3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
4LR7A 3DYCA 2W5RA 3UO0A 1FSUA 1HQAA 3NKNA 4NWJA 5INHA 2W5TA 2IFYA 3TWZA 1URAA 3BDFA 4UORA 1AJBA 4CXSA 3NKQA 1ZEBA 5L0BA 3T00A 5KXAA 3UN5A 4N7TA 4ZG7A 2ANHA 2W5SA 1AJAA 3NKOA 2W5VA 4LRAA 1ANJA 1KHNA 2ZKTA 3Q3QA 4MY4A 5EGHA 3BDHA 4CXKA 1KHJA 4FDJA 1ED9A 1EW8A 2IUCA 1O98A 5DLTA 1ZEFA 2G9YA 3WAXA 5C66A 3M7VA 1KH9A 4ZGAA 1KHKA 4TN0A 3WAVA 5GOVA 1AJCA 4KAYA 3WAYA 1E33P 2VQRA 2XRGA 3IGYB 1HDHA 3MK2A 5IJSA 5HRTA 5TJ3A 3OT9A 4GTWA 3WBHA 4ZG9A 5L0KA 5LIAA 4UOOA 3IDDA 3NKPA 1EW9A 2W5XA 1HJKA 2QZUA 4ZG6A 5L0EA 1ED8A 3M8YA 5IJQA 4MHXA 4CYRA 4KAVA 4GTZA 3SZZA 4KJDA 1K7HA 5DLWA 4UPLA 3MK0A 1AUKA 2GSNA 3UN3A 3NKRA 4LRFA 3A52A 4QAXA 1P49A 4B56A 1ALIA 2GSUA 4UOPA 3M8ZA 1EQJA 4KM4A 4NWXA 1EW2A 2W5QA 1N2KA 1KH4A 1AJDA 2RH6A 1ALHA 3BDGA 1SHNA 3DPCA 1EI6A 1KH7A 1O99A 3IGZB 3UNYA 4CXUA 5GRRA 2IUCB 3KD8A 3E2DA 3T02A 1B8JA 1KHLA 5K4PA 2W8SA 4UPIA 4YR1A 3M8WA 4CYSA 1ANIA 1E1ZP 1Y6VA 5LRMA 1E3CP 4LQYA 5LQQA 5AJ9A 1ALJA 1ALKA 4LR9A 4LRBA 5EGEA 3T01A 2GSOA 3WAWA 1Y7AA 1ELYA 3B5QA 5LRNA 4LRCA 1ELZA 1E2SP 3ED4A 3NVLA 1N2LA 3MK1A 3TG0A 4GTXA 4LR8A 3CMRA 4LR2A 1ZEDA 1URBA 1KH5A 4LREA 2W5WA 2W8DA 5DLVA 1SHQA 4UPHA 2D1GA 2XR9A 4KJGA 3TX0A 3LXQA 2GA3A 1EJJA 2GLQA 4GTYA 1ELXA 4MIVA 3NKMA 3UN2A 4UPKA 3SZYA 4FDIA 2X98A 3BDGB 4LRDA
chains in the Genus database with same CATH superfamily
4F3QA 3I5AA 3RR8A 2LU1A 4F2SA 2KG0A 1SB6A 1YWXA 2FZCB 2KVQE 2JJ4D 1HHSA 2Q3PA 2XYHB 5F8NA 4F4AA 2CJKA 2KJWA 2BW7A 4LMZA 2IFYA 2LECA 4RNMA 2IJFA 5I42B 2QT7A 1QD1A 3EWGA 2Q1LA 3CIMA 5KFIA 3BO2A 3I55S 3KXDA 3SZ2A 1U24A 4CZCA 2ZE2B 1RWXB 2OIHA 4MJKA 1JLBB 3WZ0A 5J1EB 5IS2A 1FKPB 3VAMA 4B9VA 1VC5A 4OX6A 2RVJA 2KKHA 2DD8S 1OMSA 2N7CA 1ED9A 3LP1A 2LP4A 1S7HA 3HK2A 1LW0A 1BUXA 1Q1KA 1F3VA 1GXTA 1LK7A 2VF3A 5GMEA 3TNVA 4IOCQ 3PW0A 4FF2A 2V8VA 1F9FA 3WAVA 3N6MA 4Z2XA 1ZAXA 4IKAA 3W5YA 2E5GA 4ZMMA 5L1KA 4DLEA 2FJVA 3IM9A 4LF5J 2W25A 2X1FA 4RL1A 3QYYA 2GVZA 4P73A 3RUBL 4A8QA 1DY3A 5IJSA 2OEMA 2QFJA 3OFFA 5E7OB 1B0VA 1S9EB 3NWRA 2FLPA 2C2RA 3LP2A 1KBRA 4F67A 2C2DA 3HMJG 1CJKA 4KYZA 2IA6A 1WHWA 4ZP6A 1B7FA 2BYCA 3ITHA 4HKQA 3SCLE 5KFTA 4B3OB 4IG0A 1N34F 2G0IA 3NG8A 4QPTA 2XG8A 4RW9B 3ZO7A 2MGZB 2DPJA 4NCBA 2Y1JA 4IOBA 3UW1A 1UZDA 4J7CA 4N56A 3SFGA 3EE3A 6FDRA 2W8KA 4YB5A 2DR6A 1M90T 4B9TA 3PX6A 4ERDA 2E7VA 3LA0A 4F4KA 5DETA 3QJJA 2DITA 4KHPJ 1LWEA 1UWAA 4JI7F 4CO1A 3PRVA 3QT7A 4KO0A 2MSSA 5KG4A 1M5HA 1MWYA 4U9RA 1UVJA 2BZ2A 3V2UC 3HP6A 1HYSA 1J5EF 2PDAA 3HO1A 3BSNA 3SDEB 2DHSA 1NB2A 4O3RA 5T41A 2XYPB 3VHQA 1UAWA 1HWUA 2DHXA 3UD3P 1T7PA 4C48A 3O5TB 4NI2A 2LQ5A 5KT3A 4EYIB 3QRRA 1N0UA 4YB6A 5EHHA 3EYZA 2PE8A 2W8SA 1RWPB 3KNAA 1Y6VA 2YBVA 4CO5A 4PXBA 7FDRA 1LW2A 1YK9A 2Z2YB 5HBMA 4DDFA 2ZHAA 2GVDB 2FPHX 2FYXA 4OI3A 4DR6J 3R97A 4CT9A 3AXMA 1WG5A 3A3NB 3UCUP 2RS2A 3PX0A 1QM9A 1BQNA 1T11A 1REGX 3C14B 3D7SB 3L95X 3MDFA 1PSDA 3I0SA 4Y2CA 3PZPA 3MAHA 1RTJB 5RUBA 3NVLA 2YKOA 1DLOA 3H90A 5KFZA 4GTXA 2P9GA 2V8HA 3ZZUA 1U1QA 1OO0B 5D8HB 2DNHA 1HBUA 4DR4J 1RBLA 1LQ9A 1A9NB 1URBA 2W01A 2ZOMA 3Q8VA 1VQ6S 2OPSA 4C8OA 2B51A 3MPDA 3C6TB 3U02A 4ED2A 3OFGA 1NK9A 4LREA 4C8MA 7FD1A 5LOQA 3FK4A 3C6UB 4X62J 2XS2A 4GMKA 1URNA 4MMOA 2EWHA 2MKSA 1U2FA 1FKPA 1PO6A 4C8KA 2KXFA 5LMNJ 2YWEA 1EJJA 1KQGB 1UZHA 3OV7A 3D28A 4JI8F 2V4RA 1SH0A 1U09A 4DV3J 1RHKB 5ETPA 4LR7A 1B64A 4GRSA 3PO5A 1DQAA 2U1AA 4WFZA 3CCWA 2DNZA 2B6AA 5IV3A 4ED8A 5INHA 2VOOA 3AB2B 1OY8A 4O0NA 1FKOA 1NAQA 1UWBA 2O1PA 4ZIVA 1UJ4A 2FGCA 3HSGA 2WSEC 2MPUA 4Q2MA 5A8WB 1U1LA 4DX7A 4CIOA 2R8HA 1SIZA 3T02A 3NGKA 5ETNA 4M5JA 1WC3A 2GHPA 3CO9A 3DXBA 5GAHU 1IBMF 4ZCMA 1RAAB 2IYGA 1YBAA 4WFAQ 3KLFB 3MFIA 4FDJA 4DUZJ 1APSA 4RW7B 2P8IA 4B3OA 2LEPA 2IDEA 1S1VB 5KG0A 4MKYA 2XS7A 5GOVA 3OTCA 3UE2A 5AJ3J 3DKDA 4FNIA 4P71A 4Q2LA 1B0TA 2GQCA 2IPOB 3WAYA 2BE2A 3THPA 2W7PA 3F41A 5A8KB 3UDEA 1O51A 2VPYB 4G1QB 3MR2A 3G6XA 4DR5J 1F5BA 2B9XA 3V6HA 3K0JA 2DGSA 4LSZB 3BGLA 1S77D 2AQ4A 5L0KA 3PXGa 4XTTA 2ZBPA 4JV1A 4JYAF 2GMJA 1QDUB 3AT1B 4ZPBA 4OHXA 1EW9A 4WTYA 1LWCA 1AXQA 1CS4B 4DQIA 2DY1A 3D2WA 1TVRA 2PD1A 4O44A 4M5DA 2PFDA 4W4MA 4DX6A 3K5NA 1CJUB 4B3TJ 4KAVA 4J91A 4WIQA 4OYAA 2VQEJ 2HHUA 1Q0NA 1U0HA 4U8YA 3PR4A 5I3UA 2GS8A 2OD6A 4DUYJ 3KLHA 4J9SA 3CJ8A 1E6VA 1RISA 1O6XA 4PWWA 2C3MA 2LQ8A 4C11B 3LTOA 5DM7Q 3DOLB 1VFJA 3M8ZA 3T9ZA 4YS2A 3CJ5A 4HI1A 2EXUA 1FEEA 4F4YA 4NASA 2A10A 4NL5A 2KZZA 1N2KA 1YJRA 2N4DA 3JAMY 5HJYA 2UU9F 4DPYA 3N79A 4QR1A 1WEYA 1VBXA 4OI6A 1DLOB 2V2ZA 3FRYA 4MIWA 4UOFA 2B4OA 4BWMA 4DZDA 1IBKF 5K9FA 1QAIA 4C4WA 2BRKA 1WHYA 2VC0A 2V50A 3C66A 1GH8A 4KBIA 1ZS6A 4GC7A 2RE1A 3DGVA 3T1HF 4CRJA 1S72S 2F4VF 1YJWS 4I2QB 4F26A 3G8TA 4HVZA 2E5JA 1E6YA 2UUTA 2VASA 3FQLA 1Q8LA 1TV6B 4NZ6A 2AJ1A 5HMWA 1NEEA 5L46A 4I64A 3GYNA 3EVMA 2DVIA 3T01A 4M5IA 4DS4A 3OLBA 3PRBA 2DNGA 1KOHA 3LP0A 1IBLF 3RR7A 2LXIA 1DQ9A 3DOKB 3MMCB 2N3OA 2ZE2A 1N36F 2VV5A 3CC4S 3DDNA 3PIPQ 3G6YA 2BE9B 1LV5A 3GTYX 2M70A 2OD4A 5G0RA 4ZLLA 3K17A 4DSFA 1KONA 3D66A 4O3PA 3G96A 2JFKA 3H2VE 2ZKUA 4ED1A 3MMJA 4UY8T 1SQEA 2FB0A 4NLPA 2AGPA 3PHTA 3IR6B 4KSEB 5DQIA 2FUG9 5FDLA 1KKHA 3KLIA 5MAOA 4LIRA 4QZVB 4NLXA 3ZFVA 2XR9A 1X5SA 2A2DA 2OPRA 2FJXA 2RRAA 2NSCA 3HT0A 4U8VA 2FZGB 1P27B 2F9DA 1UEVA 3NRBA 3UN2A 4NXNJ 1C2PA 3GYXB 5CYMA 1S1UA 3K5MA 3BDGB 1VS3A 1ELOA 1R3NA 1S6QA 4PZVA 3ZTRA 2FZKB 1WC4A 2HGLA 1LW2B 4OZ5A 1CJKB 2WW8A 5C2CA 3DM2A 5F8HA 3HFKA 3THTA 3FC9A 3GMGA 1URAA 3KFWX 3DDIA 1UEKA 3FZBA 3QPIA 2BXJA 4Z37A 5E3PA 3OSPA 4B9LA 5J2QB 5EWGA 2OSQA 4DQPA 4L3KA 1U25A 5KG3A 1NKCA 2Y0SD 2U2FA 4OYMA 1Z2LA 2IJRA 4RBUA 4EUVA 1ZEBA 2CYYA 2O66A 4DSJA 5ETKA 4DMZA 1TELA 4UZBA 3NKYA 2ANHA 2RDIA 1F2HA 3TJ8A 3UNGC 3NKOA 5EGHA 1S9GA 4Y65A 1Q8KA 3VF0B 1ANJA 3OBIA 4RUBA 4O4GB 1LWCB 3GSIA 4B3MJ 4X4NA 4PXDA 1OQ3A 3CD5A 4ECZA 1X4AA 3HHKA 3M9MB 2HKEA 3WAXA 3G82A 1TTHB 1S6QB 2KM8C 2UXBF 3N28A 1DJ0A 4B3RF 3MM8A 5LMUF 2Y1RI 3CXCR 3BBBA 3W9HA 4RJVA 3CJQA 3DM2B 4YEAA 1RTHA 3A3OB 1YJNS 3KLHB 4LF6J 2DGVA 2OP5A 2JNJA 3KHLA 1IWGA 4NI2B 1S0VA 4LVOP 1WDDA 1R8AA 3CDEA 3HFVA 1RTIA 1SVDA 1YDLA 3TEHB 3MD3A 4USJC 4NA1A 1S1VA 1XQIA 4K4TA 1VRQC 1G4CA 3C15A 1HLWA 2YPYA 3P96A 4AQYF 2FVQA 4NCAA 3LO3A 1PJ6A 2E9ZA 4EBEA 4KGXB 1JQGA 3RBZA 2PI4A 5FLXU 4KPYA 2COLA 3L3CA 2CWKA 5HVHA 4KGVB 1ITPA 2G2YA 3B54A 3SFUA 3UI3A 3RBEA 2BQ3A 3CT9A 3PYFA 2FHJA 3T1YF 5K8MA 2XZWA 5DG9A 2LKZA 2XMAA 5H9EK 3EICA 1RTHB 1NJZA 1CC8A 2ZH9A 1FX2A 2J0XA 1ALIA 4IDKB 1IKXA 3VZHA 5J2PA 3AOAA 3SQGB 2MTLA 3I0RB 1WUUA 3SCJE 5M2UA 3LPEA 1SL1A 4JI4J 2CPFA 2O67A 2Z2MA 2W2OP 4DU8A 1Y9OA 3UR0A 3VAGA 3DPCA 5KFWA 2EK6A 2I8EA 1WWHA 2YWHA 3M30B 3IGZB 3UPFA 3W60A 4DHVA 5GRRA 2ZH4A 2VU5A 2X51A 3OTBA 2ZUAA 2AP6A 2XSJB 4GKJF 2ROEA 1Z1ZA 1UEUA 3BN4A 3QFWA 4HACB 3AHPA 4LFAJ 1KQKA 3BSOA 3L4BC 3IG1A 3QSIA 2AYBA 2OH2A 2XMJA 2AV5A 1SJQA 2QYCA 4J9VA 3R8YA 1RKIA 3TA2A 4U95A 5B08A 2VFUA 4O23A 1QLNA 1KLNA 4OL8A 3MEDB 3DMJB 1HWKA 3N6NA 4A8XA 1ZM2A 2JEGA 2V94A 4F7VA 4WP9A 4OI4A 1U0HB 2MY8A 4M63A 4Y2IA 4BHQA 4F4XA 4Q8FA 1E2SP 4X4TA 4LF9J 4UQTA 1M5KC 1N2LA 1DTQB 1UJ6A 2IRYA 1WHVA 2MHEA 1URRA 3VGUA 1ZOTA 4U7CA 2QIFA 2GQ2A 3NAHA 4KR0B 1D9AA 1TL7A 3FVYA 1XMOJ 1N0VC 1U2RA 2JL9A 4MKVA 1PG5B 2RU3A 4NLWA 2RQ4A 1ZH5A 3PVXA 2W5WA 2BBEA 1JNZB 3NMRA 3LALA 5JVGQ 5DRKA 4K4WA 4JI2J 1X8DA 2JLEA 2PA3A 1NSPA 1RT5B 2Z2ZA 4Q45A 4NYZA 2WRMA 3I96A 4LSNB 1VQOS 2AJFE 1WI6A 2MSTA 2MQ8A 3Q83A 3BGOP 3KDNA 4OJGA 2KN4A 2L3MA 1KLMA 1CULB 1S1TA 3GWCA 3MPWA 1R8BA 1WC5A 2FC9A 3A12A 3QNWB 2YVSA 4NLOA 1WC0A 4C97A 5AE1A 1X31C 1WKKA 2QZ8A 2V69A 3KKFA 4GVBA 4ZCKA 4AYBD 4DV5F 2ASLA 4K2JA 3CMES 2PFFB 5KXAA 3KHGA 3AOCA 2L9NA 1Z2ZA 2NUHA 2C42A 3IBWA 2VG6B 3M2RA 5HO4A 2R2TA 5AXMA 3P49B 1N33J 1P6TA 3F0NA 4HTIA 1KHJA 1FA0A 2WVDA 1KVIA 4DL7A 2HFSA 2AEJA 4J9QA 2PGCA 5J2QA 1U6ZA 1EETB 2CNLB 4DV4J 1TR0A 2VFVA 4G1PA 1M5PC 2AYEA 2CJAA 1EQ0A 3A8KA 1KHKA 3G87A 3GG1A 4ZIWA 2HBYB 5IT9Y 1KLMB 2UV8G 2YWWA 4MKAA 3OQ2A 2LCWA 3Q86A 3DRPA 4N8NA 4OI0A 2ILZA 3MK2A 5HRTA 4JI0J 4JV5F 2BX6A 2F8MA 5TJ3A 2VQFF 5LJ5Y 3MEGA 4M95A 2OEKA 2B8QA 1RWVB 4UOOA 2E1RA 2WK4A 4Q8EA 1QE1A 3DCAA 3PTWA 1FDDA 2WW4A 4TYAA 4ED0A 1DZ5A 2R7XA 2CJXB 2HFZA 3ELHA 3GB0A 3O6QA 1WJ9A 4LF2A 3UWTA 1RTZA 3KK2A 4DSEA 2CADA 1D0EA 4DWIA 2MY7A 3M8YA 4MHXA 4C2MA 5L0EA 1BD6A 4RR5A 4H4MB 2CWXA 2RKIB 4KV8B 5IQQA 4L74A 4ZN3A 2KVIA 1Y5LB 4IR9A 1FE4A 4KJDA 4JI5F 3C15B 4HACA 1X5OA 2Z30B 4Q7AA 3MFHA 5LXRA 4G65A 1P9QC 4PABA 3KLEB 4QAXA 5IFMA 2YX1A 1TKDA 2YNIA 5KOXA 3VTIA 2EFPA 2W4DA 3ZNJ1 3HVAA 3BS9A 3CMQA 2XBPA 3DN9A 3JQJA 5FDLB 5CZVA 2V2KA 1KH4A 1FK9B 1U0SA 3DYAB 5K8OA 3QO9B 4GKKF 2PIIA 4ZJOA 3PFOA 1SIWB 4KE5A 2NPIA 2EFOA 1NJIT 2XLIA 2BA9A 3BSAA 3NBPB 4H4MA 4ES3A 4RNNA 3KD8A 1VGYA 5U47A 3FBFA 2MJUA 3T3FA 3PO4A 1O8BA 3LGNA 2D1CA 4DSKA 2F4FA 3THVA 1RJJA 1FX4A 2XLKA 3CJTA 1T9TA 5D0GA 1G7CB 3D68A 3I56S 3M8SA 1IUJA 3GFXA 1S7IA 3T5KA 4LQYA 2MJNA 4I6AA 2B7CB 3GJTB 2KRBA 4KO0B 3O2IA 4URSA 2ZH5A 4HYKA 1KSPA 3M1VA 2J0QD 5GAGI 1ZAWA 2CDRB 4ETXA 3Q0AA 4KFBB 5H9FK 2DYAA 2AD9A 4C8YA 2ALYB 3UDLA 4AE5A 3CD6S 1MWQA 1FK9A 2KTQA 3MAQA 4DPXA 3BZQA 2CNNB 3A8IA 3GR1A 3H59A 2SXLA 2F40A 3DNCA 2AYGA 1XIQA 4L6V3 2GA7A 1K44A 3C16B 4DX5A 1HQ2A 3TR5A 3DRXA 3TZWA 5KFQA 4ECVA 4RW7A 2VDHA 5DJBA 1SI9A 2IFXA 3POTA 2A1BA 2GCFA 2UUAF 3K89A 3T6BA 4QOTA 1FEHA 2FJWA 4YY3F 1ICEB 4NLTA 4ECSA 2FLOA 3L9ZA 3LANA 3EXCX 3VWSA 1C1CA 3QWUA 4OFZA 1KNZA 2XZTB 3MEEA 2UUCF 3LAKA 1VJWA 1U49A 4LUBA 4OYIA 3W2VB 1RT3A 4WPAA 1KDNA 2OO4A 2IM0A 1XWLA 1XNRJ 2VFTA 4D3GA 4UPKA 3TQEA 3I9V9 3SSSA 2R8KA 4LRDA 1I94F 1XNRF 4OZNA 1QAJA 1FFWB 3IRXA 2VQEF 5SZTA 2BACA 3DU6A 2LEAA 4P9SA 2FGOA 2HS4A 3OLAA 2NCKL 1Q79A 4Y00A 4MFBB 4WJBA 4OHZA 1DFDA 1JLAB 4KIAA 2F8EX 1Q5VA 5GAHI 1S9FA 3FQKA 3M6WA 3TZYA 3D6MB 4WP3A 2CPYA 5DG8A 1JLGB 3W7BA 4ZVUB 2APOA 2FTRA 1H2VZ 3W2WA 5C42B 2FLLA 1TKZB 3GCXP 1RAFB 5KG6A 1RAEB 2JEFA 3W2VA 5E2QA 3B4MA 1UJ5A 3ILJA 3EX7B 3DLLQ 1JNRB 5T7LA 1ZM9A 1N48A 5KFVA 5C66A 4UUXA 2KYZA 2JDJA 2OSRA 2XY5A 3G86A 2V0NA 1TL7B 2OLWA 3CC7S 3I32A 2D9OA 1GXUA 1HKAA 1LXNA 1FNOA 2NYIA 2NXEA 2ROGA 1RGVA 3MR7A 3TVZA 5KFKA 5J1EA 4LF5F 1A6LA 1SKWA 1FESA 1NJYA 2EFVA 2VQRA 1B99A 2W9CB 2YNIB 1OQ6A 1CQNA 3CCLS 1T03B 2FVPA 1Q81T 3DRSA 4ED6A 2OGUA 1FRJA 1YIJS 4DG1B 3EZ5A 4DL3A 2AYMA 2IMWP 2DJWA 2YQ3A 3D9BA 3FDSA 4RLEA 4TY9A 4CP5A 4EK2A 2UVUA 1LWXA 4ZS6A 5K14B 1NNDA 3BR9A 4TLRA 4YHHF 2EBGA 2MHNA 4OI1A 3MD1A 5CA5A 4A8YA 4MH8A 2F8HA 5LSRA 4B9NA 3L7OA 1VJQA 1CPZA 1X4EA 4LFBJ 1HMVB 1IM6A 3QT6A 2CXEA 4FDFA 1N5YB 4OYOA 3G6VA 2E1CA 3ZZZA 4JOUA 1LKZA 5DLGA 1Q8BA 3UCGA 3BV8A 4CLFA 1UKUA 1EB0A 2QV6A 5LJ3Y 2VICA 2DNRA 5F8MA 1VQ9S 4DV1J 1S1XB 2I6WA 3PEJA 1M0SA 3R5GA 5KG2A 2B56A 2EI5A 2MQQA 4A8SA 3C2PA 1EW2A 3S6EA 1MROB 2FHJD 1N88A 1J5EJ 3UR3C 2BJEA 1R27B 1HWLA 3DI6B 3I0SB 4L72B 1FXDA 2PMWA 1TFYA 3GU0A 3QQCD 3UNYA 2VG5B 2RRBA 3C46A 4QWCA 3ADAC 3OXLA 3LF0A 4ICLB 4YDDB 2DNMA 4ZJQA 1NPKA 1RT5A 5J2MB 4DV2J 2YKMB 1KHLA 2HFOA 3K8WA 3M8WA 2HMIB 3W66A 4KC5A 1RABB 2MZRA 2OELA 3MOZA 3RTVA 2MKJA 1VOMA 3MECA 2XLJA 1AROP 2WOMB 4DR6F 5ETQA 2W7AA 4B3SF 2ZZNA 4RWXA 2BANA 3NEKA 5D6GA 1AA1B 3F56A 4PWUA 3TANA 1WF0A 2HQ3A 3CD7A 3DRRB 2DNNA 1T94A 3ED4A 2FD2A 4HTJA 3KUEA 3GIKA 1F0XA 4W92B 4QU7A 1HNVA 3C8YA 4LR8A 4W90B 2VFRA 3CMRA 4TU7A 4TYBA 3OFHA 2I9SA 3OSNA 1N5SA 1WTFA 2JSXA 2MZSA 4MFBA 4N76A 4WYLA 3QJLA 3C19A 2DNQA 2JRSA 2HVEA 2K06A 3CJRA 3GIRA 2VKZG 4NCGB 3FFIA 2FJAB 3GIMA 3BKUA 3CNQP 2M8DB 1U8WA 1HNIB 6AT1B 2F65A 3A8JA 4Y3CA 1VQ7S 3D6FB 2D3O1 4ER8A 3AJDA 3M2VA 3WIUA 3HT3A 4ELTA 5LL6d 1ELXA 2G13A 5F8LA 2IRUA 1G3OA 1HD0A 4IH5A 2DEJA 1E3CP 1HNZF 1C0UA 1EQMA 1HW8A 2FC8A 1SV5B 1MMNA 4MK9A 1U26A 4ANCA 4X64J 5G0RB 1CC7A 4DR7F 4J90A 3UD4P 4EGLA 1VDHA 1VYAA 2F7VA 3LUYA 2QA1A 1NCLA 2W5TA 2BE2B 3Q8QB 4UORA 4YB7A 2EKNA 4EI2A 1PBUA 1NHKL 2ZBIA 4DX8H 4PPZA 1V3ZA 1I5OB 3DRSB 4X4QA 3KK1A 3UN5A 5CCMA 4Q0BA 4CNYA 1U45A 4OHYA 1H6KX 1IBMJ 2R8GA 4FXVA 3NGSA 3KHHA 4R25A 1YRUA 2MQOA 4DUZF 2VH7A 4WFBQ 4UY85 3AODA 2PC6A 3C3LA 1ZZFA 3J81Y 2BJ7A 3MPVA 1PGZA 1L3UA 2XS5A 4FF1A 2MLYA 2XWXA 1H98A 3OPKA 2H1YA 3PIOQ 5ITHA 1C1CB 1TL3B 1CJVA 4QYZK 3EGZA 3NBPA 1IQZA 2YQ1A 1M1KT 4WZMA 2KI2A 1C4AA 3KUHA 4DV0F 3I31A 3M32A 4M8LA 3EMTA 1DHMA 2DHAA 2IM3A 5ETRA 1JX4A 2J6SA 5L8RC 4IH6A 4JYAJ 1XEZA 1T9VA 2GJIA 5ETLA 3IDDA 1FCAA 4CYUA 4TKTA 3RGIA 3D0GE 2QRRA 4NA3A 5GADU 5EDWA 4HR2A 1S10A 5M2PA 2CQBA 1RLDA 1UVIA 4B3TF 1TL1B 1XN9A 2PT0A 5L9NA 1P9YA 1NK4A 1XMBA 2F1FA 1S0NA 2E9TA 4DXLA 3G8QA 3GZ7A 2DH7A 3P4UB 5KT7A 3GYGA 3W8GA 4WTOB 3K2YA 3GV8B 4J9RA 3CCSS 1NHVA 1W2IA 3U27A 5K14A 1F5AA 2JOQA 1AT1B 5B0GA 4WFXA 2ZNZA 4JV0A 4WZQA 1DTTA 4KM4A 4NWXA 1D9FA 2MQNA 2CJYB 1NUEA 3LWLA 2D7SA 5A6WA 2MQLA 3ET6A 4HH1A 2BDPA 4DCOB 2KO1A 2UU9J 1XK8A 4UTGA 1NK5A 2OI2A 3MMCA 3QAEA 4MK8A 4FYVB 4OLOA 3UDVA 2C2ZB 1S4EA 4X4SA 3NGUA 5D4NA 4O3OA 2RU9A 5F9NA 1IBKJ 4C3LA 3TX8A 2W9CA 3SI8A 4DSIA 2HQGA 1OPZA 4H4OA 2AT1B 2GAGC 1X0FA 1YJVA 1HYSB 1R8HA 1ANIA 3QGIA 1KS2A 1ZPVA 2B43A 1B0PA 2CIMA 2W24A 3HHLA 4LJMA 3CCTA 1T02A 4NA2A 4URQU 2R7UA 4TN2A 1X4BA 5FLXY 1VQ8S 1ALJA 2YNFB 3IAM9 1XERA 2RHSB 4LR9A 1T95A 2IAJA 3MCMA 3W5XA 3OVAA 2MKHA 3IRWP 3IM8A 1FRIA 1MN9A 4GVBB 5CAAA 4DR1J 1IBLJ 4JI1F 3AA8A 2DCLA 1CBKA 1R31A 2XHCA 1IKVB 2D69A 3CSKA 4OX7A 5EUHA 2V8GA 3W2WB 5KFAA 5C42A 4R5PB 3GFYA 3MM8B 1WG4A 3IO1A 5LSLA 1SHQA 1IKYA 4NEYA 1RACB 1S59A 2UZAA 1YBUA 2J7UA 2Z0GA 1H7XA 1UPMB 4ELVA 3TO8A 1WNEA 1HQEA 2LU2A 2LFVA 3FCWA 4CLUA 3BREA 4HT5A 5L1LA 1SJRA 2OFGX 3CJ0A 1DAXA 1RT7A 4CLZA 3DRRA 1X9SA 1F9HA 4KY3A 3V81A 1S76D 3IGVA 2R4FA 1G2EA 3LH2S 2I1RA 1K1SA 1HARA 1I51B 3IWLA 1FI4A 3N5FA 2P2CB 2WONB 4WE1B 2H48B 2D1GA 4KJGA 4GTYA 1EP4A 1W2BR 3RAQA 4KPCA 3T19A 5IV4A 3EZUA 2HHHF 4NXNF 1Q86T 2LLZA 3OTEA 1QUVA 1FVQA 1WC6A 2CQDA 4F36A 1IXKA 1RWMB 2N3LA 2HWTA 3AQOA 1NDCA 5GVQA 3TW0A 3UO0A 4QU6A 2GW8A 1RCOB 3HHNB 2D74B 2JFDA 1HQAA 2VBZA 1BXNA 5HQ8A 3UCZP 2RH3A 5HANA 1GEHA 4C98A 3R1HA 3TAQA 3QGPA 2DR5A 4R0EA 4RW4B 3NKQA 2E7WA 2HWHA 3DLKB 3T41A 5IT4A 1GMVA 3OJUA 5F8GA 4E2FB 2KG1A 4I1TA 5BJRA 1HBMB 3BB5A 2HHTA 4WXOA 2B5JA 2ZKTA 4J9MA 4MY4A 3TA0A 4B3MF 2QLWA 1OWXA 2P6SA 5B09A 4X4RA 4MK7A 1UTAA 3PJXA 1KVKA 3RAXA 1MWZA 2R7SA 1SL0A 3CCMS 3NNAA 2UXBJ 2BKPA 4XPEA 2XYGB 1SKSA 4LF6F 1SC1B 2DGXA 4N8OA 3ISNC 3SIPB 1HWIA 1LNQA 1TKXB 1EZZB 3E51A 4DFMA 1S4FA 3SCIE 3H2UB 2E5HA 5J2MA 5L0BA 1L3KA 2HZAA 3HHLD 3OT9A 4K59A 4RW4A 2CDQA 3EGNA 4MKBA 1JLQA 1TP7A 4DL0C 4DU7A 4UOGA 2HMIA 2W7OA 3MXHP 1RT1A 4IFVA 3TUZC 3V6KA 3A8EA 2J0SD 3ZZPA 2BV3A 3KUGA 5HBMB 2ZBRA 4ZA1A 5L9XA 2IA0A 3T5JA 1V6HA 3JTPA 3IGNA 3KDOA 4HH0A 1RYSA 2GNKA 3WHIA 5KFBA 1PIEA 4CH7A 1HHTP 2EG2A 1Q5YA 3KHRA 1FWLA 4PWDB 2OUGA 4ZPDA 2L08A 1K7HA 4E8UA 1TFWA 3M4XA 3KJVA 3VZIA 3OHBA 4MYUA 4TQSA 4DFJA 2ROPA 3QZ8A 2M2BA 4E98A 3HHDA 4PG8A 4XDDA 4UOPA 1HBUB 1QSLA 4KKOA 1FKOB 1EQJA 1WSVA 1UWBB 2VBYA 1EIYB 3MEGB 1VQNS 1X5PA 3HVWA 1TAUA 3VR1A 4X4VA 2EK1A 2YKNB 3N6LA 4OMFG 2AGQA 2V5HG 2XCAA 1JJCB 2FHMA 3BSCA 4USWA 4ZPWR 4P2FA 4CM2A 3RBDA 4MAKA 2Z2LA 2ATCB 3O3LA 2HK3A 3FRZA 1CULA 1S1TB 1VHIA 2DNYA 4XAKA 4ZVHA 3CJKB 1UP1A 3FNNA 5A76A 1U8SA 1HFEL 2JEIA 2NR0A 4C7QA 4EO8A 2KFYA 3H4BA 5K8NA 2GAHC 3FJ2A 4GKJJ 3E2DA 5GAGU 4LFAF 3I5BA 2HS3A 4P2XA 2WSCC 5FJ4A 5T14A 2QA4S 2HRTA 4EBCA 1UCNA 2MB0B 4WYWA 2VIHA 2VG6A 3M2RB 1L5UA 1FKAF 2C2EA 3R2DJ 2Y3YA 4KKOB 5KFSA 2G0JA 1SXLA 4HHJA 4AFFA 1K0VA 4Y2KA 2LA6A 2IY5B 4IR1A 1B4SA 1EP4B 1Y00A 3HSDA 4UF4A 4IG3B 5B0CA 1WD6A 4UT4A 2GSOA 2ZITA 4B02A 2LDYA 5BXIA 3L09A 2QMXA 3E3XA 2KHDA 2WVFA 1XMQJ 2LQJA 4O3QA 1OIAA 3TG0A 2G4BA 2HHQA 5H9FJ 1R8CA 2YNGB 2ZBQA 3D1OA 4U6PA 1KQFB 3OR2A 4O0IA 1KRPA 4ZCIA 2ALZA 1KH5A 1WEXA 4FBUA 5DQGA 1OSCA 3NCRA 1JLCB 1XMOF 2FJEB 2CJ9A 3CB4A 4DPOA 4X65J 5AJ3F 3FGVA 3J7YI 4FYYB 1GMWA 2Z8QA 4DZ6A 5K5MA 1DTQA 5K8PA 2XNQA 3CIZA 4ES2A 5HP1A 4Q44A 1OYEA 3M1VB 4UOCA 2LQ9A 3ISND 4XO0A 2NZ4A 2AJ2A 4JI2F 4MIVA 1SQFA 4KFBA 1VHFA 3UD5A 1KEKA 2XO7A 3M32B 4PAAA 1N5QA 2P9EA 3CVKA 2HNDB 3PJWA 3PCOB 4FNHA 2HFUA 5HROB 4PR6A 5LXYA 2ACMA 3OL7A 4ECYA 1N52B 4QQBA 4P72A 2NUUG 3T5HA 1BC6A 4LF1A 3KJQB 1S0MA 1TKTA 5D4PA 4ANDA 2ZM6J 3ENQA 2XMMA 5GAEI 1LOUA 4QIGA 3DLEB 4DV5J 1N5YA 1OJ4A 1FFGB 1UFWA 1S1WA 2W9AA 1NJXA 1J27A 4RO0A 2GHVC 4F0KA 3BM7A 4RW8B 4N7TA 3M8RA 1NH8A 1N33F 1MSWD 3DYAA 1TV6A 2EFNA 5D77A 4ZVPB 1AJAA 1HI1A 2L9WA 4MTPA 5F9LA 5KOWA 3X1LB 4H4KC 1RWWB 1ZBTA 3AFGA 3ILLA 3FBEA 3IBCB 4I67A 3VQTA 2VKRA 3KWMA 4NLRA 4U96A 2R7RA 3NNCA 2C3PA 3NOGA 4DV4F 4PQUB 4ZVFA 4CM0A 5L1IA 2CQIA 2R42A 4QYRA 1HPZB 2I38A 3H25A 4TN0A 4UUWA 3GPAA 1AJCA 4KAYA 1IWAA 1S9GB 2CKWA 1RHRB 2J7WA 3FKBA 2BJ9A 2V4JB 1JLFA 3K8VA 1E33P 3E2EA 4V19J 5J1PA 1V3SA 3ZNUA 1ZM3A 2AEMA 3R3TA 4ZHRA 2KFNA 2DNKA 1TUWA 1JB0C 2RT3A 3CDBA 4FZVA 1R8PA 1GK8A 2W2NP 4OZ1A 2H3EB 2GJFA 2IVYA 3CJ3A 4KJIA 2AU0A 4EWTA 2W5XA 2QMUB 4G6VB 4C0HA 3QIPB 4ED3A 1N4LA 2JH3A 3CCVS 4PG5A 1RBOB 4P7VA 2AMCB 2OKQA 1A0OB 1S1UB 1RWNB 3KG0A 5IT9U 1TK0A 2YXLA 3CF5Q 4JI5J 3SZZA 4DI6A 1RT1B 2CZVC 2NXUA 3VAHA 2VBWA 1AUKA 3LGMA 2HWIA 4OHWA 2K3KA 5KFUA 2PMZD 1LFWA 1Q95G 2MKCA 2XMTA 2UV8A 3MEEB 5ETMA 4DV7F 3FEZA 3QRPA 4KGMA 1HBOB 3CD0A 1RT3B 4NYPA 1E1ZP 3CPWR 3JQMA 4LQ3A 4ZHRB 3J7ZT 4IRKA 3KNGA 4TLQA 3P3DA 4QWBA 1WOSA 4WIIA 3KYLA 2BR0A 4FBTA 1YG0A 4BBYA 4RNFA 2CPHA 2V9KA 3R7BB 1RA6A 5F0UA 4WE1A 1KTVA 2X3GA 3JTNA 1J2VA 2JZ5A 5FIIA 2K1RB 2P6TA 3GG0A 5B0DA 3MCSA 3Q22A 1B8JA 1IR0A 8ATCB 4JI6F 1KP6A 1ULRA 3CJ4A 2UXDJ 1NSKL 5E3CA 5LRMA 2WHOA 1UFLA 2DGOA 5AJ9A 1NPPA 4MYTA 2EPIA 3H40A 3CGIA 5BR8F 2Q6CA 3UVJB 3KLFA 5EGEA 3M2UA 1C1BA 3IMQJ 3N01A 3NCPA 4OYWA 2LYVA 3ZZ0A 4K4XA 2XB2D 5IT0A 2KXNB 1YJ9S 1OPIA 2QA2A 2YKAA 4WK3A 1G1XA 4NMLA 1OY6A 2V34A 3BQ1A 2CG4A 1Q16B 3SSRA 2ZC3A 1WOPA 2M52A 4OZLA 5IC6B 3JSMA 4DQQA 2G9YA 4WKYA 4G1QA 2UUAJ 1MU2A 4ANEA 3TAMA 3EDQB 1N5VA 1HA1A 1RCXB 3O44A 5J2NB 2BOPA 3BGUA 4C8NA 3PEHA 5HK4A 4DG1A 1TU0B 1BHNA 1VRUB 2ZUGA 3NS6A 3RW7A 4ILMA 3QT5A 3CUNA 2QC3A 4DF8A 1AFIA 2WAQD 1HQUB 2C28A 2A3JA 1TKXA 3HHEA 4U7UK 4ENOA 3C16A 2E44A 3LPYA 3ITHB 3SQGA 1OS5A 2ABYA 1JLQB 1UFKA 2ZJQQ 4IYQA 3RZAA 3FMBA 5HLFA 2CNKB 5GAEU 1SBRA 3EGVA 4IFVB 5HMZA 2ZH1A 3D0IE 1I94J 1RAJA 2FVCA 2XULA 4KH0B 1RB0A 1NLKL 3ENVA 4NRUA 4USKA 3TUIC 4C3MA 2ATLA 1UVMA 3MUMP 2XTJP 2W2QP 4JI3F 1N32J 2DRAA 5D0RA 2MZ1A 2WVCA 1JLFB 2ZOFA 1X9WA 4DR3J 3T1AA 3J81U 4TXSA 2HK2A 3D3CJ 1EW8A 3DLGA 2CQHA 2XI3A 3DLJA 4CTAA 1TQLA 3IWXA 5D4OA 2D3OR 3T00A 4Z7YA 2MKYA 1YRTA 2LDIA 2YH0A 2W5SA 3DI6A 1S57A 1RUSA 3W3SA 4IDKA 1YRXA 3DMJA 4CLWA 2RNEA 4LBHA 1S6PB 2GO9A 2L48A 1V5IB 3M8QA 1PCAA 3BGFA 4IO9Q 1RWOB 3TARA 1L3VA 2LA4A 3VVTA 5DLTA 2Y1LB 3M9NB 3CE8A 1C0UB 2MYFA 1N6QB 4Y2AA 2HVIA 4USTA 4RKUC 4K0KJ 5HQMA 1Q8IA 3ZTOA 5HI7A 2HGMA 1UL3A 2J9EA 1FXRA 2GVDA 5AXNA 2X1AA 2E29A 4X84A 5IOLA 1X4GA 3D6TB 3DGPB 1EAYC 2BANB 3SEOA 5IWAJ 3BGRA 3R7SB 3T6JA 2RUGA 2MLZA 1CQMA 2CPEA 3AD8C 4RBTA 4Q0BB 1AZSA 1QVFR 2XMUA 3MPYA 3AOBA 1VQKS 4YHHJ 4ILRA 1RQ0A 3RB6A 2RHQB 2PEHA 3GSDA 2VG7A 2QZUA 3DRPB 2GVZB 2WVEA 5D78A 4F50A 3W63A 1GQEA 4W98A 5HAOA 1T9XA 1VLOA 4M5LA 4YOEA 4CYRA 4LFBF 4J9UE 2B9YA 2BRLA 4PQAA 5C24B 1U1KA 2GFFA 5GADI 4ZLNA 4CH1A 3MK0A 4RW8A 1WDTA 2J0WA 2M9KA 1Q78A 5DS7A 4ID5A 1SCJB 2J76E 4ZP9A 2KDOA 2DR9A 2IC3A 3PFEA 1HQEB 4ZVRB 1HNXF 1U6BA 4DV1F 1D9DA 3SMZA 5AXKA 4YR2A 2DO0A 2ILYA 5F3TA 2DGUA 3NAIA 4KAIA 5H1SV 1U47A 1HPZA 3S01A 4YUDA 4X66J 1PAEX 4ZDNA 1LK5A 2CVEA 2HBQB 1GX6A 2HRUA 4DS5A 1F60B 1H7WA 3H4DA 1RT4A 5JJBA 2IBOA 9RUBA 1PILA 1TL1A 3ONQA 3OXGA 4ID8A 4UQGA 4DV2F 3GIJA 1F3FA 1GXLA 2IJNA 1PBAA 5K20B 3MM9B 4DL2A 1VI7A 2VPWB 1X9MA 1FRLA 3AA9A 5IC4B 3T9NA 1ZPWX 2DO4A 4AXJA 2FHOB 3FFIB 4OI2A 2ZH7A 4ILLA 2XO6A 2XC9A 2DH9A 2HVHA 1X60A 5BYQA 4LRBA 1K47A 3J7YU 3GIIA 1WSRA 1SKRA 4B3SJ 3ET6B 3DLEA 2VJUA 3J7AN 5ETTA 1RHJB 2C1EB 2BJ3A 5DDPC 5F8JA 3WAWA 1VLYA 3GILA 4LRCA 4K2XA 3G2XA 4HT7A 4LF8F 4NZ7A 1JXEA 1H38A 4LF7F 1RT4B 3MI7X 1J5OA 2W2PP 2OPQB 1WACA 2L9DA 4TY8A 3VAIA 2B0GA 1S97A 1RXOB 5CH7B 4A48A 3ILIA 3CCZA 1FTRA 4F0MA 1VQLS 1I3OB 2NSBA 3DLGB 1W26A 1WOOA 2CZ9A 3GR0A 4ZOSA 4LQ9A 2Q43A 4FVCA 3G9CA 3E8OA 3KK1B 4DCPB 1BY9A 2R7WA 4Y0FA 3DU5A 2DR7A 1Y3JA 2W4PA 1WKLA 2R7QA 4AL5A 1KR4A 2E1PA 2JWNA 2MQMA 1SC3B 4U67Q 3K5OA 3SZYA 4FDIA 1MU2B 2MXYA 2MZQA 4PKDB 3BH6B 3OTOJ 1H2UX 4A8KA 3QSYB 1HNZJ 3DYCA 4X64F 4DR7J 1YVFA 1SC6A 1GMWD 2BOAA 3H7HB 1HQUA 3ZZYA 4P10A 1KC8T 3NKNA 1RTDB 2R3VA 5KFYA 1K8AT 5IQ6A 4IOAQ 2CQPA 4LFCF 3MM5A 3PG9A 4NLVA 5E3RA 1VC6A 2A6MA 1YLXA 1C1BB 2WVBA 2ZEJA 4H4KA 5G4DA 2IVFB 3PV8A 1U6FA 1WTBA 3KJVB 1SKUB 5C25A 1M5SA 1KHNA 1FD2A 1KTQA 1U02A 2GQQA 3IS9B 4FS1A 2ZZMA 3RW6A 4NMXA 2P9CA 3RB0A 3PJ9A 2KL8A 2W2MP 3ZC4A 1S0OA 1BQNB 3ULHA 2OTLS 4EU0A 3PYDA 2QLJB 2RDDA 2VOPA 3RRHA 1ZA1B 2NZCA 3N0VA 5KG7A 3V4IB 1QTMA 2O3DA 2Q66A 2MQPA 4H54A 3PW7A 1Q7LB 2B3TB 2YPZA 2CJBA 1TVRB 4O44B 3MCNA 4Y6IA 4DPTA 3V6DB 2UVRA 2GGPA 2M7SA 2E5IA 2XZDB 5B0EA 3VVUA 4DV0J 1VCTA 4CDIA 4ZG9A 4A46A 1FT8A 3A3PB 3J80U 1NKEA 4HHHA 2G9OA 4FXDA 2R2UA 3Q2TC 1H2TZ 2C22A 3LAMA 3NS5A 3CCQS 4OZ0A 3HXMA 3HFZB 3R27A 2VA2A 1REVA 4DEZA 3QGHA 1KWMA 1Y5IB 3BR8A 4ZVOB 2BUNA 3DOMA 4GO7X 1FHTA 1RHMB 1U4BA 2LXUA 1EKRA 4OJHA 1T8EA 1AFJA 2HS0A 2B9EA 3DFEA 1M1GA 4ZPCA 1LFPA 1VK3A 2KU7A 2ZDOA 3B4DA 3IRXB 1FNMA 4H4OB 4G1IA 3R7NB 2F3JA 2GSNA 1NM2A 3G6ES 2LXFA 3WDOA 1RU1A 1QY7A 3WX8A 2BABA 2YWKA 2AW0A 2DKOB 2WB4A 4M5DB 3GV5B 3G4SS 2A18A 1WG1A 1SL2A 2W5QA 2DR8A 2KHCA 3W61A 3MURP 4Z7CA 1ZYQA 2YQ0A 1RA7A 3BDGA 1XC9A 2IYIA 3AJ1A 3OUYA 4J9NA 4I4BA 2YKPA 2GZOA 1REVB 4LBPA 1U1NA 3QRQA 1PAUB 5T7LB 3KLGA 3CTRA 3SSQA 2W8LA 3BKFA 5HQLA 1V3RA 4IUFA 4ZPAA 1SJ3P 5K4PA 1VQ5S 2C3UA 3BEGB 3BGRB 5KFMA 3H5YA 2VB6A 3FSIA 5A8RB 1H74A 3R5CA 2CPDA 2R7OA 3RU0A 1LWFA 3MGJA 4OLPA 1HL6A 3MOJB 2IMOA 3BYRA 3NOCA 2WB1D 3MZIA 4PYAA 5KFFA 2FY8A 1PYOB 2Z56B 1RLCL 4RU9A 4DV6F 1NB7A 4AL6A 1NZ8A 4IFYB 1SH3A 3I6PA 4QPXA 3TOQA 4O4RA 4MT1A 3EPIA 4DR1F 1U1MA 1BLUA 5BYRA 3G82B 1NK8A 4JI1J 2CPJA 1PYTA 3H42A 3MEKA 2W9BA 1LEOA 1YGYA 1EKSA 2A2CA 3ETMA 3JSBA 4PG7A 4B08A 2ZWPA 1ZEDA 3OHAA 5AT1B 5KG1A 3L7PA 4DR2J 5KFCA 2E66A 2B8PA 2V6AA 1ZZNA 1HR0J 1W25A 2OPRB 3FBBA 5HJXA 4DCJB 2YNHA 1JMTA 3Q8UA 4BWJA 2VA3A 1R0AB 5A8RA 2ZH3A 1QTNB 1FTCA 2GX8A 2ZHBA 1WKJA 3PACA 2VD3A 1TUVA 5KFJA 1N8RT 4JV2A 3K57A 1KFSA 2W8DA 1QE1B 2ZC4A 3HDSA 4WFYA 4QBUA 2Y0BB 2ADBA 2Y8WA 1NKBA 2B5JB 1FDBA 2GMHA 3A4TA 3W65A 2GLQA 2DH8A 1Q7YT 2HHHJ 5KFXA 5JUMA 2V63A 1MROA 4QR2A 4TQRA 5EGYA 1NXIA 3D54A 1X0PA 2ZBCA 3FCVA 5E41A 3JYTA 4J9PA 1HI0P 4N41A 4PUOA 4K50A 4I7FB 4ZVGA 4L75A 2CPIA 3SQOP 1S12A 3G8SA 2AWZA 2ZJRQ 4JUZA 1YSJA 4I56A 1TMMA 1FSUA 4NWJA 4RPFA 4O4GA 3BF4A 3DC2A 1FNXH 3BDFA 1MN7A 3FCHA 1RI7A 3M2VB 3D67A 2JC0A 1FRHA 3P8BB 5I3QA 1BQMB 2XI2A 3HKWA 3M6XA 2WOMA 4ZLPA 3HJVA 4LRAA 5AXLA 3BDHA 2QO3A 1CG2A 1RTDA 4R8UA 4LF4F 2CPZA 4QIEA 1FJGJ 4B9MA 3AJ2A 5H9EJ 3KJFB 1ZEFA 3LP0B 2FVSA 3PW5A 1FERA 3C14A 3GLJA 2QLFB 3D1QA 2BM0A 4M5GA 3O1LA 3SYZA 2JC1A 4OX9F 2PI5A 2H5IB 3CMAS 2XWYA 3EUNA 4NLYA 3KK3A 4ZP8A 4RUHA 4OZ3A 2CVIA 4WP8A 2CUYA 5JXSA 4L73A 3HKZD 1G6BA 1BQXA 1JIHA 1NPRA 2B9WA 4K5SA 4EO6A 1YZ7A 3MM9A 1YI2S 1H73A 4IG3A 4HHUA 1YZ6A 4N77A 5E3AA 2XMWA 2YKNA 3S7RA 2K7JA 3NKPA 4R0JA 1DRZA 4WK1A 2HNYA 3CCUS 1OYDA 2GO8A 3HF5A 1B7YB 3EPGA 2BKNA 1RHQB 4WWSA 3MF5A 5CYMB 1BMQB 2C3YA 3A1YG 4ZVQB 1JLEB 3IFEA 3DRYA 4CLTA 3BO3A 3HI9A 3KK3B 3M30A 2BQUA 2HZVA 3JS9A 1GX5A 1HBNA 1YBTA 1W7WA 4CQ1A 4B56A 1NBEB 5CYJA 4ECTA 5DGAA 2NYHA 3HCXA 3QJPA 4A8MP 1YJUA 2HPUA 4XK8C 3Q23A 1QJHA 2CQ3A 4DN0A 1AJDA 4YN3B 4J9KA 1XNQF 3AAWB 3IG1B 8AT1B 1PKUA 4C3KA 8RUCA 1UVNA 1SHNA 2CPXA 1XR6A 1R43A 1S5ZA 3QIPA 3CJ2A 3P5TL 1IR1A 2QLBB 1O5JA 4CLKA 4CLLA 2YNHB 1BWEA 1NU4A 1CJTB 1NSAA 4FF4A 4QW8A 1IVZA 3I4PA 2VL1A 1R0AA 2Z57B 2G2OA 4UW2A 5LQQA 5B0BA 3WC2A 5D15A 4I68A 2XM3A 1TKZA 2V8DA 3GONA 2BKOA 3TQ1A 1VRTB 3LGHA 1SJ4P 1NDPA 5E3QA 2KT5A 3HHLC 4ZN1A 4ELUA 1SQGA 3PYGA 5KT2A 4PQUA 3B5QA 2GIRA 4YDXA 1KHVA 3TA1A 2DGQA 3GE9A 3OR1B 3QWPA 4K4VA 4CYUB 1XMQF 1AYEA 1MLAA 3HD2A 4ECWA 4LR2A 2K1RA 5FD1A 3TVKA 4CLPA 4YB1P 4DQRA 2HG4A 3QAUA 3NCQA 4HL9A 2IM1A 4QR0A 1PYSB 4X65F 5C5JA 1IKVA 2BM1A 4M1KA 3Q89A 1S9EA 1TZ0A 3BBFA 4NX9A 3W1YC 1D1UA 3J7Z5 1KFDA 2H65B 1U1OA 2BJ1A 3CC2S 3NGRA 1NK6A 1KVJA 5EX0A 4DOZA 4ZJLA 1RYRA 4ED5A 2YWGA 1V9OA 3M2UB 2EVZA 1ACMB 2UVWA 1UETA 5E0OA 3VAFA 3DXSX 2RRNA 3OR1A 5KTQA 3ENAA 5F0WA 3W62A 2F5GA 4A8OA 2GHWA 1RHUB 3QFHA 5KFGA 2VG7B 3W5ZA 2GMLA 3M6VA 4JP8A 3KLEA 1LWEB 2HAFA 3Q24A 4ZVSB 3DOMB 2ZM6F 4P52A 2B4UA 1S1XA 2IDLA 1T05A 5C24A 2E1AA 2W4CA 1I6JA 2HHWA 2HGNA 4LSNA 4G3IA 4F0HA 2H5EA 2HBRB 3U1LA 3MMBA 4DLGA 3F73A 3G71S 1RZMA 2E5LF 3ZTQA 2IC3B 4RW6A 1FJ7A 2HNYB 2IAJB 4YP3A 4LIWA 1RWUA 4ICLA 5CHCB 1FDAA 5CYQB 1I1GA 3MM7A 1DARA 2DGWA 2XMVA 5B0AA 2UXCJ 1JWWA 2OMLA 3NMAA 2JX2A 3DLBA 2O01C 4WU3A 1QUPA 2ZOGA 3QMQA 2D41A 4NRTA 2B7BB 2UUWA 4NYOA 1VIOA 2DIVA 4KGKA 4DBQA 3OJSA 4OIXA 1XR7A 2DXEA 3BBCA 5KFOA 3FMWA 3SBMA 3CO0P 4GVLA 2UP1A 1HDHA 4RW9A 3GFHA 2MGZA 4GTWA 1EETA 2BMBA 4K4ZA 3EDRB 3IR5B 4O3NA 3ZZTA 1GMUA 1SUQA 2HHSA 1LWFB 4PG6A 4KRWA 1VC0A 4HDHA 2B6AB 1BGXT 2YNFA 5KFEA 1EX8A 1C0TA 4F2RA 2KZMA 2V4JA 2C2MB 3AXKA 3BH7B 5KFNA 2EBEA 4DL5A 2WBRA 1MMDA 2X1GA 3PKYA 4C8ZA 3POTB 3I9ZA 1FE0A 3MR6A 1MMLA 3ICLA 4NCGA 1SJFA 3L7UA 5B7WA 1HNWJ 3BQ2A 3VGTA 1J5OB 1NJWA 3PX4A 4DR4F 3A52A 4DV7J 1YJ7A 3IR7B 5F41A 1P49A 1T9YA 4NLDA 4KTQA 4PWDA 2DB1A 4NXMJ 4IH7A 1RT7B 3I5CA 3DLKA 2Y1IA 2IUCB 4F02A 2I5JB 2JHEA 2J7KA 1IBCB 1L3TA 4OYXA 2V4QA 3PW4A 3Q8PB 3KMSA 4ZCLA 2HHXA 3FEXB 4PRFA 1GNKA 1Q4RA 2OFHX 3MUTP 2GJ2A 2AJQA 3CDUA 1PJ5A 1RT2B 3RRKA 4ZVEA 2NXJA 2J6UA 1VQPS 3Q8SB 3OTDA 4JI6J 4YR1A 2EKYA 3TAMB 4OJ3A 4ZVTB 2UXDF 3WX4A 3O8WA 4CI0B 4YR0A 3IXQA 2ERRA 2BEFA 1ALKA 3JSYA 3D3BJ 2HSEB 2HNZA 4FKXA 5BR8J 2LEBA 1S6OA 2FY1A 3MTJA 3OVBA 3RJMB 1FRMA 1UVLA 5EWEA 4L3NA 1DURA 1NMEB 1NDLA 1EHWA 3EVWA 3WBZA 5LRNA 2ZZTA 1ELZA 5HLFB 4WBFA 4OJ1A 3VAKA 1VQ4S 3EZOA 2JVRA 2AX1A 2JLFA 2N7YA 1HBNB 2V8PA 3W9IA 4MIBA 4A47A 2RQCA 1TL3A 1GAOA 4QWAA 2J9DE 1FJEB 3DOLA 2UUBJ 2QL7B 2VZ9A 1T03A 4XPCA 2FJDB 1RAIB 2DPIA 2CG8A 4HI2A 2ZH6A 1SH2A 2IVMA 3CDAA 3MMAB 3TJAA 4ECRA 2CA9A 4CLSA 3K58A 4NLGA 1JKHA 3W9JA 4FYDA 3LXQA 3B78A 3RB3A 2K8GA 4P75A 4ECUA 3MM7B 2Q79A 5CABA 2XQCA 4ED4A 1JLGA 3VCDA 4NZ0A 2VFSA 2EG1A 4FPIA 7AT1B 5I3UB 4UZCA 2QA4G 2YX4A 4PG4A 2W5RA 4I2PA 3D1HA 2HQFA 2KJVA 4ID5B 3CJKA 2N4CA 2ZFHA 4JI3J 1N32F 2N82B 2WBMA 2F9JA 2QFIA 3N4WA 4QIWD 1WF1A 1DTTB 2PSZA 4DR3F 1RKJA 4RNOA 3H5SA 4K4SA 3JAMU 4AT1B 1D3WA 1Y11A 4J37A 5DDQC 1H0HB 1GFWB 2RB7A 2MZTA 3R5JB 4RX6A 5IM0B 3M8PB 4BS2A 1S99A 4M5NA 2IUCA 1FF2A 4ZP7A 4YMEA 5A8KA 1YKWA 5MLCV 1O98A 1WHXA 1WF2A 2YKMA 2HEKA 4ZGAA 1M5OC 3OUYB 1T3NA 1IM4A 2HLTA 4K0KF 3E01B 4WKRA 4DQSA 2DISA 2M8HA 2YX7A 3TI0A 1JJ2R 1RP5A 1VK8A 2Y8YA 2NXNA 1AW0A 2ZJPQ 3BPSP 2HHPA 1QAXA 3HPOA 4KH1B 3M8QB 4IG0B 4AL7A 3KLVA 3ZZRA 3WBHA 5IWAF 3CCES 3Q8RB 1EARA 3WIVA 1S6UA 3ETOA 3HJFA 2IRXA 4HLBA 2YWFA 4DFPA 3HD1A 2HW3A 2R8IA 4J9OA 2Y9HA 1R7IA 1R6YA 3LWMA 1ROFA 1XBWA 4F4WA 4DPWA 2EC2A 1GTHA 2VUGA 1Z4UA 3US5A 1N34J 1RT6B 1P1TA 2BQRA 1HHQA 1N56A 3I82A 4K8RA 5EWFA 1N5TA 2X7IA 1K9MT 2UVVA 2HZCA 3NWGA 1R0BG 3JTOA 4K4UA 2CRLA 3TJ9A 4KHPF 4CH0S 2J8AA 4JI7J 2ZH8A 2WZ1A 3V6DA 1YQHA 5E5NA 1YHQS 1UA1A 2AJ0A 4FYXB 1HNXJ 5EX3A 3RG6A 1JXLA 2GSUA 3KTQA 2J6TA 1RU2A 3K5LA 1JLCA 1DBDA 1S1WB 1NSQA 4EYHB 2RH6A 1H3DA 3GJQB 3KG1A 4USIA 4USVA 5ETVA 5M2RA 1VBZA 4X66F 1JLBA 5I4MA 2CQGA 1SV5A 3UN3A 1E6YB 3LQVA 4X4UA 4P6QA 1HWJA 1SC4B 2DCUB 2DGTA 4X4OA 3LOUA 4XIUA 3U1MA 1U1PA 4C8LA 4PXCA 4TY8B 2MLXA 2D3ZA 3R1LA 3R6LB 4C0BA 3BO4A 3NLCA 2HIYA 3T5LA 3PHEA 4ECXA 2RUSA 5LT5A 3MR5A 4PEOA 2VONA 4FN5A 1CLFA 5IZHA 4DF4A 3DLHA 1EJ7L 2QSWA 2AHOB 2KM8B 1TKTB 1C0TB 1DQ8A 2ACYA 4P2MA 1RBAA 1T05B 2PO4A 2QTWA 1Y7AA 2A6OA 1ELYA 2KRRA 3NS7B 3SDEA 1X4FA 2DK2A 3DHXA 3MMBB 5AE2A 1P1LA 4LF8J 4IQMA 2I0XA 1VR6A 4E0DA 4LF7J 3MK1A 2G1DA 2GIQA 3ZTSA 2JEJA 4I2PB 2ZVIA 2WCXA 2XEXA 3FSXA 4F4ZA 3P6YC 2BVZA 2DHHA 1IKXB 4OYPA 5KT5A 2XY7A 5HVGA 1RTIB 1Y4ZB 3UDCA 3TAPA 1FJCA 2RAQA 1FRXA 1FWKA 1U1RA 4QYZJ 1RADB 2RS8A 4ITSA 3PDNA 4X62F 4UPHA 2VHGA 1LXJA 5DO2A 2R2RA 5EN1A 4EFAC 3IS9A 1ZA2B 5LMNF 1O0PA 3VAJA 3VALA 4F8RA 1D09B 4JI8J 2QJ3A 1MNEA 2CFXA 4DV3F 3OTOF 3EJMA 3IAS9 1RTJA 1SUQB 1FDNA 2BE7D 2RQKA 1NK7A 4P7TA 1VQSA 1RAGB 5I3PA 2K3IA 4A4JA 4QWEA 2DY9A 4YQWA 4M5MA 1X7VA 3AH6A 2ZH2A 2V9WA 2RILA 4A8FA 3V4MA 4LFCJ 2AJ4A 2HAIA 5BYSA 1UPPA 4V19X 3KG4A 4MIAA 9ATCB 4ZG7A 2YKQA 4ZITA 2W1BA 1M5VC 4CO2A 4EBDA 2W5VA 2H4YB 3HULA 3Q3QA 4NLQA 1QSYA 2ZDPA 4ZKAA 2BJ8A 1VQYA 2E1MC 3ISZA 3ZTPA 3BKTA 1UMJA 4J9LA 1HD1A 1FRKA 4CT8A 3W64A 1AUDA 2OAUA 4OV6A 3CJSA 5D0HA 2M4MA 4DSLA 3VQSA 5DLFA 3TUJC 2HHVA 1R6VA 4OYBA 1AB8A 4CO3A 3AD9C 3IP0A 2DNOA 1JJ4A 1QAYA 1KD1T 4LVNP 3IGYB 1S6PA 3J81j 4DR5F 3CW2C 3MEDA 2R7VA 3NXZA 4IFYA 4N47A 4YFUA 4DL4A 5E33A 2ASYA 1R0CB 2ZNYA 3ZXWA 1HIYA 2EFGA 2LVWA 4EMDA 3E01A 3BJYA 3H5XA 1E6VB 4L76A 3R9LA 4O3SA 3IBFB 2B4VA 1VRTA 4BCAA 1IJEB 4QCLA 4WU2A 2CQ2A 5J2PB 2M3DA 5IXUA 4ETZA 3H98A 4GTZA 1S49A 1PJ7A 2OPPA 3A13A 1NZAA 2FIUA 2DIUA 2J9DA 2MZJA 2RIJA 3MM6A 5A2QU 4IQXA 5DLWA 1AZSB 4OYZA 4I0WA 6FD1A 3OL8A 2GV1A 4DUYF 2K2PA 4BC7A 1RK8A 1XTZA 4LRFA 1QVGR 2EW9A 1HW9A 1WORA 3JB9k 3GJRB 3TZXA 1Y3KA 2ADCA 2L41A 3JSMB 2OHDA 2H4WB 1B3TA 2CZ4A 2J5AA 3QT8A 4FVMA 5KT4A 1M1HA 1JK9B 2GIFA 4DL6A 4KQZA 4DN9A 1VRUA 3KJNB 4KGZB 2XGQA 3JXOA 3ZZOA 1RAOA 4AD6A 4I7FA 3KOAA 5DM6Q 5DDRC 2RMLA 5JVHQ 4CXUA 2NQPA 1H72C 2LQBA 2RD5C 2AX0A 4NOHA 2VC1A 2HFNA 3BQ0A 2R8JA 4UPIA 2OPSB 5KFHA 2HVZA 1IQTA 1RSCA 2G2ZA 4R5PA 4NEZA 5D3GB 2AIRB 4M94A 3MAAA 4LT6A 4NLSA 1X4DA 1CJVB 4DV6J 4EZ9A 2IIHA 1PC4A 3HSJA 4R8UB 2H9ZA 1Y10A 1OY9A 2C2KB 3RBXA 4ES1A 2B4PA 2ZHOA 3BDPA 2F4VJ 1N36J 3HHLB 3JYTB 3GCWP 3RB4A 3HVTA 2QL9B 5IM0A 3V5RA 4DR2F 1VISA 4RW6B 1HR0F 2IBKA 3M6UA 4RUCA 2WONA 1WELA 5C2GA 3U7JA 2H5JB 1RDRA 4QW9A 2AEFA 1N6QA 4KB7A 2POKA 3BPDA 1ZAVA 5SUHA 1QSSA 1T9WA 1ZM4A 2X1BA 1TK8A 1KN6A 4WF9Q 1IKYB 1NK0A 1Y0HA 4BLGA 1XR5A 3CEDA 2GA3A 2ZVSA 1RE1B 2V2VA 2Z4PA 2XCPA 3NKMA 1RWKB 2PEBA 4OZJA 2O5DA 3D5MA 3RYLA 2PA8D 3NY0A 3WC0A 2CJQA 5JMNA 4N5SA 4NE9C 3TZZA 3UQSA 3U1NA 5KFPA 4ZPVR 4C6AA 1T9UA 2DNLA 2GC8A 2OEJA 3K59A 3TWZA 3D4JA 1UA0A 4IRDA 4Y34A 1TL5A 5L39A 2JLGA 4IRCA 1HBOA 3BN7A 5HVFA 3TUPA 1AJBA 3NP5A 4CXSA 2AF6A 3TEGA 5LSOA 2QGFB 2RQMA 1L3SA 3OVSA 4I2QA 4PUOB 4KHRA 1ZTWA 2DRBA 1F2GA 3KMQA 4TU9A 4X4PA 2KYXA 3I4HX 3MHYA 3QO9A 3R5BA 3QIDA 1FVSA 2VDIA 5DZ7A 3PR5B 4ZPTR 5C7PA 5KFRA 1UW4A 5LM7E 3JQKA 3AY0A 3PYEA 2VBXA 3R6GB 4LF4J 5KFLA 5CZXA 3R2CJ 1FJGF 1CJUA 3M7VA 2V68A 5GMKa 1CJTA 1CSJA 4I6WA 3C6TA 4NPOA 4TVAB 4BDPA 3FEYB 1JLEA 4FXWA 5LMUJ 5CXTA 4OX9J 3QBCA 4B3RJ 4CCHA 2J8SA 2XNRA 3W8PA 1ZETA 3C6UA 1K1QA 4A8WA 5A2QY 2OPQA 4KHMA 3SCKE 3KK2B 2AKWB 3H8YA 5ADZA 3V6JA 5KT6A 4GC6A 2XRGA 3GJSB 3OW2R 2RKIA 4KV8A 1VIXA 4WFNQ 4USUA 1NRKA 2DXDA 2YTCA 4B9UA 5LIAA 2C3OA 4AQYJ 3Q2SC 4K7QA 2AZ1A 4NWBA 3J80Y 3V4IA 3OD2A 5KFDA 1S79A 3GQCA 3R5AA 3EM1A 1U7LA 2WTFA 2H54B 1ED8A 3N9UC 4JV5J 1Q53A 1JLAA 2I2YA 4FP9A 2EC0A 2H51B 3MR3A 4K4YA 2ZWOA 3T1YJ 1T0TV 2VPXB 2DT9A 3OXFA 5A0YB 1VQMS 2QL5B 2HQCA 4HEA9 5ETOA 4DJBA 4ECQA 5J2NA 1K0TA 5HN0A 4RUAA 3NKRA 3CWJA 3D6HB 3D0HE 4Y28C 1VBYA 4FKYA 4P74A 5DG7A 3MM5B 2K7KA 3RRGA 4FF3A 2XSJA 3QGGA 4JI4F 1FD8A 2OPPB 1V5VA 3SV3A 2HNDA 3EVOA 5HROA 1XNQJ 1EI6A 1B70B 2EFQA 2MMYA 2NXCA 3CDWA 1HBMA 3HZGA 3MMAA 4U7UD 1WC1A 2KH9A 3PW2A 5DGBA 3HVTB 1X4HA 2QSFA 3BYPA 4DPUA 2ASJA 3HM9A 2HYIB 4F25A 3NNHA 5HMXA 2FDNA 2BJDA 2CAJA 1AUSL 4AUKA 2CNOB 5AE3A 4URGA 1TUGB 4LBIA 5DDOC 1YJTA 2MKIA 2CQ1A 3NL0A 1Y5NB 3AD7C 3QLHB 2J9CA 4RBVA 4F3OA 4I69A 3DDKA 2V2QA 2ZD1B 2VODA 5L38A 2GGPB 3M9OB 1T3OA 3OR2B 5CCLA 1IKWA 4D3HA 2M88A 2KFZA 4C0OC 3QZ7A 2EEYA 4OHVA 2HQDA 2QYGA 1TL4A 3HZEA 4JBCA 4LF9F 5D3GA 4RZRA 1OSDA 2XHWA 2HVDA 5DLVA 2Z58B 1X5TA 4OX8A 3M8PA 2RDJA 3VV2B 2HRYA 1UVKA 3B6BA 1RT2A 4JB8B 4C11A 2OTJS 2XGPA 5D4LA 5HMYA 4Q43A 3QLHA 2KT3A 4HDGA 1D8ZA 4WCEQ 2W9BB 5GMDA 3CCJS 3ENWA 5J1NA 4X2BA 3VGSA 1Y7PA 3CCRS 2HLUA 2KB2A 2HNZB 3MPUB 2VG5A 2YH1A 1F1BB 5DZ6A 3X3UA 3HLUA 3OFEA 2QMWA 2R2SA 1YTYA 1D8YA 5I42A 3H5UA 5HATA 1ZTTA 5CYQA 4DFKA 2HFVA 3AB4B 1HMVA 1U2CA 3UFCX 3MTKA 3T1HJ 2IHR1 4BC9A 1MW7A 3H0PA 4CLYA 4TNOA 3HSZA 3B82A 4OQJA 4F3MA 3KLGB 2NREA 2R7TA 4CWBA 2MEWA 1BWVA 2D9PA 2HQIA 1X4CA 2QN6B 3MM6B 4QWDA 2OMOA 3TRGA 4EEYA 2CQCA 3DOKA 5HL7Q 1N54B 1KQSR 2CQ0A 5HSPA 3CULA 5B0FA 2E5LJ 2DNPA 3WQPA 4CXKA 1HNVB 1IR2A 3I87A 3QATA 2ASDA 4GO5X 1C4CA 1R89A 2WSFC 2FVRA 3N5BA 2UXCF 2V67A 1KH9A 4K5RA 1JXVA 2G0CA 3S1TA 3VGVA 2BW2A 4M5KA 5F8IA 4AXIA 2M0GB 3KLIB 3TYTA 2LMIA 3MECB 2YNGA 4WXWA 3J7A1 1GTEA 4IO1A 2D3UA 2KT2A 4PCQA 2DRDA 2QEXS 2MKKA 2E7XA 3IC1A 3MWBA 4PYDA 3B8HA 4QIVA 1VBKA 4PXEA 4RWWA 4JI0F 4P2SA 3UVJA 5A6PA 3I0RA 4YR3A 2A0FB 2VQFJ 2AGOA 3Q8YA 3V81B 1VMBA 5CD4A 3H20A 4USMA 3MAAB 2DXFA 3IWNC 5HP1B 4RU2A 2NLWA 4ALZA 1P8GA 3NGDA 1HNWF 1HJKA 1WI8A 4ZG6A 1F9EB 2VJVA 4DUTA 3PM9A 5IJQA 1LW0B 1FXLA 4LSLB 1U48A 3GV7B 3RAMA 2FJBB 4XDCA 1NO8A 1YITS 1KOOA 2PMHA 4ATNA 1XJWB 2QX0A 2HIQA 2DBBA 4QIFA 1SPBP 4UPLA 1HI8A 2C2NA 1KHWA 1BE4A 1MG7A 2XSFA 4RNHA 1F5CA 1FO1A 4B17A 5F3ZA 5KAKA 1Q82T 1NDKA 3MUVP 2XMKA 1TMJA 2ZD1A 4CNZA 3SXLA 1JJHA 2RJZA 3DHWC 4EZ6A 4NXMF 3TVYA 1FFSB 4USHA 1IKWB 1BQMA 1WEZA 4CO0A 2VPZB 3K7RA 3IN5A 2DHGA 2FLNA 1ALHA 3LP2B 2CQ4A 1RAHB 2C2OB 5DQHA 1KH7A 1O99A 3F44A 3FZ2A 3GP9A 4GKKJ 3PNIA 2G1HA 4C9DA 3EXYA 2YY3A 5CD4H 2NS1B 4V1Ak 2KXHA 2FQQB 2HURA 3LW5C 1NHUA 2X3DA 3PRDA 1S48A 4LSLA 3PKMA 3FSYA 4S0MA 3M05A 1TAQA 3H2LA 3P45B 3OL6A 2E9RX 1K73T 4CYSA 2I5JA 5ETSA 3BDEA 2HBZB 2IM2A 2JVOA 3EGWB 2AZ3A 2QLXA 4Q5VA 3SV4A 1TK5A 5C25B 2MDAA 3IA0A 1CS4A 1IN0A 2R9LA 1JKHB 4ED7A 1CVJA 3R5DA 4FYWB 2PN6A 3HX9A 4I6YA 4TU8A 3GFZA 5KG5A 4CO4A 1F6TA 1YX2A 3P5BP 3K5PA 5A0YA 2XY6A 2RF2A 4UOHA 3HVRA 1HNIA 3AQPA 4M5HA 3S8SA 4F04B 2QE5A 4ZK7M 4OV1A 4B9SA 1PC5A 3MCOA 4NLUA 2OJ3A 1IJFB 3OL9A 1CEZA 5D0EA 2Q6BA 3TP2A 2UUBF 1UW9A 4FPRA 3DGPA 4OZ2A 1GT8A 3NGTA 2NPFA 1SJ1A 4YY3J 3FBCA 3PY8A 5L1JA 2QG9B 4ZLJA 4FS2A 4Y2MA 2FHKA 2UUCJ 4QJVA 4KT0C 2DTJA 3TX0A 1FWPA 1NH7A 2DEIA 3ILOA 4PPDA 3LP1B 2F63A 4J5OA 5THWA 3JSRA 5CQGA 1RT6A 2P5VA 3FUYA 1A7GE 5A8WA 4CTAB 2X98A 2RF2B 2RSQA 2M5YA
chains in the Genus database with same CATH topology
4LR7A 3DYCA 2W5RA 3UO0A 1FSUA 1HQAA 3NKNA 4NWJA 5INHA 2W5TA 2IFYA 3TWZA 1URAA 3BDFA 4UORA 1AJBA 4CXSA 3NKQA 1ZEBA 5L0BA 3T00A 5KXAA 3UN5A 4N7TA 4ZG7A 2ANHA 2W5SA 1AJAA 3NKOA 2W5VA 4LRAA 1ANJA 1KHNA 2ZKTA 3Q3QA 4MY4A 5EGHA 3BDHA 4CXKA 1KHJA 4FDJA 1ED9A 1EW8A 2IUCA 1O98A 5DLTA 1ZEFA 2G9YA 3WAXA 5C66A 3M7VA 1KH9A 4ZGAA 1KHKA 4TN0A 3WAVA 5GOVA 1AJCA 4KAYA 3WAYA 1E33P 2VQRA 2XRGA 3IGYB 1HDHA 3MK2A 5IJSA 5HRTA 5TJ3A 3OT9A 4GTWA 3WBHA 4ZG9A 5L0KA 5LIAA 4UOOA 3IDDA 3NKPA 1EW9A 2W5XA 1HJKA 2QZUA 4ZG6A 5L0EA 1ED8A 3M8YA 5IJQA 4MHXA 4CYRA 4KAVA 4GTZA 3SZZA 4KJDA 1K7HA 5DLWA 4UPLA 3MK0A 1AUKA 2GSNA 3UN3A 3NKRA 4LRFA 3A52A 4QAXA 1P49A 4B56A 1ALIA 2GSUA 4UOPA 3M8ZA 1EQJA 4KM4A 4NWXA 1EW2A 2W5QA 1N2KA 1KH4A 1AJDA 2RH6A 1ALHA 3BDGA 1SHNA 3DPCA 1EI6A 1KH7A 1O99A 3IGZB 3UNYA 4CXUA 5GRRA 2IUCB 3KD8A 3E2DA 3T02A 1B8JA 1KHLA 5K4PA 2W8SA 4UPIA 4YR1A 3M8WA 4CYSA 1ANIA 1E1ZP 1Y6VA 5LRMA 1E3CP 4LQYA 5LQQA 5AJ9A 1ALJA 1ALKA 4LR9A 4LRBA 5EGEA 3T01A 2GSOA 3WAWA 1Y7AA 1ELYA 3B5QA 5LRNA 4LRCA 1ELZA 1E2SP 3ED4A 3NVLA 1N2LA 3MK1A 3TG0A 4GTXA 4LR8A 3CMRA 4LR2A 1ZEDA 1URBA 1KH5A 4LREA 2W5WA 2W8DA 5DLVA 1SHQA 4UPHA 2D1GA 2XR9A 4KJGA 3TX0A 3LXQA 2GA3A 1EJJA 2GLQA 4GTYA 1ELXA 4MIVA 3NKMA 3UN2A 4UPKA 3SZYA 4FDIA 2X98A 3BDGB 4LRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LR7 A;  3DYC A;  2W5R A;  3UO0 A;  1FSU A;  1HQA A;  3NKN A;  4NWJ A;  5INH A;  2W5T A;  2IFY A;  3TWZ A;  1URA A;  3BDF A;  4UOR A;  1AJB A;  4CXS A;  3NKQ A;  1ZEB A;  5L0B A;  3T00 A;  5KXA A;  3UN5 A;  4N7T A;  4ZG7 A;  2ANH A;  2W5S A;  1AJA A;  3NKO A;  2W5V A;  4LRA A;  1ANJ A;  1KHN A;  2ZKT A;  3Q3Q A;  4MY4 A;  5EGH A;  3BDH A;  4CXK A;  1KHJ A;  4FDJ A;  1ED9 A;  1EW8 A;  2IUC A;  1O98 A;  5DLT A;  1ZEF A;  2G9Y A;  3WAX A;  5C66 A;  3M7V A;  1KH9 A;  4ZGA A;  1KHK A;  4TN0 A;  3WAV A;  5GOV A;  1AJC A;  4KAY A;  3WAY A;  1E33 P;  2VQR A;  2XRG A;  3IGY B;  1HDH A;  3MK2 A;  5IJS A;  5HRT A;  5TJ3 A;  3OT9 A;  4GTW A;  3WBH A;  4ZG9 A;  5L0K A;  5LIA A;  4UOO A;  3IDD A;  3NKP A;  1EW9 A;  2W5X A;  1HJK A;  2QZU A;  4ZG6 A;  5L0E A;  1ED8 A;  3M8Y A;  5IJQ A;  4MHX A;  4CYR A;  4KAV A;  4GTZ A;  3SZZ A;  4KJD A;  1K7H A;  5DLW A;  4UPL A;  3MK0 A;  1AUK A;  2GSN A;  3UN3 A;  3NKR A;  4LRF A;  3A52 A;  4QAX A;  1P49 A;  4B56 A;  1ALI A;  2GSU A;  4UOP A;  3M8Z A;  1EQJ A;  4KM4 A;  4NWX A;  1EW2 A;  2W5Q A;  1N2K A;  1KH4 A;  1AJD A;  2RH6 A;  1ALH A;  3BDG A;  1SHN A;  3DPC A;  1EI6 A;  1KH7 A;  1O99 A;  3IGZ B;  3UNY A;  4CXU A;  5GRR A;  2IUC B;  3KD8 A;  3E2D A;  3T02 A;  1B8J A;  1KHL A;  5K4P A;  2W8S A;  4UPI A;  4YR1 A;  3M8W A;  4CYS A;  1ANI A;  1E1Z P;  1Y6V A;  5LRM A;  1E3C P;  4LQY A;  5LQQ A;  5AJ9 A;  1ALJ A;  1ALK A;  4LR9 A;  4LRB A;  5EGE A;  3T01 A;  2GSO A;  3WAW A;  1Y7A A;  1ELY A;  3B5Q A;  5LRN A;  4LRC A;  1ELZ A;  1E2S P;  3ED4 A;  3NVL A;  1N2L A;  3MK1 A;  3TG0 A;  4GTX A;  4LR8 A;  3CMR A;  4LR2 A;  1ZED A;  1URB A;  1KH5 A;  4LRE A;  2W5W A;  2W8D A;  5DLV A;  1SHQ A;  4UPH A;  2D1G A;  2XR9 A;  4KJG A;  3TX0 A;  3LXQ A;  2GA3 A;  1EJJ A;  2GLQ A;  4GTY A;  1ELX A;  4MIV A;  3NKM A;  3UN2 A;  4UPK A;  3SZY A;  4FDI A;  2X98 A;  3BDG B;  4LRD A; 
#chains in the Genus database with same CATH topology
 4F3Q A;  3I5A A;  3RR8 A;  2LU1 A;  4F2S A;  2KG0 A;  1SB6 A;  1YWX A;  2FZC B;  2KVQ E;  2JJ4 D;  1HHS A;  2Q3P A;  2XYH B;  5F8N A;  4F4A A;  2CJK A;  2KJW A;  2BW7 A;  4LMZ A;  2IFY A;  2LEC A;  4RNM A;  2IJF A;  5I42 B;  2QT7 A;  1QD1 A;  3EWG A;  2Q1L A;  3CIM A;  5KFI A;  3BO2 A;  3I55 S;  3KXD A;  3SZ2 A;  1U24 A;  4CZC A;  2ZE2 B;  1RWX B;  2OIH A;  4MJK A;  1JLB B;  3WZ0 A;  5J1E B;  5IS2 A;  1FKP B;  3VAM A;  4B9V A;  1VC5 A;  4OX6 A;  2RVJ A;  2KKH A;  2DD8 S;  1OMS A;  2N7C A;  1ED9 A;  3LP1 A;  2LP4 A;  1S7H A;  3HK2 A;  1LW0 A;  1BUX A;  1Q1K A;  1F3V A;  1GXT A;  1LK7 A;  2VF3 A;  5GME A;  3TNV A;  4IOC Q;  3PW0 A;  4FF2 A;  2V8V A;  1F9F A;  3WAV A;  3N6M A;  4Z2X A;  1ZAX A;  4IKA A;  3W5Y A;  2E5G A;  4ZMM A;  5L1K A;  4DLE A;  2FJV A;  3IM9 A;  4LF5 J;  2W25 A;  2X1F A;  4RL1 A;  3QYY A;  2GVZ A;  4P73 A;  3RUB L;  4A8Q A;  1DY3 A;  5IJS A;  2OEM A;  2QFJ A;  3OFF A;  5E7O B;  1B0V A;  1S9E B;  3NWR A;  2FLP A;  2C2R A;  3LP2 A;  1KBR A;  4F67 A;  2C2D A;  3HMJ G;  1CJK A;  4KYZ A;  2IA6 A;  1WHW A;  4ZP6 A;  1B7F A;  2BYC A;  3ITH A;  4HKQ A;  3SCL E;  5KFT A;  4B3O B;  4IG0 A;  1N34 F;  2G0I A;  3NG8 A;  4QPT A;  2XG8 A;  4RW9 B;  3ZO7 A;  2MGZ B;  2DPJ A;  4NCB A;  2Y1J A;  4IOB A;  3UW1 A;  1UZD A;  4J7C A;  4N56 A;  3SFG A;  3EE3 A;  6FDR A;  2W8K A;  4YB5 A;  2DR6 A;  1M90 T;  4B9T A;  3PX6 A;  4ERD A;  2E7V A;  3LA0 A;  4F4K A;  5DET A;  3QJJ A;  2DIT A;  4KHP J;  1LWE A;  1UWA A;  4JI7 F;  4CO1 A;  3PRV A;  3QT7 A;  4KO0 A;  2MSS A;  5KG4 A;  1M5H A;  1MWY A;  4U9R A;  1UVJ A;  2BZ2 A;  3V2U C;  3HP6 A;  1HYS A;  1J5E F;  2PDA A;  3HO1 A;  3BSN A;  3SDE B;  2DHS A;  1NB2 A;  4O3R A;  5T41 A;  2XYP B;  3VHQ A;  1UAW A;  1HWU A;  2DHX A;  3UD3 P;  1T7P A;  4C48 A;  3O5T B;  4NI2 A;  2LQ5 A;  5KT3 A;  4EYI B;  3QRR A;  1N0U A;  4YB6 A;  5EHH A;  3EYZ A;  2PE8 A;  2W8S A;  1RWP B;  3KNA A;  1Y6V A;  2YBV A;  4CO5 A;  4PXB A;  7FDR A;  1LW2 A;  1YK9 A;  2Z2Y B;  5HBM A;  4DDF A;  2ZHA A;  2GVD B;  2FPH X;  2FYX A;  4OI3 A;  4DR6 J;  3R97 A;  4CT9 A;  3AXM A;  1WG5 A;  3A3N B;  3UCU P;  2RS2 A;  3PX0 A;  1QM9 A;  1BQN A;  1T11 A;  1REG X;  3C14 B;  3D7S B;  3L95 X;  3MDF A;  1PSD A;  3I0S A;  4Y2C A;  3PZP A;  3MAH A;  1RTJ B;  5RUB A;  3NVL A;  2YKO A;  1DLO A;  3H90 A;  5KFZ A;  4GTX A;  2P9G A;  2V8H A;  3ZZU A;  1U1Q A;  1OO0 B;  5D8H B;  2DNH A;  1HBU A;  4DR4 J;  1RBL A;  1LQ9 A;  1A9N B;  1URB A;  2W01 A;  2ZOM A;  3Q8V A;  1VQ6 S;  2OPS A;  4C8O A;  2B51 A;  3MPD A;  3C6T B;  3U02 A;  4ED2 A;  3OFG A;  1NK9 A;  4LRE A;  4C8M A;  7FD1 A;  5LOQ A;  3FK4 A;  3C6U B;  4X62 J;  2XS2 A;  4GMK A;  1URN A;  4MMO A;  2EWH A;  2MKS A;  1U2F A;  1FKP A;  1PO6 A;  4C8K A;  2KXF A;  5LMN J;  2YWE A;  1EJJ A;  1KQG B;  1UZH A;  3OV7 A;  3D28 A;  4JI8 F;  2V4R A;  1SH0 A;  1U09 A;  4DV3 J;  1RHK B;  5ETP A;  4LR7 A;  1B64 A;  4GRS A;  3PO5 A;  1DQA A;  2U1A A;  4WFZ A;  3CCW A;  2DNZ A;  2B6A A;  5IV3 A;  4ED8 A;  5INH A;  2VOO A;  3AB2 B;  1OY8 A;  4O0N A;  1FKO A;  1NAQ A;  1UWB A;  2O1P A;  4ZIV A;  1UJ4 A;  2FGC A;  3HSG A;  2WSE C;  2MPU A;  4Q2M A;  5A8W B;  1U1L A;  4DX7 A;  4CIO A;  2R8H A;  1SIZ A;  3T02 A;  3NGK A;  5ETN A;  4M5J A;  1WC3 A;  2GHP A;  3CO9 A;  3DXB A;  5GAH U;  1IBM F;  4ZCM A;  1RAA B;  2IYG A;  1YBA A;  4WFA Q;  3KLF B;  3MFI A;  4FDJ A;  4DUZ J;  1APS A;  4RW7 B;  2P8I A;  4B3O A;  2LEP A;  2IDE A;  1S1V B;  5KG0 A;  4MKY A;  2XS7 A;  5GOV A;  3OTC A;  3UE2 A;  5AJ3 J;  3DKD A;  4FNI A;  4P71 A;  4Q2L A;  1B0T A;  2GQC A;  2IPO B;  3WAY A;  2BE2 A;  3THP A;  2W7P A;  3F41 A;  5A8K B;  3UDE A;  1O51 A;  2VPY B;  4G1Q B;  3MR2 A;  3G6X A;  4DR5 J;  1F5B A;  2B9X A;  3V6H A;  3K0J A;  2DGS A;  4LSZ B;  3BGL A;  1S77 D;  2AQ4 A;  5L0K A;  3PXG a;  4XTT A;  2ZBP A;  4JV1 A;  4JYA F;  2GMJ A;  1QDU B;  3AT1 B;  4ZPB A;  4OHX A;  1EW9 A;  4WTY A;  1LWC A;  1AXQ A;  1CS4 B;  4DQI A;  2DY1 A;  3D2W A;  1TVR A;  2PD1 A;  4O44 A;  4M5D A;  2PFD A;  4W4M A;  4DX6 A;  3K5N A;  1CJU B;  4B3T J;  4KAV A;  4J91 A;  4WIQ A;  4OYA A;  2VQE J;  2HHU A;  1Q0N A;  1U0H A;  4U8Y A;  3PR4 A;  5I3U A;  2GS8 A;  2OD6 A;  4DUY J;  3KLH A;  4J9S A;  3CJ8 A;  1E6V A;  1RIS A;  1O6X A;  4PWW A;  2C3M A;  2LQ8 A;  4C11 B;  3LTO A;  5DM7 Q;  3DOL B;  1VFJ A;  3M8Z A;  3T9Z A;  4YS2 A;  3CJ5 A;  4HI1 A;  2EXU A;  1FEE A;  4F4Y A;  4NAS A;  2A10 A;  4NL5 A;  2KZZ A;  1N2K A;  1YJR A;  2N4D A;  3JAM Y;  5HJY A;  2UU9 F;  4DPY A;  3N79 A;  4QR1 A;  1WEY A;  1VBX A;  4OI6 A;  1DLO B;  2V2Z A;  3FRY A;  4MIW A;  4UOF A;  2B4O A;  4BWM A;  4DZD A;  1IBK F;  5K9F A;  1QAI A;  4C4W A;  2BRK A;  1WHY A;  2VC0 A;  2V50 A;  3C66 A;  1GH8 A;  4KBI A;  1ZS6 A;  4GC7 A;  2RE1 A;  3DGV A;  3T1H F;  4CRJ A;  1S72 S;  2F4V F;  1YJW S;  4I2Q B;  4F26 A;  3G8T A;  4HVZ A;  2E5J A;  1E6Y A;  2UUT A;  2VAS A;  3FQL A;  1Q8L A;  1TV6 B;  4NZ6 A;  2AJ1 A;  5HMW A;  1NEE A;  5L46 A;  4I64 A;  3GYN A;  3EVM A;  2DVI A;  3T01 A;  4M5I A;  4DS4 A;  3OLB A;  3PRB A;  2DNG A;  1KOH A;  3LP0 A;  1IBL F;  3RR7 A;  2LXI A;  1DQ9 A;  3DOK B;  3MMC B;  2N3O A;  2ZE2 A;  1N36 F;  2VV5 A;  3CC4 S;  3DDN A;  3PIP Q;  3G6Y A;  2BE9 B;  1LV5 A;  3GTY X;  2M70 A;  2OD4 A;  5G0R A;  4ZLL A;  3K17 A;  4DSF A;  1KON A;  3D66 A;  4O3P A;  3G96 A;  2JFK A;  3H2V E;  2ZKU A;  4ED1 A;  3MMJ A;  4UY8 T;  1SQE A;  2FB0 A;  4NLP A;  2AGP A;  3PHT A;  3IR6 B;  4KSE B;  5DQI A;  2FUG 9;  5FDL A;  1KKH A;  3KLI A;  5MAO A;  4LIR A;  4QZV B;  4NLX A;  3ZFV A;  2XR9 A;  1X5S A;  2A2D A;  2OPR A;  2FJX A;  2RRA A;  2NSC A;  3HT0 A;  4U8V A;  2FZG B;  1P27 B;  2F9D A;  1UEV A;  3NRB A;  3UN2 A;  4NXN J;  1C2P A;  3GYX B;  5CYM A;  1S1U A;  3K5M A;  3BDG B;  1VS3 A;  1ELO A;  1R3N A;  1S6Q A;  4PZV A;  3ZTR A;  2FZK B;  1WC4 A;  2HGL A;  1LW2 B;  4OZ5 A;  1CJK B;  2WW8 A;  5C2C A;  3DM2 A;  5F8H A;  3HFK A;  3THT A;  3FC9 A;  3GMG A;  1URA A;  3KFW X;  3DDI A;  1UEK A;  3FZB A;  3QPI A;  2BXJ A;  4Z37 A;  5E3P A;  3OSP A;  4B9L A;  5J2Q B;  5EWG A;  2OSQ A;  4DQP A;  4L3K A;  1U25 A;  5KG3 A;  1NKC A;  2Y0S D;  2U2F A;  4OYM A;  1Z2L A;  2IJR A;  4RBU A;  4EUV A;  1ZEB A;  2CYY A;  2O66 A;  4DSJ A;  5ETK A;  4DMZ A;  1TEL A;  4UZB A;  3NKY A;  2ANH A;  2RDI A;  1F2H A;  3TJ8 A;  3UNG C;  3NKO A;  5EGH A;  1S9G A;  4Y65 A;  1Q8K A;  3VF0 B;  1ANJ A;  3OBI A;  4RUB A;  4O4G B;  1LWC B;  3GSI A;  4B3M J;  4X4N A;  4PXD A;  1OQ3 A;  3CD5 A;  4ECZ A;  1X4A A;  3HHK A;  3M9M B;  2HKE A;  3WAX A;  3G82 A;  1TTH B;  1S6Q B;  2KM8 C;  2UXB F;  3N28 A;  1DJ0 A;  4B3R F;  3MM8 A;  5LMU F;  2Y1R I;  3CXC R;  3BBB A;  3W9H A;  4RJV A;  3CJQ A;  3DM2 B;  4YEA A;  1RTH A;  3A3O B;  1YJN S;  3KLH B;  4LF6 J;  2DGV A;  2OP5 A;  2JNJ A;  3KHL A;  1IWG A;  4NI2 B;  1S0V A;  4LVO P;  1WDD A;  1R8A A;  3CDE A;  3HFV A;  1RTI A;  1SVD A;  1YDL A;  3TEH B;  3MD3 A;  4USJ C;  4NA1 A;  1S1V A;  1XQI A;  4K4T A;  1VRQ C;  1G4C A;  3C15 A;  1HLW A;  2YPY A;  3P96 A;  4AQY F;  2FVQ A;  4NCA A;  3LO3 A;  1PJ6 A;  2E9Z A;  4EBE A;  4KGX B;  1JQG A;  3RBZ A;  2PI4 A;  5FLX U;  4KPY A;  2COL A;  3L3C A;  2CWK A;  5HVH A;  4KGV B;  1ITP A;  2G2Y A;  3B54 A;  3SFU A;  3UI3 A;  3RBE A;  2BQ3 A;  3CT9 A;  3PYF A;  2FHJ A;  3T1Y F;  5K8M A;  2XZW A;  5DG9 A;  2LKZ A;  2XMA A;  5H9E K;  3EIC A;  1RTH B;  1NJZ A;  1CC8 A;  2ZH9 A;  1FX2 A;  2J0X A;  1ALI A;  4IDK B;  1IKX A;  3VZH A;  5J2P A;  3AOA A;  3SQG B;  2MTL A;  3I0R B;  1WUU A;  3SCJ E;  5M2U A;  3LPE A;  1SL1 A;  4JI4 J;  2CPF A;  2O67 A;  2Z2M A;  2W2O P;  4DU8 A;  1Y9O A;  3UR0 A;  3VAG A;  3DPC A;  5KFW A;  2EK6 A;  2I8E A;  1WWH A;  2YWH A;  3M30 B;  3IGZ B;  3UPF A;  3W60 A;  4DHV A;  5GRR A;  2ZH4 A;  2VU5 A;  2X51 A;  3OTB A;  2ZUA A;  2AP6 A;  2XSJ B;  4GKJ F;  2ROE A;  1Z1Z A;  1UEU A;  3BN4 A;  3QFW A;  4HAC B;  3AHP A;  4LFA J;  1KQK A;  3BSO A;  3L4B C;  3IG1 A;  3QSI A;  2AYB A;  2OH2 A;  2XMJ A;  2AV5 A;  1SJQ A;  2QYC A;  4J9V A;  3R8Y A;  1RKI A;  3TA2 A;  4U95 A;  5B08 A;  2VFU A;  4O23 A;  1QLN A;  1KLN A;  4OL8 A;  3MED B;  3DMJ B;  1HWK A;  3N6N A;  4A8X A;  1ZM2 A;  2JEG A;  2V94 A;  4F7V A;  4WP9 A;  4OI4 A;  1U0H B;  2MY8 A;  4M63 A;  4Y2I A;  4BHQ A;  4F4X A;  4Q8F A;  1E2S P;  4X4T A;  4LF9 J;  4UQT A;  1M5K C;  1N2L A;  1DTQ B;  1UJ6 A;  2IRY A;  1WHV A;  2MHE A;  1URR A;  3VGU A;  1ZOT A;  4U7C A;  2QIF A;  2GQ2 A;  3NAH A;  4KR0 B;  1D9A A;  1TL7 A;  3FVY A;  1XMO J;  1N0V C;  1U2R A;  2JL9 A;  4MKV A;  1PG5 B;  2RU3 A;  4NLW A;  2RQ4 A;  1ZH5 A;  3PVX A;  2W5W A;  2BBE A;  1JNZ B;  3NMR A;  3LAL A;  5JVG Q;  5DRK A;  4K4W A;  4JI2 J;  1X8D A;  2JLE A;  2PA3 A;  1NSP A;  1RT5 B;  2Z2Z A;  4Q45 A;  4NYZ A;  2WRM A;  3I96 A;  4LSN B;  1VQO S;  2AJF E;  1WI6 A;  2MST A;  2MQ8 A;  3Q83 A;  3BGO P;  3KDN A;  4OJG A;  2KN4 A;  2L3M A;  1KLM A;  1CUL B;  1S1T A;  3GWC A;  3MPW A;  1R8B A;  1WC5 A;  2FC9 A;  3A12 A;  3QNW B;  2YVS A;  4NLO A;  1WC0 A;  4C97 A;  5AE1 A;  1X31 C;  1WKK A;  2QZ8 A;  2V69 A;  3KKF A;  4GVB A;  4ZCK A;  4AYB D;  4DV5 F;  2ASL A;  4K2J A;  3CME S;  2PFF B;  5KXA A;  3KHG A;  3AOC A;  2L9N A;  1Z2Z A;  2NUH A;  2C42 A;  3IBW A;  2VG6 B;  3M2R A;  5HO4 A;  2R2T A;  5AXM A;  3P49 B;  1N33 J;  1P6T A;  3F0N A;  4HTI A;  1KHJ A;  1FA0 A;  2WVD A;  1KVI A;  4DL7 A;  2HFS A;  2AEJ A;  4J9Q A;  2PGC A;  5J2Q A;  1U6Z A;  1EET B;  2CNL B;  4DV4 J;  1TR0 A;  2VFV A;  4G1P A;  1M5P C;  2AYE A;  2CJA A;  1EQ0 A;  3A8K A;  1KHK A;  3G87 A;  3GG1 A;  4ZIW A;  2HBY B;  5IT9 Y;  1KLM B;  2UV8 G;  2YWW A;  4MKA A;  3OQ2 A;  2LCW A;  3Q86 A;  3DRP A;  4N8N A;  4OI0 A;  2ILZ A;  3MK2 A;  5HRT A;  4JI0 J;  4JV5 F;  2BX6 A;  2F8M A;  5TJ3 A;  2VQF F;  5LJ5 Y;  3MEG A;  4M95 A;  2OEK A;  2B8Q A;  1RWV B;  4UOO A;  2E1R A;  2WK4 A;  4Q8E A;  1QE1 A;  3DCA A;  3PTW A;  1FDD A;  2WW4 A;  4TYA A;  4ED0 A;  1DZ5 A;  2R7X A;  2CJX B;  2HFZ A;  3ELH A;  3GB0 A;  3O6Q A;  1WJ9 A;  4LF2 A;  3UWT A;  1RTZ A;  3KK2 A;  4DSE A;  2CAD A;  1D0E A;  4DWI A;  2MY7 A;  3M8Y A;  4MHX A;  4C2M A;  5L0E A;  1BD6 A;  4RR5 A;  4H4M B;  2CWX A;  2RKI B;  4KV8 B;  5IQQ A;  4L74 A;  4ZN3 A;  2KVI A;  1Y5L B;  4IR9 A;  1FE4 A;  4KJD A;  4JI5 F;  3C15 B;  4HAC A;  1X5O A;  2Z30 B;  4Q7A A;  3MFH A;  5LXR A;  4G65 A;  1P9Q C;  4PAB A;  3KLE B;  4QAX A;  5IFM A;  2YX1 A;  1TKD A;  2YNI A;  5KOX A;  3VTI A;  2EFP A;  2W4D A;  3ZNJ 1;  3HVA A;  3BS9 A;  3CMQ A;  2XBP A;  3DN9 A;  3JQJ A;  5FDL B;  5CZV A;  2V2K A;  1KH4 A;  1FK9 B;  1U0S A;  3DYA B;  5K8O A;  3QO9 B;  4GKK F;  2PII A;  4ZJO A;  3PFO A;  1SIW B;  4KE5 A;  2NPI A;  2EFO A;  1NJI T;  2XLI A;  2BA9 A;  3BSA A;  3NBP B;  4H4M A;  4ES3 A;  4RNN A;  3KD8 A;  1VGY A;  5U47 A;  3FBF A;  2MJU A;  3T3F A;  3PO4 A;  1O8B A;  3LGN A;  2D1C A;  4DSK A;  2F4F A;  3THV A;  1RJJ A;  1FX4 A;  2XLK A;  3CJT A;  1T9T A;  5D0G A;  1G7C B;  3D68 A;  3I56 S;  3M8S A;  1IUJ A;  3GFX A;  1S7I A;  3T5K A;  4LQY A;  2MJN A;  4I6A A;  2B7C B;  3GJT B;  2KRB A;  4KO0 B;  3O2I A;  4URS A;  2ZH5 A;  4HYK A;  1KSP A;  3M1V A;  2J0Q D;  5GAG I;  1ZAW A;  2CDR B;  4ETX A;  3Q0A A;  4KFB B;  5H9F K;  2DYA A;  2AD9 A;  4C8Y A;  2ALY B;  3UDL A;  4AE5 A;  3CD6 S;  1MWQ A;  1FK9 A;  2KTQ A;  3MAQ A;  4DPX A;  3BZQ A;  2CNN B;  3A8I A;  3GR1 A;  3H59 A;  2SXL A;  2F40 A;  3DNC A;  2AYG A;  1XIQ A;  4L6V 3;  2GA7 A;  1K44 A;  3C16 B;  4DX5 A;  1HQ2 A;  3TR5 A;  3DRX A;  3TZW A;  5KFQ A;  4ECV A;  4RW7 A;  2VDH A;  5DJB A;  1SI9 A;  2IFX A;  3POT A;  2A1B A;  2GCF A;  2UUA F;  3K89 A;  3T6B A;  4QOT A;  1FEH A;  2FJW A;  4YY3 F;  1ICE B;  4NLT A;  4ECS A;  2FLO A;  3L9Z A;  3LAN A;  3EXC X;  3VWS A;  1C1C A;  3QWU A;  4OFZ A;  1KNZ A;  2XZT B;  3MEE A;  2UUC F;  3LAK A;  1VJW A;  1U49 A;  4LUB A;  4OYI A;  3W2V B;  1RT3 A;  4WPA A;  1KDN A;  2OO4 A;  2IM0 A;  1XWL A;  1XNR J;  2VFT A;  4D3G A;  4UPK A;  3TQE A;  3I9V 9;  3SSS A;  2R8K A;  4LRD A;  1I94 F;  1XNR F;  4OZN A;  1QAJ A;  1FFW B;  3IRX A;  2VQE F;  5SZT A;  2BAC A;  3DU6 A;  2LEA A;  4P9S A;  2FGO A;  2HS4 A;  3OLA A;  2NCK L;  1Q79 A;  4Y00 A;  4MFB B;  4WJB A;  4OHZ A;  1DFD A;  1JLA B;  4KIA A;  2F8E X;  1Q5V A;  5GAH I;  1S9F A;  3FQK A;  3M6W A;  3TZY A;  3D6M B;  4WP3 A;  2CPY A;  5DG8 A;  1JLG B;  3W7B A;  4ZVU B;  2APO A;  2FTR A;  1H2V Z;  3W2W A;  5C42 B;  2FLL A;  1TKZ B;  3GCX P;  1RAF B;  5KG6 A;  1RAE B;  2JEF A;  3W2V A;  5E2Q A;  3B4M A;  1UJ5 A;  3ILJ A;  3EX7 B;  3DLL Q;  1JNR B;  5T7L A;  1ZM9 A;  1N48 A;  5KFV A;  5C66 A;  4UUX A;  2KYZ A;  2JDJ A;  2OSR A;  2XY5 A;  3G86 A;  2V0N A;  1TL7 B;  2OLW A;  3CC7 S;  3I32 A;  2D9O A;  1GXU A;  1HKA A;  1LXN A;  1FNO A;  2NYI A;  2NXE A;  2ROG A;  1RGV A;  3MR7 A;  3TVZ A;  5KFK A;  5J1E A;  4LF5 F;  1A6L A;  1SKW A;  1FES A;  1NJY A;  2EFV A;  2VQR A;  1B99 A;  2W9C B;  2YNI B;  1OQ6 A;  1CQN A;  3CCL S;  1T03 B;  2FVP A;  1Q81 T;  3DRS A;  4ED6 A;  2OGU A;  1FRJ A;  1YIJ S;  4DG1 B;  3EZ5 A;  4DL3 A;  2AYM A;  2IMW P;  2DJW A;  2YQ3 A;  3D9B A;  3FDS A;  4RLE A;  4TY9 A;  4CP5 A;  4EK2 A;  2UVU A;  1LWX A;  4ZS6 A;  5K14 B;  1NND A;  3BR9 A;  4TLR A;  4YHH F;  2EBG A;  2MHN A;  4OI1 A;  3MD1 A;  5CA5 A;  4A8Y A;  4MH8 A;  2F8H A;  5LSR A;  4B9N A;  3L7O A;  1VJQ A;  1CPZ A;  1X4E A;  4LFB J;  1HMV B;  1IM6 A;  3QT6 A;  2CXE A;  4FDF A;  1N5Y B;  4OYO A;  3G6V A;  2E1C A;  3ZZZ A;  4JOU A;  1LKZ A;  5DLG A;  1Q8B A;  3UCG A;  3BV8 A;  4CLF A;  1UKU A;  1EB0 A;  2QV6 A;  5LJ3 Y;  2VIC A;  2DNR A;  5F8M A;  1VQ9 S;  4DV1 J;  1S1X B;  2I6W A;  3PEJ A;  1M0S A;  3R5G A;  5KG2 A;  2B56 A;  2EI5 A;  2MQQ A;  4A8S A;  3C2P A;  1EW2 A;  3S6E A;  1MRO B;  2FHJ D;  1N88 A;  1J5E J;  3UR3 C;  2BJE A;  1R27 B;  1HWL A;  3DI6 B;  3I0S B;  4L72 B;  1FXD A;  2PMW A;  1TFY A;  3GU0 A;  3QQC D;  3UNY A;  2VG5 B;  2RRB A;  3C46 A;  4QWC A;  3ADA C;  3OXL A;  3LF0 A;  4ICL B;  4YDD B;  2DNM A;  4ZJQ A;  1NPK A;  1RT5 A;  5J2M B;  4DV2 J;  2YKM B;  1KHL A;  2HFO A;  3K8W A;  3M8W A;  2HMI B;  3W66 A;  4KC5 A;  1RAB B;  2MZR A;  2OEL A;  3MOZ A;  3RTV A;  2MKJ A;  1VOM A;  3MEC A;  2XLJ A;  1ARO P;  2WOM B;  4DR6 F;  5ETQ A;  2W7A A;  4B3S F;  2ZZN A;  4RWX A;  2BAN A;  3NEK A;  5D6G A;  1AA1 B;  3F56 A;  4PWU A;  3TAN A;  1WF0 A;  2HQ3 A;  3CD7 A;  3DRR B;  2DNN A;  1T94 A;  3ED4 A;  2FD2 A;  4HTJ A;  3KUE A;  3GIK A;  1F0X A;  4W92 B;  4QU7 A;  1HNV A;  3C8Y A;  4LR8 A;  4W90 B;  2VFR A;  3CMR A;  4TU7 A;  4TYB A;  3OFH A;  2I9S A;  3OSN A;  1N5S A;  1WTF A;  2JSX A;  2MZS A;  4MFB A;  4N76 A;  4WYL A;  3QJL A;  3C19 A;  2DNQ A;  2JRS A;  2HVE A;  2K06 A;  3CJR A;  3GIR A;  2VKZ G;  4NCG B;  3FFI A;  2FJA B;  3GIM A;  3BKU A;  3CNQ P;  2M8D B;  1U8W A;  1HNI B;  6AT1 B;  2F65 A;  3A8J A;  4Y3C A;  1VQ7 S;  3D6F B;  2D3O 1;  4ER8 A;  3AJD A;  3M2V A;  3WIU A;  3HT3 A;  4ELT A;  5LL6 d;  1ELX A;  2G13 A;  5F8L A;  2IRU A;  1G3O A;  1HD0 A;  4IH5 A;  2DEJ A;  1E3C P;  1HNZ F;  1C0U A;  1EQM A;  1HW8 A;  2FC8 A;  1SV5 B;  1MMN A;  4MK9 A;  1U26 A;  4ANC A;  4X64 J;  5G0R B;  1CC7 A;  4DR7 F;  4J90 A;  3UD4 P;  4EGL A;  1VDH A;  1VYA A;  2F7V A;  3LUY A;  2QA1 A;  1NCL A;  2W5T A;  2BE2 B;  3Q8Q B;  4UOR A;  4YB7 A;  2EKN A;  4EI2 A;  1PBU A;  1NHK L;  2ZBI A;  4DX8 H;  4PPZ A;  1V3Z A;  1I5O B;  3DRS B;  4X4Q A;  3KK1 A;  3UN5 A;  5CCM A;  4Q0B A;  4CNY A;  1U45 A;  4OHY A;  1H6K X;  1IBM J;  2R8G A;  4FXV A;  3NGS A;  3KHH A;  4R25 A;  1YRU A;  2MQO A;  4DUZ F;  2VH7 A;  4WFB Q;  4UY8 5;  3AOD A;  2PC6 A;  3C3L A;  1ZZF A;  3J81 Y;  2BJ7 A;  3MPV A;  1PGZ A;  1L3U A;  2XS5 A;  4FF1 A;  2MLY A;  2XWX A;  1H98 A;  3OPK A;  2H1Y A;  3PIO Q;  5ITH A;  1C1C B;  1TL3 B;  1CJV A;  4QYZ K;  3EGZ A;  3NBP A;  1IQZ A;  2YQ1 A;  1M1K T;  4WZM A;  2KI2 A;  1C4A A;  3KUH A;  4DV0 F;  3I31 A;  3M32 A;  4M8L A;  3EMT A;  1DHM A;  2DHA A;  2IM3 A;  5ETR A;  1JX4 A;  2J6S A;  5L8R C;  4IH6 A;  4JYA J;  1XEZ A;  1T9V A;  2GJI A;  5ETL A;  3IDD A;  1FCA A;  4CYU A;  4TKT A;  3RGI A;  3D0G E;  2QRR A;  4NA3 A;  5GAD U;  5EDW A;  4HR2 A;  1S10 A;  5M2P A;  2CQB A;  1RLD A;  1UVI A;  4B3T F;  1TL1 B;  1XN9 A;  2PT0 A;  5L9N A;  1P9Y A;  1NK4 A;  1XMB A;  2F1F A;  1S0N A;  2E9T A;  4DXL A;  3G8Q A;  3GZ7 A;  2DH7 A;  3P4U B;  5KT7 A;  3GYG A;  3W8G A;  4WTO B;  3K2Y A;  3GV8 B;  4J9R A;  3CCS S;  1NHV A;  1W2I A;  3U27 A;  5K14 A;  1F5A A;  2JOQ A;  1AT1 B;  5B0G A;  4WFX A;  2ZNZ A;  4JV0 A;  4WZQ A;  1DTT A;  4KM4 A;  4NWX A;  1D9F A;  2MQN A;  2CJY B;  1NUE A;  3LWL A;  2D7S A;  5A6W A;  2MQL A;  3ET6 A;  4HH1 A;  2BDP A;  4DCO B;  2KO1 A;  2UU9 J;  1XK8 A;  4UTG A;  1NK5 A;  2OI2 A;  3MMC A;  3QAE A;  4MK8 A;  4FYV B;  4OLO A;  3UDV A;  2C2Z B;  1S4E A;  4X4S A;  3NGU A;  5D4N A;  4O3O A;  2RU9 A;  5F9N A;  1IBK J;  4C3L A;  3TX8 A;  2W9C A;  3SI8 A;  4DSI A;  2HQG A;  1OPZ A;  4H4O A;  2AT1 B;  2GAG C;  1X0F A;  1YJV A;  1HYS B;  1R8H A;  1ANI A;  3QGI A;  1KS2 A;  1ZPV A;  2B43 A;  1B0P A;  2CIM A;  2W24 A;  3HHL A;  4LJM A;  3CCT A;  1T02 A;  4NA2 A;  4URQ U;  2R7U A;  4TN2 A;  1X4B A;  5FLX Y;  1VQ8 S;  1ALJ A;  2YNF B;  3IAM 9;  1XER A;  2RHS B;  4LR9 A;  1T95 A;  2IAJ A;  3MCM A;  3W5X A;  3OVA A;  2MKH A;  3IRW P;  3IM8 A;  1FRI A;  1MN9 A;  4GVB B;  5CAA A;  4DR1 J;  1IBL J;  4JI1 F;  3AA8 A;  2DCL A;  1CBK A;  1R31 A;  2XHC A;  1IKV B;  2D69 A;  3CSK A;  4OX7 A;  5EUH A;  2V8G A;  3W2W B;  5KFA A;  5C42 A;  4R5P B;  3GFY A;  3MM8 B;  1WG4 A;  3IO1 A;  5LSL A;  1SHQ A;  1IKY A;  4NEY A;  1RAC B;  1S59 A;  2UZA A;  1YBU A;  2J7U A;  2Z0G A;  1H7X A;  1UPM B;  4ELV A;  3TO8 A;  1WNE A;  1HQE A;  2LU2 A;  2LFV A;  3FCW A;  4CLU A;  3BRE A;  4HT5 A;  5L1L A;  1SJR A;  2OFG X;  3CJ0 A;  1DAX A;  1RT7 A;  4CLZ A;  3DRR A;  1X9S A;  1F9H A;  4KY3 A;  3V81 A;  1S76 D;  3IGV A;  2R4F A;  1G2E A;  3LH2 S;  2I1R A;  1K1S A;  1HAR A;  1I51 B;  3IWL A;  1FI4 A;  3N5F A;  2P2C B;  2WON B;  4WE1 B;  2H48 B;  2D1G A;  4KJG A;  4GTY A;  1EP4 A;  1W2B R;  3RAQ A;  4KPC A;  3T19 A;  5IV4 A;  3EZU A;  2HHH F;  4NXN F;  1Q86 T;  2LLZ A;  3OTE A;  1QUV A;  1FVQ A;  1WC6 A;  2CQD A;  4F36 A;  1IXK A;  1RWM B;  2N3L A;  2HWT A;  3AQO A;  1NDC A;  5GVQ A;  3TW0 A;  3UO0 A;  4QU6 A;  2GW8 A;  1RCO B;  3HHN B;  2D74 B;  2JFD A;  1HQA A;  2VBZ A;  1BXN A;  5HQ8 A;  3UCZ P;  2RH3 A;  5HAN A;  1GEH A;  4C98 A;  3R1H A;  3TAQ A;  3QGP A;  2DR5 A;  4R0E A;  4RW4 B;  3NKQ A;  2E7W A;  2HWH A;  3DLK B;  3T41 A;  5IT4 A;  1GMV A;  3OJU A;  5F8G A;  4E2F B;  2KG1 A;  4I1T A;  5BJR A;  1HBM B;  3BB5 A;  2HHT A;  4WXO A;  2B5J A;  2ZKT A;  4J9M A;  4MY4 A;  3TA0 A;  4B3M F;  2QLW A;  1OWX A;  2P6S A;  5B09 A;  4X4R A;  4MK7 A;  1UTA A;  3PJX A;  1KVK A;  3RAX A;  1MWZ A;  2R7S A;  1SL0 A;  3CCM S;  3NNA A;  2UXB J;  2BKP A;  4XPE A;  2XYG B;  1SKS A;  4LF6 F;  1SC1 B;  2DGX A;  4N8O A;  3ISN C;  3SIP B;  1HWI A;  1LNQ A;  1TKX B;  1EZZ B;  3E51 A;  4DFM A;  1S4F A;  3SCI E;  3H2U B;  2E5H A;  5J2M A;  5L0B A;  1L3K A;  2HZA A;  3HHL D;  3OT9 A;  4K59 A;  4RW4 A;  2CDQ A;  3EGN A;  4MKB A;  1JLQ A;  1TP7 A;  4DL0 C;  4DU7 A;  4UOG A;  2HMI A;  2W7O A;  3MXH P;  1RT1 A;  4IFV A;  3TUZ C;  3V6K A;  3A8E A;  2J0S D;  3ZZP A;  2BV3 A;  3KUG A;  5HBM B;  2ZBR A;  4ZA1 A;  5L9X A;  2IA0 A;  3T5J A;  1V6H A;  3JTP A;  3IGN A;  3KDO A;  4HH0 A;  1RYS A;  2GNK A;  3WHI A;  5KFB A;  1PIE A;  4CH7 A;  1HHT P;  2EG2 A;  1Q5Y A;  3KHR A;  1FWL A;  4PWD B;  2OUG A;  4ZPD A;  2L08 A;  1K7H A;  4E8U A;  1TFW A;  3M4X A;  3KJV A;  3VZI A;  3OHB A;  4MYU A;  4TQS A;  4DFJ A;  2ROP A;  3QZ8 A;  2M2B A;  4E98 A;  3HHD A;  4PG8 A;  4XDD A;  4UOP A;  1HBU B;  1QSL A;  4KKO A;  1FKO B;  1EQJ A;  1WSV A;  1UWB B;  2VBY A;  1EIY B;  3MEG B;  1VQN S;  1X5P A;  3HVW A;  1TAU A;  3VR1 A;  4X4V A;  2EK1 A;  2YKN B;  3N6L A;  4OMF G;  2AGQ A;  2V5H G;  2XCA A;  1JJC B;  2FHM A;  3BSC A;  4USW A;  4ZPW R;  4P2F A;  4CM2 A;  3RBD A;  4MAK A;  2Z2L A;  2ATC B;  3O3L A;  2HK3 A;  3FRZ A;  1CUL A;  1S1T B;  1VHI A;  2DNY A;  4XAK A;  4ZVH A;  3CJK B;  1UP1 A;  3FNN A;  5A76 A;  1U8S A;  1HFE L;  2JEI A;  2NR0 A;  4C7Q A;  4EO8 A;  2KFY A;  3H4B A;  5K8N A;  2GAH C;  3FJ2 A;  4GKJ J;  3E2D A;  5GAG U;  4LFA F;  3I5B A;  2HS3 A;  4P2X A;  2WSC C;  5FJ4 A;  5T14 A;  2QA4 S;  2HRT A;  4EBC A;  1UCN A;  2MB0 B;  4WYW A;  2VIH A;  2VG6 A;  3M2R B;  1L5U A;  1FKA F;  2C2E A;  3R2D J;  2Y3Y A;  4KKO B;  5KFS A;  2G0J A;  1SXL A;  4HHJ A;  4AFF A;  1K0V A;  4Y2K A;  2LA6 A;  2IY5 B;  4IR1 A;  1B4S A;  1EP4 B;  1Y00 A;  3HSD A;  4UF4 A;  4IG3 B;  5B0C A;  1WD6 A;  4UT4 A;  2GSO A;  2ZIT A;  4B02 A;  2LDY A;  5BXI A;  3L09 A;  2QMX A;  3E3X A;  2KHD A;  2WVF A;  1XMQ J;  2LQJ A;  4O3Q A;  1OIA A;  3TG0 A;  2G4B A;  2HHQ A;  5H9F J;  1R8C A;  2YNG B;  2ZBQ A;  3D1O A;  4U6P A;  1KQF B;  3OR2 A;  4O0I A;  1KRP A;  4ZCI A;  2ALZ A;  1KH5 A;  1WEX A;  4FBU A;  5DQG A;  1OSC A;  3NCR A;  1JLC B;  1XMO F;  2FJE B;  2CJ9 A;  3CB4 A;  4DPO A;  4X65 J;  5AJ3 F;  3FGV A;  3J7Y I;  4FYY B;  1GMW A;  2Z8Q A;  4DZ6 A;  5K5M A;  1DTQ A;  5K8P A;  2XNQ A;  3CIZ A;  4ES2 A;  5HP1 A;  4Q44 A;  1OYE A;  3M1V B;  4UOC A;  2LQ9 A;  3ISN D;  4XO0 A;  2NZ4 A;  2AJ2 A;  4JI2 F;  4MIV A;  1SQF A;  4KFB A;  1VHF A;  3UD5 A;  1KEK A;  2XO7 A;  3M32 B;  4PAA A;  1N5Q A;  2P9E A;  3CVK A;  2HND B;  3PJW A;  3PCO B;  4FNH A;  2HFU A;  5HRO B;  4PR6 A;  5LXY A;  2ACM A;  3OL7 A;  4ECY A;  1N52 B;  4QQB A;  4P72 A;  2NUU G;  3T5H A;  1BC6 A;  4LF1 A;  3KJQ B;  1S0M A;  1TKT A;  5D4P A;  4AND A;  2ZM6 J;  3ENQ A;  2XMM A;  5GAE I;  1LOU A;  4QIG A;  3DLE B;  4DV5 J;  1N5Y A;  1OJ4 A;  1FFG B;  1UFW A;  1S1W A;  2W9A A;  1NJX A;  1J27 A;  4RO0 A;  2GHV C;  4F0K A;  3BM7 A;  4RW8 B;  4N7T A;  3M8R A;  1NH8 A;  1N33 F;  1MSW D;  3DYA A;  1TV6 A;  2EFN A;  5D77 A;  4ZVP B;  1AJA A;  1HI1 A;  2L9W A;  4MTP A;  5F9L A;  5KOW A;  3X1L B;  4H4K C;  1RWW B;  1ZBT A;  3AFG A;  3ILL A;  3FBE A;  3IBC B;  4I67 A;  3VQT A;  2VKR A;  3KWM A;  4NLR A;  4U96 A;  2R7R A;  3NNC A;  2C3P A;  3NOG A;  4DV4 F;  4PQU B;  4ZVF A;  4CM0 A;  5L1I A;  2CQI A;  2R42 A;  4QYR A;  1HPZ B;  2I38 A;  3H25 A;  4TN0 A;  4UUW A;  3GPA A;  1AJC A;  4KAY A;  1IWA A;  1S9G B;  2CKW A;  1RHR B;  2J7W A;  3FKB A;  2BJ9 A;  2V4J B;  1JLF A;  3K8V A;  1E33 P;  3E2E A;  4V19 J;  5J1P A;  1V3S A;  3ZNU A;  1ZM3 A;  2AEM A;  3R3T A;  4ZHR A;  2KFN A;  2DNK A;  1TUW A;  1JB0 C;  2RT3 A;  3CDB A;  4FZV A;  1R8P A;  1GK8 A;  2W2N P;  4OZ1 A;  2H3E B;  2GJF A;  2IVY A;  3CJ3 A;  4KJI A;  2AU0 A;  4EWT A;  2W5X A;  2QMU B;  4G6V B;  4C0H A;  3QIP B;  4ED3 A;  1N4L A;  2JH3 A;  3CCV S;  4PG5 A;  1RBO B;  4P7V A;  2AMC B;  2OKQ A;  1A0O B;  1S1U B;  1RWN B;  3KG0 A;  5IT9 U;  1TK0 A;  2YXL A;  3CF5 Q;  4JI5 J;  3SZZ A;  4DI6 A;  1RT1 B;  2CZV C;  2NXU A;  3VAH A;  2VBW A;  1AUK A;  3LGM A;  2HWI A;  4OHW A;  2K3K A;  5KFU A;  2PMZ D;  1LFW A;  1Q95 G;  2MKC A;  2XMT A;  2UV8 A;  3MEE B;  5ETM A;  4DV7 F;  3FEZ A;  3QRP A;  4KGM A;  1HBO B;  3CD0 A;  1RT3 B;  4NYP A;  1E1Z P;  3CPW R;  3JQM A;  4LQ3 A;  4ZHR B;  3J7Z T;  4IRK A;  3KNG A;  4TLQ A;  3P3D A;  4QWB A;  1WOS A;  4WII A;  3KYL A;  2BR0 A;  4FBT A;  1YG0 A;  4BBY A;  4RNF A;  2CPH A;  2V9K A;  3R7B B;  1RA6 A;  5F0U A;  4WE1 A;  1KTV A;  2X3G A;  3JTN A;  1J2V A;  2JZ5 A;  5FII A;  2K1R B;  2P6T A;  3GG0 A;  5B0D A;  3MCS A;  3Q22 A;  1B8J A;  1IR0 A;  8ATC B;  4JI6 F;  1KP6 A;  1ULR A;  3CJ4 A;  2UXD J;  1NSK L;  5E3C A;  5LRM A;  2WHO A;  1UFL A;  2DGO A;  5AJ9 A;  1NPP A;  4MYT A;  2EPI A;  3H40 A;  3CGI A;  5BR8 F;  2Q6C A;  3UVJ B;  3KLF A;  5EGE A;  3M2U A;  1C1B A;  3IMQ J;  3N01 A;  3NCP A;  4OYW A;  2LYV A;  3ZZ0 A;  4K4X A;  2XB2 D;  5IT0 A;  2KXN B;  1YJ9 S;  1OPI A;  2QA2 A;  2YKA A;  4WK3 A;  1G1X A;  4NML A;  1OY6 A;  2V34 A;  3BQ1 A;  2CG4 A;  1Q16 B;  3SSR A;  2ZC3 A;  1WOP A;  2M52 A;  4OZL A;  5IC6 B;  3JSM A;  4DQQ A;  2G9Y A;  4WKY A;  4G1Q A;  2UUA J;  1MU2 A;  4ANE A;  3TAM A;  3EDQ B;  1N5V A;  1HA1 A;  1RCX B;  3O44 A;  5J2N B;  2BOP A;  3BGU A;  4C8N A;  3PEH A;  5HK4 A;  4DG1 A;  1TU0 B;  1BHN A;  1VRU B;  2ZUG A;  3NS6 A;  3RW7 A;  4ILM A;  3QT5 A;  3CUN A;  2QC3 A;  4DF8 A;  1AFI A;  2WAQ D;  1HQU B;  2C28 A;  2A3J A;  1TKX A;  3HHE A;  4U7U K;  4ENO A;  3C16 A;  2E44 A;  3LPY A;  3ITH B;  3SQG A;  1OS5 A;  2ABY A;  1JLQ B;  1UFK A;  2ZJQ Q;  4IYQ A;  3RZA A;  3FMB A;  5HLF A;  2CNK B;  5GAE U;  1SBR A;  3EGV A;  4IFV B;  5HMZ A;  2ZH1 A;  3D0I E;  1I94 J;  1RAJ A;  2FVC A;  2XUL A;  4KH0 B;  1RB0 A;  1NLK L;  3ENV A;  4NRU A;  4USK A;  3TUI C;  4C3M A;  2ATL A;  1UVM A;  3MUM P;  2XTJ P;  2W2Q P;  4JI3 F;  1N32 J;  2DRA A;  5D0R A;  2MZ1 A;  2WVC A;  1JLF B;  2ZOF A;  1X9W A;  4DR3 J;  3T1A A;  3J81 U;  4TXS A;  2HK2 A;  3D3C J;  1EW8 A;  3DLG A;  2CQH A;  2XI3 A;  3DLJ A;  4CTA A;  1TQL A;  3IWX A;  5D4O A;  2D3O R;  3T00 A;  4Z7Y A;  2MKY A;  1YRT A;  2LDI A;  2YH0 A;  2W5S A;  3DI6 A;  1S57 A;  1RUS A;  3W3S A;  4IDK A;  1YRX A;  3DMJ A;  4CLW A;  2RNE A;  4LBH A;  1S6P B;  2GO9 A;  2L48 A;  1V5I B;  3M8Q A;  1PCA A;  3BGF A;  4IO9 Q;  1RWO B;  3TAR A;  1L3V A;  2LA4 A;  3VVT A;  5DLT A;  2Y1L B;  3M9N B;  3CE8 A;  1C0U B;  2MYF A;  1N6Q B;  4Y2A A;  2HVI A;  4UST A;  4RKU C;  4K0K J;  5HQM A;  1Q8I A;  3ZTO A;  5HI7 A;  2HGM A;  1UL3 A;  2J9E A;  1FXR A;  2GVD A;  5AXN A;  2X1A A;  2E29 A;  4X84 A;  5IOL A;  1X4G A;  3D6T B;  3DGP B;  1EAY C;  2BAN B;  3SEO A;  5IWA J;  3BGR A;  3R7S B;  3T6J A;  2RUG A;  2MLZ A;  1CQM A;  2CPE A;  3AD8 C;  4RBT A;  4Q0B B;  1AZS A;  1QVF R;  2XMU A;  3MPY A;  3AOB A;  1VQK S;  4YHH J;  4ILR A;  1RQ0 A;  3RB6 A;  2RHQ B;  2PEH A;  3GSD A;  2VG7 A;  2QZU A;  3DRP B;  2GVZ B;  2WVE A;  5D78 A;  4F50 A;  3W63 A;  1GQE A;  4W98 A;  5HAO A;  1T9X A;  1VLO A;  4M5L A;  4YOE A;  4CYR A;  4LFB F;  4J9U E;  2B9Y A;  2BRL A;  4PQA A;  5C24 B;  1U1K A;  2GFF A;  5GAD I;  4ZLN A;  4CH1 A;  3MK0 A;  4RW8 A;  1WDT A;  2J0W A;  2M9K A;  1Q78 A;  5DS7 A;  4ID5 A;  1SCJ B;  2J76 E;  4ZP9 A;  2KDO A;  2DR9 A;  2IC3 A;  3PFE A;  1HQE B;  4ZVR B;  1HNX F;  1U6B A;  4DV1 F;  1D9D A;  3SMZ A;  5AXK A;  4YR2 A;  2DO0 A;  2ILY A;  5F3T A;  2DGU A;  3NAI A;  4KAI A;  5H1S V;  1U47 A;  1HPZ A;  3S01 A;  4YUD A;  4X66 J;  1PAE X;  4ZDN A;  1LK5 A;  2CVE A;  2HBQ B;  1GX6 A;  2HRU A;  4DS5 A;  1F60 B;  1H7W A;  3H4D A;  1RT4 A;  5JJB A;  2IBO A;  9RUB A;  1PIL A;  1TL1 A;  3ONQ A;  3OXG A;  4ID8 A;  4UQG A;  4DV2 F;  3GIJ A;  1F3F A;  1GXL A;  2IJN A;  1PBA A;  5K20 B;  3MM9 B;  4DL2 A;  1VI7 A;  2VPW B;  1X9M A;  1FRL A;  3AA9 A;  5IC4 B;  3T9N A;  1ZPW X;  2DO4 A;  4AXJ A;  2FHO B;  3FFI B;  4OI2 A;  2ZH7 A;  4ILL A;  2XO6 A;  2XC9 A;  2DH9 A;  2HVH A;  1X60 A;  5BYQ A;  4LRB A;  1K47 A;  3J7Y U;  3GII A;  1WSR A;  1SKR A;  4B3S J;  3ET6 B;  3DLE A;  2VJU A;  3J7A N;  5ETT A;  1RHJ B;  2C1E B;  2BJ3 A;  5DDP C;  5F8J A;  3WAW A;  1VLY A;  3GIL A;  4LRC A;  4K2X A;  3G2X A;  4HT7 A;  4LF8 F;  4NZ7 A;  1JXE A;  1H38 A;  4LF7 F;  1RT4 B;  3MI7 X;  1J5O A;  2W2P P;  2OPQ B;  1WAC A;  2L9D A;  4TY8 A;  3VAI A;  2B0G A;  1S97 A;  1RXO B;  5CH7 B;  4A48 A;  3ILI A;  3CCZ A;  1FTR A;  4F0M A;  1VQL S;  1I3O B;  2NSB A;  3DLG B;  1W26 A;  1WOO A;  2CZ9 A;  3GR0 A;  4ZOS A;  4LQ9 A;  2Q43 A;  4FVC A;  3G9C A;  3E8O A;  3KK1 B;  4DCP B;  1BY9 A;  2R7W A;  4Y0F A;  3DU5 A;  2DR7 A;  1Y3J A;  2W4P A;  1WKL A;  2R7Q A;  4AL5 A;  1KR4 A;  2E1P A;  2JWN A;  2MQM A;  1SC3 B;  4U67 Q;  3K5O A;  3SZY A;  4FDI A;  1MU2 B;  2MXY A;  2MZQ A;  4PKD B;  3BH6 B;  3OTO J;  1H2U X;  4A8K A;  3QSY B;  1HNZ J;  3DYC A;  4X64 F;  4DR7 J;  1YVF A;  1SC6 A;  1GMW D;  2BOA A;  3H7H B;  1HQU A;  3ZZY A;  4P10 A;  1KC8 T;  3NKN A;  1RTD B;  2R3V A;  5KFY A;  1K8A T;  5IQ6 A;  4IOA Q;  2CQP A;  4LFC F;  3MM5 A;  3PG9 A;  4NLV A;  5E3R A;  1VC6 A;  2A6M A;  1YLX A;  1C1B B;  2WVB A;  2ZEJ A;  4H4K A;  5G4D A;  2IVF B;  3PV8 A;  1U6F A;  1WTB A;  3KJV B;  1SKU B;  5C25 A;  1M5S A;  1KHN A;  1FD2 A;  1KTQ A;  1U02 A;  2GQQ A;  3IS9 B;  4FS1 A;  2ZZM A;  3RW6 A;  4NMX A;  2P9C A;  3RB0 A;  3PJ9 A;  2KL8 A;  2W2M P;  3ZC4 A;  1S0O A;  1BQN B;  3ULH A;  2OTL S;  4EU0 A;  3PYD A;  2QLJ B;  2RDD A;  2VOP A;  3RRH A;  1ZA1 B;  2NZC A;  3N0V A;  5KG7 A;  3V4I B;  1QTM A;  2O3D A;  2Q66 A;  2MQP A;  4H54 A;  3PW7 A;  1Q7L B;  2B3T B;  2YPZ A;  2CJB A;  1TVR B;  4O44 B;  3MCN A;  4Y6I A;  4DPT A;  3V6D B;  2UVR A;  2GGP A;  2M7S A;  2E5I A;  2XZD B;  5B0E A;  3VVU A;  4DV0 J;  1VCT A;  4CDI A;  4ZG9 A;  4A46 A;  1FT8 A;  3A3P B;  3J80 U;  1NKE A;  4HHH A;  2G9O A;  4FXD A;  2R2U A;  3Q2T C;  1H2T Z;  2C22 A;  3LAM A;  3NS5 A;  3CCQ S;  4OZ0 A;  3HXM A;  3HFZ B;  3R27 A;  2VA2 A;  1REV A;  4DEZ A;  3QGH A;  1KWM A;  1Y5I B;  3BR8 A;  4ZVO B;  2BUN A;  3DOM A;  4GO7 X;  1FHT A;  1RHM B;  1U4B A;  2LXU A;  1EKR A;  4OJH A;  1T8E A;  1AFJ A;  2HS0 A;  2B9E A;  3DFE A;  1M1G A;  4ZPC A;  1LFP A;  1VK3 A;  2KU7 A;  2ZDO A;  3B4D A;  3IRX B;  1FNM A;  4H4O B;  4G1I A;  3R7N B;  2F3J A;  2GSN A;  1NM2 A;  3G6E S;  2LXF A;  3WDO A;  1RU1 A;  1QY7 A;  3WX8 A;  2BAB A;  2YWK A;  2AW0 A;  2DKO B;  2WB4 A;  4M5D B;  3GV5 B;  3G4S S;  2A18 A;  1WG1 A;  1SL2 A;  2W5Q A;  2DR8 A;  2KHC A;  3W61 A;  3MUR P;  4Z7C A;  1ZYQ A;  2YQ0 A;  1RA7 A;  3BDG A;  1XC9 A;  2IYI A;  3AJ1 A;  3OUY A;  4J9N A;  4I4B A;  2YKP A;  2GZO A;  1REV B;  4LBP A;  1U1N A;  3QRQ A;  1PAU B;  5T7L B;  3KLG A;  3CTR A;  3SSQ A;  2W8L A;  3BKF A;  5HQL A;  1V3R A;  4IUF A;  4ZPA A;  1SJ3 P;  5K4P A;  1VQ5 S;  2C3U A;  3BEG B;  3BGR B;  5KFM A;  3H5Y A;  2VB6 A;  3FSI A;  5A8R B;  1H74 A;  3R5C A;  2CPD A;  2R7O A;  3RU0 A;  1LWF A;  3MGJ A;  4OLP A;  1HL6 A;  3MOJ B;  2IMO A;  3BYR A;  3NOC A;  2WB1 D;  3MZI A;  4PYA A;  5KFF A;  2FY8 A;  1PYO B;  2Z56 B;  1RLC L;  4RU9 A;  4DV6 F;  1NB7 A;  4AL6 A;  1NZ8 A;  4IFY B;  1SH3 A;  3I6P A;  4QPX A;  3TOQ A;  4O4R A;  4MT1 A;  3EPI A;  4DR1 F;  1U1M A;  1BLU A;  5BYR A;  3G82 B;  1NK8 A;  4JI1 J;  2CPJ A;  1PYT A;  3H42 A;  3MEK A;  2W9B A;  1LEO A;  1YGY A;  1EKS A;  2A2C A;  3ETM A;  3JSB A;  4PG7 A;  4B08 A;  2ZWP A;  1ZED A;  3OHA A;  5AT1 B;  5KG1 A;  3L7P A;  4DR2 J;  5KFC A;  2E66 A;  2B8P A;  2V6A A;  1ZZN A;  1HR0 J;  1W25 A;  2OPR B;  3FBB A;  5HJX A;  4DCJ B;  2YNH A;  1JMT A;  3Q8U A;  4BWJ A;  2VA3 A;  1R0A B;  5A8R A;  2ZH3 A;  1QTN B;  1FTC A;  2GX8 A;  2ZHB A;  1WKJ A;  3PAC A;  2VD3 A;  1TUV A;  5KFJ A;  1N8R T;  4JV2 A;  3K57 A;  1KFS A;  2W8D A;  1QE1 B;  2ZC4 A;  3HDS A;  4WFY A;  4QBU A;  2Y0B B;  2ADB A;  2Y8W A;  1NKB A;  2B5J B;  1FDB A;  2GMH A;  3A4T A;  3W65 A;  2GLQ A;  2DH8 A;  1Q7Y T;  2HHH J;  5KFX A;  5JUM A;  2V63 A;  1MRO A;  4QR2 A;  4TQR A;  5EGY A;  1NXI A;  3D54 A;  1X0P A;  2ZBC A;  3FCV A;  5E41 A;  3JYT A;  4J9P A;  1HI0 P;  4N41 A;  4PUO A;  4K50 A;  4I7F B;  4ZVG A;  4L75 A;  2CPI A;  3SQO P;  1S12 A;  3G8S A;  2AWZ A;  2ZJR Q;  4JUZ A;  1YSJ A;  4I56 A;  1TMM A;  1FSU A;  4NWJ A;  4RPF A;  4O4G A;  3BF4 A;  3DC2 A;  1FNX H;  3BDF A;  1MN7 A;  3FCH A;  1RI7 A;  3M2V B;  3D67 A;  2JC0 A;  1FRH A;  3P8B B;  5I3Q A;  1BQM B;  2XI2 A;  3HKW A;  3M6X A;  2WOM A;  4ZLP A;  3HJV A;  4LRA A;  5AXL A;  3BDH A;  2QO3 A;  1CG2 A;  1RTD A;  4R8U A;  4LF4 F;  2CPZ A;  4QIE A;  1FJG J;  4B9M A;  3AJ2 A;  5H9E J;  3KJF B;  1ZEF A;  3LP0 B;  2FVS A;  3PW5 A;  1FER A;  3C14 A;  3GLJ A;  2QLF B;  3D1Q A;  2BM0 A;  4M5G A;  3O1L A;  3SYZ A;  2JC1 A;  4OX9 F;  2PI5 A;  2H5I B;  3CMA S;  2XWY A;  3EUN A;  4NLY A;  3KK3 A;  4ZP8 A;  4RUH A;  4OZ3 A;  2CVI A;  4WP8 A;  2CUY A;  5JXS A;  4L73 A;  3HKZ D;  1G6B A;  1BQX A;  1JIH A;  1NPR A;  2B9W A;  4K5S A;  4EO6 A;  1YZ7 A;  3MM9 A;  1YI2 S;  1H73 A;  4IG3 A;  4HHU A;  1YZ6 A;  4N77 A;  5E3A A;  2XMW A;  2YKN A;  3S7R A;  2K7J A;  3NKP A;  4R0J A;  1DRZ A;  4WK1 A;  2HNY A;  3CCU S;  1OYD A;  2GO8 A;  3HF5 A;  1B7Y B;  3EPG A;  2BKN A;  1RHQ B;  4WWS A;  3MF5 A;  5CYM B;  1BMQ B;  2C3Y A;  3A1Y G;  4ZVQ B;  1JLE B;  3IFE A;  3DRY A;  4CLT A;  3BO3 A;  3HI9 A;  3KK3 B;  3M30 A;  2BQU A;  2HZV A;  3JS9 A;  1GX5 A;  1HBN A;  1YBT A;  1W7W A;  4CQ1 A;  4B56 A;  1NBE B;  5CYJ A;  4ECT A;  5DGA A;  2NYH A;  3HCX A;  3QJP A;  4A8M P;  1YJU A;  2HPU A;  4XK8 C;  3Q23 A;  1QJH A;  2CQ3 A;  4DN0 A;  1AJD A;  4YN3 B;  4J9K A;  1XNQ F;  3AAW B;  3IG1 B;  8AT1 B;  1PKU A;  4C3K A;  8RUC A;  1UVN A;  1SHN A;  2CPX A;  1XR6 A;  1R43 A;  1S5Z A;  3QIP A;  3CJ2 A;  3P5T L;  1IR1 A;  2QLB B;  1O5J A;  4CLK A;  4CLL A;  2YNH B;  1BWE A;  1NU4 A;  1CJT B;  1NSA A;  4FF4 A;  4QW8 A;  1IVZ A;  3I4P A;  2VL1 A;  1R0A A;  2Z57 B;  2G2O A;  4UW2 A;  5LQQ A;  5B0B A;  3WC2 A;  5D15 A;  4I68 A;  2XM3 A;  1TKZ A;  2V8D A;  3GON A;  2BKO A;  3TQ1 A;  1VRT B;  3LGH A;  1SJ4 P;  1NDP A;  5E3Q A;  2KT5 A;  3HHL C;  4ZN1 A;  4ELU A;  1SQG A;  3PYG A;  5KT2 A;  4PQU A;  3B5Q A;  2GIR A;  4YDX A;  1KHV A;  3TA1 A;  2DGQ A;  3GE9 A;  3OR1 B;  3QWP A;  4K4V A;  4CYU B;  1XMQ F;  1AYE A;  1MLA A;  3HD2 A;  4ECW A;  4LR2 A;  2K1R A;  5FD1 A;  3TVK A;  4CLP A;  4YB1 P;  4DQR A;  2HG4 A;  3QAU A;  3NCQ A;  4HL9 A;  2IM1 A;  4QR0 A;  1PYS B;  4X65 F;  5C5J A;  1IKV A;  2BM1 A;  4M1K A;  3Q89 A;  1S9E A;  1TZ0 A;  3BBF A;  4NX9 A;  3W1Y C;  1D1U A;  3J7Z 5;  1KFD A;  2H65 B;  1U1O A;  2BJ1 A;  3CC2 S;  3NGR A;  1NK6 A;  1KVJ A;  5EX0 A;  4DOZ A;  4ZJL A;  1RYR A;  4ED5 A;  2YWG A;  1V9O A;  3M2U B;  2EVZ A;  1ACM B;  2UVW A;  1UET A;  5E0O A;  3VAF A;  3DXS X;  2RRN A;  3OR1 A;  5KTQ A;  3ENA A;  5F0W A;  3W62 A;  2F5G A;  4A8O A;  2GHW A;  1RHU B;  3QFH A;  5KFG A;  2VG7 B;  3W5Z A;  2GML A;  3M6V A;  4JP8 A;  3KLE A;  1LWE B;  2HAF A;  3Q24 A;  4ZVS B;  3DOM B;  2ZM6 F;  4P52 A;  2B4U A;  1S1X A;  2IDL A;  1T05 A;  5C24 A;  2E1A A;  2W4C A;  1I6J A;  2HHW A;  2HGN A;  4LSN A;  4G3I A;  4F0H A;  2H5E A;  2HBR B;  3U1L A;  3MMB A;  4DLG A;  3F73 A;  3G71 S;  1RZM A;  2E5L F;  3ZTQ A;  2IC3 B;  4RW6 A;  1FJ7 A;  2HNY B;  2IAJ B;  4YP3 A;  4LIW A;  1RWU A;  4ICL A;  5CHC B;  1FDA A;  5CYQ B;  1I1G A;  3MM7 A;  1DAR A;  2DGW A;  2XMV A;  5B0A A;  2UXC J;  1JWW A;  2OML A;  3NMA A;  2JX2 A;  3DLB A;  2O01 C;  4WU3 A;  1QUP A;  2ZOG A;  3QMQ A;  2D41 A;  4NRT A;  2B7B B;  2UUW A;  4NYO A;  1VIO A;  2DIV A;  4KGK A;  4DBQ A;  3OJS A;  4OIX A;  1XR7 A;  2DXE A;  3BBC A;  5KFO A;  3FMW A;  3SBM A;  3CO0 P;  4GVL A;  2UP1 A;  1HDH A;  4RW9 A;  3GFH A;  2MGZ A;  4GTW A;  1EET A;  2BMB A;  4K4Z A;  3EDR B;  3IR5 B;  4O3N A;  3ZZT A;  1GMU A;  1SUQ A;  2HHS A;  1LWF B;  4PG6 A;  4KRW A;  1VC0 A;  4HDH A;  2B6A B;  1BGX T;  2YNF A;  5KFE A;  1EX8 A;  1C0T A;  4F2R A;  2KZM A;  2V4J A;  2C2M B;  3AXK A;  3BH7 B;  5KFN A;  2EBE A;  4DL5 A;  2WBR A;  1MMD A;  2X1G A;  3PKY A;  4C8Z A;  3POT B;  3I9Z A;  1FE0 A;  3MR6 A;  1MML A;  3ICL A;  4NCG A;  1SJF A;  3L7U A;  5B7W A;  1HNW J;  3BQ2 A;  3VGT A;  1J5O B;  1NJW A;  3PX4 A;  4DR4 F;  3A52 A;  4DV7 J;  1YJ7 A;  3IR7 B;  5F41 A;  1P49 A;  1T9Y A;  4NLD A;  4KTQ A;  4PWD A;  2DB1 A;  4NXM J;  4IH7 A;  1RT7 B;  3I5C A;  3DLK A;  2Y1I A;  2IUC B;  4F02 A;  2I5J B;  2JHE A;  2J7K A;  1IBC B;  1L3T A;  4OYX A;  2V4Q A;  3PW4 A;  3Q8P B;  3KMS A;  4ZCL A;  2HHX A;  3FEX B;  4PRF A;  1GNK A;  1Q4R A;  2OFH X;  3MUT P;  2GJ2 A;  2AJQ A;  3CDU A;  1PJ5 A;  1RT2 B;  3RRK A;  4ZVE A;  2NXJ A;  2J6U A;  1VQP S;  3Q8S B;  3OTD A;  4JI6 J;  4YR1 A;  2EKY A;  3TAM B;  4OJ3 A;  4ZVT B;  2UXD F;  3WX4 A;  3O8W A;  4CI0 B;  4YR0 A;  3IXQ A;  2ERR A;  2BEF A;  1ALK A;  3JSY A;  3D3B J;  2HSE B;  2HNZ A;  4FKX A;  5BR8 J;  2LEB A;  1S6O A;  2FY1 A;  3MTJ A;  3OVB A;  3RJM B;  1FRM A;  1UVL A;  5EWE A;  4L3N A;  1DUR A;  1NME B;  1NDL A;  1EHW A;  3EVW A;  3WBZ A;  5LRN A;  2ZZT A;  1ELZ A;  5HLF B;  4WBF A;  4OJ1 A;  3VAK A;  1VQ4 S;  3EZO A;  2JVR A;  2AX1 A;  2JLF A;  2N7Y A;  1HBN B;  2V8P A;  3W9I A;  4MIB A;  4A47 A;  2RQC A;  1TL3 A;  1GAO A;  4QWA A;  2J9D E;  1FJE B;  3DOL A;  2UUB J;  2QL7 B;  2VZ9 A;  1T03 A;  4XPC A;  2FJD B;  1RAI B;  2DPI A;  2CG8 A;  4HI2 A;  2ZH6 A;  1SH2 A;  2IVM A;  3CDA A;  3MMA B;  3TJA A;  4ECR A;  2CA9 A;  4CLS A;  3K58 A;  4NLG A;  1JKH A;  3W9J A;  4FYD A;  3LXQ A;  3B78 A;  3RB3 A;  2K8G A;  4P75 A;  4ECU A;  3MM7 B;  2Q79 A;  5CAB A;  2XQC A;  4ED4 A;  1JLG A;  3VCD A;  4NZ0 A;  2VFS A;  2EG1 A;  4FPI A;  7AT1 B;  5I3U B;  4UZC A;  2QA4 G;  2YX4 A;  4PG4 A;  2W5R A;  4I2P A;  3D1H A;  2HQF A;  2KJV A;  4ID5 B;  3CJK A;  2N4C A;  2ZFH A;  4JI3 J;  1N32 F;  2N82 B;  2WBM A;  2F9J A;  2QFI A;  3N4W A;  4QIW D;  1WF1 A;  1DTT B;  2PSZ A;  4DR3 F;  1RKJ A;  4RNO A;  3H5S A;  4K4S A;  3JAM U;  4AT1 B;  1D3W A;  1Y11 A;  4J37 A;  5DDQ C;  1H0H B;  1GFW B;  2RB7 A;  2MZT A;  3R5J B;  4RX6 A;  5IM0 B;  3M8P B;  4BS2 A;  1S99 A;  4M5N A;  2IUC A;  1FF2 A;  4ZP7 A;  4YME A;  5A8K A;  1YKW A;  5MLC V;  1O98 A;  1WHX A;  1WF2 A;  2YKM A;  2HEK A;  4ZGA A;  1M5O C;  3OUY B;  1T3N A;  1IM4 A;  2HLT A;  4K0K F;  3E01 B;  4WKR A;  4DQS A;  2DIS A;  2M8H A;  2YX7 A;  3TI0 A;  1JJ2 R;  1RP5 A;  1VK8 A;  2Y8Y A;  2NXN A;  1AW0 A;  2ZJP Q;  3BPS P;  2HHP A;  1QAX A;  3HPO A;  4KH1 B;  3M8Q B;  4IG0 B;  4AL7 A;  3KLV A;  3ZZR A;  3WBH A;  5IWA F;  3CCE S;  3Q8R B;  1EAR A;  3WIV A;  1S6U A;  3ETO A;  3HJF A;  2IRX A;  4HLB A;  2YWF A;  4DFP A;  3HD1 A;  2HW3 A;  2R8I A;  4J9O A;  2Y9H A;  1R7I A;  1R6Y A;  3LWM A;  1ROF A;  1XBW A;  4F4W A;  4DPW A;  2EC2 A;  1GTH A;  2VUG A;  1Z4U A;  3US5 A;  1N34 J;  1RT6 B;  1P1T A;  2BQR A;  1HHQ A;  1N56 A;  3I82 A;  4K8R A;  5EWF A;  1N5T A;  2X7I A;  1K9M T;  2UVV A;  2HZC A;  3NWG A;  1R0B G;  3JTO A;  4K4U A;  2CRL A;  3TJ9 A;  4KHP F;  4CH0 S;  2J8A A;  4JI7 J;  2ZH8 A;  2WZ1 A;  3V6D A;  1YQH A;  5E5N A;  1YHQ S;  1UA1 A;  2AJ0 A;  4FYX B;  1HNX J;  5EX3 A;  3RG6 A;  1JXL A;  2GSU A;  3KTQ A;  2J6T A;  1RU2 A;  3K5L A;  1JLC A;  1DBD A;  1S1W B;  1NSQ A;  4EYH B;  2RH6 A;  1H3D A;  3GJQ B;  3KG1 A;  4USI A;  4USV A;  5ETV A;  5M2R A;  1VBZ A;  4X66 F;  1JLB A;  5I4M A;  2CQG A;  1SV5 A;  3UN3 A;  1E6Y B;  3LQV A;  4X4U A;  4P6Q A;  1HWJ A;  1SC4 B;  2DCU B;  2DGT A;  4X4O A;  3LOU A;  4XIU A;  3U1M A;  1U1P A;  4C8L A;  4PXC A;  4TY8 B;  2MLX A;  2D3Z A;  3R1L A;  3R6L B;  4C0B A;  3BO4 A;  3NLC A;  2HIY A;  3T5L A;  3PHE A;  4ECX A;  2RUS A;  5LT5 A;  3MR5 A;  4PEO A;  2VON A;  4FN5 A;  1CLF A;  5IZH A;  4DF4 A;  3DLH A;  1EJ7 L;  2QSW A;  2AHO B;  2KM8 B;  1TKT B;  1C0T B;  1DQ8 A;  2ACY A;  4P2M A;  1RBA A;  1T05 B;  2PO4 A;  2QTW A;  1Y7A A;  2A6O A;  1ELY A;  2KRR A;  3NS7 B;  3SDE A;  1X4F A;  2DK2 A;  3DHX A;  3MMB B;  5AE2 A;  1P1L A;  4LF8 J;  4IQM A;  2I0X A;  1VR6 A;  4E0D A;  4LF7 J;  3MK1 A;  2G1D A;  2GIQ A;  3ZTS A;  2JEJ A;  4I2P B;  2ZVI A;  2WCX A;  2XEX A;  3FSX A;  4F4Z A;  3P6Y C;  2BVZ A;  2DHH A;  1IKX B;  4OYP A;  5KT5 A;  2XY7 A;  5HVG A;  1RTI B;  1Y4Z B;  3UDC A;  3TAP A;  1FJC A;  2RAQ A;  1FRX A;  1FWK A;  1U1R A;  4QYZ J;  1RAD B;  2RS8 A;  4ITS A;  3PDN A;  4X62 F;  4UPH A;  2VHG A;  1LXJ A;  5DO2 A;  2R2R A;  5EN1 A;  4EFA C;  3IS9 A;  1ZA2 B;  5LMN F;  1O0P A;  3VAJ A;  3VAL A;  4F8R A;  1D09 B;  4JI8 J;  2QJ3 A;  1MNE A;  2CFX A;  4DV3 F;  3OTO F;  3EJM A;  3IAS 9;  1RTJ A;  1SUQ B;  1FDN A;  2BE7 D;  2RQK A;  1NK7 A;  4P7T A;  1VQS A;  1RAG B;  5I3P A;  2K3I A;  4A4J A;  4QWE A;  2DY9 A;  4YQW A;  4M5M A;  1X7V A;  3AH6 A;  2ZH2 A;  2V9W A;  2RIL A;  4A8F A;  3V4M A;  4LFC J;  2AJ4 A;  2HAI A;  5BYS A;  1UPP A;  4V19 X;  3KG4 A;  4MIA A;  9ATC B;  4ZG7 A;  2YKQ A;  4ZIT A;  2W1B A;  1M5V C;  4CO2 A;  4EBD A;  2W5V A;  2H4Y B;  3HUL A;  3Q3Q A;  4NLQ A;  1QSY A;  2ZDP A;  4ZKA A;  2BJ8 A;  1VQY A;  2E1M C;  3ISZ A;  3ZTP A;  3BKT A;  1UMJ A;  4J9L A;  1HD1 A;  1FRK A;  4CT8 A;  3W64 A;  1AUD A;  2OAU A;  4OV6 A;  3CJS A;  5D0H A;  2M4M A;  4DSL A;  3VQS A;  5DLF A;  3TUJ C;  2HHV A;  1R6V A;  4OYB A;  1AB8 A;  4CO3 A;  3AD9 C;  3IP0 A;  2DNO A;  1JJ4 A;  1QAY A;  1KD1 T;  4LVN P;  3IGY B;  1S6P A;  3J81 j;  4DR5 F;  3CW2 C;  3MED A;  2R7V A;  3NXZ A;  4IFY A;  4N47 A;  4YFU A;  4DL4 A;  5E33 A;  2ASY A;  1R0C B;  2ZNY A;  3ZXW A;  1HIY A;  2EFG A;  2LVW A;  4EMD A;  3E01 A;  3BJY A;  3H5X A;  1E6V B;  4L76 A;  3R9L A;  4O3S A;  3IBF B;  2B4V A;  1VRT A;  4BCA A;  1IJE B;  4QCL A;  4WU2 A;  2CQ2 A;  5J2P B;  2M3D A;  5IXU A;  4ETZ A;  3H98 A;  4GTZ A;  1S49 A;  1PJ7 A;  2OPP A;  3A13 A;  1NZA A;  2FIU A;  2DIU A;  2J9D A;  2MZJ A;  2RIJ A;  3MM6 A;  5A2Q U;  4IQX A;  5DLW A;  1AZS B;  4OYZ A;  4I0W A;  6FD1 A;  3OL8 A;  2GV1 A;  4DUY F;  2K2P A;  4BC7 A;  1RK8 A;  1XTZ A;  4LRF A;  1QVG R;  2EW9 A;  1HW9 A;  1WOR A;  3JB9 k;  3GJR B;  3TZX A;  1Y3K A;  2ADC A;  2L41 A;  3JSM B;  2OHD A;  2H4W B;  1B3T A;  2CZ4 A;  2J5A A;  3QT8 A;  4FVM A;  5KT4 A;  1M1H A;  1JK9 B;  2GIF A;  4DL6 A;  4KQZ A;  4DN9 A;  1VRU A;  3KJN B;  4KGZ B;  2XGQ A;  3JXO A;  3ZZO A;  1RAO A;  4AD6 A;  4I7F A;  3KOA A;  5DM6 Q;  5DDR C;  2RML A;  5JVH Q;  4CXU A;  2NQP A;  1H72 C;  2LQB A;  2RD5 C;  2AX0 A;  4NOH A;  2VC1 A;  2HFN A;  3BQ0 A;  2R8J A;  4UPI A;  2OPS B;  5KFH A;  2HVZ A;  1IQT A;  1RSC A;  2G2Z A;  4R5P A;  4NEZ A;  5D3G B;  2AIR B;  4M94 A;  3MAA A;  4LT6 A;  4NLS A;  1X4D A;  1CJV B;  4DV6 J;  4EZ9 A;  2IIH A;  1PC4 A;  3HSJ A;  4R8U B;  2H9Z A;  1Y10 A;  1OY9 A;  2C2K B;  3RBX A;  4ES1 A;  2B4P A;  2ZHO A;  3BDP A;  2F4V J;  1N36 J;  3HHL B;  3JYT B;  3GCW P;  3RB4 A;  3HVT A;  2QL9 B;  5IM0 A;  3V5R A;  4DR2 F;  1VIS A;  4RW6 B;  1HR0 F;  2IBK A;  3M6U A;  4RUC A;  2WON A;  1WEL A;  5C2G A;  3U7J A;  2H5J B;  1RDR A;  4QW9 A;  2AEF A;  1N6Q A;  4KB7 A;  2POK A;  3BPD A;  1ZAV A;  5SUH A;  1QSS A;  1T9W A;  1ZM4 A;  2X1B A;  1TK8 A;  1KN6 A;  4WF9 Q;  1IKY B;  1NK0 A;  1Y0H A;  4BLG A;  1XR5 A;  3CED A;  2GA3 A;  2ZVS A;  1RE1 B;  2V2V A;  2Z4P A;  2XCP A;  3NKM A;  1RWK B;  2PEB A;  4OZJ A;  2O5D A;  3D5M A;  3RYL A;  2PA8 D;  3NY0 A;  3WC0 A;  2CJQ A;  5JMN A;  4N5S A;  4NE9 C;  3TZZ A;  3UQS A;  3U1N A;  5KFP A;  4ZPV R;  4C6A A;  1T9U A;  2DNL A;  2GC8 A;  2OEJ A;  3K59 A;  3TWZ A;  3D4J A;  1UA0 A;  4IRD A;  4Y34 A;  1TL5 A;  5L39 A;  2JLG A;  4IRC A;  1HBO A;  3BN7 A;  5HVF A;  3TUP A;  1AJB A;  3NP5 A;  4CXS A;  2AF6 A;  3TEG A;  5LSO A;  2QGF B;  2RQM A;  1L3S A;  3OVS A;  4I2Q A;  4PUO B;  4KHR A;  1ZTW A;  2DRB A;  1F2G A;  3KMQ A;  4TU9 A;  4X4P A;  2KYX A;  3I4H X;  3MHY A;  3QO9 A;  3R5B A;  3QID A;  1FVS A;  2VDI A;  5DZ7 A;  3PR5 B;  4ZPT R;  5C7P A;  5KFR A;  1UW4 A;  5LM7 E;  3JQK A;  3AY0 A;  3PYE A;  2VBX A;  3R6G B;  4LF4 J;  5KFL A;  5CZX A;  3R2C J;  1FJG F;  1CJU A;  3M7V A;  2V68 A;  5GMK a;  1CJT A;  1CSJ A;  4I6W A;  3C6T A;  4NPO A;  4TVA B;  4BDP A;  3FEY B;  1JLE A;  4FXW A;  5LMU J;  5CXT A;  4OX9 J;  3QBC A;  4B3R J;  4CCH A;  2J8S A;  2XNR A;  3W8P A;  1ZET A;  3C6U A;  1K1Q A;  4A8W A;  5A2Q Y;  2OPQ A;  4KHM A;  3SCK E;  3KK2 B;  2AKW B;  3H8Y A;  5ADZ A;  3V6J A;  5KT6 A;  4GC6 A;  2XRG A;  3GJS B;  3OW2 R;  2RKI A;  4KV8 A;  1VIX A;  4WFN Q;  4USU A;  1NRK A;  2DXD A;  2YTC A;  4B9U A;  5LIA A;  2C3O A;  4AQY J;  3Q2S C;  4K7Q A;  2AZ1 A;  4NWB A;  3J80 Y;  3V4I A;  3OD2 A;  5KFD A;  1S79 A;  3GQC A;  3R5A A;  3EM1 A;  1U7L A;  2WTF A;  2H54 B;  1ED8 A;  3N9U C;  4JV5 J;  1Q53 A;  1JLA A;  2I2Y A;  4FP9 A;  2EC0 A;  2H51 B;  3MR3 A;  4K4Y A;  2ZWO A;  3T1Y J;  1T0T V;  2VPX B;  2DT9 A;  3OXF A;  5A0Y B;  1VQM S;  2QL5 B;  2HQC A;  4HEA 9;  5ETO A;  4DJB A;  4ECQ A;  5J2N A;  1K0T A;  5HN0 A;  4RUA A;  3NKR A;  3CWJ A;  3D6H B;  3D0H E;  4Y28 C;  1VBY A;  4FKY A;  4P74 A;  5DG7 A;  3MM5 B;  2K7K A;  3RRG A;  4FF3 A;  2XSJ A;  3QGG A;  4JI4 F;  1FD8 A;  2OPP B;  1V5V A;  3SV3 A;  2HND A;  3EVO A;  5HRO A;  1XNQ J;  1EI6 A;  1B70 B;  2EFQ A;  2MMY A;  2NXC A;  3CDW A;  1HBM A;  3HZG A;  3MMA A;  4U7U D;  1WC1 A;  2KH9 A;  3PW2 A;  5DGB A;  3HVT B;  1X4H A;  2QSF A;  3BYP A;  4DPU A;  2ASJ A;  3HM9 A;  2HYI B;  4F25 A;  3NNH A;  5HMX A;  2FDN A;  2BJD A;  2CAJ A;  1AUS L;  4AUK A;  2CNO B;  5AE3 A;  4URG A;  1TUG B;  4LBI A;  5DDO C;  1YJT A;  2MKI A;  2CQ1 A;  3NL0 A;  1Y5N B;  3AD7 C;  3QLH B;  2J9C A;  4RBV A;  4F3O A;  4I69 A;  3DDK A;  2V2Q A;  2ZD1 B;  2VOD A;  5L38 A;  2GGP B;  3M9O B;  1T3O A;  3OR2 B;  5CCL A;  1IKW A;  4D3H A;  2M88 A;  2KFZ A;  4C0O C;  3QZ7 A;  2EEY A;  4OHV A;  2HQD A;  2QYG A;  1TL4 A;  3HZE A;  4JBC A;  4LF9 F;  5D3G A;  4RZR A;  1OSD A;  2XHW A;  2HVD A;  5DLV A;  2Z58 B;  1X5T A;  4OX8 A;  3M8P A;  2RDJ A;  3VV2 B;  2HRY A;  1UVK A;  3B6B A;  1RT2 A;  4JB8 B;  4C11 A;  2OTJ S;  2XGP A;  5D4L A;  5HMY A;  4Q43 A;  3QLH A;  2KT3 A;  4HDG A;  1D8Z A;  4WCE Q;  2W9B B;  5GMD A;  3CCJ S;  3ENW A;  5J1N A;  4X2B A;  3VGS A;  1Y7P A;  3CCR S;  2HLU A;  2KB2 A;  2HNZ B;  3MPU B;  2VG5 A;  2YH1 A;  1F1B B;  5DZ6 A;  3X3U A;  3HLU A;  3OFE A;  2QMW A;  2R2S A;  1YTY A;  1D8Y A;  5I42 A;  3H5U A;  5HAT A;  1ZTT A;  5CYQ A;  4DFK A;  2HFV A;  3AB4 B;  1HMV A;  1U2C A;  3UFC X;  3MTK A;  3T1H J;  2IHR 1;  4BC9 A;  1MW7 A;  3H0P A;  4CLY A;  4TNO A;  3HSZ A;  3B82 A;  4OQJ A;  4F3M A;  3KLG B;  2NRE A;  2R7T A;  4CWB A;  2MEW A;  1BWV A;  2D9P A;  2HQI A;  1X4C A;  2QN6 B;  3MM6 B;  4QWD A;  2OMO A;  3TRG A;  4EEY A;  2CQC A;  3DOK A;  5HL7 Q;  1N54 B;  1KQS R;  2CQ0 A;  5HSP A;  3CUL A;  5B0F A;  2E5L J;  2DNP A;  3WQP A;  4CXK A;  1HNV B;  1IR2 A;  3I87 A;  3QAT A;  2ASD A;  4GO5 X;  1C4C A;  1R89 A;  2WSF C;  2FVR A;  3N5B A;  2UXC F;  2V67 A;  1KH9 A;  4K5R A;  1JXV A;  2G0C A;  3S1T A;  3VGV A;  2BW2 A;  4M5K A;  5F8I A;  4AXI A;  2M0G B;  3KLI B;  3TYT A;  2LMI A;  3MEC B;  2YNG A;  4WXW A;  3J7A 1;  1GTE A;  4IO1 A;  2D3U A;  2KT2 A;  4PCQ A;  2DRD A;  2QEX S;  2MKK A;  2E7X A;  3IC1 A;  3MWB A;  4PYD A;  3B8H A;  4QIV A;  1VBK A;  4PXE A;  4RWW A;  4JI0 F;  4P2S A;  3UVJ A;  5A6P A;  3I0R A;  4YR3 A;  2A0F B;  2VQF J;  2AGO A;  3Q8Y A;  3V81 B;  1VMB A;  5CD4 A;  3H20 A;  4USM A;  3MAA B;  2DXF A;  3IWN C;  5HP1 B;  4RU2 A;  2NLW A;  4ALZ A;  1P8G A;  3NGD A;  1HNW F;  1HJK A;  1WI8 A;  4ZG6 A;  1F9E B;  2VJV A;  4DUT A;  3PM9 A;  5IJQ A;  1LW0 B;  1FXL A;  4LSL B;  1U48 A;  3GV7 B;  3RAM A;  2FJB B;  4XDC A;  1NO8 A;  1YIT S;  1KOO A;  2PMH A;  4ATN A;  1XJW B;  2QX0 A;  2HIQ A;  2DBB A;  4QIF A;  1SPB P;  4UPL A;  1HI8 A;  2C2N A;  1KHW A;  1BE4 A;  1MG7 A;  2XSF A;  4RNH A;  1F5C A;  1FO1 A;  4B17 A;  5F3Z A;  5KAK A;  1Q82 T;  1NDK A;  3MUV P;  2XMK A;  1TMJ A;  2ZD1 A;  4CNZ A;  3SXL A;  1JJH A;  2RJZ A;  3DHW C;  4EZ6 A;  4NXM F;  3TVY A;  1FFS B;  4USH A;  1IKW B;  1BQM A;  1WEZ A;  4CO0 A;  2VPZ B;  3K7R A;  3IN5 A;  2DHG A;  2FLN A;  1ALH A;  3LP2 B;  2CQ4 A;  1RAH B;  2C2O B;  5DQH A;  1KH7 A;  1O99 A;  3F44 A;  3FZ2 A;  3GP9 A;  4GKK J;  3PNI A;  2G1H A;  4C9D A;  3EXY A;  2YY3 A;  5CD4 H;  2NS1 B;  4V1A k;  2KXH A;  2FQQ B;  2HUR A;  3LW5 C;  1NHU A;  2X3D A;  3PRD A;  1S48 A;  4LSL A;  3PKM A;  3FSY A;  4S0M A;  3M05 A;  1TAQ A;  3H2L A;  3P45 B;  3OL6 A;  2E9R X;  1K73 T;  4CYS A;  2I5J A;  5ETS A;  3BDE A;  2HBZ B;  2IM2 A;  2JVO A;  3EGW B;  2AZ3 A;  2QLX A;  4Q5V A;  3SV4 A;  1TK5 A;  5C25 B;  2MDA A;  3IA0 A;  1CS4 A;  1IN0 A;  2R9L A;  1JKH B;  4ED7 A;  1CVJ A;  3R5D A;  4FYW B;  2PN6 A;  3HX9 A;  4I6Y A;  4TU8 A;  3GFZ A;  5KG5 A;  4CO4 A;  1F6T A;  1YX2 A;  3P5B P;  3K5P A;  5A0Y A;  2XY6 A;  2RF2 A;  4UOH A;  3HVR A;  1HNI A;  3AQP A;  4M5H A;  3S8S A;  4F04 B;  2QE5 A;  4ZK7 M;  4OV1 A;  4B9S A;  1PC5 A;  3MCO A;  4NLU A;  2OJ3 A;  1IJF B;  3OL9 A;  1CEZ A;  5D0E A;  2Q6B A;  3TP2 A;  2UUB F;  1UW9 A;  4FPR A;  3DGP A;  4OZ2 A;  1GT8 A;  3NGT A;  2NPF A;  1SJ1 A;  4YY3 J;  3FBC A;  3PY8 A;  5L1J A;  2QG9 B;  4ZLJ A;  4FS2 A;  4Y2M A;  2FHK A;  2UUC J;  4QJV A;  4KT0 C;  2DTJ A;  3TX0 A;  1FWP A;  1NH7 A;  2DEI A;  3ILO A;  4PPD A;  3LP1 B;  2F63 A;  4J5O A;  5THW A;  3JSR A;  5CQG A;  1RT6 A;  2P5V A;  3FUY A;  1A7G E;  5A8W A;  4CTA B;  2X98 A;  2RF2 B;  2RSQ A;  2M5Y A; 
#chains in the Genus database with same CATH homology
 4LR7 A;  3DYC A;  2W5R A;  3UO0 A;  1FSU A;  1HQA A;  3NKN A;  4NWJ A;  5INH A;  2W5T A;  2IFY A;  3TWZ A;  1URA A;  3BDF A;  4UOR A;  1AJB A;  4CXS A;  3NKQ A;  1ZEB A;  5L0B A;  3T00 A;  5KXA A;  3UN5 A;  4N7T A;  4ZG7 A;  2ANH A;  2W5S A;  1AJA A;  3NKO A;  2W5V A;  4LRA A;  1ANJ A;  1KHN A;  2ZKT A;  3Q3Q A;  4MY4 A;  5EGH A;  3BDH A;  4CXK A;  1KHJ A;  4FDJ A;  1ED9 A;  1EW8 A;  2IUC A;  1O98 A;  5DLT A;  1ZEF A;  2G9Y A;  3WAX A;  5C66 A;  3M7V A;  1KH9 A;  4ZGA A;  1KHK A;  4TN0 A;  3WAV A;  5GOV A;  1AJC A;  4KAY A;  3WAY A;  1E33 P;  2VQR A;  2XRG A;  3IGY B;  1HDH A;  3MK2 A;  5IJS A;  5HRT A;  5TJ3 A;  3OT9 A;  4GTW A;  3WBH A;  4ZG9 A;  5L0K A;  5LIA A;  4UOO A;  3IDD A;  3NKP A;  1EW9 A;  2W5X A;  1HJK A;  2QZU A;  4ZG6 A;  5L0E A;  1ED8 A;  3M8Y A;  5IJQ A;  4MHX A;  4CYR A;  4KAV A;  4GTZ A;  3SZZ A;  4KJD A;  1K7H A;  5DLW A;  4UPL A;  3MK0 A;  1AUK A;  2GSN A;  3UN3 A;  3NKR A;  4LRF A;  3A52 A;  4QAX A;  1P49 A;  4B56 A;  1ALI A;  2GSU A;  4UOP A;  3M8Z A;  1EQJ A;  4KM4 A;  4NWX A;  1EW2 A;  2W5Q A;  1N2K A;  1KH4 A;  1AJD A;  2RH6 A;  1ALH A;  3BDG A;  1SHN A;  3DPC A;  1EI6 A;  1KH7 A;  1O99 A;  3IGZ B;  3UNY A;  4CXU A;  5GRR A;  2IUC B;  3KD8 A;  3E2D A;  3T02 A;  1B8J A;  1KHL A;  5K4P A;  2W8S A;  4UPI A;  4YR1 A;  3M8W A;  4CYS A;  1ANI A;  1E1Z P;  1Y6V A;  5LRM A;  1E3C P;  4LQY A;  5LQQ A;  5AJ9 A;  1ALJ A;  1ALK A;  4LR9 A;  4LRB A;  5EGE A;  3T01 A;  2GSO A;  3WAW A;  1Y7A A;  1ELY A;  3B5Q A;  5LRN A;  4LRC A;  1ELZ A;  1E2S P;  3ED4 A;  3NVL A;  1N2L A;  3MK1 A;  3TG0 A;  4GTX A;  4LR8 A;  3CMR A;  4LR2 A;  1ZED A;  1URB A;  1KH5 A;  4LRE A;  2W5W A;  2W8D A;  5DLV A;  1SHQ A;  4UPH A;  2D1G A;  2XR9 A;  4KJG A;  3TX0 A;  3LXQ A;  2GA3 A;  1EJJ A;  2GLQ A;  4GTY A;  1ELX A;  4MIV A;  3NKM A;  3UN2 A;  4UPK A;  3SZY A;  4FDI A;  2X98 A;  3BDG B;  4LRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...