4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
2X98A 4LRAA 4NWJA 1AJCA 5LQQA 4UOOA 4LQYA 1EI6A 1K7HA 3MK2A 1SHNA 1HDHA 2IUCA 2W5VA 3NKPA 4ZG7A 3A52A 4GTZA 1KH4A 3DPCA 4LREA 3IDDA 2XRGA 4LRDA 1ED8A 5TJ3A 3M8WA 2W5XA 1KHJA 4KAVA 2GA3A 3WAWA 5LRNA 4FDIA 1AJAA 4CYRA 4UOPA 2W8DA 4ZG9A 5DLVA 4CXSA 2GLQA 3BDGA 2W5WA 4LRFA 3WAVA 1ELYA 4YR1A 1N2KA 1ALJA 4MY4A 1AJBA 3NKMA 2D1GA 2W8SA 3M8YA 3WAYA 2W5RA 5GRRA 4QAXA 5C66A 4KAYA 4ZGAA 1O98A 2GSNA 1E3CP 3NKRA 3T00A 1EJJA 1B8JA 1ZEDA 2VQRA 3TWZA 3KD8A 1AUKA 2W5TA 2IFYA 5K4PA 4KM4A 3B5QA 4LR2A 3ED4A 4LR7A 1AJDA 4GTXA 4MIVA 2W5SA 1E1ZP 1EQJA 1ALKA 1FSUA 4UORA 1ALHA 3M7VA 3NVLA 3TX0A 3WAXA 5L0KA 5L0BA 1P49A 4KJDA 5LIAA 2GSOA 1HQAA 1ELZA 4UPHA 3M8ZA 3MK1A 4CYSA 1O99A 4TN0A 1URBA 4N7TA 1Y7AA 4LRCA 2G9YA 3IGZB 3UNYA 1E2SP 3NKOA 1ZEBA 1Y6VA 4GTYA 1EW2A 5INHA 5L0EA 5HRTA 4B56A 3WBHA 1ELXA 1EW9A 3UN5A 4GTWA 2ZKTA 3UN2A 5AJ9A 2GSUA 4KJGA 4CXKA 1ED9A 1KHLA 4LR8A 1ZEFA 3LXQA 3T02A 5IJSA 1KH5A 3Q3QA 3SZYA 1E33P 1SHQA 5IJQA 1KHNA 5EGEA 1HJKA 3DYCA 4LRBA 3OT9A 4UPKA 1KH7A 3TG0A 3IGYB 3NKQA 3BDFA 1ALIA 4NWXA 1EW8A 1ANIA 3BDHA 1URAA 2IUCB 3NKNA 1N2LA 2ANHA 5EGHA 5DLWA 2QZUA 4ZG6A 1KHKA 3BDGB 3MK0A 4LR9A 5KXAA 1KH9A 4FDJA 3UO0A 4CXUA 5LRMA 5GOVA 2RH6A 3UN3A 2W5QA 3SZZA 2XR9A 4MHXA 4UPLA 3E2DA 3CMRA 5DLTA 3T01A 1ANJA 4UPIA
chains in the Genus database with same CATH superfamily
4LK1A 3EQLA 1TWGA 1WORA 1VRQC 2O5JA 4ZG7A 5M5XK 1IS1A 1HDHA 1K83K 3GIRA 3JSTA 4QJVA 2NVQK 4BY7C 4YG2A 2E2JC 5C44C 1XXCA 5C3EC 1R9TA 1IL2A 4ZH4A 4LREA 3S2DC 4Y52K 2R93C 3IDDA 4XSZA 3GTQC 4X6AK 5C4XK 4YFKA 2JA7C 1ZVUA 4A3JC 1V5VA 1VJEA 4CYRA 4Y52C 4ZG9A 1TWCC 2CFAB 4LRFA 3GTJA 1Y1VK 1VLOA 1EFWA 2FQTA 3K7AC 1O24A 2W8SA 2GAGC 4A3DK 4A3FK 1R9TC 2R7ZK 3PO3C 3NKRA 1ZEDA 2VQRA 2NVTK 3TWZA 3KD8A 1AUKA 5K4PA 4AYBD 3M4OK 1EH1A 3B5QA 1SFOC 4GTXA 2R93K 4MIVA 3PO2C 5M3MK 3S2HC 1E1ZP 4PABA 4UORA 2V6UA 1SFOK 4A3CK 1ALHA 5L0BA 3WODA 1USMA 1P49A 4C3HC 1XZPA 4Q4ZA 1YX2A 1EQRA 4P5BA 3OEPA 3RZOC 1IW7A 1YCLA 3OREA 3M8ZA 1F7VA 3GTMA 3MK1A 1O99A 4CYSA 1INNA 4XCHA 3FKIC 3HOVK 1Y7AA 1I50K 1I3QK 4AYBL 2O5IA 2G9YA 3IGZB 1WCMC 5FLMK 3UNYA 5IYCC 4B56A 2JA8K 4A3BK 3UN5A 2RGRA 1F9NA 4KN7A 2GSUA 4C3JC 2E2HK 4MEYA 2ZKTA 5AJ9A 1ED9A 4FM9A 4LR8A 3LXQA 3GTLA 4AH6A 4C3JK 4A3LC 4GTDA 3GTOK 1KH5A 5IYCK 4GT9A 4WJ3M 1I6HC 3I4NK 2Y0SL 4KC6A 4KB4A 1VH2A 3HOVC 1KHNA 1K83C 1HJKA 2R92C 3DYCA 1KH7A 4BKWA 1EW8A 1WQHA 1WQGA 4GTLA 4KARA 4Q5SA 1IBAA 4GZYA 1N2LA 2PA8L 1XZQB 2JA7K 4A3MK 2NVYK 1DCOA 4ZG6A 2XCQA 4LR9A 2JH3A 5FJ8K 2RH6A 3AQOA 1ISEA 2V6TA 1L0WA 3E2DA 2GAHC 3BUEA 1ANJA 4UPIA 3HOYC 2X98A 5LQQA 4G0UA 3A8IA 1J6VA 4C2MC 1EK8A 3AQPA 3H0GK 1EI6A 2W5VA 1UV7A 3FHZA 2WB1L 1I6HK 2PA8D 2JA6A 4QIWL 2B63A 2ZFZA 3S2HK 2B63K 2JA5C 2XRGA 3GTOC 4QJVB 4A3MC 1KHJA 5IYDC 3GEIA 3H0GA 1TWHC 1WOSA 2JA8C 4KMHA 3AH5A 3AD7C 2JA5K 1F7UA 3M3YC 3BDGA 4A3FC 4NOIA 4LK0A 1ALJA 4A3IK 4XLPA 4MY4A 3NKMA 1Y1VC 2XCRB 2D1GA 1BS2A 3RZDC 3WAYA 3GTKC 5IYBK 2W5RA 1BJTA 5C66A 2NVYA 2GSNA 1E3CP 3T00A 1EJJA 1B8JA 3VA7A 4DDQA 4BY1K 3S1RC 5IYDK 3TFHA 5IOSA 1SMYA 1VGXA 2PMZL 4KM8A 2W5SA 5IP7K 3GTGA 1FSUA 1B4BA 5D4DA 4A3KK 1TWAC 1Y1WK 5L0KA 3MMLB 4OINA 3LPXA 4KJDA 5LIAA 2W7VA 3S16C 4PAAA 3S1QK 3GTLK 1XZQA 4BBRC 2E2HA 3S15C 3S0XA 1Y6VA 4GTYA 3PO2K 1EW2A 5HRTA 4MQ9A 3TFIA 2YU9C 1EW9A 1I3QA 4CXKA 1I50A 5M5YK 3ERED 3M4OC 3UN2A 1PJ7A 2CW0A 1ZEFA 1Y1WA 3GTGK 3NUHA 4LOWA 3QX3A 4A3DC 1E33P 1SHQA 1O2FB 5IJQA 1DCHA 2ZUEA 4LRBA 1SFOA 1ZXOA 3IGYB 4NWXA 2R93A 4A3LK 3BDHA 1DCPA 2ANHA 5EGHA 1WQFA 5DLWA 4MEXA 2PHCB 4BBSK 1KHKA 3MK0A 2JA5A 2R7ZA 5C3EK 1YNNA 2NVQC 2V6SA 4RMFA 3GTJK 3CMRA 3GEEA 2NVTC 5DLTA 1JVIA 3G4AA 4A3EK 1BGWA 1O27A 2BE5A 2A6HA 2NVXC 4LRAA 1WOPA 2JA6K 4BXXC 4UOOA 4LQYA 2P8TA 3MK2A 2IUCA 1GE9A 3K7AK 4KMAA 3I4MC 2WAQL 5C4JK 3A52A 4A3CC 3DXJA 4G7ZA 1IQ0A 1KH4A 3HOXK 5IP9K 4G7HA 4LRDA 2A6EA 5TJ3A 1ED8A 1WSRA 3GDZA 4P9SA 1K83A 4G7OA 3WAWA 5LRNA 5TMCA 4UOPA 5CJ9A 2W8DA 5DLVA 3S2DK 2GLQA 3RZDK 2W5WA 1WCMK 5FLMC 4A3GC 1N2KA 4KDDA 3CQZK 5C44K 3I4NC 3I4MK 2JA7A 1AJBA 5IOQA 3M8YA 4A3GK 3HXAA 3LAJA 4JK1A 5GRRA 3FOEA 1TWFK 3L4JA 4QAXA 4XSXA 1J98A 3AD8C 3AD9C 4KATA 4GTFA 2E2IK 2W5TA 2IFYA 3LAPA 4KAWX 4LR2A 5JVOA 3ED4A 4LR7A 4FZBA 3GTQK 1AJDA 5IP9C 1O29A 3HKZL 1EQJA 4G0VA 1WSVA 3GTOA 4LLGA 4BBSC 4OIOA 1PJ6A 3M7VA 1PJ5A 1XZPB 3HOWC 3CAGA 1G51A 2VUMC 4KASA 2Y3PA 3GTKA 1ELZA 1IE0A 4A93K 3HOYK 3PO3K 2YU9A 3G4CA 1O26A 1USOA 4TN0A 1J6WA 4N7TA 1HQMA 5IORA 1YNJA 4Y7NC 3GTMK 3N3YA 1E2SP 1ZEBA 4C3IC 4XLNA 4C45A 5INHA 5L0EA 3WBHA 3H3VD 1WIHA 2Y0SD 1KHLA 2A69A 4GTEA 3T02A 4X6AC 3S17K 1O2AA 2NVXA 3S14C 2R7ZC 3Q3QA 5TMFA 3SZYA 1XXBA 4BBRK 5EGEA 3FKIK 3OT9A 3L4KA 1KQ4A 1O2BA 4BLBA 2PPBA 1TWCK 5IOTA 3BP8C 1TWHK 3N0CA 2IUCB 3NKNA 3S1NK 4ILDA 4QIWD 2FQOA 2VUMA 1JQWA 3GTPC 4C3HK 3HOWK 3HOZK 5C4XC 2QZUA 1Y1VA 4A3BC 1TWAK 4KB2A 4OIPA 3BDGB 1TWGC 3UO0A 5IP7C 4FDJA 4CXUA 4M1XA 2NVYC 3UN3A 1I50C 2KWAA 5L46A 2E2JK 2W5QA 4UPLA 3HOZC 3H0GC 3IPJA 4BXXK 4KM9A 3RZOK 2P5MA 2XCOA 3S16K 4NWJA 4A3EC 1BDFA 1AJCA 1R9TK 4YFNA 5E68A 1DD5A 1K7HA 1SHNA 3NKPA 3HOUK 3GTPA 4A3IC 1Y1WC 4GTZA 3BP3A 3DPCA 1B4AA 1TWGK 4YFXA 1O25A 3GTPK 3M8WA 2W5XA 4KAVA 2E2IC 2GA3A 2EBBA 4BY1C 3S1MC 4FDIA 1AJAA 3ADAC 1X31C 1O28A 3GEHA 1J6XA 4CXSA 5IYBC 4KMUA 5HL8A 3V4GA 1ELYA 3WAVA 4YR1A 4G0WA 5C4JC 4BY7K 3HOUC 4WJ4A 3M3YK 4C2MK 3GTGC 4BLAA 3FOFA 4KAYA 4ZGAA 1O98A 2WB1D 1TWAA 4O2DA 3S14K 3TTGA 4A3JK 1WOOA 2VUMK 4KM4A 2E2HC 3GSIA 2R92A 1TWHA 4GFQA 4A3KC 4KN4A 1F93A 1JOEA 4C3IK 1TWCA 1ALKA 4Y7NK 3GTMC 1XPPA 3NVLA 3TX0A 3OPFA 3WAXA 1ZYRA 3FKIA 4LJZA 3A8KA 5M3FK 3S1RK 4WILA 3GTLC 2JA6C 2GSOA 3S1NC 1HQAA 1I6VA 4UPHA 2NVXK 1C0AA 5JFEA 5CHPA 3GTJC 1URBA 2PMZD 3CQZC 4LRCA 3A8JA 1AB4A 3NKOA 1ZQ1C 1ZBSA 1ELXA 3S17C 4GTWA 4KJGA 3N0BA 5IJSA 2YU9K 1HI9A 1TWFC 3GTKK 1RU0A 3TFJA 4GTAA 4OIQA 2R92K 1I3QC 4UPKA 3H3VL 4OIRA 2ZUFA 3TG0A 4GTBA 3S1QC 3NKQA 3BDFA 1ALIA 4A93C 1ANIA 1URAA 4GTCA 3GTQA 3S1MK 2E2IA 2WAQD 1XXAA 2B63C 3HOXC 4J3NA 5KXAA 5LRMA 1KH9A 2CFAA 1TWFA 2D6FC 3S15K 5M5WK 3SZZA 2A68A 4KMDA 2XR9A 4MHXA 3CQZA 4P5AA 1WCMA 5GOVA 3T01A 3HKZD
chains in the Genus database with same CATH topology
1TWGA 4ZG7A 1IS1A 1HDHA 1XXCA 1R9TA 4LREA 3IDDA 1ZVUA 4CYRA 4ZG9A 2CFAB 4LRFA 3GTJA 1O24A 2W8SA 3NKRA 1ZEDA 2VQRA 3TWZA 3KD8A 1AUKA 5K4PA 3B5QA 1EH1A 4GTXA 4MIVA 1E1ZP 4UORA 1ALHA 5L0BA 1P49A 4C3HC 4P5BA 3OEPA 3OREA 3M8ZA 3GTMA 3MK1A 4CYSA 1O99A 1Y7AA 3UNYA 2G9YA 3IGZB 4B56A 3UN5A 2RGRA 1F9NA 5AJ9A 4C3JC 2GSUA 2ZKTA 1ED9A 4FM9A 4LR8A 3LXQA 3GTLA 4GTDA 1KH5A 4GT9A 4KC6A 4KB4A 1KHNA 1HJKA 3DYCA 1KH7A 4BKWA 1EW8A 1WQHA 1WQGA 4GTLA 4KARA 1N2LA 4ZG6A 2XCQA 4LR9A 2JH3A 2RH6A 3AQOA 1ISEA 3E2DA 3BUEA 1ANJA 4UPIA 2X98A 5LQQA 4G0UA 4C2MC 1EK8A 3AQPA 1EI6A 2W5VA 3FHZA 2JA6A 2B63A 2ZFZA 2XRGA 1KHJA 3H0GA 4KMHA 3AH5A 3BDGA 1ALJA 4MY4A 3NKMA 2XCRB 2D1GA 3WAYA 2W5RA 1BJTA 5C66A 2NVYA 2GSNA 1E3CP 3T00A 1EJJA 1B8JA 3VA7A 4DDQA 5IOSA 4KM8A 2W5SA 3GTGA 1FSUA 1B4BA 5L0KA 3MMLB 3LPXA 4KJDA 5LIAA 2E2HA 3S0XA 1Y6VA 4GTYA 1EW2A 5HRTA 1EW9A 1I3QA 4CXKA 1I50A 3ERED 3UN2A 1ZEFA 1Y1WA 3NUHA 3QX3A 1E33P 1SHQA 5IJQA 4LRBA 1SFOA 1ZXOA 3IGYB 4NWXA 2R93A 3BDHA 2ANHA 5EGHA 1WQFA 5DLWA 2PHCB 3MK0A 1KHKA 2JA5A 2R7ZA 3CMRA 5DLTA 3G4AA 1BGWA 1O27A 4LRAA 4UOOA 4LQYA 3MK2A 2IUCA 1GE9A 4KMAA 3A52A 1KH4A 4LRDA 5TJ3A 1ED8A 1K83A 3WAWA 5LRNA 4UOPA 5CJ9A 2W8DA 5DLVA 2GLQA 2W5WA 1N2KA 4KDDA 2JA7A 1AJBA 5IOQA 3M8YA 3LAJA 5GRRA 3FOEA 3L4JA 4QAXA 4KATA 4GTFA 2W5TA 2IFYA 3LAPA 3ED4A 4KAWX 4LR2A 5JVOA 4LR7A 4FZBA 1AJDA 1O29A 1EQJA 4G0VA 3GTOA 3M7VA 3CAGA 4KASA 2Y3PA 3GTKA 1ELZA 2YU9A 3G4CA 1O26A 4TN0A 4N7TA 5IORA 3N3YA 1E2SP 1ZEBA 4C3IC 5INHA 5L0EA 3WBHA 1WIHA 1KHLA 4GTEA 3T02A 1O2AA 2NVXA 3Q3QA 3SZYA 1XXBA 5EGEA 3OT9A 3L4KA 1KQ4A 1O2BA 4BLBA 5IOTA 3N0CA 2IUCB 3NKNA 4ILDA 2VUMA 2QZUA 1Y1VA 4KB2A 3BDGB 3UO0A 4FDJA 4CXUA 4M1XA 3UN3A 2KWAA 2W5QA 4UPLA 4KM9A 2P5MA 2XCOA 4NWJA 1AJCA 1DD5A 1K7HA 1SHNA 3NKPA 3GTPA 4GTZA 3DPCA 1B4AA 1O25A 3M8WA 2W5XA 4KAVA 2GA3A 4FDIA 1AJAA 1O28A 4CXSA 3V4GA 3WAVA 1ELYA 4YR1A 4G0WA 4BLAA 3FOFA 4KAYA 4ZGAA 1O98A 1TWAA 4KM4A 2R92A 1TWHA 4GFQA 1TWCA 1ALKA 3NVLA 3TX0A 3OPFA 3WAXA 3FKIA 2GSOA 1HQAA 4UPHA 5JFEA 5CHPA 1URBA 4LRCA 1AB4A 3NKOA 1ZBSA 1ELXA 4GTWA 4KJGA 3N0BA 5IJSA 4GTAA 4UPKA 3TG0A 4GTBA 3NKQA 3BDFA 1ALIA 1ANIA 1URAA 4GTCA 3GTQA 2E2IA 1XXAA 4J3NA 5KXAA 5LRMA 1KH9A 2CFAA 1TWFA 3SZZA 4KMDA 2XR9A 4MHXA 3CQZA 4P5AA 1WCMA 5GOVA 3T01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X98 A;  4LRA A;  4NWJ A;  1AJC A;  5LQQ A;  4UOO A;  4LQY A;  1EI6 A;  1K7H A;  3MK2 A;  1SHN A;  1HDH A;  2IUC A;  2W5V A;  3NKP A;  4ZG7 A;  3A52 A;  4GTZ A;  1KH4 A;  3DPC A;  4LRE A;  3IDD A;  2XRG A;  4LRD A;  1ED8 A;  5TJ3 A;  3M8W A;  2W5X A;  1KHJ A;  4KAV A;  2GA3 A;  3WAW A;  5LRN A;  4FDI A;  1AJA A;  4CYR A;  4UOP A;  2W8D A;  4ZG9 A;  5DLV A;  4CXS A;  2GLQ A;  3BDG A;  2W5W A;  4LRF A;  3WAV A;  1ELY A;  4YR1 A;  1N2K A;  1ALJ A;  4MY4 A;  1AJB A;  3NKM A;  2D1G A;  2W8S A;  3M8Y A;  3WAY A;  2W5R A;  5GRR A;  4QAX A;  5C66 A;  4KAY A;  4ZGA A;  1O98 A;  2GSN A;  1E3C P;  3NKR A;  3T00 A;  1EJJ A;  1B8J A;  1ZED A;  2VQR A;  3TWZ A;  3KD8 A;  1AUK A;  2W5T A;  2IFY A;  5K4P A;  4KM4 A;  3B5Q A;  4LR2 A;  3ED4 A;  4LR7 A;  1AJD A;  4GTX A;  4MIV A;  2W5S A;  1E1Z P;  1EQJ A;  1ALK A;  1FSU A;  4UOR A;  1ALH A;  3M7V A;  3NVL A;  3TX0 A;  3WAX A;  5L0K A;  5L0B A;  1P49 A;  4KJD A;  5LIA A;  2GSO A;  1HQA A;  1ELZ A;  4UPH A;  3M8Z A;  3MK1 A;  4CYS A;  1O99 A;  4TN0 A;  1URB A;  4N7T A;  1Y7A A;  4LRC A;  2G9Y A;  3IGZ B;  3UNY A;  1E2S P;  3NKO A;  1ZEB A;  1Y6V A;  4GTY A;  1EW2 A;  5INH A;  5L0E A;  5HRT A;  4B56 A;  3WBH A;  1ELX A;  1EW9 A;  3UN5 A;  4GTW A;  2ZKT A;  3UN2 A;  5AJ9 A;  2GSU A;  4KJG A;  4CXK A;  1ED9 A;  1KHL A;  4LR8 A;  1ZEF A;  3LXQ A;  3T02 A;  5IJS A;  1KH5 A;  3Q3Q A;  3SZY A;  1E33 P;  1SHQ A;  5IJQ A;  1KHN A;  5EGE A;  1HJK A;  3DYC A;  4LRB A;  3OT9 A;  4UPK A;  1KH7 A;  3TG0 A;  3IGY B;  3NKQ A;  3BDF A;  1ALI A;  4NWX A;  1EW8 A;  1ANI A;  3BDH A;  1URA A;  2IUC B;  3NKN A;  1N2L A;  2ANH A;  5EGH A;  5DLW A;  2QZU A;  4ZG6 A;  1KHK A;  3BDG B;  3MK0 A;  4LR9 A;  5KXA A;  1KH9 A;  4FDJ A;  3UO0 A;  4CXU A;  5LRM A;  5GOV A;  2RH6 A;  3UN3 A;  2W5Q A;  3SZZ A;  2XR9 A;  4MHX A;  4UPL A;  3E2D A;  3CMR A;  5DLT A;  3T01 A;  1ANJ A;  4UPI A; 
#chains in the Genus database with same CATH topology
 4LK1 A;  3EQL A;  1TWG A;  1WOR A;  1VRQ C;  2O5J A;  4ZG7 A;  5M5X K;  1IS1 A;  1HDH A;  1K83 K;  3GIR A;  3JST A;  4QJV A;  2NVQ K;  4BY7 C;  4YG2 A;  2E2J C;  5C44 C;  1XXC A;  5C3E C;  1R9T A;  1IL2 A;  4ZH4 A;  4LRE A;  3S2D C;  4Y52 K;  2R93 C;  3IDD A;  4XSZ A;  3GTQ C;  4X6A K;  5C4X K;  4YFK A;  2JA7 C;  1ZVU A;  4A3J C;  1V5V A;  1VJE A;  4CYR A;  4Y52 C;  4ZG9 A;  1TWC C;  2CFA B;  4LRF A;  3GTJ A;  1Y1V K;  1VLO A;  1EFW A;  2FQT A;  3K7A C;  1O24 A;  2W8S A;  2GAG C;  4A3D K;  4A3F K;  1R9T C;  2R7Z K;  3PO3 C;  3NKR A;  1ZED A;  2VQR A;  2NVT K;  3TWZ A;  3KD8 A;  1AUK A;  5K4P A;  4AYB D;  3M4O K;  1EH1 A;  3B5Q A;  1SFO C;  4GTX A;  2R93 K;  4MIV A;  3PO2 C;  5M3M K;  3S2H C;  1E1Z P;  4PAB A;  4UOR A;  2V6U A;  1SFO K;  4A3C K;  1ALH A;  5L0B A;  3WOD A;  1USM A;  1P49 A;  4C3H C;  1XZP A;  4Q4Z A;  1YX2 A;  1EQR A;  4P5B A;  3OEP A;  3RZO C;  1IW7 A;  1YCL A;  3ORE A;  3M8Z A;  1F7V A;  3GTM A;  3MK1 A;  1O99 A;  4CYS A;  1INN A;  4XCH A;  3FKI C;  3HOV K;  1Y7A A;  1I50 K;  1I3Q K;  4AYB L;  2O5I A;  2G9Y A;  3IGZ B;  1WCM C;  5FLM K;  3UNY A;  5IYC C;  4B56 A;  2JA8 K;  4A3B K;  3UN5 A;  2RGR A;  1F9N A;  4KN7 A;  2GSU A;  4C3J C;  2E2H K;  4MEY A;  2ZKT A;  5AJ9 A;  1ED9 A;  4FM9 A;  4LR8 A;  3LXQ A;  3GTL A;  4AH6 A;  4C3J K;  4A3L C;  4GTD A;  3GTO K;  1KH5 A;  5IYC K;  4GT9 A;  4WJ3 M;  1I6H C;  3I4N K;  2Y0S L;  4KC6 A;  4KB4 A;  1VH2 A;  3HOV C;  1KHN A;  1K83 C;  1HJK A;  2R92 C;  3DYC A;  1KH7 A;  4BKW A;  1EW8 A;  1WQH A;  1WQG A;  4GTL A;  4KAR A;  4Q5S A;  1IBA A;  4GZY A;  1N2L A;  2PA8 L;  1XZQ B;  2JA7 K;  4A3M K;  2NVY K;  1DCO A;  4ZG6 A;  2XCQ A;  4LR9 A;  2JH3 A;  5FJ8 K;  2RH6 A;  3AQO A;  1ISE A;  2V6T A;  1L0W A;  3E2D A;  2GAH C;  3BUE A;  1ANJ A;  4UPI A;  3HOY C;  2X98 A;  5LQQ A;  4G0U A;  3A8I A;  1J6V A;  4C2M C;  1EK8 A;  3AQP A;  3H0G K;  1EI6 A;  2W5V A;  1UV7 A;  3FHZ A;  2WB1 L;  1I6H K;  2PA8 D;  2JA6 A;  4QIW L;  2B63 A;  2ZFZ A;  3S2H K;  2B63 K;  2JA5 C;  2XRG A;  3GTO C;  4QJV B;  4A3M C;  1KHJ A;  5IYD C;  3GEI A;  3H0G A;  1TWH C;  1WOS A;  2JA8 C;  4KMH A;  3AH5 A;  3AD7 C;  2JA5 K;  1F7U A;  3M3Y C;  3BDG A;  4A3F C;  4NOI A;  4LK0 A;  1ALJ A;  4A3I K;  4XLP A;  4MY4 A;  3NKM A;  1Y1V C;  2XCR B;  2D1G A;  1BS2 A;  3RZD C;  3WAY A;  3GTK C;  5IYB K;  2W5R A;  1BJT A;  5C66 A;  2NVY A;  2GSN A;  1E3C P;  3T00 A;  1EJJ A;  1B8J A;  3VA7 A;  4DDQ A;  4BY1 K;  3S1R C;  5IYD K;  3TFH A;  5IOS A;  1SMY A;  1VGX A;  2PMZ L;  4KM8 A;  2W5S A;  5IP7 K;  3GTG A;  1FSU A;  1B4B A;  5D4D A;  4A3K K;  1TWA C;  1Y1W K;  5L0K A;  3MML B;  4OIN A;  3LPX A;  4KJD A;  5LIA A;  2W7V A;  3S16 C;  4PAA A;  3S1Q K;  3GTL K;  1XZQ A;  4BBR C;  2E2H A;  3S15 C;  3S0X A;  1Y6V A;  4GTY A;  3PO2 K;  1EW2 A;  5HRT A;  4MQ9 A;  3TFI A;  2YU9 C;  1EW9 A;  1I3Q A;  4CXK A;  1I50 A;  5M5Y K;  3ERE D;  3M4O C;  3UN2 A;  1PJ7 A;  2CW0 A;  1ZEF A;  1Y1W A;  3GTG K;  3NUH A;  4LOW A;  3QX3 A;  4A3D C;  1E33 P;  1SHQ A;  1O2F B;  5IJQ A;  1DCH A;  2ZUE A;  4LRB A;  1SFO A;  1ZXO A;  3IGY B;  4NWX A;  2R93 A;  4A3L K;  3BDH A;  1DCP A;  2ANH A;  5EGH A;  1WQF A;  5DLW A;  4MEX A;  2PHC B;  4BBS K;  1KHK A;  3MK0 A;  2JA5 A;  2R7Z A;  5C3E K;  1YNN A;  2NVQ C;  2V6S A;  4RMF A;  3GTJ K;  3CMR A;  3GEE A;  2NVT C;  5DLT A;  1JVI A;  3G4A A;  4A3E K;  1BGW A;  1O27 A;  2BE5 A;  2A6H A;  2NVX C;  4LRA A;  1WOP A;  2JA6 K;  4BXX C;  4UOO A;  4LQY A;  2P8T A;  3MK2 A;  2IUC A;  1GE9 A;  3K7A K;  4KMA A;  3I4M C;  2WAQ L;  5C4J K;  3A52 A;  4A3C C;  3DXJ A;  4G7Z A;  1IQ0 A;  1KH4 A;  3HOX K;  5IP9 K;  4G7H A;  4LRD A;  2A6E A;  5TJ3 A;  1ED8 A;  1WSR A;  3GDZ A;  4P9S A;  1K83 A;  4G7O A;  3WAW A;  5LRN A;  5TMC A;  4UOP A;  5CJ9 A;  2W8D A;  5DLV A;  3S2D K;  2GLQ A;  3RZD K;  2W5W A;  1WCM K;  5FLM C;  4A3G C;  1N2K A;  4KDD A;  3CQZ K;  5C44 K;  3I4N C;  3I4M K;  2JA7 A;  1AJB A;  5IOQ A;  3M8Y A;  4A3G K;  3HXA A;  3LAJ A;  4JK1 A;  5GRR A;  3FOE A;  1TWF K;  3L4J A;  4QAX A;  4XSX A;  1J98 A;  3AD8 C;  3AD9 C;  4KAT A;  4GTF A;  2E2I K;  2W5T A;  2IFY A;  3LAP A;  4KAW X;  4LR2 A;  5JVO A;  3ED4 A;  4LR7 A;  4FZB A;  3GTQ K;  1AJD A;  5IP9 C;  1O29 A;  3HKZ L;  1EQJ A;  4G0V A;  1WSV A;  3GTO A;  4LLG A;  4BBS C;  4OIO A;  1PJ6 A;  3M7V A;  1PJ5 A;  1XZP B;  3HOW C;  3CAG A;  1G51 A;  2VUM C;  4KAS A;  2Y3P A;  3GTK A;  1ELZ A;  1IE0 A;  4A93 K;  3HOY K;  3PO3 K;  2YU9 A;  3G4C A;  1O26 A;  1USO A;  4TN0 A;  1J6W A;  4N7T A;  1HQM A;  5IOR A;  1YNJ A;  4Y7N C;  3GTM K;  3N3Y A;  1E2S P;  1ZEB A;  4C3I C;  4XLN A;  4C45 A;  5INH A;  5L0E A;  3WBH A;  3H3V D;  1WIH A;  2Y0S D;  1KHL A;  2A69 A;  4GTE A;  3T02 A;  4X6A C;  3S17 K;  1O2A A;  2NVX A;  3S14 C;  2R7Z C;  3Q3Q A;  5TMF A;  3SZY A;  1XXB A;  4BBR K;  5EGE A;  3FKI K;  3OT9 A;  3L4K A;  1KQ4 A;  1O2B A;  4BLB A;  2PPB A;  1TWC K;  5IOT A;  3BP8 C;  1TWH K;  3N0C A;  2IUC B;  3NKN A;  3S1N K;  4ILD A;  4QIW D;  2FQO A;  2VUM A;  1JQW A;  3GTP C;  4C3H K;  3HOW K;  3HOZ K;  5C4X C;  2QZU A;  1Y1V A;  4A3B C;  1TWA K;  4KB2 A;  4OIP A;  3BDG B;  1TWG C;  3UO0 A;  5IP7 C;  4FDJ A;  4CXU A;  4M1X A;  2NVY C;  3UN3 A;  1I50 C;  2KWA A;  5L46 A;  2E2J K;  2W5Q A;  4UPL A;  3HOZ C;  3H0G C;  3IPJ A;  4BXX K;  4KM9 A;  3RZO K;  2P5M A;  2XCO A;  3S16 K;  4NWJ A;  4A3E C;  1BDF A;  1AJC A;  1R9T K;  4YFN A;  5E68 A;  1DD5 A;  1K7H A;  1SHN A;  3NKP A;  3HOU K;  3GTP A;  4A3I C;  1Y1W C;  4GTZ A;  3BP3 A;  3DPC A;  1B4A A;  1TWG K;  4YFX A;  1O25 A;  3GTP K;  3M8W A;  2W5X A;  4KAV A;  2E2I C;  2GA3 A;  2EBB A;  4BY1 C;  3S1M C;  4FDI A;  1AJA A;  3ADA C;  1X31 C;  1O28 A;  3GEH A;  1J6X A;  4CXS A;  5IYB C;  4KMU A;  5HL8 A;  3V4G A;  1ELY A;  3WAV A;  4YR1 A;  4G0W A;  5C4J C;  4BY7 K;  3HOU C;  4WJ4 A;  3M3Y K;  4C2M K;  3GTG C;  4BLA A;  3FOF A;  4KAY A;  4ZGA A;  1O98 A;  2WB1 D;  1TWA A;  4O2D A;  3S14 K;  3TTG A;  4A3J K;  1WOO A;  2VUM K;  4KM4 A;  2E2H C;  3GSI A;  2R92 A;  1TWH A;  4GFQ A;  4A3K C;  4KN4 A;  1F93 A;  1JOE A;  4C3I K;  1TWC A;  1ALK A;  4Y7N K;  3GTM C;  1XPP A;  3NVL A;  3TX0 A;  3OPF A;  3WAX A;  1ZYR A;  3FKI A;  4LJZ A;  3A8K A;  5M3F K;  3S1R K;  4WIL A;  3GTL C;  2JA6 C;  2GSO A;  3S1N C;  1HQA A;  1I6V A;  4UPH A;  2NVX K;  1C0A A;  5JFE A;  5CHP A;  3GTJ C;  1URB A;  2PMZ D;  3CQZ C;  4LRC A;  3A8J A;  1AB4 A;  3NKO A;  1ZQ1 C;  1ZBS A;  1ELX A;  3S17 C;  4GTW A;  4KJG A;  3N0B A;  5IJS A;  2YU9 K;  1HI9 A;  1TWF C;  3GTK K;  1RU0 A;  3TFJ A;  4GTA A;  4OIQ A;  2R92 K;  1I3Q C;  4UPK A;  3H3V L;  4OIR A;  2ZUF A;  3TG0 A;  4GTB A;  3S1Q C;  3NKQ A;  3BDF A;  1ALI A;  4A93 C;  1ANI A;  1URA A;  4GTC A;  3GTQ A;  3S1M K;  2E2I A;  2WAQ D;  1XXA A;  2B63 C;  3HOX C;  4J3N A;  5KXA A;  5LRM A;  1KH9 A;  2CFA A;  1TWF A;  2D6F C;  3S15 K;  5M5W K;  3SZZ A;  2A68 A;  4KMD A;  2XR9 A;  4MHX A;  3CQZ A;  4P5A A;  1WCM A;  5GOV A;  3T01 A;  3HKZ D; 
#chains in the Genus database with same CATH homology
 1TWG A;  4ZG7 A;  1IS1 A;  1HDH A;  1XXC A;  1R9T A;  4LRE A;  3IDD A;  1ZVU A;  4CYR A;  4ZG9 A;  2CFA B;  4LRF A;  3GTJ A;  1O24 A;  2W8S A;  3NKR A;  1ZED A;  2VQR A;  3TWZ A;  3KD8 A;  1AUK A;  5K4P A;  3B5Q A;  1EH1 A;  4GTX A;  4MIV A;  1E1Z P;  4UOR A;  1ALH A;  5L0B A;  1P49 A;  4C3H C;  4P5B A;  3OEP A;  3ORE A;  3M8Z A;  3GTM A;  3MK1 A;  4CYS A;  1O99 A;  1Y7A A;  3UNY A;  2G9Y A;  3IGZ B;  4B56 A;  3UN5 A;  2RGR A;  1F9N A;  5AJ9 A;  4C3J C;  2GSU A;  2ZKT A;  1ED9 A;  4FM9 A;  4LR8 A;  3LXQ A;  3GTL A;  4GTD A;  1KH5 A;  4GT9 A;  4KC6 A;  4KB4 A;  1KHN A;  1HJK A;  3DYC A;  1KH7 A;  4BKW A;  1EW8 A;  1WQH A;  1WQG A;  4GTL A;  4KAR A;  1N2L A;  4ZG6 A;  2XCQ A;  4LR9 A;  2JH3 A;  2RH6 A;  3AQO A;  1ISE A;  3E2D A;  3BUE A;  1ANJ A;  4UPI A;  2X98 A;  5LQQ A;  4G0U A;  4C2M C;  1EK8 A;  3AQP A;  1EI6 A;  2W5V A;  3FHZ A;  2JA6 A;  2B63 A;  2ZFZ A;  2XRG A;  1KHJ A;  3H0G A;  4KMH A;  3AH5 A;  3BDG A;  1ALJ A;  4MY4 A;  3NKM A;  2XCR B;  2D1G A;  3WAY A;  2W5R A;  1BJT A;  5C66 A;  2NVY A;  2GSN A;  1E3C P;  3T00 A;  1EJJ A;  1B8J A;  3VA7 A;  4DDQ A;  5IOS A;  4KM8 A;  2W5S A;  3GTG A;  1FSU A;  1B4B A;  5L0K A;  3MML B;  3LPX A;  4KJD A;  5LIA A;  2E2H A;  3S0X A;  1Y6V A;  4GTY A;  1EW2 A;  5HRT A;  1EW9 A;  1I3Q A;  4CXK A;  1I50 A;  3ERE D;  3UN2 A;  1ZEF A;  1Y1W A;  3NUH A;  3QX3 A;  1E33 P;  1SHQ A;  5IJQ A;  4LRB A;  1SFO A;  1ZXO A;  3IGY B;  4NWX A;  2R93 A;  3BDH A;  2ANH A;  5EGH A;  1WQF A;  5DLW A;  2PHC B;  3MK0 A;  1KHK A;  2JA5 A;  2R7Z A;  3CMR A;  5DLT A;  3G4A A;  1BGW A;  1O27 A;  4LRA A;  4UOO A;  4LQY A;  3MK2 A;  2IUC A;  1GE9 A;  4KMA A;  3A52 A;  1KH4 A;  4LRD A;  5TJ3 A;  1ED8 A;  1K83 A;  3WAW A;  5LRN A;  4UOP A;  5CJ9 A;  2W8D A;  5DLV A;  2GLQ A;  2W5W A;  1N2K A;  4KDD A;  2JA7 A;  1AJB A;  5IOQ A;  3M8Y A;  3LAJ A;  5GRR A;  3FOE A;  3L4J A;  4QAX A;  4KAT A;  4GTF A;  2W5T A;  2IFY A;  3LAP A;  3ED4 A;  4KAW X;  4LR2 A;  5JVO A;  4LR7 A;  4FZB A;  1AJD A;  1O29 A;  1EQJ A;  4G0V A;  3GTO A;  3M7V A;  3CAG A;  4KAS A;  2Y3P A;  3GTK A;  1ELZ A;  2YU9 A;  3G4C A;  1O26 A;  4TN0 A;  4N7T A;  5IOR A;  3N3Y A;  1E2S P;  1ZEB A;  4C3I C;  5INH A;  5L0E A;  3WBH A;  1WIH A;  1KHL A;  4GTE A;  3T02 A;  1O2A A;  2NVX A;  3Q3Q A;  3SZY A;  1XXB A;  5EGE A;  3OT9 A;  3L4K A;  1KQ4 A;  1O2B A;  4BLB A;  5IOT A;  3N0C A;  2IUC B;  3NKN A;  4ILD A;  2VUM A;  2QZU A;  1Y1V A;  4KB2 A;  3BDG B;  3UO0 A;  4FDJ A;  4CXU A;  4M1X A;  3UN3 A;  2KWA A;  2W5Q A;  4UPL A;  4KM9 A;  2P5M A;  2XCO A;  4NWJ A;  1AJC A;  1DD5 A;  1K7H A;  1SHN A;  3NKP A;  3GTP A;  4GTZ A;  3DPC A;  1B4A A;  1O25 A;  3M8W A;  2W5X A;  4KAV A;  2GA3 A;  4FDI A;  1AJA A;  1O28 A;  4CXS A;  3V4G A;  3WAV A;  1ELY A;  4YR1 A;  4G0W A;  4BLA A;  3FOF A;  4KAY A;  4ZGA A;  1O98 A;  1TWA A;  4KM4 A;  2R92 A;  1TWH A;  4GFQ A;  1TWC A;  1ALK A;  3NVL A;  3TX0 A;  3OPF A;  3WAX A;  3FKI A;  2GSO A;  1HQA A;  4UPH A;  5JFE A;  5CHP A;  1URB A;  4LRC A;  1AB4 A;  3NKO A;  1ZBS A;  1ELX A;  4GTW A;  4KJG A;  3N0B A;  5IJS A;  4GTA A;  4UPK A;  3TG0 A;  4GTB A;  3NKQ A;  3BDF A;  1ALI A;  1ANI A;  1URA A;  4GTC A;  3GTQ A;  2E2I A;  1XXA A;  4J3N A;  5KXA A;  5LRM A;  1KH9 A;  2CFA A;  1TWF A;  3SZZ A;  4KMD A;  2XR9 A;  4MHX A;  3CQZ A;  4P5A A;  1WCM A;  5GOV A;  3T01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...