4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
2IUCB 2G9YA 3IGYB 4CYRA 5L0EA 4CXUA 3Q3QA 4FDIA 4TN0A 1EQJA 3NKOA 2XR9A 4LR7A 1AJDA 1O99A 3BDHA 5DLVA 1O98A 3UO0A 2W5WA 4GTXA 4GTZA 4QAXA 3DPCA 4GTWA 4NWJA 4MHXA 4UPHA 1AJBA 2GSUA 2VQRA 3SZYA 3UN5A 5DLWA 1K7HA 1URAA 3UN3A 4LR2A 1ELYA 2GSOA 2W5RA 1AJCA 3NKQA 4LRCA 1ED9A 4KAYA 1Y6VA 1HQAA 4GTYA 5IJQA 4MIVA 4LRFA 1AJAA 3NVLA 3T01A 5LQQA 4YR1A 3WAVA 1E2SP 3NKMA 5L0BA 1ED8A 4ZGAA 3M7VA 1N2LA 1URBA 2W5VA 5AJ9A 5HRTA 1KH9A 2XRGA 2QZUA 4UORA 3UNYA 5L0KA 1FSUA 1E1ZP 3MK0A 4KAVA 4N7TA 3WAWA 2GSNA 4NWXA 4LREA 4ZG7A 2GA3A 1SHQA 4LRBA 3OT9A 4MY4A 4CYSA 3MK2A 3SZZA 3NKPA 1EI6A 5EGHA 2IUCA 2RH6A 1ZEBA 4ZG6A 2W8SA 3IGZB 4UPIA 3BDGB 4LRDA 1B8JA 3DYCA 4LR8A 1ELXA 1P49A 3M8YA 3UN2A 5INHA 3WBHA 3CMRA 4UOOA 5C66A 3NKNA 4KJDA 3WAXA 4UPLA 1KH7A 2IFYA 3TX0A 4UOPA 1EW9A 1Y7AA 3IDDA 2W5SA 5K4PA 3T02A 1AUKA 3WAYA 3BDFA 2W8DA 3A52A 5LIAA 2GLQA 5KXAA 3E2DA 4ZG9A 4CXKA 5DLTA 5TJ3A 1ZEDA 3NKRA 1SHNA 2D1GA 3LXQA 1KHKA 2W5QA 5EGEA 4KM4A 1ALJA 1EW2A 2ZKTA 1KH5A 3MK1A 1KH4A 1EJJA 1N2KA 2W5XA 1ALIA 1E33P 1KHNA 1ALKA 4CXSA 2W5TA 4FDJA 3TG0A 4LR9A 3T00A 1HJKA 5IJSA 1ELZA 5GRRA 3B5QA 1E3CP 1EW8A 2X98A 1ANIA 4LRAA 3KD8A 4UPKA 5GOVA 1ALHA 1ANJA 4B56A 1HDHA 3M8WA 3ED4A 1ZEFA 3BDGA 5LRMA 5LRNA 4KJGA 3TWZA 2ANHA 4LQYA 3M8ZA 1KHJA 1KHLA
chains in the Genus database with same CATH superfamily
2E2JC 3HOZC 2IUCB 4YFXA 5L0EA 4X6AC 2NVTC 3RZDC 3OPFA 3GIRA 3HOYK 1I3QC 3PO2K 4GTDA 4G7HA 5E68A 2R7ZA 1YX2A 2WAQL 4GTXA 4KM9A 4Q4ZA 4GTZA 1F93A 1I3QK 2JA6K 3PO2C 2PMZL 4A3LK 3S1NC 4MHXA 1IS1A 2PHCB 2NVQK 4A3IK 1J6WA 4Y52K 3HOWC 3SZYA 2R92K 4BBRC 1ZQ1C 3S2HK 1WQHA 2W5RA 1AJCA 1TWAC 2YU9K 2NVQC 1Y6VA 4MIVA 1TWHA 4A3GC 1AJAA 1O29A 4BY1K 4LK1A 4BBRK 4Y7NK 1E2SP 3NKMA 1YNNA 1N2LA 1URBA 5TMFA 1ZYRA 4C2MK 2XRGA 3S1RK 4UORA 2Y0SL 5L0KA 1L0WA 4C3JC 5C4JC 1WQGA 3S17K 5IYDC 1K83C 4KASA 4LREA 3GTOK 4GTAA 3M4OC 4BY7K 5IP9K 1TWCA 5FJ8K 4KB2A 4AYBL 4A3EK 2BE5A 3SZZA 1R9TA 3ADAC 3HOXC 2IUCA 3HXAA 1IBAA 1YNJA 2VUMC 4A93K 2NVYK 3S2DK 3FOFA 5M5XK 4YG2A 4A3KC 5INHA 1X31C 3HOYC 1F9NA 3NKNA 3RZOC 4KJDA 5C66A 1TWAA 3S1QK 3TX0A 2GAGC 4MEXA 1Y7AA 4XLNA 1USOA 3ERED 4FM9A 4C3HC 5JFEA 1AUKA 2R7ZC 1Y1VA 5C4XK 4GTBA 2W8DA 4GFQA 3WODA 3NKRA 2NVYA 3VA7A 1SHNA 2D1GA 5D4DA 4XSZA 3S17C 1EW2A 4P5BA 1TWAK 2YU9C 5IYBK 3GTQA 3NUHA 1WSVA 1ALIA 4C3IK 4FDJA 3TG0A 3OEPA 3AQOA 1HJKA 3I4MC 4BXXC 3H3VL 5IP7C 5IYBC 1DCHA 3S14K 5GRRA 3B5QA 3AD8C 4C2MC 1EW8A 1I6HC 4KATA 2NVXA 4C3JK 4A3JC 5JVOA 2FQTA 4GTCA 4UPKA 5GOVA 4AYBD 1ANJA 4BKWA 4BBSC 4KJGA 1Y1WA 1KH5A 1KHJA 3FKIC 4QJVA 2G9YA 3BP8C 4O2DA 1AB4A 4TN0A 3CAGA 1I50K 2VUMK 3FHZA 2NVYC 2NVXK 1AJDA 1J6XA 1Y1VK 3UO0A 1EK8A 4KMAA 1BGWA 2V6TA 4A3LC 1RU0A 4GTWA 3H3VD 1IE0A 4KC6A 2Y3PA 1Y1WK 3AD9C 1WOSA 1AJBA 1XZPB 2XCOA 5C3EK 5C44K 4XLPA 5DLWA 1TWGC 3UN3A 4LR2A 1ELYA 2GSOA 2PMZD 1WOOA 4LRCA 1VGXA 1JOEA 3BP3A 4KMDA 5IYCK 2E2HA 3NVLA 3WAVA 5L0BA 4M1XA 2R93C 4ZGAA 1EQRA 3FKIA 4OIRA 4BXXK 4LJZA 2V6SA 3CQZC 4N7TA 3WAWA 2GSNA 2B63K 1DCPA 2GA3A 2JA5A 2Y0SD 3LAJA 1SHQA 4LRBA 2E2JK 4RMFA 3NKPA 5EGHA 1WCMA 1WQFA 2RH6A 5IOTA 4G7OA 3FKIK 3GEEA 2A6EA 3DYCA 4LRDA 3N0BA 3GTGK 3AQPA 4LLGA 3GTJA 2WAQD 1P49A 4G7ZA 1J6VA 1O2AA 3M8YA 1XZQB 2B63A 3CMRA 4A3KK 4UOOA 3GTQK 3EQLA 3HOUC 3GTLA 4KDDA 2E2HC 5C4XC 3IPJA 4XCHA 5K4PA 3HOVC 1VLOA 3V4GA 2NVTK 3E2DA 5KXAA 1WSRA 2V6UA 3S0XA 5DLTA 5TJ3A 3GTMA 1BDFA 1O25A 2E2HK 1IL2A 3LXQA 5EGEA 4KM4A 1ALJA 1KH4A 2JA6C 3TFJA 3MMLB 3OREA 4GT9A 3GTOA 1SFOA 1ALKA 4GTFA 5IYCC 5IOQA 4LR9A 3T00A 5IJSA 4AH6A 1HQMA 5IP7K 3S14C 1WCMC 4MQ9A 1F7VA 3I4MK 1I6HK 1E3CP 3M4OK 4BY7C 1TWHC 3M3YC 2X98A 4JK1A 1DCOA 4Y7NC 2B63C 3M8WA 1ZEFA 3GTPC 5LRMA 2A68A 1ZXOA 2E2IA 4KAWX 4LQYA 3M8ZA 4KMHA 3IGYB 4CYRA 3K7AC 4FDIA 4LR7A 3GTKK 1WORA 2XCQA 3BDHA 5DLVA 3PO3K 1JVIA 4Y52C 2W5WA 1USMA 2R7ZK 3RZDK 4QAXA 2W7VA 4NWJA 1SFOC 4YFNA 4GZYA 3S2DC 3H0GK 5C44C 4OIQA 4UPHA 1TWFK 3S16K 3HOVK 1B4AA 4A3DK 2R92A 3UN5A 1IQ0A 1ZVUA 3TFHA 2GAHC 4OINA 2YU9A 3S1QC 5FLMK 3NKQA 1ED9A 3H0GC 4NOIA 1VH2A 2CFAA 4C3HK 4C3IC 2P5MA 4KB4A 5LQQA 1B4BA 3GTJC 2W5VA 3GTOC 2QZUA 5M5YK 1HI9A 3HOZK 1E1ZP 4KAVA 3N3YA 3CQZK 3GEHA 1I6VA 4Q5SA 3HOXK 4KN4A 2E2IK 4NWXA 4ZG7A 3BUEA 1TWCK 2JH3A 2PPBA 3OT9A 3G4AA 2JA7K 4OIPA 4MY4A 3MK2A 1EI6A 4OIOA 4A3CK 2JA6A 1ZEBA 4ZG6A 4KARA 1O26A 3IGZB 5M3MK 2A69A 2JA7C 1TWFC 3S16C 3BDGB 4G0VA 4DDQA 1PJ7A 1ELXA 3AH5A 4A3FC 3UN2A 1XZPA 4A3BK 4ILDA 4MEYA 1K83A 3WAXA 4QJVB 1BS2A 5HL8A 3GTQC 4UOPA 1ISEA 1Y1WC 1EW9A 1O2BA 2W5SA 1XXAA 3T02A 4A3FK 2GLQA 1TWGA 4C45A 4ZG9A 4PAAA 1ZEDA 4KMUA 3HOWK 3S1RC 3DXJA 1EFWA 2ZKTA 3S2HC 1EH1A 1V5VA 3MK1A 4LK0A 2R93K 1K83K 1N2KA 5CJ9A 1KHNA 4CXSA 1UV7A 4A3GK 2W5TA 4A3JK 3QX3A 5CHPA 1TWGK 3CQZA 5TMCA 1SMYA 3FOEA 1TWHK 3M3YK 2JA5C 2JA7A 3KD8A 3GDZA 4LOWA 1WOPA 1F7UA 1ALHA 3L4KA 1HDHA 4B56A 1INNA 3GEIA 1C0AA 2JA8C 2R93A 3GTMC 3S1MC 5IP9C 5M5WK 1XXBA 3H0GA 3LPXA 1VJEA 2FQOA 2RGRA 1Y1VC 4X6AK 3GTGC 4CXUA 3Q3QA 2ZFZA 4QIWD 3L4JA 1O27A 3S1MK 1EQJA 2XR9A 3NKOA 4P5AA 3N0CA 3S15C 2VUMA 3PO3C 1O99A 1ZBSA 3GTKC 1O98A 2CW0A 1DD5A 4KM8A 4A3BC 4QIWL 3DPCA 4PABA 5IOSA 2WB1L 1SFOK 4A3IC 2GSUA 4WJ4A 2VQRA 1K7HA 1URAA 2D6FC 4G0WA 3HOUK 5IORA 5FLMC 4KAYA 1HQAA 4GTYA 1GE9A 5IJQA 3AD7C 4LRFA 3A8KA 3T01A 4P9SA 3LAPA 1IW7A 4YR1A 1ED8A 1I3QA 3M7VA 2JA8K 5AJ9A 4ZH4A 5HRTA 1KH9A 3UNYA 1FSUA 2P8TA 3MK0A 3GTPA 1I50A 2JA5K 2E2IC 2NVXC 1PJ6A 3TTGA 3HKZD 4CYSA 1WCMK 4A3CC 1BJTA 4A3MK 4BBSK 4A93C 2W8SA 4FZBA 4UPIA 1B8JA 3GSIA 4LR8A 3GTGA 3A8IA 3WBHA 4J3NA 4A3MC 3GTPK 1I50C 3S15K 1KH7A 2IFYA 4UPLA 3RZOK 3S1NK 2WB1D 3IDDA 4BLAA 5LIAA 3WAYA 3BDFA 3A52A 2KWAA 4A3DC 1VRQC 1R9TK 2CFAB 4CXKA 4KN7A 4WJ3M 1XXCA 5C3EC 3I4NC 1KHKA 2W5QA 2PA8D 1KQ4A 1R9TC 4WILA 4G0UA 3JSTA 4YFKA 2EBBA 1J98A 4BLBA 1XPPA 2O5JA 1EJJA 2W5XA 3GTLC 1E33P 3I4NK 1O24A 1TWFA 2PA8L 1JQWA 3GTKA 2R92C 3A8JA 1XZQA 5C4JK 1ELZA 3G4CA 1O2FB 1O28A 4GTEA 4XSXA 2O5IA 3GTLK 1WIHA 5IYDK 1TWCC 3TFIA 1ANIA 4LRAA 5L46A 4BY1C 2ZUEA 3HKZL 2A6HA 3GTJK 4A3EC 1G51A 1YCLA 3K7AK 4GTLA 3GTMK 3ED4A 1PJ5A 3BDGA 5LRNA 2ZUFA 5M3FK 3TWZA 2ANHA 2XCRB 1KHLA
chains in the Genus database with same CATH topology
2IUCB 5L0EA 3OPFA 4GTDA 2R7ZA 4GTXA 4KM9A 4GTZA 4MHXA 1IS1A 2PHCB 3SZYA 1WQHA 2W5RA 1AJCA 1Y6VA 4MIVA 1TWHA 1AJAA 1O29A 1E2SP 3NKMA 1N2LA 1URBA 2XRGA 4UORA 5L0KA 4C3JC 1WQGA 4KASA 4LREA 4GTAA 1TWCA 4KB2A 1R9TA 3SZZA 2IUCA 3FOFA 5INHA 5C66A 1F9NA 3NKNA 4KJDA 1TWAA 3TX0A 1Y7AA 3ERED 4FM9A 4C3HC 5JFEA 1AUKA 2W8DA 1Y1VA 4GTBA 4GFQA 3NKRA 2NVYA 3VA7A 1SHNA 2D1GA 1EW2A 4P5BA 3GTQA 3NUHA 1ALIA 4FDJA 3TG0A 3OEPA 3AQOA 1HJKA 5GRRA 3B5QA 4C2MC 1EW8A 4KATA 2NVXA 5JVOA 4GTCA 4UPKA 5GOVA 1ANJA 4BKWA 4KJGA 1Y1WA 1KHJA 1KH5A 2G9YA 1AB4A 4TN0A 3CAGA 3FHZA 1AJDA 3UO0A 1EK8A 4KMAA 1BGWA 4GTWA 4KC6A 2Y3PA 1AJBA 2XCOA 5DLWA 3UN3A 4LR2A 1ELYA 2GSOA 4LRCA 4KMDA 2E2HA 3NVLA 3WAVA 5L0BA 4M1XA 4ZGAA 3FKIA 4N7TA 3WAWA 2GSNA 2GA3A 2JA5A 3LAJA 1SHQA 4LRBA 3NKPA 5EGHA 1WCMA 1WQFA 2RH6A 5IOTA 4LRDA 3DYCA 3N0BA 3AQPA 3GTJA 1P49A 3M8YA 1O2AA 2B63A 3CMRA 4UOOA 3GTLA 4KDDA 5K4PA 3V4GA 5KXAA 3E2DA 3S0XA 5DLTA 5TJ3A 3GTMA 1O25A 3LXQA 5EGEA 4KM4A 1ALJA 1KH4A 3OREA 3MMLB 4GT9A 3GTOA 1SFOA 1ALKA 4GTFA 5IOQA 4LR9A 3T00A 5IJSA 1E3CP 2X98A 3M8WA 1ZEFA 5LRMA 2E2IA 1ZXOA 4KAWX 4LQYA 3M8ZA 4KMHA 3IGYB 4CYRA 4FDIA 4LR7A 2XCQA 3BDHA 5DLVA 2W5WA 4QAXA 4NWJA 4UPHA 1B4AA 2R92A 3UN5A 1ZVUA 2YU9A 3NKQA 1ED9A 2CFAA 4C3IC 2P5MA 4KB4A 5LQQA 1B4BA 2W5VA 2QZUA 1E1ZP 4KAVA 3N3YA 4NWXA 4ZG7A 3BUEA 2JH3A 3OT9A 3G4AA 4MY4A 3MK2A 1EI6A 2JA6A 1ZEBA 4ZG6A 4KARA 1O26A 3IGZB 3BDGB 4G0VA 4DDQA 1ELXA 3AH5A 3UN2A 4ILDA 1K83A 3WAXA 4UOPA 1ISEA 1EW9A 1O2BA 2W5SA 1XXAA 3T02A 2GLQA 1TWGA 4ZG9A 1ZEDA 2ZKTA 1EH1A 3MK1A 1N2KA 5CJ9A 1KHNA 4CXSA 2W5TA 3QX3A 5CHPA 3CQZA 3FOEA 2JA7A 3KD8A 1ALHA 3L4KA 1HDHA 4B56A 2R93A 1XXBA 3H0GA 3LPXA 2RGRA 4CXUA 3Q3QA 2ZFZA 3L4JA 1EQJA 1O27A 2XR9A 3NKOA 4P5AA 3N0CA 2VUMA 1O99A 1ZBSA 1O98A 4KM8A 1DD5A 3DPCA 5IOSA 2GSUA 2VQRA 1K7HA 1URAA 4G0WA 5IORA 4KAYA 1HQAA 4GTYA 1GE9A 5IJQA 4LRFA 3T01A 3LAPA 4YR1A 1ED8A 1I3QA 3M7VA 5AJ9A 5HRTA 1KH9A 3UNYA 1FSUA 3MK0A 3GTPA 1I50A 4CYSA 1BJTA 2W8SA 4FZBA 4UPIA 1B8JA 4LR8A 3GTGA 3WBHA 4J3NA 4UPLA 1KH7A 2IFYA 3IDDA 4BLAA 5LIAA 3WAYA 3BDFA 3A52A 2KWAA 2CFAB 4CXKA 1XXCA 1KHKA 2W5QA 1KQ4A 4G0UA 4BLBA 1EJJA 2W5XA 1E33P 1O24A 1TWFA 3GTKA 1ELZA 3G4CA 1O28A 4GTEA 1WIHA 1ANIA 4LRAA 4GTLA 3ED4A 3BDGA 5LRNA 3TWZA 2ANHA 2XCRB 1KHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUC B;  2G9Y A;  3IGY B;  4CYR A;  5L0E A;  4CXU A;  3Q3Q A;  4FDI A;  4TN0 A;  1EQJ A;  3NKO A;  2XR9 A;  4LR7 A;  1AJD A;  1O99 A;  3BDH A;  5DLV A;  1O98 A;  3UO0 A;  2W5W A;  4GTX A;  4GTZ A;  4QAX A;  3DPC A;  4GTW A;  4NWJ A;  4MHX A;  4UPH A;  1AJB A;  2GSU A;  2VQR A;  3SZY A;  3UN5 A;  5DLW A;  1K7H A;  1URA A;  3UN3 A;  4LR2 A;  1ELY A;  2GSO A;  2W5R A;  1AJC A;  3NKQ A;  4LRC A;  1ED9 A;  4KAY A;  1Y6V A;  1HQA A;  4GTY A;  5IJQ A;  4MIV A;  4LRF A;  1AJA A;  3NVL A;  3T01 A;  5LQQ A;  4YR1 A;  3WAV A;  1E2S P;  3NKM A;  5L0B A;  1ED8 A;  4ZGA A;  3M7V A;  1N2L A;  1URB A;  2W5V A;  5AJ9 A;  5HRT A;  1KH9 A;  2XRG A;  2QZU A;  4UOR A;  3UNY A;  5L0K A;  1FSU A;  1E1Z P;  3MK0 A;  4KAV A;  4N7T A;  3WAW A;  2GSN A;  4NWX A;  4LRE A;  4ZG7 A;  2GA3 A;  1SHQ A;  4LRB A;  3OT9 A;  4MY4 A;  4CYS A;  3MK2 A;  3SZZ A;  3NKP A;  1EI6 A;  5EGH A;  2IUC A;  2RH6 A;  1ZEB A;  4ZG6 A;  2W8S A;  3IGZ B;  4UPI A;  3BDG B;  4LRD A;  1B8J A;  3DYC A;  4LR8 A;  1ELX A;  1P49 A;  3M8Y A;  3UN2 A;  5INH A;  3WBH A;  3CMR A;  4UOO A;  5C66 A;  3NKN A;  4KJD A;  3WAX A;  4UPL A;  1KH7 A;  2IFY A;  3TX0 A;  4UOP A;  1EW9 A;  1Y7A A;  3IDD A;  2W5S A;  5K4P A;  3T02 A;  1AUK A;  3WAY A;  3BDF A;  2W8D A;  3A52 A;  5LIA A;  2GLQ A;  5KXA A;  3E2D A;  4ZG9 A;  4CXK A;  5DLT A;  5TJ3 A;  1ZED A;  3NKR A;  1SHN A;  2D1G A;  3LXQ A;  1KHK A;  2W5Q A;  5EGE A;  4KM4 A;  1ALJ A;  1EW2 A;  2ZKT A;  1KH5 A;  3MK1 A;  1KH4 A;  1EJJ A;  1N2K A;  2W5X A;  1ALI A;  1E33 P;  1KHN A;  1ALK A;  4CXS A;  2W5T A;  4FDJ A;  3TG0 A;  4LR9 A;  3T00 A;  1HJK A;  5IJS A;  1ELZ A;  5GRR A;  3B5Q A;  1E3C P;  1EW8 A;  2X98 A;  1ANI A;  4LRA A;  3KD8 A;  4UPK A;  5GOV A;  1ALH A;  1ANJ A;  4B56 A;  1HDH A;  3M8W A;  3ED4 A;  1ZEF A;  3BDG A;  5LRM A;  5LRN A;  4KJG A;  3TWZ A;  2ANH A;  4LQY A;  3M8Z A;  1KHJ A;  1KHL A; 
#chains in the Genus database with same CATH topology
 2E2J C;  3HOZ C;  2IUC B;  4YFX A;  5L0E A;  4X6A C;  2NVT C;  3RZD C;  3OPF A;  3GIR A;  3HOY K;  1I3Q C;  3PO2 K;  4GTD A;  4G7H A;  5E68 A;  2R7Z A;  1YX2 A;  2WAQ L;  4GTX A;  4KM9 A;  4Q4Z A;  4GTZ A;  1F93 A;  1I3Q K;  2JA6 K;  3PO2 C;  2PMZ L;  4A3L K;  3S1N C;  4MHX A;  1IS1 A;  2PHC B;  2NVQ K;  4A3I K;  1J6W A;  4Y52 K;  3HOW C;  3SZY A;  2R92 K;  4BBR C;  1ZQ1 C;  3S2H K;  1WQH A;  2W5R A;  1AJC A;  1TWA C;  2YU9 K;  2NVQ C;  1Y6V A;  4MIV A;  1TWH A;  4A3G C;  1AJA A;  1O29 A;  4BY1 K;  4LK1 A;  4BBR K;  4Y7N K;  1E2S P;  3NKM A;  1YNN A;  1N2L A;  1URB A;  5TMF A;  1ZYR A;  4C2M K;  2XRG A;  3S1R K;  4UOR A;  2Y0S L;  5L0K A;  1L0W A;  4C3J C;  5C4J C;  1WQG A;  3S17 K;  5IYD C;  1K83 C;  4KAS A;  4LRE A;  3GTO K;  4GTA A;  3M4O C;  4BY7 K;  5IP9 K;  1TWC A;  5FJ8 K;  4KB2 A;  4AYB L;  4A3E K;  2BE5 A;  3SZZ A;  1R9T A;  3ADA C;  3HOX C;  2IUC A;  3HXA A;  1IBA A;  1YNJ A;  2VUM C;  4A93 K;  2NVY K;  3S2D K;  3FOF A;  5M5X K;  4YG2 A;  4A3K C;  5INH A;  1X31 C;  3HOY C;  1F9N A;  3NKN A;  3RZO C;  4KJD A;  5C66 A;  1TWA A;  3S1Q K;  3TX0 A;  2GAG C;  4MEX A;  1Y7A A;  4XLN A;  1USO A;  3ERE D;  4FM9 A;  4C3H C;  5JFE A;  1AUK A;  2R7Z C;  1Y1V A;  5C4X K;  4GTB A;  2W8D A;  4GFQ A;  3WOD A;  3NKR A;  2NVY A;  3VA7 A;  1SHN A;  2D1G A;  5D4D A;  4XSZ A;  3S17 C;  1EW2 A;  4P5B A;  1TWA K;  2YU9 C;  5IYB K;  3GTQ A;  3NUH A;  1WSV A;  1ALI A;  4C3I K;  4FDJ A;  3TG0 A;  3OEP A;  3AQO A;  1HJK A;  3I4M C;  4BXX C;  3H3V L;  5IP7 C;  5IYB C;  1DCH A;  3S14 K;  5GRR A;  3B5Q A;  3AD8 C;  4C2M C;  1EW8 A;  1I6H C;  4KAT A;  2NVX A;  4C3J K;  4A3J C;  5JVO A;  2FQT A;  4GTC A;  4UPK A;  5GOV A;  4AYB D;  1ANJ A;  4BKW A;  4BBS C;  4KJG A;  1Y1W A;  1KH5 A;  1KHJ A;  3FKI C;  4QJV A;  2G9Y A;  3BP8 C;  4O2D A;  1AB4 A;  4TN0 A;  3CAG A;  1I50 K;  2VUM K;  3FHZ A;  2NVY C;  2NVX K;  1AJD A;  1J6X A;  1Y1V K;  3UO0 A;  1EK8 A;  4KMA A;  1BGW A;  2V6T A;  4A3L C;  1RU0 A;  4GTW A;  3H3V D;  1IE0 A;  4KC6 A;  2Y3P A;  1Y1W K;  3AD9 C;  1WOS A;  1AJB A;  1XZP B;  2XCO A;  5C3E K;  5C44 K;  4XLP A;  5DLW A;  1TWG C;  3UN3 A;  4LR2 A;  1ELY A;  2GSO A;  2PMZ D;  1WOO A;  4LRC A;  1VGX A;  1JOE A;  3BP3 A;  4KMD A;  5IYC K;  2E2H A;  3NVL A;  3WAV A;  5L0B A;  4M1X A;  2R93 C;  4ZGA A;  1EQR A;  3FKI A;  4OIR A;  4BXX K;  4LJZ A;  2V6S A;  3CQZ C;  4N7T A;  3WAW A;  2GSN A;  2B63 K;  1DCP A;  2GA3 A;  2JA5 A;  2Y0S D;  3LAJ A;  1SHQ A;  4LRB A;  2E2J K;  4RMF A;  3NKP A;  5EGH A;  1WCM A;  1WQF A;  2RH6 A;  5IOT A;  4G7O A;  3FKI K;  3GEE A;  2A6E A;  3DYC A;  4LRD A;  3N0B A;  3GTG K;  3AQP A;  4LLG A;  3GTJ A;  2WAQ D;  1P49 A;  4G7Z A;  1J6V A;  1O2A A;  3M8Y A;  1XZQ B;  2B63 A;  3CMR A;  4A3K K;  4UOO A;  3GTQ K;  3EQL A;  3HOU C;  3GTL A;  4KDD A;  2E2H C;  5C4X C;  3IPJ A;  4XCH A;  5K4P A;  3HOV C;  1VLO A;  3V4G A;  2NVT K;  3E2D A;  5KXA A;  1WSR A;  2V6U A;  3S0X A;  5DLT A;  5TJ3 A;  3GTM A;  1BDF A;  1O25 A;  2E2H K;  1IL2 A;  3LXQ A;  5EGE A;  4KM4 A;  1ALJ A;  1KH4 A;  2JA6 C;  3TFJ A;  3MML B;  3ORE A;  4GT9 A;  3GTO A;  1SFO A;  1ALK A;  4GTF A;  5IYC C;  5IOQ A;  4LR9 A;  3T00 A;  5IJS A;  4AH6 A;  1HQM A;  5IP7 K;  3S14 C;  1WCM C;  4MQ9 A;  1F7V A;  3I4M K;  1I6H K;  1E3C P;  3M4O K;  4BY7 C;  1TWH C;  3M3Y C;  2X98 A;  4JK1 A;  1DCO A;  4Y7N C;  2B63 C;  3M8W A;  1ZEF A;  3GTP C;  5LRM A;  2A68 A;  1ZXO A;  2E2I A;  4KAW X;  4LQY A;  3M8Z A;  4KMH A;  3IGY B;  4CYR A;  3K7A C;  4FDI A;  4LR7 A;  3GTK K;  1WOR A;  2XCQ A;  3BDH A;  5DLV A;  3PO3 K;  1JVI A;  4Y52 C;  2W5W A;  1USM A;  2R7Z K;  3RZD K;  4QAX A;  2W7V A;  4NWJ A;  1SFO C;  4YFN A;  4GZY A;  3S2D C;  3H0G K;  5C44 C;  4OIQ A;  4UPH A;  1TWF K;  3S16 K;  3HOV K;  1B4A A;  4A3D K;  2R92 A;  3UN5 A;  1IQ0 A;  1ZVU A;  3TFH A;  2GAH C;  4OIN A;  2YU9 A;  3S1Q C;  5FLM K;  3NKQ A;  1ED9 A;  3H0G C;  4NOI A;  1VH2 A;  2CFA A;  4C3H K;  4C3I C;  2P5M A;  4KB4 A;  5LQQ A;  1B4B A;  3GTJ C;  2W5V A;  3GTO C;  2QZU A;  5M5Y K;  1HI9 A;  3HOZ K;  1E1Z P;  4KAV A;  3N3Y A;  3CQZ K;  3GEH A;  1I6V A;  4Q5S A;  3HOX K;  4KN4 A;  2E2I K;  4NWX A;  4ZG7 A;  3BUE A;  1TWC K;  2JH3 A;  2PPB A;  3OT9 A;  3G4A A;  2JA7 K;  4OIP A;  4MY4 A;  3MK2 A;  1EI6 A;  4OIO A;  4A3C K;  2JA6 A;  1ZEB A;  4ZG6 A;  4KAR A;  1O26 A;  3IGZ B;  5M3M K;  2A69 A;  2JA7 C;  1TWF C;  3S16 C;  3BDG B;  4G0V A;  4DDQ A;  1PJ7 A;  1ELX A;  3AH5 A;  4A3F C;  3UN2 A;  1XZP A;  4A3B K;  4ILD A;  4MEY A;  1K83 A;  3WAX A;  4QJV B;  1BS2 A;  5HL8 A;  3GTQ C;  4UOP A;  1ISE A;  1Y1W C;  1EW9 A;  1O2B A;  2W5S A;  1XXA A;  3T02 A;  4A3F K;  2GLQ A;  1TWG A;  4C45 A;  4ZG9 A;  4PAA A;  1ZED A;  4KMU A;  3HOW K;  3S1R C;  3DXJ A;  1EFW A;  2ZKT A;  3S2H C;  1EH1 A;  1V5V A;  3MK1 A;  4LK0 A;  2R93 K;  1K83 K;  1N2K A;  5CJ9 A;  1KHN A;  4CXS A;  1UV7 A;  4A3G K;  2W5T A;  4A3J K;  3QX3 A;  5CHP A;  1TWG K;  3CQZ A;  5TMC A;  1SMY A;  3FOE A;  1TWH K;  3M3Y K;  2JA5 C;  2JA7 A;  3KD8 A;  3GDZ A;  4LOW A;  1WOP A;  1F7U A;  1ALH A;  3L4K A;  1HDH A;  4B56 A;  1INN A;  3GEI A;  1C0A A;  2JA8 C;  2R93 A;  3GTM C;  3S1M C;  5IP9 C;  5M5W K;  1XXB A;  3H0G A;  3LPX A;  1VJE A;  2FQO A;  2RGR A;  1Y1V C;  4X6A K;  3GTG C;  4CXU A;  3Q3Q A;  2ZFZ A;  4QIW D;  3L4J A;  1O27 A;  3S1M K;  1EQJ A;  2XR9 A;  3NKO A;  4P5A A;  3N0C A;  3S15 C;  2VUM A;  3PO3 C;  1O99 A;  1ZBS A;  3GTK C;  1O98 A;  2CW0 A;  1DD5 A;  4KM8 A;  4A3B C;  4QIW L;  3DPC A;  4PAB A;  5IOS A;  2WB1 L;  1SFO K;  4A3I C;  2GSU A;  4WJ4 A;  2VQR A;  1K7H A;  1URA A;  2D6F C;  4G0W A;  3HOU K;  5IOR A;  5FLM C;  4KAY A;  1HQA A;  4GTY A;  1GE9 A;  5IJQ A;  3AD7 C;  4LRF A;  3A8K A;  3T01 A;  4P9S A;  3LAP A;  1IW7 A;  4YR1 A;  1ED8 A;  1I3Q A;  3M7V A;  2JA8 K;  5AJ9 A;  4ZH4 A;  5HRT A;  1KH9 A;  3UNY A;  1FSU A;  2P8T A;  3MK0 A;  3GTP A;  1I50 A;  2JA5 K;  2E2I C;  2NVX C;  1PJ6 A;  3TTG A;  3HKZ D;  4CYS A;  1WCM K;  4A3C C;  1BJT A;  4A3M K;  4BBS K;  4A93 C;  2W8S A;  4FZB A;  4UPI A;  1B8J A;  3GSI A;  4LR8 A;  3GTG A;  3A8I A;  3WBH A;  4J3N A;  4A3M C;  3GTP K;  1I50 C;  3S15 K;  1KH7 A;  2IFY A;  4UPL A;  3RZO K;  3S1N K;  2WB1 D;  3IDD A;  4BLA A;  5LIA A;  3WAY A;  3BDF A;  3A52 A;  2KWA A;  4A3D C;  1VRQ C;  1R9T K;  2CFA B;  4CXK A;  4KN7 A;  4WJ3 M;  1XXC A;  5C3E C;  3I4N C;  1KHK A;  2W5Q A;  2PA8 D;  1KQ4 A;  1R9T C;  4WIL A;  4G0U A;  3JST A;  4YFK A;  2EBB A;  1J98 A;  4BLB A;  1XPP A;  2O5J A;  1EJJ A;  2W5X A;  3GTL C;  1E33 P;  3I4N K;  1O24 A;  1TWF A;  2PA8 L;  1JQW A;  3GTK A;  2R92 C;  3A8J A;  1XZQ A;  5C4J K;  1ELZ A;  3G4C A;  1O2F B;  1O28 A;  4GTE A;  4XSX A;  2O5I A;  3GTL K;  1WIH A;  5IYD K;  1TWC C;  3TFI A;  1ANI A;  4LRA A;  5L46 A;  4BY1 C;  2ZUE A;  3HKZ L;  2A6H A;  3GTJ K;  4A3E C;  1G51 A;  1YCL A;  3K7A K;  4GTL A;  3GTM K;  3ED4 A;  1PJ5 A;  3BDG A;  5LRN A;  2ZUF A;  5M3F K;  3TWZ A;  2ANH A;  2XCR B;  1KHL A; 
#chains in the Genus database with same CATH homology
 2IUC B;  5L0E A;  3OPF A;  4GTD A;  2R7Z A;  4GTX A;  4KM9 A;  4GTZ A;  4MHX A;  1IS1 A;  2PHC B;  3SZY A;  1WQH A;  2W5R A;  1AJC A;  1Y6V A;  4MIV A;  1TWH A;  1AJA A;  1O29 A;  1E2S P;  3NKM A;  1N2L A;  1URB A;  2XRG A;  4UOR A;  5L0K A;  4C3J C;  1WQG A;  4KAS A;  4LRE A;  4GTA A;  1TWC A;  4KB2 A;  1R9T A;  3SZZ A;  2IUC A;  3FOF A;  5INH A;  5C66 A;  1F9N A;  3NKN A;  4KJD A;  1TWA A;  3TX0 A;  1Y7A A;  3ERE D;  4FM9 A;  4C3H C;  5JFE A;  1AUK A;  2W8D A;  1Y1V A;  4GTB A;  4GFQ A;  3NKR A;  2NVY A;  3VA7 A;  1SHN A;  2D1G A;  1EW2 A;  4P5B A;  3GTQ A;  3NUH A;  1ALI A;  4FDJ A;  3TG0 A;  3OEP A;  3AQO A;  1HJK A;  5GRR A;  3B5Q A;  4C2M C;  1EW8 A;  4KAT A;  2NVX A;  5JVO A;  4GTC A;  4UPK A;  5GOV A;  1ANJ A;  4BKW A;  4KJG A;  1Y1W A;  1KHJ A;  1KH5 A;  2G9Y A;  1AB4 A;  4TN0 A;  3CAG A;  3FHZ A;  1AJD A;  3UO0 A;  1EK8 A;  4KMA A;  1BGW A;  4GTW A;  4KC6 A;  2Y3P A;  1AJB A;  2XCO A;  5DLW A;  3UN3 A;  4LR2 A;  1ELY A;  2GSO A;  4LRC A;  4KMD A;  2E2H A;  3NVL A;  3WAV A;  5L0B A;  4M1X A;  4ZGA A;  3FKI A;  4N7T A;  3WAW A;  2GSN A;  2GA3 A;  2JA5 A;  3LAJ A;  1SHQ A;  4LRB A;  3NKP A;  5EGH A;  1WCM A;  1WQF A;  2RH6 A;  5IOT A;  4LRD A;  3DYC A;  3N0B A;  3AQP A;  3GTJ A;  1P49 A;  3M8Y A;  1O2A A;  2B63 A;  3CMR A;  4UOO A;  3GTL A;  4KDD A;  5K4P A;  3V4G A;  5KXA A;  3E2D A;  3S0X A;  5DLT A;  5TJ3 A;  3GTM A;  1O25 A;  3LXQ A;  5EGE A;  4KM4 A;  1ALJ A;  1KH4 A;  3ORE A;  3MML B;  4GT9 A;  3GTO A;  1SFO A;  1ALK A;  4GTF A;  5IOQ A;  4LR9 A;  3T00 A;  5IJS A;  1E3C P;  2X98 A;  3M8W A;  1ZEF A;  5LRM A;  2E2I A;  1ZXO A;  4KAW X;  4LQY A;  3M8Z A;  4KMH A;  3IGY B;  4CYR A;  4FDI A;  4LR7 A;  2XCQ A;  3BDH A;  5DLV A;  2W5W A;  4QAX A;  4NWJ A;  4UPH A;  1B4A A;  2R92 A;  3UN5 A;  1ZVU A;  2YU9 A;  3NKQ A;  1ED9 A;  2CFA A;  4C3I C;  2P5M A;  4KB4 A;  5LQQ A;  1B4B A;  2W5V A;  2QZU A;  1E1Z P;  4KAV A;  3N3Y A;  4NWX A;  4ZG7 A;  3BUE A;  2JH3 A;  3OT9 A;  3G4A A;  4MY4 A;  3MK2 A;  1EI6 A;  2JA6 A;  1ZEB A;  4ZG6 A;  4KAR A;  1O26 A;  3IGZ B;  3BDG B;  4G0V A;  4DDQ A;  1ELX A;  3AH5 A;  3UN2 A;  4ILD A;  1K83 A;  3WAX A;  4UOP A;  1ISE A;  1EW9 A;  1O2B A;  2W5S A;  1XXA A;  3T02 A;  2GLQ A;  1TWG A;  4ZG9 A;  1ZED A;  2ZKT A;  1EH1 A;  3MK1 A;  1N2K A;  5CJ9 A;  1KHN A;  4CXS A;  2W5T A;  3QX3 A;  5CHP A;  3CQZ A;  3FOE A;  2JA7 A;  3KD8 A;  1ALH A;  3L4K A;  1HDH A;  4B56 A;  2R93 A;  1XXB A;  3H0G A;  3LPX A;  2RGR A;  4CXU A;  3Q3Q A;  2ZFZ A;  3L4J A;  1EQJ A;  1O27 A;  2XR9 A;  3NKO A;  4P5A A;  3N0C A;  2VUM A;  1O99 A;  1ZBS A;  1O98 A;  4KM8 A;  1DD5 A;  3DPC A;  5IOS A;  2GSU A;  2VQR A;  1K7H A;  1URA A;  4G0W A;  5IOR A;  4KAY A;  1HQA A;  4GTY A;  1GE9 A;  5IJQ A;  4LRF A;  3T01 A;  3LAP A;  4YR1 A;  1ED8 A;  1I3Q A;  3M7V A;  5AJ9 A;  5HRT A;  1KH9 A;  3UNY A;  1FSU A;  3MK0 A;  3GTP A;  1I50 A;  4CYS A;  1BJT A;  2W8S A;  4FZB A;  4UPI A;  1B8J A;  4LR8 A;  3GTG A;  3WBH A;  4J3N A;  4UPL A;  1KH7 A;  2IFY A;  3IDD A;  4BLA A;  5LIA A;  3WAY A;  3BDF A;  3A52 A;  2KWA A;  2CFA B;  4CXK A;  1XXC A;  1KHK A;  2W5Q A;  1KQ4 A;  4G0U A;  4BLB A;  1EJJ A;  2W5X A;  1E33 P;  1O24 A;  1TWF A;  3GTK A;  1ELZ A;  3G4C A;  1O28 A;  4GTE A;  1WIH A;  1ANI A;  4LRA A;  4GTL A;  3ED4 A;  3BDG A;  5LRN A;  3TWZ A;  2ANH A;  2XCR B;  1KHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...