4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
5L0EA 1SHNA 1KH9A 1KH7A 1Y7AA 1EW9A 2W8SA 1KHKA 5DLVA 4UPHA 4ZGAA 5DLTA 5K4PA 2RH6A 1AJAA 1ELYA 4KM4A 4UPKA 2QZUA 3MK1A 2W5WA 5INHA 3E2DA 3NKQA 3A52A 5LRMA 1N2LA 1ZEDA 3M8ZA 2XR9A 3MK2A 3NKMA 2D1GA 3IDDA 2XRGA 3M8WA 4MHXA 5GOVA 5LQQA 3DPCA 4GTZA 2GLQA 3SZZA 4LRAA 1E2SP 1ZEBA 5L0BA 1EW2A 1FSUA 3OT9A 5IJSA 2ANHA 4GTWA 3TWZA 5GRRA 3UNYA 3SZYA 3BDGB 3DYCA 1KHJA 3Q3QA 4KJDA 1K7HA 4UPLA 1ELZA 4LR9A 5L0KA 1KHNA 4ZG9A 1EQJA 5LIAA 1E33P 2W5XA 3B5QA 3WAVA 2W5QA 5AJ9A 1ALHA 4FDIA 4ZG6A 2GA3A 4CXKA 4GTXA 1URAA 1URBA 3IGZB 3M8YA 3MK0A 4GTYA 1B8JA 4NWXA 4LRCA 4CXSA 4MIVA 1AUKA 2W8DA 1AJCA 1KH4A 4LRFA 1ANIA 4UORA 4FDJA 4LR8A 3T02A 1AJBA 3TX0A 1ZEFA 1ALKA 3WAXA 1N2KA 2GSNA 2ZKTA 3UN2A 3NKNA 5EGEA 4LRBA 1ED9A 4QAXA 4UOPA 3NKPA 2IUCB 3BDFA 2W5VA 5HRTA 4LRDA 4UOOA 1EJJA 4KAVA 3M7VA 3WBHA 3NKRA 4MY4A 3UN5A 2G9YA 3KD8A 3T00A 2W5SA 1ELXA 5TJ3A 1ED8A 2GSUA 4LR7A 5KXAA 3IGYB 2X98A 1HQAA 4LQYA 5IJQA 3WAYA 1EW8A 4CXUA 3CMRA 3TG0A 4KJGA 3T01A 4LR2A 1ALIA 4N7TA 4CYSA 4NWJA 1E3CP 3LXQA 3WAWA 2W5TA 3ED4A 4UPIA 3NVLA 5C66A 1O98A 4B56A 1SHQA 2VQRA 1AJDA 4KAYA 4CYRA 1EI6A 2W5RA 1P49A 1O99A 2IUCA 1KH5A 1KHLA 1HJKA 1ANJA 3BDGA 4TN0A 2GSOA 5EGHA 3NKOA 4LREA 4ZG7A 1E1ZP 1Y6VA 3UO0A 2IFYA 1HDHA 3BDHA 4YR1A 5LRNA 1ALJA 5DLWA 3UN3A
chains in the Genus database with same CATH superfamily
1KH7A 1JOEA 3GTPK 5IYCC 2GAHC 2PPBA 3H3VL 3S1QC 1TWGC 4KB2A 1DCOA 3GTPA 4PAAA 3HOXC 4A93C 1F7UA 3TFIA 2QZUA 2W5WA 2JA7A 3BP3A 5IOQA 4A3MK 4C3HK 3TFHA 4A3GK 2R7ZA 1N2LA 3M8ZA 2XR9A 1F93A 3HOYC 2XCOA 3M8WA 5GOVA 4G0UA 5LQQA 1WQFA 2R7ZK 4O2DA 4LRAA 1E2SP 1EW2A 3OT9A 3GEHA 5IJSA 3TWZA 3SZYA 1IQ0A 5C3EC 4KB4A 3HOWC 1K7HA 2WAQD 5IYDC 1K83C 3PO2C 3GDZA 1O26A 1WOSA 1ZQ1C 2GAGC 1IE0A 4MEXA 1XZQB 4JK1A 3B5QA 4LR7A 1R9TA 1ALHA 4C2MC 3RZDK 3GEIA 2GA3A 3G4AA 4KC6A 3M8YA 3MK0A 4G7ZA 3IPJA 5IYCK 1YNJA 4G7HA 3AQPA 4NWXA 4MIVA 2W8DA 3JSTA 4UORA 4LR8A 4BY7K 2XCQA 5JFEA 4XLNA 3S1RK 1AB4A 5IP9C 1SMYA 2CFAB 1N2KA 3WAXA 2GSNA 3UN2A 4Y52C 4LRBA 3M3YC 2E2HK 1KQ4A 2V6UA 2W5VA 4LRDA 4UOOA 4KAVA 3H3VD 2E2HA 4MY4A 1WIHA 3OEPA 4GTLA 3A8JA 2G9YA 3HOXK 2NVYC 4YG2A 2W5SA 2R92C 2JA5K 5C3EK 4A3GC 1Y1VA 4OIOA 4C3HC 5M5WK 1K83K 3EQLA 3WAYA 1EW8A 4CXUA 5CHPA 1SFOA 4GTCA 1ALIA 1O25A 1E3CP 4KAWX 2BE5A 3S14K 4UPIA 1J6XA 4B56A 1O24A 4A3EC 4CYRA 2PHCB 3AD8C 4KN4A 1O2BA 1KHLA 3HOZK 3BDGA 1J6VA 4TN0A 3NKOA 4Q5SA 1TWGA 4BBRC 3L4JA 4YFNA 4LOWA 4ZG7A 3UO0A 4BY7C 4LK0A 1UV7A 4A3JC 3V4GA 4YR1A 1Y1WA 3FOEA 1B4BA 4AYBD 3UN3A 5L0EA 2NVTC 2V6SA 2NVQK 1KH9A 2A68A 4OINA 1KHKA 1JQWA 1BJTA 2CW0A 3GTQA 2VUMA 3S17C 1TWFA 3DXJA 3FHZA 1VLOA 5K4PA 3GTMK 1USOA 4KM9A 5D4DA 1TWHC 3E2DA 3NKQA 1EH1A 5LRMA 1WOOA 2ZUFA 2D1GA 1WCMA 3IDDA 4FZBA 2NVXK 4MHXA 4A3KK 2R92A 4KMDA 4GTZA 4A3DK 1ZEBA 3G4CA 4M1XA 3GTJA 2ANHA 5GRRA 1YCLA 1EQRA 4C3IC 3BDGB 3DYCA 3FKIC 4QJVB 2R92K 3GTGK 3GTQC 1KHJA 1X31C 1WCMK 1EK8A 4LR9A 4GTAA 1IS1A 4G0VA 4ZG9A 3HKZL 1HQMA 2JA7C 5C4JK 2B63A 2W5XA 5AJ9A 4C45A 1R9TC 4A3BC 4CXKA 4GTXA 1WOPA 1SFOC 1WSVA 1XZPB 4WJ3M 1O27A 1C0AA 4BY1C 1WORA 3GTOA 1O2FB 4GTEA 5IP7K 3I4MC 1AUKA 1AJCA 4OIRA 1AJBA 2V6TA 4XLPA 1ZEFA 1G51A 1ISEA 2ZKTA 4KATA 3NKNA 1I3QK 5EGEA 1ED9A 4QAXA 4A3FC 4AYBL 1Y1VC 4WILA 5FLMK 3GTJK 5HRTA 1BGWA 1EJJA 1I50K 3M4OC 2JA6A 2PA8L 3M7VA 4KN7A 3UN5A 3S17K 1O28A 3OPFA 4NOIA 2E2IA 5L46A 4WJ4A 3GTLC 2YU9A 3A8IA 4DDQA 1O2AA 2GSUA 3GTJC 1DCPA 1L0WA 5IOTA 1VJEA 5C4JC 4XSXA 5IJQA 3GTMA 5E68A 3CMRA 3T01A 4KASA 1XXBA 4FM9A 4A3CC 3HXAA 5TMCA 2W5TA 3N0BA 3NVLA 3K7AK 3HOUC 1O98A 3S1NK 5C66A 2VQRA 4LK1A 3S16K 1Y1WK 2D6FC 1EI6A 3ADAC 2IUCA 3AD7C 1IBAA 1ANJA 2GSOA 5EGHA 3ERED 2O5IA 1DD5A 3HOWK 2WB1D 1RU0A 5IYBK 4LREA 1TWCC 3AH5A 2JH3A 1E1ZP 2A6HA 1Y6VA 3HOVC 1EFWA 3S1MC 1HDHA 3BDHA 1Y1WC 2B63C 1SHNA 2JA8K 1EW9A 3GTMC 1I6VA 4UPHA 3CQZK 1YX2A 1AJAA 1ELYA 4KM4A 4BLBA 1TWAC 2KWAA 5INHA 1TWHA 4P9SA 4KMAA 2JA6K 3GSIA 3A52A 1ZYRA 3FKIA 1XXAA 4A93K 3M3YK 1ZEDA 3S0XA 4A3LC 1TWCA 3I4NC 2Y3PA 2YU9C 3FKIK 3DPCA 5L0BA 1TWAK 1FSUA 1TWHK 4Q4ZA 2XCRB 4RMFA 3PO2K 3I4NK 1WQGA 2VUMC 3Q3QA 3N0CA 3LPXA 1TWFC 2NVYA 2EBBA 4UPLA 3GTOK 4A3BK 3GTKC 2R93K 1KHNA 4KM8A 4BBSK 5L0KA 1EQJA 3BP8C 3S2HK 4LJZA 3WAVA 5M3MK 4C3IK 2W5QA 1F7VA 4J3NA 3IGZB 3GTOC 1I3QC 1JVIA 2PMZD 3VA7A 1R9TK 2A69A 4LRFA 4A3EK 4FDJA 2JA6C 4A3FK 3TX0A 3QX3A 4BXXC 1YNNA 5C4XK 3HKZD 3A8KA 4G7OA 3LAPA 1IL2A 3BDFA 4QIWL 4YFKA 4Y7NK 2A6EA 3PO3K 4YFXA 2E2JK 3GTLK 1BS2A 1O29A 3GEEA 3WBHA 2R93A 4GZYA 1B4AA 2O5JA 3NKRA 2E2IC 5FJ8K 3T00A 4XSZA 2VUMK 5TJ3A 3GTQK 5FLMC 3K7AC 3N3YA 3HOUK 1ED8A 1J6WA 4X6AC 1ELXA 3IGYB 3S15K 4LQYA 4KMHA 5KXAA 4KARA 4A3LK 3TG0A 4KJGA 3GTGA 4NWJA 3S2DC 1XPPA 4A3IK 3TFJA 5M5XK 4XCHA 1SHQA 3I4MK 1AJDA 1O99A 1XZQA 2NVXA 1KH5A 4A3JK 3S14C 2RGRA 2FQOA 3GTKK 2R93C 2W7VA 3GIRA 5C4XC 3CQZA 1BDFA 3GTLA 4AH6A 4BLAA 2IFYA 1ZBSA 1PJ7A 1ALJA 5LRNA 5DLWA 4PABA 1Y7AA 2W8SA 1Y1VK 5DLVA 4BBRK 4ZGAA 1F9NA 4BY1K 2PMZL 1INNA 1TWCK 1VGXA 2E2JC 5DLTA 3TTGA 2JA8C 2RH6A 3H0GK 4UPKA 1I6HC 4BXXK 3MK1A 2ZFZA 3S1RC 4X6AK 1HI9A 4A3KC 1USMA 2JA5C 4LLGA 5IORA 3MK2A 3NKMA 2XRGA 3S2DK 5HL8A 4GTFA 4ZH4A 3SZZA 2GLQA 1VH2A 2P8TA 3L4KA 4A3MC 3S1NC 4Y7NC 3PO3C 4GTWA 4C3JC 3S2HC 3NUHA 3UNYA 1VRQC 2NVYK 4GFQA 4BBSC 5M3FK 2YU9K 2R7ZC 4KMUA 1SFOK 2E2IK 4KJDA 4GTDA 1K83A 1ELZA 1TWAA 4C3JK 5LIAA 1E33P 4GTBA 2NVTK 4FDIA 4A3IC 4ZG6A 1URAA 1URBA 5IP9K 3CQZC 1TWGK 1XXCA 1B8JA 4GTYA 4P5BA 5JVOA 2Y0SL 5C44C 4C2MK 3RZDC 4LRCA 2Y0SD 4CXSA 1KH4A 1ANIA 1J98A 3T02A 2ZUEA 4BKWA 2FQTA 1I6HK 3HOVK 1ALKA 5IYBC 1IW7A 3HOYK 3GTKA 4UOPA 4MEYA 3NKPA 2IUCB 3RZOC 2B63K 2JA5A 3AD9C 3H0GC 3LAJA 4GT9A 2E2HC 3GTGC 1GE9A 1DCHA 4A3CK 5M5YK 4Y52K 1I3QA 1I50C 2P5MA 3M4OK 3KD8A 3MMLB 1ZXOA 2WAQL 3RZOK 2X98A 1HQAA 5TMFA 2WB1L 3S16C 2NVXC 1PJ5A 3AQOA 3H0GA 4ILDA 4A3DC 4LR2A 4N7TA 4CYSA 4QJVA 3LXQA 4OIPA 1WQHA 2CFAA 2PA8D 3WAWA 4QIWD 4MQ9A 1PJ6A 3ED4A 1WSRA 3CAGA 5IOSA 3WODA 4G0WA 4KAYA 3S15C 3BUEA 5IP7C 2W5RA 1P49A 5C44K 3S1MK 1HJKA 3OREA 4KDDA 1TWFK 1WCMC 1XZPA 5IYDK 2NVQC 4P5AA 3GTPC 1I50A 4OIQA 1V5VA 3HOZC 2JA7K 3S1QK 3FOFA 5CJ9A 1ZVUA
chains in the Genus database with same CATH topology
1KH7A 4KB2A 3GTPA 2QZUA 2W5WA 2JA7A 5IOQA 2R7ZA 1N2LA 3M8ZA 2XR9A 2XCOA 3M8WA 5GOVA 4G0UA 5LQQA 1WQFA 4LRAA 1E2SP 1EW2A 3OT9A 5IJSA 3TWZA 3SZYA 4KB4A 1K7HA 1O26A 3B5QA 1R9TA 1ALHA 4C2MC 2GA3A 3G4AA 4KC6A 3M8YA 3MK0A 3AQPA 4NWXA 4MIVA 2W8DA 4UORA 4LR8A 2XCQA 5JFEA 1AB4A 3WAXA 2CFAB 1N2KA 2GSNA 3UN2A 4LRBA 1KQ4A 2W5VA 4LRDA 4UOOA 4KAVA 2E2HA 4MY4A 1WIHA 3OEPA 4GTLA 2G9YA 2W5SA 1Y1VA 4C3HC 3WAYA 1EW8A 4CXUA 5CHPA 1SFOA 4GTCA 1ALIA 1O25A 1E3CP 4KAWX 4UPIA 4B56A 1O24A 4CYRA 2PHCB 1O2BA 1KHLA 3BDGA 4TN0A 3NKOA 1TWGA 3L4JA 4ZG7A 3UO0A 3V4GA 4YR1A 1Y1WA 3FOEA 1B4BA 3UN3A 5L0EA 1KH9A 1KHKA 3GTQA 1BJTA 2VUMA 1TWFA 3FHZA 5K4PA 4KM9A 3E2DA 3NKQA 1EH1A 5LRMA 2D1GA 1WCMA 3IDDA 4FZBA 4MHXA 2R92A 4KMDA 4GTZA 1ZEBA 3G4CA 4M1XA 3GTJA 2ANHA 5GRRA 4C3IC 3BDGB 3DYCA 1KHJA 1EK8A 4LR9A 4GTAA 1IS1A 4G0VA 4ZG9A 2B63A 2W5XA 5AJ9A 4CXKA 4GTXA 1O27A 3GTOA 4GTEA 1AUKA 1AJCA 1AJBA 1ZEFA 1ISEA 2ZKTA 4KATA 3NKNA 5EGEA 1ED9A 4QAXA 5HRTA 1BGWA 1EJJA 2JA6A 3M7VA 3UN5A 1O28A 3OPFA 2E2IA 2YU9A 4DDQA 1O2AA 2GSUA 5IOTA 5IJQA 3GTMA 3CMRA 3T01A 4KASA 1XXBA 4FM9A 2W5TA 3N0BA 3NVLA 1O98A 5C66A 2VQRA 1EI6A 2IUCA 1ANJA 2GSOA 5EGHA 3ERED 1DD5A 4LREA 3AH5A 2JH3A 1E1ZP 1Y6VA 1HDHA 3BDHA 1SHNA 1EW9A 4UPHA 1AJAA 1ELYA 4KM4A 4BLBA 2KWAA 5INHA 1TWHA 4KMAA 3A52A 3FKIA 1XXAA 1ZEDA 3S0XA 1TWCA 2Y3PA 3DPCA 5L0BA 1FSUA 2XCRB 1WQGA 3Q3QA 3N0CA 3LPXA 2NVYA 4UPLA 5L0KA 1KHNA 4KM8A 1EQJA 3WAVA 2W5QA 4J3NA 3IGZB 3VA7A 4LRFA 4FDJA 3TX0A 3QX3A 3LAPA 3BDFA 1O29A 3WBHA 2R93A 1B4AA 3NKRA 3T00A 5TJ3A 1ELXA 1ED8A 3N3YA 4LR7A 5KXAA 3IGYB 4LQYA 4KMHA 4KARA 3TG0A 4KJGA 3GTGA 4NWJA 1SHQA 1AJDA 1O99A 2NVXA 1KH5A 2RGRA 3CQZA 3GTLA 4BLAA 2IFYA 1ZBSA 1ALJA 5LRNA 5DLWA 1Y7AA 2W8SA 5DLVA 4ZGAA 1F9NA 5DLTA 2RH6A 4UPKA 3MK1A 2ZFZA 5IORA 3MK2A 3NKMA 2XRGA 4GTFA 2GLQA 3SZZA 3L4KA 4GTWA 4C3JC 3NUHA 3UNYA 4GFQA 4KJDA 4GTDA 1K83A 1ELZA 1TWAA 5LIAA 1E33P 4GTBA 4FDIA 4ZG6A 1URAA 1URBA 4GTYA 1XXCA 1B8JA 4P5BA 5JVOA 4LRCA 4CXSA 1KH4A 1ANIA 3T02A 4BKWA 1ALKA 3GTKA 4UOPA 3NKPA 2IUCB 2JA5A 3LAJA 4GT9A 1GE9A 1I3QA 2P5MA 3KD8A 3MMLB 1ZXOA 2X98A 1HQAA 3AQOA 3H0GA 4ILDA 4CYSA 4LR2A 4N7TA 3LXQA 1WQHA 2CFAA 3WAWA 3ED4A 3CAGA 5IOSA 4G0WA 4KAYA 3BUEA 2W5RA 1P49A 1HJKA 3OREA 4KDDA 4P5AA 1I50A 3FOFA 5CJ9A 1ZVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0E A;  1SHN A;  1KH9 A;  1KH7 A;  1Y7A A;  1EW9 A;  2W8S A;  1KHK A;  5DLV A;  4UPH A;  4ZGA A;  5DLT A;  5K4P A;  2RH6 A;  1AJA A;  1ELY A;  4KM4 A;  4UPK A;  2QZU A;  3MK1 A;  2W5W A;  5INH A;  3E2D A;  3NKQ A;  3A52 A;  5LRM A;  1N2L A;  1ZED A;  3M8Z A;  2XR9 A;  3MK2 A;  3NKM A;  2D1G A;  3IDD A;  2XRG A;  3M8W A;  4MHX A;  5GOV A;  5LQQ A;  3DPC A;  4GTZ A;  2GLQ A;  3SZZ A;  4LRA A;  1E2S P;  1ZEB A;  5L0B A;  1EW2 A;  1FSU A;  3OT9 A;  5IJS A;  2ANH A;  4GTW A;  3TWZ A;  5GRR A;  3UNY A;  3SZY A;  3BDG B;  3DYC A;  1KHJ A;  3Q3Q A;  4KJD A;  1K7H A;  4UPL A;  1ELZ A;  4LR9 A;  5L0K A;  1KHN A;  4ZG9 A;  1EQJ A;  5LIA A;  1E33 P;  2W5X A;  3B5Q A;  3WAV A;  2W5Q A;  5AJ9 A;  1ALH A;  4FDI A;  4ZG6 A;  2GA3 A;  4CXK A;  4GTX A;  1URA A;  1URB A;  3IGZ B;  3M8Y A;  3MK0 A;  4GTY A;  1B8J A;  4NWX A;  4LRC A;  4CXS A;  4MIV A;  1AUK A;  2W8D A;  1AJC A;  1KH4 A;  4LRF A;  1ANI A;  4UOR A;  4FDJ A;  4LR8 A;  3T02 A;  1AJB A;  3TX0 A;  1ZEF A;  1ALK A;  3WAX A;  1N2K A;  2GSN A;  2ZKT A;  3UN2 A;  3NKN A;  5EGE A;  4LRB A;  1ED9 A;  4QAX A;  4UOP A;  3NKP A;  2IUC B;  3BDF A;  2W5V A;  5HRT A;  4LRD A;  4UOO A;  1EJJ A;  4KAV A;  3M7V A;  3WBH A;  3NKR A;  4MY4 A;  3UN5 A;  2G9Y A;  3KD8 A;  3T00 A;  2W5S A;  1ELX A;  5TJ3 A;  1ED8 A;  2GSU A;  4LR7 A;  5KXA A;  3IGY B;  2X98 A;  1HQA A;  4LQY A;  5IJQ A;  3WAY A;  1EW8 A;  4CXU A;  3CMR A;  3TG0 A;  4KJG A;  3T01 A;  4LR2 A;  1ALI A;  4N7T A;  4CYS A;  4NWJ A;  1E3C P;  3LXQ A;  3WAW A;  2W5T A;  3ED4 A;  4UPI A;  3NVL A;  5C66 A;  1O98 A;  4B56 A;  1SHQ A;  2VQR A;  1AJD A;  4KAY A;  4CYR A;  1EI6 A;  2W5R A;  1P49 A;  1O99 A;  2IUC A;  1KH5 A;  1KHL A;  1HJK A;  1ANJ A;  3BDG A;  4TN0 A;  2GSO A;  5EGH A;  3NKO A;  4LRE A;  4ZG7 A;  1E1Z P;  1Y6V A;  3UO0 A;  2IFY A;  1HDH A;  3BDH A;  4YR1 A;  5LRN A;  1ALJ A;  5DLW A;  3UN3 A; 
#chains in the Genus database with same CATH topology
 1KH7 A;  1JOE A;  3GTP K;  5IYC C;  2GAH C;  2PPB A;  3H3V L;  3S1Q C;  1TWG C;  4KB2 A;  1DCO A;  3GTP A;  4PAA A;  3HOX C;  4A93 C;  1F7U A;  3TFI A;  2QZU A;  2W5W A;  2JA7 A;  3BP3 A;  5IOQ A;  4A3M K;  4C3H K;  3TFH A;  4A3G K;  2R7Z A;  1N2L A;  3M8Z A;  2XR9 A;  1F93 A;  3HOY C;  2XCO A;  3M8W A;  5GOV A;  4G0U A;  5LQQ A;  1WQF A;  2R7Z K;  4O2D A;  4LRA A;  1E2S P;  1EW2 A;  3OT9 A;  3GEH A;  5IJS A;  3TWZ A;  3SZY A;  1IQ0 A;  5C3E C;  4KB4 A;  3HOW C;  1K7H A;  2WAQ D;  5IYD C;  1K83 C;  3PO2 C;  3GDZ A;  1O26 A;  1WOS A;  1ZQ1 C;  2GAG C;  1IE0 A;  4MEX A;  1XZQ B;  4JK1 A;  3B5Q A;  4LR7 A;  1R9T A;  1ALH A;  4C2M C;  3RZD K;  3GEI A;  2GA3 A;  3G4A A;  4KC6 A;  3M8Y A;  3MK0 A;  4G7Z A;  3IPJ A;  5IYC K;  1YNJ A;  4G7H A;  3AQP A;  4NWX A;  4MIV A;  2W8D A;  3JST A;  4UOR A;  4LR8 A;  4BY7 K;  2XCQ A;  5JFE A;  4XLN A;  3S1R K;  1AB4 A;  5IP9 C;  1SMY A;  2CFA B;  1N2K A;  3WAX A;  2GSN A;  3UN2 A;  4Y52 C;  4LRB A;  3M3Y C;  2E2H K;  1KQ4 A;  2V6U A;  2W5V A;  4LRD A;  4UOO A;  4KAV A;  3H3V D;  2E2H A;  4MY4 A;  1WIH A;  3OEP A;  4GTL A;  3A8J A;  2G9Y A;  3HOX K;  2NVY C;  4YG2 A;  2W5S A;  2R92 C;  2JA5 K;  5C3E K;  4A3G C;  1Y1V A;  4OIO A;  4C3H C;  5M5W K;  1K83 K;  3EQL A;  3WAY A;  1EW8 A;  4CXU A;  5CHP A;  1SFO A;  4GTC A;  1ALI A;  1O25 A;  1E3C P;  4KAW X;  2BE5 A;  3S14 K;  4UPI A;  1J6X A;  4B56 A;  1O24 A;  4A3E C;  4CYR A;  2PHC B;  3AD8 C;  4KN4 A;  1O2B A;  1KHL A;  3HOZ K;  3BDG A;  1J6V A;  4TN0 A;  3NKO A;  4Q5S A;  1TWG A;  4BBR C;  3L4J A;  4YFN A;  4LOW A;  4ZG7 A;  3UO0 A;  4BY7 C;  4LK0 A;  1UV7 A;  4A3J C;  3V4G A;  4YR1 A;  1Y1W A;  3FOE A;  1B4B A;  4AYB D;  3UN3 A;  5L0E A;  2NVT C;  2V6S A;  2NVQ K;  1KH9 A;  2A68 A;  4OIN A;  1KHK A;  1JQW A;  1BJT A;  2CW0 A;  3GTQ A;  2VUM A;  3S17 C;  1TWF A;  3DXJ A;  3FHZ A;  1VLO A;  5K4P A;  3GTM K;  1USO A;  4KM9 A;  5D4D A;  1TWH C;  3E2D A;  3NKQ A;  1EH1 A;  5LRM A;  1WOO A;  2ZUF A;  2D1G A;  1WCM A;  3IDD A;  4FZB A;  2NVX K;  4MHX A;  4A3K K;  2R92 A;  4KMD A;  4GTZ A;  4A3D K;  1ZEB A;  3G4C A;  4M1X A;  3GTJ A;  2ANH A;  5GRR A;  1YCL A;  1EQR A;  4C3I C;  3BDG B;  3DYC A;  3FKI C;  4QJV B;  2R92 K;  3GTG K;  3GTQ C;  1KHJ A;  1X31 C;  1WCM K;  1EK8 A;  4LR9 A;  4GTA A;  1IS1 A;  4G0V A;  4ZG9 A;  3HKZ L;  1HQM A;  2JA7 C;  5C4J K;  2B63 A;  2W5X A;  5AJ9 A;  4C45 A;  1R9T C;  4A3B C;  4CXK A;  4GTX A;  1WOP A;  1SFO C;  1WSV A;  1XZP B;  4WJ3 M;  1O27 A;  1C0A A;  4BY1 C;  1WOR A;  3GTO A;  1O2F B;  4GTE A;  5IP7 K;  3I4M C;  1AUK A;  1AJC A;  4OIR A;  1AJB A;  2V6T A;  4XLP A;  1ZEF A;  1G51 A;  1ISE A;  2ZKT A;  4KAT A;  3NKN A;  1I3Q K;  5EGE A;  1ED9 A;  4QAX A;  4A3F C;  4AYB L;  1Y1V C;  4WIL A;  5FLM K;  3GTJ K;  5HRT A;  1BGW A;  1EJJ A;  1I50 K;  3M4O C;  2JA6 A;  2PA8 L;  3M7V A;  4KN7 A;  3UN5 A;  3S17 K;  1O28 A;  3OPF A;  4NOI A;  2E2I A;  5L46 A;  4WJ4 A;  3GTL C;  2YU9 A;  3A8I A;  4DDQ A;  1O2A A;  2GSU A;  3GTJ C;  1DCP A;  1L0W A;  5IOT A;  1VJE A;  5C4J C;  4XSX A;  5IJQ A;  3GTM A;  5E68 A;  3CMR A;  3T01 A;  4KAS A;  1XXB A;  4FM9 A;  4A3C C;  3HXA A;  5TMC A;  2W5T A;  3N0B A;  3NVL A;  3K7A K;  3HOU C;  1O98 A;  3S1N K;  5C66 A;  2VQR A;  4LK1 A;  3S16 K;  1Y1W K;  2D6F C;  1EI6 A;  3ADA C;  2IUC A;  3AD7 C;  1IBA A;  1ANJ A;  2GSO A;  5EGH A;  3ERE D;  2O5I A;  1DD5 A;  3HOW K;  2WB1 D;  1RU0 A;  5IYB K;  4LRE A;  1TWC C;  3AH5 A;  2JH3 A;  1E1Z P;  2A6H A;  1Y6V A;  3HOV C;  1EFW A;  3S1M C;  1HDH A;  3BDH A;  1Y1W C;  2B63 C;  1SHN A;  2JA8 K;  1EW9 A;  3GTM C;  1I6V A;  4UPH A;  3CQZ K;  1YX2 A;  1AJA A;  1ELY A;  4KM4 A;  4BLB A;  1TWA C;  2KWA A;  5INH A;  1TWH A;  4P9S A;  4KMA A;  2JA6 K;  3GSI A;  3A52 A;  1ZYR A;  3FKI A;  1XXA A;  4A93 K;  3M3Y K;  1ZED A;  3S0X A;  4A3L C;  1TWC A;  3I4N C;  2Y3P A;  2YU9 C;  3FKI K;  3DPC A;  5L0B A;  1TWA K;  1FSU A;  1TWH K;  4Q4Z A;  2XCR B;  4RMF A;  3PO2 K;  3I4N K;  1WQG A;  2VUM C;  3Q3Q A;  3N0C A;  3LPX A;  1TWF C;  2NVY A;  2EBB A;  4UPL A;  3GTO K;  4A3B K;  3GTK C;  2R93 K;  1KHN A;  4KM8 A;  4BBS K;  5L0K A;  1EQJ A;  3BP8 C;  3S2H K;  4LJZ A;  3WAV A;  5M3M K;  4C3I K;  2W5Q A;  1F7V A;  4J3N A;  3IGZ B;  3GTO C;  1I3Q C;  1JVI A;  2PMZ D;  3VA7 A;  1R9T K;  2A69 A;  4LRF A;  4A3E K;  4FDJ A;  2JA6 C;  4A3F K;  3TX0 A;  3QX3 A;  4BXX C;  1YNN A;  5C4X K;  3HKZ D;  3A8K A;  4G7O A;  3LAP A;  1IL2 A;  3BDF A;  4QIW L;  4YFK A;  4Y7N K;  2A6E A;  3PO3 K;  4YFX A;  2E2J K;  3GTL K;  1BS2 A;  1O29 A;  3GEE A;  3WBH A;  2R93 A;  4GZY A;  1B4A A;  2O5J A;  3NKR A;  2E2I C;  5FJ8 K;  3T00 A;  4XSZ A;  2VUM K;  5TJ3 A;  3GTQ K;  5FLM C;  3K7A C;  3N3Y A;  3HOU K;  1ED8 A;  1J6W A;  4X6A C;  1ELX A;  3IGY B;  3S15 K;  4LQY A;  4KMH A;  5KXA A;  4KAR A;  4A3L K;  3TG0 A;  4KJG A;  3GTG A;  4NWJ A;  3S2D C;  1XPP A;  4A3I K;  3TFJ A;  5M5X K;  4XCH A;  1SHQ A;  3I4M K;  1AJD A;  1O99 A;  1XZQ A;  2NVX A;  1KH5 A;  4A3J K;  3S14 C;  2RGR A;  2FQO A;  3GTK K;  2R93 C;  2W7V A;  3GIR A;  5C4X C;  3CQZ A;  1BDF A;  3GTL A;  4AH6 A;  4BLA A;  2IFY A;  1ZBS A;  1PJ7 A;  1ALJ A;  5LRN A;  5DLW A;  4PAB A;  1Y7A A;  2W8S A;  1Y1V K;  5DLV A;  4BBR K;  4ZGA A;  1F9N A;  4BY1 K;  2PMZ L;  1INN A;  1TWC K;  1VGX A;  2E2J C;  5DLT A;  3TTG A;  2JA8 C;  2RH6 A;  3H0G K;  4UPK A;  1I6H C;  4BXX K;  3MK1 A;  2ZFZ A;  3S1R C;  4X6A K;  1HI9 A;  4A3K C;  1USM A;  2JA5 C;  4LLG A;  5IOR A;  3MK2 A;  3NKM A;  2XRG A;  3S2D K;  5HL8 A;  4GTF A;  4ZH4 A;  3SZZ A;  2GLQ A;  1VH2 A;  2P8T A;  3L4K A;  4A3M C;  3S1N C;  4Y7N C;  3PO3 C;  4GTW A;  4C3J C;  3S2H C;  3NUH A;  3UNY A;  1VRQ C;  2NVY K;  4GFQ A;  4BBS C;  5M3F K;  2YU9 K;  2R7Z C;  4KMU A;  1SFO K;  2E2I K;  4KJD A;  4GTD A;  1K83 A;  1ELZ A;  1TWA A;  4C3J K;  5LIA A;  1E33 P;  4GTB A;  2NVT K;  4FDI A;  4A3I C;  4ZG6 A;  1URA A;  1URB A;  5IP9 K;  3CQZ C;  1TWG K;  1XXC A;  1B8J A;  4GTY A;  4P5B A;  5JVO A;  2Y0S L;  5C44 C;  4C2M K;  3RZD C;  4LRC A;  2Y0S D;  4CXS A;  1KH4 A;  1ANI A;  1J98 A;  3T02 A;  2ZUE A;  4BKW A;  2FQT A;  1I6H K;  3HOV K;  1ALK A;  5IYB C;  1IW7 A;  3HOY K;  3GTK A;  4UOP A;  4MEY A;  3NKP A;  2IUC B;  3RZO C;  2B63 K;  2JA5 A;  3AD9 C;  3H0G C;  3LAJ A;  4GT9 A;  2E2H C;  3GTG C;  1GE9 A;  1DCH A;  4A3C K;  5M5Y K;  4Y52 K;  1I3Q A;  1I50 C;  2P5M A;  3M4O K;  3KD8 A;  3MML B;  1ZXO A;  2WAQ L;  3RZO K;  2X98 A;  1HQA A;  5TMF A;  2WB1 L;  3S16 C;  2NVX C;  1PJ5 A;  3AQO A;  3H0G A;  4ILD A;  4A3D C;  4LR2 A;  4N7T A;  4CYS A;  4QJV A;  3LXQ A;  4OIP A;  1WQH A;  2CFA A;  2PA8 D;  3WAW A;  4QIW D;  4MQ9 A;  1PJ6 A;  3ED4 A;  1WSR A;  3CAG A;  5IOS A;  3WOD A;  4G0W A;  4KAY A;  3S15 C;  3BUE A;  5IP7 C;  2W5R A;  1P49 A;  5C44 K;  3S1M K;  1HJK A;  3ORE A;  4KDD A;  1TWF K;  1WCM C;  1XZP A;  5IYD K;  2NVQ C;  4P5A A;  3GTP C;  1I50 A;  4OIQ A;  1V5V A;  3HOZ C;  2JA7 K;  3S1Q K;  3FOF A;  5CJ9 A;  1ZVU A; 
#chains in the Genus database with same CATH homology
 1KH7 A;  4KB2 A;  3GTP A;  2QZU A;  2W5W A;  2JA7 A;  5IOQ A;  2R7Z A;  1N2L A;  3M8Z A;  2XR9 A;  2XCO A;  3M8W A;  5GOV A;  4G0U A;  5LQQ A;  1WQF A;  4LRA A;  1E2S P;  1EW2 A;  3OT9 A;  5IJS A;  3TWZ A;  3SZY A;  4KB4 A;  1K7H A;  1O26 A;  3B5Q A;  1R9T A;  1ALH A;  4C2M C;  2GA3 A;  3G4A A;  4KC6 A;  3M8Y A;  3MK0 A;  3AQP A;  4NWX A;  4MIV A;  2W8D A;  4UOR A;  4LR8 A;  2XCQ A;  5JFE A;  1AB4 A;  3WAX A;  2CFA B;  1N2K A;  2GSN A;  3UN2 A;  4LRB A;  1KQ4 A;  2W5V A;  4LRD A;  4UOO A;  4KAV A;  2E2H A;  4MY4 A;  1WIH A;  3OEP A;  4GTL A;  2G9Y A;  2W5S A;  1Y1V A;  4C3H C;  3WAY A;  1EW8 A;  4CXU A;  5CHP A;  1SFO A;  4GTC A;  1ALI A;  1O25 A;  1E3C P;  4KAW X;  4UPI A;  4B56 A;  1O24 A;  4CYR A;  2PHC B;  1O2B A;  1KHL A;  3BDG A;  4TN0 A;  3NKO A;  1TWG A;  3L4J A;  4ZG7 A;  3UO0 A;  3V4G A;  4YR1 A;  1Y1W A;  3FOE A;  1B4B A;  3UN3 A;  5L0E A;  1KH9 A;  1KHK A;  3GTQ A;  1BJT A;  2VUM A;  1TWF A;  3FHZ A;  5K4P A;  4KM9 A;  3E2D A;  3NKQ A;  1EH1 A;  5LRM A;  2D1G A;  1WCM A;  3IDD A;  4FZB A;  4MHX A;  2R92 A;  4KMD A;  4GTZ A;  1ZEB A;  3G4C A;  4M1X A;  3GTJ A;  2ANH A;  5GRR A;  4C3I C;  3BDG B;  3DYC A;  1KHJ A;  1EK8 A;  4LR9 A;  4GTA A;  1IS1 A;  4G0V A;  4ZG9 A;  2B63 A;  2W5X A;  5AJ9 A;  4CXK A;  4GTX A;  1O27 A;  3GTO A;  4GTE A;  1AUK A;  1AJC A;  1AJB A;  1ZEF A;  1ISE A;  2ZKT A;  4KAT A;  3NKN A;  5EGE A;  1ED9 A;  4QAX A;  5HRT A;  1BGW A;  1EJJ A;  2JA6 A;  3M7V A;  3UN5 A;  1O28 A;  3OPF A;  2E2I A;  2YU9 A;  4DDQ A;  1O2A A;  2GSU A;  5IOT A;  5IJQ A;  3GTM A;  3CMR A;  3T01 A;  4KAS A;  1XXB A;  4FM9 A;  2W5T A;  3N0B A;  3NVL A;  1O98 A;  5C66 A;  2VQR A;  1EI6 A;  2IUC A;  1ANJ A;  2GSO A;  5EGH A;  3ERE D;  1DD5 A;  4LRE A;  3AH5 A;  2JH3 A;  1E1Z P;  1Y6V A;  1HDH A;  3BDH A;  1SHN A;  1EW9 A;  4UPH A;  1AJA A;  1ELY A;  4KM4 A;  4BLB A;  2KWA A;  5INH A;  1TWH A;  4KMA A;  3A52 A;  3FKI A;  1XXA A;  1ZED A;  3S0X A;  1TWC A;  2Y3P A;  3DPC A;  5L0B A;  1FSU A;  2XCR B;  1WQG A;  3Q3Q A;  3N0C A;  3LPX A;  2NVY A;  4UPL A;  5L0K A;  1KHN A;  4KM8 A;  1EQJ A;  3WAV A;  2W5Q A;  4J3N A;  3IGZ B;  3VA7 A;  4LRF A;  4FDJ A;  3TX0 A;  3QX3 A;  3LAP A;  3BDF A;  1O29 A;  3WBH A;  2R93 A;  1B4A A;  3NKR A;  3T00 A;  5TJ3 A;  1ELX A;  1ED8 A;  3N3Y A;  4LR7 A;  5KXA A;  3IGY B;  4LQY A;  4KMH A;  4KAR A;  3TG0 A;  4KJG A;  3GTG A;  4NWJ A;  1SHQ A;  1AJD A;  1O99 A;  2NVX A;  1KH5 A;  2RGR A;  3CQZ A;  3GTL A;  4BLA A;  2IFY A;  1ZBS A;  1ALJ A;  5LRN A;  5DLW A;  1Y7A A;  2W8S A;  5DLV A;  4ZGA A;  1F9N A;  5DLT A;  2RH6 A;  4UPK A;  3MK1 A;  2ZFZ A;  5IOR A;  3MK2 A;  3NKM A;  2XRG A;  4GTF A;  2GLQ A;  3SZZ A;  3L4K A;  4GTW A;  4C3J C;  3NUH A;  3UNY A;  4GFQ A;  4KJD A;  4GTD A;  1K83 A;  1ELZ A;  1TWA A;  5LIA A;  1E33 P;  4GTB A;  4FDI A;  4ZG6 A;  1URA A;  1URB A;  4GTY A;  1XXC A;  1B8J A;  4P5B A;  5JVO A;  4LRC A;  4CXS A;  1KH4 A;  1ANI A;  3T02 A;  4BKW A;  1ALK A;  3GTK A;  4UOP A;  3NKP A;  2IUC B;  2JA5 A;  3LAJ A;  4GT9 A;  1GE9 A;  1I3Q A;  2P5M A;  3KD8 A;  3MML B;  1ZXO A;  2X98 A;  1HQA A;  3AQO A;  3H0G A;  4ILD A;  4CYS A;  4LR2 A;  4N7T A;  3LXQ A;  1WQH A;  2CFA A;  3WAW A;  3ED4 A;  3CAG A;  5IOS A;  4G0W A;  4KAY A;  3BUE A;  2W5R A;  1P49 A;  1HJK A;  3ORE A;  4KDD A;  4P5A A;  1I50 A;  3FOF A;  5CJ9 A;  1ZVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...