B;  4DR5 F;  3IBC B;  3J7Z T;  3PVX A;  2QIF A;  2V8P A;  1RWX B;  2BXJ A;  3FSY A;  3MM5 B;  2OPS A;  3CCE S;  2VG6 B;  1I94 J;  1G4C A;  2IDL A;  3MAA B;  3CC7 S;  1SJR A;  4ZOS A;  2FLO A;  3U27 A;  2BRK A;  3NS5 A;  1N56 A;  3HFK A;  2XCA A;  5FII A;  2ZZM A;  1HBO B;  3CMA S;  4WFX A;  4BC7 A;  1KQK A;  1U7L A;  4OYX A;  5HP1 A;  1IN0 A;  4YR2 A;  3KLV A;  2KT3 A;  2KZM A;  2I8E A;  2L9W A;  3JQK A;  4KHR A;  3BS9 A;  2UXC F;  5A0Y A;  4PWW A;  1ARO P;  1T3O A;  1XR6 A;  4C11 A;  4GMK A;  2ALZ A;  2XI3 A;  5ETL A;  1NJZ A;  2OGU A;  1RTD A;  3IGZ B;  2IC3 A;  3P6Y C;  4QIE A;  1RHU B;  2MDA A;  3EGN A;  3MWB A;  3HPO A;  1Q53 A;  2AW0 A;  2CQ0 A;  2YH1 A;  5DRK A;  3TP2 A;  1N88 A;  4K0K F;  4Y2A A;  1NBE B;  4OJH A;  4TY8 B;  4GVB B;  5LJ5 Y;  1JLF B;  4LF9 F;  5T7L A;  3TJA A;  2E5J A;  4B9U A;  3M6W A;  1RBL A;  3QZ7 A;  1KHW A;  3TA2 A;  3UVJ A;  2V8G A;  3SBM A;  1LK5 A;  3TA0 A;  3FVY A;  4EUV A;  3RGI A;  4I7F B;  1RSC A;  1YBT A;  2BW7 A;  3T6J A;  5DDO C;  4C8M A;  2MMY A;  1X5S A;  4WE1 B;  4ZP6 A;  4DWI A;  3CO0 P;  2QTW A;  5D4O A;  3AA8 A;  1VI7 A;  3RB4 A;  3DLH A;  4R5P A;  4I2Q B;  3ELH A;  1UTA A;  1Y11 A;  5I3U A;  2A2D A;  1VIX A;  1XBW A;  5EUH A;  1C1B B;  1HAR A;  3DRS B;  3GJS B;  2IJF A;  1SV5 A;  4RUB A;  1AJB A;  2ZOG A;  1SL0 A;  1WEL A;  3G86 A;  3KLF A;  3VGT A;  2JVR A;  3ITH B;  3W63 A;  1G2E A;  1AUS L;  4QW9 A;  2FLN A;  4NLV A;  3SEO A;  2Z2M A;  4QU7 A;  5LMN F;  2VHG A;  3LAM A;  4Q45 A;  3PG9 A;  4NYZ A;  1IKW A;  2VC1 A;  2LCW A;  1ANJ A;  2DNQ A;  1PYO B;  2XHW A;  4CTA B;  3BN7 A;  4N47 A;  4NA1 A;  2UP1 A;  4KRW A;  2IAJ A;  4RUC A;  3PX6 A;  4OX8 A;  4JBC A;  1DJ0 A;  4DG1 A;  4FF4 A;  1K44 A;  3PXG a;  3MR6 A;  1WHX A;  4O44 A;  4DLE A;  2AGO A;  2X3G A;  3PV8 A;  4TYB A;  3HF5 A;  3NAH A;  4PKD B;  1YJ9 S;  3BGR B;  2OO4 A;  4CCH A;  2ZD1 A;  3MED B;  2EWH A;  2BE9 B;  1HJK A;  2IVM A;  4UPL A;  2K2P A;  2GO9 A;  1FK9 A;  4AXI A;  2QA1 A;  5HMW A;  5EGY A;  2DB1 A;  1OY9 A;  4ES2 A;  1LWE B;  2VFS A;  2NPI A;  4H4O A;  3CMQ A;  2QA4 G;  2KFN A;  4AE5 A;  2OLW A;  2B9W A;  2DH9 A;  1S9E B;  1FJC A;  1S6Q A;  2QJ3 A;  5F3T A;  2P2C B;  5J2Q A;  3C14 B;  4YEA A;  3ZTQ A;  3OFF A;  2VG7 A;  1J2V A;  3MHY A;  1GMW D;  3CPW R;  4K4X A;  5IT4 A;  3LGM A;  3HT3 A;  2E66 A;  4JI5 J;  1MN7 A;  5LM7 E;  4EFA C;  2FPH X;  3NP5 A;  1PC4 A;  1EW2 A;  3EUN A;  3HJV A;  3BF4 A;  1DY3 A;  1G1X A;  2POK A;  3OL6 A;  2RE1 A;  1D9A A;  3G9C A;  2E9R X;  4PWD A;  2MKH A;  1KC8 T;  3ETO A;  3CCS S;  1FVQ A;  1RT2 B;  2OPQ A;  4YME A;  1VK8 A;  2O01 C;  5KAK A;  4LQY A;  2BUN A;  2K3K A;  4Q2M A;  2P5V A;  5E3R A;  3PEJ A;  5DJB A;  1A7G E;  2AYB A;  3RAQ A;  1XMO J;  4TYA A;  2IJR A;  3GFX A;  2DKO B;  3BSA A;  5B0F A;  3RUB L;  1QD1 A;  4B3R F;  1JKH A;  4FDF A;  3QYY A;  3WAV A;  2DHX A;  1FJ7 A;  2OD4 A;  3QT5 A;  3RAX A;  4FYY B;  2BW2 A;  4ES3 A;  1E6Y A;  2N7C A;  2XUL A;  4J9R A;  2KT2 A;  4DZD A;  1B4S A;  4F26 A;  3Q8V A;  3OVS A;  3NS6 A;  4DV1 J;  1FJG F;  2M7S A;  4LIR A;  1NZA A;  1QTN B;  5KOW A;  4NCG A;  2HW3 A;  1IKX B;  4FBU A;  1YJW S;  2VG5 A;  2CNN B;  2DGS A;  2R2R A;  3IG1 B;  1CUL A;  1G7C B;  1KTQ A;  2YKN A;  2EFP A;  4N8N A;  4UQT A;  3HSG A;  4ELV A;  4CLZ A;  2V2Q A;  2QLJ B;  1C0U A;  2BM1 A;  3T1H J;  2BE7 D;  3V5R A;  4FPR A;  1PO6 A;  1FJE B;  4LVO P;  3OR1 A;  3R8Y A;  1FRI A;  2XZD B;  2HGM A;  3HVA A;  4GKJ F;  2YPY A;  3I5C A;  4NLQ A;  5A2Q U;  2XM3 A;  2DY1 A;  2PDA A;  2OTJ S;  2CZV C;  1WHW A;  2BE2 B;  1RA6 A;  2AEJ A;  2CJY B;  3FJ2 A;  2HHU A;  3DGV A;  1HI1 A;  3VAH A;  4OI1 A;  1GEH A;  3N01 A;  3IR7 B;  1K47 A;  4NEZ A;  3M8P B;  3TW0 A;  4RX6 A;  2OEK A;  3KUH A;  3W65 A;  1JQG A;  4LR9 A;  2DR6 A;  3KG0 A;  1VLO A;  1TVR A;  1FSU A;  1Y3K A;  6FDR A;  1U6B A;  2OFH X;  1RT5 A;  2V4J B;  4F4W A;  4HVZ A;  4I2P B;  3RG6 A;  3E2E A;  4OYA A;  4EBE A;  1CC8 A;  4BDP A;  2OMO A;  4K8R A;  4NA3 A;  3ZO7 A;  1Q5V A;  3C8Y A;  1PAU B;  3LP1 B;  4G1Q B;  3CJK B;  1NK4 A;  4GC7 A;  3TWZ A;  4RNM A;  4O0I A;  1AZS A;  2W2Q P;  3BBC A;  3MDF A;  3NNA A;  3FCH A;  3CCQ S;  2W5W A;  1MG7 A;  2C22 A;  3GJR B;  3W66 A;  1RLC L;  3M9M B;  5KG2 A;  1YK9 A;  3PX4 A;  3K5O A;  3HSJ A;  2R8K A;  5THW A;  2P6S A;  4DL6 A;  3C2P A;  3CDB A;  4E0D A;  1FKP B;  1WSV A;  2OHD A;  1SBR A;  3K59 A;  2OPP A;  4F4Y A;  1N4L A;  1MRO A;  2J9C A;  3MR5 A;  2GVZ B;  3EVO A;  3DDN A;  1BC6 A;  5GAG I;  1HW9 A;  1RAO A;  2PMZ D;  1XIQ A;  1REG X;  4J9S A;  2VBX A;  3QAE A;  3KLH A;  4OV1 A;  3QQC D;  3NKQ A;  1K1S A;  2NXE A;  3M1V B;  1ROF A;  4ECQ A;  2JL9 A;  3D6M B;  2J76 E;  4HTI A;  1FD2 A;  1QSY A;  3D28 A;  1X4E A;  2DHS A;  3TAP A;  2WB4 A;  1GMW A;  1ALK A;  3BBF A;  1OO0 B;  4FNI A;  3AOC A;  1U1L A;  3IRX A;  3BH6 B;  4RW8 A;  4ZIV A;  4K50 A;  1GK8 A;  3IDD A;  4AUK A;  1Q8I A;  1JWW A;  4JI1 J;  2WZ1 A;  2MLY A;  2MEW A;  1EAY C;  4IH6 A;  1NSA A;  3C16 B;  2J0Q D;  3UN2 A;  1D9F A;  5HBM A;  2DPJ A;  1YWX A;  5M2R A;  4MIV A;  2P9C A;  2XGP A;  1F1B B;  2XBP A;  4QQB A;  2VB6 A;  4DBQ A;  5KFF A;  4C3M A;  3VVT A;  1D8Y A;  1O99 A;  4OHY A;  4DR4 F;  4HTJ A;  4M94 A;  1Q81 T;  2BQU A;  4K5S A;  2BOA A;  2W2P P;  3ZFV A;  2V9W A;  4ZMM A;  3KHR A;  1WDD A;  1RTH B;  3KK2 B;  4R25 A;  2CPH A;  1TTH B;  2J6U A;  1RGV A;  1UPP A;  2IVF B;  3SZ2 A;  2ASJ A;  4XDD A;  3ISZ A;  2JZ5 A;  4CLF A;  1WC6 A;  3HVT B;  5KFD A;  1ZAV A;  2CQP A;  3I0S A;  3BO2 A;  4MIB A;  1PGZ A;  3BJY A;  1IBC B;  1N34 J;  4ZVP B;  3IGV A;  5GAE U;  3DLK B;  4TY9 A;  2W2O P;  3HZE A;  4AYB D;  3WIV A;  3ISN C;  1VRT B;  5DDP C;  4JYA J;  3KK1 B;  1N32 F;  4H4M B;  1M5K C;  3PDN A;  1BQN B;  1KQS R;  4CZC A;  2J7U A;  2GAH C;  4ZP7 A;  3W3S A;  2F63 A;  3VGS A;  4LFA J;  4ELT A;  1W2B R;  5F9N A;  4OX9 F;  1ZPW X;  4ZPV R;  4WII A;  3AJ2 A;  4O3O A;  1JLE B;  1HQU A;  3OHA A;  5D0H A;  1RWO B;  1FRL A;  3GWC A;  1EW8 A;  1LNQ A;  3G96 A;  3DMJ B;  5KG4 A;  3CJR A;  3SV3 A;  2CPX A;  2Y1J A;  1UEU A;  3EMT A;  2WOM A;  4DUY J;  2IA6 A;  4TKT A;  1IJE B;  3ILJ A;  4PG4 A;  4X65 J;  4OYW A;  4ITS A;  7FD1 A;  3CT9 A;  4JI0 F;  5KFQ A;  3VTI A;  4PYA A;  1Q86 T;  3OD2 A;  1VBZ A;  2A6O A;  4X4P A;  4J5O A;  2MGZ A;  2XGQ A;  5LSO A;  1HQ2 A;  5KFC A;  3MPV A;  3SI8 A;  5KFL A;  3Q8P B;  3C3L A;  2CQC A;  3PW0 A;  2DEI A;  3TQE A;  3AOD A;  1RK8 A;  3G87 A;  5HAO A;  3PHT A;  4FF3 A;  3TUZ C;  2GNK A;  4IFY A;  1U02 A;  1NK0 A;  5HI7 A;  1SB6 A;  4LR8 A;  5LOQ A;  2NYH A;  2ZH1 A;  3DFE A;  3HSD A;  4CXU A;  5GAD I;  4YB6 A;  5D3G B;  1X7V A;  3MFI A;  3CJ0 A;  5EX0 A;  4Z37 A;  2P6T A;  4UY8 T;  2L3M A;  1X9W A;  1EKS A;  4ZVU B;  1RYS A;  1QAI A;  1V5V A;  3BYR A;  2QG9 B;  1OQ6 A;  2AT1 B;  1RAA B;  4W98 A;  1KH4 A;  1NUE A;  4QPX A;  4N76 A;  6FD1 A;  1NM2 A;  3AD8 C;  3QT6 A;  2KXN B;  5SUH A;  5ETR A;  4ZJL A;  2IJN A;  2CWK A;  1DBD A;  1VQ5 S;  3QSY B;  3W1Y C;  4NOH A;  1IR1 A;  4UQG A;  4EGL A;  4Y2M A;  1T9V A;  4ER8 A;  2RQC A;  1S1U B;  1FVS A;  4JV2 A;  3KHL A;  4PG8 A;  3BSN A;  1VJW A;  4C8Y A;  2ZH5 A;  2PO4 A;  4CLT A;  5KFE A;  1S5Z A;  4X4O A;  3W2V A;  1TL5 A;  1E3C P;  2J0S D;  3PKM A;  2L08 A;  3GSI A;  3G8T A;  1F3V A;  4ZN3 A;  2F9J A;  4O3Q A;  1JXL A;  1ALJ A;  1CJU B;  2BJ7 A;  1XR7 A;  1NAQ A;  2RS8 A;  2OKQ A;  1WSR A;  3C15 A;  4BWM A;  2V67 A;  3R5G A;  4OZ0 A;  2ZBC A;  3RJM B;  1KR4 A;  2FC8 A;  1S1T A;  2VFT A;  3CJ2 A;  2Z2Z A;  3BH7 B;  4PG5 A;  2WVF A;  4ZA1 A;  4RNF A;  5HRT A;  3E8O A;  1VBY A;  5FJ4 A;  1XNR J;  4OYO A;  4G1I A;  2WHO A;  4WXW A;  3JSM A;  1X31 C;  3FBE A;  1HQE A;  4ETZ A;  2ZUA A;  3DOL B;  2GO8 A;  2C2N A;  4M5D A;  3ZZZ A;  3V4I B;  1XTZ A;  2I2Y A;  2XZT B;  4IH7 A;  5F8M A;  3RYL A;  1EIY B;  1F2G A;  2V8H A;  2DNP A;  1TAU A;  2D1G A;  1SIW B;  4BCA A;  2RDD A;  3PX0 A;  4IDK B;  1HNZ F;  4C8O A;  1CEZ A;  1WTF A;  3GIK A;  3H2U B;  2I5J B;  5CQG A;  4DSL A;  3CF5 Q;  3NBP A;  2AJ4 A;  2XEX A;  4CO0 A;  3RAM A;  3MI7 X;  3IS9 A;  2AYG A;  2RNE A;  2FGO A;  3DHW C;  5F8N A;  5IOL A;  1AT1 B;  1UCN A;  3GMG A;  4DL4 A;  2C2M B;  2C2Z B;  3H2V E;  3HHK A;  4USV A;  5IC4 B;  4CLP A;  1XNQ F;  1SKW A;  5DLF A;  4HI2 A;  5KFS A;  4L76 A;  2CQ3 A;  2KXH A;  3DLE A;  3GFZ A;  3RBD A;  5KFJ A;  2KM8 B;  4P10 A;  4IG0 A;  4U6P A;  1CJV B;  2W8S A;  5C2G A;  4EYI B;  3I31 A;  3Q8R B;  1HNI A;  2IBO A;  3MM7 B;  3DI6 A;  3MUM P;  2JOQ A;  3EZO A;  1CQM A;  1R0A A;  2ZVI A;  3D5M A;  4YB5 A;  3GII A;  3KMQ A;  2NXN A;  4B9N A;  5A8W A;  4WP9 A;  2OUG A;  4WIQ A;  1IWG A;  1W26 A;  2N82 B;  3D3C J;  1OSC A;  1S7H A;  2RKI A;  1KSP A;  1S1V A;  3CJS A;  2GHV C;  3VAM A;  4QWE A;  3M32 B;  2V4Q A;  4MIW A;  1H72 C;  2L41 A;  1XR5 A;  1RTJ B;  1UFL A;  2DGU A;  4DFP A;  2HWT A;  4IR1 A;  4N8O A;  4Q44 A;  1N5Q A;  1REV A;  1TFY A;  1CS4 A;  1FXL A;  3LAN A;  3JB9 k;  5DM7 Q;  1SUQ B;  4GO7 X;  2X98 A;  3RB0 A;  1EP4 A;  4F7V A;  2FJX A;  2JC0 A;  4ZCL A;  1YQH A;  5KG1 A;  1FE0 A;  2UVV A;  3NKP A;  1R3N A;  4KAI A;  1RT1 A;  1JLG B;  5A6W A;  4KYZ A;  4CH0 S;  4ECZ A;  3NS7 B;  3ZXW A;  1VRU A;  4YHH F;  4WYL A;  4LFB J;  1FKA F;  2H1Y A;  1DLO A;  3GB0 A;  2DNR A;  4U67 Q;  2VBY A;  1J5O B;  2MZT A;  1M0S A;  5I3P A;  4P72 A;  2AQ4 A;  1IQZ A;  1YZ7 A;  3E51 A;  1TK0 A;  2GIQ A;  5DLV A;  2MQO A;  2GFF A;  2FVR A;  2GCF A;  3GJT B;  3OTO J;  3UQS A;  4ZPC A;  4NA2 A;  1SHQ A;  3CCZ A;  1I94 F;  4QJV A;  4RWW A;  1LW2 A;  2HHH J;  1Y5N B;  2XMK A;  2ZVS A;  4EZ9 A;  1IBK J;  4QWB A;  2I9S A;  3BEG B;  3QLH B;  2LDI A;  2ZH9 A;  2CJK A;  2CA9 A;  1Q79 A;  1HWL A;  3RR7 A;  1ZM9 A;  2RQM A;  2GZO A;  2Q3P A;  2GQQ A;  2F8E X;  1VQ7 S;  5HK4 A;  1MWY A;  2KVI A;  4HDG A;  2CQI A;  4N41 A;  4L3K A;  5EN1 A;  3AA9 A;  2CQ1 A;  3FRZ A;  2UUC F;  1BMQ B;  4ZP9 A;  2ZH7 A;  3CIZ A;  2W8K A;  1U1K A;  3SCK E;  3I56 S;  4LBP A;  1FWP A;  3FNN A;  2CJQ A;  2HVD A;  1Q82 T;  4P74 A;  1LQ9 A;  3LF0 A;  5F8L A;  1M1K T;  2M52 A;  3WX8 A;  1NH8 A;  4I4B A;  4ECU A;  4LSN B;  2AGP A;  2K7J A;  4DL2 A;  4F0K A;  1T3N A;  3JYT A;  3B4D A;  1P9Q C;  2H3E B;  2QL5 B;  1N8R T;  1D8Z A;  3GCX P;  4USI A;  2JFD A;  4M8L A;  1UFW A;  2OEL A;  5DO2 A;  2JHE A;  4OYB A;  2Q66 A;  8ATC B;  1U24 A;  2VAS A;  3MMB A;  3CD5 A;  3WX4 A;  1VBK A;  4J90 A;  3FCW A;  3B78 A;  3J81 Y;  5GAH U;  4PQU B;  3QIP B;  1RAF B;  4WFB Q;  4ZN1 A;  4RKU C;  3JXO A;  1S6P B;  2FZG B;  2KJW A;  2DH7 A;  2Q6C A;  1FRX A;  1RIS A;  5C42 A;  2HQD A;  2IFY A;  2QLW A;  1ALH A;  2YBV A;  4DUT A;  4FN5 A;  4WFY A;  3UD3 P;  4RR5 A;  1PKU A;  3DLJ A;  2C2E A;  3TUJ C;  1S4E A;  1ZTW A;  4ED8 A;  3OXF A;  3KLI B;  4DFK A;  4KPC A;  5B0C A;  2I6W A;  1OPZ A;  2HVI A;  3A8E A;  3OSP A;  2D7S A;  3I87 A;  3DLG A;  4K0K J;  1JLB A;  2NS1 B;  2Y8Y A;  1BHN A;  4LF9 J;  3DOM B;  2DNN A;  3CD7 A;  2FJW A;  4EI2 A;  3MMC A;  4CO4 A;  3M2V B;  2ROE A;  2FVS A;  1DRZ A;  2HGN A;  3LUY A;  1RYR A;  3BBB A;  4CNY A;  2NCK L;  2DIU A;  2AMC B;  1HNV A;  5EWE A;  4LFC F;  1N48 A;  2RU9 A;  4FYV B;  4GO5 X;  1RU1 A;  4WP3 A;  2FZC B;  2G13 A;  4KE5 A;  5HVG A;  2ADC A;  2O1P A;  1JLQ A;  1RTD B;  4Y2C A;  2HZC A;  4URQ U;  3J80 Y;  3BO3 A;  5KXA A;  4Y65 A;  2ZWP A;  4JI2 F;  4HAC A;  1ZZN A;  4B08 A;  5D8H B;  2FVP A;  4QW8 A;  3KJV B;  2RAQ A;  4B3O B;  4R8U B;  3MTK A;  1MU2 A;  3FKB A;  2JEG A;  3TAQ A;  2W9C A;  4NZ6 A;  1TKT A;  4UTG A;  4IRK A;  2V9K A;  1FER A;  3ZZR A;  5HLF B;  1Q8B A;  3ILL A;  3PO4 A;  4AQY F;  5LMN J;  4PWU A;  2W5S A;  4C4W A;  3M8Y A;  3FEX B;  5KFW A;  1KWM A;  2XC9 A;  4PR6 A;  5IXU A;  5JXS A;  1BY9 A;  2QV6 A;  2YH0 A;  3OR2 B;  2MLZ A;  2FLL A;  5KFP A;  1F5C A;  4WBF A;  3EE3 A;  2HIQ A;  4IQX A;  4BC9 A;  1V5I B;  1OYE A;  3I82 A;  2X1A A;  2ZDP A;  2UUA F;  5I3U B;  3TA1 A;  1R0B G;  2XMV A;  1NEE A;  1NDC A;  4Y3C A;  5EDW A;  2V5H G;  1T9X A;  2LXF A;  4P9S A;  4OI2 A;  3AH6 A;  1DHM A;  3BR9 A;  3MEG A;  4GVL A;  2LQ8 A;  2Z58 B;  2XRG A;  2LQJ A;  3M6V A;  2MZR A;  3AB4 B;  3OPK A;  4ECY A;  2CPD A;  2QX0 A;  1TUW A;  1GXU A;  4W92 B;  4KV8 A;  3AT1 B;  2Z56 B;  1SKR A;  3NOG A;  4M63 A;  4KQZ A;  4WF9 Q;  4DQP A;  1K8A T;  4DV5 F;  4LBI A;  4X62 F;  2BYC A;  4QZV B;  3M8Q B;  3C19 A;  2NSC A;  2R9L A;  1HBM B;  5AE3 A;  2OML A;  4JV0 A;  1KHL A;  2AX1 A;  3SXL A;  3FMW A;  5C25 B;  2MHN A;  2ZH6 A;  1TFW A;  5TJ3 A;  4J9V A;  3TG0 A;  3PYD A;  3BRE A;  2FHM A;  3T5L A;  2CG4 A;  3M9N B;  2QRR A;  1N2L A;  1F5B A;  3R6L B;  1IUJ A;  4GRS A;  4G3I A;  3SV4 A;  2HHW A;  3GYX B;  1S77 D;  2YTC A;  3RRH A;  4EO8 A;  4A4J A;  3H98 A;  3L7U A;  4YR3 A;  4GC6 A;  2ZHO A;  3Q86 A;  4Y0F A;  2DRD A;  3AOB A;  2AJ0 A;  1JMT A;  4EWT A;  3GJQ B;  1QM9 A;  4IKA A;  4NXM J;  5DQI A;  2RDJ A;  4RUA A;  2C3O A;  1S6Q B;  3K2Y A;  4B3R J;  1H7X A;  3IN5 A;  2ZBQ A;  2B6A B;  3R1L A;  2GQC A;  3PYE A;  4I6W A;  4UUX A;  1RT7 B;  2HQG A;  4I0W A;  1AJA A;  3DRX A;  1QTM A;  2OPR B;  5J2N A;  1ZA2 B;  1DTT A;  2DBB A;  2GMJ A;  5A8R A;  2SXL A;  3HHL D;  2BJ9 A;  1E6V B;  4LRE A;  1FJG J;  4LUB A;  1WD6 A;  1HNX F;  4JB8 B;  4EZ6 A;  2DNH A;  2E5G A;  3KJN B;  3QGP A;  1S0O A;  5L1L A;  5HRO B;  4LF2 A;  2KL8 A;  4KGX B;  4V19 J;  2YNG B;  2OPQ B;  3C46 A;  1S79 A;  3OTE A;  1NB2 A;  2KYX A;  2K1R B;  3KUG A;  3U1M A;  4AL6 A;  4C6A A;  3N4W A;  4ZCK A;  2OD6 A;  4F8R A;  1T9T A;  2ILY A;  3D1Q A;  1NZ8 A;  2YNF A;  4C8N A;  1YJN S;  2C2R A;  2QLB B;  3BDG A;  4N77 A;  1JKH B;  3CJQ A;  1IM4 A;  4GKJ J;  5FLX Y;  3SDE A;  1FKO B;  3MTJ A;  4Y2I A;  3R5C A;  1EET B;  1KH5 A;  3RBE A;  3V2U C;  1E6Y B;  3Q23 A;  3BPS P;  4O3N A;  3DOK B;  5AJ9 A;  3HP6 A;  4BWJ A;  1Y00 A;  3KUE A;  3IWL A;  3LP2 A;  3O8W A;  3CDU A;  2D3O 1;  2HVE A;  5DM6 Q;  2I1R A;  3CGI A;  1RT4 B;  4NCG B;  1IWA A;  2RF2 A;  4K4S A;  4CYS A;  3BKT A;  1WF0 A;  2XS5 A;  3S01 A;  2PN6 A;  1HR0 F;  1UW9 A;  1CUL B;  2HVH A;  2YWG A;  4DPT A;  2OJ3 A;  1NH7 A;  5KFN A;  1JLA A;  3BQ2 A;  3LTO A;  3WZ0 A;  4N7T A;  4ZPB A;  4CQ1 A;  3Q2T C;  1Q95 G;  2YX7 A;  2XSJ B;  1EI6 A;  1YBU A;  3T3F A;  1YHQ S;  4KFB A;  4G65 A;  2A3J A;  2C2K B;  3SCL E;  4KHP F;  3TX8 A;  3J80 U;  5E3Q A;  4KM4 A;  1PIE A;  1S9G B;  3QAT A;  5D4L A;  3RBX A;  1F2H A;  1TZ0 A;  3M7V A;  4MHX A;  2KDO A;  1YJ7 A;  4M5H A;  2E1R A;  3EXY A;  2VZ9 A;  4IFV B;  5D4P A;  2C3P A;  2DR7 A;  2UXB F;  1RAB B;  1WEZ A;  5LXY A;  4OI6 A;  3NL0 A;  3C6T A;  5HL7 Q;  4O3P A;  2MQN A;  3S1T A;  2XMW A;  4FYD A;  2R8H A;  4HR2 A;  3HCX A;  2RDI A;  2DD8 S;  3KMS A;  1ZET A;  2XLI A;  1SH0 A;  5T41 A;  4BS2 A;  2I38 A;  4HI1 A;  1A9N B;  1NXI A;  4TNO A;  4DUZ J;  4IH5 A;  5DGA A;  2JNJ A;  5AE2 A;  3RZA A;  2WBR A;  3CXC R;  3M8Z A;  4DN9 A;  4HT7 A;  3MPD A;  1R8H A;  2JX2 A;  4RPF A;  3R2C J;  4LRF A;  5SZT A;  2FLP A;  2M88 A;  1IBL F;  2WON B;  4B9M A;  1SJ4 P;  5K8O A;  4QWD A;  4F4K A;  1PJ7 A;  1FCA A;  2HHV A;  2JLG A;  2UU9 J;  1RAC B;  1CJK B;  1UA1 A;  4X4Q A;  2QA2 A;  1CJT A;  1N34 F;  1XEZ A;  3N5F A;  2NXU A;  3TRG A;  1NPR A;  4CLS A;  4U7U D;  3N0V A;  2CAJ A;  4YFU A;  1BQM B;  3VGV A;  3GV8 B;  1P9Y A;  4DQQ A;  2C2D A;  1RWV B;  4EYH B;  2U1A A;  2E9Z A;  2ZOF A;  1AFI A;  1SI9 A;  1PC5 A;  4DEZ A;  2KFY A;  4DR4 J;  4ECW A;  1ZEF A;  5DQG A;  4PUO B;  1JNR B;  3IGY B;  2KTQ A;  3KLG A;  1FTC A;  5FDL A;  3NMA A;  2J9D E;  3OVA A;  3UDC A;  5L1J A;  2PFD A;  3MMA A;  1SH3 A;  5B7W A;  3L7P A;  5G0R A;  2WSE C;  4U8Y A;  4C0O C;  3IRX B;  2J8A A;  3BN4 A;  1UZD A;  5KT6 A;  1HFE L;  3HHL A;  3SQG B;  4DR7 J;  1K0V A;  2MPU A;  2R7S A;  3VVU A;  2YNH B;  3HO1 A;  5CZV A;  1S1X A;  2HFS A;  5HBM B;  4OL8 A;  1VQY A;  3LO3 A;  3ETM A;  1QJH A;  4LSL B;  1TKX B;  3MEE A;  1N32 J;  4F2R A;  4RW4 A;  1FRJ A;  3BGO P;  3QO9 A;  5KG6 A;  5DLW A;  5D77 A;  1KQG B;  5L39 A;  4OX9 J;  1KN6 A;  4G1P A;  2FHO B;  3ZZY A;  4B9L A;  4E98 A;  2E1C A;  1RAG B;  1FEH A;  2GAG C;  1UPM B;  3IAS 9;  3RBZ A;  2BA9 A;  1LW0 A;  5DS7 A;  3K0J A;  2R7X A;  4TVA B;  1N33 F;  1R6Y A;  2IMW P;  1R27 B;  2FHK A;  1SKU B;  5K8M A;  1KHK A;  4NLR A;  3I55 S;  4EU0 A;  3MXH P;  4JI0 J;  4Q5V A;  1RA7 A;  1ULR A;  3QZ8 A;  3S6E A;  1NPK A;  4DX8 H;  1M5H A;  4LF5 F;  4TXS A;  3LXQ A;  2Y0B B;  4UPK A;  1MMD A;  1MNE A;  4ZK7 M;  4UF4 A;  2VPZ B;  5KFT A;  3N5B A;  4ZVQ B;  3V6J A;  3CCV S;  3ZNJ 1;  1NDL A;  4OYZ A;  3DYC A;  2KO1 A;  1X5T A;  5FLX U;  4DCP B;  5F9L A;  1Z4U A;  2QLF B;  3MM5 A;  3W62 A;  4RNO A;  2CPE A;  3IMQ J;  4LQ3 A;  2VG6 A;  5K8N A;  2IRX A;  4CH7 A;  4OJG A;  3J7Y U;  2BEF A;  3MAA A;  1VBX A;  2GVD B;  4B3M F;  4F67 A;  1KLM A;  4C0B A;  1FES A;  1FNM A;  3KD8 A;  2PEH A;  1HBO A;  5A6P A;  2RML A;  5J2P B;  4HL9 A;  2LLZ A;  4RO0 A;  2FTR A;  1WF1 A;  4PEO A;  1ZOT A;  1NK6 A;  2C42 A;  2ZUG A;  1FFW B;  1HDH A;  4K5R A;  4A8Y A; 
#chains in the Genus database with same CATH homology
 1O98 A;  4FDJ A;  4KAY A;  1FSU A;  3TG0 A;  2W5R A;  2X98 A;  4ZG6 A;  5INH A;  4UOO A;  1ED9 A;  4ZGA A;  5C66 A;  1ANJ A;  5LQQ A;  1KHJ A;  1HQA A;  1KH9 A;  3UO0 A;  1N2L A;  4N7T A;  5LIA A;  2GSN A;  3UNY A;  4FDI A;  1EI6 A;  2W5V A;  4LR7 A;  3M8Z A;  4UOP A;  1ALI A;  1Y6V A;  1K7H A;  1ZEB A;  1EW2 A;  3E2D A;  4LRF A;  3LXQ A;  3OT9 A;  4KAV A;  3NKP A;  5L0E A;  1Y7A A;  2GSU A;  3NKQ A;  4UPK A;  4UOR A;  3UN3 A;  2W8S A;  2QZU A;  3ED4 A;  4LR2 A;  1EJJ A;  5DLT A;  5HRT A;  1KH4 A;  3NKR A;  4CYR A;  3WBH A;  2IFY A;  3DPC A;  1ALH A;  1ZED A;  3BDG A;  5IJQ A;  3WAY A;  5KXA A;  2W5T A;  4NWJ A;  3A52 A;  4GTY A;  4KM4 A;  2G9Y A;  1ELX A;  3DYC A;  4QAX A;  4UPH A;  4KJG A;  4TN0 A;  3T01 A;  5LRM A;  5K4P A;  1URA A;  1ALK A;  2XRG A;  4KJD A;  3TWZ A;  4UPI A;  3MK1 A;  3M7V A;  3UN5 A;  3M8W A;  1E2S P;  4MHX A;  2ANH A;  1KH7 A;  4LQY A;  1E1Z P;  2IUC A;  3NVL A;  1ANI A;  1AJC A;  3B5Q A;  1KH5 A;  4CXK A;  1ED8 A;  1EW9 A;  2D1G A;  4NWX A;  5EGH A;  4YR1 A;  1AUK A;  4LRC A;  3T02 A;  1URB A;  3IDD A;  2W5W A;  1B8J A;  1HJK A;  5DLW A;  4LRB A;  5LRN A;  4UPL A;  3Q3Q A;  5L0K A;  3BDF A;  3BDH A;  5AJ9 A;  3IGZ B;  3T00 A;  4GTZ A;  4MY4 A;  4CXS A;  5DLV A;  3KD8 A;  1ELZ A;  4LR8 A;  2ZKT A;  5GOV A;  1AJA A;  3SZZ A;  3UN2 A;  4LRA A;  1KHN A;  1AJB A;  3WAV A;  5L0B A;  2W5S A;  3NKO A;  2W5Q A;  3M8Y A;  1EQJ A;  4MIV A;  1SHQ A;  2W5X A;  1ELY A;  2XR9 A;  3NKN A;  4CXU A;  4CYS A;  2GSO A;  3SZY A;  2GLQ A;  3CMR A;  1N2K A;  1KHL A;  1SHN A;  2IUC B;  3MK2 A;  3NKM A;  3MK0 A;  1ZEF A;  2VQR A;  1AJD A;  1E3C P;  3WAW A;  4B56 A;  3IGY B;  4ZG9 A;  4LRE A;  1P49 A;  5EGE A;  5GRR A;  4ZG7 A;  4LR9 A;  2RH6 A;  5IJS A;  1HDH A;  4LRD A;  4GTX A;  1E33 P;  3TX0 A;  4GTW A;  5TJ3 A;  1EW8 A;  3BDG B;  1ALJ A;  1KHK A;  2GA3 A;  1O99 A;  3WAX A;  2W8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...