4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
1P49A 4TN0A 4LRBA 4LRFA 3KD8A 1AJDA 1EW8A 2ANHA 4GTZA 5GRRA 1E2SP 1EQJA 1KHJA 1FSUA 4LRAA 4UOOA 4LR9A 5LRMA 4MY4A 3IGZB 1ELXA 1KHKA 1HJKA 1URBA 3UN2A 4LQYA 5HRTA 2GSNA 1ED8A 4LR8A 2GSUA 4KJDA 3UN3A 3NKRA 1ANIA 3M8ZA 1ELZA 1EW2A 1EJJA 2IUCA 3NVLA 1ALJA 2QZUA 1ZEFA 1ZEDA 3IDDA 3B5QA 1AUKA 3DYCA 3OT9A 4ZGAA 3MK1A 3T00A 3UNYA 1O99A 3NKQA 1Y6VA 2VQRA 4FDIA 5KXAA 1HDHA 4KAYA 3WAYA 3TWZA 4KM4A 3UN5A 4CYRA 2D1GA 4UOPA 1ALHA 5DLTA 4N7TA 3WAXA 2ZKTA 1KH4A 2GSOA 3BDHA 5DLVA 2W5VA 5LIAA 1O98A 4ZG6A 4ZG7A 4CYSA 2XR9A 3A52A 1E1ZP 2X98A 4UPLA 4CXKA 1ALIA 3M8WA 5EGEA 1KHNA 1KH7A 3IGYB 3LXQA 3NKMA 2W5WA 3ED4A 1B8JA 2W5QA 3NKOA 1EI6A 5EGHA 3SZZA 2W8DA 3BDGB 1N2LA 5AJ9A 1KH9A 5K4PA 1AJAA 4B56A 2W5RA 1KHLA 5DLWA 3UO0A 3TG0A 5L0BA 1ALKA 4UPIA 5C66A 5LQQA 1KH5A 3T01A 4KAVA 1AJBA 2GA3A 3BDFA 2IUCB 3Q3QA 2W5TA 5L0KA 2W5XA 4NWJA 4ZG9A 5L0EA 2RH6A 3M8YA 4KJGA 3WAVA 5INHA 1E3CP 4UORA 4GTXA 4YR1A 2IFYA 1ED9A 3NKNA 4LREA 5GOVA 4FDJA 1ZEBA 4CXUA 5LRNA 1ELYA 1EW9A 1HQAA 4MHXA 3T02A 2GLQA 4LR2A 3BDGA 5IJQA 1SHQA 1URAA 2W8SA 1E33P 4LRDA 1AJCA 3M7VA 4QAXA 4CXSA 1N2KA 4LRCA 5TJ3A 1Y7AA 3DPCA 4UPHA 3TX0A 3CMRA 4NWXA 1SHNA 4GTWA 4GTYA 3E2DA 4LR7A 3WAWA 1K7HA 3NKPA 5IJSA 3MK0A 3WBHA 4UPKA 1ANJA 2G9YA 4MIVA 2XRGA 3SZYA 3MK2A 2W5SA
chains in the Genus database with same CATH superfamily
5IP7C 1Y1VA 3A8JA 1AJDA 3AD7C 2ANHA 4KMUA 3QX3A 1C0AA 1WQGA 4A3LK 4GTDA 3L4KA 2ZUFA 5C4XC 2E2JK 3TTGA 3S15K 3FOEA 1XZPA 4Y7NK 5LRMA 2NVYA 2V6TA 3N0BA 3IGZB 4QJVA 1RU0A 1HJKA 2JA5K 1URBA 3GTGC 2GSNA 1WSRA 2R93K 1ELZA 1WCMA 1ALJA 4Y52C 3IDDA 1ISEA 1K83A 3GTKA 5IORA 1AUKA 5E68A 4FDIA 4KAYA 1F93A 3UN5A 1YCLA 3H0GK 1YNJA 1WORA 5M3FK 3PO3K 4N7TA 2Y0SL 5IYDK 3BDHA 3GTKK 4A3DC 5LIAA 2JA7A 1BS2A 3ADAC 3AD8C 2JA6K 1I50C 1HI9A 3HKZL 1XZQB 1JQWA 5EGEA 1DCPA 3IGYB 3TFIA 3RZOC 2WAQL 3NKMA 1O25A 2WB1L 3LAPA 5C4XK 3BDGB 3CAGA 2W5RA 3GTPC 1ZBSA 2E2HC 1WOOA 3GTGK 2NVXA 5LQQA 5FLMK 4GTFA 2D6FC 1BDFA 1ZYRA 4KAVA 3Q3QA 4LLGA 5IP9K 4JK1A 4A93K 3CQZA 4AYBL 5C3EK 5L0EA 3M8YA 1I3QK 3GTJA 1IW7A 5INHA 4C3HC 4GTXA 3S2DC 3HOWC 4A3FC 5LRNA 4KDDA 1TWHA 1WQHA 4LJZA 1SFOA 4A3DK 1XZPB 4KB2A 5FJ8K 3OREA 3GTQC 4QJVB 4MEXA 4QAXA 4MEYA 5M5WK 1DD5A 5M5YK 4UPHA 1TWCC 1Y1WC 3CMRA 4LR7A 3WAWA 1J6XA 1L0WA 5IJSA 4UPKA 3FKIC 1WOPA 1SFOK 4MIVA 3HXAA 3OEPA 1WOSA 5IOSA 3GTPK 1P49A 1HQMA 2E2HK 2YU9A 3HOYK 2RGRA 3S2HC 4AH6A 1JVIA 4GTZA 1INNA 4KM9A 1EQJA 4A3KC 1YX2A 2XCQA 2EBBA 4QIWL 5L46A 2E2IA 3S1NC 4X6AC 1ELXA 1KHKA 3UN2A 1SMYA 3AQPA 4LQYA 2YU9K 4A3CC 4XCHA 5HRTA 1ED8A 4C3HK 2PMZL 3RZDK 2V6UA 3M8ZA 4KMHA 3FHZA 4BXXC 1O29A 3S2DK 1I6VA 4P5BA 3HOWK 2QZUA 1AB4A 1VRQC 1O2FB 3V4GA 3S0XA 4KM8A 4ZGAA 4XSXA 2R92C 3T00A 3I4NC 2JA5A 5TMCA 1O99A 5IYBC 1Y6VA 2VQRA 4BLBA 5KXAA 3L4JA 3GTOA 4BBSC 4Q5SA 3WAYA 4CYRA 2CFAA 2R93A 4KM4A 1TWCK 4O2DA 3GTMK 1GE9A 1IS1A 1WCMC 1TWAC 2Y0SD 1ZXOA 2P8TA 4ZG6A 3HOVK 2B63A 4CYSA 4BBRC 4DDQA 3GTOK 1E1ZP 4UPLA 3HKZD 5M3MK 3H0GA 4OIOA 5C4JC 3S2HK 5IYCC 2WAQD 1BGWA 1B8JA 2WB1D 2PPBA 1EH1A 2JA8C 1EI6A 3SZZA 4A3KK 3HOXK 4BY7C 2B63K 1KH9A 2JA6A 3BP8C 1AJAA 4YFXA 1N2LA 5AJ9A 3S1MC 5DLWA 4B56A 2JA7C 3S1QC 3S1NK 5C66A 4PAAA 1VH2A 4YFKA 4GZYA 4C45A 3WODA 1AJBA 2A69A 4NOIA 2GA3A 4J3NA 2IUCB 4KMDA 4A3MC 3S1RC 5L0KA 4NWJA 1O2AA 1TWGC 2R92K 4XSZA 1EK8A 4AYBD 1R9TC 3GEIA 5C44C 4M1XA 5IP7K 5IYBK 3GTGA 1XPPA 1DCOA 1J6WA 2GAGC 4GTEA 3AQOA 1ED9A 3NKNA 4CXUA 4XLNA 1WSVA 4A3EC 1EW9A 1HQAA 4MHXA 3T02A 2GLQA 1USOA 1TWAK 4LR2A 2ZUEA 4YFNA 2GAHC 1V5VA 1E33P 3K7AC 1USMA 4C3JC 1I3QA 1AJCA 3M7VA 4CXSA 5TJ3A 4LRCA 1Y7AA 3TX0A 4NWXA 3M3YC 3GDZA 1SHNA 3GTLC 4GTYA 5IYCK 4WJ4A 2CW0A 4Y52K 1F7UA 4BY1C 1K7HA 3NKPA 5IOQA 3MK0A 3WBHA 4Q4ZA 2JA8K 3JSTA 4ZH4A 2XRGA 3A8IA 4BY7K 3EQLA 1I50A 1EFWA 4LRFA 5CHPA 3KD8A 3I4MC 1EW8A 2CFAB 5GRRA 1WIHA 4A3IC 4BKWA 5M5XK 1KHJA 4LRAA 4C2MC 4UOOA 4A3MK 2PA8L 3GTPA 2NVQC 4MY4A 1TWGK 1I50K 4QIWD 1R9TK 2E2HA 5C44K 3M4OC 4LR8A 2GSUA 3RZOK 4KJDA 3UN3A 2PMZD 2PHCB 1EW2A 2IUCA 1ZEFA 1JOEA 2VUMC 1G51A 4KAWX 3DYCA 1PJ6A 4KMAA 1BJTA 4OIPA 2XCRB 4A3JC 3NKQA 3G4AA 1O24A 4KC6A 4LK1A 1HDHA 2E2IC 3TWZA 1O2BA 3OPFA 4UOPA 3GTLK 5DLTA 5HL8A 3H3VL 1TWFC 4BY1K 1F9NA 2R7ZC 2GSOA 4A3LC 5DLVA 2W5VA 1PJ7A 4GTLA 1O98A 4GTCA 4ZG7A 1VGXA 3VA7A 3GTQA 3A52A 2Y3PA 4GTAA 1Y1VC 1TWCA 2FQOA 1ALIA 4CXKA 3GTMA 3I4MK 4A3FK 1B4AA 1DCHA 2W5QA 4LK0A 4GFQA 1IL2A 1KQ4A 3S14C 5K4PA 2NVYC 1VJEA 3GTQK 1KHLA 3TG0A 1ZQ1C 4UPIA 1Y1WK 1IBAA 1VLOA 3T01A 5TMFA 2V6SA 1IE0A 3FKIK 3S16C 3N3YA 3HOZC 5CJ9A 5D4DA 5IYDC 1K83C 2W5TA 2A68A 2W5XA 3GTKC 4ZG9A 3GIRA 2RH6A 3AH5A 4KB4A 4A3JK 1O27A 4KJGA 3WAVA 1XXCA 1E3CP 3DXJA 4C3IC 4YR1A 2IFYA 4P9SA 5GOVA 3GSIA 4FDJA 1ELYA 3PO2C 1TWFK 1I6HC 2R7ZK 2R92A 1SHQA 1URAA 2W8SA 4X6AK 4A3GC 1ZVUA 4OIQA 4PABA 4A3CK 4G0WA 3DPCA 4G7HA 1J6VA 1X31C 1Y1VK 4G7ZA 2XCOA 4GTWA 5FLMC 4BXXK 4KATA 4GTBA 2JH3A 1EQRA 1TWAA 3HOUC 2G9YA 5IP9C 3I4NK 4A93C 3S14K 3SZYA 4A3BC 4BLAA 5C3EC 2NVYK 4WILA 4BBSK 1I3QC 4TN0A 4LRBA 2NVXC 4FZBA 1E2SP 1WCMK 3S16K 1FSUA 5JVOA 3HOZK 4XLPA 4LR9A 1K83K 3CQZC 4BBRK 2PA8D 2O5JA 2FQTA 3GTJC 2O5IA 1UV7A 5C4JK 4WJ3M 1ANIA 1F7VA 3NKRA 4C3IK 3NVLA 1O26A 3AD9C 3BP3A 1EJJA 4G0VA 3IPJA 3MMLB 1ZEDA 1IQ0A 3PO2K 1TWHC 1I6HK 3B5QA 3OT9A 1SFOC 1TWGA 3S1MK 3MK1A 1R9TA 2JA7K 3S1QK 4OIRA 3UNYA 4G7OA 4A3GK 2BE5A 2A6HA 2D1GA 4LOWA 3HOYC 3N0CA 1ALHA 3TFHA 4MQ9A 3S17C 3WAXA 3H3VD 2ZKTA 3S1RK 4P5AA 1KH4A 3ERED 3HOUK 3G4CA 4A3BK 2XR9A 2ZFZA 4OINA 4KASA 2X98A 1PJ5A 2YU9C 3M8WA 1XXBA 3GTLA 4RMFA 3RZDC 2NVXK 1KHNA 1KH7A 3LXQA 2W5WA 3ED4A 2NVTC 4A3EK 3LPXA 4KN4A 4YG2A 3TFJA 3NKOA 2A6EA 5EGHA 2W8DA 3K7AK 4C3JK 3GEEA 3UO0A 3CQZK 2P5MA 5L0BA 1O28A 1ALKA 1WQFA 2W7VA 3GTJK 4KN7A 3M3YK 1KH5A 1XXAA 4G0UA 3FOFA 3GTMC 3A8KA 1YNNA 3BDFA 2E2JC 3S15C 4Y7NC 4KARA 1TWHK 2JA5C 3HOVC 1Y1WA 1XZQA 4ILDA 3GTOC 1J98A 4UORA 2R93C 3LAJA 4A3IK 3NUHA 4LREA 3FKIA 1ZEBA 2VUMA 4C2MK 3S17K 3BDGA 5IJQA 2NVQK 3HOXC 2B63C 4LRDA 3M4OK 1N2KA 3H0GC 4GT9A 5JFEA 3E2DA 4FM9A 3PO3C 2VUMK 1TWFA 2NVTK 3GEHA 2R7ZA 1ANJA 1B4BA 3BUEA 5IOTA 2KWAA 2JA6C 3MK2A 2W5SA 2E2IK
chains in the Genus database with same CATH topology
1Y1VA 1AJDA 2ANHA 3QX3A 1WQGA 4GTDA 3L4KA 3FOEA 5LRMA 2NVYA 3N0BA 3IGZB 1HJKA 1URBA 2GSNA 1ELZA 1WCMA 1ALJA 3IDDA 1ISEA 1K83A 3GTKA 5IORA 1AUKA 4FDIA 4KAYA 3UN5A 4N7TA 3BDHA 5LIAA 2JA7A 5EGEA 3IGYB 3NKMA 1O25A 3LAPA 3BDGB 3CAGA 2W5RA 1ZBSA 2NVXA 5LQQA 4GTFA 4KAVA 3Q3QA 3CQZA 5L0EA 3M8YA 3GTJA 5INHA 4C3HC 4GTXA 5LRNA 4KDDA 1TWHA 1WQHA 1SFOA 4KB2A 3OREA 4QAXA 4UPHA 1DD5A 3CMRA 4LR7A 3WAWA 5IJSA 4UPKA 4MIVA 5IOSA 3OEPA 1P49A 2YU9A 2RGRA 4GTZA 4KM9A 1EQJA 2XCQA 2E2IA 1ELXA 1KHKA 3UN2A 3AQPA 4LQYA 5HRTA 1ED8A 3M8ZA 4KMHA 3FHZA 1O29A 2QZUA 4P5BA 1AB4A 3S0XA 3V4GA 4KM8A 4ZGAA 3T00A 2JA5A 1O99A 1Y6VA 2VQRA 4BLBA 5KXAA 3L4JA 3GTOA 3WAYA 4CYRA 2CFAA 2R93A 4KM4A 1GE9A 1IS1A 1ZXOA 4ZG6A 2B63A 4CYSA 4DDQA 1E1ZP 4UPLA 3H0GA 1BGWA 1B8JA 1EH1A 1EI6A 3SZZA 1N2LA 5AJ9A 1KH9A 2JA6A 1AJAA 4B56A 5DLWA 5C66A 1AJBA 2GA3A 4J3NA 2IUCB 4KMDA 5L0KA 4NWJA 1O2AA 1EK8A 4M1XA 3GTGA 4GTEA 3AQOA 1ED9A 3NKNA 4CXUA 1EW9A 1HQAA 4MHXA 3T02A 2GLQA 4LR2A 1E33P 4C3JC 1I3QA 1AJCA 3M7VA 4CXSA 5TJ3A 4LRCA 1Y7AA 3TX0A 4NWXA 1SHNA 4GTYA 1K7HA 3NKPA 5IOQA 3MK0A 3WBHA 2XRGA 1I50A 4LRFA 5CHPA 3KD8A 1EW8A 2CFAB 5GRRA 1WIHA 4BKWA 1KHJA 4LRAA 4C2MC 4UOOA 3GTPA 4MY4A 2E2HA 4LR8A 2GSUA 4KJDA 3UN3A 2PHCB 1EW2A 2IUCA 1ZEFA 4KAWX 3DYCA 4KMAA 1BJTA 2XCRB 3NKQA 3G4AA 1O24A 4KC6A 1HDHA 3TWZA 1O2BA 3OPFA 4UOPA 5DLTA 1F9NA 2GSOA 5DLVA 2W5VA 4GTLA 1O98A 4GTCA 4ZG7A 3VA7A 3GTQA 3A52A 2Y3PA 4GTAA 1TWCA 4CXKA 1ALIA 2W5SA 3GTMA 1B4AA 2W5QA 4GFQA 1KQ4A 5K4PA 1KHLA 3TG0A 4UPIA 3T01A 3N3YA 5CJ9A 2W5TA 2W5XA 4ZG9A 2RH6A 3AH5A 4KB4A 1O27A 4KJGA 3WAVA 1XXCA 1E3CP 4YR1A 4C3IC 2IFYA 5GOVA 4FDJA 1ELYA 2R92A 1SHQA 1URAA 2W8SA 1ZVUA 4G0WA 3DPCA 2XCOA 4GTWA 4KATA 4GTBA 2JH3A 1TWAA 2G9YA 3SZYA 4BLAA 4TN0A 4LRBA 4FZBA 1E2SP 1FSUA 5JVOA 4LR9A 1ANIA 3NKRA 3NVLA 1O26A 1EJJA 4G0VA 3MMLB 1ZEDA 3B5QA 3OT9A 1TWGA 3MK1A 1R9TA 3UNYA 2D1GA 3N0CA 1ALHA 3WAXA 2ZKTA 1KH4A 4P5AA 3ERED 3G4CA 2XR9A 2ZFZA 4KASA 2X98A 1XXBA 3GTLA 1KHNA 1KH7A 3LXQA 2W5WA 3ED4A 3LPXA 3NKOA 5EGHA 2W8DA 3UO0A 2P5MA 5L0BA 1O28A 1ALKA 1WQFA 1KH5A 1XXAA 4G0UA 3FOFA 3BDFA 4KARA 1Y1WA 4ILDA 4UORA 3LAJA 3NUHA 4LREA 3FKIA 1ZEBA 2VUMA 3BDGA 5IJQA 4LRDA 1N2KA 4GT9A 5JFEA 3E2DA 4FM9A 1TWFA 2R7ZA 1ANJA 1B4BA 3BUEA 5IOTA 2KWAA 3MK2A 3M8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P49 A;  4TN0 A;  4LRB A;  4LRF A;  3KD8 A;  1AJD A;  1EW8 A;  2ANH A;  4GTZ A;  5GRR A;  1E2S P;  1EQJ A;  1KHJ A;  1FSU A;  4LRA A;  4UOO A;  4LR9 A;  5LRM A;  4MY4 A;  3IGZ B;  1ELX A;  1KHK A;  1HJK A;  1URB A;  3UN2 A;  4LQY A;  5HRT A;  2GSN A;  1ED8 A;  4LR8 A;  2GSU A;  4KJD A;  3UN3 A;  3NKR A;  1ANI A;  3M8Z A;  1ELZ A;  1EW2 A;  1EJJ A;  2IUC A;  3NVL A;  1ALJ A;  2QZU A;  1ZEF A;  1ZED A;  3IDD A;  3B5Q A;  1AUK A;  3DYC A;  3OT9 A;  4ZGA A;  3MK1 A;  3T00 A;  3UNY A;  1O99 A;  3NKQ A;  1Y6V A;  2VQR A;  4FDI A;  5KXA A;  1HDH A;  4KAY A;  3WAY A;  3TWZ A;  4KM4 A;  3UN5 A;  4CYR A;  2D1G A;  4UOP A;  1ALH A;  5DLT A;  4N7T A;  3WAX A;  2ZKT A;  1KH4 A;  2GSO A;  3BDH A;  5DLV A;  2W5V A;  5LIA A;  1O98 A;  4ZG6 A;  4ZG7 A;  4CYS A;  2XR9 A;  3A52 A;  1E1Z P;  2X98 A;  4UPL A;  4CXK A;  1ALI A;  3M8W A;  5EGE A;  1KHN A;  1KH7 A;  3IGY B;  3LXQ A;  3NKM A;  2W5W A;  3ED4 A;  1B8J A;  2W5Q A;  3NKO A;  1EI6 A;  5EGH A;  3SZZ A;  2W8D A;  3BDG B;  1N2L A;  5AJ9 A;  1KH9 A;  5K4P A;  1AJA A;  4B56 A;  2W5R A;  1KHL A;  5DLW A;  3UO0 A;  3TG0 A;  5L0B A;  1ALK A;  4UPI A;  5C66 A;  5LQQ A;  1KH5 A;  3T01 A;  4KAV A;  1AJB A;  2GA3 A;  3BDF A;  2IUC B;  3Q3Q A;  2W5T A;  5L0K A;  2W5X A;  4NWJ A;  4ZG9 A;  5L0E A;  2RH6 A;  3M8Y A;  4KJG A;  3WAV A;  5INH A;  1E3C P;  4UOR A;  4GTX A;  4YR1 A;  2IFY A;  1ED9 A;  3NKN A;  4LRE A;  5GOV A;  4FDJ A;  1ZEB A;  4CXU A;  5LRN A;  1ELY A;  1EW9 A;  1HQA A;  4MHX A;  3T02 A;  2GLQ A;  4LR2 A;  3BDG A;  5IJQ A;  1SHQ A;  1URA A;  2W8S A;  1E33 P;  4LRD A;  1AJC A;  3M7V A;  4QAX A;  4CXS A;  1N2K A;  4LRC A;  5TJ3 A;  1Y7A A;  3DPC A;  4UPH A;  3TX0 A;  3CMR A;  4NWX A;  1SHN A;  4GTW A;  4GTY A;  3E2D A;  4LR7 A;  3WAW A;  1K7H A;  3NKP A;  5IJS A;  3MK0 A;  3WBH A;  4UPK A;  1ANJ A;  2G9Y A;  4MIV A;  2XRG A;  3SZY A;  3MK2 A;  2W5S A; 
#chains in the Genus database with same CATH topology
 5IP7 C;  1Y1V A;  3A8J A;  1AJD A;  3AD7 C;  2ANH A;  4KMU A;  3QX3 A;  1C0A A;  1WQG A;  4A3L K;  4GTD A;  3L4K A;  2ZUF A;  5C4X C;  2E2J K;  3TTG A;  3S15 K;  3FOE A;  1XZP A;  4Y7N K;  5LRM A;  2NVY A;  2V6T A;  3N0B A;  3IGZ B;  4QJV A;  1RU0 A;  1HJK A;  2JA5 K;  1URB A;  3GTG C;  2GSN A;  1WSR A;  2R93 K;  1ELZ A;  1WCM A;  1ALJ A;  4Y52 C;  3IDD A;  1ISE A;  1K83 A;  3GTK A;  5IOR A;  1AUK A;  5E68 A;  4FDI A;  4KAY A;  1F93 A;  3UN5 A;  1YCL A;  3H0G K;  1YNJ A;  1WOR A;  5M3F K;  3PO3 K;  4N7T A;  2Y0S L;  5IYD K;  3BDH A;  3GTK K;  4A3D C;  5LIA A;  2JA7 A;  1BS2 A;  3ADA C;  3AD8 C;  2JA6 K;  1I50 C;  1HI9 A;  3HKZ L;  1XZQ B;  1JQW A;  5EGE A;  1DCP A;  3IGY B;  3TFI A;  3RZO C;  2WAQ L;  3NKM A;  1O25 A;  2WB1 L;  3LAP A;  5C4X K;  3BDG B;  3CAG A;  2W5R A;  3GTP C;  1ZBS A;  2E2H C;  1WOO A;  3GTG K;  2NVX A;  5LQQ A;  5FLM K;  4GTF A;  2D6F C;  1BDF A;  1ZYR A;  4KAV A;  3Q3Q A;  4LLG A;  5IP9 K;  4JK1 A;  4A93 K;  3CQZ A;  4AYB L;  5C3E K;  5L0E A;  3M8Y A;  1I3Q K;  3GTJ A;  1IW7 A;  5INH A;  4C3H C;  4GTX A;  3S2D C;  3HOW C;  4A3F C;  5LRN A;  4KDD A;  1TWH A;  1WQH A;  4LJZ A;  1SFO A;  4A3D K;  1XZP B;  4KB2 A;  5FJ8 K;  3ORE A;  3GTQ C;  4QJV B;  4MEX A;  4QAX A;  4MEY A;  5M5W K;  1DD5 A;  5M5Y K;  4UPH A;  1TWC C;  1Y1W C;  3CMR A;  4LR7 A;  3WAW A;  1J6X A;  1L0W A;  5IJS A;  4UPK A;  3FKI C;  1WOP A;  1SFO K;  4MIV A;  3HXA A;  3OEP A;  1WOS A;  5IOS A;  3GTP K;  1P49 A;  1HQM A;  2E2H K;  2YU9 A;  3HOY K;  2RGR A;  3S2H C;  4AH6 A;  1JVI A;  4GTZ A;  1INN A;  4KM9 A;  1EQJ A;  4A3K C;  1YX2 A;  2XCQ A;  2EBB A;  4QIW L;  5L46 A;  2E2I A;  3S1N C;  4X6A C;  1ELX A;  1KHK A;  3UN2 A;  1SMY A;  3AQP A;  4LQY A;  2YU9 K;  4A3C C;  4XCH A;  5HRT A;  1ED8 A;  4C3H K;  2PMZ L;  3RZD K;  2V6U A;  3M8Z A;  4KMH A;  3FHZ A;  4BXX C;  1O29 A;  3S2D K;  1I6V A;  4P5B A;  3HOW K;  2QZU A;  1AB4 A;  1VRQ C;  1O2F B;  3V4G A;  3S0X A;  4KM8 A;  4ZGA A;  4XSX A;  2R92 C;  3T00 A;  3I4N C;  2JA5 A;  5TMC A;  1O99 A;  5IYB C;  1Y6V A;  2VQR A;  4BLB A;  5KXA A;  3L4J A;  3GTO A;  4BBS C;  4Q5S A;  3WAY A;  4CYR A;  2CFA A;  2R93 A;  4KM4 A;  1TWC K;  4O2D A;  3GTM K;  1GE9 A;  1IS1 A;  1WCM C;  1TWA C;  2Y0S D;  1ZXO A;  2P8T A;  4ZG6 A;  3HOV K;  2B63 A;  4CYS A;  4BBR C;  4DDQ A;  3GTO K;  1E1Z P;  4UPL A;  3HKZ D;  5M3M K;  3H0G A;  4OIO A;  5C4J C;  3S2H K;  5IYC C;  2WAQ D;  1BGW A;  1B8J A;  2WB1 D;  2PPB A;  1EH1 A;  2JA8 C;  1EI6 A;  3SZZ A;  4A3K K;  3HOX K;  4BY7 C;  2B63 K;  1KH9 A;  2JA6 A;  3BP8 C;  1AJA A;  4YFX A;  1N2L A;  5AJ9 A;  3S1M C;  5DLW A;  4B56 A;  2JA7 C;  3S1Q C;  3S1N K;  5C66 A;  4PAA A;  1VH2 A;  4YFK A;  4GZY A;  4C45 A;  3WOD A;  1AJB A;  2A69 A;  4NOI A;  2GA3 A;  4J3N A;  2IUC B;  4KMD A;  4A3M C;  3S1R C;  5L0K A;  4NWJ A;  1O2A A;  1TWG C;  2R92 K;  4XSZ A;  1EK8 A;  4AYB D;  1R9T C;  3GEI A;  5C44 C;  4M1X A;  5IP7 K;  5IYB K;  3GTG A;  1XPP A;  1DCO A;  1J6W A;  2GAG C;  4GTE A;  3AQO A;  1ED9 A;  3NKN A;  4CXU A;  4XLN A;  1WSV A;  4A3E C;  1EW9 A;  1HQA A;  4MHX A;  3T02 A;  2GLQ A;  1USO A;  1TWA K;  4LR2 A;  2ZUE A;  4YFN A;  2GAH C;  1V5V A;  1E33 P;  3K7A C;  1USM A;  4C3J C;  1I3Q A;  1AJC A;  3M7V A;  4CXS A;  5TJ3 A;  4LRC A;  1Y7A A;  3TX0 A;  4NWX A;  3M3Y C;  3GDZ A;  1SHN A;  3GTL C;  4GTY A;  5IYC K;  4WJ4 A;  2CW0 A;  4Y52 K;  1F7U A;  4BY1 C;  1K7H A;  3NKP A;  5IOQ A;  3MK0 A;  3WBH A;  4Q4Z A;  2JA8 K;  3JST A;  4ZH4 A;  2XRG A;  3A8I A;  4BY7 K;  3EQL A;  1I50 A;  1EFW A;  4LRF A;  5CHP A;  3KD8 A;  3I4M C;  1EW8 A;  2CFA B;  5GRR A;  1WIH A;  4A3I C;  4BKW A;  5M5X K;  1KHJ A;  4LRA A;  4C2M C;  4UOO A;  4A3M K;  2PA8 L;  3GTP A;  2NVQ C;  4MY4 A;  1TWG K;  1I50 K;  4QIW D;  1R9T K;  2E2H A;  5C44 K;  3M4O C;  4LR8 A;  2GSU A;  3RZO K;  4KJD A;  3UN3 A;  2PMZ D;  2PHC B;  1EW2 A;  2IUC A;  1ZEF A;  1JOE A;  2VUM C;  1G51 A;  4KAW X;  3DYC A;  1PJ6 A;  4KMA A;  1BJT A;  4OIP A;  2XCR B;  4A3J C;  3NKQ A;  3G4A A;  1O24 A;  4KC6 A;  4LK1 A;  1HDH A;  2E2I C;  3TWZ A;  1O2B A;  3OPF A;  4UOP A;  3GTL K;  5DLT A;  5HL8 A;  3H3V L;  1TWF C;  4BY1 K;  1F9N A;  2R7Z C;  2GSO A;  4A3L C;  5DLV A;  2W5V A;  1PJ7 A;  4GTL A;  1O98 A;  4GTC A;  4ZG7 A;  1VGX A;  3VA7 A;  3GTQ A;  3A52 A;  2Y3P A;  4GTA A;  1Y1V C;  1TWC A;  2FQO A;  1ALI A;  4CXK A;  3GTM A;  3I4M K;  4A3F K;  1B4A A;  1DCH A;  2W5Q A;  4LK0 A;  4GFQ A;  1IL2 A;  1KQ4 A;  3S14 C;  5K4P A;  2NVY C;  1VJE A;  3GTQ K;  1KHL A;  3TG0 A;  1ZQ1 C;  4UPI A;  1Y1W K;  1IBA A;  1VLO A;  3T01 A;  5TMF A;  2V6S A;  1IE0 A;  3FKI K;  3S16 C;  3N3Y A;  3HOZ C;  5CJ9 A;  5D4D A;  5IYD C;  1K83 C;  2W5T A;  2A68 A;  2W5X A;  3GTK C;  4ZG9 A;  3GIR A;  2RH6 A;  3AH5 A;  4KB4 A;  4A3J K;  1O27 A;  4KJG A;  3WAV A;  1XXC A;  1E3C P;  3DXJ A;  4C3I C;  4YR1 A;  2IFY A;  4P9S A;  5GOV A;  3GSI A;  4FDJ A;  1ELY A;  3PO2 C;  1TWF K;  1I6H C;  2R7Z K;  2R92 A;  1SHQ A;  1URA A;  2W8S A;  4X6A K;  4A3G C;  1ZVU A;  4OIQ A;  4PAB A;  4A3C K;  4G0W A;  3DPC A;  4G7H A;  1J6V A;  1X31 C;  1Y1V K;  4G7Z A;  2XCO A;  4GTW A;  5FLM C;  4BXX K;  4KAT A;  4GTB A;  2JH3 A;  1EQR A;  1TWA A;  3HOU C;  2G9Y A;  5IP9 C;  3I4N K;  4A93 C;  3S14 K;  3SZY A;  4A3B C;  4BLA A;  5C3E C;  2NVY K;  4WIL A;  4BBS K;  1I3Q C;  4TN0 A;  4LRB A;  2NVX C;  4FZB A;  1E2S P;  1WCM K;  3S16 K;  1FSU A;  5JVO A;  3HOZ K;  4XLP A;  4LR9 A;  1K83 K;  3CQZ C;  4BBR K;  2PA8 D;  2O5J A;  2FQT A;  3GTJ C;  2O5I A;  1UV7 A;  5C4J K;  4WJ3 M;  1ANI A;  1F7V A;  3NKR A;  4C3I K;  3NVL A;  1O26 A;  3AD9 C;  3BP3 A;  1EJJ A;  4G0V A;  3IPJ A;  3MML B;  1ZED A;  1IQ0 A;  3PO2 K;  1TWH C;  1I6H K;  3B5Q A;  3OT9 A;  1SFO C;  1TWG A;  3S1M K;  3MK1 A;  1R9T A;  2JA7 K;  3S1Q K;  4OIR A;  3UNY A;  4G7O A;  4A3G K;  2BE5 A;  2A6H A;  2D1G A;  4LOW A;  3HOY C;  3N0C A;  1ALH A;  3TFH A;  4MQ9 A;  3S17 C;  3WAX A;  3H3V D;  2ZKT A;  3S1R K;  4P5A A;  1KH4 A;  3ERE D;  3HOU K;  3G4C A;  4A3B K;  2XR9 A;  2ZFZ A;  4OIN A;  4KAS A;  2X98 A;  1PJ5 A;  2YU9 C;  3M8W A;  1XXB A;  3GTL A;  4RMF A;  3RZD C;  2NVX K;  1KHN A;  1KH7 A;  3LXQ A;  2W5W A;  3ED4 A;  2NVT C;  4A3E K;  3LPX A;  4KN4 A;  4YG2 A;  3TFJ A;  3NKO A;  2A6E A;  5EGH A;  2W8D A;  3K7A K;  4C3J K;  3GEE A;  3UO0 A;  3CQZ K;  2P5M A;  5L0B A;  1O28 A;  1ALK A;  1WQF A;  2W7V A;  3GTJ K;  4KN7 A;  3M3Y K;  1KH5 A;  1XXA A;  4G0U A;  3FOF A;  3GTM C;  3A8K A;  1YNN A;  3BDF A;  2E2J C;  3S15 C;  4Y7N C;  4KAR A;  1TWH K;  2JA5 C;  3HOV C;  1Y1W A;  1XZQ A;  4ILD A;  3GTO C;  1J98 A;  4UOR A;  2R93 C;  3LAJ A;  4A3I K;  3NUH A;  4LRE A;  3FKI A;  1ZEB A;  2VUM A;  4C2M K;  3S17 K;  3BDG A;  5IJQ A;  2NVQ K;  3HOX C;  2B63 C;  4LRD A;  3M4O K;  1N2K A;  3H0G C;  4GT9 A;  5JFE A;  3E2D A;  4FM9 A;  3PO3 C;  2VUM K;  1TWF A;  2NVT K;  3GEH A;  2R7Z A;  1ANJ A;  1B4B A;  3BUE A;  5IOT A;  2KWA A;  2JA6 C;  3MK2 A;  2W5S A;  2E2I K; 
#chains in the Genus database with same CATH homology
 1Y1V A;  1AJD A;  2ANH A;  3QX3 A;  1WQG A;  4GTD A;  3L4K A;  3FOE A;  5LRM A;  2NVY A;  3N0B A;  3IGZ B;  1HJK A;  1URB A;  2GSN A;  1ELZ A;  1WCM A;  1ALJ A;  3IDD A;  1ISE A;  1K83 A;  3GTK A;  5IOR A;  1AUK A;  4FDI A;  4KAY A;  3UN5 A;  4N7T A;  3BDH A;  5LIA A;  2JA7 A;  5EGE A;  3IGY B;  3NKM A;  1O25 A;  3LAP A;  3BDG B;  3CAG A;  2W5R A;  1ZBS A;  2NVX A;  5LQQ A;  4GTF A;  4KAV A;  3Q3Q A;  3CQZ A;  5L0E A;  3M8Y A;  3GTJ A;  5INH A;  4C3H C;  4GTX A;  5LRN A;  4KDD A;  1TWH A;  1WQH A;  1SFO A;  4KB2 A;  3ORE A;  4QAX A;  4UPH A;  1DD5 A;  3CMR A;  4LR7 A;  3WAW A;  5IJS A;  4UPK A;  4MIV A;  5IOS A;  3OEP A;  1P49 A;  2YU9 A;  2RGR A;  4GTZ A;  4KM9 A;  1EQJ A;  2XCQ A;  2E2I A;  1ELX A;  1KHK A;  3UN2 A;  3AQP A;  4LQY A;  5HRT A;  1ED8 A;  3M8Z A;  4KMH A;  3FHZ A;  1O29 A;  2QZU A;  4P5B A;  1AB4 A;  3S0X A;  3V4G A;  4KM8 A;  4ZGA A;  3T00 A;  2JA5 A;  1O99 A;  1Y6V A;  2VQR A;  4BLB A;  5KXA A;  3L4J A;  3GTO A;  3WAY A;  4CYR A;  2CFA A;  2R93 A;  4KM4 A;  1GE9 A;  1IS1 A;  1ZXO A;  4ZG6 A;  2B63 A;  4CYS A;  4DDQ A;  1E1Z P;  4UPL A;  3H0G A;  1BGW A;  1B8J A;  1EH1 A;  1EI6 A;  3SZZ A;  1N2L A;  5AJ9 A;  1KH9 A;  2JA6 A;  1AJA A;  4B56 A;  5DLW A;  5C66 A;  1AJB A;  2GA3 A;  4J3N A;  2IUC B;  4KMD A;  5L0K A;  4NWJ A;  1O2A A;  1EK8 A;  4M1X A;  3GTG A;  4GTE A;  3AQO A;  1ED9 A;  3NKN A;  4CXU A;  1EW9 A;  1HQA A;  4MHX A;  3T02 A;  2GLQ A;  4LR2 A;  1E33 P;  4C3J C;  1I3Q A;  1AJC A;  3M7V A;  4CXS A;  5TJ3 A;  4LRC A;  1Y7A A;  3TX0 A;  4NWX A;  1SHN A;  4GTY A;  1K7H A;  3NKP A;  5IOQ A;  3MK0 A;  3WBH A;  2XRG A;  1I50 A;  4LRF A;  5CHP A;  3KD8 A;  1EW8 A;  2CFA B;  5GRR A;  1WIH A;  4BKW A;  1KHJ A;  4LRA A;  4C2M C;  4UOO A;  3GTP A;  4MY4 A;  2E2H A;  4LR8 A;  2GSU A;  4KJD A;  3UN3 A;  2PHC B;  1EW2 A;  2IUC A;  1ZEF A;  4KAW X;  3DYC A;  4KMA A;  1BJT A;  2XCR B;  3NKQ A;  3G4A A;  1O24 A;  4KC6 A;  1HDH A;  3TWZ A;  1O2B A;  3OPF A;  4UOP A;  5DLT A;  1F9N A;  2GSO A;  5DLV A;  2W5V A;  4GTL A;  1O98 A;  4GTC A;  4ZG7 A;  3VA7 A;  3GTQ A;  3A52 A;  2Y3P A;  4GTA A;  1TWC A;  4CXK A;  1ALI A;  2W5S A;  3GTM A;  1B4A A;  2W5Q A;  4GFQ A;  1KQ4 A;  5K4P A;  1KHL A;  3TG0 A;  4UPI A;  3T01 A;  3N3Y A;  5CJ9 A;  2W5T A;  2W5X A;  4ZG9 A;  2RH6 A;  3AH5 A;  4KB4 A;  1O27 A;  4KJG A;  3WAV A;  1XXC A;  1E3C P;  4YR1 A;  4C3I C;  2IFY A;  5GOV A;  4FDJ A;  1ELY A;  2R92 A;  1SHQ A;  1URA A;  2W8S A;  1ZVU A;  4G0W A;  3DPC A;  2XCO A;  4GTW A;  4KAT A;  4GTB A;  2JH3 A;  1TWA A;  2G9Y A;  3SZY A;  4BLA A;  4TN0 A;  4LRB A;  4FZB A;  1E2S P;  1FSU A;  5JVO A;  4LR9 A;  1ANI A;  3NKR A;  3NVL A;  1O26 A;  1EJJ A;  4G0V A;  3MML B;  1ZED A;  3B5Q A;  3OT9 A;  1TWG A;  3MK1 A;  1R9T A;  3UNY A;  2D1G A;  3N0C A;  1ALH A;  3WAX A;  2ZKT A;  1KH4 A;  4P5A A;  3ERE D;  3G4C A;  2XR9 A;  2ZFZ A;  4KAS A;  2X98 A;  1XXB A;  3GTL A;  1KHN A;  1KH7 A;  3LXQ A;  2W5W A;  3ED4 A;  3LPX A;  3NKO A;  5EGH A;  2W8D A;  3UO0 A;  2P5M A;  5L0B A;  1O28 A;  1ALK A;  1WQF A;  1KH5 A;  1XXA A;  4G0U A;  3FOF A;  3BDF A;  4KAR A;  1Y1W A;  4ILD A;  4UOR A;  3LAJ A;  3NUH A;  4LRE A;  3FKI A;  1ZEB A;  2VUM A;  3BDG A;  5IJQ A;  4LRD A;  1N2K A;  4GT9 A;  5JFE A;  3E2D A;  4FM9 A;  1TWF A;  2R7Z A;  1ANJ A;  1B4B A;  3BUE A;  5IOT A;  2KWA A;  3MK2 A;  3M8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...