4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
b'LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
molecule tags Hydrolase
source organism Homo sapiens
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
2W5SA 4CYSA 4ZG7A 1AUKA 5TJ3A 4LQYA 4LR2A 2VQRA 4ZG9A 5LIAA 4KAVA 3A52A 1HQAA 3BDGB 1ZEBA 3TX0A 3Q3QA 1EI6A 1ZEFA 3LXQA 5AJ9A 4ZG6A 3NKRA 4UOOA 4UOPA 2GSOA 1AJBA 4KAYA 3MK2A 4KM4A 1E2SP 1N2LA 3WAVA 2X98A 1ALHA 1E33P 2GSNA 2IFYA 1AJCA 3CMRA 5HRTA 4UPIA 4B56A 2W5RA 1URAA 3T02A 4CXKA 3IGYB 3E2DA 1EJJA 4NWJA 2W5TA 4CXUA 1KHNA 1HJKA 2ANHA 1ED9A 4GTZA 4LRAA 5LRMA 1Y7AA 4MHXA 1HDHA 3NKPA 5DLVA 1ZEDA 5L0BA 1ANJA 2D1GA 3NKNA 5DLWA 5K4PA 3UN3A 2RH6A 1ALKA 1O98A 1ELZA 4LREA 4UPLA 4FDIA 2XRGA 3WAYA 4CXSA 4LRBA 3MK0A 1E1ZP 4N7TA 3WAXA 5INHA 3IGZB 3NKQA 4MY4A 2GSUA 1K7HA 1ELXA 1ALIA 1AJDA 2GLQA 5IJQA 1SHQA 3TG0A 3M7VA 1O99A 3T00A 3NVLA 5GRRA 3M8WA 1KH5A 1Y6VA 4LR7A 1ALJA 3B5QA 1EW8A 4LR8A 1AJAA 3M8YA 1FSUA 5LQQA 5GOVA 1EW9A 4GTWA 1ED8A 1SHNA 2XR9A 3T01A 3UN5A 4TN0A 2G9YA 4LRDA 3KD8A 1KH7A 2GA3A 5LRNA 5C66A 3M8ZA 3NKOA 3UN2A 1URBA 5EGEA 1KH9A 3DPCA 1ELYA 2IUCB 4YR1A 2W5VA 4FDJA 3WAWA 4NWXA 5EGHA 2QZUA 3IDDA 3ED4A 4LR9A 1KHLA 4UPHA 1KH4A 3SZZA 1B8JA 4CYRA 5L0KA 5L0EA 1EQJA 4UORA 3BDGA 2W5QA 4UPKA 1P49A 3OT9A 3DYCA 4GTXA 5DLTA 2W8SA 3BDFA 4KJGA 1N2KA 3SZYA 1KHKA 1KHJA 5IJSA 4LRCA 3WBHA 4LRFA 3UNYA 1ANIA 4KJDA 4QAXA 3TWZA 3UO0A 2W5WA 4ZGAA 2W5XA 2W8DA 4GTYA 2ZKTA 3NKMA 2IUCA 1E3CP 5KXAA 3BDHA 4MIVA 3MK1A 1EW2A
chains in the Genus database with same CATH superfamily
1AUKA 1I50A 5HL8A 5M3FK 1I6VA 1TWFC 3MMLB 3GTOK 3N0CA 3S2DC 2YU9C 3JSTA 4MEYA 3HOUC 1HQAA 3HOXC 3GTLK 3BDGB 1ZEBA 1VLOA 3HOWC 2PA8L 4GFQA 2B63C 2JA8K 1ZBSA 1BS2A 4JK1A 3K7AK 1X31C 3V4GA 2X98A 4LOWA 4RMFA 2GSNA 2Y0SD 5CHPA 1AJCA 1E33P 5HRTA 4B56A 1URAA 2ZUEA 1YX2A 4GTCA 3HOUK 3HOXK 1EJJA 4C3JC 3GTMA 3E2DA 4A3IC 4A3DC 4OINA 2PMZD 4P9SA 4C2MC 3S1MK 4LRAA 3G4AA 2PHCB 3GTKK 4BY7K 4AYBL 4MHXA 1TWCC 3GEEA 4GTFA 2FQTA 1SFOC 1ZEDA 5FJ8K 3RZOK 2FQOA 1ALKA 3GTQK 4LREA 4UPLA 4FDIA 4C2MK 3TTGA 5TMCA 1XZQB 4CXSA 1YCLA 1E1ZP 4YFNA 1Y1WK 5INHA 4KN7A 1TWHC 2O5JA 1ELXA 1AJDA 5IYBC 3M8WA 1KH5A 1IL2A 4BBSC 3OREA 3RZDC 4LR7A 1ZYRA 1YNJA 2RGRA 3GSIA 1USOA 1Y1VC 5M5XK 4LR8A 5LQQA 4GTWA 3GTLA 1WCMC 2JA5C 3H0GA 2GA3A 4P5BA 1TWFK 1I6HK 3M8ZA 3NKOA 3GTOC 3UN2A 4KB4A 3S16K 2JA6A 1ELYA 1XZPB 3GTGC 1DCOA 3WAWA 1F7VA 1Y1VK 3IDDA 4KATA 1WCMK 1BJTA 2R7ZA 3SZZA 4CYRA 1WIHA 4X6AC 4C45A 1J98A 3OT9A 3S15K 2PMZL 5DLTA 3GEIA 4MQ9A 1PJ5A 5IOSA 2Y0SL 3S0XA 1KQ4A 3SZYA 1F9NA 5IJSA 2WAQD 1RU0A 2VUMA 3UNYA 5IYCC 2R92C 1ANIA 1USMA 1VH2A 1TWFA 1O2BA 1TWGA 2EBBA 2ZKTA 3GDZA 2PPBA 4BLAA 3BDHA 1XPPA 2WB1L 1IE0A 2E2JC 1TWAA 3MK1A 3EQLA 4CYSA 3M3YC 4A3CK 1G51A 4ZG9A 5LIAA 3VA7A 5IYDC 5IP9C 5IYCK 2R92K 1TWHK 2KWAA 3AQPA 4A3BK 4AH6A 5CJ9A 3A52A 1J6WA 1EI6A 1BGWA 4UOPA 2NVYK 4BBSK 4KM4A 3HOZK 3M3YK 2R93C 2IFYA 5JVOA 4OIRA 5IP9K 4UPIA 2W5RA 4A3BC 4GZYA 1TWCA 4BY1C 3I4MC 4CXKA 1IBAA 1C0AA 4O2DA 2E2IA 3I4NK 2P5MA 1BDFA 5M5WK 3M4OC 1TWAK 2XCQA 2NVYC 1EH1A 5IORA 3OPFA 2PA8D 1YNNA 3S1NK 2R93K 5DLVA 3H0GK 4C3IC 4DDQA 2NVXC 2E2HA 4OIOA 5L0BA 2Y3PA 2VUMK 4KC6A 4P5AA 3NKNA 2RH6A 3PO3C 1PJ7A 1V5VA 3HOYC 3S15C 1DD5A 4LRBA 1O28A 4GTEA 4N7TA 4BBRK 2WAQL 4A3JC 4YFXA 3FHZA 2YU9K 5C3EK 3GTLC 2GSUA 3HOWK 1I3QC 2A6EA 2GLQA 1EK8A 3T00A 5GRRA 1HI9A 1O25A 5JFEA 1WSVA 3GTOA 3B5QA 2JA6C 4KMAA 5FLMK 2O5IA 3GTKA 1EW9A 3T01A 5C3EC 1L0WA 2G9YA 3KD8A 4QJVA 4PABA 5EGEA 3DPCA 3FKIA 3S1MC 1DCPA 4FDJA 4YR1A 1ISEA 3AD8C 5EGHA 1VRQC 4A3KC 3S2HK 4KMUA 1O2AA 4UPHA 3GTMK 3S1RC 4A3LC 1SMYA 4XLPA 4PAAA 3GTQC 5C4JC 3TFHA 4BXXC 3TFIA 4FZBA 1O26A 1TWGC 4GTXA 4A3GK 1ZVUA 3S14C 3GTJC 1TWAC 1KHJA 4LK0A 4AYBD 4G7HA 4LRCA 3CAGA 1I50C 3GTPA 4FM9A 3S2DK 4QAXA 3TWZA 4C3HK 1WQGA 3S1NC 2XCOA 2W5XA 4WJ3M 4GTYA 2YU9A 4BXXK 3NKMA 5IOTA 1R9TA 4MIVA 4G0WA 2W5SA 4QIWL 4ZG7A 3K7AC 5TJ3A 2JA7C 4A3FK 4LQYA 4GTLA 1VGXA 1HQMA 3BP3A 1K83K 3L4JA 5C4XC 3HXAA 2R93A 4C3HC 4KAVA 3CQZC 1J6VA 3TX0A 3LXQA 1O2FB 4UOOA 2GSOA 1AJBA 3MK2A 1JOEA 2E2IC 1JVIA 1N2LA 2JA7K 2A68A 3BP8C 1ALHA 1TWCK 2D6FC 3QX3A 1F93A 3IPJA 4KDDA 3IGYB 2E2HC 2NVXA 4NWJA 3H3VL 4GTZA 2A69A 4KARA 3L4KA 3GTMC 1TWHA 4A3MK 4KMDA 4WILA 3GIRA 1ANJA 2D1GA 4KN4A 2NVTK 2E2JK 3UN3A 4KASA 2V6SA 3FKIK 1ELZA 1O98A 2BE5A 1PJ6A 4XCHA 4G7ZA 2XRGA 3LAPA 5C44C 2CW0A 1ZQ1C 4G7OA 3HKZD 4BY7C 3NKQA 1R9TK 2GAGC 1K7HA 1ALIA 1SFOK 5IJQA 1SHQA 1I6HC 3TG0A 3S16C 3RZOC 2JA5A 3M7VA 3NVLA 2NVTC 1VJEA 1Y6VA 3A8IA 2WB1D 2V6TA 3GTGK 3HOZC 1EW8A 1UV7A 1AJAA 5C44K 1FSUA 4GTBA 2XR9A 3UN5A 3OEPA 4WJ4A 4A93K 4X6AK 5LRNA 4Y52C 1XXBA 1K83C 3S17K 3AD9C 5C66A 2CFAA 3BUEA 2IUCB 1Y1VA 1XXCA 3N3YA 4NWXA 3GEHA 3ADAC 3ED4A 4LR9A 3H0GC 4C3IK 2E2IK 2NVXK 4M1XA 5L0KA 3AD7C 3GTJA 4A93C 2JA5K 2VUMC 4ILDA 1GE9A 3GTPC 3BDGA 3PO3K 2W5QA 1IW7A 4UPKA 3HKZL 1P49A 4XLNA 3GTGA 3DYCA 4LLGA 2W8SA 1ZXOA 4A3IK 5IOQA 4KB2A 4A3DK 1WQFA 4KJGA 1N2KA 4YG2A 1IS1A 1I3QK 5L46A 3WBHA 2JA7A 1F7UA 3S1QK 4KJDA 3UO0A 2W5WA 2V6UA 5IP7K 4A3MC 3ERED 3CQZA 1Y1WA 1O24A 1E3CP 5KXAA 4KMHA 2P8TA 2XCRB 1EW2A 4MEXA 2R92A 3G4CA 4LR2A 2VQRA 4BY1K 5M5YK 3I4MK 1EQRA 3Q3QA 3HOVK 1ZEFA 5AJ9A 4ZG6A 3NKRA 1XZQA 5D4DA 4KAYA 3RZDK 4A3LK 4Y7NC 1E2SP 4KM8A 3WAVA 2NVYA 1O27A 3CMRA 3FOFA 5C4JK 3T02A 2CFAB 1DCHA 4QIWD 2B63A 3DXJA 4A3GC 3PO2K 4Y52K 2A6HA 3S17C 2W5TA 4CXUA 1KHNA 1HJKA 1WOOA 2ANHA 4ZH4A 1ED9A 4BKWA 1J6XA 2ZFZA 4GTAA 4BBRC 4A3JK 5LRMA 1Y7AA 5TMFA 4YFKA 1HDHA 3NKPA 2ZUFA 1I3QA 1XZPA 5E68A 4Q4ZA 3A8KA 3GTPK 5DLWA 5K4PA 2W7VA 2JA6K 3WAYA 4GT9A 3M4OK 3I4NC 5FLMC 4G0VA 3MK0A 4NOIA 1WSRA 4KAWX 3WAXA 1SFOA 3IGZB 3H3VD 4MY4A 1B4AA 3S1QC 1O99A 3AH5A 4GTDA 4XSXA 5IP7C 1K83A 4QJVB 3AQOA 1ALJA 3HOYK 4A3KK 3M8YA 1WOPA 3S2HC 1INNA 5GOVA 1ED8A 3S1RK 1SHNA 3TFJA 4TN0A 4LRDA 4A3CC 4C3JK 1KH7A 1JQWA 2E2HK 5IYDK 1URBA 1KH9A 3FOEA 2W5VA 3HOVC 3GTKC 2QZUA 1WCMA 2R7ZK 2JH3A 4Q5SA 3NUHA 3S14K 4XSZA 3GTJK 1KHLA 1KH4A 1XXAA 1I50K 4Y7NK 1B8JA 5L0EA 1EFWA 1WQHA 1EQJA 4UORA 4G0UA 5M3MK 3FKIC 1B4BA 4J3NA 4A3EC 3LPXA 2NVQC 1AB4A 1IQ0A 3LAJA 3PO2C 3BDFA 1Y1WC 3WODA 2R7ZC 1R9TC 1KHKA 4A3FC 3A8JA 5IYBK 4KM9A 4LRFA 3GTQA 5C4XK 4ZGAA 3CQZK 4OIQA 4LJZA 1O29A 4OIPA 2W8DA 1WORA 2GAHC 4A3EK 2B63K 4BLBA 2JA8C 2IUCA 1TWGK 4LK1A 2NVQK 3N0BA 1WOSA
chains in the Genus database with same CATH topology
1AUKA 1I50A 3MMLB 3N0CA 1HQAA 3BDGB 1ZEBA 4GFQA 1ZBSA 3V4GA 2X98A 5CHPA 2GSNA 1E33P 1AJCA 5HRTA 4B56A 1URAA 4GTCA 3E2DA 1EJJA 4C3JC 3GTMA 4C2MC 4LRAA 3G4AA 2PHCB 4MHXA 4GTFA 1ZEDA 1ALKA 4LREA 4UPLA 4FDIA 4CXSA 1E1ZP 5INHA 1ELXA 1AJDA 3M8WA 1KH5A 3OREA 4LR7A 2RGRA 4LR8A 5LQQA 4GTWA 3GTLA 3H0GA 2GA3A 4P5BA 3M8ZA 3NKOA 3UN2A 4KB4A 2JA6A 1ELYA 3WAWA 3IDDA 4KATA 1BJTA 2R7ZA 3SZZA 4CYRA 1WIHA 3OT9A 5DLTA 5IOSA 3S0XA 1KQ4A 3SZYA 1F9NA 5IJSA 2VUMA 3UNYA 1ANIA 1TWFA 1O2BA 1TWGA 2ZKTA 4BLAA 3BDHA 3MK1A 1TWAA 4CYSA 4ZG9A 5LIAA 3VA7A 2KWAA 3AQPA 3A52A 5CJ9A 1EI6A 1BGWA 4UOPA 4KM4A 2IFYA 5JVOA 4UPIA 2W5RA 1TWCA 4CXKA 2E2IA 2P5MA 2XCQA 1EH1A 5IORA 3OPFA 5DLVA 4C3IC 4DDQA 2E2HA 5L0BA 2Y3PA 4KC6A 4P5AA 3NKNA 2RH6A 1DD5A 4LRBA 1O28A 4GTEA 4N7TA 3FHZA 2GSUA 2GLQA 1EK8A 3T00A 5GRRA 1O25A 5JFEA 3GTOA 3B5QA 4KMAA 3GTKA 1EW9A 3T01A 2G9YA 3KD8A 5EGEA 3DPCA 3FKIA 4FDJA 4YR1A 1ISEA 5EGHA 1O2AA 4UPHA 4FZBA 1O26A 4GTXA 1ZVUA 1KHJA 4LRCA 3CAGA 3GTPA 4FM9A 4QAXA 3TWZA 1WQGA 2XCOA 2W5XA 4GTYA 2YU9A 3NKMA 5IOTA 1R9TA 4MIVA 4G0WA 2W5SA 4ZG7A 5TJ3A 4LQYA 4GTLA 3L4JA 2R93A 4C3HC 4KAVA 3TX0A 3LXQA 4UOOA 2GSOA 1AJBA 3MK2A 1N2LA 1ALHA 3QX3A 4KDDA 3IGYB 2NVXA 4NWJA 4GTZA 4KARA 3L4KA 1TWHA 4KMDA 1ANJA 2D1GA 3UN3A 4KASA 1O98A 1ELZA 2XRGA 3LAPA 3NKQA 1K7HA 1ALIA 5IJQA 1SHQA 3TG0A 2JA5A 3M7VA 3NVLA 1Y6VA 1EW8A 1AJAA 1FSUA 4GTBA 2XR9A 3UN5A 3OEPA 5LRNA 1XXBA 5C66A 2CFAA 3BUEA 2IUCB 1Y1VA 1XXCA 3N3YA 4NWXA 3ED4A 4LR9A 4M1XA 5L0KA 3GTJA 1GE9A 4ILDA 3BDGA 2W5QA 4UPKA 1P49A 3GTGA 3DYCA 2W8SA 1ZXOA 5IOQA 4KB2A 1WQFA 4KJGA 1N2KA 1IS1A 3WBHA 2JA7A 4KJDA 3UO0A 2W5WA 3ERED 3CQZA 1Y1WA 1O24A 1E3CP 5KXAA 4KMHA 1EW2A 2XCRB 2R92A 3G4CA 4LR2A 2VQRA 3Q3QA 1ZEFA 5AJ9A 4ZG6A 3NKRA 4KAYA 1E2SP 4KM8A 3WAVA 2NVYA 1O27A 3CMRA 3FOFA 3T02A 2CFAB 2B63A 2W5TA 4CXUA 1KHNA 1HJKA 2ANHA 1ED9A 4BKWA 2ZFZA 4GTAA 5LRMA 1Y7AA 1HDHA 3NKPA 1I3QA 5DLWA 5K4PA 3WAYA 4GT9A 4G0VA 3MK0A 4KAWX 3WAXA 1SFOA 3IGZB 4MY4A 1B4AA 1O99A 3AH5A 4GTDA 1K83A 3AQOA 1ALJA 3M8YA 5GOVA 1ED8A 1SHNA 4TN0A 4LRDA 1KH7A 1URBA 1KH9A 3FOEA 2W5VA 2QZUA 1WCMA 2JH3A 3NUHA 1KHLA 1KH4A 1XXAA 1B8JA 5L0EA 1EQJA 1WQHA 4UORA 4G0UA 1B4BA 4J3NA 3LPXA 1AB4A 3LAJA 3BDFA 1KHKA 4KM9A 4LRFA 3GTQA 4ZGAA 1O29A 2W8DA 4BLBA 2IUCA 3N0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5S A;  4CYS A;  4ZG7 A;  1AUK A;  5TJ3 A;  4LQY A;  4LR2 A;  2VQR A;  4ZG9 A;  5LIA A;  4KAV A;  3A52 A;  1HQA A;  3BDG B;  1ZEB A;  3TX0 A;  3Q3Q A;  1EI6 A;  1ZEF A;  3LXQ A;  5AJ9 A;  4ZG6 A;  3NKR A;  4UOO A;  4UOP A;  2GSO A;  1AJB A;  4KAY A;  3MK2 A;  4KM4 A;  1E2S P;  1N2L A;  3WAV A;  2X98 A;  1ALH A;  1E33 P;  2GSN A;  2IFY A;  1AJC A;  3CMR A;  5HRT A;  4UPI A;  4B56 A;  2W5R A;  1URA A;  3T02 A;  4CXK A;  3IGY B;  3E2D A;  1EJJ A;  4NWJ A;  2W5T A;  4CXU A;  1KHN A;  1HJK A;  2ANH A;  1ED9 A;  4GTZ A;  4LRA A;  5LRM A;  1Y7A A;  4MHX A;  1HDH A;  3NKP A;  5DLV A;  1ZED A;  5L0B A;  1ANJ A;  2D1G A;  3NKN A;  5DLW A;  5K4P A;  3UN3 A;  2RH6 A;  1ALK A;  1O98 A;  1ELZ A;  4LRE A;  4UPL A;  4FDI A;  2XRG A;  3WAY A;  4CXS A;  4LRB A;  3MK0 A;  1E1Z P;  4N7T A;  3WAX A;  5INH A;  3IGZ B;  3NKQ A;  4MY4 A;  2GSU A;  1K7H A;  1ELX A;  1ALI A;  1AJD A;  2GLQ A;  5IJQ A;  1SHQ A;  3TG0 A;  3M7V A;  1O99 A;  3T00 A;  3NVL A;  5GRR A;  3M8W A;  1KH5 A;  1Y6V A;  4LR7 A;  1ALJ A;  3B5Q A;  1EW8 A;  4LR8 A;  1AJA A;  3M8Y A;  1FSU A;  5LQQ A;  5GOV A;  1EW9 A;  4GTW A;  1ED8 A;  1SHN A;  2XR9 A;  3T01 A;  3UN5 A;  4TN0 A;  2G9Y A;  4LRD A;  3KD8 A;  1KH7 A;  2GA3 A;  5LRN A;  5C66 A;  3M8Z A;  3NKO A;  3UN2 A;  1URB A;  5EGE A;  1KH9 A;  3DPC A;  1ELY A;  2IUC B;  4YR1 A;  2W5V A;  4FDJ A;  3WAW A;  4NWX A;  5EGH A;  2QZU A;  3IDD A;  3ED4 A;  4LR9 A;  1KHL A;  4UPH A;  1KH4 A;  3SZZ A;  1B8J A;  4CYR A;  5L0K A;  5L0E A;  1EQJ A;  4UOR A;  3BDG A;  2W5Q A;  4UPK A;  1P49 A;  3OT9 A;  3DYC A;  4GTX A;  5DLT A;  2W8S A;  3BDF A;  4KJG A;  1N2K A;  3SZY A;  1KHK A;  1KHJ A;  5IJS A;  4LRC A;  3WBH A;  4LRF A;  3UNY A;  1ANI A;  4KJD A;  4QAX A;  3TWZ A;  3UO0 A;  2W5W A;  4ZGA A;  2W5X A;  2W8D A;  4GTY A;  2ZKT A;  3NKM A;  2IUC A;  1E3C P;  5KXA A;  3BDH A;  4MIV A;  3MK1 A;  1EW2 A; 
#chains in the Genus database with same CATH topology
 1AUK A;  1I50 A;  5HL8 A;  5M3F K;  1I6V A;  1TWF C;  3MML B;  3GTO K;  3N0C A;  3S2D C;  2YU9 C;  3JST A;  4MEY A;  3HOU C;  1HQA A;  3HOX C;  3GTL K;  3BDG B;  1ZEB A;  1VLO A;  3HOW C;  2PA8 L;  4GFQ A;  2B63 C;  2JA8 K;  1ZBS A;  1BS2 A;  4JK1 A;  3K7A K;  1X31 C;  3V4G A;  2X98 A;  4LOW A;  4RMF A;  2GSN A;  2Y0S D;  5CHP A;  1AJC A;  1E33 P;  5HRT A;  4B56 A;  1URA A;  2ZUE A;  1YX2 A;  4GTC A;  3HOU K;  3HOX K;  1EJJ A;  4C3J C;  3GTM A;  3E2D A;  4A3I C;  4A3D C;  4OIN A;  2PMZ D;  4P9S A;  4C2M C;  3S1M K;  4LRA A;  3G4A A;  2PHC B;  3GTK K;  4BY7 K;  4AYB L;  4MHX A;  1TWC C;  3GEE A;  4GTF A;  2FQT A;  1SFO C;  1ZED A;  5FJ8 K;  3RZO K;  2FQO A;  1ALK A;  3GTQ K;  4LRE A;  4UPL A;  4FDI A;  4C2M K;  3TTG A;  5TMC A;  1XZQ B;  4CXS A;  1YCL A;  1E1Z P;  4YFN A;  1Y1W K;  5INH A;  4KN7 A;  1TWH C;  2O5J A;  1ELX A;  1AJD A;  5IYB C;  3M8W A;  1KH5 A;  1IL2 A;  4BBS C;  3ORE A;  3RZD C;  4LR7 A;  1ZYR A;  1YNJ A;  2RGR A;  3GSI A;  1USO A;  1Y1V C;  5M5X K;  4LR8 A;  5LQQ A;  4GTW A;  3GTL A;  1WCM C;  2JA5 C;  3H0G A;  2GA3 A;  4P5B A;  1TWF K;  1I6H K;  3M8Z A;  3NKO A;  3GTO C;  3UN2 A;  4KB4 A;  3S16 K;  2JA6 A;  1ELY A;  1XZP B;  3GTG C;  1DCO A;  3WAW A;  1F7V A;  1Y1V K;  3IDD A;  4KAT A;  1WCM K;  1BJT A;  2R7Z A;  3SZZ A;  4CYR A;  1WIH A;  4X6A C;  4C45 A;  1J98 A;  3OT9 A;  3S15 K;  2PMZ L;  5DLT A;  3GEI A;  4MQ9 A;  1PJ5 A;  5IOS A;  2Y0S L;  3S0X A;  1KQ4 A;  3SZY A;  1F9N A;  5IJS A;  2WAQ D;  1RU0 A;  2VUM A;  3UNY A;  5IYC C;  2R92 C;  1ANI A;  1USM A;  1VH2 A;  1TWF A;  1O2B A;  1TWG A;  2EBB A;  2ZKT A;  3GDZ A;  2PPB A;  4BLA A;  3BDH A;  1XPP A;  2WB1 L;  1IE0 A;  2E2J C;  1TWA A;  3MK1 A;  3EQL A;  4CYS A;  3M3Y C;  4A3C K;  1G51 A;  4ZG9 A;  5LIA A;  3VA7 A;  5IYD C;  5IP9 C;  5IYC K;  2R92 K;  1TWH K;  2KWA A;  3AQP A;  4A3B K;  4AH6 A;  5CJ9 A;  3A52 A;  1J6W A;  1EI6 A;  1BGW A;  4UOP A;  2NVY K;  4BBS K;  4KM4 A;  3HOZ K;  3M3Y K;  2R93 C;  2IFY A;  5JVO A;  4OIR A;  5IP9 K;  4UPI A;  2W5R A;  4A3B C;  4GZY A;  1TWC A;  4BY1 C;  3I4M C;  4CXK A;  1IBA A;  1C0A A;  4O2D A;  2E2I A;  3I4N K;  2P5M A;  1BDF A;  5M5W K;  3M4O C;  1TWA K;  2XCQ A;  2NVY C;  1EH1 A;  5IOR A;  3OPF A;  2PA8 D;  1YNN A;  3S1N K;  2R93 K;  5DLV A;  3H0G K;  4C3I C;  4DDQ A;  2NVX C;  2E2H A;  4OIO A;  5L0B A;  2Y3P A;  2VUM K;  4KC6 A;  4P5A A;  3NKN A;  2RH6 A;  3PO3 C;  1PJ7 A;  1V5V A;  3HOY C;  3S15 C;  1DD5 A;  4LRB A;  1O28 A;  4GTE A;  4N7T A;  4BBR K;  2WAQ L;  4A3J C;  4YFX A;  3FHZ A;  2YU9 K;  5C3E K;  3GTL C;  2GSU A;  3HOW K;  1I3Q C;  2A6E A;  2GLQ A;  1EK8 A;  3T00 A;  5GRR A;  1HI9 A;  1O25 A;  5JFE A;  1WSV A;  3GTO A;  3B5Q A;  2JA6 C;  4KMA A;  5FLM K;  2O5I A;  3GTK A;  1EW9 A;  3T01 A;  5C3E C;  1L0W A;  2G9Y A;  3KD8 A;  4QJV A;  4PAB A;  5EGE A;  3DPC A;  3FKI A;  3S1M C;  1DCP A;  4FDJ A;  4YR1 A;  1ISE A;  3AD8 C;  5EGH A;  1VRQ C;  4A3K C;  3S2H K;  4KMU A;  1O2A A;  4UPH A;  3GTM K;  3S1R C;  4A3L C;  1SMY A;  4XLP A;  4PAA A;  3GTQ C;  5C4J C;  3TFH A;  4BXX C;  3TFI A;  4FZB A;  1O26 A;  1TWG C;  4GTX A;  4A3G K;  1ZVU A;  3S14 C;  3GTJ C;  1TWA C;  1KHJ A;  4LK0 A;  4AYB D;  4G7H A;  4LRC A;  3CAG A;  1I50 C;  3GTP A;  4FM9 A;  3S2D K;  4QAX A;  3TWZ A;  4C3H K;  1WQG A;  3S1N C;  2XCO A;  2W5X A;  4WJ3 M;  4GTY A;  2YU9 A;  4BXX K;  3NKM A;  5IOT A;  1R9T A;  4MIV A;  4G0W A;  2W5S A;  4QIW L;  4ZG7 A;  3K7A C;  5TJ3 A;  2JA7 C;  4A3F K;  4LQY A;  4GTL A;  1VGX A;  1HQM A;  3BP3 A;  1K83 K;  3L4J A;  5C4X C;  3HXA A;  2R93 A;  4C3H C;  4KAV A;  3CQZ C;  1J6V A;  3TX0 A;  3LXQ A;  1O2F B;  4UOO A;  2GSO A;  1AJB A;  3MK2 A;  1JOE A;  2E2I C;  1JVI A;  1N2L A;  2JA7 K;  2A68 A;  3BP8 C;  1ALH A;  1TWC K;  2D6F C;  3QX3 A;  1F93 A;  3IPJ A;  4KDD A;  3IGY B;  2E2H C;  2NVX A;  4NWJ A;  3H3V L;  4GTZ A;  2A69 A;  4KAR A;  3L4K A;  3GTM C;  1TWH A;  4A3M K;  4KMD A;  4WIL A;  3GIR A;  1ANJ A;  2D1G A;  4KN4 A;  2NVT K;  2E2J K;  3UN3 A;  4KAS A;  2V6S A;  3FKI K;  1ELZ A;  1O98 A;  2BE5 A;  1PJ6 A;  4XCH A;  4G7Z A;  2XRG A;  3LAP A;  5C44 C;  2CW0 A;  1ZQ1 C;  4G7O A;  3HKZ D;  4BY7 C;  3NKQ A;  1R9T K;  2GAG C;  1K7H A;  1ALI A;  1SFO K;  5IJQ A;  1SHQ A;  1I6H C;  3TG0 A;  3S16 C;  3RZO C;  2JA5 A;  3M7V A;  3NVL A;  2NVT C;  1VJE A;  1Y6V A;  3A8I A;  2WB1 D;  2V6T A;  3GTG K;  3HOZ C;  1EW8 A;  1UV7 A;  1AJA A;  5C44 K;  1FSU A;  4GTB A;  2XR9 A;  3UN5 A;  3OEP A;  4WJ4 A;  4A93 K;  4X6A K;  5LRN A;  4Y52 C;  1XXB A;  1K83 C;  3S17 K;  3AD9 C;  5C66 A;  2CFA A;  3BUE A;  2IUC B;  1Y1V A;  1XXC A;  3N3Y A;  4NWX A;  3GEH A;  3ADA C;  3ED4 A;  4LR9 A;  3H0G C;  4C3I K;  2E2I K;  2NVX K;  4M1X A;  5L0K A;  3AD7 C;  3GTJ A;  4A93 C;  2JA5 K;  2VUM C;  4ILD A;  1GE9 A;  3GTP C;  3BDG A;  3PO3 K;  2W5Q A;  1IW7 A;  4UPK A;  3HKZ L;  1P49 A;  4XLN A;  3GTG A;  3DYC A;  4LLG A;  2W8S A;  1ZXO A;  4A3I K;  5IOQ A;  4KB2 A;  4A3D K;  1WQF A;  4KJG A;  1N2K A;  4YG2 A;  1IS1 A;  1I3Q K;  5L46 A;  3WBH A;  2JA7 A;  1F7U A;  3S1Q K;  4KJD A;  3UO0 A;  2W5W A;  2V6U A;  5IP7 K;  4A3M C;  3ERE D;  3CQZ A;  1Y1W A;  1O24 A;  1E3C P;  5KXA A;  4KMH A;  2P8T A;  2XCR B;  1EW2 A;  4MEX A;  2R92 A;  3G4C A;  4LR2 A;  2VQR A;  4BY1 K;  5M5Y K;  3I4M K;  1EQR A;  3Q3Q A;  3HOV K;  1ZEF A;  5AJ9 A;  4ZG6 A;  3NKR A;  1XZQ A;  5D4D A;  4KAY A;  3RZD K;  4A3L K;  4Y7N C;  1E2S P;  4KM8 A;  3WAV A;  2NVY A;  1O27 A;  3CMR A;  3FOF A;  5C4J K;  3T02 A;  2CFA B;  1DCH A;  4QIW D;  2B63 A;  3DXJ A;  4A3G C;  3PO2 K;  4Y52 K;  2A6H A;  3S17 C;  2W5T A;  4CXU A;  1KHN A;  1HJK A;  1WOO A;  2ANH A;  4ZH4 A;  1ED9 A;  4BKW A;  1J6X A;  2ZFZ A;  4GTA A;  4BBR C;  4A3J K;  5LRM A;  1Y7A A;  5TMF A;  4YFK A;  1HDH A;  3NKP A;  2ZUF A;  1I3Q A;  1XZP A;  5E68 A;  4Q4Z A;  3A8K A;  3GTP K;  5DLW A;  5K4P A;  2W7V A;  2JA6 K;  3WAY A;  4GT9 A;  3M4O K;  3I4N C;  5FLM C;  4G0V A;  3MK0 A;  4NOI A;  1WSR A;  4KAW X;  3WAX A;  1SFO A;  3IGZ B;  3H3V D;  4MY4 A;  1B4A A;  3S1Q C;  1O99 A;  3AH5 A;  4GTD A;  4XSX A;  5IP7 C;  1K83 A;  4QJV B;  3AQO A;  1ALJ A;  3HOY K;  4A3K K;  3M8Y A;  1WOP A;  3S2H C;  1INN A;  5GOV A;  1ED8 A;  3S1R K;  1SHN A;  3TFJ A;  4TN0 A;  4LRD A;  4A3C C;  4C3J K;  1KH7 A;  1JQW A;  2E2H K;  5IYD K;  1URB A;  1KH9 A;  3FOE A;  2W5V A;  3HOV C;  3GTK C;  2QZU A;  1WCM A;  2R7Z K;  2JH3 A;  4Q5S A;  3NUH A;  3S14 K;  4XSZ A;  3GTJ K;  1KHL A;  1KH4 A;  1XXA A;  1I50 K;  4Y7N K;  1B8J A;  5L0E A;  1EFW A;  1WQH A;  1EQJ A;  4UOR A;  4G0U A;  5M3M K;  3FKI C;  1B4B A;  4J3N A;  4A3E C;  3LPX A;  2NVQ C;  1AB4 A;  1IQ0 A;  3LAJ A;  3PO2 C;  3BDF A;  1Y1W C;  3WOD A;  2R7Z C;  1R9T C;  1KHK A;  4A3F C;  3A8J A;  5IYB K;  4KM9 A;  4LRF A;  3GTQ A;  5C4X K;  4ZGA A;  3CQZ K;  4OIQ A;  4LJZ A;  1O29 A;  4OIP A;  2W8D A;  1WOR A;  2GAH C;  4A3E K;  2B63 K;  4BLB A;  2JA8 C;  2IUC A;  1TWG K;  4LK1 A;  2NVQ K;  3N0B A;  1WOS A; 
#chains in the Genus database with same CATH homology
 1AUK A;  1I50 A;  3MML B;  3N0C A;  1HQA A;  3BDG B;  1ZEB A;  4GFQ A;  1ZBS A;  3V4G A;  2X98 A;  5CHP A;  2GSN A;  1E33 P;  1AJC A;  5HRT A;  4B56 A;  1URA A;  4GTC A;  3E2D A;  1EJJ A;  4C3J C;  3GTM A;  4C2M C;  4LRA A;  3G4A A;  2PHC B;  4MHX A;  4GTF A;  1ZED A;  1ALK A;  4LRE A;  4UPL A;  4FDI A;  4CXS A;  1E1Z P;  5INH A;  1ELX A;  1AJD A;  3M8W A;  1KH5 A;  3ORE A;  4LR7 A;  2RGR A;  4LR8 A;  5LQQ A;  4GTW A;  3GTL A;  3H0G A;  2GA3 A;  4P5B A;  3M8Z A;  3NKO A;  3UN2 A;  4KB4 A;  2JA6 A;  1ELY A;  3WAW A;  3IDD A;  4KAT A;  1BJT A;  2R7Z A;  3SZZ A;  4CYR A;  1WIH A;  3OT9 A;  5DLT A;  5IOS A;  3S0X A;  1KQ4 A;  3SZY A;  1F9N A;  5IJS A;  2VUM A;  3UNY A;  1ANI A;  1TWF A;  1O2B A;  1TWG A;  2ZKT A;  4BLA A;  3BDH A;  3MK1 A;  1TWA A;  4CYS A;  4ZG9 A;  5LIA A;  3VA7 A;  2KWA A;  3AQP A;  3A52 A;  5CJ9 A;  1EI6 A;  1BGW A;  4UOP A;  4KM4 A;  2IFY A;  5JVO A;  4UPI A;  2W5R A;  1TWC A;  4CXK A;  2E2I A;  2P5M A;  2XCQ A;  1EH1 A;  5IOR A;  3OPF A;  5DLV A;  4C3I C;  4DDQ A;  2E2H A;  5L0B A;  2Y3P A;  4KC6 A;  4P5A A;  3NKN A;  2RH6 A;  1DD5 A;  4LRB A;  1O28 A;  4GTE A;  4N7T A;  3FHZ A;  2GSU A;  2GLQ A;  1EK8 A;  3T00 A;  5GRR A;  1O25 A;  5JFE A;  3GTO A;  3B5Q A;  4KMA A;  3GTK A;  1EW9 A;  3T01 A;  2G9Y A;  3KD8 A;  5EGE A;  3DPC A;  3FKI A;  4FDJ A;  4YR1 A;  1ISE A;  5EGH A;  1O2A A;  4UPH A;  4FZB A;  1O26 A;  4GTX A;  1ZVU A;  1KHJ A;  4LRC A;  3CAG A;  3GTP A;  4FM9 A;  4QAX A;  3TWZ A;  1WQG A;  2XCO A;  2W5X A;  4GTY A;  2YU9 A;  3NKM A;  5IOT A;  1R9T A;  4MIV A;  4G0W A;  2W5S A;  4ZG7 A;  5TJ3 A;  4LQY A;  4GTL A;  3L4J A;  2R93 A;  4C3H C;  4KAV A;  3TX0 A;  3LXQ A;  4UOO A;  2GSO A;  1AJB A;  3MK2 A;  1N2L A;  1ALH A;  3QX3 A;  4KDD A;  3IGY B;  2NVX A;  4NWJ A;  4GTZ A;  4KAR A;  3L4K A;  1TWH A;  4KMD A;  1ANJ A;  2D1G A;  3UN3 A;  4KAS A;  1O98 A;  1ELZ A;  2XRG A;  3LAP A;  3NKQ A;  1K7H A;  1ALI A;  5IJQ A;  1SHQ A;  3TG0 A;  2JA5 A;  3M7V A;  3NVL A;  1Y6V A;  1EW8 A;  1AJA A;  1FSU A;  4GTB A;  2XR9 A;  3UN5 A;  3OEP A;  5LRN A;  1XXB A;  5C66 A;  2CFA A;  3BUE A;  2IUC B;  1Y1V A;  1XXC A;  3N3Y A;  4NWX A;  3ED4 A;  4LR9 A;  4M1X A;  5L0K A;  3GTJ A;  1GE9 A;  4ILD A;  3BDG A;  2W5Q A;  4UPK A;  1P49 A;  3GTG A;  3DYC A;  2W8S A;  1ZXO A;  5IOQ A;  4KB2 A;  1WQF A;  4KJG A;  1N2K A;  1IS1 A;  3WBH A;  2JA7 A;  4KJD A;  3UO0 A;  2W5W A;  3ERE D;  3CQZ A;  1Y1W A;  1O24 A;  1E3C P;  5KXA A;  4KMH A;  1EW2 A;  2XCR B;  2R92 A;  3G4C A;  4LR2 A;  2VQR A;  3Q3Q A;  1ZEF A;  5AJ9 A;  4ZG6 A;  3NKR A;  4KAY A;  1E2S P;  4KM8 A;  3WAV A;  2NVY A;  1O27 A;  3CMR A;  3FOF A;  3T02 A;  2CFA B;  2B63 A;  2W5T A;  4CXU A;  1KHN A;  1HJK A;  2ANH A;  1ED9 A;  4BKW A;  2ZFZ A;  4GTA A;  5LRM A;  1Y7A A;  1HDH A;  3NKP A;  1I3Q A;  5DLW A;  5K4P A;  3WAY A;  4GT9 A;  4G0V A;  3MK0 A;  4KAW X;  3WAX A;  1SFO A;  3IGZ B;  4MY4 A;  1B4A A;  1O99 A;  3AH5 A;  4GTD A;  1K83 A;  3AQO A;  1ALJ A;  3M8Y A;  5GOV A;  1ED8 A;  1SHN A;  4TN0 A;  4LRD A;  1KH7 A;  1URB A;  1KH9 A;  3FOE A;  2W5V A;  2QZU A;  1WCM A;  2JH3 A;  3NUH A;  1KHL A;  1KH4 A;  1XXA A;  1B8J A;  5L0E A;  1EQJ A;  1WQH A;  4UOR A;  4G0U A;  1B4B A;  4J3N A;  3LPX A;  1AB4 A;  3LAJ A;  3BDF A;  1KHK A;  4KM9 A;  4LRF A;  3GTQ A;  4ZGA A;  1O29 A;  2W8D A;  4BLB A;  2IUC A;  3N0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...