3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
4CYRA 3WAWA 1EQJA 4B56A 3NKNA 4KJGA 2X98A 1ED8A 5DLWA 1EI6A 2IFYA 4LQYA 3M8WA 3DYCA 4LR8A 5EGEA 4UORA 1E1ZP 1ZEBA 3WAYA 5LRNA 3UO0A 4GTYA 1KHKA 1KH4A 2W5QA 5LIAA 4LR9A 2XRGA 4GTWA 1ALIA 2W5WA 4UPLA 3A52A 5GRRA 4UPIA 1AJAA 2W8DA 4LR7A 3M7VA 1AJCA 3BDHA 4UPKA 1HQAA 1KHJA 5AJ9A 3T02A 1KH9A 2W8SA 1AJDA 4TN0A 1URBA 4LR2A 4CXUA 2GSUA 2IUCA 3T01A 4QAXA 1ANJA 4KJDA 5HRTA 1ELZA 1K7HA 1URAA 2ANHA 3UN2A 2RH6A 5LRMA 1SHQA 5C66A 1AJBA 4ZG7A 1ED9A 4FDIA 4LRAA 2W5VA 2ZKTA 1EW9A 4CXKA 1KHNA 3M8YA 3M8ZA 4YR1A 3WAXA 1Y6VA 2VQRA 4MHXA 4NWJA 1EW8A 1E2SP 1KHLA 3OT9A 3E2DA 5INHA 3IGZB 3IGYB 3UNYA 3NKRA 1KH5A 4CXSA 3TG0A 5LQQA 1HDHA 5IJQA 2W5TA 4N7TA 3TX0A 2IUCB 5K4PA 5L0BA 4MIVA 4LREA 4NWXA 1ZEFA 2D1GA 2W5SA 4CYSA 1ANIA 1ALJA 4KAYA 3CMRA 3DPCA 2GLQA 5EGHA 4LRCA 5IJSA 3BDFA 4KM4A 5DLVA 4FDJA 1N2KA 5GOVA 3NKPA 2XR9A 1ALKA 5L0EA 4MY4A 1SHNA 3NKOA 1Y7AA 4UOPA 1KH7A 4LRDA 3MK2A 5TJ3A 3BDGA 4KAVA 2W5XA 4UPHA 3NVLA 2QZUA 1E3CP 3WAVA 3ED4A 4ZG6A 2GSOA 2W5RA 3T00A 2G9YA 4LRBA 3SZZA 1AUKA 3TWZA 3Q3QA 5DLTA 2GA3A 1N2LA 1ELXA 1ZEDA 4GTXA 1O98A 1ELYA 1O99A 3IDDA 3B5QA 3KD8A 3LXQA 3SZYA 3WBHA 2GSNA 4UOOA 1HJKA 4LRFA 1FSUA 3UN3A 3UN5A 4GTZA 4ZG9A 1ALHA 4ZGAA 3MK1A 1P49A 1E33P 5L0KA 3BDGB 3NKMA 1B8JA 3NKQA 3MK0A 5KXAA 1EW2A 1EJJA
chains in the Genus database with same CATH superfamily
3WAWA 4OJHA 2R3VA 1TL7A 1B64A 3DRSA 5HP1B 1B0PA 4LR9A 2W7AA 3MURP 2W5WA 2A6MA 1ZAVA 3LF0A 4KKOA 1VGYA 5KFXA 4QW8A 3EJMA 4KGMA 3M30A 3QWPA 3BN7A 3EX7B 1RWVB 3CCSS 3CIMA 1C0UB 1UEKA 3AOBA 2BDPA 3WAXA 4MHXA 3WQPA 2XGQA 2Z57B 2B7CB 2KTQA 2AJ4A 4ZVTB 4F02A 2QV6A 3LP1A 1YZ7A 4PG7A 5IC6B 3UNGC 4JI5J 1CSJA 5DS7A 1QY7A 4B9UA 5G0RA 1VQMS 1BQMB 3LP2A 1YWXA 3X1LB 5FLXU 1REVB 3HJVA 3W2VB 3CB4A 2WSEC 1U1MA 4DFKA 2RB7A 4TXSA 5EWEA 2RIJA 1JIHA 1NJWA 8RUCA 3IXQA 1YI2S 4R5PB 5KG6A 4DUYJ 2MB0B 2OP5A 4AQYJ 1LWFB 2DH9A 3DRRB 1I94J 2DVIA 4ECVA 4GTZA 5HO4A 1VQ4S 4DV7F 2J9EA 1N36F 1JJ4A 1RZMA 2XYGB 4CYUB 4IR9A 2UU9F 2JDJA 2YXLA 4F3QA 5LRNA 2BE9B 1WWHA 4NPOA 3J7YU 4O3SA 2QJ3A 1PCAA 1Q53A 5HBMA 4QAXA 1UZHA 4N8OA 1SVDA 2AYGA 1ZETA 2EKNA 5E3QA 1Y3JA 3DI6B 4NWBA 2C3PA 3MMAA 3QFWA 3AY0A 1Z2LA 3CJ8A 1KVJA 4LF9J 3MCOA 5RUBA 2H51B 2MKSA 2W5TA 2IRYA 3QAUA 3M32B 2R7RA 4JI4F 2ZFHA 2XMUA 1MLAA 1L3TA 1UVIA 4H4MB 4UOPA 1IM6A 3ZZUA 2OPPA 2H5IB 3D0GE 2DCUB 4RNFA 1KLMB 4I2PA 3G4SS 3UDLA 4IQMA 5J2NA 3DU6A 4OYMA 3FFIA 2R4FA 2MKJA 3U02A 1RP5A 2AJ2A 2A10A 4JI3J 2V2ZA 1PYOB 3UO0A 1CBKA 4GKKF 4M8LA 4MIBA 1M1GA 2HNYA 1RI7A 1BXNA 1RGVA 2CJKA 2QYGA 4CRJA 4IRKA 5F8LA 1KHNA 2R7QA 4BC9A 3IWLA 4QPTA 3KK1A 3PIPQ 2HEKA 2HLTA 2DKOB 2IRUA 1R6YA 1UPMB 3HHLC 3H4BA 4F7VA 3CW2C 4FP9A 4FDJA 3DGVA 4DBQA 3Q8SB 2UUTA 4WIIA 1T9VA 2ROPA 2WTFA 2W2PP 2IPOB 2HQDA 3PYDA 4Z7CA 2DNMA 5LMUF 4EWTA 3WBHA 2BQ3A 4X84A 1DLOB 4ZGAA 4JV5F 2OTJS 2PMHA 2CG8A 2FJEB 3GYNA 2ATLA 1FWLA 1TVRA 2PI4A 1R0AB 1KHKA 2E44A 5LIAA 2XRGA 3C2PA 3MAQA 5DDRC 1QAJA 4K4SA 1QLNA 1B99A 1T9XA 1LXNA 1IKVB 1RSCA 2J0QD 4B3MJ 2MXYA 5HRTA 2ACYA 3PKMA 3OTOJ 2E9TA 2D74B 1KRPA 4MKYA 1ZH5A 1HNXJ 2OMOA 1UWAA 1B70B 2HNZA 2M0GB 2HFZA 2HYIB 1CULB 3EGZA 3V6DA 1K44A 1TKXB 5L0BA 1D09B 1FDNA 2PEHA 2IVFB 1UFWA 3LO3A 3TUPA 4Z2XA 1VHFA 5KFGA 1B7YB 2Y0SD 1XMOF 4K4WA 4NZ0A 2RE1A 1JLQA 1EAYC 2B6AB 4U96A 1FNXH 2YWHA 5C42B 1KN6A 2D3ZA 1DQ8A 2B9WA 1PGZA 3VAKA 4LVNP 1DRZA 3ZNUA 4EBDA 3QRRA 4FS2A 1KLNA 3I9V9 3TAMA 4DV4F 1PSDA 4NMXA 2KXFA 2QLXA 3JQMA 1K0TA 1HBNA 5B0DA 3LTOA 5HAOA 3NCRA 1NSAA 1OY6A 5L9NA 4B3TF 2AW0A 1XBWA 1U45A 3BH7B 4UUWA 3TJ9A 3DNCA 4UZCA 1CJKB 4C3MA 4DX5A 2V8PA 1ELOA 3AAWB 4FNHA 3N6MA 1K9MT 1E6YB 3GFHA 2PFDA 4K0KJ 1C2PA 4JV0A 3T3FA 1GTEA 3HFVA 2GIQA 1S9FA 5DM6Q 1VLOA 2RU9A 1E6VA 5DLVA 1V3ZA 3R6GB 1R43A 1RWXB 4CLYA 3L9ZA 4P2SA 1WG1A 3K0JA 3DDNA 1N33J 4LRBA 2V68A 3PFOA 3B8HA 5E3CA 2GMLA 5HLFA 1L5UA 1WC4A 4GRSA 2V0NA 3DOKA 3DDIA 1RHJB 3PJ9A 1HNVA 3GIIA 2LEPA 4CLTA 1VCTA 4M5NA 4UPIA 2B51A 5IZHA 3Q23A 1NK8A 2V9KA 1KHVA 3FEYB 4RWXA 2PT0A 4O0IA 4LJMA 4ECZA 1AJBA 4RWWA 2IA0A 4URGA 2VKZG 4LFBJ 4KH1B 2C2OB 3OJUA 4ZVUB 4RR5A 3VAIA 2XMWA 5IJQA 5KG2A 3QT8A 2HHVA 5L39A 1X4BA 3R8YA 1HWIA 2R7OA 1F60B 5H9FK 2MJNA 4AYBD 4WP9A 2MGZA 3QLHB 1XMQF 4O23A 2QA4S 2C42A 1VQOS 1D9DA 2W5RA 1PILA 3SCKE 5KG0A 3SZZA 2XZWA 5DG7A 1FVSA 2RUGA 2Z56B 4NYOA 4QYZK 2Y8YA 5F8JA 1KVIA 5BYQA 1YTYA 2HQFA 3MMCB 5F0UA 2V34A 2UVRA 1N32F 2IFYA 3PX6A 3FBFA 5GVQA 3LW5C 3LGMA 2IC3B 3BGFA 3A52A 2YNHA 3R5CA 1GXUA 2CPFA 2CVIA 3AJDA 3OPKA 2ZJRQ 4F3OA 4CWBA 2K7KA 2E7VA 4ZN3A 3T5KA 4K8RA 4UOGA 3TQ1A 2QN6B 3M8QA 3NKYA 5KFAA 2LQ9A 1K73T 3LP0A 2XCPA 2MHEA 5ETTA 2D9PA 2B4UA 2XLIA 2DNHA 2B43A 3QGHA 4LF1A 1NDCA 3SIPB 2GJ2A 2B8QA 3G82A 1YKWA 1RB0A 1Y11A 1R7IA 2NXJA 2MQMA 1WG4A 3CWJA 3ILLA 1XNRF 2C22A 1J5EJ 4ED5A 3MTJA 3JSMB 3TEGA 3R5JB 4YN3B 2E5IA 4I2QB 5C24A 5GADU 1REGX 2LU1A 4WFZA 1ZM4A 4NLDA 3OR1A 4GMKA 5HROB 1U2CA 2IM2A 2JLFA 2VB6A 2DGQA 2JFDA 4IRDA 3K59A 4EEYA 4ELVA 2GVZA 1HNZF 1X4GA 3GFXA 2XMJA 4YB6A 1HQUB 3H5UA 4OMFG 4ZCLA 4FXVA 1HD1A 4KJDA 1T02A 1G7CB 3I4HX 2ANHA 4LSNB 3FK4A 4FNIA 4RBUA 1Z4UA 2WHOA 3D2WA 1HPZA 3EDRB 4WU3A 3LPEA 3DMJB 4MK8A 3ENWA 1TV6B 2HZCA 1HHQA 1VR6A 3UFCX 4WJBA 1F2GA 5KFIA 4F26A 3C6UA 2D1GA 4EO8A 1GXLA 2FVPA 2OPSB 4OYWA 1SQEA 2CDQA 3QIDA 2UVWA 1LW2A 1RT1B 3HT0A 1UWBA 4PQUA 2P9CA 4PEOA 2VQFJ 1H98A 5E5NA 2RRBA 3PACA 3D1QA 1XJWB 4DV6J 2CUYA 2RDJA 1F0XA 5HP1A 2FGCA 4ENOA 2A18A 1U8SA 2KT2A 4UQTA 1KS2A 3JSRA 4GO7X 4QIVA 1UVMA 1RBOB 3G86A 3NXZA 2VH7A 2DHXA 3MUTP 3MCSA 2YKOA 2UXDJ 2KB2A 1C0UA 3OFGA 2GV1A 1O51A 3NY0A 2H9ZA 2BM0A 4ZA1A 4F8RA 3CJRA 1V5VA 3TA2A 2C2MB 3I31A 2I9SA 2G4BA 1KH9A 2N4CA 1WTBA 2NYIA 4N5SA 3PJWA 2IBKA 4DN0A 1BQMA 4M5JA 3SYZA 4LF6J 3CC7S 3ZZRA 1BQNB 1REVA 4NXNJ 2YQ0A 1LV5A 3W2VA 5I3UB 3RRKA 2DYAA 4JI1J 2LA6A 1VFJA 4CLSA 1P9QC 2CPIA 3BBCA 1V3SA 2QZ8A 1SIWB 4JB8B 4JUZA 4R5PA 3FUYA 4O3NA 1HNWJ 3RW7A 3OL8A 1LWFA 2HHQA 2YKPA 4CYUA 1C1CA 3MPYA 4C0BA 4A8OA 3OFEA 5KOWA 5KFPA 3O3LA 4C8ZA 4JV1A 1J2VA 2DHGA 4PG4A 4TU7A 4DQSA 5ETRA 2FHMA 1J5OB 2DNPA 3DI6A 2R7VA 2VZ9A 1S6UA 1FX4A 2AJ1A 1WD6A 1WF1A 1RA7A 2JVRA 3FRZA 1T8EA 3T02A 2ACMA 4Q0BB 3M32A 3RBZA 4OX9F 1KFDA 1K7HA 4WFAQ 3O1LA 1RDRA 3R5BA 1MMLA 4TKTA 4H4MA 2Y1RI 1B0TA 1ZAXA 3IA0A 2H4YB 3E2DA 2DRAA 1KLMA 2V8VA 1NM2A 4DX7A 4U95A 1Y4ZB 1PO6A 2BX6A 4Y6IA 4EI2A 1VQNS 2K3IA 3GILA 1UA1A 3BQ2A 2V2QA 5AXMA 3KK2B 4DPXA 2XB2D 1IBKF 3QT5A 4PYDA 3KG4A 3EWGA 1GAOA 4IH6A 1VK3A 3DOLB 3TZYA 3KUGA 3PR5B 5HI7A 2KZZA 5D15A 4TYBA 3R9LA 4C0OC 5DLWA 3GR1A 4K59A 3OFFA 2AYMA 2YWEA 1DY3A 2PMWA 3W63A 5CYQB 4NASA 4F3MA 1S99A 1Q78A 1FFWB 5GAHI 4YFUA 4DQIA 1HD0A 3MCNA 1NK9A 2RQ4A 1KKHA 3CDBA 3IAM9 3PO5A 2EKYA 2XG8A 4DR6F 2CWKA 4DSEA 1N8RT 4FZVA 2F3JA 3KG0A 4LSZB 3T6JA 3CD5A 4J9MA 3VAMA 3QGGA 1VRQC 4MIVA 2QFIA 1JNZB 1XERA 1WJ9A 4KT0C 5DGAA 3RBDA 3GG1A 1DLOA 3OL6A 4URSA 2G13A 3CCVS 1HR0F 2MKKA 3R3TA 2LXUA 1OIAA 3TUJC 3TZXA 2ZBPA 4USUA 3BR9A 1R0AA 2M8DB 1UETA 2EVZA 4I7FB 4LBHA 4USVA 3C15B 3A8IA 1IKVA 4DQQA 2CNKB 5KFHA 4ZLJA 3HFKA 3AQOA 2M88A 1WACA 1RCXB 5IOLA 1KHJA 1CULA 1JJCB 2IMWP 4X66J 4WFYA 3SCIE 4DR3J 1TKXA 2DGUA 1VQLS 2F5GA 4H54A 4DUZF 4NA1A 3ZTSA 5F8IA 3TRGA 4A8WA 2IJNA 2D7SA 4EO6A 5KG4A 4M5IA 3C8YA 1S7IA 2FZKB 2CJAA 2RHSB 2JEIA 3AJ2A 2DNYA 3LQVA 2M3DA 2K7JA 1SJRA 1DBDA 3G87A 1FXRA 2B6AA 2CAJA 4ID8A 3M2RB 2W2QP 3GIMA 2AEFA 2W7OA 5JXSA 5C42A 4X4PA 2HG4A 3G6VA 2W1BA 4GO5X 5TJ3A 2YKNB 2LKZA 2WOMB 1UJ6A 2CQ3A 1N48A 4M5DB 3E51A 5KFNA 4I6AA 2F40A 2M9KA 2I6WA 1JWWA 2YX4A 4A8QA 2MZJA 4ES1A 5KFFA 1CJKA 3IGVA 3N79A 3L95X 4AT1B 3I6PA 2HFOA 1K0VA 1X4HA 3P8BB 1J27A 1E6YA 3CCMS 2P5VA 3DCAA 1WSVA 2DO0A 2VD3A 1CG2A 1FVQA 5DZ7A 2IM1A 4OJ1A 4OX8A 3N5FA 4IOAQ 2KRRA 4NEYA 3SI8A 2GHVC 1MMNA 2KXHA 5JJBA 4WXWA 5DJBA 4MKAA 4OLPA 3B78A 3G96A 4UOHA 1F3FA 2W5SA 3CD7A 3S7RA 5J2QB 2MQQA 3FDSA 4L76A 3BQ1A 3NL0A 4WU2A 1VQKS 1FE0A 1AA1B 3GV7B 4KHMA 3EM1A 5KFKA 1N0VC 4QQBA 1W2BR 2IHR1 5U47A 3DRYA 3FNNA 1FWKA 2GX8A 4JI6F 2HS4A 2SXLA 2B9EA 3KD8A 1KDNA 3BREA 3LWLA 1WOPA 3LGNA 1OYDA 3M05A 4BCAA 4H4KC 1JLEB 2HURA 4AUKA 3M2UB 3VVUA 2XY5A 2F7VA 3CXCR 4ZVOB 2ZOMA 2LXIA 2E1CA 4MTPA 1YJRA 3N0VA 5E0OA 3TVYA 1S10A 1KFSA 4NLPA 2AX0A 3ETMA 1U24A 4CLZA 4FYYB 3T6BA 1U1LA 3KLVA 3OT9A 3R1LA 3QLHA 3B4MA 4HKQA 2K1RB 1SJFA 1YHQS 3WC0A 4C48A 2IBOA 1URRA 1XMBA 3G8QA 4CNYA 1KQSR 2WBMA 4Z37A 4P7VA 1DJ0A 5EN1A 4LVOP 1CJTB 3MMCA 2PEBA 1NHKL 3NOGA 2XO6A 2JEGA 4B3SJ 3QMQA 4G1PA 2GA3A 2IC3A 4BLGA 3KLHB 1SB6A 4X62J 2CQIA 3IMQJ 3EPGA 1MMDA 2P6SA 3MK1A 4ZPAA 2FJDB 1NZAA 3MZIA 4JI5F 4K2JA 2ASJA 2JX2A 1QVGR 4RX6A 2AP6A 3GONA 1U1KA 4LMZA 3WDOA 4O3PA 5HJXA 1JLGB 5F41A 2O67A 4CLKA 4KY3A 1NSKL 3JTNA 3IR5B 2MQOA 2RVJA 5L1IA 3NCQA 2BKOA 4OZ0A 3VV2B 4DUYF 4PAAA 3IRXB 5ADZA 1VC5A 4AQYF 1I94F 4ATNA 4IOBA 7AT1B 3QNWB 1LEOA 4YB1P 3IS9B 3N4WA 1NB7A 4CT8A 2JLGA 2H4WB 2KG1A 3JSMA 2EWHA 4JI7J 2M7SA 2XZTB 4BDPA 2VG7B 4I2QA 1X9MA 1G6BA 3VR1A 4RJVA 4ED6A 2KFYA 3ED4A 2ZHOA 1L3KA 5HROA 2VA2A 1OS5A 3M2VB 2C3OA 4LF9F 1N2LA 1N5QA 4Y2MA 2Q43A 2GSNA 3M8PB 2NXEA 4EBEA 1F9EB 3OVAA 1M5OC 1HQUA 4DV3J 1R3NA 4USHA 4LSNA 1Q79A 2DRDA 3N5BA 2QL9B 8ATCB 2ZUAA 5K8OA 4HHHA 4I6YA 2OEKA 3DMJA 4RBTA 1AJAA 1TV6A 3OLAA 1MWYA 5CD4A 2CJ9A 3NEKA 4NX9A 3KDNA 2OPSA 1RUSA 3KYLA 3E3XA 2ZH6A 5CAAA 2KU7A 1RT1A 1T9YA 3DXBA 2DPJA 3H98A 4F0MA 3EUNA 4JI3F 1S12A 3A13A 1G2EA 2BJ3A 3L7UA 5I42B 1YJVA 3J7Z5 5IXUA 2Z4PA 3NKPA 4CLWA 1ALKA 1S97A 1GMWD 4DPTA 2ERRA 1RAFB 2XCAA 3FGVA 1KSPA 1GK8A 4XIUA 3BB5A 2GSOA 4AL6A 1RKJA 1RTHB 3LALA 3N6LA 4EK2A 3JTOA 3GV8B 4O44B 2XS7A 2B7BB 1UW4A 3R97A 3J81Y 2KG0A 1ALHA 3V81B 1UFKA 5MLCV 3BGRB 4ZS6A 4KJGA 2RF2B 3WIVA 2NZ4A 2LFVA 1BQNA 1BLUA 2CJQA 4HTJA 2XHCA 4YHHJ 5I3UA 2ZBQA 1Y10A 1QE1B 3OJSA 4CT9A 4DSIA 3NS5A 3ZZ0A 2LEAA 3TO8A 4FS1A 4NLVA 3GV5B 1U09A 3HZGA 1VYAA 2I38A 2KHCA 4CLPA 2LDIA 2OKQA 1NCLA 3Q2SC 2V8DA 2OLWA 1Y00A 4EYHB 5C7PA 3JTPA 4HL9A 4I56A 4G65A 3JXOA 5C2GA 3L7PA 4KAVA 4F4AA 2PO4A 3BBBA 1J5OA 2VIHA 2HHPA 2AJFE 2VC0A 3OTOF 2KDOA 3LUYA 2G9YA 3QGPA 2XWXA 3H42A 1HNXF 1Q8BA 4HYKA 3VAFA 1FJGJ 5GMEA 4Q0BA 2HGMA 4W4MA 3ENVA 1JJHA 4M5MA 2HHXA 3UD4P 2KFZA 2D3O1 3CVKA 2FJXA 2E9RX 1FRHA 4IR1A 1VJQA 4KYZA 2G0IA 4WKRA 2GAGC 4NLSA 3CSKA 2HNDB 1RKIA 1ED9A 2RDIA 1TK5A 1U26A 2FPHX 1P9YA 4X4VA 2R2UA 3DLGB 4HH1A 3KK2A 1T0TV 5C25B 3G2XA 4PZVA 5LQQA 4ILLA 1OO0B 1DQAA 3ONQA 4DL7A 4MK7A 2DR5A 1WNEA 4RW6B 1YBUA 3CC2S 2G1DA 2XBPA 2FHJD 2RH3A 3ZZPA 4KFBB 3DOLA 4ZPTR 2ZH8A 2HQIA 1RLCL 4OI6A 2ZD1A 4CIOA 3B54A 4F50A 1BC6A 2ZOFA 4B3RJ 1LXJA 5CYQA 4YDXA 3NGKA 3NGSA 1L3VA 2XWYA 4P9SA 1F5CA 1HJKA 3SFGA 4K0KF 2JHEA 3CULA 4CO5A 4QWAA 1QAYA 3Q8QB 4WWSA 2FZGB 1QSYA 5DDOC 3GR0A 1RWKB 1FESA 4QWDA 2V63A 1NDKA 4CTAB 3RGIA 1H72C 4M1KA 4RL1A 1N33F 1HI8A 5HVHA 2EFQA 1MN9A 1FDDA 1D9AA 2HRTA 3GCWP 1EW8A 3DRPB 2JC1A 2C2KB 1VBKA 2VG6B 3UNYA 1XK8A 3J80Y 3QO9B 4ZPCA 2B3TB 4I7FA 2NZCA 4ZVEA 3GIKA 4BBYA 3PTWA 2UUAJ 3KJVB 5IT9U 3C15A 2VJUA 4ALZA 2G1HA 3VZHA 3Q89A 2W5XA 1YRUA 3J80U 5KFOA 2VG5B 5EX0A 2BZ2A 3TX8A 3QT7A 1FCAA 5F8GA 4LFBF 1RYRA 1QTNB 4DX8H 4OLOA 1AUSL 2C3MA 3D3BJ 1TAQA 5AE2A 4E2FB 4I1TA 1H73A 4Q2LA 5GADI 1HWJA 3FQLA 3AB4B 3W9IA 2DGVA 2XEXA 1SQGA 2ZH2A 3CIZA 1AJCA 2NSCA 1UAWA 4ID5B 2IAJB 3D4JA 3WHIA 1IBLJ 3M2RA 4AXJA 2KXNB 2VV5A 1FD8A 4K7QA 2ZNZA 4H4OB 1NK7A 3CJ5A 1PJ7A 3OXFA 2Q6BA 2QLJB 4DLGA 4DSJA 4LUBA 2YKNA 3AODA 3M6WA 2WOMA 4PWUA 3BN4A 3T1HJ 4NYPA 1HLWA 4M5DA 4J9LA 1TFYA 3GB0A 1IXKA 2MMYA 5FDLB 1ZTWA 1UEVA 1YLXA 1SQFA 4EGLA 2A2DA 1KOHA 2EG2A 3O8WA 3RB4A 3W5ZA 4RW8B 4ZDNA 1PBAA 1R8CA 3FBCA 3MAHA 2VICA 3CMQA 2NQPA 1NRKA 3CD0A 1CC7A 1OY8A 2N7YA 2QYCA 4DHVA 1IJFB 3T5LA 2CQHA 3CDWA 1U6BA 2DXDA 1P1LA 2WONB 2OIHA 4DFPA 4ED2A 2J5AA 5H1SV 2DNGA 5GAEU 3CCZA 3OTBA 3KHHA 1PIEA 2DEJA 4RUCA 3CF5Q 5J2QA 3IRWP 2D1CA 3RR7A 2AHOB 4J9PA 5HL7Q 2GAHC 1S49A 4I67A 2IM0A 1HDHA 4A47A 4I68A 3GU0A 1VDHA 2ZHAA 3CCTA 1R89A 1NK4A 2AIRB 3HX9A 3LWMA 5A8KB 2H48B 4ANEA 1N2KA 4OZJA 2RKIB 5D0GA 3X3UA 2DXFA 2RAQA 4KR0B 4DV1J 4I64A 2AT1B 4WP8A 2Y1JA 1JLEA 2HS0A 2Y8WA 1AW0A 3HF5A 3M2UA 1S6OA 2MLYA 4C8LA 4MAKA 1B7FA 2APOA 3OQ2A 2VBZA 1XEZA 3CUNA 1F5BA 1KNZA 2JSXA 2XR9A 3DLJA 2QSWA 4TQSA 1SKWA 5CD4H 2HZVA 1DTTB 2CVEA 2XQCA 1A9NB 3G6ES 4ZHRB 1S79A 5L8RC 3BDPA 2VQFF 1CJVB 1LFPA 3BH6B 4ZKAA 2K1RA 4DV6F 2XSFA 4NLXA 1C1BB 3CCQS 3MEGB 1WEZA 2RH6A 1NK0A 2VDHA 4W90B 2W5VA 5LSRA 4P72A 1C0TB 1A0OB 3IWXA 1CJTA 5ETQA 2UXDF 1PYTA 1A6LA 2HWTA 3UCGA 3GIRA 1YRXA 3H5XA 2IUCB 3BSCA 4RUBA 4PYAA 2MZSA 3HD1A 3KLHA 3K8WA 4DL5A 2VFUA 1SHNA 4J9UE 2W01A 2QZUA 2VBYA 4OI2A 1WEYA 1HW8A 2V2VA 5K9FA 2Z30B 2DT9A 1PJ5A 2VPZB 1T7PA 4LF6F 3MFHA 2VA3A 2A6OA 4NXNF 1JLGA 2V8HA 4ZG9A 2JEJA 5A2QY 4NLUA 1WC3A 2FTRA 4QU7A 2R7SA 1X5SA 3I96A 2W25A 5KG7A 3SBMA 3ZZZA 4C9DA 1ZEBA 1HNWF 3IRXA 3MPWA 3QJLA 2MQNA 3QSIA 5A2QU 4K50A 4ZN1A 3IS9A 3Q2TC 4TN0A 3CCWA 2XY7A 5B0GA 3ICLA 3T1AA 2MTLA 3MEEB 2KKHA 2I0XA 4ZVFA 2ZH7A 2VG7A 1SJ1A 1I51B 4KGXB 3NGTA 1U0HB 2Z2LA 4NLGA 3QWUA 3M2VA 4B02A 4CYSA 3I0RB 4GC7A 2XS5A 3M8PA 4LBPA 1QM9A 2QRRA 2F9DA 4WTOB 4DR7J 3BBFA 3VQTA 2BW2A 4DI6A 2WVDA 1NU4A 2DITA 4L3NA 5IWAJ 4ZVHA 3BDGB 3EZUA 3T41A 2XZDB 4K4TA 3BKUA 4PPDA 3MF5A 3NKNA 4MKVA 2GMJA 4KE5A 2OTLS 4TN2A 2WZ1A 1P1TA 2B9XA 1APSA 4IO1A 3UDEA 2H3EB 4Q8EA 5E41A 5AE3A 2L41A 2W9AA 3R2DJ 1T9TA 4TLQA 3GLJA 5I42A 2Y3YA 3CE8A 4QZVB 4DCJB 3AFGA 2CNLB 2OD6A 2PD1A 1EJ7L 3AH6A 4JI2J 3PX0A 4FF1A 5KT7A 1RLDA 3ZXWA 1RTHA 4UTGA 4RW9B 3FSXA 4B9TA 2MY7A 4O44A 2ZNYA 2QE5A 2IYIA 3OL7A 3BGRA 2BXJA 2C2DA 1HNIB 2YQ3A 3MMBB 4CM0A 2RF2A 1S0MA 2VONA 1RT5B 3J81j 3AD8C 1DZ5A 2L9NA 3RTVA 2FHOB 1QE1A 1RAIB 3TARA 5CZXA 3I5CA 1N34J 1HNVB 3SXLA 2MEWA 7FDRA 5BXIA 4YB7A 2C3YA 4YR2A 1S1VB 2MZQA 5GRRA 2HHWA 3S6EA 1K8AT 1VQSA 3K5OA 2OFHX 3HMJG 3H0PA 2CQGA 4KC5A 4KRWA 4WFXA 3T1YJ 1FKOB 1RCOB 1EW9A 4HT7A 2C28A 3F56A 1LOUA 1K1QA 1S0OA 4UF4A 4DL6A 3HO1A 2NXCA 1UW9A 4F2RA 2HQCA 3MR5A 5DLGA 2L08A 3MPUB 1N88A 3PDNA 3P6YC 1VISA 3PW0A 3BS9A 3TUZC 4UOCA 4L6V3 1VQ9S 4CH0S 1X7VA 4CNZA 3Q86A 4K4VA 4Y34A 3SCLE 4X66F 1H2TZ 4DR3F 1LFWA 4OI4A 4RUAA 4IDKB 1VBXA 2CG4A 3I0SB 3T00A 1V9OA 3HHDA 4NLTA 3UWTA 1C4CA 5GAHU 4WZQA 3BO2A 2BJEA 3DLBA 4ZMMA 2VPWB 1GEHA 4FN5A 2AZ3A 5CH7B 4ECUA 3OW2R 3D3CJ 3UVJB 4V19J 3K58A 1XR5A 1PYSB 2HNDA 4FF4A 3SQOP 3OR2B 4WK3A 2UXCJ 3NRBA 2ASYA 1YJNS 3DLGA 4E8UA 3THVA 3CDUA 4UPLA 3PW4A 1ZA1B 2VUGA 4K5RA 5C25A 1R31A 2NXNA 4QW9A 4RW6A 4MIAA 4KFBA 3V6JA 2HHUA 1S48A 2RJZA 4P71A 1JLFB 4YR3A 3IGYB 2MZTA 3QJPA 1O0PA 3OXLA 2OMLA 2VASA 2CJBA 1ALJA 2M8HA 4IFYB 4CO0A 3DPCA 1SJ3P 5F8MA 2R7UA 2P6TA 3NAIA 5F8HA 1TMJA 2J0WA 2CQ2A 2VQEJ 4C97A 1NEEA 3KFWX 1NAQA 2M4MA 1ELYA 3JQKA 1RAAB 4CTAA 1RT7B 5KFWA 2KYZA 4OYOA 4QIWD 3UD5A 3SSRA 2ZWOA 3SSQA 3BO4A 1JQGA 1V6HA 5A0YB 4F4WA 4DCPB 1RAJA 3DRPA 2DNLA 2DH7A 2VG6A 3FZ2A 3TP2A 1ZTTA 1U0SA 1IKXB 2HSEB 1ZBTA 4Q8FA 3ZO7A 5FD1A 1OPZA 3LANA 3MCMA 3QO9A 4CO3A 4ZPWR 1IBMJ 3KJVA 1W26A 5M2RA 4FDIA 1I1GA 4QOTA 3IM9A 3UCUP 3KKFA 1U6ZA 3D6FB 1FERA 1Y7PA 2VG5A 5CHCB 3AXMA 1S1TB 3HCXA 2KZMA 1M0SA 2CPHA 4YP3A 2PI5A 4GC6A 1F6TA 2GLQA 2RQKA 1RHRB 2GJFA 3MDFA 3AXKA 2WVEA 1E3CP 2HIYA 4NOHA 3MM6B 1RABB 2DY9A 1N56A 1RAEB 5HQLA 4YY3J 3TVKA 2LDYA 3K89A 5DQHA 2MZ1A 4DS4A 1R8BA 2MKCA 5KT4A 1KTQA 4Y00A 1X8DA 4ID5A 2IAJA 4WCEQ 3TUIC 3NKQA 4N56A 1CVJA 1ED8A 4IYQA 3D7SB 4H4OA 4PXBA 1GH8A 1SKRA 2O01C 2XNQA 3CDAA 1T3OA 3CCRS 3Q22A 3R5GA 2V50A 4K5SA 5FLXY 4DU7A 1MSWD 4B3SF 5K20B 1RBLA 4X4QA 2QA1A 5IV3A 1F9FA 3V6HA 3FSIA 1Q95G 1JXLA 5FDLA 4X62F 1P8GA 2YKMB 1FD2A 3R7NB 4CH7A 2F4VJ 1B4SA 5EWFA 4ZP8A 2OGUA 1JMTA 3G6XA 4EZ6A 3TX0A 4R0EA 2D69A 1OWXA 3K5MA 4RW8A 1ZEFA 1ZYQA 3HK2A 1FRKA 4GKJJ 5LM7E 3NMRA 2KJVA 4IFVB 3PFEA 1C1CB 1TFWA 2YX7A 3GCXP 1U1QA 2VFVA 2WONA 3SQGB 4F0HA 2IY5B 3IDDA 1T9UA 4RW4B 1YJWS 3SZYA 3EDQB 3NBPB 1I6JA 4BS2A 1SH3A 3D0IE 4PXCA 2YNIB 5HMXA 1VBYA 4BWMA 4B3TJ 3EVOA 2K06A 4NMLA 4M5GA 3M8WA 5ETLA 1RHMB 2FJWA 4TYAA 3B4DA 3GIJA 4RUHA 4RNOA 3DGPB 2AJQA 2GHPA 3A4TA 4G1QB 1VQ7S 1FXDA 1S6PB 3HPOA 4DV5J 1W2IA 3OBIA 1OPIA 1RACB 2Z8QA 4X4SA 1WDDA 3E01B 4RKUC 5C66A 5A8KA 3VHQA 5L1LA 2ZDPA 4DG1A 4OL8A 2RKIA 5CZVA 4X65F 4DV3F 1U2FA 2CXEA 4ZOSA 4F4ZA 5B0EA 3GJTB 3MHYA 4USTA 5SZTA 1VC6A 4EZ9A 2PDAA 4ETZA 2KL8A 4U67Q 3OXGA 4S0MA 4OI3A 4RBVA 4FDFA 4C8MA 4OYAA 1DTTA 3O2IA 2NPIA 1YX2A 2BW7A 1N4LA 4ZHRA 1TUVA 2J7UA 4P2MA 1CJVA 1AT1B 2X1GA 4C11B 3WIUA 3BSOA 5DQGA 1C1BA 2X3DA 4CYRA 3MEGA 3IM8A 2HVHA 4J9OA 5DM7Q 3TJAA 1UVNA 1C0TA 1LWXA 5AT1B 1KH4A 3JAMU 5JVGQ 3NGDA 3W5YA 2I5JB 4W92B 4HI2A 1JXVA 2CNNB 2IUCA 5KFRA 1S57A 1HHTP 1ANJA 1YDLA 5DRKA 5DLFA 3LA0A 2LQ5A 2FVQA 3TOQA 5LT5A 4O4GB 1T05B 3CPWR 2UUCJ 4BC7A 2CPXA 2DR9A 4ZP9A 5THWA 4WYWA 3M6UA 1RTJB 3CMRA 3HVRA 3MMJA 5LSLA 4YHHF 4XK8C 5K8PA 2FC8A 3A3NB 3H2UB 2YVSA 3WAVA 4HHJA 1Q8KA 1OYEA 5D4NA 2IDEA 3FMWA 5IT0A 4Y2CA 2J7KA 4DF8A 1N54B 4U6PA 2X7IA 3SDEB 4X4UA 1X4DA 2ZH5A 4KGZB 2CJYB 3LGHA 3D67A 3Q8VA 4Y2IA 2H1YA 3UN5A 3MEEA 1F3VA 2WVCA 4QIGA 4PKDB 1NHUA 2BKPA 3O44A 4MYUA 4USIA 1NNDA 3RB3A 2YQ1A 3DXSX 3UD3P 1U0HA 2JL9A 2HZAA 2FVCA 1LKZA 3ISND 1DAXA 3L4BC 2L9DA 3I0RA 1RWWB 2DNNA 4G3IA 2CWXA 1X9WA 4DR1J 3I4PA 1FJGF 4RNHA 3PRVA 1QAXA 1FDAA 3L7OA 1URNA 4ED0A 1CQNA 1TZ0A 1Q8IA 1S6QB 1S0VA 1KR4A 3SMZA 4B9NA 4XDDA 4LRCA 3N9UC 1Y5IB 2ZVIA 1FRXA 4R0JA 5BYSA 3BDGA 1FRLA 2QSFA 4USMA 1YGYA 4NCBA 4YQWA 3G9CA 3QBCA 3Q8YA 2DO4A 2BOPA 1IWGA 2Y1IA 1U49A 2Z2ZA 1TR0A 3BV8A 3NP5A 3EE3A 2DD8S 5L0KA 1SPBP 2A2CA 1SH2A 2C2RA 4RZRA 2WVBA 2G9OA 3SEOA 2J9DE 1VIOA 4M95A 3K2YA 3BKFA 4ECQA 1C4AA 5KFCA 2G2ZA 2F9JA 3W9HA 1JKHB 4XO0A 4WK1A 2VBXA 1SBRA 1VIXA 4PWWA 4ZITA 1Y0HA 1YITS 4B3RF 4RW9A 1AFJA 3NMAA 2V5HG 3M8SA 1HMVB 4ILRA 1FT8A 3HJFA 3UR0A 1KHLA 2V67A 2B9YA 2ATCB 1MU2B 3BEGB 4YEAA 1HNIA 3PNIA 3JSBA 3MMBA 4OZNA 3KK3B 1SC4B 3PHEA 4ZVRB 1RT5A 1Y3KA 2EC2A 4RNNA 4N76A 5D6GA 2XI2A 5GAGU 5L0EA 3PR4A 4LF2A 4WP3A 3EGNA 2MZRA 4ELUA 4C0HA 2Q1LA 3DRXA 5F9LA 1S1VA 4L73A 1YQHA 3KXDA 1SC6A 1X5OA 1RWMB 1DURA 4OYZA 4NYZA 3EICA 3BF4A 1FKOA 2UUAF 4M94A 4DR4J 4MJKA 1GTHA 2NS1B 5KTQA 4QCLA 3ZTPA 1RWOB 2RSQA 3AHPA 2VJVA 2XMKA 4B9MA 5C2CA 3CO9A 5ETSA 5KT3A 1VQYA 1MG7A 2XMMA 5E3RA 5GAEI 2UUBJ 4PXDA 2YX1A 4OHVA 1NLKL 3H5YA 1DTQB 3K5PA 1XTZA 1XQIA 1UPPA 5D77A 5KG5A 3D28A 4IDKA 3I0SA 1T94A 3CC4S 4P7TA 1W25A 5F9NA 5EGHA 5IJSA 3UVJA 3R6LB 2BEFA 1IBLF 2WCXA 2AYBA 1EP4B 5H9EJ 2FLLA 1VRUB 1KBRA 3OR2A 3TWZA 5G4DA 4WTYA 1XR7A 3Q8RB 1FKPB 3F73A 2IIHA 3T1HF 1T11A 2G2OA 1X4AA 2EBGA 4ED1A 2IVYA 3DC2A 2FUG9 2E29A 1JLFA 3V4IB 1TL3B 1WELA 2H5EA 2E5JA 1YZ6A 2RD5C 5CXTA 2BYCA 2GS8A 1KVKA 1P6TA 4F4YA 5SUHA 4ZK7M 4IFYA 1CQMA 3RB6A 1IJEB 2LQBA 3BGLA 2BKNA 4OHXA 3IBWA 3W64A 3C19A 2RU3A 4NA2A 3L3CA 4DPOA 1IVZA 3AOCA 2ZC3A 1QUVA 4MFBB 2JFKA 1RT7A 4HI1A 5KOXA 2CPEA 2KT5A 2DR8A 4ZLNA 1GFWB 3OFHA 2R7XA 2GIRA 1QUPA 1FFSB 2J9CA 3TNVA 3NLCA 5A0YA 3H20A 3UPFA 1VLYA 1FKAF 3KHRA 4KHPJ 1SI9A 1IKXA 2G2YA 4OI1A 4ZLPA 3H2LA 1VBZA 1EJJA 5KFJA 1IUJA 3TW0A 1PBUA 2FD2A 3DYCA 2FY8A 3ILJA 2FLNA 4UY8T 4DR6J 4C98A 2GCFA 3S01A 4DV1F 1CJUB 2JC0A 4FBUA 9RUBA 4LR2A 1S1TA 3MR7A 3RZAA 4A8KA 2QLWA 3LH2S 3TEHB 3QFHA 1PJ6A 1GNKA 4R8UB 4CXKA 1FNMA 2HIQA 2E66A 1Y6VA 4TY9A 1RT6B 3LAKA 1WC1A 3MM6A 1NH7A 5LXYA 3MEDB 2EBEA 1AUDA 2DHHA 1EX8A 4ED8A 3OVSA 3HDSA 4KM4A 2Y0BB 1UJ5A 1FRMA 2HW3A 1NB2A 2JH3A 3M6VA 4C4WA 2XMAA 3UW1A 3DOMB 3KTQA 2WB4A 2EK6A 3EXCX 5KG1A 2VDIA 2DGTA 1HBUB 3IR6B 5D4PA 4XPEA 3AOAA 2QL5B 4WZMA 3MM8B 2DTJA 1FI4A 2A3JA 4AFFA 3LXQA 3WX8A 4A8XA 3MXHP 3RRGA 1JXEA 1Q86T 5K5MA 2VKRA 1X4FA 4R25A 1HBOB 3SZ2A 1FF2A 5HVGA 1NDLA 5EUHA 3KJQB 3KNAA 1E1ZP 3EZ5A 2YKMA 3BPDA 1YIJS 2Q3PA 3F41A 2B5JB 2OEMA 3FBBA 2J7WA 1NKEA 3JS9A 4LF5J 4JI0J 3K5LA 1KTVA 4XAKA 2V4QA 3ULHA 6FD1A 3UN2A 2VL1A 3H90A 5DO2A 2Z2MA 2K8GA 3M8ZA 3CD6S 4ZP7A 2PSZA 4IFVA 1UCNA 4CXSA 3Q8UA 4P75A 1QDUB 4WIQA 3SQGA 1ZM9A 1HWUA 4RW4A 1HL6A 3NBPA 1OMSA 3FVYA 5HQMA 2YNIA 4DPWA 4MK9A 2ASDA 4KHRA 3BGUA 2W4DA 2C2EA 4GTXA 2HVZA 3DGPA 4G1QA 4LF7F 4F36A 1S6PA 3HD2A 2Y1LB 4DL0C 1N5VA 4WE1B 2QL7B 4LFAJ 3E01A 4NE9C 3FZBA 3CTRA 5T7LB 5J1PA 2Q66A 4CO2A 1QSSA 4DR7F 2GVDB 2OHDA 1IN0A 1S0NA 3GP9A 2D41A 4ED7A 4K4UA 4K4YA 4KJIA 2YBVA 5CABA 2R2TA 1SKSA 4J9NA 4DL2A 2DH8A 1HHSA 5IWAF 4NWJA 5CCMA 5B7WA 3V4MA 1X0PA 3BQ0A 5L1JA 2OPRB 1IR2A 2BUNA 5LSOA 1F5AA 4NWXA 3N01A 1HQEB 4HR2A 2QFJA 2YWFA 4C11A 2W2MP 2ZD1B 3ZZYA 4DPYA 1V3RA 2NLWA 4M63A 1YSJA 2A0FB 1ELXA 3EXYA 4JI2F 4LIWA 2ZH9A 1FWPA 3TA0A 3GYXB 4U8YA 2I5JA 4B9VA 3FSYA 1RWUA 4P52A 2IJRA 1UJ4A 3W65A 2W9CB 2HAFA 1WF2A 3M8RA 4DLEA 4C3KA 2V69A 4O4GA 1T05A 3A1YG 3T5JA 3DHXA 3QATA 2PN6A 4L75A 1HIYA 4RO0A 2WW4A 2R8GA 1VQ6S 1VQ5S 3FCHA 3HZEA 1NSQA 1RTJA 1NZ8A 1BGXT 2M2BA 1R0CB 1NKBA 5KG3A 3RYLA 2HGNA 1E2SP 3DDKA 4OZ2A 4DCOB 3SFUA 3PV8A 5B0FA 3E2EA 3D9BA 1N34F 2MKYA 4LBIA 3D1OA 1K1SA 3M1VB 1I5OB 2C1EB 1VHIA 2KVIA 4NRUA 4MMOA 2ZH4A 3NOCA 4JI8J 1FA0A 1NJXA 3SDEA 1HW9A 1MN7A 1RAGB 3DYAB 4RW7B 4NZ6A 4MIWA 2BACA 1TAUA 3MOZA 4B9LA 3T1YF 5DZ6A 4KGKA 1LWCB 3P96A 4Q45A 1NJYA 5DLTA 4X64J 4JV2A 2MSTA 1FK9B 4NI2B 4IUFA 4TU9A 4FYVB 1EW2A 4JOUA 5EHHA 2IDLA 4CH1A 2FJVA 4DV0J 1N52B 2CQBA 2VOPA 5J2PB 4YS2A 5AXKA 3RW6A 3CMES 1S6QA 1T95A 4CO4A 4DSKA 1XC9A 5HVFA 2NR0A 1UEUA 4HACB 2XO7A 3N6NA 3U1NA 2ASLA 1I3OB 1H0HB 1Z2ZA 3PY8A 2RHQB 3QAEA 1HQ2A 1X9SA 3U7JA 1YJ7A 4C8YA 5M2PA 1IWAA 1N5YB 3D1HA 4I69A 1IQZA 1DFDA 5F0WA 5A6WA 2UXCF 3NG8A 1L3SA 5DDPC 5IQ6A 2W7PA 3EPIA 1B3TA 3ZTQA 3MK2A 4D3GA 1WG5A 1FX2A 3EMTA 1BY9A 4NCAA 3QZ7A 4OYPA 3A8JA 2FLPA 1JKHA 2EXUA 3AB2B 3PXGa 2CPYA 4FPIA 3M9NB 4MKBA 3VGSA 1Z1ZA 3RB0A 3UE2A 1FEHA 2HFUA 2GHWA 3MR2A 4ERDA 3MM9B 3FBEA 2HPUA 1HMVA 2HQ3A 1O6XA 1MU2A 3ZC4A 2QGFB 4LR7A 2QX0A 2NSBA 1RHKB 3MI7X 1IKYB 3ET6B 3GSDA 4DSFA 2VQEF 1TKZB 4X4OA 4URQU 3KK3A 3MTKA 1ZA2B 2ZHBA 2GO9A 2OEJA 1X4EA 1HYSB 3TI0A 3PRDA 3SCJE 2H54B 1CEZA 1FRJA 4XDCA 1RTIB 2O5DA 4PABA 1UTAA 3HHNB 1GMWA 2E5LJ 1KP6A 3FJ2A 1RT2B 3H4DA 1W7WA 1M5VC 1TL5A 3W3SA 1Q8LA 1U47A 4BWJA 3KLIB 1VS3A 4NLOA 1OY9A 1VC0A 1IBMF 4QR2A 3PG9A 2J6UA 1WC6A 5K14B 2ZDOA 1CLFA 4QWEA 1U1PA 1HI1A 2HAIA 1N5SA 2H65B 1R27B 3MUVP 2YKAA 4DL4A 1P27B 1DTQA 2B4VA 2MDAA 4CCHA 2OJ3A 2FC9A 1KWMA 5F3TA 5KT2A 4UPKA 1CC8A 1O5JA 5F3ZA 3HXMA 4YY3F 3ISZA 1RA6A 2HVIA 1S9GB 4DPUA 4C8NA 3HVTB 2CRLA 4DDFA 4CLUA 3C14B 1R0BG 1JLAB 4EUVA 1QD1A 1UFLA 1EP4A 1VRUA 3G71S 5D78A 3PEJA 3AQPA 1G1XA 2OD4A 4DR5J 2X51A 4FBTA 1EHWA 1VJWA 4FVMA 3W62A 5LL6d 2V4RA 4K4ZA 1WC0A 2BJ1A 3IAS9 3NKOA 1FKPA 3W8GA 4Q5VA 1TKTB 1VMBA 4Q7AA 5JMNA 3PJXA 3JSYA 3V4IA 1M5HA 5ETOA 1KC8T 1TL3A 4FYDA 2WBRA 2W4PA 2F4VF 3CGIA 1VOMA 2OSRA 3VAGA 4PRFA 2BJ7A 4KPYA 4GKJF 2IYGA 2JRSA 4HDHA 3HHLB 1HWKA 3OUYB 3ENAA 4WFBQ 3Q83A 3QPIA 5ETPA 4DV2J 2IFXA 3A3PB 1PAEX 4ED3A 3I5BA 2AYEA 5H9EK 3D66A 5BR8J 5IFMA 1IQTA 4NLWA 5L9XA 4D3HA 4ICLB 4DEZA 1KONA 4RLEA 4MFBA 2BANB 4U8VA 2NPFA 4Y28C 3CO0P 2HFNA 4CZCA 1AROP 2VHGA 4P2XA 1NSPA 3W2WB 3P5BP 2ZWPA 3C16B 2FHJA 4IG3B 4FXDA 3T9NA 2HLUA 4DSLA 2DIUA 2CJXB 4ZPVR 3BKTA 1DARA 2XHWA 2MKIA 2LMIA 3AD7C 2CPDA 1H2VZ 4DV5F 1HI0P 2JEFA 2XSJB 1BUXA 3PVXA 2YWKA 4J9QA 4X4NA 1U48A 1BD6A 2YKQA 4NEZA 1CJUA 3O5TB 1D9FA 3MK0A 4R8UA 3A8KA 1EI6A 5LMNJ 3R7SB 3TAPA 2K2PA 1QSLA 2OO4A 3GFZA 1RT6A 1IR0A 3LOUA 3BDHA 4ECWA 2HFSA 1AJDA 3OD2A 3VGUA 3MEDA 1S76D 4ITSA 3E8OA 1U2RA 4CP5A 4Y3CA 3JYTB 2U1AA 4FXWA 2ABYA 2L48A 4KH0B 1MNEA 2YY3A 4IKAA 2AMCB 3QZ8A 3DOMA 3HSDA 1BWEA 5CYJA 1HBUA 1S1WB 3MM8A 3UCZP 2MQPA 4DR2J 1S4FA 2ALZA 5GOVA 4ED4A 2ADCA 4FKXA 2EW9A 2RDDA 1HBOA 2J8SA 4LQ3A 4OZ1A 2AD9A 2HFVA 4ZCIA 1DQ9A 2U2FA 2UUCF 3HHEA 2LCWA 4LSLB 2B5JA 2GA7A 4RPFA 3IFEA 3UN3A 1SC3B 3NS7B 3GWCA 2GJIA 1VRTB 3FQKA 1R8AA 3HULA 3PM9A 4CLLA 3AD9C 1XNQJ 1EETB 1QAIA 3PCOB 1X31C 2W5QA 4PWDB 2CZ4A 4KV8B 4ES3A 4LQ9A 2UXBJ 2L9WA 3DLLQ 2JJ4D 4LFCJ 2HHTA 2ZEJA 2GO8A 2P9GA 1HWLA 3HVWA 4USWA 1G4CA 1S1XB 4AXIA 1SJ4P 1TL1B 3CT9A 1UVJA 1FJ7A 1KEKA 1X5PA 4B3MF 4WKYA 1PC4A 2H5JB 2OPQB 5E3PA 2ZM6J 2J0XA 1LWEB 1WOSA 3JB9k 3VCDA 5KFLA 2O1PA 5GAGI 2JWNA 3VGVA 2ZJPQ 4WE1A 1GXTA 5HMYA 3OLBA 2PC6A 3O6QA 5T7LA 4DR1F 1UVLA 2J0SD 1FEEA 5I3QA 1OSDA 2MQ8A 3NAHA 2GVDA 4TNOA 1TU0B 1RTZA 3BGOP 2RRAA 3IG1B 4DXLA 3DLKA 1HKAA 2XI3A 2AQ4A 3CJ0A 3R5AA 2ZVSA 4F04B 2E1MC 2OPRA 4PR6A 1ITPA 2NXUA 5KFTA 4MT1A 1RHUB 1HQEA 4DWIA 2ZKTA 2J76E 1Q82T 3QIPB 1S7HA 1X0FA 2XLJA 2XULA 3JQJA 1RQ0A 3I32A 1H7WA 2PGCA 3PRBA 3HI9A 4DX6A 1SUQB 4DQPA 3THPA 4DL3A 4CLFA 3B6BA 1WF0A 1SIZA 2UV8G 3T9ZA 1JNRB 2W2OP 3PW7A 3MAAB 3QJJA 3PX4A 2ZH1A 3VAJA 3EGVA 4OQJA 2XMVA 4B9SA 8AT1B 1T9WA 1O8BA 2W9CA 1G3OA 3MD3A 4OV1A 3NWRA 2DNRA 2HBYB 3ITHB 5E3AA 2F4FA 2KVQE 5ETNA 4FPRA 2DR6A 3RUBL 2GQQA 2DGSA 1K47A 1WORA 3KLGB 2VOOA 4J9KA 2YNGB 1DHMA 2KFNA 1S9EB 2EFPA 5E7OB 1RAOA 5IT9Y 5HQ8A 2N3LA 4ANDA 4U9RA 2JNJA 2W8DA 5AJ9A 2EI5A 2BOAA 3KMSA 3M1VA 3ISNC 1GX5A 2CYYA 4HEA9 5AJ3J 2EEYA 3PYGA 4NXMJ 3FRYA 4F4XA 4DMZA 1RT4B 4YR1A 4ANCA 1X5TA 1Q81T 2HK3A 3DYAA 4RW7A 2I2YA 3TQEA 4F4KA 2AGPA 1ZPVA 4DR4F 1LWCA 3HLUA 4A8SA 4ECSA 4F2SA 2CQDA 3RAMA 1FK9A 1U02A 2B56A 4NI2A 5IS2A 4KPCA 1RADB 4HT5A 2UUBF 4QJVA 3KLEB 2AJ0A 1IR1A 2QEXS 3K17A 3IGNA 2CA9A 3MM5B 1YBAA 3IBCB 1RWNB 1U1RA 1LNQA 5J2PA 4J37A 2RQMA 4OYXA 5KAKA 1FSUA 3DRRA 5KFUA 3H8YA 1S77D 2AEJA 3P5TL 4HACA 1UA0A 4ECRA 2LA4A 2RT3A 4E0DA 4FF2A 2AX1A 3QT6A 1CS4B 5GMKa 1N5YA 3K8VA 2FJBB 2HQGA 3R1HA 2FVSA 3G6YA 5IM0B 2R8JA 2VQRA 2QTWA 5D0HA 4IG0B 5AXNA 2IM3A 3NGRA 3WC2A 2I8EA 4MH8A 3CNQP 2GFFA 2POKA 4PQAA 1KH7A 2VPXB 4UPHA 4EFAC 2LP4A 2WB1D 3MM9A 5BYRA 2ZUGA 2QMXA 3B5QA 2ADBA 2QC3A 1IKYA 3ET6A 5ITHA 2R7WA 4YUDA 1TKZA 3NKMA 3AT1B 3VQSA 2PMZD 2YPZA 3EVMA 1J5EF 2DXEA 2JVOA 2QLFB 1LK5A 1AXQA 2B8PA 3CMAS 1HYSA 3OL9A 3IBFB 2LU2A 1R8PA 2UP1A 4ZVPB 4PUOB 2WW8A 4O3QA 4PXEA 4CXUA 3LPYA 2DHSA 2XGPA 1RTIA 2BABA 1URAA 5B0AA 3RU0A 4ZIVA 4DG1B 4KHPF 5T14A 1RT2A 2IJFA 5D4OA 3KLIA 1KH5A 3VVTA 5A8RB 4GVLA 3P3DA 4Q2MA 3VGTA 3CCLS 3TA1A 5J2MB 2EG1A 1F1BB 2WK4A 5L1KA 1Q16B 5K14A 3MD1A 5DETA 4KTQA 3FEZA 1D8YA 3OTCA 2B4OA 3S8SA 3I82A 4DJBA 4QU6A 3J7A1 1KHWA 2HRYA 3HP6A 5HSPA 1SV5B 2I1RA 3GG0A 3EGWB 2DJWA 2EFVA 3H25A 2X1BA 1S9GA 3CJ4A 3HVTA 2O66A 2XYHB 3W66A 4NLQA 5J1NA 3C14A 4E98A 1JLAA 5K8NA 1ZS6A 2FLOA 5J1EB 3ZTRA 5LJ3Y 1MWZA 3R7BB 2UZAA 5AE1A 2E9ZA 5D3GB 4N8NA 4V19X 5GMDA 2LEBA 2C2ZB 4KQZA 2FVRA 1LQ9A 2HBQB 3Q24A 1TKTA 2YH0A 2XM3A 2YWGA 3MWBA 5MAOA 1EARA 3MM7B 2E1RA 1IKWB 1MWQA 3H40A 2VFSA 5ETVA 1VQPS 4F67A 2OH2A 1PG5B 4JI1F 4LF5F 4QIEA 4JI0F 3VF0B 5B08A 4LF4J 4LF8J 3N28A 2KT3A 3HHLA 3HM9A 3OUYA 4KGVB 3W9JA 3C46A 3Q3QA 2LXFA 1KQGB 1JX4A 2J6TA 3DLHA 5CYMB 1SH0A 3V6KA 2HHHJ 4KAIA 1E33P 4DZ6A 4ZJQA 1ZPWX 3BO3A 3IN5A 4ICLA 2W2NP 4X4RA 2BANA 4O4RA 1T3NA 1AZSB 4UORA 4Y0FA 2GMHA 1Q5VA 1FTCA 3W2WA 1URBA 4RU9A 3C16A 3ILIA 2J9DA 4IG3A 4DFJA 1ELZA 3THTA 7FD1A 2PIIA 2DK2A 4Q43A 3ZTOA 2QLBB 2DY1A 5L46A 2BRKA 2W4CA 5D0EA 4ER8A 2Z2YB 3NKRA 1D0EA 2XSJA 2B4PA 4LFAF 1Y5LB 3FMBA 4U7CA 3QYYA 4TU8A 1WHVA 3VTIA 1U1OA 3OVBA 5L38A 3H5SA 3R2CJ 2FIUA 4JYAJ 1FE4A 4JP8A 3VAHA 4YR0A 2KRBA 3CJSA 4UQGA 3FCWA 5A76A 5KFQA 2V94A 1AUKA 4J90A 2CQ4A 5IQQA 3NGUA 2YPYA 3C6TB 2GIFA 2J8AA 2VPYB 5IV4A 1JLBB 2VBWA 4HHUA 4ZP6A 1YG0A 3MFIA 2Y9HA 1IBCB 2GQCA 1GT8A 2WSFC 1RK8A 3BPSP 3JYTA 4KO0B 3KUHA 3EZOA 1D1UA 3GYGA 1Q1KA 2V2KA 1SCJB 1S59A 5ETKA 1N5TA 1S1WA 3NS6A 3POTB 3CCJS 3AJ1A 2UVUA 2MKHA 1YK9A 3M8YA 2E7WA 3I55S 4UT4A 4YMEA 3D6TB 5M2UA 4YDDB 3J7YI 2CQ1A 2CADA 4OYBA 3D54A 1JLCB 1Y9OA 4UW2A 3B82A 4IQXA 5A8WB 4LSLA 1Q0NA 5AXLA 4OV6A 5FIIA 4C2MA 1ZM2A 1TELA 4MY4A 1VRTA 4DF4A 4ELTA 2DGOA 2COLA 4CM2A 4WBFA 2MLZA 1WHXA 1HA1A 1EETA 1AYEA 2KO1A 3NWGA 4PWDA 4M5HA 4KV8A 3M4XA 2CPJA 3QSYB 4ECXA 1RE1B 4ECTA 4UOFA 2HMIB 2EC0A 2CNOB 3KJNB 5EX3A 3HFZB 3CJ3A 2FDNA 4LQYA 4NRTA 4JI8F 4ZIWA 3M9MB 3WAYA 1S1XA 4Y2AA 3KHLA 1TL1A 2RS8A 1MW7A 1ALIA 3M7VA 3ZFVA 5CQGA 5IT4A 3DN9A 2F63A 5BJRA 3RBEA 4Y2KA 1Q5YA 2KM8C 4X64F 2OPQA 3CDEA 4J9RA 2BE2B 4ZG7A 1RU2A 4L74A 1LWEA 3DLEB 1U6FA 2FB0A 2RS2A 1FHTA 4NLYA 1TUGB 3R27A 2VF3A 4ZJOA 3RR8A 4DV7J 2WSCC 3PHTA 1N36J 4DV0F 2UU9J 3HHLD 1N6QB 2MHNA 2VC1A 2QMWA 4USKA 2EK1A 3CJTA 5EDWA 4ZG6A 1S1UB 4UZBA 1Y5NB 3QQCD 3IG1A 4XTTA 2CKWA 2BJ8A 3QRPA 1HFEL 4KSEB 2GGPB 1HBMB 1WHYA 4WPAA 1RXOB 4TVAB 1D3WA 5KXAA 3HKZD 4IH7A 4OYIA 1NPKA 2OFGX 2NREA 1OSCA 1ICEB 3QIPA 4JI4J 1YJTA 2DISA 5KFSA 2LYVA 4X65J 2E1PA 2EFNA 2GSUA 1SUQA 4WYLA 5FJ4A 3ZZOA 1NMEB 2ROGA 2VU5A 2WAQD 4YB5A 1NO8A 2DNZA 2HWHA 1S5ZA 3MAAA 2HVDA 4KBIA 1F2HA 3Q0AA 3TR5A 3PEHA 3KLFB 3ITHA 2FYXA 2HRUA 2DEIA 5K4PA 2KM8B 3K57A 1ZZFA 4U7UK 3RBXA 3ENQA 2G0JA 1BE4A 4DZDA 2ROEA 2C3UA 4PG8A 5DDQC 5E33A 4DFMA 2CPZA 1M90T 2ZKUA 3MGJA 2MJUA 4LRDA 4GKKJ 3CJKB 1BWVA 3NVLA 4CDIA 3OSNA 2O3DA 3KLGA 1Q7LB 2YNGA 1H2UX 4F25A 1GQEA 1S9EA 5CCLA 3EVWA 4I4BA 4OX6A 1IM4A 3OHAA 1LW0B 1H3DA 1MROB 3IO1A 1P49A 3ZZTA 2D3UA 1NBEB 4TY8B 3KMQA 2W9BB 3SV3A 1M1HA 5D8HB 1RTDB 1WHWA 2ZJQQ 1RT4A 4O3RA 2B0GA 2E5LF 3V5RA 4GTWA 4GVBB 1FFGB 2A1BA 1RJJA 4PG5A 2Q79A 1PAUB 3NNCA 3CJ2A 2LLZA 3VALA 2DGXA 5ETMA 4OHYA 2FGOA 3BSNA 2AU0A 1M1KT 4B3OB 5LMUJ 4EBCA 3D68A 3J7ZT 3J81U 2CQPA 2ZH3A 4C6AA 2MSSA 3KLEA 3ADAC 3A12A 3MECB 4JV5J 5KFYA 3GPAA 3MM5A 5KFMA 4OHWA 1RYSA 4ES2A 1QJHA 3OSPA 4KIAA 2ZZMA 4USJC 1U8WA 4ZCMA 4N47A 4EU0A 1Y7AA 4NL5A 2ZZTA 5KT5A 3C3LA 3DM2B 4W98A 4AL7A 3PO4A 2J6SA 4UOOA 4U7UD 4DOZA 2XNRA 2HK2A 1CS4A 2IRXA 1QVFR 2QO3A 1T03B 4DR5F 1V5IB 1U1NA 5IM0A 5DGBA 2AKWB 1X60A 4A48A 2AGOA 3CCUS 4MYTA 2P2CB 1Q4RA 2M52A 4L72B 4WFNQ 3FC9A 4C8OA 3EYZA 3HSJA 4ZLLA 4IG0A 2CDRB 3GQCA 1XMOJ 1XWLA 2XYPB 2Z58B 3UR3C 4IOCQ 1TL4A 2AEMA 2BV3A 1H74A 1RISA 6AT1B 3PYEA 2EPIA 1VK8A 3W5XA 1EKSA 3FEXB 2V4JB 2MY8A 4ZPDA 2E7XA 1TK0A 4DV2F 4DV4J 1EQMA 1RT3B 5BR8F 2HKEA 2DGWA 3NCPA 2PA3A 2V6AA 3MUMP 3ZNJ1 3TVZA 3A8EA 5LXRA 3I5AA 4XPCA 1B0VA 4FKYA 3T19A 2ALYB 4JI7F 3ETOA 4QBUA 4LRFA 4PUOA 1NKCA 4N77A 3BDEA 1WOOA 1NK6A 2ILYA 3NNHA 3AA8A 2DNOA 3PIOQ 4DS5A 4PCQA 4AD6A 2G0CA 3PW5A 2ZBIA 4CI0B 2CQCA 3V2UC 3HVAA 2R8HA 1WUUA 1TK8A 1FO1A 5A8RA 1H7XA 2FJAB 2XLKA 5J2MA 2HWIA 1FRIA 3GJQB 3FKBA 1EKRA 1GMVA 2ZC4A 4OJ3A 4J9VA 2RNEA 2GZOA 4DU8A 2R2RA 1R6VA 1GX6A 3GSIA 4QYRA 5LMNF 4K4XA 2R2SA 2R7TA 4O3OA 2F8MA 2YNFB 1RU1A 1SV5A 3K7RA 2KN4A 5KFZA 3JAMY 4OZLA 3D0HE 4EMDA 4J7CA 4NCGB 1ROFA 1SL0A 1RWPB 1ULRA 3W60A 2HGLA 4I0WA 1U4BA 3H2VE 4NLRA 4RNMA 2ZBRA 4JBCA 2FZCB 4K2XA 4X2BA 2NUHA 3A3OB 2ZE2B 4BHQA 5J1EA 3MOJB 3W61A 1FJEB 2NUUG 3BYPA 1X4CA 1EQ0A 1EQJA 2X98A 3UDVA 5D3GA 1M5SA 2D9OA 2VODA 4DR2F 2EFOA 3WZ0A 4OFZA 3VZIA 3KOAA 1QTMA 1JJ2R 5I4MA 3BYRA 1XMQJ 3MM7A 3AA9A 5D0RA 4A8FA 2V8GA 1TL7B 1A7GE 1IKWA 3DKDA 4NZ7A 3DRSB 4A8YA 1WEXA 4IRCA 4KKOB 1OJ4A 1RAHB 5KFEA 5DG8A 3UI3A 3M30B 1OQ6A 2V9WA 2MPUA 1XNQF 4ZVGA 1ANIA 1N32J 1NUEA 1YRTA 2BE7D 3WX4A 1UL3A 5CYMA 2UXBF 1ZOTA 2GQ2A 2BQUA 3OTDA 4LFCF 2EFGA 4HLBA 3U27A 1SC1B 3LP1B 1AZSA 2LVWA 4Y65A 2PA8D 1R8HA 1SL2A 5G0RB 1TP7A 2CIMA 3R5DA 3LP2B 2F8HA 2AZ1A 2JOQA 3KNGA 5KFDA 1TTHB 1WDTA 3NNAA 2ZM6F 4PG6A 5HATA 3MPDA 3PKYA 5E2QA 2XY6A 3HKWA 4HVZA 4QIFA 2F8EX 1N0UA 4LIRA 5LOQA 1UKUA 2PE8A 1XNRJ 4IH5A 1FDBA 3GMGA 1XR6A 4RU2A 4ZVSB 2BRLA 2OI2A 2LQJA 2DIVA 5HBMB 2VFRA 2OELA 2R8IA 2KHDA 3MMAB 3C6TA 4TQRA 3W1YC 2C2NA 3Q8PB 1JLBA 1HNZJ 4A4JA 5HK4A 5DG9A 1PKUA 1WI6A 4KO0A 4A46A 1O98A 4FYXB 1WC5A 2F65A 4HDGA 3POTA 2OPPB 3F0NA 4P73A 3RJMB 3KWMA 3GFYA 2E5HA 4I2PB 1KD1T 4LR8A 4P74A 4ZCKA 5J2NB 3CJQA 1YJUA 1L3UA 3VWSA 2ZITA 4UUXA 3FFIB 4C8KA 2AWZA 5B0BA 4C3LA 1RBAA 1Q7YT 4J5OA 4HTIA 1JLCA 2UV8A 5A8WA 2BJ9A 1NPPA 3BR8A 3D5MA 3GJRB 3J7AN 3MEKA 2IA6A 2HNYB 4I6WA 1UZDA 3TG0A 4N7TA 1ZAWA 4KAYA 5HMZA 3BDFA 3LAMA 2ZOGA 3KK1B 2HMIA 3HHKA 3TZZA 5AJ3F 3BM7A 4NXMF 1YBTA 5HN0A 4IO9Q 3G8SA 5EWGA 1ZEDA 4FYWB 2HVEA 1O99A 2DHAA 1YJ9S 1AB8A 4ETXA 2AGQA 4ZVQB 3DHWC 3S1TA 1FXLA 2PFFB 4EYIB 3KG1A 2R42A 2P9EA 2BE2A 3OTEA 2DB1A 3CCES 3DLEA 3GE9A 3SV4A 3PW2A 4GTYA 4X4TA 2ILZA 3BSAA 5CA5A 2BVZA 1UVKA 4H4KA 4B17A 4KB7A 2Z0GA 2BBEA 2BJDA 3WBZA 4QR1A 1TVRB 1N6QA 2F1FA 3PZPA 4O0NA 1WI8A 4ZJLA 2QIFA 2GC8A 1FNOA 2X3GA 2QT7A 4CO1A 3H59A 3I56S 3GZ7A 4M5KA 1S1UA 1ZZNA 4FF3A 5F8NA 2HBZB 2XMTA 4QR0A 4OZ3A 2DBBA 4F0KA 2GGPA 1HBMA 3DU5A 4A8MP 2E5GA 2HHSA 2HNZB 2YWWA 4LF7J 4CQ1A 3OHBA 2N3OA 3V6DB 1XIQA 2RILA 4OX9J 2MQLA 4Q44A 2XS2A 2QA2A 3MR3A 2NYHA 4QWCA 3KHGA 2IMOA 4NA3A 1TKDA 2FHKA 4J9SA 4QPXA 3TAQA 4OZ5A 2CQ0A 2QA4G 5DQIA 1SXLA 1JLQB 1TQLA 5HANA 2W24A 1S72S 2OSQA 3KLFA 1HQAA 3FCVA 2W8SA 2M70A 1IBKJ 4UY85 2CFXA 5LRMA 1PC5A 1SHQA 1CPZA 4FVCA 5D4LA 3TAMB 3IC1A 2CZVC 4DUTA 2KI2A 3CJKA 1RHQB 1HBNB 5IC4B 1KQKA 3GTYX 2KYXA 5T41A 5HMWA 3RRHA 5HJYA 1WKJA 1NXIA 1LW0A 3T5HA 3IP0A 1MROA 2DRBA 2RUSA 4AE5A 5C5JA 4QWBA 5K8MA 2E1AA 2Q6CA 4TY8A 2W9BA 3IWNC 1RTDA 2X1AA 3H7HB 2BQRA 4OIXA 4GVBA 5KT6A 1E6VB 1M5KC 3W8PA 3GJSB 3V81A 1D8ZA 9ATCB 1TMMA 2LECA 4B56A 4WF9Q 3D6MB 1NJZA 3P4UB 4HH0A 4YOEA 5EGEA 2XTJP 4B3OA 3UQSA 3QRQA 5A6PA 5HLFB 1TUWA 3TANA 1AFIA 3KJFB 1U25A 3DOKB 2QG9B 1YVFA 3RAXA 3IR7B 2W8LA 1NPRA 3MECA 3M6XA 1HR0J 2RMLA 4TLRA 5H9FJ 2AV5A 2WVFA 4ILMA 2KJWA 2ZBCA 1SKUB 3MPVA 2M5YA 2FQQB 5LJ5Y 1F9HA 1GMUA 4LT6A 3IGZB 4QYZJ 3DM2A 2DR7A 2GNKA 4LREA 3ILOA 2N4DA 2R8KA 3U1MA 1BHNA 5I3PA 4J91A 3QGIA 4DN9A 2BM1A 1T03A 1FJCA 2MLXA 2JLEA 4OI0A 2BMBA 1NDPA 4DUZJ 2W8KA 1KQFB 2OAUA 1S4EA 2UVVA 4C7QA 2BA9A 2X1FA 3P49B 1SL1A 5EGYA 3US5A 4Z7YA 1B8JA 2MGZB 1EB0A 4P6QA 2YTCA 2R9LA 3ELHA 1ZM3A 2N7CA 3HT3A 1NK5A 5B0CA 3SSSA 1EZZB 4OX7A 2K3KA 1H6KX 3KDOA 4DQRA 4LF4F 2UUWA 4LF8F 2V4JA 1NHVA 5JUMA 3I9ZA 3I87A 2RRNA 4LRAA 3TJ8A 4P10A 2KH9A 1RT3A 1OQ3A 6FDRA 2HHHF 1JK9B 1U7LA 3DFEA 5INHA 2IVMA 2YNHB 2FY1A 3HSZA 3F44A 4B08A 5B09A 2DCLA 1NH8A 2RQCA 3RAQA 4G6VB 3K5NA 2L3MA 2DPIA 4L3KA 2WRMA 2OUGA 3MR6A 3M8QB 2XC9A 3LP0B 2D3OR 4ZPBA 4ECYA 4OHZA 2QMUB 2GW8A 3TZWA 3P45B 1XN9A 2DNQA 3G82B 1VI7A 1WKLA 3BZQA 2HS3A 3L09A 2NCKL 1H38A 3CEDA 1WTFA 1VQ8S 2MYFA 5KFVA 3DLKB 2AF6A 1WSRA 4JYAF 4M5LA 3G8TA 3RG6A 3PYFA 5C24B 4V1Ak 3T01A 1ACMB 3M9OB 4N41A 2VFTA 1KOOA 3UDCA 2YNFA 3OR1B 2P8IA 1FTRA 4JI6J 4AL5A 3OV7A 4PPZA 4NCGA 1JB0C 4P2FA 2GVZB 1BMQB 2ZZNA 2N82B 1EIYB 3KUEA 1UMJA 4G1IA 3U1LA 3C66A 5JVHQ 2ZE2A 1HPZB 1HARA 1UP1A 2CZ9A 1WKKA 3W7BA 1BQXA 1M5PC 3C6UB 1NJIT 3D6HB 4OJGA 2DNKA 2BR0A 4WXOA 1LK7A 1LW2B 2HBRB 1UWBB 4PQUB 2YH1A 3HSGA 3TYTA 1SJQA 3BJYA 5KFBA 2JZ5A 2LQ8A
chains in the Genus database with same CATH topology
4CYRA 3WAWA 1EQJA 4B56A 3NKNA 4KJGA 2X98A 1ED8A 5DLWA 1EI6A 2IFYA 4LQYA 3M8WA 3DYCA 4LR8A 5EGEA 4UORA 1E1ZP 1ZEBA 3WAYA 5LRNA 3UO0A 4GTYA 1KHKA 1KH4A 2W5QA 5LIAA 4LR9A 2XRGA 4GTWA 1ALIA 2W5WA 4UPLA 3A52A 5GRRA 4UPIA 1AJAA 2W8DA 4LR7A 3M7VA 1AJCA 3BDHA 4UPKA 1HQAA 1KHJA 5AJ9A 3T02A 1KH9A 2W8SA 1AJDA 4TN0A 1URBA 4LR2A 4CXUA 2GSUA 2IUCA 3T01A 4QAXA 1ANJA 4KJDA 5HRTA 1ELZA 1K7HA 1URAA 2ANHA 3UN2A 2RH6A 5LRMA 1SHQA 5C66A 1AJBA 4ZG7A 1ED9A 4FDIA 4LRAA 2W5VA 2ZKTA 1EW9A 4CXKA 1KHNA 3M8YA 3M8ZA 4YR1A 3WAXA 1Y6VA 2VQRA 4MHXA 4NWJA 1EW8A 1E2SP 1KHLA 3OT9A 3E2DA 5INHA 3IGZB 3IGYB 3UNYA 3NKRA 1KH5A 4CXSA 3TG0A 5LQQA 1HDHA 5IJQA 2W5TA 4N7TA 3TX0A 2IUCB 5K4PA 5L0BA 4MIVA 4LREA 4NWXA 1ZEFA 2D1GA 2W5SA 4CYSA 1ANIA 1ALJA 4KAYA 3CMRA 3DPCA 2GLQA 5EGHA 4LRCA 5IJSA 3BDFA 4KM4A 5DLVA 4FDJA 1N2KA 5GOVA 3NKPA 2XR9A 1ALKA 5L0EA 4MY4A 1SHNA 3NKOA 1Y7AA 4UOPA 1KH7A 4LRDA 3MK2A 5TJ3A 3BDGA 4KAVA 2W5XA 4UPHA 3NVLA 2QZUA 1E3CP 3WAVA 3ED4A 4ZG6A 2GSOA 2W5RA 3T00A 2G9YA 4LRBA 3SZZA 1AUKA 3TWZA 3Q3QA 5DLTA 2GA3A 1N2LA 1ELXA 1ZEDA 4GTXA 1O98A 1ELYA 1O99A 3IDDA 3B5QA 3KD8A 3LXQA 3SZYA 3WBHA 2GSNA 4UOOA 1HJKA 4LRFA 1FSUA 3UN3A 3UN5A 4GTZA 4ZG9A 1ALHA 4ZGAA 3MK1A 1P49A 1E33P 5L0KA 3BDGB 3NKMA 1B8JA 3NKQA 3MK0A 5KXAA 1EW2A 1EJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYR A;  3WAW A;  1EQJ A;  4B56 A;  3NKN A;  4KJG A;  2X98 A;  1ED8 A;  5DLW A;  1EI6 A;  2IFY A;  4LQY A;  3M8W A;  3DYC A;  4LR8 A;  5EGE A;  4UOR A;  1E1Z P;  1ZEB A;  3WAY A;  5LRN A;  3UO0 A;  4GTY A;  1KHK A;  1KH4 A;  2W5Q A;  5LIA A;  4LR9 A;  2XRG A;  4GTW A;  1ALI A;  2W5W A;  4UPL A;  3A52 A;  5GRR A;  4UPI A;  1AJA A;  2W8D A;  4LR7 A;  3M7V A;  1AJC A;  3BDH A;  4UPK A;  1HQA A;  1KHJ A;  5AJ9 A;  3T02 A;  1KH9 A;  2W8S A;  1AJD A;  4TN0 A;  1URB A;  4LR2 A;  4CXU A;  2GSU A;  2IUC A;  3T01 A;  4QAX A;  1ANJ A;  4KJD A;  5HRT A;  1ELZ A;  1K7H A;  1URA A;  2ANH A;  3UN2 A;  2RH6 A;  5LRM A;  1SHQ A;  5C66 A;  1AJB A;  4ZG7 A;  1ED9 A;  4FDI A;  4LRA A;  2W5V A;  2ZKT A;  1EW9 A;  4CXK A;  1KHN A;  3M8Y A;  3M8Z A;  4YR1 A;  3WAX A;  1Y6V A;  2VQR A;  4MHX A;  4NWJ A;  1EW8 A;  1E2S P;  1KHL A;  3OT9 A;  3E2D A;  5INH A;  3IGZ B;  3IGY B;  3UNY A;  3NKR A;  1KH5 A;  4CXS A;  3TG0 A;  5LQQ A;  1HDH A;  5IJQ A;  2W5T A;  4N7T A;  3TX0 A;  2IUC B;  5K4P A;  5L0B A;  4MIV A;  4LRE A;  4NWX A;  1ZEF A;  2D1G A;  2W5S A;  4CYS A;  1ANI A;  1ALJ A;  4KAY A;  3CMR A;  3DPC A;  2GLQ A;  5EGH A;  4LRC A;  5IJS A;  3BDF A;  4KM4 A;  5DLV A;  4FDJ A;  1N2K A;  5GOV A;  3NKP A;  2XR9 A;  1ALK A;  5L0E A;  4MY4 A;  1SHN A;  3NKO A;  1Y7A A;  4UOP A;  1KH7 A;  4LRD A;  3MK2 A;  5TJ3 A;  3BDG A;  4KAV A;  2W5X A;  4UPH A;  3NVL A;  2QZU A;  1E3C P;  3WAV A;  3ED4 A;  4ZG6 A;  2GSO A;  2W5R A;  3T00 A;  2G9Y A;  4LRB A;  3SZZ A;  1AUK A;  3TWZ A;  3Q3Q A;  5DLT A;  2GA3 A;  1N2L A;  1ELX A;  1ZED A;  4GTX A;  1O98 A;  1ELY A;  1O99 A;  3IDD A;  3B5Q A;  3KD8 A;  3LXQ A;  3SZY A;  3WBH A;  2GSN A;  4UOO A;  1HJK A;  4LRF A;  1FSU A;  3UN3 A;  3UN5 A;  4GTZ A;  4ZG9 A;  1ALH A;  4ZGA A;  3MK1 A;  1P49 A;  1E33 P;  5L0K A;  3BDG B;  3NKM A;  1B8J A;  3NKQ A;  3MK0 A;  5KXA A;  1EW2 A;  1EJJ A; 
#chains in the Genus database with same CATH topology
 3WAW A;  4OJH A;  2R3V A;  1TL7 A;  1B64 A;  3DRS A;  5HP1 B;  1B0P A;  4LR9 A;  2W7A A;  3MUR P;  2W5W A;  2A6M A;  1ZAV A;  3LF0 A;  4KKO A;  1VGY A;  5KFX A;  4QW8 A;  3EJM A;  4KGM A;  3M30 A;  3QWP A;  3BN7 A;  3EX7 B;  1RWV B;  3CCS S;  3CIM A;  1C0U B;  1UEK A;  3AOB A;  2BDP A;  3WAX A;  4MHX A;  3WQP A;  2XGQ A;  2Z57 B;  2B7C B;  2KTQ A;  2AJ4 A;  4ZVT B;  4F02 A;  2QV6 A;  3LP1 A;  1YZ7 A;  4PG7 A;  5IC6 B;  3UNG C;  4JI5 J;  1CSJ A;  5DS7 A;  1QY7 A;  4B9U A;  5G0R A;  1VQM S;  1BQM B;  3LP2 A;  1YWX A;  3X1L B;  5FLX U;  1REV B;  3HJV A;  3W2V B;  3CB4 A;  2WSE C;  1U1M A;  4DFK A;  2RB7 A;  4TXS A;  5EWE A;  2RIJ A;  1JIH A;  1NJW A;  8RUC A;  3IXQ A;  1YI2 S;  4R5P B;  5KG6 A;  4DUY J;  2MB0 B;  2OP5 A;  4AQY J;  1LWF B;  2DH9 A;  3DRR B;  1I94 J;  2DVI A;  4ECV A;  4GTZ A;  5HO4 A;  1VQ4 S;  4DV7 F;  2J9E A;  1N36 F;  1JJ4 A;  1RZM A;  2XYG B;  4CYU B;  4IR9 A;  2UU9 F;  2JDJ A;  2YXL A;  4F3Q A;  5LRN A;  2BE9 B;  1WWH A;  4NPO A;  3J7Y U;  4O3S A;  2QJ3 A;  1PCA A;  1Q53 A;  5HBM A;  4QAX A;  1UZH A;  4N8O A;  1SVD A;  2AYG A;  1ZET A;  2EKN A;  5E3Q A;  1Y3J A;  3DI6 B;  4NWB A;  2C3P A;  3MMA A;  3QFW A;  3AY0 A;  1Z2L A;  3CJ8 A;  1KVJ A;  4LF9 J;  3MCO A;  5RUB A;  2H51 B;  2MKS A;  2W5T A;  2IRY A;  3QAU A;  3M32 B;  2R7R A;  4JI4 F;  2ZFH A;  2XMU A;  1MLA A;  1L3T A;  1UVI A;  4H4M B;  4UOP A;  1IM6 A;  3ZZU A;  2OPP A;  2H5I B;  3D0G E;  2DCU B;  4RNF A;  1KLM B;  4I2P A;  3G4S S;  3UDL A;  4IQM A;  5J2N A;  3DU6 A;  4OYM A;  3FFI A;  2R4F A;  2MKJ A;  3U02 A;  1RP5 A;  2AJ2 A;  2A10 A;  4JI3 J;  2V2Z A;  1PYO B;  3UO0 A;  1CBK A;  4GKK F;  4M8L A;  4MIB A;  1M1G A;  2HNY A;  1RI7 A;  1BXN A;  1RGV A;  2CJK A;  2QYG A;  4CRJ A;  4IRK A;  5F8L A;  1KHN A;  2R7Q A;  4BC9 A;  3IWL A;  4QPT A;  3KK1 A;  3PIP Q;  2HEK A;  2HLT A;  2DKO B;  2IRU A;  1R6Y A;  1UPM B;  3HHL C;  3H4B A;  4F7V A;  3CW2 C;  4FP9 A;  4FDJ A;  3DGV A;  4DBQ A;  3Q8S B;  2UUT A;  4WII A;  1T9V A;  2ROP A;  2WTF A;  2W2P P;  2IPO B;  2HQD A;  3PYD A;  4Z7C A;  2DNM A;  5LMU F;  4EWT A;  3WBH A;  2BQ3 A;  4X84 A;  1DLO B;  4ZGA A;  4JV5 F;  2OTJ S;  2PMH A;  2CG8 A;  2FJE B;  3GYN A;  2ATL A;  1FWL A;  1TVR A;  2PI4 A;  1R0A B;  1KHK A;  2E44 A;  5LIA A;  2XRG A;  3C2P A;  3MAQ A;  5DDR C;  1QAJ A;  4K4S A;  1QLN A;  1B99 A;  1T9X A;  1LXN A;  1IKV B;  1RSC A;  2J0Q D;  4B3M J;  2MXY A;  5HRT A;  2ACY A;  3PKM A;  3OTO J;  2E9T A;  2D74 B;  1KRP A;  4MKY A;  1ZH5 A;  1HNX J;  2OMO A;  1UWA A;  1B70 B;  2HNZ A;  2M0G B;  2HFZ A;  2HYI B;  1CUL B;  3EGZ A;  3V6D A;  1K44 A;  1TKX B;  5L0B A;  1D09 B;  1FDN A;  2PEH A;  2IVF B;  1UFW A;  3LO3 A;  3TUP A;  4Z2X A;  1VHF A;  5KFG A;  1B7Y B;  2Y0S D;  1XMO F;  4K4W A;  4NZ0 A;  2RE1 A;  1JLQ A;  1EAY C;  2B6A B;  4U96 A;  1FNX H;  2YWH A;  5C42 B;  1KN6 A;  2D3Z A;  1DQ8 A;  2B9W A;  1PGZ A;  3VAK A;  4LVN P;  1DRZ A;  3ZNU A;  4EBD A;  3QRR A;  4FS2 A;  1KLN A;  3I9V 9;  3TAM A;  4DV4 F;  1PSD A;  4NMX A;  2KXF A;  2QLX A;  3JQM A;  1K0T A;  1HBN A;  5B0D A;  3LTO A;  5HAO A;  3NCR A;  1NSA A;  1OY6 A;  5L9N A;  4B3T F;  2AW0 A;  1XBW A;  1U45 A;  3BH7 B;  4UUW A;  3TJ9 A;  3DNC A;  4UZC A;  1CJK B;  4C3M A;  4DX5 A;  2V8P A;  1ELO A;  3AAW B;  4FNH A;  3N6M A;  1K9M T;  1E6Y B;  3GFH A;  2PFD A;  4K0K J;  1C2P A;  4JV0 A;  3T3F A;  1GTE A;  3HFV A;  2GIQ A;  1S9F A;  5DM6 Q;  1VLO A;  2RU9 A;  1E6V A;  5DLV A;  1V3Z A;  3R6G B;  1R43 A;  1RWX B;  4CLY A;  3L9Z A;  4P2S A;  1WG1 A;  3K0J A;  3DDN A;  1N33 J;  4LRB A;  2V68 A;  3PFO A;  3B8H A;  5E3C A;  2GML A;  5HLF A;  1L5U A;  1WC4 A;  4GRS A;  2V0N A;  3DOK A;  3DDI A;  1RHJ B;  3PJ9 A;  1HNV A;  3GII A;  2LEP A;  4CLT A;  1VCT A;  4M5N A;  4UPI A;  2B51 A;  5IZH A;  3Q23 A;  1NK8 A;  2V9K A;  1KHV A;  3FEY B;  4RWX A;  2PT0 A;  4O0I A;  4LJM A;  4ECZ A;  1AJB A;  4RWW A;  2IA0 A;  4URG A;  2VKZ G;  4LFB J;  4KH1 B;  2C2O B;  3OJU A;  4ZVU B;  4RR5 A;  3VAI A;  2XMW A;  5IJQ A;  5KG2 A;  3QT8 A;  2HHV A;  5L39 A;  1X4B A;  3R8Y A;  1HWI A;  2R7O A;  1F60 B;  5H9F K;  2MJN A;  4AYB D;  4WP9 A;  2MGZ A;  3QLH B;  1XMQ F;  4O23 A;  2QA4 S;  2C42 A;  1VQO S;  1D9D A;  2W5R A;  1PIL A;  3SCK E;  5KG0 A;  3SZZ A;  2XZW A;  5DG7 A;  1FVS A;  2RUG A;  2Z56 B;  4NYO A;  4QYZ K;  2Y8Y A;  5F8J A;  1KVI A;  5BYQ A;  1YTY A;  2HQF A;  3MMC B;  5F0U A;  2V34 A;  2UVR A;  1N32 F;  2IFY A;  3PX6 A;  3FBF A;  5GVQ A;  3LW5 C;  3LGM A;  2IC3 B;  3BGF A;  3A52 A;  2YNH A;  3R5C A;  1GXU A;  2CPF A;  2CVI A;  3AJD A;  3OPK A;  2ZJR Q;  4F3O A;  4CWB A;  2K7K A;  2E7V A;  4ZN3 A;  3T5K A;  4K8R A;  4UOG A;  3TQ1 A;  2QN6 B;  3M8Q A;  3NKY A;  5KFA A;  2LQ9 A;  1K73 T;  3LP0 A;  2XCP A;  2MHE A;  5ETT A;  2D9P A;  2B4U A;  2XLI A;  2DNH A;  2B43 A;  3QGH A;  4LF1 A;  1NDC A;  3SIP B;  2GJ2 A;  2B8Q A;  3G82 A;  1YKW A;  1RB0 A;  1Y11 A;  1R7I A;  2NXJ A;  2MQM A;  1WG4 A;  3CWJ A;  3ILL A;  1XNR F;  2C22 A;  1J5E J;  4ED5 A;  3MTJ A;  3JSM B;  3TEG A;  3R5J B;  4YN3 B;  2E5I A;  4I2Q B;  5C24 A;  5GAD U;  1REG X;  2LU1 A;  4WFZ A;  1ZM4 A;  4NLD A;  3OR1 A;  4GMK A;  5HRO B;  1U2C A;  2IM2 A;  2JLF A;  2VB6 A;  2DGQ A;  2JFD A;  4IRD A;  3K59 A;  4EEY A;  4ELV A;  2GVZ A;  1HNZ F;  1X4G A;  3GFX A;  2XMJ A;  4YB6 A;  1HQU B;  3H5U A;  4OMF G;  4ZCL A;  4FXV A;  1HD1 A;  4KJD A;  1T02 A;  1G7C B;  3I4H X;  2ANH A;  4LSN B;  3FK4 A;  4FNI A;  4RBU A;  1Z4U A;  2WHO A;  3D2W A;  1HPZ A;  3EDR B;  4WU3 A;  3LPE A;  3DMJ B;  4MK8 A;  3ENW A;  1TV6 B;  2HZC A;  1HHQ A;  1VR6 A;  3UFC X;  4WJB A;  1F2G A;  5KFI A;  4F26 A;  3C6U A;  2D1G A;  4EO8 A;  1GXL A;  2FVP A;  2OPS B;  4OYW A;  1SQE A;  2CDQ A;  3QID A;  2UVW A;  1LW2 A;  1RT1 B;  3HT0 A;  1UWB A;  4PQU A;  2P9C A;  4PEO A;  2VQF J;  1H98 A;  5E5N A;  2RRB A;  3PAC A;  3D1Q A;  1XJW B;  4DV6 J;  2CUY A;  2RDJ A;  1F0X A;  5HP1 A;  2FGC A;  4ENO A;  2A18 A;  1U8S A;  2KT2 A;  4UQT A;  1KS2 A;  3JSR A;  4GO7 X;  4QIV A;  1UVM A;  1RBO B;  3G86 A;  3NXZ A;  2VH7 A;  2DHX A;  3MUT P;  3MCS A;  2YKO A;  2UXD J;  2KB2 A;  1C0U A;  3OFG A;  2GV1 A;  1O51 A;  3NY0 A;  2H9Z A;  2BM0 A;  4ZA1 A;  4F8R A;  3CJR A;  1V5V A;  3TA2 A;  2C2M B;  3I31 A;  2I9S A;  2G4B A;  1KH9 A;  2N4C A;  1WTB A;  2NYI A;  4N5S A;  3PJW A;  2IBK A;  4DN0 A;  1BQM A;  4M5J A;  3SYZ A;  4LF6 J;  3CC7 S;  3ZZR A;  1BQN B;  1REV A;  4NXN J;  2YQ0 A;  1LV5 A;  3W2V A;  5I3U B;  3RRK A;  2DYA A;  4JI1 J;  2LA6 A;  1VFJ A;  4CLS A;  1P9Q C;  2CPI A;  3BBC A;  1V3S A;  2QZ8 A;  1SIW B;  4JB8 B;  4JUZ A;  4R5P A;  3FUY A;  4O3N A;  1HNW J;  3RW7 A;  3OL8 A;  1LWF A;  2HHQ A;  2YKP A;  4CYU A;  1C1C A;  3MPY A;  4C0B A;  4A8O A;  3OFE A;  5KOW A;  5KFP A;  3O3L A;  4C8Z A;  4JV1 A;  1J2V A;  2DHG A;  4PG4 A;  4TU7 A;  4DQS A;  5ETR A;  2FHM A;  1J5O B;  2DNP A;  3DI6 A;  2R7V A;  2VZ9 A;  1S6U A;  1FX4 A;  2AJ1 A;  1WD6 A;  1WF1 A;  1RA7 A;  2JVR A;  3FRZ A;  1T8E A;  3T02 A;  2ACM A;  4Q0B B;  3M32 A;  3RBZ A;  4OX9 F;  1KFD A;  1K7H A;  4WFA Q;  3O1L A;  1RDR A;  3R5B A;  1MML A;  4TKT A;  4H4M A;  2Y1R I;  1B0T A;  1ZAX A;  3IA0 A;  2H4Y B;  3E2D A;  2DRA A;  1KLM A;  2V8V A;  1NM2 A;  4DX7 A;  4U95 A;  1Y4Z B;  1PO6 A;  2BX6 A;  4Y6I A;  4EI2 A;  1VQN S;  2K3I A;  3GIL A;  1UA1 A;  3BQ2 A;  2V2Q A;  5AXM A;  3KK2 B;  4DPX A;  2XB2 D;  1IBK F;  3QT5 A;  4PYD A;  3KG4 A;  3EWG A;  1GAO A;  4IH6 A;  1VK3 A;  3DOL B;  3TZY A;  3KUG A;  3PR5 B;  5HI7 A;  2KZZ A;  5D15 A;  4TYB A;  3R9L A;  4C0O C;  5DLW A;  3GR1 A;  4K59 A;  3OFF A;  2AYM A;  2YWE A;  1DY3 A;  2PMW A;  3W63 A;  5CYQ B;  4NAS A;  4F3M A;  1S99 A;  1Q78 A;  1FFW B;  5GAH I;  4YFU A;  4DQI A;  1HD0 A;  3MCN A;  1NK9 A;  2RQ4 A;  1KKH A;  3CDB A;  3IAM 9;  3PO5 A;  2EKY A;  2XG8 A;  4DR6 F;  2CWK A;  4DSE A;  1N8R T;  4FZV A;  2F3J A;  3KG0 A;  4LSZ B;  3T6J A;  3CD5 A;  4J9M A;  3VAM A;  3QGG A;  1VRQ C;  4MIV A;  2QFI A;  1JNZ B;  1XER A;  1WJ9 A;  4KT0 C;  5DGA A;  3RBD A;  3GG1 A;  1DLO A;  3OL6 A;  4URS A;  2G13 A;  3CCV S;  1HR0 F;  2MKK A;  3R3T A;  2LXU A;  1OIA A;  3TUJ C;  3TZX A;  2ZBP A;  4USU A;  3BR9 A;  1R0A A;  2M8D B;  1UET A;  2EVZ A;  4I7F B;  4LBH A;  4USV A;  3C15 B;  3A8I A;  1IKV A;  4DQQ A;  2CNK B;  5KFH A;  4ZLJ A;  3HFK A;  3AQO A;  2M88 A;  1WAC A;  1RCX B;  5IOL A;  1KHJ A;  1CUL A;  1JJC B;  2IMW P;  4X66 J;  4WFY A;  3SCI E;  4DR3 J;  1TKX A;  2DGU A;  1VQL S;  2F5G A;  4H54 A;  4DUZ F;  4NA1 A;  3ZTS A;  5F8I A;  3TRG A;  4A8W A;  2IJN A;  2D7S A;  4EO6 A;  5KG4 A;  4M5I A;  3C8Y A;  1S7I A;  2FZK B;  2CJA A;  2RHS B;  2JEI A;  3AJ2 A;  2DNY A;  3LQV A;  2M3D A;  2K7J A;  1SJR A;  1DBD A;  3G87 A;  1FXR A;  2B6A A;  2CAJ A;  4ID8 A;  3M2R B;  2W2Q P;  3GIM A;  2AEF A;  2W7O A;  5JXS A;  5C42 A;  4X4P A;  2HG4 A;  3G6V A;  2W1B A;  4GO5 X;  5TJ3 A;  2YKN B;  2LKZ A;  2WOM B;  1UJ6 A;  2CQ3 A;  1N48 A;  4M5D B;  3E51 A;  5KFN A;  4I6A A;  2F40 A;  2M9K A;  2I6W A;  1JWW A;  2YX4 A;  4A8Q A;  2MZJ A;  4ES1 A;  5KFF A;  1CJK A;  3IGV A;  3N79 A;  3L95 X;  4AT1 B;  3I6P A;  2HFO A;  1K0V A;  1X4H A;  3P8B B;  1J27 A;  1E6Y A;  3CCM S;  2P5V A;  3DCA A;  1WSV A;  2DO0 A;  2VD3 A;  1CG2 A;  1FVQ A;  5DZ7 A;  2IM1 A;  4OJ1 A;  4OX8 A;  3N5F A;  4IOA Q;  2KRR A;  4NEY A;  3SI8 A;  2GHV C;  1MMN A;  2KXH A;  5JJB A;  4WXW A;  5DJB A;  4MKA A;  4OLP A;  3B78 A;  3G96 A;  4UOH A;  1F3F A;  2W5S A;  3CD7 A;  3S7R A;  5J2Q B;  2MQQ A;  3FDS A;  4L76 A;  3BQ1 A;  3NL0 A;  4WU2 A;  1VQK S;  1FE0 A;  1AA1 B;  3GV7 B;  4KHM A;  3EM1 A;  5KFK A;  1N0V C;  4QQB A;  1W2B R;  2IHR 1;  5U47 A;  3DRY A;  3FNN A;  1FWK A;  2GX8 A;  4JI6 F;  2HS4 A;  2SXL A;  2B9E A;  3KD8 A;  1KDN A;  3BRE A;  3LWL A;  1WOP A;  3LGN A;  1OYD A;  3M05 A;  4BCA A;  4H4K C;  1JLE B;  2HUR A;  4AUK A;  3M2U B;  3VVU A;  2XY5 A;  2F7V A;  3CXC R;  4ZVO B;  2ZOM A;  2LXI A;  2E1C A;  4MTP A;  1YJR A;  3N0V A;  5E0O A;  3TVY A;  1S10 A;  1KFS A;  4NLP A;  2AX0 A;  3ETM A;  1U24 A;  4CLZ A;  4FYY B;  3T6B A;  1U1L A;  3KLV A;  3OT9 A;  3R1L A;  3QLH A;  3B4M A;  4HKQ A;  2K1R B;  1SJF A;  1YHQ S;  3WC0 A;  4C48 A;  2IBO A;  1URR A;  1XMB A;  3G8Q A;  4CNY A;  1KQS R;  2WBM A;  4Z37 A;  4P7V A;  1DJ0 A;  5EN1 A;  4LVO P;  1CJT B;  3MMC A;  2PEB A;  1NHK L;  3NOG A;  2XO6 A;  2JEG A;  4B3S J;  3QMQ A;  4G1P A;  2GA3 A;  2IC3 A;  4BLG A;  3KLH B;  1SB6 A;  4X62 J;  2CQI A;  3IMQ J;  3EPG A;  1MMD A;  2P6S A;  3MK1 A;  4ZPA A;  2FJD B;  1NZA A;  3MZI A;  4JI5 F;  4K2J A;  2ASJ A;  2JX2 A;  1QVG R;  4RX6 A;  2AP6 A;  3GON A;  1U1K A;  4LMZ A;  3WDO A;  4O3P A;  5HJX A;  1JLG B;  5F41 A;  2O67 A;  4CLK A;  4KY3 A;  1NSK L;  3JTN A;  3IR5 B;  2MQO A;  2RVJ A;  5L1I A;  3NCQ A;  2BKO A;  4OZ0 A;  3VV2 B;  4DUY F;  4PAA A;  3IRX B;  5ADZ A;  1VC5 A;  4AQY F;  1I94 F;  4ATN A;  4IOB A;  7AT1 B;  3QNW B;  1LEO A;  4YB1 P;  3IS9 B;  3N4W A;  1NB7 A;  4CT8 A;  2JLG A;  2H4W B;  2KG1 A;  3JSM A;  2EWH A;  4JI7 J;  2M7S A;  2XZT B;  4BDP A;  2VG7 B;  4I2Q A;  1X9M A;  1G6B A;  3VR1 A;  4RJV A;  4ED6 A;  2KFY A;  3ED4 A;  2ZHO A;  1L3K A;  5HRO A;  2VA2 A;  1OS5 A;  3M2V B;  2C3O A;  4LF9 F;  1N2L A;  1N5Q A;  4Y2M A;  2Q43 A;  2GSN A;  3M8P B;  2NXE A;  4EBE A;  1F9E B;  3OVA A;  1M5O C;  1HQU A;  4DV3 J;  1R3N A;  4USH A;  4LSN A;  1Q79 A;  2DRD A;  3N5B A;  2QL9 B;  8ATC B;  2ZUA A;  5K8O A;  4HHH A;  4I6Y A;  2OEK A;  3DMJ A;  4RBT A;  1AJA A;  1TV6 A;  3OLA A;  1MWY A;  5CD4 A;  2CJ9 A;  3NEK A;  4NX9 A;  3KDN A;  2OPS A;  1RUS A;  3KYL A;  3E3X A;  2ZH6 A;  5CAA A;  2KU7 A;  1RT1 A;  1T9Y A;  3DXB A;  2DPJ A;  3H98 A;  4F0M A;  3EUN A;  4JI3 F;  1S12 A;  3A13 A;  1G2E A;  2BJ3 A;  3L7U A;  5I42 B;  1YJV A;  3J7Z 5;  5IXU A;  2Z4P A;  3NKP A;  4CLW A;  1ALK A;  1S97 A;  1GMW D;  4DPT A;  2ERR A;  1RAF B;  2XCA A;  3FGV A;  1KSP A;  1GK8 A;  4XIU A;  3BB5 A;  2GSO A;  4AL6 A;  1RKJ A;  1RTH B;  3LAL A;  3N6L A;  4EK2 A;  3JTO A;  3GV8 B;  4O44 B;  2XS7 A;  2B7B B;  1UW4 A;  3R97 A;  3J81 Y;  2KG0 A;  1ALH A;  3V81 B;  1UFK A;  5MLC V;  3BGR B;  4ZS6 A;  4KJG A;  2RF2 B;  3WIV A;  2NZ4 A;  2LFV A;  1BQN A;  1BLU A;  2CJQ A;  4HTJ A;  2XHC A;  4YHH J;  5I3U A;  2ZBQ A;  1Y10 A;  1QE1 B;  3OJS A;  4CT9 A;  4DSI A;  3NS5 A;  3ZZ0 A;  2LEA A;  3TO8 A;  4FS1 A;  4NLV A;  3GV5 B;  1U09 A;  3HZG A;  1VYA A;  2I38 A;  2KHC A;  4CLP A;  2LDI A;  2OKQ A;  1NCL A;  3Q2S C;  2V8D A;  2OLW A;  1Y00 A;  4EYH B;  5C7P A;  3JTP A;  4HL9 A;  4I56 A;  4G65 A;  3JXO A;  5C2G A;  3L7P A;  4KAV A;  4F4A A;  2PO4 A;  3BBB A;  1J5O A;  2VIH A;  2HHP A;  2AJF E;  2VC0 A;  3OTO F;  2KDO A;  3LUY A;  2G9Y A;  3QGP A;  2XWX A;  3H42 A;  1HNX F;  1Q8B A;  4HYK A;  3VAF A;  1FJG J;  5GME A;  4Q0B A;  2HGM A;  4W4M A;  3ENV A;  1JJH A;  4M5M A;  2HHX A;  3UD4 P;  2KFZ A;  2D3O 1;  3CVK A;  2FJX A;  2E9R X;  1FRH A;  4IR1 A;  1VJQ A;  4KYZ A;  2G0I A;  4WKR A;  2GAG C;  4NLS A;  3CSK A;  2HND B;  1RKI A;  1ED9 A;  2RDI A;  1TK5 A;  1U26 A;  2FPH X;  1P9Y A;  4X4V A;  2R2U A;  3DLG B;  4HH1 A;  3KK2 A;  1T0T V;  5C25 B;  3G2X A;  4PZV A;  5LQQ A;  4ILL A;  1OO0 B;  1DQA A;  3ONQ A;  4DL7 A;  4MK7 A;  2DR5 A;  1WNE A;  4RW6 B;  1YBU A;  3CC2 S;  2G1D A;  2XBP A;  2FHJ D;  2RH3 A;  3ZZP A;  4KFB B;  3DOL A;  4ZPT R;  2ZH8 A;  2HQI A;  1RLC L;  4OI6 A;  2ZD1 A;  4CIO A;  3B54 A;  4F50 A;  1BC6 A;  2ZOF A;  4B3R J;  1LXJ A;  5CYQ A;  4YDX A;  3NGK A;  3NGS A;  1L3V A;  2XWY A;  4P9S A;  1F5C A;  1HJK A;  3SFG A;  4K0K F;  2JHE A;  3CUL A;  4CO5 A;  4QWA A;  1QAY A;  3Q8Q B;  4WWS A;  2FZG B;  1QSY A;  5DDO C;  3GR0 A;  1RWK B;  1FES A;  4QWD A;  2V63 A;  1NDK A;  4CTA B;  3RGI A;  1H72 C;  4M1K A;  4RL1 A;  1N33 F;  1HI8 A;  5HVH A;  2EFQ A;  1MN9 A;  1FDD A;  1D9A A;  2HRT A;  3GCW P;  1EW8 A;  3DRP B;  2JC1 A;  2C2K B;  1VBK A;  2VG6 B;  3UNY A;  1XK8 A;  3J80 Y;  3QO9 B;  4ZPC A;  2B3T B;  4I7F A;  2NZC A;  4ZVE A;  3GIK A;  4BBY A;  3PTW A;  2UUA J;  3KJV B;  5IT9 U;  3C15 A;  2VJU A;  4ALZ A;  2G1H A;  3VZH A;  3Q89 A;  2W5X A;  1YRU A;  3J80 U;  5KFO A;  2VG5 B;  5EX0 A;  2BZ2 A;  3TX8 A;  3QT7 A;  1FCA A;  5F8G A;  4LFB F;  1RYR A;  1QTN B;  4DX8 H;  4OLO A;  1AUS L;  2C3M A;  3D3B J;  1TAQ A;  5AE2 A;  4E2F B;  4I1T A;  1H73 A;  4Q2L A;  5GAD I;  1HWJ A;  3FQL A;  3AB4 B;  3W9I A;  2DGV A;  2XEX A;  1SQG A;  2ZH2 A;  3CIZ A;  1AJC A;  2NSC A;  1UAW A;  4ID5 B;  2IAJ B;  3D4J A;  3WHI A;  1IBL J;  3M2R A;  4AXJ A;  2KXN B;  2VV5 A;  1FD8 A;  4K7Q A;  2ZNZ A;  4H4O B;  1NK7 A;  3CJ5 A;  1PJ7 A;  3OXF A;  2Q6B A;  2QLJ B;  4DLG A;  4DSJ A;  4LUB A;  2YKN A;  3AOD A;  3M6W A;  2WOM A;  4PWU A;  3BN4 A;  3T1H J;  4NYP A;  1HLW A;  4M5D A;  4J9L A;  1TFY A;  3GB0 A;  1IXK A;  2MMY A;  5FDL B;  1ZTW A;  1UEV A;  1YLX A;  1SQF A;  4EGL A;  2A2D A;  1KOH A;  2EG2 A;  3O8W A;  3RB4 A;  3W5Z A;  4RW8 B;  4ZDN A;  1PBA A;  1R8C A;  3FBC A;  3MAH A;  2VIC A;  3CMQ A;  2NQP A;  1NRK A;  3CD0 A;  1CC7 A;  1OY8 A;  2N7Y A;  2QYC A;  4DHV A;  1IJF B;  3T5L A;  2CQH A;  3CDW A;  1U6B A;  2DXD A;  1P1L A;  2WON B;  2OIH A;  4DFP A;  4ED2 A;  2J5A A;  5H1S V;  2DNG A;  5GAE U;  3CCZ A;  3OTB A;  3KHH A;  1PIE A;  2DEJ A;  4RUC A;  3CF5 Q;  5J2Q A;  3IRW P;  2D1C A;  3RR7 A;  2AHO B;  4J9P A;  5HL7 Q;  2GAH C;  1S49 A;  4I67 A;  2IM0 A;  1HDH A;  4A47 A;  4I68 A;  3GU0 A;  1VDH A;  2ZHA A;  3CCT A;  1R89 A;  1NK4 A;  2AIR B;  3HX9 A;  3LWM A;  5A8K B;  2H48 B;  4ANE A;  1N2K A;  4OZJ A;  2RKI B;  5D0G A;  3X3U A;  2DXF A;  2RAQ A;  4KR0 B;  4DV1 J;  4I64 A;  2AT1 B;  4WP8 A;  2Y1J A;  1JLE A;  2HS0 A;  2Y8W A;  1AW0 A;  3HF5 A;  3M2U A;  1S6O A;  2MLY A;  4C8L A;  4MAK A;  1B7F A;  2APO A;  3OQ2 A;  2VBZ A;  1XEZ A;  3CUN A;  1F5B A;  1KNZ A;  2JSX A;  2XR9 A;  3DLJ A;  2QSW A;  4TQS A;  1SKW A;  5CD4 H;  2HZV A;  1DTT B;  2CVE A;  2XQC A;  1A9N B;  3G6E S;  4ZHR B;  1S79 A;  5L8R C;  3BDP A;  2VQF F;  1CJV B;  1LFP A;  3BH6 B;  4ZKA A;  2K1R A;  4DV6 F;  2XSF A;  4NLX A;  1C1B B;  3CCQ S;  3MEG B;  1WEZ A;  2RH6 A;  1NK0 A;  2VDH A;  4W90 B;  2W5V A;  5LSR A;  4P72 A;  1C0T B;  1A0O B;  3IWX A;  1CJT A;  5ETQ A;  2UXD F;  1PYT A;  1A6L A;  2HWT A;  3UCG A;  3GIR A;  1YRX A;  3H5X A;  2IUC B;  3BSC A;  4RUB A;  4PYA A;  2MZS A;  3HD1 A;  3KLH A;  3K8W A;  4DL5 A;  2VFU A;  1SHN A;  4J9U E;  2W01 A;  2QZU A;  2VBY A;  4OI2 A;  1WEY A;  1HW8 A;  2V2V A;  5K9F A;  2Z30 B;  2DT9 A;  1PJ5 A;  2VPZ B;  1T7P A;  4LF6 F;  3MFH A;  2VA3 A;  2A6O A;  4NXN F;  1JLG A;  2V8H A;  4ZG9 A;  2JEJ A;  5A2Q Y;  4NLU A;  1WC3 A;  2FTR A;  4QU7 A;  2R7S A;  1X5S A;  3I96 A;  2W25 A;  5KG7 A;  3SBM A;  3ZZZ A;  4C9D A;  1ZEB A;  1HNW F;  3IRX A;  3MPW A;  3QJL A;  2MQN A;  3QSI A;  5A2Q U;  4K50 A;  4ZN1 A;  3IS9 A;  3Q2T C;  4TN0 A;  3CCW A;  2XY7 A;  5B0G A;  3ICL A;  3T1A A;  2MTL A;  3MEE B;  2KKH A;  2I0X A;  4ZVF A;  2ZH7 A;  2VG7 A;  1SJ1 A;  1I51 B;  4KGX B;  3NGT A;  1U0H B;  2Z2L A;  4NLG A;  3QWU A;  3M2V A;  4B02 A;  4CYS A;  3I0R B;  4GC7 A;  2XS5 A;  3M8P A;  4LBP A;  1QM9 A;  2QRR A;  2F9D A;  4WTO B;  4DR7 J;  3BBF A;  3VQT A;  2BW2 A;  4DI6 A;  2WVD A;  1NU4 A;  2DIT A;  4L3N A;  5IWA J;  4ZVH A;  3BDG B;  3EZU A;  3T41 A;  2XZD B;  4K4T A;  3BKU A;  4PPD A;  3MF5 A;  3NKN A;  4MKV A;  2GMJ A;  4KE5 A;  2OTL S;  4TN2 A;  2WZ1 A;  1P1T A;  2B9X A;  1APS A;  4IO1 A;  3UDE A;  2H3E B;  4Q8E A;  5E41 A;  5AE3 A;  2L41 A;  2W9A A;  3R2D J;  1T9T A;  4TLQ A;  3GLJ A;  5I42 A;  2Y3Y A;  3CE8 A;  4QZV B;  4DCJ B;  3AFG A;  2CNL B;  2OD6 A;  2PD1 A;  1EJ7 L;  3AH6 A;  4JI2 J;  3PX0 A;  4FF1 A;  5KT7 A;  1RLD A;  3ZXW A;  1RTH A;  4UTG A;  4RW9 B;  3FSX A;  4B9T A;  2MY7 A;  4O44 A;  2ZNY A;  2QE5 A;  2IYI A;  3OL7 A;  3BGR A;  2BXJ A;  2C2D A;  1HNI B;  2YQ3 A;  3MMB B;  4CM0 A;  2RF2 A;  1S0M A;  2VON A;  1RT5 B;  3J81 j;  3AD8 C;  1DZ5 A;  2L9N A;  3RTV A;  2FHO B;  1QE1 A;  1RAI B;  3TAR A;  5CZX A;  3I5C A;  1N34 J;  1HNV B;  3SXL A;  2MEW A;  7FDR A;  5BXI A;  4YB7 A;  2C3Y A;  4YR2 A;  1S1V B;  2MZQ A;  5GRR A;  2HHW A;  3S6E A;  1K8A T;  1VQS A;  3K5O A;  2OFH X;  3HMJ G;  3H0P A;  2CQG A;  4KC5 A;  4KRW A;  4WFX A;  3T1Y J;  1FKO B;  1RCO B;  1EW9 A;  4HT7 A;  2C28 A;  3F56 A;  1LOU A;  1K1Q A;  1S0O A;  4UF4 A;  4DL6 A;  3HO1 A;  2NXC A;  1UW9 A;  4F2R A;  2HQC A;  3MR5 A;  5DLG A;  2L08 A;  3MPU B;  1N88 A;  3PDN A;  3P6Y C;  1VIS A;  3PW0 A;  3BS9 A;  3TUZ C;  4UOC A;  4L6V 3;  1VQ9 S;  4CH0 S;  1X7V A;  4CNZ A;  3Q86 A;  4K4V A;  4Y34 A;  3SCL E;  4X66 F;  1H2T Z;  4DR3 F;  1LFW A;  4OI4 A;  4RUA A;  4IDK B;  1VBX A;  2CG4 A;  3I0S B;  3T00 A;  1V9O A;  3HHD A;  4NLT A;  3UWT A;  1C4C A;  5GAH U;  4WZQ A;  3BO2 A;  2BJE A;  3DLB A;  4ZMM A;  2VPW B;  1GEH A;  4FN5 A;  2AZ3 A;  5CH7 B;  4ECU A;  3OW2 R;  3D3C J;  3UVJ B;  4V19 J;  3K58 A;  1XR5 A;  1PYS B;  2HND A;  4FF4 A;  3SQO P;  3OR2 B;  4WK3 A;  2UXC J;  3NRB A;  2ASY A;  1YJN S;  3DLG A;  4E8U A;  3THV A;  3CDU A;  4UPL A;  3PW4 A;  1ZA1 B;  2VUG A;  4K5R A;  5C25 A;  1R31 A;  2NXN A;  4QW9 A;  4RW6 A;  4MIA A;  4KFB A;  3V6J A;  2HHU A;  1S48 A;  2RJZ A;  4P71 A;  1JLF B;  4YR3 A;  3IGY B;  2MZT A;  3QJP A;  1O0P A;  3OXL A;  2OML A;  2VAS A;  2CJB A;  1ALJ A;  2M8H A;  4IFY B;  4CO0 A;  3DPC A;  1SJ3 P;  5F8M A;  2R7U A;  2P6T A;  3NAI A;  5F8H A;  1TMJ A;  2J0W A;  2CQ2 A;  2VQE J;  4C97 A;  1NEE A;  3KFW X;  1NAQ A;  2M4M A;  1ELY A;  3JQK A;  1RAA B;  4CTA A;  1RT7 B;  5KFW A;  2KYZ A;  4OYO A;  4QIW D;  3UD5 A;  3SSR A;  2ZWO A;  3SSQ A;  3BO4 A;  1JQG A;  1V6H A;  5A0Y B;  4F4W A;  4DCP B;  1RAJ A;  3DRP A;  2DNL A;  2DH7 A;  2VG6 A;  3FZ2 A;  3TP2 A;  1ZTT A;  1U0S A;  1IKX B;  2HSE B;  1ZBT A;  4Q8F A;  3ZO7 A;  5FD1 A;  1OPZ A;  3LAN A;  3MCM A;  3QO9 A;  4CO3 A;  4ZPW R;  1IBM J;  3KJV A;  1W26 A;  5M2R A;  4FDI A;  1I1G A;  4QOT A;  3IM9 A;  3UCU P;  3KKF A;  1U6Z A;  3D6F B;  1FER A;  1Y7P A;  2VG5 A;  5CHC B;  3AXM A;  1S1T B;  3HCX A;  2KZM A;  1M0S A;  2CPH A;  4YP3 A;  2PI5 A;  4GC6 A;  1F6T A;  2GLQ A;  2RQK A;  1RHR B;  2GJF A;  3MDF A;  3AXK A;  2WVE A;  1E3C P;  2HIY A;  4NOH A;  3MM6 B;  1RAB B;  2DY9 A;  1N56 A;  1RAE B;  5HQL A;  4YY3 J;  3TVK A;  2LDY A;  3K89 A;  5DQH A;  2MZ1 A;  4DS4 A;  1R8B A;  2MKC A;  5KT4 A;  1KTQ A;  4Y00 A;  1X8D A;  4ID5 A;  2IAJ A;  4WCE Q;  3TUI C;  3NKQ A;  4N56 A;  1CVJ A;  1ED8 A;  4IYQ A;  3D7S B;  4H4O A;  4PXB A;  1GH8 A;  1SKR A;  2O01 C;  2XNQ A;  3CDA A;  1T3O A;  3CCR S;  3Q22 A;  3R5G A;  2V50 A;  4K5S A;  5FLX Y;  4DU7 A;  1MSW D;  4B3S F;  5K20 B;  1RBL A;  4X4Q A;  2QA1 A;  5IV3 A;  1F9F A;  3V6H A;  3FSI A;  1Q95 G;  1JXL A;  5FDL A;  4X62 F;  1P8G A;  2YKM B;  1FD2 A;  3R7N B;  4CH7 A;  2F4V J;  1B4S A;  5EWF A;  4ZP8 A;  2OGU A;  1JMT A;  3G6X A;  4EZ6 A;  3TX0 A;  4R0E A;  2D69 A;  1OWX A;  3K5M A;  4RW8 A;  1ZEF A;  1ZYQ A;  3HK2 A;  1FRK A;  4GKJ J;  5LM7 E;  3NMR A;  2KJV A;  4IFV B;  3PFE A;  1C1C B;  1TFW A;  2YX7 A;  3GCX P;  1U1Q A;  2VFV A;  2WON A;  3SQG B;  4F0H A;  2IY5 B;  3IDD A;  1T9U A;  4RW4 B;  1YJW S;  3SZY A;  3EDQ B;  3NBP B;  1I6J A;  4BS2 A;  1SH3 A;  3D0I E;  4PXC A;  2YNI B;  5HMX A;  1VBY A;  4BWM A;  4B3T J;  3EVO A;  2K06 A;  4NML A;  4M5G A;  3M8W A;  5ETL A;  1RHM B;  2FJW A;  4TYA A;  3B4D A;  3GIJ A;  4RUH A;  4RNO A;  3DGP B;  2AJQ A;  2GHP A;  3A4T A;  4G1Q B;  1VQ7 S;  1FXD A;  1S6P B;  3HPO A;  4DV5 J;  1W2I A;  3OBI A;  1OPI A;  1RAC B;  2Z8Q A;  4X4S A;  1WDD A;  3E01 B;  4RKU C;  5C66 A;  5A8K A;  3VHQ A;  5L1L A;  2ZDP A;  4DG1 A;  4OL8 A;  2RKI A;  5CZV A;  4X65 F;  4DV3 F;  1U2F A;  2CXE A;  4ZOS A;  4F4Z A;  5B0E A;  3GJT B;  3MHY A;  4UST A;  5SZT A;  1VC6 A;  4EZ9 A;  2PDA A;  4ETZ A;  2KL8 A;  4U67 Q;  3OXG A;  4S0M A;  4OI3 A;  4RBV A;  4FDF A;  4C8M A;  4OYA A;  1DTT A;  3O2I A;  2NPI A;  1YX2 A;  2BW7 A;  1N4L A;  4ZHR A;  1TUV A;  2J7U A;  4P2M A;  1CJV A;  1AT1 B;  2X1G A;  4C11 B;  3WIU A;  3BSO A;  5DQG A;  1C1B A;  2X3D A;  4CYR A;  3MEG A;  3IM8 A;  2HVH A;  4J9O A;  5DM7 Q;  3TJA A;  1UVN A;  1C0T A;  1LWX A;  5AT1 B;  1KH4 A;  3JAM U;  5JVG Q;  3NGD A;  3W5Y A;  2I5J B;  4W92 B;  4HI2 A;  1JXV A;  2CNN B;  2IUC A;  5KFR A;  1S57 A;  1HHT P;  1ANJ A;  1YDL A;  5DRK A;  5DLF A;  3LA0 A;  2LQ5 A;  2FVQ A;  3TOQ A;  5LT5 A;  4O4G B;  1T05 B;  3CPW R;  2UUC J;  4BC7 A;  2CPX A;  2DR9 A;  4ZP9 A;  5THW A;  4WYW A;  3M6U A;  1RTJ B;  3CMR A;  3HVR A;  3MMJ A;  5LSL A;  4YHH F;  4XK8 C;  5K8P A;  2FC8 A;  3A3N B;  3H2U B;  2YVS A;  3WAV A;  4HHJ A;  1Q8K A;  1OYE A;  5D4N A;  2IDE A;  3FMW A;  5IT0 A;  4Y2C A;  2J7K A;  4DF8 A;  1N54 B;  4U6P A;  2X7I A;  3SDE B;  4X4U A;  1X4D A;  2ZH5 A;  4KGZ B;  2CJY B;  3LGH A;  3D67 A;  3Q8V A;  4Y2I A;  2H1Y A;  3UN5 A;  3MEE A;  1F3V A;  2WVC A;  4QIG A;  4PKD B;  1NHU A;  2BKP A;  3O44 A;  4MYU A;  4USI A;  1NND A;  3RB3 A;  2YQ1 A;  3DXS X;  3UD3 P;  1U0H A;  2JL9 A;  2HZA A;  2FVC A;  1LKZ A;  3ISN D;  1DAX A;  3L4B C;  2L9D A;  3I0R A;  1RWW B;  2DNN A;  4G3I A;  2CWX A;  1X9W A;  4DR1 J;  3I4P A;  1FJG F;  4RNH A;  3PRV A;  1QAX A;  1FDA A;  3L7O A;  1URN A;  4ED0 A;  1CQN A;  1TZ0 A;  1Q8I A;  1S6Q B;  1S0V A;  1KR4 A;  3SMZ A;  4B9N A;  4XDD A;  4LRC A;  3N9U C;  1Y5I B;  2ZVI A;  1FRX A;  4R0J A;  5BYS A;  3BDG A;  1FRL A;  2QSF A;  4USM A;  1YGY A;  4NCB A;  4YQW A;  3G9C A;  3QBC A;  3Q8Y A;  2DO4 A;  2BOP A;  1IWG A;  2Y1I A;  1U49 A;  2Z2Z A;  1TR0 A;  3BV8 A;  3NP5 A;  3EE3 A;  2DD8 S;  5L0K A;  1SPB P;  2A2C A;  1SH2 A;  2C2R A;  4RZR A;  2WVB A;  2G9O A;  3SEO A;  2J9D E;  1VIO A;  4M95 A;  3K2Y A;  3BKF A;  4ECQ A;  1C4A A;  5KFC A;  2G2Z A;  2F9J A;  3W9H A;  1JKH B;  4XO0 A;  4WK1 A;  2VBX A;  1SBR A;  1VIX A;  4PWW A;  4ZIT A;  1Y0H A;  1YIT S;  4B3R F;  4RW9 A;  1AFJ A;  3NMA A;  2V5H G;  3M8S A;  1HMV B;  4ILR A;  1FT8 A;  3HJF A;  3UR0 A;  1KHL A;  2V67 A;  2B9Y A;  2ATC B;  1MU2 B;  3BEG B;  4YEA A;  1HNI A;  3PNI A;  3JSB A;  3MMB A;  4OZN A;  3KK3 B;  1SC4 B;  3PHE A;  4ZVR B;  1RT5 A;  1Y3K A;  2EC2 A;  4RNN A;  4N76 A;  5D6G A;  2XI2 A;  5GAG U;  5L0E A;  3PR4 A;  4LF2 A;  4WP3 A;  3EGN A;  2MZR A;  4ELU A;  4C0H A;  2Q1L A;  3DRX A;  5F9L A;  1S1V A;  4L73 A;  1YQH A;  3KXD A;  1SC6 A;  1X5O A;  1RWM B;  1DUR A;  4OYZ A;  4NYZ A;  3EIC A;  3BF4 A;  1FKO A;  2UUA F;  4M94 A;  4DR4 J;  4MJK A;  1GTH A;  2NS1 B;  5KTQ A;  4QCL A;  3ZTP A;  1RWO B;  2RSQ A;  3AHP A;  2VJV A;  2XMK A;  4B9M A;  5C2C A;  3CO9 A;  5ETS A;  5KT3 A;  1VQY A;  1MG7 A;  2XMM A;  5E3R A;  5GAE I;  2UUB J;  4PXD A;  2YX1 A;  4OHV A;  1NLK L;  3H5Y A;  1DTQ B;  3K5P A;  1XTZ A;  1XQI A;  1UPP A;  5D77 A;  5KG5 A;  3D28 A;  4IDK A;  3I0S A;  1T94 A;  3CC4 S;  4P7T A;  1W25 A;  5F9N A;  5EGH A;  5IJS A;  3UVJ A;  3R6L B;  2BEF A;  1IBL F;  2WCX A;  2AYB A;  1EP4 B;  5H9E J;  2FLL A;  1VRU B;  1KBR A;  3OR2 A;  3TWZ A;  5G4D A;  4WTY A;  1XR7 A;  3Q8R B;  1FKP B;  3F73 A;  2IIH A;  3T1H F;  1T11 A;  2G2O A;  1X4A A;  2EBG A;  4ED1 A;  2IVY A;  3DC2 A;  2FUG 9;  2E29 A;  1JLF A;  3V4I B;  1TL3 B;  1WEL A;  2H5E A;  2E5J A;  1YZ6 A;  2RD5 C;  5CXT A;  2BYC A;  2GS8 A;  1KVK A;  1P6T A;  4F4Y A;  5SUH A;  4ZK7 M;  4IFY A;  1CQM A;  3RB6 A;  1IJE B;  2LQB A;  3BGL A;  2BKN A;  4OHX A;  3IBW A;  3W64 A;  3C19 A;  2RU3 A;  4NA2 A;  3L3C A;  4DPO A;  1IVZ A;  3AOC A;  2ZC3 A;  1QUV A;  4MFB B;  2JFK A;  1RT7 A;  4HI1 A;  5KOX A;  2CPE A;  2KT5 A;  2DR8 A;  4ZLN A;  1GFW B;  3OFH A;  2R7X A;  2GIR A;  1QUP A;  1FFS B;  2J9C A;  3TNV A;  3NLC A;  5A0Y A;  3H20 A;  3UPF A;  1VLY A;  1FKA F;  3KHR A;  4KHP J;  1SI9 A;  1IKX A;  2G2Y A;  4OI1 A;  4ZLP A;  3H2L A;  1VBZ A;  1EJJ A;  5KFJ A;  1IUJ A;  3TW0 A;  1PBU A;  2FD2 A;  3DYC A;  2FY8 A;  3ILJ A;  2FLN A;  4UY8 T;  4DR6 J;  4C98 A;  2GCF A;  3S01 A;  4DV1 F;  1CJU B;  2JC0 A;  4FBU A;  9RUB A;  4LR2 A;  1S1T A;  3MR7 A;  3RZA A;  4A8K A;  2QLW A;  3LH2 S;  3TEH B;  3QFH A;  1PJ6 A;  1GNK A;  4R8U B;  4CXK A;  1FNM A;  2HIQ A;  2E66 A;  1Y6V A;  4TY9 A;  1RT6 B;  3LAK A;  1WC1 A;  3MM6 A;  1NH7 A;  5LXY A;  3MED B;  2EBE A;  1AUD A;  2DHH A;  1EX8 A;  4ED8 A;  3OVS A;  3HDS A;  4KM4 A;  2Y0B B;  1UJ5 A;  1FRM A;  2HW3 A;  1NB2 A;  2JH3 A;  3M6V A;  4C4W A;  2XMA A;  3UW1 A;  3DOM B;  3KTQ A;  2WB4 A;  2EK6 A;  3EXC X;  5KG1 A;  2VDI A;  2DGT A;  1HBU B;  3IR6 B;  5D4P A;  4XPE A;  3AOA A;  2QL5 B;  4WZM A;  3MM8 B;  2DTJ A;  1FI4 A;  2A3J A;  4AFF A;  3LXQ A;  3WX8 A;  4A8X A;  3MXH P;  3RRG A;  1JXE A;  1Q86 T;  5K5M A;  2VKR A;  1X4F A;  4R25 A;  1HBO B;  3SZ2 A;  1FF2 A;  5HVG A;  1NDL A;  5EUH A;  3KJQ B;  3KNA A;  1E1Z P;  3EZ5 A;  2YKM A;  3BPD A;  1YIJ S;  2Q3P A;  3F41 A;  2B5J B;  2OEM A;  3FBB A;  2J7W A;  1NKE A;  3JS9 A;  4LF5 J;  4JI0 J;  3K5L A;  1KTV A;  4XAK A;  2V4Q A;  3ULH A;  6FD1 A;  3UN2 A;  2VL1 A;  3H90 A;  5DO2 A;  2Z2M A;  2K8G A;  3M8Z A;  3CD6 S;  4ZP7 A;  2PSZ A;  4IFV A;  1UCN A;  4CXS A;  3Q8U A;  4P75 A;  1QDU B;  4WIQ A;  3SQG A;  1ZM9 A;  1HWU A;  4RW4 A;  1HL6 A;  3NBP A;  1OMS A;  3FVY A;  5HQM A;  2YNI A;  4DPW A;  4MK9 A;  2ASD A;  4KHR A;  3BGU A;  2W4D A;  2C2E A;  4GTX A;  2HVZ A;  3DGP A;  4G1Q A;  4LF7 F;  4F36 A;  1S6P A;  3HD2 A;  2Y1L B;  4DL0 C;  1N5V A;  4WE1 B;  2QL7 B;  4LFA J;  3E01 A;  4NE9 C;  3FZB A;  3CTR A;  5T7L B;  5J1P A;  2Q66 A;  4CO2 A;  1QSS A;  4DR7 F;  2GVD B;  2OHD A;  1IN0 A;  1S0N A;  3GP9 A;  2D41 A;  4ED7 A;  4K4U A;  4K4Y A;  4KJI A;  2YBV A;  5CAB A;  2R2T A;  1SKS A;  4J9N A;  4DL2 A;  2DH8 A;  1HHS A;  5IWA F;  4NWJ A;  5CCM A;  5B7W A;  3V4M A;  1X0P A;  3BQ0 A;  5L1J A;  2OPR B;  1IR2 A;  2BUN A;  5LSO A;  1F5A A;  4NWX A;  3N01 A;  1HQE B;  4HR2 A;  2QFJ A;  2YWF A;  4C11 A;  2W2M P;  2ZD1 B;  3ZZY A;  4DPY A;  1V3R A;  2NLW A;  4M63 A;  1YSJ A;  2A0F B;  1ELX A;  3EXY A;  4JI2 F;  4LIW A;  2ZH9 A;  1FWP A;  3TA0 A;  3GYX B;  4U8Y A;  2I5J A;  4B9V A;  3FSY A;  1RWU A;  4P52 A;  2IJR A;  1UJ4 A;  3W65 A;  2W9C B;  2HAF A;  1WF2 A;  3M8R A;  4DLE A;  4C3K A;  2V69 A;  4O4G A;  1T05 A;  3A1Y G;  3T5J A;  3DHX A;  3QAT A;  2PN6 A;  4L75 A;  1HIY A;  4RO0 A;  2WW4 A;  2R8G A;  1VQ6 S;  1VQ5 S;  3FCH A;  3HZE A;  1NSQ A;  1RTJ A;  1NZ8 A;  1BGX T;  2M2B A;  1R0C B;  1NKB A;  5KG3 A;  3RYL A;  2HGN A;  1E2S P;  3DDK A;  4OZ2 A;  4DCO B;  3SFU A;  3PV8 A;  5B0F A;  3E2E A;  3D9B A;  1N34 F;  2MKY A;  4LBI A;  3D1O A;  1K1S A;  3M1V B;  1I5O B;  2C1E B;  1VHI A;  2KVI A;  4NRU A;  4MMO A;  2ZH4 A;  3NOC A;  4JI8 J;  1FA0 A;  1NJX A;  3SDE A;  1HW9 A;  1MN7 A;  1RAG B;  3DYA B;  4RW7 B;  4NZ6 A;  4MIW A;  2BAC A;  1TAU A;  3MOZ A;  4B9L A;  3T1Y F;  5DZ6 A;  4KGK A;  1LWC B;  3P96 A;  4Q45 A;  1NJY A;  5DLT A;  4X64 J;  4JV2 A;  2MST A;  1FK9 B;  4NI2 B;  4IUF A;  4TU9 A;  4FYV B;  1EW2 A;  4JOU A;  5EHH A;  2IDL A;  4CH1 A;  2FJV A;  4DV0 J;  1N52 B;  2CQB A;  2VOP A;  5J2P B;  4YS2 A;  5AXK A;  3RW6 A;  3CME S;  1S6Q A;  1T95 A;  4CO4 A;  4DSK A;  1XC9 A;  5HVF A;  2NR0 A;  1UEU A;  4HAC B;  2XO7 A;  3N6N A;  3U1N A;  2ASL A;  1I3O B;  1H0H B;  1Z2Z A;  3PY8 A;  2RHQ B;  3QAE A;  1HQ2 A;  1X9S A;  3U7J A;  1YJ7 A;  4C8Y A;  5M2P A;  1IWA A;  1N5Y B;  3D1H A;  4I69 A;  1IQZ A;  1DFD A;  5F0W A;  5A6W A;  2UXC F;  3NG8 A;  1L3S A;  5DDP C;  5IQ6 A;  2W7P A;  3EPI A;  1B3T A;  3ZTQ A;  3MK2 A;  4D3G A;  1WG5 A;  1FX2 A;  3EMT A;  1BY9 A;  4NCA A;  3QZ7 A;  4OYP A;  3A8J A;  2FLP A;  1JKH A;  2EXU A;  3AB2 B;  3PXG a;  2CPY A;  4FPI A;  3M9N B;  4MKB A;  3VGS A;  1Z1Z A;  3RB0 A;  3UE2 A;  1FEH A;  2HFU A;  2GHW A;  3MR2 A;  4ERD A;  3MM9 B;  3FBE A;  2HPU A;  1HMV A;  2HQ3 A;  1O6X A;  1MU2 A;  3ZC4 A;  2QGF B;  4LR7 A;  2QX0 A;  2NSB A;  1RHK B;  3MI7 X;  1IKY B;  3ET6 B;  3GSD A;  4DSF A;  2VQE F;  1TKZ B;  4X4O A;  4URQ U;  3KK3 A;  3MTK A;  1ZA2 B;  2ZHB A;  2GO9 A;  2OEJ A;  1X4E A;  1HYS B;  3TI0 A;  3PRD A;  3SCJ E;  2H54 B;  1CEZ A;  1FRJ A;  4XDC A;  1RTI B;  2O5D A;  4PAB A;  1UTA A;  3HHN B;  1GMW A;  2E5L J;  1KP6 A;  3FJ2 A;  1RT2 B;  3H4D A;  1W7W A;  1M5V C;  1TL5 A;  3W3S A;  1Q8L A;  1U47 A;  4BWJ A;  3KLI B;  1VS3 A;  4NLO A;  1OY9 A;  1VC0 A;  1IBM F;  4QR2 A;  3PG9 A;  2J6U A;  1WC6 A;  5K14 B;  2ZDO A;  1CLF A;  4QWE A;  1U1P A;  1HI1 A;  2HAI A;  1N5S A;  2H65 B;  1R27 B;  3MUV P;  2YKA A;  4DL4 A;  1P27 B;  1DTQ A;  2B4V A;  2MDA A;  4CCH A;  2OJ3 A;  2FC9 A;  1KWM A;  5F3T A;  5KT2 A;  4UPK A;  1CC8 A;  1O5J A;  5F3Z A;  3HXM A;  4YY3 F;  3ISZ A;  1RA6 A;  2HVI A;  1S9G B;  4DPU A;  4C8N A;  3HVT B;  2CRL A;  4DDF A;  4CLU A;  3C14 B;  1R0B G;  1JLA B;  4EUV A;  1QD1 A;  1UFL A;  1EP4 A;  1VRU A;  3G71 S;  5D78 A;  3PEJ A;  3AQP A;  1G1X A;  2OD4 A;  4DR5 J;  2X51 A;  4FBT A;  1EHW A;  1VJW A;  4FVM A;  3W62 A;  5LL6 d;  2V4R A;  4K4Z A;  1WC0 A;  2BJ1 A;  3IAS 9;  3NKO A;  1FKP A;  3W8G A;  4Q5V A;  1TKT B;  1VMB A;  4Q7A A;  5JMN A;  3PJX A;  3JSY A;  3V4I A;  1M5H A;  5ETO A;  1KC8 T;  1TL3 A;  4FYD A;  2WBR A;  2W4P A;  2F4V F;  3CGI A;  1VOM A;  2OSR A;  3VAG A;  4PRF A;  2BJ7 A;  4KPY A;  4GKJ F;  2IYG A;  2JRS A;  4HDH A;  3HHL B;  1HWK A;  3OUY B;  3ENA A;  4WFB Q;  3Q83 A;  3QPI A;  5ETP A;  4DV2 J;  2IFX A;  3A3P B;  1PAE X;  4ED3 A;  3I5B A;  2AYE A;  5H9E K;  3D66 A;  5BR8 J;  5IFM A;  1IQT A;  4NLW A;  5L9X A;  4D3H A;  4ICL B;  4DEZ A;  1KON A;  4RLE A;  4MFB A;  2BAN B;  4U8V A;  2NPF A;  4Y28 C;  3CO0 P;  2HFN A;  4CZC A;  1ARO P;  2VHG A;  4P2X A;  1NSP A;  3W2W B;  3P5B P;  2ZWP A;  3C16 B;  2FHJ A;  4IG3 B;  4FXD A;  3T9N A;  2HLU A;  4DSL A;  2DIU A;  2CJX B;  4ZPV R;  3BKT A;  1DAR A;  2XHW A;  2MKI A;  2LMI A;  3AD7 C;  2CPD A;  1H2V Z;  4DV5 F;  1HI0 P;  2JEF A;  2XSJ B;  1BUX A;  3PVX A;  2YWK A;  4J9Q A;  4X4N A;  1U48 A;  1BD6 A;  2YKQ A;  4NEZ A;  1CJU A;  3O5T B;  1D9F A;  3MK0 A;  4R8U A;  3A8K A;  1EI6 A;  5LMN J;  3R7S B;  3TAP A;  2K2P A;  1QSL A;  2OO4 A;  3GFZ A;  1RT6 A;  1IR0 A;  3LOU A;  3BDH A;  4ECW A;  2HFS A;  1AJD A;  3OD2 A;  3VGU A;  3MED A;  1S76 D;  4ITS A;  3E8O A;  1U2R A;  4CP5 A;  4Y3C A;  3JYT B;  2U1A A;  4FXW A;  2ABY A;  2L48 A;  4KH0 B;  1MNE A;  2YY3 A;  4IKA A;  2AMC B;  3QZ8 A;  3DOM A;  3HSD A;  1BWE A;  5CYJ A;  1HBU A;  1S1W B;  3MM8 A;  3UCZ P;  2MQP A;  4DR2 J;  1S4F A;  2ALZ A;  5GOV A;  4ED4 A;  2ADC A;  4FKX A;  2EW9 A;  2RDD A;  1HBO A;  2J8S A;  4LQ3 A;  4OZ1 A;  2AD9 A;  2HFV A;  4ZCI A;  1DQ9 A;  2U2F A;  2UUC F;  3HHE A;  2LCW A;  4LSL B;  2B5J A;  2GA7 A;  4RPF A;  3IFE A;  3UN3 A;  1SC3 B;  3NS7 B;  3GWC A;  2GJI A;  1VRT B;  3FQK A;  1R8A A;  3HUL A;  3PM9 A;  4CLL A;  3AD9 C;  1XNQ J;  1EET B;  1QAI A;  3PCO B;  1X31 C;  2W5Q A;  4PWD B;  2CZ4 A;  4KV8 B;  4ES3 A;  4LQ9 A;  2UXB J;  2L9W A;  3DLL Q;  2JJ4 D;  4LFC J;  2HHT A;  2ZEJ A;  2GO8 A;  2P9G A;  1HWL A;  3HVW A;  4USW A;  1G4C A;  1S1X B;  4AXI A;  1SJ4 P;  1TL1 B;  3CT9 A;  1UVJ A;  1FJ7 A;  1KEK A;  1X5P A;  4B3M F;  4WKY A;  1PC4 A;  2H5J B;  2OPQ B;  5E3P A;  2ZM6 J;  2J0X A;  1LWE B;  1WOS A;  3JB9 k;  3VCD A;  5KFL A;  2O1P A;  5GAG I;  2JWN A;  3VGV A;  2ZJP Q;  4WE1 A;  1GXT A;  5HMY A;  3OLB A;  2PC6 A;  3O6Q A;  5T7L A;  4DR1 F;  1UVL A;  2J0S D;  1FEE A;  5I3Q A;  1OSD A;  2MQ8 A;  3NAH A;  2GVD A;  4TNO A;  1TU0 B;  1RTZ A;  3BGO P;  2RRA A;  3IG1 B;  4DXL A;  3DLK A;  1HKA A;  2XI3 A;  2AQ4 A;  3CJ0 A;  3R5A A;  2ZVS A;  4F04 B;  2E1M C;  2OPR A;  4PR6 A;  1ITP A;  2NXU A;  5KFT A;  4MT1 A;  1RHU B;  1HQE A;  4DWI A;  2ZKT A;  2J76 E;  1Q82 T;  3QIP B;  1S7H A;  1X0F A;  2XLJ A;  2XUL A;  3JQJ A;  1RQ0 A;  3I32 A;  1H7W A;  2PGC A;  3PRB A;  3HI9 A;  4DX6 A;  1SUQ B;  4DQP A;  3THP A;  4DL3 A;  4CLF A;  3B6B A;  1WF0 A;  1SIZ A;  2UV8 G;  3T9Z A;  1JNR B;  2W2O P;  3PW7 A;  3MAA B;  3QJJ A;  3PX4 A;  2ZH1 A;  3VAJ A;  3EGV A;  4OQJ A;  2XMV A;  4B9S A;  8AT1 B;  1T9W A;  1O8B A;  2W9C A;  1G3O A;  3MD3 A;  4OV1 A;  3NWR A;  2DNR A;  2HBY B;  3ITH B;  5E3A A;  2F4F A;  2KVQ E;  5ETN A;  4FPR A;  2DR6 A;  3RUB L;  2GQQ A;  2DGS A;  1K47 A;  1WOR A;  3KLG B;  2VOO A;  4J9K A;  2YNG B;  1DHM A;  2KFN A;  1S9E B;  2EFP A;  5E7O B;  1RAO A;  5IT9 Y;  5HQ8 A;  2N3L A;  4AND A;  4U9R A;  2JNJ A;  2W8D A;  5AJ9 A;  2EI5 A;  2BOA A;  3KMS A;  3M1V A;  3ISN C;  1GX5 A;  2CYY A;  4HEA 9;  5AJ3 J;  2EEY A;  3PYG A;  4NXM J;  3FRY A;  4F4X A;  4DMZ A;  1RT4 B;  4YR1 A;  4ANC A;  1X5T A;  1Q81 T;  2HK3 A;  3DYA A;  4RW7 A;  2I2Y A;  3TQE A;  4F4K A;  2AGP A;  1ZPV A;  4DR4 F;  1LWC A;  3HLU A;  4A8S A;  4ECS A;  4F2S A;  2CQD A;  3RAM A;  1FK9 A;  1U02 A;  2B56 A;  4NI2 A;  5IS2 A;  4KPC A;  1RAD B;  4HT5 A;  2UUB F;  4QJV A;  3KLE B;  2AJ0 A;  1IR1 A;  2QEX S;  3K17 A;  3IGN A;  2CA9 A;  3MM5 B;  1YBA A;  3IBC B;  1RWN B;  1U1R A;  1LNQ A;  5J2P A;  4J37 A;  2RQM A;  4OYX A;  5KAK A;  1FSU A;  3DRR A;  5KFU A;  3H8Y A;  1S77 D;  2AEJ A;  3P5T L;  4HAC A;  1UA0 A;  4ECR A;  2LA4 A;  2RT3 A;  4E0D A;  4FF2 A;  2AX1 A;  3QT6 A;  1CS4 B;  5GMK a;  1N5Y A;  3K8V A;  2FJB B;  2HQG A;  3R1H A;  2FVS A;  3G6Y A;  5IM0 B;  2R8J A;  2VQR A;  2QTW A;  5D0H A;  4IG0 B;  5AXN A;  2IM3 A;  3NGR A;  3WC2 A;  2I8E A;  4MH8 A;  3CNQ P;  2GFF A;  2POK A;  4PQA A;  1KH7 A;  2VPX B;  4UPH A;  4EFA C;  2LP4 A;  2WB1 D;  3MM9 A;  5BYR A;  2ZUG A;  2QMX A;  3B5Q A;  2ADB A;  2QC3 A;  1IKY A;  3ET6 A;  5ITH A;  2R7W A;  4YUD A;  1TKZ A;  3NKM A;  3AT1 B;  3VQS A;  2PMZ D;  2YPZ A;  3EVM A;  1J5E F;  2DXE A;  2JVO A;  2QLF B;  1LK5 A;  1AXQ A;  2B8P A;  3CMA S;  1HYS A;  3OL9 A;  3IBF B;  2LU2 A;  1R8P A;  2UP1 A;  4ZVP B;  4PUO B;  2WW8 A;  4O3Q A;  4PXE A;  4CXU A;  3LPY A;  2DHS A;  2XGP A;  1RTI A;  2BAB A;  1URA A;  5B0A A;  3RU0 A;  4ZIV A;  4DG1 B;  4KHP F;  5T14 A;  1RT2 A;  2IJF A;  5D4O A;  3KLI A;  1KH5 A;  3VVT A;  5A8R B;  4GVL A;  3P3D A;  4Q2M A;  3VGT A;  3CCL S;  3TA1 A;  5J2M B;  2EG1 A;  1F1B B;  2WK4 A;  5L1K A;  1Q16 B;  5K14 A;  3MD1 A;  5DET A;  4KTQ A;  3FEZ A;  1D8Y A;  3OTC A;  2B4O A;  3S8S A;  3I82 A;  4DJB A;  4QU6 A;  3J7A 1;  1KHW A;  2HRY A;  3HP6 A;  5HSP A;  1SV5 B;  2I1R A;  3GG0 A;  3EGW B;  2DJW A;  2EFV A;  3H25 A;  2X1B A;  1S9G A;  3CJ4 A;  3HVT A;  2O66 A;  2XYH B;  3W66 A;  4NLQ A;  5J1N A;  3C14 A;  4E98 A;  1JLA A;  5K8N A;  1ZS6 A;  2FLO A;  5J1E B;  3ZTR A;  5LJ3 Y;  1MWZ A;  3R7B B;  2UZA A;  5AE1 A;  2E9Z A;  5D3G B;  4N8N A;  4V19 X;  5GMD A;  2LEB A;  2C2Z B;  4KQZ A;  2FVR A;  1LQ9 A;  2HBQ B;  3Q24 A;  1TKT A;  2YH0 A;  2XM3 A;  2YWG A;  3MWB A;  5MAO A;  1EAR A;  3MM7 B;  2E1R A;  1IKW B;  1MWQ A;  3H40 A;  2VFS A;  5ETV A;  1VQP S;  4F67 A;  2OH2 A;  1PG5 B;  4JI1 F;  4LF5 F;  4QIE A;  4JI0 F;  3VF0 B;  5B08 A;  4LF4 J;  4LF8 J;  3N28 A;  2KT3 A;  3HHL A;  3HM9 A;  3OUY A;  4KGV B;  3W9J A;  3C46 A;  3Q3Q A;  2LXF A;  1KQG B;  1JX4 A;  2J6T A;  3DLH A;  5CYM B;  1SH0 A;  3V6K A;  2HHH J;  4KAI A;  1E33 P;  4DZ6 A;  4ZJQ A;  1ZPW X;  3BO3 A;  3IN5 A;  4ICL A;  2W2N P;  4X4R A;  2BAN A;  4O4R A;  1T3N A;  1AZS B;  4UOR A;  4Y0F A;  2GMH A;  1Q5V A;  1FTC A;  3W2W A;  1URB A;  4RU9 A;  3C16 A;  3ILI A;  2J9D A;  4IG3 A;  4DFJ A;  1ELZ A;  3THT A;  7FD1 A;  2PII A;  2DK2 A;  4Q43 A;  3ZTO A;  2QLB B;  2DY1 A;  5L46 A;  2BRK A;  2W4C A;  5D0E A;  4ER8 A;  2Z2Y B;  3NKR A;  1D0E A;  2XSJ A;  2B4P A;  4LFA F;  1Y5L B;  3FMB A;  4U7C A;  3QYY A;  4TU8 A;  1WHV A;  3VTI A;  1U1O A;  3OVB A;  5L38 A;  3H5S A;  3R2C J;  2FIU A;  4JYA J;  1FE4 A;  4JP8 A;  3VAH A;  4YR0 A;  2KRB A;  3CJS A;  4UQG A;  3FCW A;  5A76 A;  5KFQ A;  2V94 A;  1AUK A;  4J90 A;  2CQ4 A;  5IQQ A;  3NGU A;  2YPY A;  3C6T B;  2GIF A;  2J8A A;  2VPY B;  5IV4 A;  1JLB B;  2VBW A;  4HHU A;  4ZP6 A;  1YG0 A;  3MFI A;  2Y9H A;  1IBC B;  2GQC A;  1GT8 A;  2WSF C;  1RK8 A;  3BPS P;  3JYT A;  4KO0 B;  3KUH A;  3EZO A;  1D1U A;  3GYG A;  1Q1K A;  2V2K A;  1SCJ B;  1S59 A;  5ETK A;  1N5T A;  1S1W A;  3NS6 A;  3POT B;  3CCJ S;  3AJ1 A;  2UVU A;  2MKH A;  1YK9 A;  3M8Y A;  2E7W A;  3I55 S;  4UT4 A;  4YME A;  3D6T B;  5M2U A;  4YDD B;  3J7Y I;  2CQ1 A;  2CAD A;  4OYB A;  3D54 A;  1JLC B;  1Y9O A;  4UW2 A;  3B82 A;  4IQX A;  5A8W B;  4LSL A;  1Q0N A;  5AXL A;  4OV6 A;  5FII A;  4C2M A;  1ZM2 A;  1TEL A;  4MY4 A;  1VRT A;  4DF4 A;  4ELT A;  2DGO A;  2COL A;  4CM2 A;  4WBF A;  2MLZ A;  1WHX A;  1HA1 A;  1EET A;  1AYE A;  2KO1 A;  3NWG A;  4PWD A;  4M5H A;  4KV8 A;  3M4X A;  2CPJ A;  3QSY B;  4ECX A;  1RE1 B;  4ECT A;  4UOF A;  2HMI B;  2EC0 A;  2CNO B;  3KJN B;  5EX3 A;  3HFZ B;  3CJ3 A;  2FDN A;  4LQY A;  4NRT A;  4JI8 F;  4ZIW A;  3M9M B;  3WAY A;  1S1X A;  4Y2A A;  3KHL A;  1TL1 A;  2RS8 A;  1MW7 A;  1ALI A;  3M7V A;  3ZFV A;  5CQG A;  5IT4 A;  3DN9 A;  2F63 A;  5BJR A;  3RBE A;  4Y2K A;  1Q5Y A;  2KM8 C;  4X64 F;  2OPQ A;  3CDE A;  4J9R A;  2BE2 B;  4ZG7 A;  1RU2 A;  4L74 A;  1LWE A;  3DLE B;  1U6F A;  2FB0 A;  2RS2 A;  1FHT A;  4NLY A;  1TUG B;  3R27 A;  2VF3 A;  4ZJO A;  3RR8 A;  4DV7 J;  2WSC C;  3PHT A;  1N36 J;  4DV0 F;  2UU9 J;  3HHL D;  1N6Q B;  2MHN A;  2VC1 A;  2QMW A;  4USK A;  2EK1 A;  3CJT A;  5EDW A;  4ZG6 A;  1S1U B;  4UZB A;  1Y5N B;  3QQC D;  3IG1 A;  4XTT A;  2CKW A;  2BJ8 A;  3QRP A;  1HFE L;  4KSE B;  2GGP B;  1HBM B;  1WHY A;  4WPA A;  1RXO B;  4TVA B;  1D3W A;  5KXA A;  3HKZ D;  4IH7 A;  4OYI A;  1NPK A;  2OFG X;  2NRE A;  1OSC A;  1ICE B;  3QIP A;  4JI4 J;  1YJT A;  2DIS A;  5KFS A;  2LYV A;  4X65 J;  2E1P A;  2EFN A;  2GSU A;  1SUQ A;  4WYL A;  5FJ4 A;  3ZZO A;  1NME B;  2ROG A;  2VU5 A;  2WAQ D;  4YB5 A;  1NO8 A;  2DNZ A;  2HWH A;  1S5Z A;  3MAA A;  2HVD A;  4KBI A;  1F2H A;  3Q0A A;  3TR5 A;  3PEH A;  3KLF B;  3ITH A;  2FYX A;  2HRU A;  2DEI A;  5K4P A;  2KM8 B;  3K57 A;  1ZZF A;  4U7U K;  3RBX A;  3ENQ A;  2G0J A;  1BE4 A;  4DZD A;  2ROE A;  2C3U A;  4PG8 A;  5DDQ C;  5E33 A;  4DFM A;  2CPZ A;  1M90 T;  2ZKU A;  3MGJ A;  2MJU A;  4LRD A;  4GKK J;  3CJK B;  1BWV A;  3NVL A;  4CDI A;  3OSN A;  2O3D A;  3KLG A;  1Q7L B;  2YNG A;  1H2U X;  4F25 A;  1GQE A;  1S9E A;  5CCL A;  3EVW A;  4I4B A;  4OX6 A;  1IM4 A;  3OHA A;  1LW0 B;  1H3D A;  1MRO B;  3IO1 A;  1P49 A;  3ZZT A;  2D3U A;  1NBE B;  4TY8 B;  3KMQ A;  2W9B B;  3SV3 A;  1M1H A;  5D8H B;  1RTD B;  1WHW A;  2ZJQ Q;  1RT4 A;  4O3R A;  2B0G A;  2E5L F;  3V5R A;  4GTW A;  4GVB B;  1FFG B;  2A1B A;  1RJJ A;  4PG5 A;  2Q79 A;  1PAU B;  3NNC A;  3CJ2 A;  2LLZ A;  3VAL A;  2DGX A;  5ETM A;  4OHY A;  2FGO A;  3BSN A;  2AU0 A;  1M1K T;  4B3O B;  5LMU J;  4EBC A;  3D68 A;  3J7Z T;  3J81 U;  2CQP A;  2ZH3 A;  4C6A A;  2MSS A;  3KLE A;  3ADA C;  3A12 A;  3MEC B;  4JV5 J;  5KFY A;  3GPA A;  3MM5 A;  5KFM A;  4OHW A;  1RYS A;  4ES2 A;  1QJH A;  3OSP A;  4KIA A;  2ZZM A;  4USJ C;  1U8W A;  4ZCM A;  4N47 A;  4EU0 A;  1Y7A A;  4NL5 A;  2ZZT A;  5KT5 A;  3C3L A;  3DM2 B;  4W98 A;  4AL7 A;  3PO4 A;  2J6S A;  4UOO A;  4U7U D;  4DOZ A;  2XNR A;  2HK2 A;  1CS4 A;  2IRX A;  1QVF R;  2QO3 A;  1T03 B;  4DR5 F;  1V5I B;  1U1N A;  5IM0 A;  5DGB A;  2AKW B;  1X60 A;  4A48 A;  2AGO A;  3CCU S;  4MYT A;  2P2C B;  1Q4R A;  2M52 A;  4L72 B;  4WFN Q;  3FC9 A;  4C8O A;  3EYZ A;  3HSJ A;  4ZLL A;  4IG0 A;  2CDR B;  3GQC A;  1XMO J;  1XWL A;  2XYP B;  2Z58 B;  3UR3 C;  4IOC Q;  1TL4 A;  2AEM A;  2BV3 A;  1H74 A;  1RIS A;  6AT1 B;  3PYE A;  2EPI A;  1VK8 A;  3W5X A;  1EKS A;  3FEX B;  2V4J B;  2MY8 A;  4ZPD A;  2E7X A;  1TK0 A;  4DV2 F;  4DV4 J;  1EQM A;  1RT3 B;  5BR8 F;  2HKE A;  2DGW A;  3NCP A;  2PA3 A;  2V6A A;  3MUM P;  3ZNJ 1;  3TVZ A;  3A8E A;  5LXR A;  3I5A A;  4XPC A;  1B0V A;  4FKY A;  3T19 A;  2ALY B;  4JI7 F;  3ETO A;  4QBU A;  4LRF A;  4PUO A;  1NKC A;  4N77 A;  3BDE A;  1WOO A;  1NK6 A;  2ILY A;  3NNH A;  3AA8 A;  2DNO A;  3PIO Q;  4DS5 A;  4PCQ A;  4AD6 A;  2G0C A;  3PW5 A;  2ZBI A;  4CI0 B;  2CQC A;  3V2U C;  3HVA A;  2R8H A;  1WUU A;  1TK8 A;  1FO1 A;  5A8R A;  1H7X A;  2FJA B;  2XLK A;  5J2M A;  2HWI A;  1FRI A;  3GJQ B;  3FKB A;  1EKR A;  1GMV A;  2ZC4 A;  4OJ3 A;  4J9V A;  2RNE A;  2GZO A;  4DU8 A;  2R2R A;  1R6V A;  1GX6 A;  3GSI A;  4QYR A;  5LMN F;  4K4X A;  2R2S A;  2R7T A;  4O3O A;  2F8M A;  2YNF B;  1RU1 A;  1SV5 A;  3K7R A;  2KN4 A;  5KFZ A;  3JAM Y;  4OZL A;  3D0H E;  4EMD A;  4J7C A;  4NCG B;  1ROF A;  1SL0 A;  1RWP B;  1ULR A;  3W60 A;  2HGL A;  4I0W A;  1U4B A;  3H2V E;  4NLR A;  4RNM A;  2ZBR A;  4JBC A;  2FZC B;  4K2X A;  4X2B A;  2NUH A;  3A3O B;  2ZE2 B;  4BHQ A;  5J1E A;  3MOJ B;  3W61 A;  1FJE B;  2NUU G;  3BYP A;  1X4C A;  1EQ0 A;  1EQJ A;  2X98 A;  3UDV A;  5D3G A;  1M5S A;  2D9O A;  2VOD A;  4DR2 F;  2EFO A;  3WZ0 A;  4OFZ A;  3VZI A;  3KOA A;  1QTM A;  1JJ2 R;  5I4M A;  3BYR A;  1XMQ J;  3MM7 A;  3AA9 A;  5D0R A;  4A8F A;  2V8G A;  1TL7 B;  1A7G E;  1IKW A;  3DKD A;  4NZ7 A;  3DRS B;  4A8Y A;  1WEX A;  4IRC A;  4KKO B;  1OJ4 A;  1RAH B;  5KFE A;  5DG8 A;  3UI3 A;  3M30 B;  1OQ6 A;  2V9W A;  2MPU A;  1XNQ F;  4ZVG A;  1ANI A;  1N32 J;  1NUE A;  1YRT A;  2BE7 D;  3WX4 A;  1UL3 A;  5CYM A;  2UXB F;  1ZOT A;  2GQ2 A;  2BQU A;  3OTD A;  4LFC F;  2EFG A;  4HLB A;  3U27 A;  1SC1 B;  3LP1 B;  1AZS A;  2LVW A;  4Y65 A;  2PA8 D;  1R8H A;  1SL2 A;  5G0R B;  1TP7 A;  2CIM A;  3R5D A;  3LP2 B;  2F8H A;  2AZ1 A;  2JOQ A;  3KNG A;  5KFD A;  1TTH B;  1WDT A;  3NNA A;  2ZM6 F;  4PG6 A;  5HAT A;  3MPD A;  3PKY A;  5E2Q A;  2XY6 A;  3HKW A;  4HVZ A;  4QIF A;  2F8E X;  1N0U A;  4LIR A;  5LOQ A;  1UKU A;  2PE8 A;  1XNR J;  4IH5 A;  1FDB A;  3GMG A;  1XR6 A;  4RU2 A;  4ZVS B;  2BRL A;  2OI2 A;  2LQJ A;  2DIV A;  5HBM B;  2VFR A;  2OEL A;  2R8I A;  2KHD A;  3MMA B;  3C6T A;  4TQR A;  3W1Y C;  2C2N A;  3Q8P B;  1JLB A;  1HNZ J;  4A4J A;  5HK4 A;  5DG9 A;  1PKU A;  1WI6 A;  4KO0 A;  4A46 A;  1O98 A;  4FYX B;  1WC5 A;  2F65 A;  4HDG A;  3POT A;  2OPP B;  3F0N A;  4P73 A;  3RJM B;  3KWM A;  3GFY A;  2E5H A;  4I2P B;  1KD1 T;  4LR8 A;  4P74 A;  4ZCK A;  5J2N B;  3CJQ A;  1YJU A;  1L3U A;  3VWS A;  2ZIT A;  4UUX A;  3FFI B;  4C8K A;  2AWZ A;  5B0B A;  4C3L A;  1RBA A;  1Q7Y T;  4J5O A;  4HTI A;  1JLC A;  2UV8 A;  5A8W A;  2BJ9 A;  1NPP A;  3BR8 A;  3D5M A;  3GJR B;  3J7A N;  3MEK A;  2IA6 A;  2HNY B;  4I6W A;  1UZD A;  3TG0 A;  4N7T A;  1ZAW A;  4KAY A;  5HMZ A;  3BDF A;  3LAM A;  2ZOG A;  3KK1 B;  2HMI A;  3HHK A;  3TZZ A;  5AJ3 F;  3BM7 A;  4NXM F;  1YBT A;  5HN0 A;  4IO9 Q;  3G8S A;  5EWG A;  1ZED A;  4FYW B;  2HVE A;  1O99 A;  2DHA A;  1YJ9 S;  1AB8 A;  4ETX A;  2AGQ A;  4ZVQ B;  3DHW C;  3S1T A;  1FXL A;  2PFF B;  4EYI B;  3KG1 A;  2R42 A;  2P9E A;  2BE2 A;  3OTE A;  2DB1 A;  3CCE S;  3DLE A;  3GE9 A;  3SV4 A;  3PW2 A;  4GTY A;  4X4T A;  2ILZ A;  3BSA A;  5CA5 A;  2BVZ A;  1UVK A;  4H4K A;  4B17 A;  4KB7 A;  2Z0G A;  2BBE A;  2BJD A;  3WBZ A;  4QR1 A;  1TVR B;  1N6Q A;  2F1F A;  3PZP A;  4O0N A;  1WI8 A;  4ZJL A;  2QIF A;  2GC8 A;  1FNO A;  2X3G A;  2QT7 A;  4CO1 A;  3H59 A;  3I56 S;  3GZ7 A;  4M5K A;  1S1U A;  1ZZN A;  4FF3 A;  5F8N A;  2HBZ B;  2XMT A;  4QR0 A;  4OZ3 A;  2DBB A;  4F0K A;  2GGP A;  1HBM A;  3DU5 A;  4A8M P;  2E5G A;  2HHS A;  2HNZ B;  2YWW A;  4LF7 J;  4CQ1 A;  3OHB A;  2N3O A;  3V6D B;  1XIQ A;  2RIL A;  4OX9 J;  2MQL A;  4Q44 A;  2XS2 A;  2QA2 A;  3MR3 A;  2NYH A;  4QWC A;  3KHG A;  2IMO A;  4NA3 A;  1TKD A;  2FHK A;  4J9S A;  4QPX A;  3TAQ A;  4OZ5 A;  2CQ0 A;  2QA4 G;  5DQI A;  1SXL A;  1JLQ B;  1TQL A;  5HAN A;  2W24 A;  1S72 S;  2OSQ A;  3KLF A;  1HQA A;  3FCV A;  2W8S A;  2M70 A;  1IBK J;  4UY8 5;  2CFX A;  5LRM A;  1PC5 A;  1SHQ A;  1CPZ A;  4FVC A;  5D4L A;  3TAM B;  3IC1 A;  2CZV C;  4DUT A;  2KI2 A;  3CJK A;  1RHQ B;  1HBN B;  5IC4 B;  1KQK A;  3GTY X;  2KYX A;  5T41 A;  5HMW A;  3RRH A;  5HJY A;  1WKJ A;  1NXI A;  1LW0 A;  3T5H A;  3IP0 A;  1MRO A;  2DRB A;  2RUS A;  4AE5 A;  5C5J A;  4QWB A;  5K8M A;  2E1A A;  2Q6C A;  4TY8 A;  2W9B A;  3IWN C;  1RTD A;  2X1A A;  3H7H B;  2BQR A;  4OIX A;  4GVB A;  5KT6 A;  1E6V B;  1M5K C;  3W8P A;  3GJS B;  3V81 A;  1D8Z A;  9ATC B;  1TMM A;  2LEC A;  4B56 A;  4WF9 Q;  3D6M B;  1NJZ A;  3P4U B;  4HH0 A;  4YOE A;  5EGE A;  2XTJ P;  4B3O A;  3UQS A;  3QRQ A;  5A6P A;  5HLF B;  1TUW A;  3TAN A;  1AFI A;  3KJF B;  1U25 A;  3DOK B;  2QG9 B;  1YVF A;  3RAX A;  3IR7 B;  2W8L A;  1NPR A;  3MEC A;  3M6X A;  1HR0 J;  2RML A;  4TLR A;  5H9F J;  2AV5 A;  2WVF A;  4ILM A;  2KJW A;  2ZBC A;  1SKU B;  3MPV A;  2M5Y A;  2FQQ B;  5LJ5 Y;  1F9H A;  1GMU A;  4LT6 A;  3IGZ B;  4QYZ J;  3DM2 A;  2DR7 A;  2GNK A;  4LRE A;  3ILO A;  2N4D A;  2R8K A;  3U1M A;  1BHN A;  5I3P A;  4J91 A;  3QGI A;  4DN9 A;  2BM1 A;  1T03 A;  1FJC A;  2MLX A;  2JLE A;  4OI0 A;  2BMB A;  1NDP A;  4DUZ J;  2W8K A;  1KQF B;  2OAU A;  1S4E A;  2UVV A;  4C7Q A;  2BA9 A;  2X1F A;  3P49 B;  1SL1 A;  5EGY A;  3US5 A;  4Z7Y A;  1B8J A;  2MGZ B;  1EB0 A;  4P6Q A;  2YTC A;  2R9L A;  3ELH A;  1ZM3 A;  2N7C A;  3HT3 A;  1NK5 A;  5B0C A;  3SSS A;  1EZZ B;  4OX7 A;  2K3K A;  1H6K X;  3KDO A;  4DQR A;  4LF4 F;  2UUW A;  4LF8 F;  2V4J A;  1NHV A;  5JUM A;  3I9Z A;  3I87 A;  2RRN A;  4LRA A;  3TJ8 A;  4P10 A;  2KH9 A;  1RT3 A;  1OQ3 A;  6FDR A;  2HHH F;  1JK9 B;  1U7L A;  3DFE A;  5INH A;  2IVM A;  2YNH B;  2FY1 A;  3HSZ A;  3F44 A;  4B08 A;  5B09 A;  2DCL A;  1NH8 A;  2RQC A;  3RAQ A;  4G6V B;  3K5N A;  2L3M A;  2DPI A;  4L3K A;  2WRM A;  2OUG A;  3MR6 A;  3M8Q B;  2XC9 A;  3LP0 B;  2D3O R;  4ZPB A;  4ECY A;  4OHZ A;  2QMU B;  2GW8 A;  3TZW A;  3P45 B;  1XN9 A;  2DNQ A;  3G82 B;  1VI7 A;  1WKL A;  3BZQ A;  2HS3 A;  3L09 A;  2NCK L;  1H38 A;  3CED A;  1WTF A;  1VQ8 S;  2MYF A;  5KFV A;  3DLK B;  2AF6 A;  1WSR A;  4JYA F;  4M5L A;  3G8T A;  3RG6 A;  3PYF A;  5C24 B;  4V1A k;  3T01 A;  1ACM B;  3M9O B;  4N41 A;  2VFT A;  1KOO A;  3UDC A;  2YNF A;  3OR1 B;  2P8I A;  1FTR A;  4JI6 J;  4AL5 A;  3OV7 A;  4PPZ A;  4NCG A;  1JB0 C;  4P2F A;  2GVZ B;  1BMQ B;  2ZZN A;  2N82 B;  1EIY B;  3KUE A;  1UMJ A;  4G1I A;  3U1L A;  3C66 A;  5JVH Q;  2ZE2 A;  1HPZ B;  1HAR A;  1UP1 A;  2CZ9 A;  1WKK A;  3W7B A;  1BQX A;  1M5P C;  3C6U B;  1NJI T;  3D6H B;  4OJG A;  2DNK A;  2BR0 A;  4WXO A;  1LK7 A;  1LW2 B;  2HBR B;  1UWB B;  4PQU B;  2YH1 A;  3HSG A;  3TYT A;  1SJQ A;  3BJY A;  5KFB A;  2JZ5 A;  2LQ8 A; 
#chains in the Genus database with same CATH homology
 4CYR A;  3WAW A;  1EQJ A;  4B56 A;  3NKN A;  4KJG A;  2X98 A;  1ED8 A;  5DLW A;  1EI6 A;  2IFY A;  4LQY A;  3M8W A;  3DYC A;  4LR8 A;  5EGE A;  4UOR A;  1E1Z P;  1ZEB A;  3WAY A;  5LRN A;  3UO0 A;  4GTY A;  1KHK A;  1KH4 A;  2W5Q A;  5LIA A;  4LR9 A;  2XRG A;  4GTW A;  1ALI A;  2W5W A;  4UPL A;  3A52 A;  5GRR A;  4UPI A;  1AJA A;  2W8D A;  4LR7 A;  3M7V A;  1AJC A;  3BDH A;  4UPK A;  1HQA A;  1KHJ A;  5AJ9 A;  3T02 A;  1KH9 A;  2W8S A;  1AJD A;  4TN0 A;  1URB A;  4LR2 A;  4CXU A;  2GSU A;  2IUC A;  3T01 A;  4QAX A;  1ANJ A;  4KJD A;  5HRT A;  1ELZ A;  1K7H A;  1URA A;  2ANH A;  3UN2 A;  2RH6 A;  5LRM A;  1SHQ A;  5C66 A;  1AJB A;  4ZG7 A;  1ED9 A;  4FDI A;  4LRA A;  2W5V A;  2ZKT A;  1EW9 A;  4CXK A;  1KHN A;  3M8Y A;  3M8Z A;  4YR1 A;  3WAX A;  1Y6V A;  2VQR A;  4MHX A;  4NWJ A;  1EW8 A;  1E2S P;  1KHL A;  3OT9 A;  3E2D A;  5INH A;  3IGZ B;  3IGY B;  3UNY A;  3NKR A;  1KH5 A;  4CXS A;  3TG0 A;  5LQQ A;  1HDH A;  5IJQ A;  2W5T A;  4N7T A;  3TX0 A;  2IUC B;  5K4P A;  5L0B A;  4MIV A;  4LRE A;  4NWX A;  1ZEF A;  2D1G A;  2W5S A;  4CYS A;  1ANI A;  1ALJ A;  4KAY A;  3CMR A;  3DPC A;  2GLQ A;  5EGH A;  4LRC A;  5IJS A;  3BDF A;  4KM4 A;  5DLV A;  4FDJ A;  1N2K A;  5GOV A;  3NKP A;  2XR9 A;  1ALK A;  5L0E A;  4MY4 A;  1SHN A;  3NKO A;  1Y7A A;  4UOP A;  1KH7 A;  4LRD A;  3MK2 A;  5TJ3 A;  3BDG A;  4KAV A;  2W5X A;  4UPH A;  3NVL A;  2QZU A;  1E3C P;  3WAV A;  3ED4 A;  4ZG6 A;  2GSO A;  2W5R A;  3T00 A;  2G9Y A;  4LRB A;  3SZZ A;  1AUK A;  3TWZ A;  3Q3Q A;  5DLT A;  2GA3 A;  1N2L A;  1ELX A;  1ZED A;  4GTX A;  1O98 A;  1ELY A;  1O99 A;  3IDD A;  3B5Q A;  3KD8 A;  3LXQ A;  3SZY A;  3WBH A;  2GSN A;  4UOO A;  1HJK A;  4LRF A;  1FSU A;  3UN3 A;  3UN5 A;  4GTZ A;  4ZG9 A;  1ALH A;  4ZGA A;  3MK1 A;  1P49 A;  1E33 P;  5L0K A;  3BDG B;  3NKM A;  1B8J A;  3NKQ A;  3MK0 A;  5KXA A;  1EW2 A;  1EJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...