4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
b'LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
2GSOA 4UOPA 4ZG7A 1KH9A 5EGEA 3NKMA 1Y6VA 3UN2A 3NKQA 4ZG6A 1EW2A 1EW8A 2QZUA 3MK0A 5TJ3A 3UN3A 4MIVA 3WBHA 3BDFA 2G9YA 4KJGA 4B56A 1ALHA 4LREA 1ANJA 3BDGA 4KAYA 4LR7A 4KM4A 3A52A 1SHNA 2XRGA 1KHNA 1EI6A 1EW9A 1EQJA 4FDIA 3DYCA 3M8WA 1ED8A 2W8DA 3SZZA 1ALJA 3NKNA 4LRAA 1E1ZP 1KHKA 1URAA 3BDHA 3LXQA 5GRRA 3UNYA 3NKPA 4KJDA 1ZEFA 1AJAA 1E33P 3E2DA 1E2SP 4KAVA 5LIAA 3M8YA 3WAXA 5L0BA 5IJSA 3MK1A 4LR2A 1N2LA 4GTXA 5DLTA 5L0EA 4N7TA 1O99A 2IFYA 1HJKA 1P49A 2X98A 1KH5A 1AJCA 1Y7AA 3B5QA 3IDDA 4UPLA 5LRNA 1B8JA 1ALIA 3SZYA 4MHXA 4CXKA 2GSUA 4QAXA 3NKRA 4NWXA 3T01A 2RH6A 1EJJA 3UN5A 2W5RA 1O98A 4CYSA 3DPCA 4NWJA 3IGYB 3NKOA 4UPKA 4YR1A 2W5SA 1ALKA 2W8SA 2GA3A 1FSUA 4MY4A 3OT9A 1AUKA 1ZEBA 3IGZB 3MK2A 4UORA 2D1GA 3TG0A 4GTZA 2ZKTA 4CYRA 1ELZA 2ANHA 4LR8A 4ZG9A 1ELYA 5K4PA 1HDHA 1ELXA 3WAWA 3T00A 4LRFA 1ZEDA 4GTYA 2XR9A 5EGHA 4LQYA 5HRTA 3T02A 1KHJA 4LRCA 5L0KA 2W5QA 5AJ9A 4TN0A 4CXSA 4FDJA 2IUCB 3ED4A 3KD8A 1N2KA 4UOOA 1SHQA 3M8ZA 5KXAA 2W5XA 5GOVA 5IJQA 3UO0A 3WAYA 5LQQA 1HQAA 1K7HA 1ED9A 2GSNA 5DLWA 2VQRA 4ZGAA 1KH4A 2GLQA 3NVLA 1AJBA 3WAVA 1KH7A 5DLVA 3BDGB 3CMRA 2W5WA 1AJDA 1E3CP 1KHLA 2W5VA 5LRMA 1URBA 5INHA 4CXUA 1ANIA 3TWZA 4LR9A 3TX0A 4LRBA 5C66A 4UPHA 4UPIA 2W5TA 2IUCA 4GTWA 3Q3QA 4LRDA 3M7VA
chains in the Genus database with same CATH superfamily
1I3QA 1TWFC 4ZG7A 4OINA 3H0GC 2E2HC 1GE9A 1I6VA 4ZG6A 1EW8A 3EQLA 3K7AK 3WBHA 3BDFA 2WB1D 4PAAA 1BJTA 2Y0SL 2R7ZA 4KJGA 2V6SA 2GAHC 1Y1WK 1DCOA 1F93A 3FKIA 4XCHA 1Y1VC 4FM9A 3GTGC 1SHNA 4Y52K 4A3DC 5CJ9A 3DYCA 3G4CA 4BBSK 3GTGA 1WOPA 2A68A 3QX3A 1VH2A 2XCQA 1KHKA 4BY1C 4NOIA 4GTFA 4G0WA 3UNYA 4KM8A 1I50C 3E2DA 1VLOA 1X31C 4KAVA 5LIAA 5IYCK 3PO2C 3M8YA 3GTPK 3MK1A 1N2LA 5JVOA 3FOEA 2WAQD 1SFOC 1KH5A 1Y7AA 1SMYA 4GTEA 2ZUEA 3IDDA 4GZYA 5M3MK 4CXKA 4A3MK 4BBRC 4NWXA 2PA8L 3GTOK 3RZOC 4A93C 1O98A 3I4NK 4NWJA 5FLMK 3CQZA 4UPKA 4A3LC 3L4KA 3M4OC 4MY4A 3TFHA 1ZQ1C 5IOQA 1HQMA 3IGZB 3GTKK 3HOWC 3TFJA 1EQRA 3HOXK 4GTDA 2D1GA 2E2IC 2CFAA 3I4MC 2JA5C 1B4AA 1WQFA 1I6HK 1TWCC 2B63A 1IS1A 4GTLA 3T00A 3S1RK 3S1NK 2YU9K 3S1QC 2CW0A 2VUMC 2XR9A 1ISEA 3T02A 5L0KA 2PMZD 2P5MA 2A6EA 2NVYC 1VGXA 3HXAA 2VUMA 3GTPA 4X6AK 3AH5A 3VA7A 1HQAA 2PHCB 3GEEA 1ED9A 2GSNA 3A8IA 4ILDA 2GAGC 1I3QK 3NUHA 4G0UA 4A3IK 3NVLA 1AJBA 1J6VA 1TWAK 1EK8A 4A3KK 3CMRA 3OPFA 2Y3PA 1PJ6A 2W5VA 2A69A 1URBA 4PABA 1ANIA 3GTOA 4LRBA 1UV7A 2E2HK 5C66A 3V4GA 4G0VA 4C3IC 4GTWA 4XLNA 4UOPA 3GTKA 1KH9A 4QJVA 2NVXC 3S1MC 1O28A 2ZUFA 5M3FK 1Y6VA 3NKQA 4KAWX 1Y1VK 1J6XA 4GT9A 3GTGK 3MK0A 1WSRA 2JA6A 5IYBK 1ZYRA 4KMAA 1USOA 4XSZA 3WODA 2YU9A 4A3DK 5M5YK 2P8TA 4KM4A 4GTAA 3S17C 2XRGA 4BY1K 1EW9A 1WOOA 4FDIA 1BS2A 5IYDC 1TWGC 4JK1A 3GTJC 2JH3A 5C4XC 1ALJA 3PO2K 3NKNA 1WIHA 4LRAA 1ZBSA 3S16C 5GRRA 4LK0A 3NKPA 4KJDA 4AYBL 5C4JC 1TWAA 4OIPA 1O25A 5TMCA 4Q5SA 2JA7C 1SFOK 3N0CA 4KC6A 1TWFA 4KB4A 4MQ9A 5TMFA 3H0GA 5L0BA 4G7HA 2E2HA 4LR2A 5DLTA 5L0EA 2XCRB 3CQZK 2IFYA 3PO3K 4BBRK 3HKZD 1P49A 2X98A 4OIRA 3RZOK 4A93K 2KWAA 4A3EC 4A3LK 3M4OK 4A3FK 1Y1VA 3T01A 3L4JA 2B63K 3HOWK 1EJJA 3GEHA 4A3BC 5C44C 4FZBA 4C3HC 5IP9C 3N0BA 2E2IK 1HI9A 1PJ7A 3GEIA 2R92C 2JA5K 1INNA 2W5SA 4YR1A 2W8SA 2GA3A 1FSUA 2RGRA 1TWCK 4KARA 2WB1L 2R93C 1USMA 3S1QK 1R9TC 2VUMK 5CHPA 1ZXOA 4A3GC 2ZKTA 4LR8A 3AD8C 1I50A 1HDHA 1IE0A 3S2HC 1O2AA 4GTYA 5EGHA 4LQYA 3BUEA 1XXBA 3HOVC 4CXSA 4TN0A 1SFOA 1TWHC 4FDJA 3S0XA 1WSVA 3KD8A 4UOOA 3HOZK 2NVQC 4G7OA 3M8ZA 5IJQA 4BXXC 3HOYC 2BE5A 5DLWA 2VQRA 1XXCA 4KN7A 4Y7NC 4ZGAA 1XZPA 2GLQA 1KH7A 1XZPB 5DLVA 3BDGB 1RU0A 3K7AC 2WAQL 1AJDA 1E3CP 3GSIA 2JA6K 1XPPA 4LR9A 3TX0A 1Y1WC 3S1MK 2E2IA 2JA5A 1YCLA 4O2DA 4A3JC 1TWCA 3H3VD 4Y52C 5IP7C 5EGEA 3NKMA 3UN2A 4A3CC 5M5WK 4G7ZA 2NVYA 3S17K 4BY7C 4MIVA 2NVTC 5FJ8K 2G9YA 5C3EK 2PPBA 4B56A 4LREA 5IOTA 4BLAA 5IYDK 1ANJA 4KAYA 1IW7A 5C4XK 4AH6A 3A52A 3GTLC 1TWFK 3S16K 3H0GK 4GTBA 1G51A 5C4JK 1EQJA 2PMZL 2JA7K 3M8WA 1K83C 1ED8A 3SZZA 2XCOA 1E1ZP 3BDHA 5LRMA 4KMUA 1YNJA 1F9NA 3G4AA 4BKWA 4C3JC 5L46A 4P9SA 4KM9A 4A3EK 2NVXA 5IJSA 2V6UA 3AD9C 5IORA 4GTXA 4KN4A 4BLBA 3S14C 3TTGA 4N7TA 1O99A 1HJKA 1AJCA 1WQHA 3B5QA 3HOXC 5E68A 4A3BK 4UPLA 5LRNA 5IP9K 4QIWD 3ADAC 1WCMC 1ALIA 4MHXA 1I50K 1I6HC 2GSUA 4QAXA 3NKRA 3AQOA 2R93K 1V5VA 1R9TK 3S1NC 3S2DC 3GTQC 4A3GK 2W5RA 4CYSA 3DPCA 1TWGA 3GTJA 4OIQA 2O5JA 4MEXA 4LLGA 3RZDC 1AUKA 3DXJA 3OT9A 3GTMC 2Y0SD 3GTQA 3S2HK 4LOWA 3TG0A 4CYRA 2ANHA 3HOVK 4ZG9A 2E2JC 1ELYA 2JA7A 1KQ4A 1O2BA 1DCHA 4DDQA 1I3QC 1J98A 3CAGA 2NVQK 4P5BA 1ZEDA 3M3YC 2W7VA 4C2MC 4BXXK 1KHJA 4LRCA 5AJ9A 4Q4ZA 1ZVUA 2IUCB 3LAJA 3ED4A 4Y7NK 5JFEA 2R7ZC 1SHQA 4LK1A 5D4DA 2W5XA 5GOVA 3BP8C 3FKIC 3UO0A 3I4MK 5LQQA 1K7HA 1O27A 3BP3A 1YX2A 1EH1A 3IPJA 1KH4A 4WJ3M 2A6HA 3A8JA 1VJEA 2R92A 2EBBA 1KHLA 4P5AA 5IYBC 3HKZL 4A3JK 3S15C 4OIOA 2NVYK 1AB4A 5IP7K 2R93A 4CXUA 2JA8C 1R9TA 4KASA 4UPHA 1JOEA 3HOUC 4A3CK 3AD7C 4MEYA 3Q3QA 4BY7K 3M7VA 4XSXA 1WORA 2NVTK 2GSOA 4LRDA 2PA8D 1YNNA 4KMDA 2ZFZA 4GTCA 3GDZA 1O29A 4WJ4A 1WOSA 1EW2A 2QZUA 5TJ3A 1TWHA 3UN3A 3GTLK 1BGWA 1ALHA 3OEPA 3BDGA 1BDFA 4LR7A 4WILA 1K83K 4C3IK 1J6WA 1KHNA 1EI6A 3A8KA 1B4BA 2NVXK 3CQZC 4YFNA 4C3JK 3PO3C 3OREA 2W8DA 3JSTA 4YG2A 1URAA 1IQ0A 3LXQA 1Y1WA 1ZEFA 2V6TA 1DCPA 4A3FC 3S14K 2FQOA 4M1XA 1AJAA 1E33P 4BBSC 1E2SP 2B63C 2O5IA 3WAXA 1IBAA 1VRQC 1WCMK 5IOSA 1TWGK 1IL2A 2CFAB 3GTJK 5IYCC 3S2DK 4J3NA 1C0AA 3GTQK 3LPXA 3TFIA 3GTPC 1B8JA 1O26A 4KMHA 2FQTA 3SZYA 4KB2A 1PJ5A 4ZH4A 3RZDK 1O2FB 1F7UA 3GTLA 3H3VL 3GTMK 2RH6A 3UN5A 1JVIA 5HL8A 3IGYB 3NKOA 2E2JK 1ALKA 1K83A 4A3MC 3HOZC 1ZEBA 3MK2A 3GTOC 4UORA 4LJZA 3M3YK 4C2MK 3I4NC 4GTZA 5FLMC 1ELZA 5K4PA 1ELXA 3WAWA 2R7ZK 3GTKC 4LRFA 4YFXA 3FKIK 5C44K 4XLPA 3GIRA 5HRTA 4C3HK 2R92K 2W5QA 1O24A 1F7VA 2D6FC 1L0WA 2JA6C 1N2KA 3S1RC 2YU9C 5KXAA 4AYBD 4QJVB 1WCMA 4YFKA 3WAYA 4GFQA 3S15K 2JA8K 1DD5A 3FOFA 4KDDA 3HOUK 3WAVA 4X6AC 3FHZA 1XZQA 4C45A 3MMLB 2W5WA 3AQPA 1EFWA 5M5XK 1JQWA 1TWHK 1XZQB 5INHA 4KATA 3GTMA 5C3EC 1WQGA 4RMFA 3TWZA 4A3IC 3ERED 4QIWL 1XXAA 3N3YA 4UPIA 1TWAC 3LAPA 2IUCA 2W5TA 4A3KC 3HOYK
chains in the Genus database with same CATH topology
1I3QA 4ZG7A 1GE9A 4ZG6A 1EW8A 3WBHA 3BDFA 1BJTA 2R7ZA 4KJGA 3FKIA 4FM9A 1SHNA 5CJ9A 3DYCA 3G4CA 3GTGA 3QX3A 2XCQA 1KHKA 4GTFA 4G0WA 3UNYA 4KM8A 3E2DA 4KAVA 5LIAA 3M8YA 3MK1A 1N2LA 5JVOA 3FOEA 1KH5A 1Y7AA 3IDDA 4GTEA 4CXKA 4NWXA 1O98A 4NWJA 3CQZA 4UPKA 3L4KA 4MY4A 5IOQA 3IGZB 2D1GA 4GTDA 2CFAA 1B4AA 1WQFA 2B63A 1IS1A 4GTLA 3T00A 2XR9A 1ISEA 3T02A 5L0KA 2P5MA 2VUMA 3GTPA 3AH5A 3VA7A 1HQAA 2PHCB 1ED9A 2GSNA 4ILDA 3NUHA 4G0UA 3NVLA 1AJBA 1EK8A 3CMRA 2Y3PA 3OPFA 2W5VA 1URBA 1ANIA 3GTOA 4LRBA 5C66A 3V4GA 4G0VA 4C3IC 4GTWA 4UOPA 3GTKA 1KH9A 1O28A 1Y6VA 3NKQA 4KAWX 4GT9A 3MK0A 2JA6A 4KMAA 2YU9A 4KM4A 4GTAA 2XRGA 1EW9A 4FDIA 2JH3A 1ALJA 3NKNA 1WIHA 4LRAA 1ZBSA 5GRRA 3NKPA 4KJDA 1TWAA 1O25A 3N0CA 4KC6A 1TWFA 4KB4A 3H0GA 5L0BA 2E2HA 4LR2A 5DLTA 5L0EA 2XCRB 2IFYA 1P49A 2X98A 2KWAA 1Y1VA 3L4JA 3T01A 1EJJA 4FZBA 4C3HC 3N0BA 4YR1A 2W5SA 2W8SA 2GA3A 1FSUA 2RGRA 4KARA 5CHPA 1ZXOA 2ZKTA 4LR8A 1I50A 1HDHA 1O2AA 4GTYA 5EGHA 4LQYA 3BUEA 1XXBA 4CXSA 4TN0A 1SFOA 4FDJA 3S0XA 3KD8A 4UOOA 3M8ZA 5IJQA 5DLWA 2VQRA 1XXCA 4ZGAA 2GLQA 1KH7A 5DLVA 3BDGB 1AJDA 1E3CP 4LR9A 3TX0A 2E2IA 2JA5A 1TWCA 5EGEA 3NKMA 3UN2A 2NVYA 4MIVA 2G9YA 4B56A 4LREA 5IOTA 4BLAA 1ANJA 4KAYA 3A52A 1EQJA 4GTBA 3M8WA 1ED8A 3SZZA 2XCOA 1E1ZP 3BDHA 1F9NA 3G4AA 4BKWA 4C3JC 4KM9A 2NVXA 5IJSA 5IORA 4GTXA 4BLBA 4N7TA 1O99A 1HJKA 1AJCA 1WQHA 3B5QA 4UPLA 5LRNA 1ALIA 4MHXA 2GSUA 4QAXA 3NKRA 3AQOA 2W5RA 4CYSA 3DPCA 1TWGA 3GTJA 3OT9A 1AUKA 3GTQA 3TG0A 4CYRA 2ANHA 4ZG9A 1ELYA 2JA7A 1KQ4A 1O2BA 4DDQA 3CAGA 4P5BA 1ZEDA 4C2MC 1KHJA 4LRCA 5AJ9A 1ZVUA 2IUCB 3LAJA 3ED4A 5JFEA 1SHQA 2W5XA 5GOVA 3UO0A 5LQQA 1K7HA 1O27A 1EH1A 1KH4A 2R92A 1KHLA 4P5AA 5LRMA 1AB4A 2R93A 4CXUA 1R9TA 4KASA 4UPHA 3Q3QA 4LRDA 3M7VA 2GSOA 4KMDA 2ZFZA 4GTCA 1O29A 1EW2A 2QZUA 5TJ3A 1TWHA 3UN3A 1BGWA 1ALHA 3OEPA 3BDGA 4LR7A 1KHNA 1EI6A 1B4BA 3OREA 2W8DA 1URAA 3LXQA 1Y1WA 1ZEFA 1AJAA 4M1XA 1E33P 1E2SP 3WAXA 5IOSA 2CFAB 4J3NA 3LPXA 1B8JA 1O26A 4KMHA 3SZYA 4KB2A 3GTLA 2RH6A 3UN5A 3IGYB 3NKOA 1ALKA 1K83A 1ZEBA 3MK2A 4UORA 4GTZA 1ELZA 5K4PA 1ELXA 3WAWA 4LRFA 5HRTA 2W5QA 1O24A 1N2KA 5KXAA 1WCMA 3WAYA 4GFQA 1DD5A 3FOFA 4KDDA 3WAVA 3FHZA 3MMLB 2W5WA 3AQPA 5INHA 4KATA 3GTMA 1WQGA 3TWZA 3ERED 1XXAA 3N3YA 4UPIA 3LAPA 2IUCA 2W5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSO A;  4UOP A;  4ZG7 A;  1KH9 A;  5EGE A;  3NKM A;  1Y6V A;  3UN2 A;  3NKQ A;  4ZG6 A;  1EW2 A;  1EW8 A;  2QZU A;  3MK0 A;  5TJ3 A;  3UN3 A;  4MIV A;  3WBH A;  3BDF A;  2G9Y A;  4KJG A;  4B56 A;  1ALH A;  4LRE A;  1ANJ A;  3BDG A;  4KAY A;  4LR7 A;  4KM4 A;  3A52 A;  1SHN A;  2XRG A;  1KHN A;  1EI6 A;  1EW9 A;  1EQJ A;  4FDI A;  3DYC A;  3M8W A;  1ED8 A;  2W8D A;  3SZZ A;  1ALJ A;  3NKN A;  4LRA A;  1E1Z P;  1KHK A;  1URA A;  3BDH A;  3LXQ A;  5GRR A;  3UNY A;  3NKP A;  4KJD A;  1ZEF A;  1AJA A;  1E33 P;  3E2D A;  1E2S P;  4KAV A;  5LIA A;  3M8Y A;  3WAX A;  5L0B A;  5IJS A;  3MK1 A;  4LR2 A;  1N2L A;  4GTX A;  5DLT A;  5L0E A;  4N7T A;  1O99 A;  2IFY A;  1HJK A;  1P49 A;  2X98 A;  1KH5 A;  1AJC A;  1Y7A A;  3B5Q A;  3IDD A;  4UPL A;  5LRN A;  1B8J A;  1ALI A;  3SZY A;  4MHX A;  4CXK A;  2GSU A;  4QAX A;  3NKR A;  4NWX A;  3T01 A;  2RH6 A;  1EJJ A;  3UN5 A;  2W5R A;  1O98 A;  4CYS A;  3DPC A;  4NWJ A;  3IGY B;  3NKO A;  4UPK A;  4YR1 A;  2W5S A;  1ALK A;  2W8S A;  2GA3 A;  1FSU A;  4MY4 A;  3OT9 A;  1AUK A;  1ZEB A;  3IGZ B;  3MK2 A;  4UOR A;  2D1G A;  3TG0 A;  4GTZ A;  2ZKT A;  4CYR A;  1ELZ A;  2ANH A;  4LR8 A;  4ZG9 A;  1ELY A;  5K4P A;  1HDH A;  1ELX A;  3WAW A;  3T00 A;  4LRF A;  1ZED A;  4GTY A;  2XR9 A;  5EGH A;  4LQY A;  5HRT A;  3T02 A;  1KHJ A;  4LRC A;  5L0K A;  2W5Q A;  5AJ9 A;  4TN0 A;  4CXS A;  4FDJ A;  2IUC B;  3ED4 A;  3KD8 A;  1N2K A;  4UOO A;  1SHQ A;  3M8Z A;  5KXA A;  2W5X A;  5GOV A;  5IJQ A;  3UO0 A;  3WAY A;  5LQQ A;  1HQA A;  1K7H A;  1ED9 A;  2GSN A;  5DLW A;  2VQR A;  4ZGA A;  1KH4 A;  2GLQ A;  3NVL A;  1AJB A;  3WAV A;  1KH7 A;  5DLV A;  3BDG B;  3CMR A;  2W5W A;  1AJD A;  1E3C P;  1KHL A;  2W5V A;  5LRM A;  1URB A;  5INH A;  4CXU A;  1ANI A;  3TWZ A;  4LR9 A;  3TX0 A;  4LRB A;  5C66 A;  4UPH A;  4UPI A;  2W5T A;  2IUC A;  4GTW A;  3Q3Q A;  4LRD A;  3M7V A; 
#chains in the Genus database with same CATH topology
 1I3Q A;  1TWF C;  4ZG7 A;  4OIN A;  3H0G C;  2E2H C;  1GE9 A;  1I6V A;  4ZG6 A;  1EW8 A;  3EQL A;  3K7A K;  3WBH A;  3BDF A;  2WB1 D;  4PAA A;  1BJT A;  2Y0S L;  2R7Z A;  4KJG A;  2V6S A;  2GAH C;  1Y1W K;  1DCO A;  1F93 A;  3FKI A;  4XCH A;  1Y1V C;  4FM9 A;  3GTG C;  1SHN A;  4Y52 K;  4A3D C;  5CJ9 A;  3DYC A;  3G4C A;  4BBS K;  3GTG A;  1WOP A;  2A68 A;  3QX3 A;  1VH2 A;  2XCQ A;  1KHK A;  4BY1 C;  4NOI A;  4GTF A;  4G0W A;  3UNY A;  4KM8 A;  1I50 C;  3E2D A;  1VLO A;  1X31 C;  4KAV A;  5LIA A;  5IYC K;  3PO2 C;  3M8Y A;  3GTP K;  3MK1 A;  1N2L A;  5JVO A;  3FOE A;  2WAQ D;  1SFO C;  1KH5 A;  1Y7A A;  1SMY A;  4GTE A;  2ZUE A;  3IDD A;  4GZY A;  5M3M K;  4CXK A;  4A3M K;  4BBR C;  4NWX A;  2PA8 L;  3GTO K;  3RZO C;  4A93 C;  1O98 A;  3I4N K;  4NWJ A;  5FLM K;  3CQZ A;  4UPK A;  4A3L C;  3L4K A;  3M4O C;  4MY4 A;  3TFH A;  1ZQ1 C;  5IOQ A;  1HQM A;  3IGZ B;  3GTK K;  3HOW C;  3TFJ A;  1EQR A;  3HOX K;  4GTD A;  2D1G A;  2E2I C;  2CFA A;  3I4M C;  2JA5 C;  1B4A A;  1WQF A;  1I6H K;  1TWC C;  2B63 A;  1IS1 A;  4GTL A;  3T00 A;  3S1R K;  3S1N K;  2YU9 K;  3S1Q C;  2CW0 A;  2VUM C;  2XR9 A;  1ISE A;  3T02 A;  5L0K A;  2PMZ D;  2P5M A;  2A6E A;  2NVY C;  1VGX A;  3HXA A;  2VUM A;  3GTP A;  4X6A K;  3AH5 A;  3VA7 A;  1HQA A;  2PHC B;  3GEE A;  1ED9 A;  2GSN A;  3A8I A;  4ILD A;  2GAG C;  1I3Q K;  3NUH A;  4G0U A;  4A3I K;  3NVL A;  1AJB A;  1J6V A;  1TWA K;  1EK8 A;  4A3K K;  3CMR A;  3OPF A;  2Y3P A;  1PJ6 A;  2W5V A;  2A69 A;  1URB A;  4PAB A;  1ANI A;  3GTO A;  4LRB A;  1UV7 A;  2E2H K;  5C66 A;  3V4G A;  4G0V A;  4C3I C;  4GTW A;  4XLN A;  4UOP A;  3GTK A;  1KH9 A;  4QJV A;  2NVX C;  3S1M C;  1O28 A;  2ZUF A;  5M3F K;  1Y6V A;  3NKQ A;  4KAW X;  1Y1V K;  1J6X A;  4GT9 A;  3GTG K;  3MK0 A;  1WSR A;  2JA6 A;  5IYB K;  1ZYR A;  4KMA A;  1USO A;  4XSZ A;  3WOD A;  2YU9 A;  4A3D K;  5M5Y K;  2P8T A;  4KM4 A;  4GTA A;  3S17 C;  2XRG A;  4BY1 K;  1EW9 A;  1WOO A;  4FDI A;  1BS2 A;  5IYD C;  1TWG C;  4JK1 A;  3GTJ C;  2JH3 A;  5C4X C;  1ALJ A;  3PO2 K;  3NKN A;  1WIH A;  4LRA A;  1ZBS A;  3S16 C;  5GRR A;  4LK0 A;  3NKP A;  4KJD A;  4AYB L;  5C4J C;  1TWA A;  4OIP A;  1O25 A;  5TMC A;  4Q5S A;  2JA7 C;  1SFO K;  3N0C A;  4KC6 A;  1TWF A;  4KB4 A;  4MQ9 A;  5TMF A;  3H0G A;  5L0B A;  4G7H A;  2E2H A;  4LR2 A;  5DLT A;  5L0E A;  2XCR B;  3CQZ K;  2IFY A;  3PO3 K;  4BBR K;  3HKZ D;  1P49 A;  2X98 A;  4OIR A;  3RZO K;  4A93 K;  2KWA A;  4A3E C;  4A3L K;  3M4O K;  4A3F K;  1Y1V A;  3T01 A;  3L4J A;  2B63 K;  3HOW K;  1EJJ A;  3GEH A;  4A3B C;  5C44 C;  4FZB A;  4C3H C;  5IP9 C;  3N0B A;  2E2I K;  1HI9 A;  1PJ7 A;  3GEI A;  2R92 C;  2JA5 K;  1INN A;  2W5S A;  4YR1 A;  2W8S A;  2GA3 A;  1FSU A;  2RGR A;  1TWC K;  4KAR A;  2WB1 L;  2R93 C;  1USM A;  3S1Q K;  1R9T C;  2VUM K;  5CHP A;  1ZXO A;  4A3G C;  2ZKT A;  4LR8 A;  3AD8 C;  1I50 A;  1HDH A;  1IE0 A;  3S2H C;  1O2A A;  4GTY A;  5EGH A;  4LQY A;  3BUE A;  1XXB A;  3HOV C;  4CXS A;  4TN0 A;  1SFO A;  1TWH C;  4FDJ A;  3S0X A;  1WSV A;  3KD8 A;  4UOO A;  3HOZ K;  2NVQ C;  4G7O A;  3M8Z A;  5IJQ A;  4BXX C;  3HOY C;  2BE5 A;  5DLW A;  2VQR A;  1XXC A;  4KN7 A;  4Y7N C;  4ZGA A;  1XZP A;  2GLQ A;  1KH7 A;  1XZP B;  5DLV A;  3BDG B;  1RU0 A;  3K7A C;  2WAQ L;  1AJD A;  1E3C P;  3GSI A;  2JA6 K;  1XPP A;  4LR9 A;  3TX0 A;  1Y1W C;  3S1M K;  2E2I A;  2JA5 A;  1YCL A;  4O2D A;  4A3J C;  1TWC A;  3H3V D;  4Y52 C;  5IP7 C;  5EGE A;  3NKM A;  3UN2 A;  4A3C C;  5M5W K;  4G7Z A;  2NVY A;  3S17 K;  4BY7 C;  4MIV A;  2NVT C;  5FJ8 K;  2G9Y A;  5C3E K;  2PPB A;  4B56 A;  4LRE A;  5IOT A;  4BLA A;  5IYD K;  1ANJ A;  4KAY A;  1IW7 A;  5C4X K;  4AH6 A;  3A52 A;  3GTL C;  1TWF K;  3S16 K;  3H0G K;  4GTB A;  1G51 A;  5C4J K;  1EQJ A;  2PMZ L;  2JA7 K;  3M8W A;  1K83 C;  1ED8 A;  3SZZ A;  2XCO A;  1E1Z P;  3BDH A;  5LRM A;  4KMU A;  1YNJ A;  1F9N A;  3G4A A;  4BKW A;  4C3J C;  5L46 A;  4P9S A;  4KM9 A;  4A3E K;  2NVX A;  5IJS A;  2V6U A;  3AD9 C;  5IOR A;  4GTX A;  4KN4 A;  4BLB A;  3S14 C;  3TTG A;  4N7T A;  1O99 A;  1HJK A;  1AJC A;  1WQH A;  3B5Q A;  3HOX C;  5E68 A;  4A3B K;  4UPL A;  5LRN A;  5IP9 K;  4QIW D;  3ADA C;  1WCM C;  1ALI A;  4MHX A;  1I50 K;  1I6H C;  2GSU A;  4QAX A;  3NKR A;  3AQO A;  2R93 K;  1V5V A;  1R9T K;  3S1N C;  3S2D C;  3GTQ C;  4A3G K;  2W5R A;  4CYS A;  3DPC A;  1TWG A;  3GTJ A;  4OIQ A;  2O5J A;  4MEX A;  4LLG A;  3RZD C;  1AUK A;  3DXJ A;  3OT9 A;  3GTM C;  2Y0S D;  3GTQ A;  3S2H K;  4LOW A;  3TG0 A;  4CYR A;  2ANH A;  3HOV K;  4ZG9 A;  2E2J C;  1ELY A;  2JA7 A;  1KQ4 A;  1O2B A;  1DCH A;  4DDQ A;  1I3Q C;  1J98 A;  3CAG A;  2NVQ K;  4P5B A;  1ZED A;  3M3Y C;  2W7V A;  4C2M C;  4BXX K;  1KHJ A;  4LRC A;  5AJ9 A;  4Q4Z A;  1ZVU A;  2IUC B;  3LAJ A;  3ED4 A;  4Y7N K;  5JFE A;  2R7Z C;  1SHQ A;  4LK1 A;  5D4D A;  2W5X A;  5GOV A;  3BP8 C;  3FKI C;  3UO0 A;  3I4M K;  5LQQ A;  1K7H A;  1O27 A;  3BP3 A;  1YX2 A;  1EH1 A;  3IPJ A;  1KH4 A;  4WJ3 M;  2A6H A;  3A8J A;  1VJE A;  2R92 A;  2EBB A;  1KHL A;  4P5A A;  5IYB C;  3HKZ L;  4A3J K;  3S15 C;  4OIO A;  2NVY K;  1AB4 A;  5IP7 K;  2R93 A;  4CXU A;  2JA8 C;  1R9T A;  4KAS A;  4UPH A;  1JOE A;  3HOU C;  4A3C K;  3AD7 C;  4MEY A;  3Q3Q A;  4BY7 K;  3M7V A;  4XSX A;  1WOR A;  2NVT K;  2GSO A;  4LRD A;  2PA8 D;  1YNN A;  4KMD A;  2ZFZ A;  4GTC A;  3GDZ A;  1O29 A;  4WJ4 A;  1WOS A;  1EW2 A;  2QZU A;  5TJ3 A;  1TWH A;  3UN3 A;  3GTL K;  1BGW A;  1ALH A;  3OEP A;  3BDG A;  1BDF A;  4LR7 A;  4WIL A;  1K83 K;  4C3I K;  1J6W A;  1KHN A;  1EI6 A;  3A8K A;  1B4B A;  2NVX K;  3CQZ C;  4YFN A;  4C3J K;  3PO3 C;  3ORE A;  2W8D A;  3JST A;  4YG2 A;  1URA A;  1IQ0 A;  3LXQ A;  1Y1W A;  1ZEF A;  2V6T A;  1DCP A;  4A3F C;  3S14 K;  2FQO A;  4M1X A;  1AJA A;  1E33 P;  4BBS C;  1E2S P;  2B63 C;  2O5I A;  3WAX A;  1IBA A;  1VRQ C;  1WCM K;  5IOS A;  1TWG K;  1IL2 A;  2CFA B;  3GTJ K;  5IYC C;  3S2D K;  4J3N A;  1C0A A;  3GTQ K;  3LPX A;  3TFI A;  3GTP C;  1B8J A;  1O26 A;  4KMH A;  2FQT A;  3SZY A;  4KB2 A;  1PJ5 A;  4ZH4 A;  3RZD K;  1O2F B;  1F7U A;  3GTL A;  3H3V L;  3GTM K;  2RH6 A;  3UN5 A;  1JVI A;  5HL8 A;  3IGY B;  3NKO A;  2E2J K;  1ALK A;  1K83 A;  4A3M C;  3HOZ C;  1ZEB A;  3MK2 A;  3GTO C;  4UOR A;  4LJZ A;  3M3Y K;  4C2M K;  3I4N C;  4GTZ A;  5FLM C;  1ELZ A;  5K4P A;  1ELX A;  3WAW A;  2R7Z K;  3GTK C;  4LRF A;  4YFX A;  3FKI K;  5C44 K;  4XLP A;  3GIR A;  5HRT A;  4C3H K;  2R92 K;  2W5Q A;  1O24 A;  1F7V A;  2D6F C;  1L0W A;  2JA6 C;  1N2K A;  3S1R C;  2YU9 C;  5KXA A;  4AYB D;  4QJV B;  1WCM A;  4YFK A;  3WAY A;  4GFQ A;  3S15 K;  2JA8 K;  1DD5 A;  3FOF A;  4KDD A;  3HOU K;  3WAV A;  4X6A C;  3FHZ A;  1XZQ A;  4C45 A;  3MML B;  2W5W A;  3AQP A;  1EFW A;  5M5X K;  1JQW A;  1TWH K;  1XZQ B;  5INH A;  4KAT A;  3GTM A;  5C3E C;  1WQG A;  4RMF A;  3TWZ A;  4A3I C;  3ERE D;  4QIW L;  1XXA A;  3N3Y A;  4UPI A;  1TWA C;  3LAP A;  2IUC A;  2W5T A;  4A3K C;  3HOY K; 
#chains in the Genus database with same CATH homology
 1I3Q A;  4ZG7 A;  1GE9 A;  4ZG6 A;  1EW8 A;  3WBH A;  3BDF A;  1BJT A;  2R7Z A;  4KJG A;  3FKI A;  4FM9 A;  1SHN A;  5CJ9 A;  3DYC A;  3G4C A;  3GTG A;  3QX3 A;  2XCQ A;  1KHK A;  4GTF A;  4G0W A;  3UNY A;  4KM8 A;  3E2D A;  4KAV A;  5LIA A;  3M8Y A;  3MK1 A;  1N2L A;  5JVO A;  3FOE A;  1KH5 A;  1Y7A A;  3IDD A;  4GTE A;  4CXK A;  4NWX A;  1O98 A;  4NWJ A;  3CQZ A;  4UPK A;  3L4K A;  4MY4 A;  5IOQ A;  3IGZ B;  2D1G A;  4GTD A;  2CFA A;  1B4A A;  1WQF A;  2B63 A;  1IS1 A;  4GTL A;  3T00 A;  2XR9 A;  1ISE A;  3T02 A;  5L0K A;  2P5M A;  2VUM A;  3GTP A;  3AH5 A;  3VA7 A;  1HQA A;  2PHC B;  1ED9 A;  2GSN A;  4ILD A;  3NUH A;  4G0U A;  3NVL A;  1AJB A;  1EK8 A;  3CMR A;  2Y3P A;  3OPF A;  2W5V A;  1URB A;  1ANI A;  3GTO A;  4LRB A;  5C66 A;  3V4G A;  4G0V A;  4C3I C;  4GTW A;  4UOP A;  3GTK A;  1KH9 A;  1O28 A;  1Y6V A;  3NKQ A;  4KAW X;  4GT9 A;  3MK0 A;  2JA6 A;  4KMA A;  2YU9 A;  4KM4 A;  4GTA A;  2XRG A;  1EW9 A;  4FDI A;  2JH3 A;  1ALJ A;  3NKN A;  1WIH A;  4LRA A;  1ZBS A;  5GRR A;  3NKP A;  4KJD A;  1TWA A;  1O25 A;  3N0C A;  4KC6 A;  1TWF A;  4KB4 A;  3H0G A;  5L0B A;  2E2H A;  4LR2 A;  5DLT A;  5L0E A;  2XCR B;  2IFY A;  1P49 A;  2X98 A;  2KWA A;  1Y1V A;  3L4J A;  3T01 A;  1EJJ A;  4FZB A;  4C3H C;  3N0B A;  4YR1 A;  2W5S A;  2W8S A;  2GA3 A;  1FSU A;  2RGR A;  4KAR A;  5CHP A;  1ZXO A;  2ZKT A;  4LR8 A;  1I50 A;  1HDH A;  1O2A A;  4GTY A;  5EGH A;  4LQY A;  3BUE A;  1XXB A;  4CXS A;  4TN0 A;  1SFO A;  4FDJ A;  3S0X A;  3KD8 A;  4UOO A;  3M8Z A;  5IJQ A;  5DLW A;  2VQR A;  1XXC A;  4ZGA A;  2GLQ A;  1KH7 A;  5DLV A;  3BDG B;  1AJD A;  1E3C P;  4LR9 A;  3TX0 A;  2E2I A;  2JA5 A;  1TWC A;  5EGE A;  3NKM A;  3UN2 A;  2NVY A;  4MIV A;  2G9Y A;  4B56 A;  4LRE A;  5IOT A;  4BLA A;  1ANJ A;  4KAY A;  3A52 A;  1EQJ A;  4GTB A;  3M8W A;  1ED8 A;  3SZZ A;  2XCO A;  1E1Z P;  3BDH A;  1F9N A;  3G4A A;  4BKW A;  4C3J C;  4KM9 A;  2NVX A;  5IJS A;  5IOR A;  4GTX A;  4BLB A;  4N7T A;  1O99 A;  1HJK A;  1AJC A;  1WQH A;  3B5Q A;  4UPL A;  5LRN A;  1ALI A;  4MHX A;  2GSU A;  4QAX A;  3NKR A;  3AQO A;  2W5R A;  4CYS A;  3DPC A;  1TWG A;  3GTJ A;  3OT9 A;  1AUK A;  3GTQ A;  3TG0 A;  4CYR A;  2ANH A;  4ZG9 A;  1ELY A;  2JA7 A;  1KQ4 A;  1O2B A;  4DDQ A;  3CAG A;  4P5B A;  1ZED A;  4C2M C;  1KHJ A;  4LRC A;  5AJ9 A;  1ZVU A;  2IUC B;  3LAJ A;  3ED4 A;  5JFE A;  1SHQ A;  2W5X A;  5GOV A;  3UO0 A;  5LQQ A;  1K7H A;  1O27 A;  1EH1 A;  1KH4 A;  2R92 A;  1KHL A;  4P5A A;  5LRM A;  1AB4 A;  2R93 A;  4CXU A;  1R9T A;  4KAS A;  4UPH A;  3Q3Q A;  4LRD A;  3M7V A;  2GSO A;  4KMD A;  2ZFZ A;  4GTC A;  1O29 A;  1EW2 A;  2QZU A;  5TJ3 A;  1TWH A;  3UN3 A;  1BGW A;  1ALH A;  3OEP A;  3BDG A;  4LR7 A;  1KHN A;  1EI6 A;  1B4B A;  3ORE A;  2W8D A;  1URA A;  3LXQ A;  1Y1W A;  1ZEF A;  1AJA A;  4M1X A;  1E33 P;  1E2S P;  3WAX A;  5IOS A;  2CFA B;  4J3N A;  3LPX A;  1B8J A;  1O26 A;  4KMH A;  3SZY A;  4KB2 A;  3GTL A;  2RH6 A;  3UN5 A;  3IGY B;  3NKO A;  1ALK A;  1K83 A;  1ZEB A;  3MK2 A;  4UOR A;  4GTZ A;  1ELZ A;  5K4P A;  1ELX A;  3WAW A;  4LRF A;  5HRT A;  2W5Q A;  1O24 A;  1N2K A;  5KXA A;  1WCM A;  3WAY A;  4GFQ A;  1DD5 A;  3FOF A;  4KDD A;  3WAV A;  3FHZ A;  3MML B;  2W5W A;  3AQP A;  5INH A;  4KAT A;  3GTM A;  1WQG A;  3TWZ A;  3ERE D;  1XXA A;  3N3Y A;  4UPI A;  3LAP A;  2IUC A;  2W5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...