4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
1ELYA 3IGYB 3TG0A 1B8JA 4TN0A 3KD8A 1KH9A 1O99A 4LR9A 3NKPA 1EW2A 3BDHA 3T01A 2VQRA 2W5SA 2W5VA 1KHKA 4MY4A 3NVLA 4NWXA 2ANHA 2W5RA 3NKNA 3A52A 5LRNA 1ELZA 5GOVA 2W5WA 3Q3QA 2GLQA 4MHXA 3TX0A 3WAWA 5L0EA 2IUCA 3OT9A 1HJKA 4CXUA 1KHLA 2W5TA 3E2DA 5LQQA 4LR2A 5EGHA 1ALHA 1FSUA 3NKMA 4UOPA 3M8YA 1KH4A 4ZG9A 1ALKA 1URAA 1ANIA 3T02A 4FDIA 4GTXA 3MK2A 4UPLA 5LIAA 1P49A 1ED9A 1HDHA 4GTWA 4KJDA 3SZYA 4NWJA 5EGEA 3UN5A 4LR8A 1ZEBA 3M7VA 2GSNA 1SHNA 3M8WA 4UORA 1ALJA 4N7TA 2W5QA 1AJDA 1SHQA 1K7HA 4LR7A 4YR1A 5TJ3A 1EJJA 1ELXA 2IFYA 4ZG7A 1N2KA 4LRDA 4UOOA 5L0BA 1EI6A 1EQJA 3M8ZA 4GTZA 3WAYA 1KH5A 1E33P 1KHNA 3UN2A 4FDJA 4CXKA 5DLWA 3ED4A 1HQAA 2GA3A 4ZG6A 3MK1A 5IJQA 3UO0A 5DLVA 2RH6A 4KM4A 3LXQA 2GSUA 1ALIA 1EW8A 4ZGAA 3BDGB 5HRTA 4CXSA 3UNYA 4QAXA 4LRFA 3NKRA 4UPIA 1ED8A 1AJBA 3WAVA 5AJ9A 1E1ZP 3IGZB 4LRAA 3IDDA 4MIVA 2GSOA 2XRGA 3SZZA 2W8DA 3WBHA 1EW9A 4CYSA 4LREA 1E2SP 2D1GA 3T00A 2X98A 2QZUA 1AJCA 4KAYA 5LRMA 2ZKTA 3WAXA 4UPHA 5GRRA 4KJGA 5C66A 4B56A 1ZEDA 3B5QA 1AJAA 3BDGA 4GTYA 1ANJA 4LRCA 1O98A 1KHJA 1URBA 1AUKA 2W8SA 3NKQA 2IUCB 1KH7A 3MK0A 4LRBA 2XR9A 5KXAA 4UPKA 5IJSA 3DYCA 5INHA 3UN3A 2W5XA 3NKOA 3TWZA 1ZEFA 5K4PA 4LQYA 3BDFA 5DLTA 3CMRA 4CYRA 2G9YA 5L0KA 1Y7AA 1E3CP 4KAVA 1Y6VA 3DPCA 1N2LA
chains in the Genus database with same CATH superfamily
3GTOA 1ELYA 3GTKK 3KD8A 1TWHA 3A8IA 2A6HA 2E2HC 3BDHA 5TMFA 3HOXK 3S14K 2W5SA 2W5VA 1ZVUA 2FQOA 2PPBA 5IP7K 2W5RA 2NVYK 4GZYA 1XZQB 1O25A 3DXJA 3LAJA 1YX2A 4A93C 2GLQA 1SFOC 1TWAK 3OREA 3OT9A 4G0WA 4OIOA 2W5TA 4LR2A 4KMAA 2NVTC 2E2HA 1ALHA 4KN4A 3GTMK 3M4OK 2NVQK 1ALKA 3T02A 1K83C 4A3JK 3MK2A 5LIAA 2V6UA 3H0GK 1P49A 1ED9A 4LK0A 3SZYA 4A3FK 4NWJA 3UN5A 1JQWA 4X6AC 1I6HK 4KDDA 1SFOA 5IYDK 3M8WA 1TWCC 3S17C 4A3DK 4C2MK 2W5QA 1I6VA 3HKZD 1AJDA 1R9TK 4A3LK 5TJ3A 1XXBA 1C0AA 4YG2A 1ELXA 4ZG7A 4XSXA 1K83A 3GTOK 4LRDA 3GIRA 1EI6A 3M8ZA 4GTZA 1TWHK 3BUEA 1KHNA 3UN2A 3HOUC 4NOIA 4C3JK 4XLNA 4AH6A 5DLVA 4OIRA 4Q5SA 1TWCA 3AD9C 4MEXA 4FZBA 1ALIA 3FOFA 3VA7A 4BY1C 3BDGB 5HRTA 4CXSA 4YFKA 3UNYA 1O24A 3NKRA 1ED8A 1AJBA 3WAVA 1E1ZP 3IGZB 1YNNA 4MEYA 3IDDA 3H3VD 4MIVA 2E2HK 3HOZK 3CQZC 2Y0SD 2NVXC 1ISEA 4PAAA 3V4GA 1VH2A 5IYBC 3K7AC 1UV7A 3S1QC 2O5JA 2X98A 2V6SA 1I3QC 4A93K 2QZUA 3TTGA 5IOSA 2P8TA 1SFOK 1AB4A 1RU0A 2CFAB 1BGWA 2NVTK 2ZKTA 2XCQA 4GTAA 1ZEDA 3CQZA 3S2DC 4BKWA 2NVXA 1EQRA 1K83K 1O98A 1Y1VC 4ZH4A 1L0WA 3S2HC 4WJ3M 3S16C 4LRBA 1I3QA 4X6AK 5KXAA 1G51A 3DYCA 3A8KA 5INHA 1WSRA 1TWCK 3S17K 3TWZA 1TWGC 3BP8C 3PO3C 1ZEFA 1KQ4A 3BDFA 2G9YA 1ZYRA 2R93C 4QJVB 1HQAA 1IL2A 3PO2C 1BJTA 3GEEA 1Y1VA 1PJ7A 1Y1WC 1DD5A 1EW2A 3T01A 3HOUK 1O27A 1O2FB 1XPPA 4A3GC 4A3LC 1KHKA 5JFEA 3GTOC 4NWXA 1TWGA 3HKZL 1V5VA 4BY1K 5LRNA 1ELZA 4XLPA 5GOVA 2R93A 3Q3QA 4KM9A 3WAWA 4G7HA 4GTCA 1HJKA 2IUCA 1KHLA 1PJ6A 2FQTA 1Y1WA 2E2IC 3NKMA 4UOPA 3M8YA 1KH4A 4ZG9A 2Y3PA 3CQZK 3FKIC 2NVXK 1ZBSA 5IYBK 1HDHA 4KJDA 3K7AK 4YFNA 2A69A 3EQLA 3RZDC 3S1QK 3HOZC 1I3QK 2E2JC 1ZEBA 3MMLB 4O2DA 4ILDA 2GSNA 1VJEA 3H3VL 1ALJA 3AD7C 2E2IA 4XSZA 4LR7A 1SHQA 1EJJA 1BDFA 2P5MA 2Y0SL 1XZQA 3GTLC 3FKIA 3S2DK 1HI9A 4UOOA 1Y1VK 1KH5A 1E33P 1WQHA 3S2HK 2W7VA 3S16K 2PHCB 1VGXA 5DLWA 1IBAA 4GT9A 1EK8A 1WORA 4KATA 4QIWL 1TWGK 3PO3K 4KAWX 3S1MC 3S15C 2R93K 3GTLA 3PO2K 4LRAA 4A3KC 3HOYC 3AH5A 1Y1WK 3CAGA 3GTQC 3QX3A 4A3GK 4GTLA 1ZXOA 3SZZA 2W8DA 4A3IC 1EW9A 5C4JC 4A3CC 4AYBD 3ADAC 3T00A 1IQ0A 4KAYA 2E2IK 4GTFA 5LRMA 3WAXA 1EH1A 3GTQA 3S1NC 5GRRA 5M3MK 3B5QA 4B56A 5FJ8K 3LAPA 3BDGA 3FKIK 4LRCA 4PABA 1URBA 1USOA 5CJ9A 3RZDK 2ZUEA 3RZOC 2XR9A 4JK1A 2E2JK 1O28A 2KWAA 5IJSA 2A68A 3IPJA 3I4MC 1X31C 1F93A 4KB4A 4Y52C 3CMRA 3ERED 4BLBA 5L0KA 4KAVA 4LK1A 3GTLK 5FLMC 1O29A 3IGYB 5IYCC 3S1RC 1O99A 3NKPA 4FM9A 4QIWD 2CFAA 4KMUA 4A3MC 4BXXC 3NKNA 3S1MK 3A52A 3S15K 4BLAA 2R7ZC 3GDZA 3WODA 5IOTA 4Y7NC 2R92C 4GTEA 3TFIA 5IORA 5L0EA 4CXUA 3GSIA 4KN7A 1IS1A 5LQQA 5EGHA 4A3KK 3HOYK 1FSUA 5M5YK 2ZUFA 3GTQK 1URAA 1ANIA 5M5WK 4C45A 4A3IK 4G0UA 2EBBA 5C4JK 4A3CK 3N3YA 4QJVA 5E68A 5JVOA 4GTWA 4OINA 1VRQC 3FOEA 2WAQD 1HQMA 2R7ZA 1J6XA 4A3EC 4A3BC 1O2AA 4P5BA 1USMA 1WOOA 2R92A 2JA7C 4UORA 2ZFZA 4N7TA 3S1NK 4YR1A 1WQFA 2D6FC 1N2KA 4AYBL 5L0BA 1WSVA 4DDQA 3WAYA 4KMHA 1WQGA 2WB1D 4FDJA 3RZOK 3ED4A 1J98A 3FHZA 2GA3A 4ZG6A 2JA7A 3I4MK 1B4AA 1IW7A 2GSUA 5CHPA 2YU9C 4Y52K 4BBRC 1INNA 1EW8A 2O5IA 4ZGAA 5C3EC 3TFHA 1WOPA 2JA6C 4WILA 4KB2A 4QAXA 4LRFA 5FLMK 1F9NA 3GTJC 3GTGC 5IYCK 5C44C 3S1RK 2VUMC 4BBSC 4LJZA 1B4BA 3G4CA 4P9SA 3WBHA 1O26A 4KM8A 2PMZD 3AD8C 1YCLA 3L4KA 4A3MK 2YU9A 4BXXK 2D1GA 4C3IC 2XCOA 4KMDA 2JA6A 2R7ZK 4Y7NK 3OPFA 2R92K 1XXCA 3GTJA 3GTGA 5C4XC 2VUMA 5D4DA 2GAGC 2RGRA 4KJGA 5C66A 1XZPB 1AJAA 2PA8D 4G7OA 1ANJA 3HXAA 1KHJA 1XZPA 4M1XA 1AUKA 4G0VA 2W8SA 3S0XA 3M3YC 5IP9C 4A3EK 2A6EA 2B63C 4A3BK 4UPKA 3LPXA 1SMYA 2JA7K 2W5XA 3HOVC 2V6TA 4CYRA 4GTDA 1F7UA 1E3CP 1Y6VA 3LXQA 1N2LA 4GFQA 4MQ9A 2JA5C 3I4NC 3TG0A 1B8JA 4TN0A 1KH9A 4LR9A 2WAQL 1YNJA 5L46A 1WCMC 1VLOA 2VQRA 2B63A 4MY4A 3NVLA 2XCRB 4BY7C 2ANHA 2YU9K 4BBRK 3N0CA 5C3EK 2W5WA 2JA6K 2BE5A 3HOWC 3TX0A 2JA5A 3GTJK 1TWFC 3GTGK 4C3HC 3E2DA 5C44K 2WB1L 1F7VA 2VUMK 4BBSK 1I50C 1PJ5A 1WCMA 4LOWA 2JA8C 3AQOA 1O2BA 4FDIA 4GTXA 4UPLA 4J3NA 4C3IK 5EGEA 3NUHA 4XCHA 4LR8A 3M7VA 1TWFA 3L4JA 1SHNA 3OEPA 1DCPA 5C4XK 1JVIA 3GTPC 1I50A 4P5AA 1K7HA 2IFYA 3GTKC 2PMZL 1EQJA 3G4AA 3GEIA 3M3YK 4CXKA 5IP9K 4OIPA 3HOXC 3S14C 2B63K 1EFWA 2JH3A 3MK1A 5IJQA 3AQPA 3UO0A 2RH6A 3HOVK 1DCHA 5IP7C 3GTPA 2NVYC 4KM4A 1IE0A 4LLGA 2PA8L 1DCOA 1WOSA 4YFXA 4Q4ZA 3GTKA 4UPIA 1TWAC 4KASA 2JA5K 5IOQA 4G7ZA 3I4NK 5AJ9A 2GSOA 3JSTA 2GAHC 3GTMC 3M4OC 1WCMK 2NVQC 2XRGA 1BS2A 4OIQA 1GE9A 4A3JC 3GEHA 4LREA 1E2SP 4CYSA 2NVYA 4BY7K 3H0GC 1JOEA 2CW0A 5HL8A 5M3FK 4A3FC 1ZQ1C 1I6HC 1J6VA 3HOWK 5IYDC 1TWAA 1AJCA 1TWFK 1J6WA 4A3DC 4C3HK 1XXAA 3A8JA 4C2MC 4KC6A 3GTMA 1I50K 4WJ4A 1R9TC 4UPHA 2JA8K 5M5XK 4GTYA 3H0GA 1TWHC 3NKQA 3TFJA 4RMFA 2IUCB 1KH7A 3MK0A 4C3JC 3UN3A 4GTBA 4KARA 3NKOA 3N0BA 5K4PA 3GTPK 4LQYA 5DLTA 1R9TA 1Y7AA 1WIHA 4MHXA 5TMCA 3DPCA 3BP3A
chains in the Genus database with same CATH topology
3GTOA 1ELYA 3KD8A 1TWHA 3BDHA 2W5SA 2W5VA 1ZVUA 2W5RA 1O25A 3LAJA 2GLQA 3OREA 3OT9A 4G0WA 2W5TA 4LR2A 4KMAA 2E2HA 1ALHA 1ALKA 3T02A 3MK2A 5LIAA 1P49A 1ED9A 3SZYA 4NWJA 3UN5A 4KDDA 1SFOA 3M8WA 2W5QA 1AJDA 5TJ3A 1XXBA 1ELXA 4ZG7A 1K83A 4LRDA 1EI6A 3M8ZA 4GTZA 3BUEA 1KHNA 3UN2A 5DLVA 1TWCA 4FZBA 1ALIA 3FOFA 3VA7A 3BDGB 5HRTA 4CXSA 3UNYA 1O24A 3NKRA 1ED8A 1AJBA 3WAVA 1E1ZP 3IGZB 3IDDA 4MIVA 1ISEA 3V4GA 2X98A 2QZUA 5IOSA 1AB4A 2CFAB 1BGWA 2ZKTA 2XCQA 4GTAA 1ZEDA 3CQZA 4BKWA 2NVXA 1O98A 4LRBA 1I3QA 5KXAA 3DYCA 5INHA 3TWZA 1ZEFA 1KQ4A 3BDFA 2G9YA 1HQAA 1BJTA 1Y1VA 1DD5A 1EW2A 3T01A 1O27A 1KHKA 5JFEA 4NWXA 1TWGA 5LRNA 1ELZA 5GOVA 2R93A 3Q3QA 4KM9A 3WAWA 2IUCA 4GTCA 1HJKA 1KHLA 1Y1WA 3NKMA 4UOPA 3M8YA 1KH4A 4ZG9A 2Y3PA 1ZBSA 1HDHA 4KJDA 1ZEBA 3MMLB 4ILDA 2GSNA 1ALJA 2E2IA 4LR7A 1SHQA 1EJJA 2P5MA 3FKIA 4UOOA 1KH5A 1E33P 1WQHA 5DLWA 2PHCB 4GT9A 1EK8A 4KATA 4KAWX 3GTLA 4LRAA 3AH5A 3CAGA 3QX3A 4GTLA 1ZXOA 2W8DA 3SZZA 1EW9A 3T00A 4KAYA 4GTFA 5LRMA 3WAXA 1EH1A 3GTQA 5GRRA 4B56A 3B5QA 3LAPA 3BDGA 4LRCA 1URBA 5CJ9A 2XR9A 5IJSA 1O28A 2KWAA 4KB4A 3CMRA 3ERED 4BLBA 5L0KA 4KAVA 1O29A 3IGYB 1O99A 3NKPA 4FM9A 2CFAA 3NKNA 3A52A 4BLAA 5IOTA 4GTEA 5IORA 5L0EA 4CXUA 1IS1A 5LQQA 5EGHA 1FSUA 1URAA 1ANIA 4G0UA 3N3YA 5JVOA 4GTWA 3FOEA 2R7ZA 1O2AA 4P5BA 2R92A 4UORA 2ZFZA 4N7TA 4YR1A 1WQFA 1N2KA 5L0BA 4DDQA 3WAYA 4KMHA 1WQGA 4FDJA 3ED4A 2GA3A 3FHZA 4ZG6A 2JA7A 1B4AA 2GSUA 5CHPA 1EW8A 4ZGAA 4QAXA 4KB2A 4LRFA 1F9NA 1B4BA 3G4CA 3WBHA 1O26A 4KM8A 3L4KA 2YU9A 2D1GA 4C3IC 2XCOA 4KMDA 2JA6A 3OPFA 1XXCA 3GTJA 3GTGA 2VUMA 2RGRA 4KJGA 5C66A 1AJAA 1ANJA 1KHJA 4M1XA 1AUKA 2W8SA 4G0VA 3S0XA 4UPKA 3LPXA 2W5XA 4CYRA 4GTDA 1E3CP 1Y6VA 3LXQA 1N2LA 4GFQA 3TG0A 1B8JA 4TN0A 1KH9A 4LR9A 2VQRA 2B63A 4MY4A 3NVLA 2XCRB 2ANHA 3N0CA 2W5WA 3TX0A 2JA5A 4C3HC 3E2DA 1WCMA 3AQOA 1O2BA 4FDIA 4GTXA 4UPLA 4J3NA 5EGEA 3NUHA 4LR8A 3M7VA 1TWFA 3L4JA 1SHNA 3OEPA 1I50A 4P5AA 1K7HA 2IFYA 1EQJA 3G4AA 4CXKA 2JH3A 3MK1A 5IJQA 3AQPA 3UO0A 2RH6A 3GTPA 4KM4A 3GTKA 4UPIA 4KASA 5IOQA 5AJ9A 2GSOA 2XRGA 1GE9A 4CYSA 4LREA 1E2SP 2NVYA 1AJCA 1TWAA 1XXAA 4C2MC 4KC6A 3GTMA 4UPHA 4GTYA 3H0GA 3NKQA 2IUCB 1KH7A 3MK0A 4C3JC 3UN3A 4GTBA 4KARA 3NKOA 3N0BA 5K4PA 4LQYA 5DLTA 1R9TA 1Y7AA 1WIHA 4MHXA 3DPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELY A;  3IGY B;  3TG0 A;  1B8J A;  4TN0 A;  3KD8 A;  1KH9 A;  1O99 A;  4LR9 A;  3NKP A;  1EW2 A;  3BDH A;  3T01 A;  2VQR A;  2W5S A;  2W5V A;  1KHK A;  4MY4 A;  3NVL A;  4NWX A;  2ANH A;  2W5R A;  3NKN A;  3A52 A;  5LRN A;  1ELZ A;  5GOV A;  2W5W A;  3Q3Q A;  2GLQ A;  4MHX A;  3TX0 A;  3WAW A;  5L0E A;  2IUC A;  3OT9 A;  1HJK A;  4CXU A;  1KHL A;  2W5T A;  3E2D A;  5LQQ A;  4LR2 A;  5EGH A;  1ALH A;  1FSU A;  3NKM A;  4UOP A;  3M8Y A;  1KH4 A;  4ZG9 A;  1ALK A;  1URA A;  1ANI A;  3T02 A;  4FDI A;  4GTX A;  3MK2 A;  4UPL A;  5LIA A;  1P49 A;  1ED9 A;  1HDH A;  4GTW A;  4KJD A;  3SZY A;  4NWJ A;  5EGE A;  3UN5 A;  4LR8 A;  1ZEB A;  3M7V A;  2GSN A;  1SHN A;  3M8W A;  4UOR A;  1ALJ A;  4N7T A;  2W5Q A;  1AJD A;  1SHQ A;  1K7H A;  4LR7 A;  4YR1 A;  5TJ3 A;  1EJJ A;  1ELX A;  2IFY A;  4ZG7 A;  1N2K A;  4LRD A;  4UOO A;  5L0B A;  1EI6 A;  1EQJ A;  3M8Z A;  4GTZ A;  3WAY A;  1KH5 A;  1E33 P;  1KHN A;  3UN2 A;  4FDJ A;  4CXK A;  5DLW A;  3ED4 A;  1HQA A;  2GA3 A;  4ZG6 A;  3MK1 A;  5IJQ A;  3UO0 A;  5DLV A;  2RH6 A;  4KM4 A;  3LXQ A;  2GSU A;  1ALI A;  1EW8 A;  4ZGA A;  3BDG B;  5HRT A;  4CXS A;  3UNY A;  4QAX A;  4LRF A;  3NKR A;  4UPI A;  1ED8 A;  1AJB A;  3WAV A;  5AJ9 A;  1E1Z P;  3IGZ B;  4LRA A;  3IDD A;  4MIV A;  2GSO A;  2XRG A;  3SZZ A;  2W8D A;  3WBH A;  1EW9 A;  4CYS A;  4LRE A;  1E2S P;  2D1G A;  3T00 A;  2X98 A;  2QZU A;  1AJC A;  4KAY A;  5LRM A;  2ZKT A;  3WAX A;  4UPH A;  5GRR A;  4KJG A;  5C66 A;  4B56 A;  1ZED A;  3B5Q A;  1AJA A;  3BDG A;  4GTY A;  1ANJ A;  4LRC A;  1O98 A;  1KHJ A;  1URB A;  1AUK A;  2W8S A;  3NKQ A;  2IUC B;  1KH7 A;  3MK0 A;  4LRB A;  2XR9 A;  5KXA A;  4UPK A;  5IJS A;  3DYC A;  5INH A;  3UN3 A;  2W5X A;  3NKO A;  3TWZ A;  1ZEF A;  5K4P A;  4LQY A;  3BDF A;  5DLT A;  3CMR A;  4CYR A;  2G9Y A;  5L0K A;  1Y7A A;  1E3C P;  4KAV A;  1Y6V A;  3DPC A;  1N2L A; 
#chains in the Genus database with same CATH topology
 3GTO A;  1ELY A;  3GTK K;  3KD8 A;  1TWH A;  3A8I A;  2A6H A;  2E2H C;  3BDH A;  5TMF A;  3HOX K;  3S14 K;  2W5S A;  2W5V A;  1ZVU A;  2FQO A;  2PPB A;  5IP7 K;  2W5R A;  2NVY K;  4GZY A;  1XZQ B;  1O25 A;  3DXJ A;  3LAJ A;  1YX2 A;  4A93 C;  2GLQ A;  1SFO C;  1TWA K;  3ORE A;  3OT9 A;  4G0W A;  4OIO A;  2W5T A;  4LR2 A;  4KMA A;  2NVT C;  2E2H A;  1ALH A;  4KN4 A;  3GTM K;  3M4O K;  2NVQ K;  1ALK A;  3T02 A;  1K83 C;  4A3J K;  3MK2 A;  5LIA A;  2V6U A;  3H0G K;  1P49 A;  1ED9 A;  4LK0 A;  3SZY A;  4A3F K;  4NWJ A;  3UN5 A;  1JQW A;  4X6A C;  1I6H K;  4KDD A;  1SFO A;  5IYD K;  3M8W A;  1TWC C;  3S17 C;  4A3D K;  4C2M K;  2W5Q A;  1I6V A;  3HKZ D;  1AJD A;  1R9T K;  4A3L K;  5TJ3 A;  1XXB A;  1C0A A;  4YG2 A;  1ELX A;  4ZG7 A;  4XSX A;  1K83 A;  3GTO K;  4LRD A;  3GIR A;  1EI6 A;  3M8Z A;  4GTZ A;  1TWH K;  3BUE A;  1KHN A;  3UN2 A;  3HOU C;  4NOI A;  4C3J K;  4XLN A;  4AH6 A;  5DLV A;  4OIR A;  4Q5S A;  1TWC A;  3AD9 C;  4MEX A;  4FZB A;  1ALI A;  3FOF A;  3VA7 A;  4BY1 C;  3BDG B;  5HRT A;  4CXS A;  4YFK A;  3UNY A;  1O24 A;  3NKR A;  1ED8 A;  1AJB A;  3WAV A;  1E1Z P;  3IGZ B;  1YNN A;  4MEY A;  3IDD A;  3H3V D;  4MIV A;  2E2H K;  3HOZ K;  3CQZ C;  2Y0S D;  2NVX C;  1ISE A;  4PAA A;  3V4G A;  1VH2 A;  5IYB C;  3K7A C;  1UV7 A;  3S1Q C;  2O5J A;  2X98 A;  2V6S A;  1I3Q C;  4A93 K;  2QZU A;  3TTG A;  5IOS A;  2P8T A;  1SFO K;  1AB4 A;  1RU0 A;  2CFA B;  1BGW A;  2NVT K;  2ZKT A;  2XCQ A;  4GTA A;  1ZED A;  3CQZ A;  3S2D C;  4BKW A;  2NVX A;  1EQR A;  1K83 K;  1O98 A;  1Y1V C;  4ZH4 A;  1L0W A;  3S2H C;  4WJ3 M;  3S16 C;  4LRB A;  1I3Q A;  4X6A K;  5KXA A;  1G51 A;  3DYC A;  3A8K A;  5INH A;  1WSR A;  1TWC K;  3S17 K;  3TWZ A;  1TWG C;  3BP8 C;  3PO3 C;  1ZEF A;  1KQ4 A;  3BDF A;  2G9Y A;  1ZYR A;  2R93 C;  4QJV B;  1HQA A;  1IL2 A;  3PO2 C;  1BJT A;  3GEE A;  1Y1V A;  1PJ7 A;  1Y1W C;  1DD5 A;  1EW2 A;  3T01 A;  3HOU K;  1O27 A;  1O2F B;  1XPP A;  4A3G C;  4A3L C;  1KHK A;  5JFE A;  3GTO C;  4NWX A;  1TWG A;  3HKZ L;  1V5V A;  4BY1 K;  5LRN A;  1ELZ A;  4XLP A;  5GOV A;  2R93 A;  3Q3Q A;  4KM9 A;  3WAW A;  4G7H A;  4GTC A;  1HJK A;  2IUC A;  1KHL A;  1PJ6 A;  2FQT A;  1Y1W A;  2E2I C;  3NKM A;  4UOP A;  3M8Y A;  1KH4 A;  4ZG9 A;  2Y3P A;  3CQZ K;  3FKI C;  2NVX K;  1ZBS A;  5IYB K;  1HDH A;  4KJD A;  3K7A K;  4YFN A;  2A69 A;  3EQL A;  3RZD C;  3S1Q K;  3HOZ C;  1I3Q K;  2E2J C;  1ZEB A;  3MML B;  4O2D A;  4ILD A;  2GSN A;  1VJE A;  3H3V L;  1ALJ A;  3AD7 C;  2E2I A;  4XSZ A;  4LR7 A;  1SHQ A;  1EJJ A;  1BDF A;  2P5M A;  2Y0S L;  1XZQ A;  3GTL C;  3FKI A;  3S2D K;  1HI9 A;  4UOO A;  1Y1V K;  1KH5 A;  1E33 P;  1WQH A;  3S2H K;  2W7V A;  3S16 K;  2PHC B;  1VGX A;  5DLW A;  1IBA A;  4GT9 A;  1EK8 A;  1WOR A;  4KAT A;  4QIW L;  1TWG K;  3PO3 K;  4KAW X;  3S1M C;  3S15 C;  2R93 K;  3GTL A;  3PO2 K;  4LRA A;  4A3K C;  3HOY C;  3AH5 A;  1Y1W K;  3CAG A;  3GTQ C;  3QX3 A;  4A3G K;  4GTL A;  1ZXO A;  3SZZ A;  2W8D A;  4A3I C;  1EW9 A;  5C4J C;  4A3C C;  4AYB D;  3ADA C;  3T00 A;  1IQ0 A;  4KAY A;  2E2I K;  4GTF A;  5LRM A;  3WAX A;  1EH1 A;  3GTQ A;  3S1N C;  5GRR A;  5M3M K;  3B5Q A;  4B56 A;  5FJ8 K;  3LAP A;  3BDG A;  3FKI K;  4LRC A;  4PAB A;  1URB A;  1USO A;  5CJ9 A;  3RZD K;  2ZUE A;  3RZO C;  2XR9 A;  4JK1 A;  2E2J K;  1O28 A;  2KWA A;  5IJS A;  2A68 A;  3IPJ A;  3I4M C;  1X31 C;  1F93 A;  4KB4 A;  4Y52 C;  3CMR A;  3ERE D;  4BLB A;  5L0K A;  4KAV A;  4LK1 A;  3GTL K;  5FLM C;  1O29 A;  3IGY B;  5IYC C;  3S1R C;  1O99 A;  3NKP A;  4FM9 A;  4QIW D;  2CFA A;  4KMU A;  4A3M C;  4BXX C;  3NKN A;  3S1M K;  3A52 A;  3S15 K;  4BLA A;  2R7Z C;  3GDZ A;  3WOD A;  5IOT A;  4Y7N C;  2R92 C;  4GTE A;  3TFI A;  5IOR A;  5L0E A;  4CXU A;  3GSI A;  4KN7 A;  1IS1 A;  5LQQ A;  5EGH A;  4A3K K;  3HOY K;  1FSU A;  5M5Y K;  2ZUF A;  3GTQ K;  1URA A;  1ANI A;  5M5W K;  4C45 A;  4A3I K;  4G0U A;  2EBB A;  5C4J K;  4A3C K;  3N3Y A;  4QJV A;  5E68 A;  5JVO A;  4GTW A;  4OIN A;  1VRQ C;  3FOE A;  2WAQ D;  1HQM A;  2R7Z A;  1J6X A;  4A3E C;  4A3B C;  1O2A A;  4P5B A;  1USM A;  1WOO A;  2R92 A;  2JA7 C;  4UOR A;  2ZFZ A;  4N7T A;  3S1N K;  4YR1 A;  1WQF A;  2D6F C;  1N2K A;  4AYB L;  5L0B A;  1WSV A;  4DDQ A;  3WAY A;  4KMH A;  1WQG A;  2WB1 D;  4FDJ A;  3RZO K;  3ED4 A;  1J98 A;  3FHZ A;  2GA3 A;  4ZG6 A;  2JA7 A;  3I4M K;  1B4A A;  1IW7 A;  2GSU A;  5CHP A;  2YU9 C;  4Y52 K;  4BBR C;  1INN A;  1EW8 A;  2O5I A;  4ZGA A;  5C3E C;  3TFH A;  1WOP A;  2JA6 C;  4WIL A;  4KB2 A;  4QAX A;  4LRF A;  5FLM K;  1F9N A;  3GTJ C;  3GTG C;  5IYC K;  5C44 C;  3S1R K;  2VUM C;  4BBS C;  4LJZ A;  1B4B A;  3G4C A;  4P9S A;  3WBH A;  1O26 A;  4KM8 A;  2PMZ D;  3AD8 C;  1YCL A;  3L4K A;  4A3M K;  2YU9 A;  4BXX K;  2D1G A;  4C3I C;  2XCO A;  4KMD A;  2JA6 A;  2R7Z K;  4Y7N K;  3OPF A;  2R92 K;  1XXC A;  3GTJ A;  3GTG A;  5C4X C;  2VUM A;  5D4D A;  2GAG C;  2RGR A;  4KJG A;  5C66 A;  1XZP B;  1AJA A;  2PA8 D;  4G7O A;  1ANJ A;  3HXA A;  1KHJ A;  1XZP A;  4M1X A;  1AUK A;  4G0V A;  2W8S A;  3S0X A;  3M3Y C;  5IP9 C;  4A3E K;  2A6E A;  2B63 C;  4A3B K;  4UPK A;  3LPX A;  1SMY A;  2JA7 K;  2W5X A;  3HOV C;  2V6T A;  4CYR A;  4GTD A;  1F7U A;  1E3C P;  1Y6V A;  3LXQ A;  1N2L A;  4GFQ A;  4MQ9 A;  2JA5 C;  3I4N C;  3TG0 A;  1B8J A;  4TN0 A;  1KH9 A;  4LR9 A;  2WAQ L;  1YNJ A;  5L46 A;  1WCM C;  1VLO A;  2VQR A;  2B63 A;  4MY4 A;  3NVL A;  2XCR B;  4BY7 C;  2ANH A;  2YU9 K;  4BBR K;  3N0C A;  5C3E K;  2W5W A;  2JA6 K;  2BE5 A;  3HOW C;  3TX0 A;  2JA5 A;  3GTJ K;  1TWF C;  3GTG K;  4C3H C;  3E2D A;  5C44 K;  2WB1 L;  1F7V A;  2VUM K;  4BBS K;  1I50 C;  1PJ5 A;  1WCM A;  4LOW A;  2JA8 C;  3AQO A;  1O2B A;  4FDI A;  4GTX A;  4UPL A;  4J3N A;  4C3I K;  5EGE A;  3NUH A;  4XCH A;  4LR8 A;  3M7V A;  1TWF A;  3L4J A;  1SHN A;  3OEP A;  1DCP A;  5C4X K;  1JVI A;  3GTP C;  1I50 A;  4P5A A;  1K7H A;  2IFY A;  3GTK C;  2PMZ L;  1EQJ A;  3G4A A;  3GEI A;  3M3Y K;  4CXK A;  5IP9 K;  4OIP A;  3HOX C;  3S14 C;  2B63 K;  1EFW A;  2JH3 A;  3MK1 A;  5IJQ A;  3AQP A;  3UO0 A;  2RH6 A;  3HOV K;  1DCH A;  5IP7 C;  3GTP A;  2NVY C;  4KM4 A;  1IE0 A;  4LLG A;  2PA8 L;  1DCO A;  1WOS A;  4YFX A;  4Q4Z A;  3GTK A;  4UPI A;  1TWA C;  4KAS A;  2JA5 K;  5IOQ A;  4G7Z A;  3I4N K;  5AJ9 A;  2GSO A;  3JST A;  2GAH C;  3GTM C;  3M4O C;  1WCM K;  2NVQ C;  2XRG A;  1BS2 A;  4OIQ A;  1GE9 A;  4A3J C;  3GEH A;  4LRE A;  1E2S P;  4CYS A;  2NVY A;  4BY7 K;  3H0G C;  1JOE A;  2CW0 A;  5HL8 A;  5M3F K;  4A3F C;  1ZQ1 C;  1I6H C;  1J6V A;  3HOW K;  5IYD C;  1TWA A;  1AJC A;  1TWF K;  1J6W A;  4A3D C;  4C3H K;  1XXA A;  3A8J A;  4C2M C;  4KC6 A;  3GTM A;  1I50 K;  4WJ4 A;  1R9T C;  4UPH A;  2JA8 K;  5M5X K;  4GTY A;  3H0G A;  1TWH C;  3NKQ A;  3TFJ A;  4RMF A;  2IUC B;  1KH7 A;  3MK0 A;  4C3J C;  3UN3 A;  4GTB A;  4KAR A;  3NKO A;  3N0B A;  5K4P A;  3GTP K;  4LQY A;  5DLT A;  1R9T A;  1Y7A A;  1WIH A;  4MHX A;  5TMC A;  3DPC A;  3BP3 A; 
#chains in the Genus database with same CATH homology
 3GTO A;  1ELY A;  3KD8 A;  1TWH A;  3BDH A;  2W5S A;  2W5V A;  1ZVU A;  2W5R A;  1O25 A;  3LAJ A;  2GLQ A;  3ORE A;  3OT9 A;  4G0W A;  2W5T A;  4LR2 A;  4KMA A;  2E2H A;  1ALH A;  1ALK A;  3T02 A;  3MK2 A;  5LIA A;  1P49 A;  1ED9 A;  3SZY A;  4NWJ A;  3UN5 A;  4KDD A;  1SFO A;  3M8W A;  2W5Q A;  1AJD A;  5TJ3 A;  1XXB A;  1ELX A;  4ZG7 A;  1K83 A;  4LRD A;  1EI6 A;  3M8Z A;  4GTZ A;  3BUE A;  1KHN A;  3UN2 A;  5DLV A;  1TWC A;  4FZB A;  1ALI A;  3FOF A;  3VA7 A;  3BDG B;  5HRT A;  4CXS A;  3UNY A;  1O24 A;  3NKR A;  1ED8 A;  1AJB A;  3WAV A;  1E1Z P;  3IGZ B;  3IDD A;  4MIV A;  1ISE A;  3V4G A;  2X98 A;  2QZU A;  5IOS A;  1AB4 A;  2CFA B;  1BGW A;  2ZKT A;  2XCQ A;  4GTA A;  1ZED A;  3CQZ A;  4BKW A;  2NVX A;  1O98 A;  4LRB A;  1I3Q A;  5KXA A;  3DYC A;  5INH A;  3TWZ A;  1ZEF A;  1KQ4 A;  3BDF A;  2G9Y A;  1HQA A;  1BJT A;  1Y1V A;  1DD5 A;  1EW2 A;  3T01 A;  1O27 A;  1KHK A;  5JFE A;  4NWX A;  1TWG A;  5LRN A;  1ELZ A;  5GOV A;  2R93 A;  3Q3Q A;  4KM9 A;  3WAW A;  2IUC A;  4GTC A;  1HJK A;  1KHL A;  1Y1W A;  3NKM A;  4UOP A;  3M8Y A;  1KH4 A;  4ZG9 A;  2Y3P A;  1ZBS A;  1HDH A;  4KJD A;  1ZEB A;  3MML B;  4ILD A;  2GSN A;  1ALJ A;  2E2I A;  4LR7 A;  1SHQ A;  1EJJ A;  2P5M A;  3FKI A;  4UOO A;  1KH5 A;  1E33 P;  1WQH A;  5DLW A;  2PHC B;  4GT9 A;  1EK8 A;  4KAT A;  4KAW X;  3GTL A;  4LRA A;  3AH5 A;  3CAG A;  3QX3 A;  4GTL A;  1ZXO A;  2W8D A;  3SZZ A;  1EW9 A;  3T00 A;  4KAY A;  4GTF A;  5LRM A;  3WAX A;  1EH1 A;  3GTQ A;  5GRR A;  4B56 A;  3B5Q A;  3LAP A;  3BDG A;  4LRC A;  1URB A;  5CJ9 A;  2XR9 A;  5IJS A;  1O28 A;  2KWA A;  4KB4 A;  3CMR A;  3ERE D;  4BLB A;  5L0K A;  4KAV A;  1O29 A;  3IGY B;  1O99 A;  3NKP A;  4FM9 A;  2CFA A;  3NKN A;  3A52 A;  4BLA A;  5IOT A;  4GTE A;  5IOR A;  5L0E A;  4CXU A;  1IS1 A;  5LQQ A;  5EGH A;  1FSU A;  1URA A;  1ANI A;  4G0U A;  3N3Y A;  5JVO A;  4GTW A;  3FOE A;  2R7Z A;  1O2A A;  4P5B A;  2R92 A;  4UOR A;  2ZFZ A;  4N7T A;  4YR1 A;  1WQF A;  1N2K A;  5L0B A;  4DDQ A;  3WAY A;  4KMH A;  1WQG A;  4FDJ A;  3ED4 A;  2GA3 A;  3FHZ A;  4ZG6 A;  2JA7 A;  1B4A A;  2GSU A;  5CHP A;  1EW8 A;  4ZGA A;  4QAX A;  4KB2 A;  4LRF A;  1F9N A;  1B4B A;  3G4C A;  3WBH A;  1O26 A;  4KM8 A;  3L4K A;  2YU9 A;  2D1G A;  4C3I C;  2XCO A;  4KMD A;  2JA6 A;  3OPF A;  1XXC A;  3GTJ A;  3GTG A;  2VUM A;  2RGR A;  4KJG A;  5C66 A;  1AJA A;  1ANJ A;  1KHJ A;  4M1X A;  1AUK A;  2W8S A;  4G0V A;  3S0X A;  4UPK A;  3LPX A;  2W5X A;  4CYR A;  4GTD A;  1E3C P;  1Y6V A;  3LXQ A;  1N2L A;  4GFQ A;  3TG0 A;  1B8J A;  4TN0 A;  1KH9 A;  4LR9 A;  2VQR A;  2B63 A;  4MY4 A;  3NVL A;  2XCR B;  2ANH A;  3N0C A;  2W5W A;  3TX0 A;  2JA5 A;  4C3H C;  3E2D A;  1WCM A;  3AQO A;  1O2B A;  4FDI A;  4GTX A;  4UPL A;  4J3N A;  5EGE A;  3NUH A;  4LR8 A;  3M7V A;  1TWF A;  3L4J A;  1SHN A;  3OEP A;  1I50 A;  4P5A A;  1K7H A;  2IFY A;  1EQJ A;  3G4A A;  4CXK A;  2JH3 A;  3MK1 A;  5IJQ A;  3AQP A;  3UO0 A;  2RH6 A;  3GTP A;  4KM4 A;  3GTK A;  4UPI A;  4KAS A;  5IOQ A;  5AJ9 A;  2GSO A;  2XRG A;  1GE9 A;  4CYS A;  4LRE A;  1E2S P;  2NVY A;  1AJC A;  1TWA A;  1XXA A;  4C2M C;  4KC6 A;  3GTM A;  4UPH A;  4GTY A;  3H0G A;  3NKQ A;  2IUC B;  1KH7 A;  3MK0 A;  4C3J C;  3UN3 A;  4GTB A;  4KAR A;  3NKO A;  3N0B A;  5K4P A;  4LQY A;  5DLT A;  1R9T A;  1Y7A A;  1WIH A;  4MHX A;  3DPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...