3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
5DLVA 1ED8A 3MK1A 2W5TA 1ELZA 1EW8A 4LR2A 2W8DA 1EI6A 1KH7A 4LRFA 2W5QA 1ELXA 5K4PA 1KHJA 4ZG9A 3B5QA 3UN5A 5LIAA 5INHA 1E33P 1ELYA 4NWXA 3BDHA 3NKPA 2G9YA 2IUCB 4UPLA 5LRMA 3OT9A 5L0EA 2D1GA 2W5VA 2ZKTA 3BDGA 5AJ9A 3T02A 3T01A 4CXUA 1ALJA 1E1ZP 2XRGA 5TJ3A 1EJJA 1E3CP 1ED9A 3E2DA 5LRNA 3A52A 5IJSA 2IFYA 2W5WA 2GLQA 5L0KA 1N2LA 4FDIA 1FSUA 1KHNA 1HQAA 3Q3QA 3TWZA 3ED4A 4KM4A 5GOVA 3TG0A 2GSNA 3DPCA 3WAVA 4MY4A 4UPHA 5EGHA 3TX0A 3WAWA 4UOOA 3M8ZA 4UORA 5GRRA 4KJDA 5LQQA 2W8SA 2X98A 2W5XA 4YR1A 2ANHA 4LRBA 3LXQA 4LR8A 1ANIA 3SZYA 3M8YA 1K7HA 1Y7AA 3NKMA 2VQRA 2RH6A 4ZG7A 1N2KA 2QZUA 3UNYA 1HJKA 3CMRA 4UPKA 4ZG6A 3BDFA 4GTWA 4KAYA 4UPIA 1O98A 4KAVA 5DLTA 3MK2A 4UOPA 3UN3A 5L0BA 3WAXA 3IGYB 4MHXA 3T00A 2GA3A 4LREA 1AJBA 1EQJA 1B8JA 4LR9A 1URAA 3NKRA 3SZZA 1KHLA 4LR7A 2XR9A 4CXKA 4ZGAA 4LRAA 1EW9A 4QAXA 1AJCA 5KXAA 4CYRA 4TN0A 1Y6VA 1ALHA 3UN2A 5HRTA 3IGZB 5IJQA 1AJAA 2GSUA 2W5SA 4GTYA 1P49A 1ZEFA 1ZEDA 1O99A 1SHQA 1KHKA 1ZEBA 1SHNA 2W5RA 3NKNA 5DLWA 4MIVA 3NKOA 3WBHA 2IUCA 3MK0A 2GSOA 1KH9A 4NWJA 4LRCA 3IDDA 4LQYA 4GTZA 3KD8A 4KJGA 1URBA 5C66A 1KH5A 3M8WA 4LRDA 3NVLA 1HDHA 1ALIA 3WAYA 4GTXA 3BDGB 4B56A 1AUKA 1EW2A 1ANJA 1ALKA 4CYSA 5EGEA 3NKQA 1KH4A 4N7TA 3UO0A 3M7VA 1E2SP 1AJDA 3DYCA 4CXSA 4FDJA
chains in the Genus database with same CATH superfamily
4ZVRB 1Q5YA 4A46A 1L3TA 4N56A 1UKUA 2AWZA 1NZ8A 3IBWA 3TQEA 3DLBA 1XK8A 3AD7C 4U95A 1FTRA 2QSFA 3CJ3A 1AUSL 2Y3YA 2ZH5A 2VA3A 3VR1A 1LWXA 3ZNJ1 2EK1A 3SFUA 2VICA 2J7UA 3TZWA 1T94A 3MMAB 3D1HA 1WI8A 3G82B 2GIRA 1U1NA 2HHUA 2JEFA 4RNOA 3NY0A 5KFKA 1PBAA 5ETRA 1JLFB 2V2QA 2LDYA 3MTKA 3NP5A 4TU9A 3WC0A 1RJJA 1ED9A 3S8SA 2YNGA 3MM6A 4OLPA 2Z8QA 1N56A 1RBLA 4UOCA 4AFFA 3K5LA 4DL4A 3MHYA 3ENVA 1CG2A 2XY7A 3MMBA 5HBMB 1N33F 3DRYA 3OXFA 2YNFA 3TUIC 3L7OA 2P9GA 5HMZA 2K1RA 2E5LJ 1VQ6S 1TVRA 4TY8B 2D1CA 2XLKA 1B0VA 4QCLA 1KHNA 4EFAC 3FCHA 5J1NA 3MM9A 1TUWA 2A1BA 2EG1A 2HIQA 4UOFA 5U47A 4HH1A 4DPTA 3ENQA 2V2VA 4WZMA 2CRLA 2DXEA 1IWGA 2F8EX 3HHKA 4OI4A 1D9FA 1H7WA 5DQIA 1LW0A 4QW8A 3JAMU 3ZNUA 4N76A 1S0NA 3DOKA 1Y00A 4F4AA 3SDEA 3BBBA 2A18A 2E66A 2O5DA 2RD5C 2QSWA 5DM6Q 3HHEA 2JLEA 2YWEA 3MAQA 2QLWA 1GMUA 1UFKA 2BJDA 4TXSA 4CRJA 3JSMB 4X62J 4X4PA 2Y1JA 3PW7A 1HJKA 1V6HA 4B3SF 2CDQA 2MLXA 3D0HE 4KAYA 3C8YA 3OUYB 3SQGB 4YY3J 3A1YG 2W8KA 1YJUA 2EFQA 4R0EA 4RWWA 3MK2A 1WJ9A 1DURA 2QFIA 3PJWA 4OI0A 3T00A 5J2PA 1AJBA 4QR0A 4UF4A 4UW2A 2PD1A 4I0WA 2FVSA 4ZGAA 1TKXB 1WOOA 2J9EA 2DIVA 4OMFG 1TQLA 3GU0A 5KT2A 1KHVA 1W7WA 1RTZA 2WBMA 4LSLB 1KQFB 1VC6A 4DFMA 2QL5B 2XWYA 3ET6B 2QN6B 4EBEA 2R8KA 3PVXA 1MG7A 1HYSA 3JSBA 4RW7B 3GLJA 4B02A 2B0GA 1TKDA 2R7UA 4E0DA 1APSA 1S1XB 3EDRB 1E6VA 3CE8A 4Y2MA 2VV5A 4WE1B 4ED3A 2KG0A 1T05A 3TI0A 1GTEA 4OV6A 1N6QB 2UUAJ 4URSA 3MXHP 1VMBA 3DLGA 2C2MB 2O1PA 2OFGX 4C8KA 1UL3A 3GONA 1VIOA 5KG0A 2UUCF 3FBFA 3ZC4A 5KOXA 3ZTRA 1N48A 1AB8A 3MR6A 3VALA 3E3XA 4CO4A 1XMOF 1HYSB 2MQPA 1VRTA 1Y9OA 1C2PA 2RNEA 3Q23A 1DRZA 2LEAA 1RWNB 3VGTA 3SI8A 1DBDA 5F8JA 1F6TA 4PQUB 4DR4J 3GTYX 3PEJA 4EBDA 2CQPA 2EFOA 1HDHA 1FFWB 4FPRA 2LQBA 3O1LA 1KN6A 2EK6A 1Q8IA 1SJ3P 1UW4A 2G13A 2VQFF 4KH1B 3CJTA 3HM9A 3B54A 5B0BA 1V9OA 2ZHAA 4DV2F 4MTPA 1C1CB 2IHR1 1IBCB 3BH6B 4RUBA 4ZVOB 3G8TA 2HNYA 2BYCA 2Y1LB 3BYPA 3KUEA 2XMAA 3K59A 4G65A 6FD1A 3RBEA 3PIPQ 3CW2C 3DRSB 4ZHRB 1K1QA 1NK9A 4I7FA 5HVFA 4G1QB 2BV3A 3CD5A 3H90A 4NRUA 3W5YA 4DUZF 1HIYA 4X4TA 3RGIA 3GV5B 5KT4A 1EQ0A 5HN0A 4RUCA 4C8OA 2WVDA 2MKIA 2AX0A 1SL2A 4DSKA 5AXKA 1H3DA 3ITHA 3CC4S 3HP6A 3EM1A 4O4RA 4OYIA 3BGUA 4L6V3 4OJ3A 1UVIA 2X3GA 2DGTA 1Z1ZA 3NGRA 3GILA 1H72C 2FJAB 1MROB 1X4BA 2OGUA 2FGOA 4RW9B 2QL7B 1RT4B 2VDIA 3UDEA 3OVSA 2CPZA 2RS2A 1E1ZP 1VQYA 2GFFA 4JI8J 1RQ0A 3CB4A 3TNVA 2IBKA 1QUVA 2DH9A 2HVZA 1H38A 3IRXA 5K8MA 5DETA 4X4QA 1UJ6A 1HWUA 4TKTA 4JI3J 3GG1A 2V8HA 2CG8A 1S12A 1JJHA 1MWZA 2IM2A 2A6MA 2K06A 4NEZA 3DLKB 4WFXA 5F8IA 3M8QA 1N4LA 3NCPA 3MTJA 5L1KA 2IVFB 1VBXA 4ENOA 1D3WA 2AYMA 2IC3A 4NLOA 2P9CA 5ETQA 1XNQF 1X7VA 2LXUA 4NLGA 4F4YA 3JQMA 5DJBA 2W9CA 4L3NA 2L9DA 5F0WA 4LF4J 1KVIA 4Q44A 4J5OA 2X98A 2E44A 1S5ZA 3H4DA 4A8QA 4DZDA 5J2NB 2XY5A 4OL8A 3NL0A 5GADU 3AODA 4QR2A 4DUYJ 4NLQA 4LF7J 1F9EB 2PA8D 1WDDA 4PG4A 3Q8PB 3S6EA 1QLNA 1FESA 1NH8A 2CNOB 4KC5A 4DDFA 2LECA 3L95X 1M5HA 4C48A 1U24A 3DOLB 5G0RB 4F0MA 2GV1A 3HT3A 2V4JA 2DNMA 1FFSB 2QC3A 2BACA 3NOGA 4KGKA 3A8EA 3TA2A 1SV5A 4DU7A 4DR6J 1AFJA 2CQ3A 2ADBA 1JLQA 3QIPA 4DN9A 1EQJA 3PACA 3Q8VA 3SZZA 4I68A 2E1AA 3CCJS 4FP9A 4A8OA 3TAQA 3PYFA 1JKHB 3W2WB 4KHRA 1EZZB 4DR3J 4K4VA 4B17A 4YHHF 3N4WA 3SMZA 3F41A 1I6JA 4AL7A 5T7LA 1YGYA 4M5NA 2AGQA 2AQ4A 3B8HA 1U45A 4CO1A 5KFCA 2V67A 3M6UA 2X1AA 5BR8J 4ECXA 4W4MA 4FF2A 4JYAJ 2F65A 2HFNA 1KLNA 1DTQB 2ZDPA 1S77D 2DHXA 1JNRB 4NLSA 1VHFA 2VH7A 2WHOA 2X1BA 3LGMA 3FGVA 1ZYQA 3RW6A 2BJ1A 3BF4A 2BJ8A 3BR8A 8AT1B 3KYLA 1DFDA 3NKOA 3HK2A 3CJSA 3ISNC 2V6AA 5L1LA 3KLFA 2C2OB 1W2IA 3GP9A 2WBRA 1Y0HA 2BRKA 1TL1A 3GWCA 2YQ1A 1SH3A 3VVTA 4HT5A 3CWJA 4WTYA 2H48B 2C3YA 3TVZA 2GAHC 3PXGa 3I55S 1PAUB 2OIHA 3WAYA 1RTHB 4UUXA 1Y3KA 3A3OB 4NLTA 3K58A 1WF2A 2B9XA 5IZHA 1FRJA 1B4SA 3T41A 2A6OA 1YX2A 2CNLB 4Q0BB 2CQGA 5LJ5Y 1K73T 1E2SP 2HZCA 2VFUA 2K1RB 3PEHA 4IKAA 3GV7B 1IR2A 4PWDA 4J9LA 1YJ9S 4QR1A 1NK6A 4LSNB 1FO1A 3HSJA 1BWVA 3BS9A 4YN3B 4DEZA 4EYIB 2QYGA 3ET6A 2QZ8A 3SBMA 4RUAA 3BQ1A 3HJFA 2W8DA 4LRFA 2V94A 4XO0A 5IT9Y 3DNCA 4WYLA 2V4QA 1YZ7A 3GV8B 3M05A 1JX4A 4HVZA 1YG0A 2AYEA 2ZH8A 4DV3J 1SJ4P 2DNYA 2VG5A 4MFBA 2IM0A 2M8DB 1RT3A 3H7HB 5DRKA 3KNGA 4WP8A 5KG4A 2COLA 1UEUA 5HANA 2CQBA 1J5EJ 5LRMA 2R7QA 4DX6A 2C22A 5F8NA 1B99A 4ELVA 4FKYA 2DNGA 3GFHA 1KOHA 1HBOA 4TU7A 2XGPA 1TK5A 4EZ6A 1HNVB 1B70B 5CYQA 1YKWA 2KYXA 4J9UE 4U7UK 2W5WA 4PQUA 3BO2A 2WRMA 2BX6A 5J2QB 2ZUAA 4CLUA 4LF6J 2PE8A 4DV1F 3PJXA 2KZZA 1FDBA 4NCGB 2GVZB 3OL6A 1N5QA 4MYTA 1S9EA 4NPOA 3HMJG 1RSCA 4JB8B 4QU6A 3KLGB 3WAVA 2D69A 4R8UB 4NXMF 4OQJA 1S0VA 4MY4A 3WAWA 2BOAA 4EZ9A 1SIWB 1YHQS 5HROB 1HNZJ 3ENAA 4AXJA 2DYAA 2B5JA 2DKOB 2Q6BA 3KK2B 1HI1A 2G0IA 4GVBA 1XERA 4RU9A 1RXOB 6FDRA 3TAPA 2YPYA 1M5KC 1WEZA 1NDPA 2LVWA 5EGYA 3MM7B 2YKMB 2OTJS 1JK9B 4X2BA 4O3PA 3NKMA 1SVDA 3SIPB 4GVLA 4USMA 4Y2KA 3ITHB 4R5PB 4ZG7A 2BA9A 4RBUA 5L9XA 3D6TB 3TAMB 1VRTB 1N36J 2DPJA 2YY3A 4USTA 4JI4F 3CMRA 5DGAA 4U8YA 1IQTA 3KDOA 4PXEA 5CQGA 5ETNA 5AXNA 5DLTA 4UOPA 4CWBA 5L46A 1U1KA 1EQMA 2BE9B 5EWFA 1IBMJ 3IGYB 3TRGA 1R8PA 2DNPA 3N6LA 1UVNA 2AMCB 3TZZA 3VHQA 1NLKL 2DXDA 1WORA 2ILYA 2R2RA 4A8KA 4O3NA 1S1WA 3MEGA 2BZ2A 3EVWA 2HIYA 2HNYB 1LK7A 2WB1D 4NASA 1UETA 2WK4A 1L3KA 3ILJA 2HVEA 1Y6VA 2RF2A 1WDTA 1AZSB 1H6KX 4GTYA 3RB4A 1KRPA 1HL6A 4DPYA 4CCHA 2DR7A 3C14A 4NMLA 2ZOFA 3WIUA 4NYZA 5CABA 1TKTB 3LF0A 1TELA 3H0PA 4C11A 2FTRA 3MEEA 1FDNA 3QYYA 4LT6A 2W4PA 4MIVA 1V3RA 1TMJA 2DTJA 4H4OA 3BKUA 3T9ZA 2KHCA 4WK3A 1FJCA 1J5OB 3J7A1 3MK0A 3GFXA 5C24A 1SUQB 5HP1A 4L73A 4ZLPA 4K5SA 1GH8A 1U6FA 2GIQA 2X51A 4O44B 2HHXA 3PO4A 1OPZA 5E3CA 1EKRA 3IRXB 4EO6A 3HCXA 2ASLA 2VBXA 1Q7YT 1HNXJ 1DQ9A 1SV5B 2R4FA 3QGPA 5DZ7A 4WIIA 3W1YC 1R27B 4P6QA 4U7CA 2HRUA 3CJRA 2R2UA 1JLQB 4NLWA 4Q7AA 3OXLA 3UO0A 2ERRA 3PRDA 1Z2LA 1G7CB 3I9ZA 1ZA2B 5L8RC 5F3ZA 3G96A 1YVFA 5I3PA 2OAUA 5KFVA 1LXNA 4XIUA 4DQSA 1OSDA 4TU8A 1JLEB 3OW2R 2HZVA 4X4OA 3DGPA 1LEOA 1YRTA 4RW6B 1CS4B 3D9BA 5CD4H 1S6PA 2KHDA 5C7PA 4DV2J 2F4VJ 3MURP 4CM2A 3T6BA 1NK5A 4F26A 1Q95G 1KH7A 3H25A 2FIUA 1P6TA 5T7LB 3ETMA 5ETMA 3VVUA 4ED4A 3C6UB 2OMLA 3PV8A 5IS2A 4B3MF 1RAJA 2OD6A 1EETB 2B7CB 2VC0A 3K5OA 3TR5A 3JYTA 2RS8A 3V4IB 1R8CA 4ID5B 3ZTQA 1IKYB 1WHYA 2BR0A 5INHA 1FJ7A 4X4RA 5IT9U 1VQPS 2DGWA 2O67A 5K5MA 1MMNA 5DG8A 2I2YA 1B0PA 2C2ZB 1HKAA 5I42B 1P9YA 2BQ3A 4CXUA 2J9CA 2OPPA 4M8LA 2X7IA 4I2PA 4O4GB 4Y34A 2VQFJ 2V5HG 4C7QA 4NCAA 2MZ1A 3DOMB 3B4MA 1KFDA 1TUGB 1UAWA 1HD1A 5ETKA 3DRPB 2DD8S 5HI7A 3KHGA 2Y0SD 1RKJA 1S97A 1VBZA 4LF7F 1JLAA 1HNIA 2RDIA 2YWFA 2J6UA 2DY9A 3M9OB 1TL5A 3LH2S 3WZ0A 5GOVA 4PZVA 3RUBL 3G71S 1EHWA 4IRKA 3ZZTA 3FBEA 4RPFA 1BQNA 1JLBB 4KAIA 2FC9A 5D15A 4UOOA 4LBIA 4QYRA 2VOPA 3AOCA 3P8BB 3PYGA 1RWOB 4RWXA 3MUMP 3CC2S 5D4LA 5F8LA 4A47A 2DO4A 4B9NA 3R7BB 4LRBA 4V19X 2LQ9A 2W01A 4IR9A 2OD4A 4U9RA 2C2DA 1R3NA 1Q81T 3AJDA 4ZVEA 4JI2F 2CQHA 3MI7X 3W62A 2UU9F 3KTQA 1F60B 4ZPDA 3RJMB 2QG9B 3CD7A 4M5HA 1XMBA 3RAXA 1TK0A 1FKPB 5M2RA 1F1BB 3BBCA 1HHSA 3BZQA 3JSRA 2JNJA 4NA2A 1QY7A 4ZVQB 2BANB 2V69A 2VG7A 4JV0A 3EPIA 5MLCV 3CCSS 3NAHA 1Q8KA 2AKWB 2OPQB 3GQCA 3K7RA 1NO8A 3MMCA 3RTVA 3CEDA 4ED6A 5EWGA 2XS7A 2KH9A 3HHLC 3OJUA 2PFDA 1DLOB 2CVEA 4BCAA 4O23A 4HI2A 3MZIA 3I31A 4L75A 3VGSA 3KJVA 1ALHA 3SDEB 4DUYF 4CO5A 2B56A 3SCLE 3T5JA 5CCMA 5IJQA 2W5SA 2GVDB 3R5BA 1LWCA 2M5YA 1SHQA 2B6AA 4NYOA 5A2QU 4WJBA 3OR1B 4MKYA 3PM9A 5IQ6A 2YVSA 2W7OA 3FZBA 3OTBA 4MYUA 2DISA 1LWEB 5AT1B 4CLKA 5JVHQ 2ZJRQ 3QAUA 3FVYA 3IC1A 3MMBB 4WZQA 1S1TA 3M6XA 4FYVB 4LBHA 3M2RA 5D3GB 4H54A 4K7QA 2UUTA 1FKAF 2FJEB 5KT7A 4IH7A 3BSCA 3HPOA 1QAIA 1VLOA 3KD8A 4GTZA 3PR4A 2DNLA 1YRXA 4C0HA 4ZN3A 3GJQB 1T8EA 2AEMA 2ZOGA 3FMWA 1J2VA 3HKWA 1LKZA 2PMHA 3FBCA 3CF5Q 1L3VA 4JI7J 1ANJA 1OIAA 4FS2A 2J9DA 3R3TA 2CPEA 2DNNA 1G3OA 2DT9A 2FJWA 3D3BJ 1RTJA 2GVZA 2YH0A 5B0CA 2P2CB 3C6TA 2IRXA 2ZC3A 3AHPA 4IQMA 3IR7B 1Q8LA 4PXBA 3IFEA 3TJAA 3K57A 2E5IA 5B0FA 4JI5J 4OI6A 3OTCA 1UVJA 2KN4A 4IG0A 3HXMA 2YWGA 1HNWJ 1RAGB 2RUGA 3ETOA 1JIHA 3QWUA 3MAHA 5KT5A 1Z4UA 2NPIA 2MQ8A 4KKOB 2W8LA 1FNMA 2XMJA 4KGXB 3E8OA 4J90A 2IMWP 3WIVA 1FWKA 4U7UD 3T5LA 3B5QA 1RT6A 1CJTA 2KJWA 1S10A 2CXEA 2H1YA 2QA2A 1RCOB 2RDDA 3A8IA 3R6GB 4H4MA 4ZLNA 2DO0A 2FZKB 1UEKA 1UFLA 1BC6A 1V3SA 2D1GA 4AYBD 3BDGA 4FS1A 3LALA 1J5OA 5D4NA 1S1UA 2EFNA 4DR7J 4BHQA 1YIJS 1FERA 3E2DA 4P7TA 5D0EA 4O44A 4R0JA 4DPXA 3AA9A 2CWXA 4JI6F 2FHKA 4NLRA 3EMTA 3R27A 1S9GB 4UQTA 1T05B 4CNZA 4DUTA 1GFWB 3WC2A 4QIEA 1KEKA 2XLIA 1PJ6A 1ELOA 4DPOA 3T1YJ 1X4DA 2GSNA 3ZXWA 1GMWD 2A3JA 4OIXA 5HRTA 2OELA 4CLYA 2CZVC 3D6HB 2QE5A 4ZPCA 1RCXB 4DV3F 5E3QA 3FBBA 3D66A 1BGXT 1JLEA 2KM8B 1EJ7L 3OHAA 1VC0A 1UP1A 2B9EA 4WF9Q 2HGMA 4RW4B 6AT1B 1UFWA 1U7LA 3SCJE 2DRAA 3CPWR 4QJVA 3W60A 3LW5C 3UQSA 1Y4ZB 4F36A 3QRRA 5HSPA 4LR8A 1TL3A 1TP7A 4I6AA 1YQHA 1AUDA 4YY3F 3KHHA 4AQYF 4V19J 2BEFA 2FD2A 3IO1A 4H4OB 4QYZK 3LO3A 1RAFB 3DLJA 1WI6A 4MJKA 1KVKA 1A7GE 3THTA 3ZTSA 5F0UA 2OPRA 3CD6S 1SUQA 1NBEB 2ZD1B 3LP0A 2WAQD 3M9MB 3QIPB 1F3VA 4GTWA 3NKYA 2D3ZA 2OEKA 3OQ2A 4WU3A 1IJEB 2ZH2A 1KS2A 5EX3A 3CCRS 4I2PB 2W7AA 1RLDA 4NLPA 4DSEA 1Q78A 3QSIA 5F9LA 5MAOA 1QSLA 3IBFB 5FJ4A 2IC3B 2JVRA 2OFHX 1C0TA 4YQWA 4LRAA 2ZHBA 1PYSB 1HNZF 1RABB 1X5PA 3N6MA 4URGA 2KZMA 1HWLA 2N4CA 1WNEA 3MM5A 5EDWA 3KLEB 1CS4A 1WELA 2PI5A 5B08A 2H5EA 1FX2A 4CIOA 2J5AA 2HFZA 2HYIB 2C28A 3DLLQ 1ZEDA 3LGNA 2NZCA 1WTBA 1N36F 2YX4A 2W5RA 2FJDB 4ZVPB 2M2BA 2JEGA 3Q86A 5HVGA 1VQOS 4I64A 3QWPA 3RBDA 1DQ8A 2FHJD 3ENWA 2EBGA 4NLDA 3W63A 1TAQA 3IDDA 1QE1B 4UY8T 3CD0A 3G6XA 1WKJA 3VZIA 4L72B 2YNHA 3BYRA 2EC2A 2HSEB 3NWRA 3S01A 4DQPA 2HQIA 1XNRF 2NQPA 1PYOB 5A8KA 4NZ7A 3OL9A 2E29A 1JXEA 2EG2A 4ZOSA 1X5SA 2ADCA 4YS2A 5IM0B 3PTWA 3V81A 3TEHB 4NZ6A 2Q6CA 5E0OA 1RTDB 4JI2J 1TKZA 1PILA 1Y5NB 3Q8YA 2YNIB 4UZCA 4OI1A 2GZOA 3AQPA 4X62F 2W5TA 4NE9C 2OTLS 2XB2D 1ZTTA 1U0HB 1FXDA 3OLAA 2UVVA 2GC8A 2MZJA 1X9MA 3J81Y 2CJKA 1RA6A 1EI6A 2Z56B 1GAOA 2Y1RI 1N0UA 2VBYA 3MAAA 4KBIA 4FYYB 5CCLA 4WCEQ 4DV7F 1N0VC 1X5OA 2XHWA 4DV0J 4DG1A 1I5OB 5KFTA 4B9VA 2EFVA 4ECVA 1F0XA 3CCLS 3RB3A 1VQ9S 3ONQA 1CEZA 5A2QY 2J0QD 2L41A 4JI0J 3I87A 1HBOB 3NNAA 4OJ1A 1MWYA 3R5JB 3O3LA 3ILLA 5GAHU 2W7PA 4Q0BA 4LIWA 3D2WA 1EJJA 2LA6A 4D3HA 1NRKA 3VGUA 2HNDB 1Y5IB 1NH7A 1SBRA 2GJIA 3BBFA 4RX6A 5GADI 3EZ5A 2NREA 5KG2A 3C15A 1FCAA 4A8FA 3MPDA 3BREA 4IG3A 3M8PA 1Y11A 5LXYA 1HQAA 5KFZA 1SC4B 5IC6B 4KIAA 2GQCA 4FNHA 3TA1A 2NSCA 3P96A 4CYUA 3T5KA 4RBTA 1NK8A 2X1GA 3KJNB 5B7WA 1JLCB 1FX4A 4MFBB 4UOHA 2EEYA 4NLVA 1CULA 4CH7A 4DSLA 3NMAA 4CLLA 3K5PA 3NCQA 4D3GA 2MQNA 2APOA 2M70A 2XMWA 3EGWB 2YWHA 2I5JB 3FKBA 1ZM4A 2OP5A 2R7XA 4FDFA 4ZVTB 3SCKE 3SZYA 2UUBJ 1ANIA 1LWEA 4O3OA 2OEMA 5JUMA 2V9WA 2VQRA 4F4ZA 2MZSA 1U2FA 4DV4F 4J9SA 2QZUA 1RTIA 4UQGA 4PUOA 1XR5A 5D3GA 4H4MB 4ZG6A 4QIGA 1SKSA 4ETZA 2JWNA 1IKWA 3A3NB 2MKKA 1BQMB 1ZM3A 3UN3A 3MFHA 1FK9A 2BXJA 2F7VA 5L0BA 1O0PA 2LXFA 4PG6A 4C98A 5AJ3J 1YDLA 3PKMA 1FTCA 3MEGB 2H9ZA 3C66A 4LR9A 3SYZA 1T3NA 3MUTP 2FLPA 4DR4F 1RWXB 1VJQA 1YWXA 5E5NA 4N77A 2B5JB 1RTJB 2NXUA 3AD9C 2BE2A 2M8HA 2RQMA 3QIDA 4TVAB 5GVQA 2GJ2A 1FE0A 2XZTB 3C6TB 3MPWA 3LA0A 5BR8F 4F4XA 3JSYA 2VZ9A 1AROP 2KI2A 3PFEA 3M1VA 4URQU 4TN0A 1T95A 1KNZA 3GIMA 2ZITA 4XPCA 5DGBA 1QSYA 3Q2TC 1U2CA 5F41A 3EVOA 1NZAA 1N5YB 2RQKA 1KP6A 2W4CA 3LGHA 2E5JA 4C11B 4QWCA 3KK1A 3V6HA 4GKJJ 4TN2A 1ELYA 1QAXA 1HQ2A 3H2LA 4CQ1A 2DHSA 1HNVA 4HTJA 2ALYB 2VQEJ 2GO8A 3AB2B 3H5UA 5I4MA 3AJ1A 1ICEB 3T9NA 2VC1A 5H1SV 1KH9A 2BKPA 2Y9HA 1IKVB 4LVNP 4C0OC 2DGVA 2DR8A 2ROGA 1UA0A 2GQQA 2NLWA 3JXOA 1HBNB 1TV6B 3AOAA 2VBWA 4LSZB 1OYEA 1SQEA 2OEJA 3EXCX 3HDSA 4GTXA 1U4BA 2CPHA 2FZCB 1K8AT 4GC6A 1HR0F 2BE7D 1KH4A 4I67A 3M7VA 5H9FK 1LW2A 3RR8A 1RAEB 2AIRB 3VCDA 4JI7F 4CXSA 1WG1A 3HSGA 3HD2A 1PKUA 5LSRA 3H40A 2I0XA 1HBUA 2Y1IA 2LFVA 4XTTA 3C16A 2YKPA 5AJ9A 1U1QA 2ASDA 1LWFB 3L4BC 4DR6F 1FA0A 4RW4A 2R9LA 2RKIA 3I5AA 4QIWD 1CJKA 2QLXA 3QFWA 4WXOA 4C0BA 5EHHA 4ED7A 4LF5J 4AL5A 2BVZA 2C3UA 2MLZA 3H98A 4IFVA 5C5JA 1QTMA 2OUGA 2HRYA 5BYSA 3WDOA 2VODA 1C4CA 4HHJA 3BDHA 4CLZA 4UPLA 3VAMA 3PX6A 3HHLB 4OX8A 1RYRA 2O3DA 5CD4A 4DR3F 4HTIA 2ZC4A 3FNNA 3H5SA 5CYMA 3ZFVA 5CA5A 5TJ3A 3UPFA 1FKOA 2PSZA 3E01A 4P10A 1FDAA 1SXLA 2IYIA 4DFKA 3R1HA 1U6BA 1NDKA 4ILLA 2W2MP 4O0NA 5GAGI 1SL1A 1AZSA 1D9DA 4PWWA 3O8WA 1SIZA 4ETXA 4ECZA 4RJVA 4KPCA 2K7KA 4KYZA 1UCNA 3GFZA 1BQNB 3D3CJ 1SH0A 4KQZA 3LWMA 4C4WA 2DNZA 2QA4G 3MM5B 3Q22A 5LMUJ 2FVRA 3KG0A 2FVQA 4MK9A 2MY7A 3OFFA 3QZ8A 1FDDA 1HA1A 5HMYA 2F40A 4ER8A 1NKBA 2A2DA 2W8SA 4J9VA 1F9HA 1U25A 1JQGA 2CWKA 5B0AA 4QWDA 4DOZA 3G8SA 3LAMA 1H98A 4O4GA 3MAAB 5E2QA 2CQDA 1NMEB 2ZH1A 1K44A 2C2KB 1FVSA 2ZBQA 1Y7AA 4DR5J 2H4WB 5JXSA 2KFZA 3NWGA 2ZJPQ 4FVCA 5GAEI 3IM9A 4XPEA 4Z7YA 1SKUB 4JI8F 4Q5VA 1T03A 3BKTA 1WEYA 1KVJA 1TK8A 3GJRB 3ZZUA 1EB0A 3CVKA 3F44A 2VBZA 1NK7A 3W3SA 3IM8A 1AW0A 4NLXA 3IGNA 2QYCA 3OFHA 2FYXA 5HBMA 1UMJA 4JI3F 4MHXA 4J9NA 1URAA 1TVRB 2JLFA 4TY8A 1Q4RA 5A8WA 1U0SA 2V68A 4LR7A 5A6PA 3KMQA 2BJ3A 1DTTA 4J7CA 4IOAQ 1EX8A 1RHQB 5IT0A 3QRQA 4KHPJ 1EW9A 4QAXA 3HKZD 1XIQA 4IOCQ 1TKZB 4Y2AA 3L9ZA 3MCMA 2DHAA 4NL5A 4ANCA 2GVDA 1UPPA 4IG3B 3BGLA 3DKDA 4ZS6A 4USWA 5C25B 3BQ0A 4DLEA 2Z2MA 1S6QB 4WK1A 3V6DB 5HJXA 1RT7A 2YX1A 2IA0A 4KY3A 5I42A 3MEKA 4YFUA 3BO3A 4LFCJ 2MSSA 1S0OA 3BPDA 2Q1LA 2GHWA 3BN7A 4YB5A 4DX7A 1WOSA 4NYPA 2PGCA 4NMXA 4RL1A 4USHA 3P4UB 1S1TB 4CTAA 5KT3A 5DG7A 4P71A 2DHGA 3MEDA 2DXFA 3M32A 1FJEB 4KO0B 1FVQA 1U26A 1VK3A 1Y10A 2XI3A 3DM2A 2ZZMA 4ES3A 3JB9k 3FUYA 3GCWP 2HFUA 5AXMA 4MIBA 3WBZA 4Q8EA 1HD0A 2BW7A 1VISA 1HNXF 2KG1A 3N5BA 2NXEA 2V63A 3Q89A 5DO2A 3QMQA 5C42B 5J2MA 1N5VA 2J0SD 4OHWA 2I9SA 2HNDA 2F9DA 4BC7A 3HVRA 1KQSR 1F2HA 1ZAXA 1V3ZA 2Z2ZA 1BQMA 2DH7A 3B78A 5ETTA 3NGSA 4ZJQA 3CDEA 1SL0A 1D1UA 2UUBF 4PRFA 1RWVB 4OYOA 1HMVA 4F0HA 3Q0AA 5D8HB 4TLQA 3G6VA 2MPUA 4DQRA 4YB1P 4HH0A 3OVBA 2ZE2A 3PO5A 3MPYA 2CQ0A 2OSQA 2AV5A 1X31C 3FQKA 4IG0B 4F3QA 2WW8A 3DYAA 5CXTA 1QDUB 4EO8A 2KFYA 2XMTA 1GMWA 2ZKUA 3VF0B 4JI4J 4WE1A 3ZZYA 4RZRA 4ED2A 1P1TA 2IAJA 3CDBA 4KHMA 1ALJA 5DLGA 2ZM6J 4CO2A 5GAGU 5AJ3F 2FHOB 3BGFA 1PC5A 4X4NA 3CDWA 3HHDA 4QW9A 2NXCA 1X4CA 2JDJA 2KRRA 3QQCD 4W98A 4OHYA 4P73A 4J9MA 4HACA 2UXCJ 1F5CA 2WVCA 1WEXA 4KPYA 3UR3C 1JLGB 1NSPA 1QM9A 4IO1A 3IWLA 2B4UA 3G87A 5KFNA 1NK4A 2IUCB 3BN4A 1MU2B 4OZJA 3HSZA 1N54B 1HQUA 3N28A 3K2YA 4JBCA 2XQCA 1NEEA 1FRKA 3TZXA 1ZH5A 2X3DA 4CI0B 3T01A 3HFZB 2FQQB 1U47A 4KTQA 2VL1A 3TJ8A 4DL6A 1NDCA 3FZ2A 3DXSX 5LMNJ 2PFFB 1G4CA 3L7UA 3LPYA 2WB4A 3KK3B 3K0JA 3F56A 3TUPA 4LVOP 1IM4A 2XCAA 3AJ2A 3DMJB 4GO5X 3W8GA 4DSJA 4B9TA 2DBBA 5GAEU 1PSDA 4G1QA 3SSSA 3DFEA 4XDDA 1X4FA 3J7ZT 1TTHB 3M1VB 1PBUA 3UFCX 1R0CB 3LOUA 1HARA 1RT5B 1S49A 4HDGA 3TEGA 1OSCA 5HAOA 2JLGA 3BSAA 4EI2A 2BQRA 2CPIA 3ISND 1N5YA 4U6PA 1TL3B 2CNKB 2D3UA 1RWWB 5L9NA 2H3EB 3OR2A 5LQQA 1HR0J 4YDXA 1X9WA 1ZPVA 4ZCLA 2D9PA 2ZH6A 2QA4S 4B3OB 1CQMA 4ERDA 3H59A 3J7Z5 2XY6A 2ZD1A 1MROA 3JTPA 1Q16B 4X66F 3V6KA 2DY1A 4DV6J 3FJ2A 3FSIA 3K5MA 4DSFA 2GHPA 3RAQA 1OY9A 1G1XA 4LFBF 4R25A 4PEOA 1WHVA 1D8ZA 4HYKA 2HNZA 4IRCA 3M30A 4B3RF 3BDFA 2XCPA 4BLGA 3VAJA 2DR9A 3QO9B 3O5TB 2J0XA 4AL6A 2XMVA 3GCXP 3Q8UA 1YJVA 3UNGC 4KJIA 2EBEA 1MSWD 3ZZ0A 1U6ZA 2J8AA 4PQAA 3DLKA 4UZBA 2FGCA 4LF8F 2HMIA 4IDKB 3QLHB 5J1PA 2F9JA 4X64J 4W90B 3RRKA 3L09A 3RRGA 2CA9A 2CAJA 3IG1A 3Q8QB 2DH8A 4DR1F 1LW2B 2DEJA 3LANA 2AJ4A 2HFSA 1X60A 2ZH3A 4X4VA 2AJ1A 3FSYA 4CP5A 4F25A 2Z4PA 1RT2A 2EKNA 2PMWA 4EEYA 4GKKJ 5KXAA 3QBCA 3KLIB 3WQPA 4FF1A 3KLHB 2IFYA 5L1IA 2RRNA 3TUJC 2L9NA 5J2NA 4PYAA 2J0WA 3G86A 5E41A 1X8DA 1AJAA 2YXLA 2QMXA 3IGVA 3A4TA 1FWPA 3OLBA 1KHKA 5ETVA 3LP0B 4HDHA 1ZEBA 1YJTA 2YWWA 3NKNA 2XG8A 2R42A 5B09A 5BXIA 5DLWA 1Q8BA 1S1VB 2WSEC 3CT9A 4AT1B 5FLXU 4Y3CA 4A8MP 2BOPA 4DLGA 2E1MC 4K8RA 1RISA 2HFVA 2LYVA 3PJ9A 2WSFC 1U1MA 4OZ5A 3C2PA 2XSJB 2YNFB 2VQEF 2HHQA 1VQNS 1HWIA 2FVPA 2CIMA 3MOJB 1VRQC 2GGPA 2VJUA 2CQ2A 2RSQA 4ICLB 4RBVA 5IM0A 2PI4A 3G2XA 1DARA 2QLJB 3Q24A 4KV8A 4E98A 3GJTB 3DGVA 2YKNA 4WIQA 4C8LA 5KFWA 1XMQJ 4ATNA 2KRBA 2G2ZA 3NNHA 2IMOA 1ZS6A 4F8RA 1KKHA 2R7TA 3VZHA 3HFVA 1VRUB 3UCZP 4JV5J 4FDJA 1NCLA 1ED8A 4KGZB 4DCJB 4RW8B 1KDNA 1T0TV 1YRUA 2HHHF 2XLJA 1Y7PA 1FRHA 1T9WA 1FJGF 1QUPA 3QT7A 3NGDA 2V2KA 3X3UA 1KD1T 4K4SA 2NZ4A 1MN7A 1S6QA 2Z58B 3IS9B 3PG9A 2WVFA 2JH3A 2CJBA 2RJZA 3EZOA 4CH1A 4ID8A 4B3TJ 4OI2A 1FF2A 1DAXA 1HLWA 2B8QA 1FE4A 1H73A 5KAKA 1E33P 4ILRA 4CZCA 1M5VC 4NWXA 4ES2A 1TL1B 1C0TB 4P74A 4CT9A 2IVMA 4LF5F 4KGMA 2QIFA 3OT9A 4ZA1A 1LQ9A 3DI6A 4KRWA 3J7YI 1I51B 3CO0P 2ZKTA 1P8GA 5DQHA 4X4SA 3V81B 3EPGA 4LF9F 1GX6A 1ZZFA 1VR6A 1ZM9A 3GYGA 3N5FA 2GMJA 3GR1A 4N8OA 4A8SA 1NB7A 1YBAA 3G6ES 2VASA 1XWLA 2K3KA 3CC7S 4B3SJ 3R6LB 2R2SA 4IUFA 5C42A 3D54A 2ROEA 5HMWA 2GCFA 1RI7A 2GMHA 2XI2A 2ZBRA 2I1RA 1E6VB 1SKRA 2XM3A 2VFRA 1N5SA 4FN5A 3U1MA 4K4WA 4FYXB 1HMVB 3TG0A 2JZ5A 1FNOA 1HPZB 2UZAA 1CULB 4I69A 3TA0A 4A4JA 4USJC 3CJKA 3LWLA 1MLAA 2DB1A 3B6BA 2PA3A 2YNGB 3MM6B 1W25A 4FYDA 3RBXA 3A8JA 4Y2CA 3NGTA 4PXCA 4L74A 3GMGA 2HPUA 2PEBA 3I82A 3KDNA 4BWMA 4YR1A 5LJ3Y 4G3IA 2WVEA 2XS2A 2O66A 4NA3A 2MMYA 2E1CA 4RNNA 4F7VA 3GYNA 3DM2B 3Q8RB 2CKWA 1TKXA 2IIHA 4DL5A 2IBOA 1IKWB 2IRUA 5KFYA 4TYBA 2CZ4A 3H8YA 3U1NA 5ADZA 1VQ8S 1R0AB 5KG7A 1RWPB 5CYQB 4YDDB 2FPHX 1RHRB 5HK4A 2HHTA 3R5GA 2IM3A 2UXBJ 1S9FA 3UDCA 1D0EA 2E5LF 4RU2A 2NYHA 1NU4A 5ITHA 1H2UX 4NI2A 2AJFE 3DOKB 2BE2B 2E1PA 1HNWF 1KLMA 4GMKA 1HW8A 2CPFA 4PXDA 2RRAA 2XR9A 2JVOA 3BGRB 3NS6A 4R8UA 4DI6A 3R1LA 3CIMA 4OZ3A 2ZBPA 2A0FB 3WX4A 4Q45A 1UPMB 4A8YA 1BQXA 4N47A 1SJRA 4F67A 1BLUA 2B3TB 3IAS9 4GVBB 4OYPA 1ZAVA 2E5HA 4WFZA 2DCUB 2OKQA 3NXZA 2ZBIA 1MNEA 3M8RA 2E9TA 1FD8A 4M95A 2HVIA 1K0VA 2WONA 4PG7A 1X0PA 3ZTOA 2F1FA 4TQSA 3M2VA 2J7KA 4LF2A 3OXGA 3OSNA 4CO0A 3ZZPA 5IWAJ 4EYHB 3OVAA 1VI7A 1RKIA 4TY9A 4J9KA 4AUKA 1N5TA 2RHSB 1LXJA 4DS4A 2IUCA 4X84A 1RBAA 1XNRJ 1DHMA 2B9YA 1HQUB 2JC0A 3I0RB 2MQQA 1WD6A 3KNAA 1S1XA 2YKQA 3I4PA 3P49B 5K9FA 2M4MA 2ZWPA 2MXYA 4LFAF 1ALIA 5LSOA 3PFOA 1U49A 1RBOB 2HLUA 4O3RA 4EK2A 3W5XA 4DR7F 1EW2A 2MKYA 5JJBA 2K2PA 4CYSA 2VKZG 1NHVA 4ED1A 4M94A 1HBUB 2HS4A 2W2NP 4EUVA 2UVUA 4DSIA 5A0YB 2VONA 5AE2A 4LFBJ 2ZBCA 1N52B 1VJWA 3C16B 3KJQB 5D78A 5DZ6A 2AZ3A 5HQLA 1S7HA 5GAHI 5L1JA 3SZ2A 2UUAF 4C3MA 4ELTA 2MHNA 2OSRA 2RKIB 4TNOA 4DV0F 1EW8A 4M5JA 2L9WA 3GIIA 3KLIA 4LF1A 5D4OA 4LUBA 2WW4A 3TARA 3A3PB 5I3UA 4K4UA 2XMUA 1S4EA 1WC4A 1JXLA 4JI0F 1ELXA 5FIIA 4E8UA 2G0JA 3FQLA 2EKYA 3HHLA 2XYHB 4OYMA 4DR1J 5IQQA 1XNQJ 1C1CA 5LIAA 5HP1B 2RVJA 3K8WA 4DXLA 3RR7A 2XTJP 1IM6A 1RADB 4M5KA 2C3MA 4Q8FA 1HHTP 2N82B 1WC1A 3E01B 2CPYA 4QPXA 5FLXY 1RWKB 3T19A 4HT7A 2W5VA 1T9YA 3W2WA 3NAIA 1E3CP 5AE1A 4ZIWA 1NHKL 3GJSB 8ATCB 4K2XA 4DX5A 2W9CB 1WHWA 2GS8A 2PEHA 1VHIA 2YBVA 1HBMA 3MR7A 3UD3P 2HHSA 1KOOA 2G9OA 3KK1B 1JJCB 2DNOA 4U96A 3HO1A 2VF3A 5LMNF 1ZETA 4PABA 3NNCA 1S79A 3MM8A 1S6PB 1X5TA 3M6WA 3TWZA 5CH7B 4ZPBA 1HQEB 2DPIA 5CZVA 1V5VA 5KG1A 2MY8A 3UW1A 3PDNA 3JSMA 3UDLA 1RU2A 3MD3A 1U48A 3EVMA 3DRRA 4GO7X 5IC4B 2ZH4A 3DOLA 2DNKA 5HVHA 3IMQJ 1YI2S 1BUXA 1NSAA 1IQZA 1AXQA 1SH2A 1OJ4A 3QFHA 2RE1A 4ID5A 3MPUB 2DR6A 2KTQA 2AEFA 4WKYA 3SSQA 5C2CA 5CYMB 1QAJA 3IAM9 1ZTWA 2CJ9A 2KU7A 3BV8A 4ZITA 2N7YA 2M52A 1PCAA 2GHVC 4DN0A 3HVTA 3MMJA 5AXLA 5DDPC 1H7XA 4B9UA 4LQ9A 4QWEA 4OYXA 3NMRA 3UNYA 1YZ6A 3ZTPA 5D0HA 2YQ3A 3MD1A 4Y0FA 4JI5F 4HL9A 5L38A 1YLXA 2HW3A 4KAVA 3DI6B 3EGNA 3D1OA 1SJFA 4WFBQ 1FRXA 1QD1A 2F5GA 3EZUA 3FFIB 4LSNA 2DRDA 4M5DB 3BB5A 4MAKA 4RNHA 5D4PA 4DR2J 1S72S 1KR4A 3L3CA 3QZ7A 2Y0BB 3KMSA 5HQMA 2Q3PA 1V5IB 2VD3A 1QJHA 1NSQA 1KBRA 2FB0A 4UUWA 2BMBA 2CYYA 3EWGA 3HLUA 1LV5A 4K5RA 3GPAA 4Z2XA 2ZVSA 3DDIA 1R8HA 4X64F 3US5A 4NOHA 4KB7A 3MFIA 3UWTA 4LF9J 2W24A 3CXCR 2PMZD 4RW8A 1CJUA 2OJ3A 2WCXA 2R7WA 4CTAB 5KFHA 5DLFA 1T9XA 3OTEA 1Q86T 4F02A 5K14A 2RRBA 2CNNB 1P49A 4F3MA 1OO0B 3AXMA 4LJMA 1RU1A 4QPTA 1IBLJ 1FKOB 2Z2YB 1T03B 4B3RJ 4PWDB 5K20B 4DV7J 1ZZNA 2RH3A 3PW4A 1GXUA 1YITS 2J8SA 2PO4A 2NXNA 1R7IA 3GZ7A 3FEZA 3T1HF 4K0KF 2AT1B 2KDOA 1H0HB 3G8QA 4MK7A 4CLSA 2JFDA 5JMNA 5J2MB 4YR3A 4KR0B 1K47A 5B0DA 3QGGA 4JI1J 3GYXB 5KFXA 1JWWA 2OPQA 9ATCB 3PY8A 4ELUA 1R0AA 1GXTA 2NR0A 3O6QA 2DGSA 3EJMA 4WXWA 5GMEA 2HS3A 1JLFA 1KWMA 2CJAA 1UJ4A 3QNWB 4OFZA 4ZPTR 3J80U 2CADA 2IJRA 2BDPA 1ZPWX 3I5CA 2XYPB 3NKQA 3ISZA 1YBUA 1X4GA 2BBEA 2QMUB 3KJVB 2AU0A 1HWJA 4A8XA 3PR5B 4NWBA 2IAJB 3NGUA 4LQ3A 2ASYA 4QWBA 3OHBA 2FY8A 3KLFB 3M8SA 2B7BB 4NRTA 3BQ2A 4DV4J 1URNA 5E3PA 4JYAF 2YKMA 1MW7A 1VYAA 3QGIA 1ELZA 2H4YB 2HQCA 3CCES 4HACB 5KFBA 1RAHB 1FT8A 2DVIA 1JKHA 3ICLA 2W5QA 3T3FA 3GFYA 2HURA 1T9UA 4XK8C 2RMLA 3QAEA 4FZVA 2RT3A 1SCJB 1R8BA 2CG4A 3IXQA 5L39A 5J2QA 1KFSA 2YKOA 2R7SA 2QT7A 5HL7Q 4DPUA 1DTTB 2LKZA 4OV1A 2FJXA 2G9YA 3MCOA 4PAAA 3LUYA 4N5SA 1I94F 1X4AA 5KFAA 4B3TF 3D67A 3U7JA 4WU2A 3HJVA 1RB0A 1MWQA 1T9TA 2RB7A 1I3OB 2CJYB 3VAHA 3CJQA 5HQ8A 3BEGB 2JL9A 1TZ0A 5LRNA 1S7IA 3VWSA 4FXWA 2LEBA 3MCSA 5FDLA 1NPPA 1S6UA 2XSFA 3OV7A 3OUYA 1KLMB 3D4JA 2LQ5A 2R8IA 4F50A 1M1KT 4GKJF 2LU2A 2IA6A 4RNMA 1G2EA 3A52A 2F8MA 1RHMB 4TQRA 1FJGJ 4ECUA 2HRTA 3VGVA 3MEDB 1XC9A 1WOPA 5J1EA 1RAIB 4AE5A 3EX7B 1CQNA 4QZVB 3I32A 1RTHA 3TX0A 4QBUA 5EGHA 4ITSA 5M2UA 1N88A 3KJFB 1PYTA 3T1AA 3NOCA 3PZPA 3MPVA 2LCWA 4YR0A 4JV2A 1PIEA 1H2VZ 2ASJA 1RT6B 5DQGA 4C8ZA 3FRZA 2RU3A 3JQJA 1BWEA 1T11A 3THPA 4NCGA 1B64A 5I3UB 1S9EB 2RQ4A 1U1OA 1WC3A 3DXBA 3H4BA 2BABA 5KG3A 1FI4A 4ZN1A 3KK3A 2RH6A 3O44A 1RWMB 1ZBTA 3BM7A 1RAOA 3GE9A 3HHLD 3RU0A 2QMWA 4UPKA 1WKLA 2E7WA 2MZRA 1REGX 2UV8G 3R5CA 5KFDA 3C19A 4DF4A 2BKOA 3B4DA 1HFEL 2G0CA 4Y28C 3QLHA 2HK2A 4UOGA 3QRPA 1IN0A 1P27B 2ILZA 3R9LA 3NGKA 3TOQA 2UXBF 2K3IA 2C2EA 1VQMS 3GIKA 2DEIA 4M63A 2FY1A 2MKJA 5IXUA 4P7VA 4O3QA 2D3O1 1GX5A 3AQOA 2MJUA 3TANA 1VBKA 1XEZA 3C6UA 2ATLA 3QT6A 1W2BR 4LFCF 1JLGA 4I56A 4PYDA 3IP0A 1F2GA 2QRRA 2ZOMA 2ZWOA 4MKVA 1RACB 3R97A 4ECSA 1R6YA 3UN2A 4RNFA 3PKYA 3BGOP 3QT5A 4G6VB 1CBKA 4LMZA 3PNIA 3ZO7A 2NS1B 3JAMY 2G1DA 2MQOA 1SKWA 5KFGA 1ZEFA 3U27A 1O99A 2N4DA 3R7NB 4USKA 2E9RX 2HNZB 3M2UB 1ACMB 1KTVA 3T6JA 3LAKA 1S57A 2FHJA 4F2SA 4RKUC 3TVKA 3IR5B 8RUCA 1RDRA 3W5ZA 1HNIB 1JLAB 3AB4B 1SJ1A 2CUYA 1XR7A 2RIJA 5F3TA 2GSOA 5IWAF 3HSDA 1UWAA 4I2QA 2ZEJA 3TW0A 3DGPB 5A76A 5LMUF 5B0GA 2GA7A 2L3MA 3RW7A 3RB6A 1OY6A 3MM7A 1ZM2A 1UJ5A 1TL7A 2FUG9 2HBZB 2P6SA 3ADAC 2QX0A 4ZVSB 5CYJA 2MHEA 2XS5A 1ALKA 3UCUP 3MEEB 3OR2B 2BJ7A 4WYWA 5CZXA 4DJBA 1UA1A 2B8PA 4NX9A 4Z37A 3NS7B 4LFAJ 3KLEA 2JFKA 5BJRA 1K1SA 2UUWA 4DV5F 4NZ0A 1FEEA 3VAFA 3R5DA 2IDLA 3IWNC 5DLVA 2EXUA 3DRXA 3IS9A 2UXCF 3M8QB 4UTGA 2D9OA 5FD1A 1UVLA 3CDUA 4LR2A 4PR6A 3ZZOA 3JS9A 1YJWS 4HI1A 2BW2A 3AT1B 1CJUB 4P52A 1S0MA 1NJIT 3DRPA 1FKPA 1KHJA 3E51A 2DRBA 1DQAA 1P1LA 2GMLA 2FDNA 2WOMA 3HF5A 4ZKAA 2XC9A 2HMIB 2CZ9A 1I1GA 3TYTA 3V2UC 2BANA 2RF2B 1Q53A 2MQMA 4CM0A 1X9SA 1D8YA 2AJ0A 3HULA 2DIUA 1HW9A 2HGNA 3MMCB 1S48A 4DHVA 2W9BB 2DNQA 4HHHA 3HZGA 4QIVA 4F04B 2B4VA 3T02A 4K59A 2HWHA 2XRGA 4ZP7A 3A13A 2PC6A 2W1BA 4OZLA 1JB0C 5ETOA 3RYLA 2O01C 1EETA 2XZDB 4H4KA 3BPSP 5BYRA 1IKYA 4IRDA 4OX6A 3KG4A 1U1LA 5F8HA 1LWCB 1R6VA 2K7JA 2PT0A 1RUSA 3T1HJ 4FXDA 4F4KA 4K0KJ 1U0HA 3Q3QA 4XDCA 4KM4A 4ZP8A 2XNQA 1SQGA 3OR1A 2HAFA 2KJVA 1VCTA 4CDIA 4YMEA 3KUHA 2ZNZA 4ZJLA 3HFKA 5A6WA 4DG1B 1BD6A 1M1GA 4FYWB 3T5HA 3MF5A 4KJDA 4KT0C 2SXLA 2IJNA 2FLOA 1N32J 5K8NA 4WTOB 2JJ4D 4BC9A 1TFYA 4HKQA 2DGQA 4DU8A 2VG7B 4ZVUB 4OYBA 7FD1A 2B43A 3M8YA 4NXNJ 1BMQB 2BM1A 2H51B 2QA1A 2ZUGA 4KV8B 4ANEA 1DZ5A 2GJFA 4DX8H 2KXNB 3QATA 3K89A 1OWXA 3BO4A 3VAKA 1JLBA 1DLOA 3OD2A 2LMIA 1OYDA 4QYZJ 1S6OA 3RZAA 4LF8J 2RAQA 3K5NA 3W8PA 2CDRB 3K8VA 2MLYA 3I4HX 3MECB 1FD2A 3NLCA 3UDVA 3CMAS 2CJQA 3M8PB 2V8PA 2MKCA 3I0SA 3CCTA 4CH0S 4X65F 3H5YA 1GQEA 3WAXA 1ZAWA 1O51A 4RR5A 4CXKA 2MZTA 4QQBA 4FNIA 1YJ7A 4KFBB 3W2VA 4KKOA 3CCQS 2BKNA 1Q79A 4JP8A 2V34A 1EIYB 4WP3A 1IKXA 4ZLLA 3J7AN 4ZPWR 2OH2A 3RG6A 1KC8T 1IXKA 1WACA 1VGYA 5KG5A 1IJFB 2EVZA 2ZNYA 1LK5A 5BYQA 3OJSA 2Q66A 1IVZA 2XO6A 5KT6A 2NXJA 2V2ZA 4OX9F 2GSUA 2ZH7A 2YWKA 4NXNF 1VIXA 2VKRA 4DUZJ 2E9ZA 2DCLA 3PYDA 2R8JA 2F8HA 1VQ7S 2UU9J 2FLLA 1O6XA 1VDHA 2MQLA 1RTIB 2J6TA 4PUOB 2HZAA 4OX7A 2QLBB 4DQQA 1EP4B 2DK2A 2VDHA 3CUNA 2MJNA 2Z0GA 4NI2B 2JSXA 3M4XA 1S9GA 3AOBA 2W9AA 1NAQA 1A0OB 1S99A 4TYAA 2J9DE 2VG5B 1WC6A 2R7OA 3H2UB 2V8DA 3TZYA 2V4RA 4W92B 2KT2A 5LT5A 2POKA 1PO6A 1M5SA 1RWUA 2KYZA 1KH5A 4LRDA 3UR0A 3DLHA 1PAEX 5EX0A 4B56A 4HR2A 2CQ1A 4WBFA 5A0YA 1SC6A 4TLRA 3VQTA 3CMQA 3SV4A 5ETPA 3SEOA 2V8GA 4DFJA 3KOAA 5DDRC 1MN9A 4N7TA 4PPZA 1FEHA 5EUHA 2BM0A 3G9CA 1K9MT 3POTB 2Z2LA 1YK9A 1CJTB 5IV4A 4U67Q 2HHHJ 4K50A 3J7YU 1U8WA 4JI6J 2HEKA 2ATCB 4X4UA 2V8VA 2W4DA 3M2VB 2M7SA 5HATA 1IBLF 1FXLA 1N34J 3HD1A 2VHGA 4C97A 3TQ1A 4FVMA 1OQ3A 3S7RA 4EU0A 3T1YF 1UTAA 1WSVA 1HWKA 3K17A 3V6DA 2H65B 2UUCJ 4J91A 5K4PA 3FEYB 4ZG9A 2D3OR 3NRBA 4LF4F 1LFWA 1ZOTA 2GO9A 2AW0A 2CQCA 4OYWA 1IKVA 3B82A 5EWEA 2PDAA 2E5GA 3NKPA 2XWXA 4ECWA 3AA8A 2ZFHA 5SUHA 5GMKa 4ZDNA 3D6MB 4K4TA 3BDPA 3SQOP 5KFOA 2VPXB 1RA7A 2CPDA 3DDKA 2MKSA 1HBMB 4OLOA 4YR2A 2HGLA 1CVJA 2I6WA 4DS5A 1FHTA 1VBYA 5B0EA 2VIHA 4PCQA 4OHXA 3TUZC 1VK8A 2IPOB 4OI3A 5E33A 2AYBA 5IJSA 1SJQA 2GLQA 3LQVA 1YSJA 1UEVA 2WONB 3D28A 4DBQA 1NNDA 4ECQA 2GIFA 3SCIE 1EAYC 1W26A 1VFJA 3MWBA 3N79A 3OTDA 2ACYA 4ZCMA 3I56S 1XMOJ 3CDAA 3CJ0A 5K8PA 3ED4A 2NSBA 3GR0A 2M9KA 3HX9A 4WPAA 1XR6A 3DPCA 2ZM6F 3F73A 1N33J 3H5XA 4UPHA 2H54B 3TJ9A 1WC5A 3PYEA 3QPIA 2UVWA 1IR0A 1L5UA 3WX8A 2OPSB 4UORA 3QSYB 1CSJA 2IDEA 2IY5B 3HVTB 2ABYA 3NG8A 4B08A 4C6AA 3N6NA 4P2XA 2IJFA 3IRWP 3LXQA 1FXRA 1B0TA 2DNHA 2DGUA 1UW9A 2VFTA 2JEJA 2HQGA 5A8KB 3VAGA 5DDOC 4DZ6A 1RT1A 1C0UA 4EWTA 2RDJA 2GQ2A 2XMMA 2E7XA 5D0RA 3I5BA 4ECTA 1VQLS 2B4PA 4JV5F 4M5DA 3CCZA 4PWUA 3P6YC 2CFXA 3BKFA 3R7SB 4J9RA 3RRHA 4ZIVA 4DF8A 4IO9Q 2M88A 3S1TA 3UVJB 1U1PA 1MMDA 3BR9A 4QOTA 3M9NB 1HQEA 3LPEA 3UD5A 1SC3B 2GX8A 3CGIA 2OO4A 3HVAA 2ZVIA 3FMBA 2HLTA 3H2VE 4LREA 1XJWB 2HK3A 1A9NB 1B8JA 4F2RA 3DRRB 2V9KA 3LP1A 4KSEB 4G1PA 2AGPA 1QTNB 2FLNA 2NUUG 2BJ9A 3VAIA 1S1UB 1T02A 2B9WA 5THWA 3R8YA 5HMXA 3EXYA 3KHRA 1GT8A 2N7CA 3D68A 5K14B 1XMQF 3NBPB 3DN9A 3TVYA 2FVCA 4CT8A 4P2FA 3CCMS 1FRLA 1RLCL 4IH5A 5E7OB 2UXDJ 3GB0A 2AEJA 1Z2ZA 4PPDA 4K4XA 4IR1A 3UI3A 2ACMA 2M3DA 2HBRB 4N8NA 2NCKL 4RW6A 3THVA 3OSPA 4L3KA 2M0GB 4KJGA 4X66J 1QAYA 4DPWA 4DV6F 1XBWA 2VFVA 3QGHA 2J7WA 4MK8A 5KFEA 5IFMA 1NKEA 1IWAA 4K4ZA 3P3DA 3SFGA 2GA3A 2HFOA 3W9JA 1WG5A 1RHUB 2E7VA 4ZPVR 3FFIA 2HVHA 1GXLA 4JOUA 4NWJA 3MM8B 4LQYA 2RUSA 2YNIA 3J80Y 4RO0A 1RZMA 2CPXA 1RYSA 5KFRA 1KQKA 4I4BA 2HWIA 4DWIA 2JOQA 2BRLA 4DL3A 2HHVA 3OTOJ 1AFIA 2P6TA 2V50A 2HQFA 3BDEA 2NUHA 4IH6A 2C2RA 4NEYA 4YB7A 2WZ1A 3MECA 4ZVHA 3QJPA 2QFJA 1AA1B 2HWTA 4GKKF 1AJDA 3D0IE 2BJEA 2PIIA 3SQGA 1QE1A 4M5MA 3MR3A 1N8RT 2P9EA 3L7PA 3MDFA 4KFBA 4ZK7M 4YOEA 3FK4A 1RGVA 5IV3A 3W65A 2IVYA 1PG5B 2Q43A 3P5TL 4CNYA 4WKRA 2IYGA 1R43A 1WG4A 4FKXA 2KKHA 5LSLA 1Q0NA 1WTFA 2P5VA 1YJNS 4YP3A 1F5BA 3A12A 5IT4A 1SB6A 1VQSA 2B4OA 5A8RA 2YTCA 4M1KA 3GSIA 3CJ2A 4MKAA 5RUBA 2XBPA 1FNXH 4FF4A 2EC0A 1UZDA 4LSLA 1AYEA 1RTDA 3C15B 1KTQA 1O5JA 1TR0A 3I96A 2DGXA 2V0NA 3CCVS 1R8AA 3KLVA 3DCAA 3FCWA 4L76A 2JX2A 2JRSA 4RW7A 1QVFR 1LNQA 1NM2A 3MCNA 2MDAA 2J6SA 1CC7A 2MYFA 2KB2A 7AT1B 5T14A 1URRA 4OHZA 2X1FA 4ILMA 1NJYA 2R3VA 3G82A 3SV3A 1L3UA 3LTOA 1M5PC 1B7FA 5KFMA 2G2OA 2VB6A 4OJHA 3NCRA 2WSCC 3DLGB 3GG0A 2QO3A 2ZE2B 5H9EJ 2AZ1A 3EICA 3HHNB 2EPIA 2C42A 2I5JA 5H9EK 2MKHA 4IOBA 2FJVA 1XTZA 4CLWA 5KFJA 1NB2A 2FC8A 4DQIA 2KT5A 3ZZZA 5KFPA 3CCWA 4FPIA 2DITA 2N3OA 3PHEA 4DCPB 1F5AA 5CAAA 2YH1A 1WUUA 1SQFA 3DC2A 1NJWA 3EE3A 2CQ4A 2ZZNA 1TU0B 2C3OA 1LFPA 1X0FA 1JJ2R 3G4SS 2XNRA 2E1RA 1E6YA 2HG4A 5HLFA 3D6FB 2HHWA 2LP4A 1FWLA 2EFPA 2DHHA 5D6GA 1J5EF 2WTFA 3HT0A 2XYGB 2L48A 1K7HA 4V1Ak 2B6AB 1N32F 3OL7A 1T7PA 2IM1A 2W2OP 3CSKA 4ZVFA 4YHHJ 1N6QA 3CJ5A 5KFUA 3IR6B 5C2GA 1EARA 3PRBA 9RUBA 5DDQC 4NLYA 4P72A 1IBKF 1NXIA 1O8BA 3SXLA 3M2RB 4GC7A 5J1EB 1NPRA 4DV1J 1R31A 1GNKA 3RBZA 2RQCA 3H42A 1KHLA 1X4EA 2F3JA 4Y2IA 1FRMA 1PJ5A 5T41A 3MR2A 2QTWA 3MGJA 2KVIA 4MH8A 4Q2MA 1CJKB 4QIFA 2HS0A 5J2PB 1RT5A 2WVBA 4Y00A 1AJCA 4RW9A 4IFVB 3UCGA 4M5LA 4X65J 2DNRA 3GSDA 1QSSA 2Y8WA 4C8YA 1FK9B 3M2UA 1PJ7A 2I38A 2MGZB 3N0VA 1A6LA 3DU5A 4USUA 1C1BB 4ZMMA 2F4VF 5E3AA 4H4KC 2ZJQQ 2OPSA 1M1HA 4RUHA 2BUNA 4DL2A 1SHNA 5FDLB 2CPJA 1M5OC 1B3TA 3WHIA 4JI1F 4ZPAA 4OX9J 4CYUB 4WFNQ 1REVA 2FHMA 3WBHA 3QO9A 5JVGQ 1HI8A 4ANDA 4J9PA 2R7RA 3ULHA 4Q2LA 3JTNA 4IYQA 5F8GA 4LRCA 2XO7A 2VPYB 1U02A 2ZDOA 1RT1B 3ELHA 3H20A 1KHWA 4IFYB 3QJJA 1ITPA 1URBA 4IDKA 3EGZA 5C66A 3R2DJ 3M8WA 3FRYA 3NVLA 3FCVA 3OL8A 4K2JA 3V4MA 2C2NA 3BDGB 1AUKA 3AH6A 3EGVA 1RT2B 4YEAA 2LXIA 3KHLA 2VFSA 3KLHA 1GEHA 3IBCB 2C3PA 3BSOA 1CPZA 4ECRA 2LA4A 4NCBA 4CLFA 3LP1B 3BSNA 3DYCA 1TMMA 3AD8C 2B51A 2HAIA 3LP2A 4LIRA 2FJBB 1JMTA 5D77A 1D09B 3EYZA 3CJ8A 4S0MA 4G1IA 3BH7B 1IBMF 4ZLJA 4PG8A 3DRSA 4ZHRA 2I8EA 2U2FA 1L3SA 1N34F 2LEPA 1T3OA 2YQ0A 2BQUA 1NHUA 3P5BP 4I2QB 1UVMA 3UN5A 4K4YA 2VG6B 3Q8SB 3C3LA 2D7SA 1Q5VA 2XSJA 2EI5A 3W64A 2DGOA 3D0GE 3FEXB 1C0UB 1Q7LB 3R5AA 2R8HA 3TP2A 4DFPA 4ZJOA 4J9OA 2DR5A 1CJVB 2W25A 1BE4A 2HKEA 3DHWC 3KXDA 5K8OA 4O0IA 4EMDA 4O3SA 1TAUA 3W9IA 3JQKA 3KWMA 2OPRB 3IA0A 1WKKA 4JUZA 3ZZRA 5C25A 4YB6A 1AT1B 2RILA 1DTQA 1Y5LB 4I1TA 2LQ8A 3CO9A 3AAWB 2QJ3A 3I6PA 4C8MA 4C3LA 1U1RA 1GK8A 3PW5A 1IUJA 1VRUA 1B7YB 1UWBB 3P45B 4OHVA 4CLTA 4N41A 4C9DA 2XZWA 4FDIA 1ULRA 4FBTA 1MMLA 3DLEB 2GNKA 1FSUA 2J76E 2H5IB 2L08A 3PX0A 3RB0A 4C2MA 1NSKL 1JNZB 3VTIA 4ED8A 5G4DA 2IRYA 1UZHA 4LF6F 3NBPA 1JXVA 2KM8C 3GIJA 4KO0A 2WOMB 5E3RA 3CCUS 2W2QP 1LOUA 3QT8A 1KONA 4KE5A 3EDQB 3R2CJ 1WF1A 3ILIA 3CIZA 1RE1B 5GRRA 3PCOB 3W66A 4ES1A 3AXKA 4NXMJ 3F0NA 2W9BA 2R2TA 1T9VA 2ANHA 1TL7B 4ZP6A 3AY0A 1VC5A 3PW0A 4MMOA 1RK8A 1YJRA 2QL9B 3G6YA 2AX1A 4MT1A 1YTYA 2VJVA 1N2KA 2LDIA 3HVWA 4UPIA 1NKCA 2OHDA 1O98A 1H74A 3FSXA 1OPIA 1J27A 4UY85 2ROPA 7FDRA 1RHKB 1RT7B 3I9V9 3PHTA 1S59A 5G0RA 4F3OA 1WF0A 3D1QA 3W2VB 2ALZA 1VLYA 3M6VA 2YNHB 1XN9A 3NKRA 3PRVA 3N9UC 3IWXA 3CTRA 3O2IA 3KUGA 2YKAA 3D5MA 1D9AA 3KKFA 5HO4A 1HHQA 5KFIA 4OZ1A 3TX8A 4QWAA 4I6YA 4CYRA 2AYGA 3MM9B 2Y8YA 2QEXS 4CO3A 1I94J 2EFGA 4WWSA 2RHQB 1R89A 1OS5A 2A10A 1S76D 4HLBA 1G6BA 3W9HA 2R8GA 2VPWB 3ILOA 1P9QC 5A8RB 1H2TZ 3MMAA 2MZQA 2UXDF 1CLFA 5KFLA 2MTLA 1DJ0A 4AXIA 3Q2SC 1SPBP 2CQIA 2GAGC 1E6YB 3OBIA 4RLEA 3W7BA 3KLGA 5HLFB 3CULA 3CNQP 4BS2A 4NLUA 4FF3A 2KXHA 2Z57B 3DMJA 3U02A 3PIOQ 1U8SA 1Q82T 1NDLA 3OFGA 1HI0P 1BY9A 1KSPA 5D0GA 3KK2A 3J81j 2LU1A 5LXRA 1Y3JA 1M90T 4DR2F 5F9NA 2JHEA 4KHPF 3BGRA 3OFEA 2KT3A 3OPKA 4DV5J 4P9SA 4ZVGA 5H9FJ 1TL4A 3M32B 2R7VA 4AD6A 5EGEA 2YX7A 3SSRA 3OTOF 2LQJA 4MKBA 3TAMA 2AD9A 2XEXA 2D74B 2CVIA 4F4WA 2HBYB 2ZH9A 2CJXB 2VA2A 2MB0B 4MIWA 1VQKS 2G2YA 2JEIA 1K0TA 3MK1A 5I3QA 3U1LA 2XHCA 4HEA9 4BDPA 3DDNA 2VU5A 4F0KA 5A8WB 4FBUA 1LW0B 2HVDA 2JC1A 1UVKA 2UV8A 4YUDA 3MR5A 2AHOB 2DJWA 1OQ6A 3M30B 1F9FA 1FRIA 3NEKA 1JLCA 1ZA1B 1F3FA 1TFWA 1VQ4S 3UE2A 1C1BA 2VPZB 4Z7CA 2HQ3A 3I0RA 3I0SB 1QVGR 2K8GA 4P75A 5HROA 3DYAB 4B3MJ 1NK0A 3HZEA 4AQYJ 5HJYA 5L0EA 1U2RA 1IKXB 4Y65A 4ED5A 1RT3B 2RU9A 5LM7E 1IR1A 1BHNA 2XULA 1M0SA 3C14B 4PG5A 5GMDA 2Z30B 4IFYA 2OMOA 3AFGA 4PKDB 4P2MA 4R5PA 4JV1A 4WFAQ 4A8WA 5IOLA 4OYZA 4MIAA 2OI2A 4ALZA 3V6JA 5L0KA 1N2LA 3HI9A 4LBPA 4HHUA 2P8IA 1R0BG 1SC1B 2KVQE 5DS7A 5KTQA 4B3OA 4J37A 2AJQA 3TO8A 3VQSA 1U09A 2UVRA 1WC0A 5SZTA 4ECYA 1EP4A 4OYAA 4B9SA 3JTOA 3BJYA 5KOWA 5DM7Q 2A2CA 2F63A 4I7FB 3M8ZA 4ED0A 5KFSA 4IQXA 2MGZA 3LP2B 4GRSA 2UP1A 1S1WB 1BXNA 2MEWA 3DU6A 4M5GA 5LOQA 1PGZA 2AP6A 4BBYA 2QV6A 3V5RA 2W5XA 1YBTA 4OJGA 4M5IA 4DCOB 1NJXA 2KXFA 4ICLA 4OZ2A 4Y6IA 1VQ5S 2H5JB 1REVB 4USVA 2NPFA 3IG1B 2AGOA 3GIRA 3QJLA 2HBQB 2AF6A 1KQGB 3PX4A 2VUGA 3POTA 2IFXA 4WFYA 4EGLA 2YKNB 3RAMA 5F8MA 1EKSA 4DL0C 2C1EB 2NYIA 5KFQA 4C8NA 2KL8A 3W61A 1X4HA 2PN6A 3IN5A 3PW2A 2KFNA 2QLFB 4KGVB 4WP9A 4B9MA 1FFGB 3KFWX 3FDSA 4KH0B 3MUVP 1NJZA 1CC8A 1HBNA 2GW8A 1TV6A 4ZP9A 1MU2A 2G1HA 2XGQA 1S4FA 3UD4P 5AE3A 2EWHA 1DY3A 1XQIA 3NS5A 1JJ4A 4A48A 4DMZA 4QU7A 2W2PP 3J81U 5LL6d 5KG6A 1GTHA 1SI9A 4I6WA 2N3LA 1OMSA 2HQDA 4J9QA 4XAKA 3Q83A 1RHJB 2ZHOA 3VV2B 4UT4A 3MOZA 3IGZB 1NUEA 2OLWA 2GGPB 4ZCIA 1RP5A 2KO1A 2AJ2A 1TUVA 1NPKA 1VS3A 4FXVA 4EBCA 2VG6A 2EW9A 1LWFA 4USIA 4Q43A 2G4BA 2ZZTA 3UVJA 1GMVA 3DHXA 4OZNA 5ETSA 1IBKJ 4P2SA 1RT4A 1TKTA 1C4AA 1PC4A 1OY8A 1Q1KA 2QGFB 2U1AA 3A8KA 1CJVA 4NA1A 4E2FB 5KFFA 1WWHA 2FZGB 3EUNA 4DR5F 4U8VA 3CMES 1VOMA 2V4JB 3JYTB 3N01A 3V4IA 4B9LA 3X1LB 5EN1A 2F4FA 5C24B 5ETLA 1HPZA 5M2PA 2VOOA 2HHPA 3KG1A 1RAAB 3CJKB 1WHXA 3E2EA 2MSTA 1S1VA 2Q79A 3D7SB 4BWJA 2LLZA 1ROFA 1UWBA 2OPPB 3C46A 2XMKA 2YPZA 3CJ4A 4C3KA 5DG9A 4DL7A 3DLEA 5CHCB 3FC9A 4OZ0A 4ZCKA 4CLPA 1WSRA 3DOMA 2D41A
chains in the Genus database with same CATH topology
5DLVA 1ED8A 3MK1A 2W5TA 1ELZA 1EW8A 4LR2A 2W8DA 1EI6A 1KH7A 4LRFA 2W5QA 1ELXA 5K4PA 1KHJA 4ZG9A 3B5QA 3UN5A 5LIAA 5INHA 1E33P 1ELYA 4NWXA 3BDHA 3NKPA 2G9YA 2IUCB 4UPLA 5LRMA 3OT9A 5L0EA 2D1GA 2W5VA 2ZKTA 3BDGA 5AJ9A 3T02A 3T01A 4CXUA 1ALJA 1E1ZP 2XRGA 5TJ3A 1EJJA 1E3CP 1ED9A 3E2DA 5LRNA 3A52A 5IJSA 2IFYA 2W5WA 2GLQA 5L0KA 1N2LA 4FDIA 1FSUA 1KHNA 1HQAA 3Q3QA 3TWZA 3ED4A 4KM4A 5GOVA 3TG0A 2GSNA 3DPCA 3WAVA 4MY4A 4UPHA 5EGHA 3TX0A 3WAWA 4UOOA 3M8ZA 4UORA 5GRRA 4KJDA 5LQQA 2W8SA 2X98A 2W5XA 4YR1A 2ANHA 4LRBA 3LXQA 4LR8A 1ANIA 3SZYA 3M8YA 1K7HA 1Y7AA 3NKMA 2VQRA 2RH6A 4ZG7A 1N2KA 2QZUA 3UNYA 1HJKA 3CMRA 4UPKA 4ZG6A 3BDFA 4GTWA 4KAYA 4UPIA 1O98A 4KAVA 5DLTA 3MK2A 4UOPA 3UN3A 5L0BA 3WAXA 3IGYB 4MHXA 3T00A 2GA3A 4LREA 1AJBA 1EQJA 1B8JA 4LR9A 1URAA 3NKRA 3SZZA 1KHLA 4LR7A 2XR9A 4CXKA 4ZGAA 4LRAA 1EW9A 4QAXA 1AJCA 5KXAA 4CYRA 4TN0A 1Y6VA 1ALHA 3UN2A 5HRTA 3IGZB 5IJQA 1AJAA 2GSUA 2W5SA 4GTYA 1P49A 1ZEFA 1ZEDA 1O99A 1SHQA 1KHKA 1ZEBA 1SHNA 2W5RA 3NKNA 5DLWA 4MIVA 3NKOA 3WBHA 2IUCA 3MK0A 2GSOA 1KH9A 4NWJA 4LRCA 3IDDA 4LQYA 4GTZA 3KD8A 4KJGA 1URBA 5C66A 1KH5A 3M8WA 4LRDA 3NVLA 1HDHA 1ALIA 3WAYA 4GTXA 3BDGB 4B56A 1AUKA 1EW2A 1ANJA 1ALKA 4CYSA 5EGEA 3NKQA 1KH4A 4N7TA 3UO0A 3M7VA 1E2SP 1AJDA 3DYCA 4CXSA 4FDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLV A;  1ED8 A;  3MK1 A;  2W5T A;  1ELZ A;  1EW8 A;  4LR2 A;  2W8D A;  1EI6 A;  1KH7 A;  4LRF A;  2W5Q A;  1ELX A;  5K4P A;  1KHJ A;  4ZG9 A;  3B5Q A;  3UN5 A;  5LIA A;  5INH A;  1E33 P;  1ELY A;  4NWX A;  3BDH A;  3NKP A;  2G9Y A;  2IUC B;  4UPL A;  5LRM A;  3OT9 A;  5L0E A;  2D1G A;  2W5V A;  2ZKT A;  3BDG A;  5AJ9 A;  3T02 A;  3T01 A;  4CXU A;  1ALJ A;  1E1Z P;  2XRG A;  5TJ3 A;  1EJJ A;  1E3C P;  1ED9 A;  3E2D A;  5LRN A;  3A52 A;  5IJS A;  2IFY A;  2W5W A;  2GLQ A;  5L0K A;  1N2L A;  4FDI A;  1FSU A;  1KHN A;  1HQA A;  3Q3Q A;  3TWZ A;  3ED4 A;  4KM4 A;  5GOV A;  3TG0 A;  2GSN A;  3DPC A;  3WAV A;  4MY4 A;  4UPH A;  5EGH A;  3TX0 A;  3WAW A;  4UOO A;  3M8Z A;  4UOR A;  5GRR A;  4KJD A;  5LQQ A;  2W8S A;  2X98 A;  2W5X A;  4YR1 A;  2ANH A;  4LRB A;  3LXQ A;  4LR8 A;  1ANI A;  3SZY A;  3M8Y A;  1K7H A;  1Y7A A;  3NKM A;  2VQR A;  2RH6 A;  4ZG7 A;  1N2K A;  2QZU A;  3UNY A;  1HJK A;  3CMR A;  4UPK A;  4ZG6 A;  3BDF A;  4GTW A;  4KAY A;  4UPI A;  1O98 A;  4KAV A;  5DLT A;  3MK2 A;  4UOP A;  3UN3 A;  5L0B A;  3WAX A;  3IGY B;  4MHX A;  3T00 A;  2GA3 A;  4LRE A;  1AJB A;  1EQJ A;  1B8J A;  4LR9 A;  1URA A;  3NKR A;  3SZZ A;  1KHL A;  4LR7 A;  2XR9 A;  4CXK A;  4ZGA A;  4LRA A;  1EW9 A;  4QAX A;  1AJC A;  5KXA A;  4CYR A;  4TN0 A;  1Y6V A;  1ALH A;  3UN2 A;  5HRT A;  3IGZ B;  5IJQ A;  1AJA A;  2GSU A;  2W5S A;  4GTY A;  1P49 A;  1ZEF A;  1ZED A;  1O99 A;  1SHQ A;  1KHK A;  1ZEB A;  1SHN A;  2W5R A;  3NKN A;  5DLW A;  4MIV A;  3NKO A;  3WBH A;  2IUC A;  3MK0 A;  2GSO A;  1KH9 A;  4NWJ A;  4LRC A;  3IDD A;  4LQY A;  4GTZ A;  3KD8 A;  4KJG A;  1URB A;  5C66 A;  1KH5 A;  3M8W A;  4LRD A;  3NVL A;  1HDH A;  1ALI A;  3WAY A;  4GTX A;  3BDG B;  4B56 A;  1AUK A;  1EW2 A;  1ANJ A;  1ALK A;  4CYS A;  5EGE A;  3NKQ A;  1KH4 A;  4N7T A;  3UO0 A;  3M7V A;  1E2S P;  1AJD A;  3DYC A;  4CXS A;  4FDJ A; 
#chains in the Genus database with same CATH topology
 4ZVR B;  1Q5Y A;  4A46 A;  1L3T A;  4N56 A;  1UKU A;  2AWZ A;  1NZ8 A;  3IBW A;  3TQE A;  3DLB A;  1XK8 A;  3AD7 C;  4U95 A;  1FTR A;  2QSF A;  3CJ3 A;  1AUS L;  2Y3Y A;  2ZH5 A;  2VA3 A;  3VR1 A;  1LWX A;  3ZNJ 1;  2EK1 A;  3SFU A;  2VIC A;  2J7U A;  3TZW A;  1T94 A;  3MMA B;  3D1H A;  1WI8 A;  3G82 B;  2GIR A;  1U1N A;  2HHU A;  2JEF A;  4RNO A;  3NY0 A;  5KFK A;  1PBA A;  5ETR A;  1JLF B;  2V2Q A;  2LDY A;  3MTK A;  3NP5 A;  4TU9 A;  3WC0 A;  1RJJ A;  1ED9 A;  3S8S A;  2YNG A;  3MM6 A;  4OLP A;  2Z8Q A;  1N56 A;  1RBL A;  4UOC A;  4AFF A;  3K5L A;  4DL4 A;  3MHY A;  3ENV A;  1CG2 A;  2XY7 A;  3MMB A;  5HBM B;  1N33 F;  3DRY A;  3OXF A;  2YNF A;  3TUI C;  3L7O A;  2P9G A;  5HMZ A;  2K1R A;  2E5L J;  1VQ6 S;  1TVR A;  4TY8 B;  2D1C A;  2XLK A;  1B0V A;  4QCL A;  1KHN A;  4EFA C;  3FCH A;  5J1N A;  3MM9 A;  1TUW A;  2A1B A;  2EG1 A;  2HIQ A;  4UOF A;  5U47 A;  4HH1 A;  4DPT A;  3ENQ A;  2V2V A;  4WZM A;  2CRL A;  2DXE A;  1IWG A;  2F8E X;  3HHK A;  4OI4 A;  1D9F A;  1H7W A;  5DQI A;  1LW0 A;  4QW8 A;  3JAM U;  3ZNU A;  4N76 A;  1S0N A;  3DOK A;  1Y00 A;  4F4A A;  3SDE A;  3BBB A;  2A18 A;  2E66 A;  2O5D A;  2RD5 C;  2QSW A;  5DM6 Q;  3HHE A;  2JLE A;  2YWE A;  3MAQ A;  2QLW A;  1GMU A;  1UFK A;  2BJD A;  4TXS A;  4CRJ A;  3JSM B;  4X62 J;  4X4P A;  2Y1J A;  3PW7 A;  1HJK A;  1V6H A;  4B3S F;  2CDQ A;  2MLX A;  3D0H E;  4KAY A;  3C8Y A;  3OUY B;  3SQG B;  4YY3 J;  3A1Y G;  2W8K A;  1YJU A;  2EFQ A;  4R0E A;  4RWW A;  3MK2 A;  1WJ9 A;  1DUR A;  2QFI A;  3PJW A;  4OI0 A;  3T00 A;  5J2P A;  1AJB A;  4QR0 A;  4UF4 A;  4UW2 A;  2PD1 A;  4I0W A;  2FVS A;  4ZGA A;  1TKX B;  1WOO A;  2J9E A;  2DIV A;  4OMF G;  1TQL A;  3GU0 A;  5KT2 A;  1KHV A;  1W7W A;  1RTZ A;  2WBM A;  4LSL B;  1KQF B;  1VC6 A;  4DFM A;  2QL5 B;  2XWY A;  3ET6 B;  2QN6 B;  4EBE A;  2R8K A;  3PVX A;  1MG7 A;  1HYS A;  3JSB A;  4RW7 B;  3GLJ A;  4B02 A;  2B0G A;  1TKD A;  2R7U A;  4E0D A;  1APS A;  1S1X B;  3EDR B;  1E6V A;  3CE8 A;  4Y2M A;  2VV5 A;  4WE1 B;  4ED3 A;  2KG0 A;  1T05 A;  3TI0 A;  1GTE A;  4OV6 A;  1N6Q B;  2UUA J;  4URS A;  3MXH P;  1VMB A;  3DLG A;  2C2M B;  2O1P A;  2OFG X;  4C8K A;  1UL3 A;  3GON A;  1VIO A;  5KG0 A;  2UUC F;  3FBF A;  3ZC4 A;  5KOX A;  3ZTR A;  1N48 A;  1AB8 A;  3MR6 A;  3VAL A;  3E3X A;  4CO4 A;  1XMO F;  1HYS B;  2MQP A;  1VRT A;  1Y9O A;  1C2P A;  2RNE A;  3Q23 A;  1DRZ A;  2LEA A;  1RWN B;  3VGT A;  3SI8 A;  1DBD A;  5F8J A;  1F6T A;  4PQU B;  4DR4 J;  3GTY X;  3PEJ A;  4EBD A;  2CQP A;  2EFO A;  1HDH A;  1FFW B;  4FPR A;  2LQB A;  3O1L A;  1KN6 A;  2EK6 A;  1Q8I A;  1SJ3 P;  1UW4 A;  2G13 A;  2VQF F;  4KH1 B;  3CJT A;  3HM9 A;  3B54 A;  5B0B A;  1V9O A;  2ZHA A;  4DV2 F;  4MTP A;  1C1C B;  2IHR 1;  1IBC B;  3BH6 B;  4RUB A;  4ZVO B;  3G8T A;  2HNY A;  2BYC A;  2Y1L B;  3BYP A;  3KUE A;  2XMA A;  3K59 A;  4G65 A;  6FD1 A;  3RBE A;  3PIP Q;  3CW2 C;  3DRS B;  4ZHR B;  1K1Q A;  1NK9 A;  4I7F A;  5HVF A;  4G1Q B;  2BV3 A;  3CD5 A;  3H90 A;  4NRU A;  3W5Y A;  4DUZ F;  1HIY A;  4X4T A;  3RGI A;  3GV5 B;  5KT4 A;  1EQ0 A;  5HN0 A;  4RUC A;  4C8O A;  2WVD A;  2MKI A;  2AX0 A;  1SL2 A;  4DSK A;  5AXK A;  1H3D A;  3ITH A;  3CC4 S;  3HP6 A;  3EM1 A;  4O4R A;  4OYI A;  3BGU A;  4L6V 3;  4OJ3 A;  1UVI A;  2X3G A;  2DGT A;  1Z1Z A;  3NGR A;  3GIL A;  1H72 C;  2FJA B;  1MRO B;  1X4B A;  2OGU A;  2FGO A;  4RW9 B;  2QL7 B;  1RT4 B;  2VDI A;  3UDE A;  3OVS A;  2CPZ A;  2RS2 A;  1E1Z P;  1VQY A;  2GFF A;  4JI8 J;  1RQ0 A;  3CB4 A;  3TNV A;  2IBK A;  1QUV A;  2DH9 A;  2HVZ A;  1H38 A;  3IRX A;  5K8M A;  5DET A;  4X4Q A;  1UJ6 A;  1HWU A;  4TKT A;  4JI3 J;  3GG1 A;  2V8H A;  2CG8 A;  1S12 A;  1JJH A;  1MWZ A;  2IM2 A;  2A6M A;  2K06 A;  4NEZ A;  3DLK B;  4WFX A;  5F8I A;  3M8Q A;  1N4L A;  3NCP A;  3MTJ A;  5L1K A;  2IVF B;  1VBX A;  4ENO A;  1D3W A;  2AYM A;  2IC3 A;  4NLO A;  2P9C A;  5ETQ A;  1XNQ F;  1X7V A;  2LXU A;  4NLG A;  4F4Y A;  3JQM A;  5DJB A;  2W9C A;  4L3N A;  2L9D A;  5F0W A;  4LF4 J;  1KVI A;  4Q44 A;  4J5O A;  2X98 A;  2E44 A;  1S5Z A;  3H4D A;  4A8Q A;  4DZD A;  5J2N B;  2XY5 A;  4OL8 A;  3NL0 A;  5GAD U;  3AOD A;  4QR2 A;  4DUY J;  4NLQ A;  4LF7 J;  1F9E B;  2PA8 D;  1WDD A;  4PG4 A;  3Q8P B;  3S6E A;  1QLN A;  1FES A;  1NH8 A;  2CNO B;  4KC5 A;  4DDF A;  2LEC A;  3L95 X;  1M5H A;  4C48 A;  1U24 A;  3DOL B;  5G0R B;  4F0M A;  2GV1 A;  3HT3 A;  2V4J A;  2DNM A;  1FFS B;  2QC3 A;  2BAC A;  3NOG A;  4KGK A;  3A8E A;  3TA2 A;  1SV5 A;  4DU7 A;  4DR6 J;  1AFJ A;  2CQ3 A;  2ADB A;  1JLQ A;  3QIP A;  4DN9 A;  1EQJ A;  3PAC A;  3Q8V A;  3SZZ A;  4I68 A;  2E1A A;  3CCJ S;  4FP9 A;  4A8O A;  3TAQ A;  3PYF A;  1JKH B;  3W2W B;  4KHR A;  1EZZ B;  4DR3 J;  4K4V A;  4B17 A;  4YHH F;  3N4W A;  3SMZ A;  3F41 A;  1I6J A;  4AL7 A;  5T7L A;  1YGY A;  4M5N A;  2AGQ A;  2AQ4 A;  3B8H A;  1U45 A;  4CO1 A;  5KFC A;  2V67 A;  3M6U A;  2X1A A;  5BR8 J;  4ECX A;  4W4M A;  4FF2 A;  4JYA J;  2F65 A;  2HFN A;  1KLN A;  1DTQ B;  2ZDP A;  1S77 D;  2DHX A;  1JNR B;  4NLS A;  1VHF A;  2VH7 A;  2WHO A;  2X1B A;  3LGM A;  3FGV A;  1ZYQ A;  3RW6 A;  2BJ1 A;  3BF4 A;  2BJ8 A;  3BR8 A;  8AT1 B;  3KYL A;  1DFD A;  3NKO A;  3HK2 A;  3CJS A;  3ISN C;  2V6A A;  5L1L A;  3KLF A;  2C2O B;  1W2I A;  3GP9 A;  2WBR A;  1Y0H A;  2BRK A;  1TL1 A;  3GWC A;  2YQ1 A;  1SH3 A;  3VVT A;  4HT5 A;  3CWJ A;  4WTY A;  2H48 B;  2C3Y A;  3TVZ A;  2GAH C;  3PXG a;  3I55 S;  1PAU B;  2OIH A;  3WAY A;  1RTH B;  4UUX A;  1Y3K A;  3A3O B;  4NLT A;  3K58 A;  1WF2 A;  2B9X A;  5IZH A;  1FRJ A;  1B4S A;  3T41 A;  2A6O A;  1YX2 A;  2CNL B;  4Q0B B;  2CQG A;  5LJ5 Y;  1K73 T;  1E2S P;  2HZC A;  2VFU A;  2K1R B;  3PEH A;  4IKA A;  3GV7 B;  1IR2 A;  4PWD A;  4J9L A;  1YJ9 S;  4QR1 A;  1NK6 A;  4LSN B;  1FO1 A;  3HSJ A;  1BWV A;  3BS9 A;  4YN3 B;  4DEZ A;  4EYI B;  2QYG A;  3ET6 A;  2QZ8 A;  3SBM A;  4RUA A;  3BQ1 A;  3HJF A;  2W8D A;  4LRF A;  2V94 A;  4XO0 A;  5IT9 Y;  3DNC A;  4WYL A;  2V4Q A;  1YZ7 A;  3GV8 B;  3M05 A;  1JX4 A;  4HVZ A;  1YG0 A;  2AYE A;  2ZH8 A;  4DV3 J;  1SJ4 P;  2DNY A;  2VG5 A;  4MFB A;  2IM0 A;  2M8D B;  1RT3 A;  3H7H B;  5DRK A;  3KNG A;  4WP8 A;  5KG4 A;  2COL A;  1UEU A;  5HAN A;  2CQB A;  1J5E J;  5LRM A;  2R7Q A;  4DX6 A;  2C22 A;  5F8N A;  1B99 A;  4ELV A;  4FKY A;  2DNG A;  3GFH A;  1KOH A;  1HBO A;  4TU7 A;  2XGP A;  1TK5 A;  4EZ6 A;  1HNV B;  1B70 B;  5CYQ A;  1YKW A;  2KYX A;  4J9U E;  4U7U K;  2W5W A;  4PQU A;  3BO2 A;  2WRM A;  2BX6 A;  5J2Q B;  2ZUA A;  4CLU A;  4LF6 J;  2PE8 A;  4DV1 F;  3PJX A;  2KZZ A;  1FDB A;  4NCG B;  2GVZ B;  3OL6 A;  1N5Q A;  4MYT A;  1S9E A;  4NPO A;  3HMJ G;  1RSC A;  4JB8 B;  4QU6 A;  3KLG B;  3WAV A;  2D69 A;  4R8U B;  4NXM F;  4OQJ A;  1S0V A;  4MY4 A;  3WAW A;  2BOA A;  4EZ9 A;  1SIW B;  1YHQ S;  5HRO B;  1HNZ J;  3ENA A;  4AXJ A;  2DYA A;  2B5J A;  2DKO B;  2Q6B A;  3KK2 B;  1HI1 A;  2G0I A;  4GVB A;  1XER A;  4RU9 A;  1RXO B;  6FDR A;  3TAP A;  2YPY A;  1M5K C;  1WEZ A;  1NDP A;  2LVW A;  5EGY A;  3MM7 B;  2YKM B;  2OTJ S;  1JK9 B;  4X2B A;  4O3P A;  3NKM A;  1SVD A;  3SIP B;  4GVL A;  4USM A;  4Y2K A;  3ITH B;  4R5P B;  4ZG7 A;  2BA9 A;  4RBU A;  5L9X A;  3D6T B;  3TAM B;  1VRT B;  1N36 J;  2DPJ A;  2YY3 A;  4UST A;  4JI4 F;  3CMR A;  5DGA A;  4U8Y A;  1IQT A;  3KDO A;  4PXE A;  5CQG A;  5ETN A;  5AXN A;  5DLT A;  4UOP A;  4CWB A;  5L46 A;  1U1K A;  1EQM A;  2BE9 B;  5EWF A;  1IBM J;  3IGY B;  3TRG A;  1R8P A;  2DNP A;  3N6L A;  1UVN A;  2AMC B;  3TZZ A;  3VHQ A;  1NLK L;  2DXD A;  1WOR A;  2ILY A;  2R2R A;  4A8K A;  4O3N A;  1S1W A;  3MEG A;  2BZ2 A;  3EVW A;  2HIY A;  2HNY B;  1LK7 A;  2WB1 D;  4NAS A;  1UET A;  2WK4 A;  1L3K A;  3ILJ A;  2HVE A;  1Y6V A;  2RF2 A;  1WDT A;  1AZS B;  1H6K X;  4GTY A;  3RB4 A;  1KRP A;  1HL6 A;  4DPY A;  4CCH A;  2DR7 A;  3C14 A;  4NML A;  2ZOF A;  3WIU A;  4NYZ A;  5CAB A;  1TKT B;  3LF0 A;  1TEL A;  3H0P A;  4C11 A;  2FTR A;  3MEE A;  1FDN A;  3QYY A;  4LT6 A;  2W4P A;  4MIV A;  1V3R A;  1TMJ A;  2DTJ A;  4H4O A;  3BKU A;  3T9Z A;  2KHC A;  4WK3 A;  1FJC A;  1J5O B;  3J7A 1;  3MK0 A;  3GFX A;  5C24 A;  1SUQ B;  5HP1 A;  4L73 A;  4ZLP A;  4K5S A;  1GH8 A;  1U6F A;  2GIQ A;  2X51 A;  4O44 B;  2HHX A;  3PO4 A;  1OPZ A;  5E3C A;  1EKR A;  3IRX B;  4EO6 A;  3HCX A;  2ASL A;  2VBX A;  1Q7Y T;  1HNX J;  1DQ9 A;  1SV5 B;  2R4F A;  3QGP A;  5DZ7 A;  4WII A;  3W1Y C;  1R27 B;  4P6Q A;  4U7C A;  2HRU A;  3CJR A;  2R2U A;  1JLQ B;  4NLW A;  4Q7A A;  3OXL A;  3UO0 A;  2ERR A;  3PRD A;  1Z2L A;  1G7C B;  3I9Z A;  1ZA2 B;  5L8R C;  5F3Z A;  3G96 A;  1YVF A;  5I3P A;  2OAU A;  5KFV A;  1LXN A;  4XIU A;  4DQS A;  1OSD A;  4TU8 A;  1JLE B;  3OW2 R;  2HZV A;  4X4O A;  3DGP A;  1LEO A;  1YRT A;  4RW6 B;  1CS4 B;  3D9B A;  5CD4 H;  1S6P A;  2KHD A;  5C7P A;  4DV2 J;  2F4V J;  3MUR P;  4CM2 A;  3T6B A;  1NK5 A;  4F26 A;  1Q95 G;  1KH7 A;  3H25 A;  2FIU A;  1P6T A;  5T7L B;  3ETM A;  5ETM A;  3VVU A;  4ED4 A;  3C6U B;  2OML A;  3PV8 A;  5IS2 A;  4B3M F;  1RAJ A;  2OD6 A;  1EET B;  2B7C B;  2VC0 A;  3K5O A;  3TR5 A;  3JYT A;  2RS8 A;  3V4I B;  1R8C A;  4ID5 B;  3ZTQ A;  1IKY B;  1WHY A;  2BR0 A;  5INH A;  1FJ7 A;  4X4R A;  5IT9 U;  1VQP S;  2DGW A;  2O67 A;  5K5M A;  1MMN A;  5DG8 A;  2I2Y A;  1B0P A;  2C2Z B;  1HKA A;  5I42 B;  1P9Y A;  2BQ3 A;  4CXU A;  2J9C A;  2OPP A;  4M8L A;  2X7I A;  4I2P A;  4O4G B;  4Y34 A;  2VQF J;  2V5H G;  4C7Q A;  4NCA A;  2MZ1 A;  3DOM B;  3B4M A;  1KFD A;  1TUG B;  1UAW A;  1HD1 A;  5ETK A;  3DRP B;  2DD8 S;  5HI7 A;  3KHG A;  2Y0S D;  1RKJ A;  1S97 A;  1VBZ A;  4LF7 F;  1JLA A;  1HNI A;  2RDI A;  2YWF A;  2J6U A;  2DY9 A;  3M9O B;  1TL5 A;  3LH2 S;  3WZ0 A;  5GOV A;  4PZV A;  3RUB L;  3G71 S;  1EHW A;  4IRK A;  3ZZT A;  3FBE A;  4RPF A;  1BQN A;  1JLB B;  4KAI A;  2FC9 A;  5D15 A;  4UOO A;  4LBI A;  4QYR A;  2VOP A;  3AOC A;  3P8B B;  3PYG A;  1RWO B;  4RWX A;  3MUM P;  3CC2 S;  5D4L A;  5F8L A;  4A47 A;  2DO4 A;  4B9N A;  3R7B B;  4LRB A;  4V19 X;  2LQ9 A;  2W01 A;  4IR9 A;  2OD4 A;  4U9R A;  2C2D A;  1R3N A;  1Q81 T;  3AJD A;  4ZVE A;  4JI2 F;  2CQH A;  3MI7 X;  3W62 A;  2UU9 F;  3KTQ A;  1F60 B;  4ZPD A;  3RJM B;  2QG9 B;  3CD7 A;  4M5H A;  1XMB A;  3RAX A;  1TK0 A;  1FKP B;  5M2R A;  1F1B B;  3BBC A;  1HHS A;  3BZQ A;  3JSR A;  2JNJ A;  4NA2 A;  1QY7 A;  4ZVQ B;  2BAN B;  2V69 A;  2VG7 A;  4JV0 A;  3EPI A;  5MLC V;  3CCS S;  3NAH A;  1Q8K A;  2AKW B;  2OPQ B;  3GQC A;  3K7R A;  1NO8 A;  3MMC A;  3RTV A;  3CED A;  4ED6 A;  5EWG A;  2XS7 A;  2KH9 A;  3HHL C;  3OJU A;  2PFD A;  1DLO B;  2CVE A;  4BCA A;  4O23 A;  4HI2 A;  3MZI A;  3I31 A;  4L75 A;  3VGS A;  3KJV A;  1ALH A;  3SDE B;  4DUY F;  4CO5 A;  2B56 A;  3SCL E;  3T5J A;  5CCM A;  5IJQ A;  2W5S A;  2GVD B;  3R5B A;  1LWC A;  2M5Y A;  1SHQ A;  2B6A A;  4NYO A;  5A2Q U;  4WJB A;  3OR1 B;  4MKY A;  3PM9 A;  5IQ6 A;  2YVS A;  2W7O A;  3FZB A;  3OTB A;  4MYU A;  2DIS A;  1LWE B;  5AT1 B;  4CLK A;  5JVH Q;  2ZJR Q;  3QAU A;  3FVY A;  3IC1 A;  3MMB B;  4WZQ A;  1S1T A;  3M6X A;  4FYV B;  4LBH A;  3M2R A;  5D3G B;  4H54 A;  4K7Q A;  2UUT A;  1FKA F;  2FJE B;  5KT7 A;  4IH7 A;  3BSC A;  3HPO A;  1QAI A;  1VLO A;  3KD8 A;  4GTZ A;  3PR4 A;  2DNL A;  1YRX A;  4C0H A;  4ZN3 A;  3GJQ B;  1T8E A;  2AEM A;  2ZOG A;  3FMW A;  1J2V A;  3HKW A;  1LKZ A;  2PMH A;  3FBC A;  3CF5 Q;  1L3V A;  4JI7 J;  1ANJ A;  1OIA A;  4FS2 A;  2J9D A;  3R3T A;  2CPE A;  2DNN A;  1G3O A;  2DT9 A;  2FJW A;  3D3B J;  1RTJ A;  2GVZ A;  2YH0 A;  5B0C A;  2P2C B;  3C6T A;  2IRX A;  2ZC3 A;  3AHP A;  4IQM A;  3IR7 B;  1Q8L A;  4PXB A;  3IFE A;  3TJA A;  3K57 A;  2E5I A;  5B0F A;  4JI5 J;  4OI6 A;  3OTC A;  1UVJ A;  2KN4 A;  4IG0 A;  3HXM A;  2YWG A;  1HNW J;  1RAG B;  2RUG A;  3ETO A;  1JIH A;  3QWU A;  3MAH A;  5KT5 A;  1Z4U A;  2NPI A;  2MQ8 A;  4KKO B;  2W8L A;  1FNM A;  2XMJ A;  4KGX B;  3E8O A;  4J90 A;  2IMW P;  3WIV A;  1FWK A;  4U7U D;  3T5L A;  3B5Q A;  1RT6 A;  1CJT A;  2KJW A;  1S10 A;  2CXE A;  2H1Y A;  2QA2 A;  1RCO B;  2RDD A;  3A8I A;  3R6G B;  4H4M A;  4ZLN A;  2DO0 A;  2FZK B;  1UEK A;  1UFL A;  1BC6 A;  1V3S A;  2D1G A;  4AYB D;  3BDG A;  4FS1 A;  3LAL A;  1J5O A;  5D4N A;  1S1U A;  2EFN A;  4DR7 J;  4BHQ A;  1YIJ S;  1FER A;  3E2D A;  4P7T A;  5D0E A;  4O44 A;  4R0J A;  4DPX A;  3AA9 A;  2CWX A;  4JI6 F;  2FHK A;  4NLR A;  3EMT A;  3R27 A;  1S9G B;  4UQT A;  1T05 B;  4CNZ A;  4DUT A;  1GFW B;  3WC2 A;  4QIE A;  1KEK A;  2XLI A;  1PJ6 A;  1ELO A;  4DPO A;  3T1Y J;  1X4D A;  2GSN A;  3ZXW A;  1GMW D;  2A3J A;  4OIX A;  5HRT A;  2OEL A;  4CLY A;  2CZV C;  3D6H B;  2QE5 A;  4ZPC A;  1RCX B;  4DV3 F;  5E3Q A;  3FBB A;  3D66 A;  1BGX T;  1JLE A;  2KM8 B;  1EJ7 L;  3OHA A;  1VC0 A;  1UP1 A;  2B9E A;  4WF9 Q;  2HGM A;  4RW4 B;  6AT1 B;  1UFW A;  1U7L A;  3SCJ E;  2DRA A;  3CPW R;  4QJV A;  3W60 A;  3LW5 C;  3UQS A;  1Y4Z B;  4F36 A;  3QRR A;  5HSP A;  4LR8 A;  1TL3 A;  1TP7 A;  4I6A A;  1YQH A;  1AUD A;  4YY3 F;  3KHH A;  4AQY F;  4V19 J;  2BEF A;  2FD2 A;  3IO1 A;  4H4O B;  4QYZ K;  3LO3 A;  1RAF B;  3DLJ A;  1WI6 A;  4MJK A;  1KVK A;  1A7G E;  3THT A;  3ZTS A;  5F0U A;  2OPR A;  3CD6 S;  1SUQ A;  1NBE B;  2ZD1 B;  3LP0 A;  2WAQ D;  3M9M B;  3QIP B;  1F3V A;  4GTW A;  3NKY A;  2D3Z A;  2OEK A;  3OQ2 A;  4WU3 A;  1IJE B;  2ZH2 A;  1KS2 A;  5EX3 A;  3CCR S;  4I2P B;  2W7A A;  1RLD A;  4NLP A;  4DSE A;  1Q78 A;  3QSI A;  5F9L A;  5MAO A;  1QSL A;  3IBF B;  5FJ4 A;  2IC3 B;  2JVR A;  2OFH X;  1C0T A;  4YQW A;  4LRA A;  2ZHB A;  1PYS B;  1HNZ F;  1RAB B;  1X5P A;  3N6M A;  4URG A;  2KZM A;  1HWL A;  2N4C A;  1WNE A;  3MM5 A;  5EDW A;  3KLE B;  1CS4 A;  1WEL A;  2PI5 A;  5B08 A;  2H5E A;  1FX2 A;  4CIO A;  2J5A A;  2HFZ A;  2HYI B;  2C28 A;  3DLL Q;  1ZED A;  3LGN A;  2NZC A;  1WTB A;  1N36 F;  2YX4 A;  2W5R A;  2FJD B;  4ZVP B;  2M2B A;  2JEG A;  3Q86 A;  5HVG A;  1VQO S;  4I64 A;  3QWP A;  3RBD A;  1DQ8 A;  2FHJ D;  3ENW A;  2EBG A;  4NLD A;  3W63 A;  1TAQ A;  3IDD A;  1QE1 B;  4UY8 T;  3CD0 A;  3G6X A;  1WKJ A;  3VZI A;  4L72 B;  2YNH A;  3BYR A;  2EC2 A;  2HSE B;  3NWR A;  3S01 A;  4DQP A;  2HQI A;  1XNR F;  2NQP A;  1PYO B;  5A8K A;  4NZ7 A;  3OL9 A;  2E29 A;  1JXE A;  2EG2 A;  4ZOS A;  1X5S A;  2ADC A;  4YS2 A;  5IM0 B;  3PTW A;  3V81 A;  3TEH B;  4NZ6 A;  2Q6C A;  5E0O A;  1RTD B;  4JI2 J;  1TKZ A;  1PIL A;  1Y5N B;  3Q8Y A;  2YNI B;  4UZC A;  4OI1 A;  2GZO A;  3AQP A;  4X62 F;  2W5T A;  4NE9 C;  2OTL S;  2XB2 D;  1ZTT A;  1U0H B;  1FXD A;  3OLA A;  2UVV A;  2GC8 A;  2MZJ A;  1X9M A;  3J81 Y;  2CJK A;  1RA6 A;  1EI6 A;  2Z56 B;  1GAO A;  2Y1R I;  1N0U A;  2VBY A;  3MAA A;  4KBI A;  4FYY B;  5CCL A;  4WCE Q;  4DV7 F;  1N0V C;  1X5O A;  2XHW A;  4DV0 J;  4DG1 A;  1I5O B;  5KFT A;  4B9V A;  2EFV A;  4ECV A;  1F0X A;  3CCL S;  3RB3 A;  1VQ9 S;  3ONQ A;  1CEZ A;  5A2Q Y;  2J0Q D;  2L41 A;  4JI0 J;  3I87 A;  1HBO B;  3NNA A;  4OJ1 A;  1MWY A;  3R5J B;  3O3L A;  3ILL A;  5GAH U;  2W7P A;  4Q0B A;  4LIW A;  3D2W A;  1EJJ A;  2LA6 A;  4D3H A;  1NRK A;  3VGU A;  2HND B;  1Y5I B;  1NH7 A;  1SBR A;  2GJI A;  3BBF A;  4RX6 A;  5GAD I;  3EZ5 A;  2NRE A;  5KG2 A;  3C15 A;  1FCA A;  4A8F A;  3MPD A;  3BRE A;  4IG3 A;  3M8P A;  1Y11 A;  5LXY A;  1HQA A;  5KFZ A;  1SC4 B;  5IC6 B;  4KIA A;  2GQC A;  4FNH A;  3TA1 A;  2NSC A;  3P96 A;  4CYU A;  3T5K A;  4RBT A;  1NK8 A;  2X1G A;  3KJN B;  5B7W A;  1JLC B;  1FX4 A;  4MFB B;  4UOH A;  2EEY A;  4NLV A;  1CUL A;  4CH7 A;  4DSL A;  3NMA A;  4CLL A;  3K5P A;  3NCQ A;  4D3G A;  2MQN A;  2APO A;  2M70 A;  2XMW A;  3EGW B;  2YWH A;  2I5J B;  3FKB A;  1ZM4 A;  2OP5 A;  2R7X A;  4FDF A;  4ZVT B;  3SCK E;  3SZY A;  2UUB J;  1ANI A;  1LWE A;  4O3O A;  2OEM A;  5JUM A;  2V9W A;  2VQR A;  4F4Z A;  2MZS A;  1U2F A;  4DV4 F;  4J9S A;  2QZU A;  1RTI A;  4UQG A;  4PUO A;  1XR5 A;  5D3G A;  4H4M B;  4ZG6 A;  4QIG A;  1SKS A;  4ETZ A;  2JWN A;  1IKW A;  3A3N B;  2MKK A;  1BQM B;  1ZM3 A;  3UN3 A;  3MFH A;  1FK9 A;  2BXJ A;  2F7V A;  5L0B A;  1O0P A;  2LXF A;  4PG6 A;  4C98 A;  5AJ3 J;  1YDL A;  3PKM A;  1FTC A;  3MEG B;  2H9Z A;  3C66 A;  4LR9 A;  3SYZ A;  1T3N A;  3MUT P;  2FLP A;  4DR4 F;  1RWX B;  1VJQ A;  1YWX A;  5E5N A;  4N77 A;  2B5J B;  1RTJ B;  2NXU A;  3AD9 C;  2BE2 A;  2M8H A;  2RQM A;  3QID A;  4TVA B;  5GVQ A;  2GJ2 A;  1FE0 A;  2XZT B;  3C6T B;  3MPW A;  3LA0 A;  5BR8 F;  4F4X A;  3JSY A;  2VZ9 A;  1ARO P;  2KI2 A;  3PFE A;  3M1V A;  4URQ U;  4TN0 A;  1T95 A;  1KNZ A;  3GIM A;  2ZIT A;  4XPC A;  5DGB A;  1QSY A;  3Q2T C;  1U2C A;  5F41 A;  3EVO A;  1NZA A;  1N5Y B;  2RQK A;  1KP6 A;  2W4C A;  3LGH A;  2E5J A;  4C11 B;  4QWC A;  3KK1 A;  3V6H A;  4GKJ J;  4TN2 A;  1ELY A;  1QAX A;  1HQ2 A;  3H2L A;  4CQ1 A;  2DHS A;  1HNV A;  4HTJ A;  2ALY B;  2VQE J;  2GO8 A;  3AB2 B;  3H5U A;  5I4M A;  3AJ1 A;  1ICE B;  3T9N A;  2VC1 A;  5H1S V;  1KH9 A;  2BKP A;  2Y9H A;  1IKV B;  4LVN P;  4C0O C;  2DGV A;  2DR8 A;  2ROG A;  1UA0 A;  2GQQ A;  2NLW A;  3JXO A;  1HBN B;  1TV6 B;  3AOA A;  2VBW A;  4LSZ B;  1OYE A;  1SQE A;  2OEJ A;  3EXC X;  3HDS A;  4GTX A;  1U4B A;  2CPH A;  2FZC B;  1K8A T;  4GC6 A;  1HR0 F;  2BE7 D;  1KH4 A;  4I67 A;  3M7V A;  5H9F K;  1LW2 A;  3RR8 A;  1RAE B;  2AIR B;  3VCD A;  4JI7 F;  4CXS A;  1WG1 A;  3HSG A;  3HD2 A;  1PKU A;  5LSR A;  3H40 A;  2I0X A;  1HBU A;  2Y1I A;  2LFV A;  4XTT A;  3C16 A;  2YKP A;  5AJ9 A;  1U1Q A;  2ASD A;  1LWF B;  3L4B C;  4DR6 F;  1FA0 A;  4RW4 A;  2R9L A;  2RKI A;  3I5A A;  4QIW D;  1CJK A;  2QLX A;  3QFW A;  4WXO A;  4C0B A;  5EHH A;  4ED7 A;  4LF5 J;  4AL5 A;  2BVZ A;  2C3U A;  2MLZ A;  3H98 A;  4IFV A;  5C5J A;  1QTM A;  2OUG A;  2HRY A;  5BYS A;  3WDO A;  2VOD A;  1C4C A;  4HHJ A;  3BDH A;  4CLZ A;  4UPL A;  3VAM A;  3PX6 A;  3HHL B;  4OX8 A;  1RYR A;  2O3D A;  5CD4 A;  4DR3 F;  4HTI A;  2ZC4 A;  3FNN A;  3H5S A;  5CYM A;  3ZFV A;  5CA5 A;  5TJ3 A;  3UPF A;  1FKO A;  2PSZ A;  3E01 A;  4P10 A;  1FDA A;  1SXL A;  2IYI A;  4DFK A;  3R1H A;  1U6B A;  1NDK A;  4ILL A;  2W2M P;  4O0N A;  5GAG I;  1SL1 A;  1AZS A;  1D9D A;  4PWW A;  3O8W A;  1SIZ A;  4ETX A;  4ECZ A;  4RJV A;  4KPC A;  2K7K A;  4KYZ A;  1UCN A;  3GFZ A;  1BQN B;  3D3C J;  1SH0 A;  4KQZ A;  3LWM A;  4C4W A;  2DNZ A;  2QA4 G;  3MM5 B;  3Q22 A;  5LMU J;  2FVR A;  3KG0 A;  2FVQ A;  4MK9 A;  2MY7 A;  3OFF A;  3QZ8 A;  1FDD A;  1HA1 A;  5HMY A;  2F40 A;  4ER8 A;  1NKB A;  2A2D A;  2W8S A;  4J9V A;  1F9H A;  1U25 A;  1JQG A;  2CWK A;  5B0A A;  4QWD A;  4DOZ A;  3G8S A;  3LAM A;  1H98 A;  4O4G A;  3MAA B;  5E2Q A;  2CQD A;  1NME B;  2ZH1 A;  1K44 A;  2C2K B;  1FVS A;  2ZBQ A;  1Y7A A;  4DR5 J;  2H4W B;  5JXS A;  2KFZ A;  3NWG A;  2ZJP Q;  4FVC A;  5GAE I;  3IM9 A;  4XPE A;  4Z7Y A;  1SKU B;  4JI8 F;  4Q5V A;  1T03 A;  3BKT A;  1WEY A;  1KVJ A;  1TK8 A;  3GJR B;  3ZZU A;  1EB0 A;  3CVK A;  3F44 A;  2VBZ A;  1NK7 A;  3W3S A;  3IM8 A;  1AW0 A;  4NLX A;  3IGN A;  2QYC A;  3OFH A;  2FYX A;  5HBM A;  1UMJ A;  4JI3 F;  4MHX A;  4J9N A;  1URA A;  1TVR B;  2JLF A;  4TY8 A;  1Q4R A;  5A8W A;  1U0S A;  2V68 A;  4LR7 A;  5A6P A;  3KMQ A;  2BJ3 A;  1DTT A;  4J7C A;  4IOA Q;  1EX8 A;  1RHQ B;  5IT0 A;  3QRQ A;  4KHP J;  1EW9 A;  4QAX A;  3HKZ D;  1XIQ A;  4IOC Q;  1TKZ B;  4Y2A A;  3L9Z A;  3MCM A;  2DHA A;  4NL5 A;  4ANC A;  2GVD A;  1UPP A;  4IG3 B;  3BGL A;  3DKD A;  4ZS6 A;  4USW A;  5C25 B;  3BQ0 A;  4DLE A;  2Z2M A;  1S6Q B;  4WK1 A;  3V6D B;  5HJX A;  1RT7 A;  2YX1 A;  2IA0 A;  4KY3 A;  5I42 A;  3MEK A;  4YFU A;  3BO3 A;  4LFC J;  2MSS A;  1S0O A;  3BPD A;  2Q1L A;  2GHW A;  3BN7 A;  4YB5 A;  4DX7 A;  1WOS A;  4NYP A;  2PGC A;  4NMX A;  4RL1 A;  4USH A;  3P4U B;  1S1T B;  4CTA A;  5KT3 A;  5DG7 A;  4P71 A;  2DHG A;  3MED A;  2DXF A;  3M32 A;  1FJE B;  4KO0 B;  1FVQ A;  1U26 A;  1VK3 A;  1Y10 A;  2XI3 A;  3DM2 A;  2ZZM A;  4ES3 A;  3JB9 k;  3FUY A;  3GCW P;  2HFU A;  5AXM A;  4MIB A;  3WBZ A;  4Q8E A;  1HD0 A;  2BW7 A;  1VIS A;  1HNX F;  2KG1 A;  3N5B A;  2NXE A;  2V63 A;  3Q89 A;  5DO2 A;  3QMQ A;  5C42 B;  5J2M A;  1N5V A;  2J0S D;  4OHW A;  2I9S A;  2HND A;  2F9D A;  4BC7 A;  3HVR A;  1KQS R;  1F2H A;  1ZAX A;  1V3Z A;  2Z2Z A;  1BQM A;  2DH7 A;  3B78 A;  5ETT A;  3NGS A;  4ZJQ A;  3CDE A;  1SL0 A;  1D1U A;  2UUB F;  4PRF A;  1RWV B;  4OYO A;  1HMV A;  4F0H A;  3Q0A A;  5D8H B;  4TLQ A;  3G6V A;  2MPU A;  4DQR A;  4YB1 P;  4HH0 A;  3OVB A;  2ZE2 A;  3PO5 A;  3MPY A;  2CQ0 A;  2OSQ A;  2AV5 A;  1X31 C;  3FQK A;  4IG0 B;  4F3Q A;  2WW8 A;  3DYA A;  5CXT A;  1QDU B;  4EO8 A;  2KFY A;  2XMT A;  1GMW A;  2ZKU A;  3VF0 B;  4JI4 J;  4WE1 A;  3ZZY A;  4RZR A;  4ED2 A;  1P1T A;  2IAJ A;  3CDB A;  4KHM A;  1ALJ A;  5DLG A;  2ZM6 J;  4CO2 A;  5GAG U;  5AJ3 F;  2FHO B;  3BGF A;  1PC5 A;  4X4N A;  3CDW A;  3HHD A;  4QW9 A;  2NXC A;  1X4C A;  2JDJ A;  2KRR A;  3QQC D;  4W98 A;  4OHY A;  4P73 A;  4J9M A;  4HAC A;  2UXC J;  1F5C A;  2WVC A;  1WEX A;  4KPY A;  3UR3 C;  1JLG B;  1NSP A;  1QM9 A;  4IO1 A;  3IWL A;  2B4U A;  3G87 A;  5KFN A;  1NK4 A;  2IUC B;  3BN4 A;  1MU2 B;  4OZJ A;  3HSZ A;  1N54 B;  1HQU A;  3N28 A;  3K2Y A;  4JBC A;  2XQC A;  1NEE A;  1FRK A;  3TZX A;  1ZH5 A;  2X3D A;  4CI0 B;  3T01 A;  3HFZ B;  2FQQ B;  1U47 A;  4KTQ A;  2VL1 A;  3TJ8 A;  4DL6 A;  1NDC A;  3FZ2 A;  3DXS X;  5LMN J;  2PFF B;  1G4C A;  3L7U A;  3LPY A;  2WB4 A;  3KK3 B;  3K0J A;  3F56 A;  3TUP A;  4LVO P;  1IM4 A;  2XCA A;  3AJ2 A;  3DMJ B;  4GO5 X;  3W8G A;  4DSJ A;  4B9T A;  2DBB A;  5GAE U;  1PSD A;  4G1Q A;  3SSS A;  3DFE A;  4XDD A;  1X4F A;  3J7Z T;  1TTH B;  3M1V B;  1PBU A;  3UFC X;  1R0C B;  3LOU A;  1HAR A;  1RT5 B;  1S49 A;  4HDG A;  3TEG A;  1OSC A;  5HAO A;  2JLG A;  3BSA A;  4EI2 A;  2BQR A;  2CPI A;  3ISN D;  1N5Y A;  4U6P A;  1TL3 B;  2CNK B;  2D3U A;  1RWW B;  5L9N A;  2H3E B;  3OR2 A;  5LQQ A;  1HR0 J;  4YDX A;  1X9W A;  1ZPV A;  4ZCL A;  2D9P A;  2ZH6 A;  2QA4 S;  4B3O B;  1CQM A;  4ERD A;  3H59 A;  3J7Z 5;  2XY6 A;  2ZD1 A;  1MRO A;  3JTP A;  1Q16 B;  4X66 F;  3V6K A;  2DY1 A;  4DV6 J;  3FJ2 A;  3FSI A;  3K5M A;  4DSF A;  2GHP A;  3RAQ A;  1OY9 A;  1G1X A;  4LFB F;  4R25 A;  4PEO A;  1WHV A;  1D8Z A;  4HYK A;  2HNZ A;  4IRC A;  3M30 A;  4B3R F;  3BDF A;  2XCP A;  4BLG A;  3VAJ A;  2DR9 A;  3QO9 B;  3O5T B;  2J0X A;  4AL6 A;  2XMV A;  3GCX P;  3Q8U A;  1YJV A;  3UNG C;  4KJI A;  2EBE A;  1MSW D;  3ZZ0 A;  1U6Z A;  2J8A A;  4PQA A;  3DLK A;  4UZB A;  2FGC A;  4LF8 F;  2HMI A;  4IDK B;  3QLH B;  5J1P A;  2F9J A;  4X64 J;  4W90 B;  3RRK A;  3L09 A;  3RRG A;  2CA9 A;  2CAJ A;  3IG1 A;  3Q8Q B;  2DH8 A;  4DR1 F;  1LW2 B;  2DEJ A;  3LAN A;  2AJ4 A;  2HFS A;  1X60 A;  2ZH3 A;  4X4V A;  2AJ1 A;  3FSY A;  4CP5 A;  4F25 A;  2Z4P A;  1RT2 A;  2EKN A;  2PMW A;  4EEY A;  4GKK J;  5KXA A;  3QBC A;  3KLI B;  3WQP A;  4FF1 A;  3KLH B;  2IFY A;  5L1I A;  2RRN A;  3TUJ C;  2L9N A;  5J2N A;  4PYA A;  2J0W A;  3G86 A;  5E41 A;  1X8D A;  1AJA A;  2YXL A;  2QMX A;  3IGV A;  3A4T A;  1FWP A;  3OLB A;  1KHK A;  5ETV A;  3LP0 B;  4HDH A;  1ZEB A;  1YJT A;  2YWW A;  3NKN A;  2XG8 A;  2R42 A;  5B09 A;  5BXI A;  5DLW A;  1Q8B A;  1S1V B;  2WSE C;  3CT9 A;  4AT1 B;  5FLX U;  4Y3C A;  4A8M P;  2BOP A;  4DLG A;  2E1M C;  4K8R A;  1RIS A;  2HFV A;  2LYV A;  3PJ9 A;  2WSF C;  1U1M A;  4OZ5 A;  3C2P A;  2XSJ B;  2YNF B;  2VQE F;  2HHQ A;  1VQN S;  1HWI A;  2FVP A;  2CIM A;  3MOJ B;  1VRQ C;  2GGP A;  2VJU A;  2CQ2 A;  2RSQ A;  4ICL B;  4RBV A;  5IM0 A;  2PI4 A;  3G2X A;  1DAR A;  2QLJ B;  3Q24 A;  4KV8 A;  4E98 A;  3GJT B;  3DGV A;  2YKN A;  4WIQ A;  4C8L A;  5KFW A;  1XMQ J;  4ATN A;  2KRB A;  2G2Z A;  3NNH A;  2IMO A;  1ZS6 A;  4F8R A;  1KKH A;  2R7T A;  3VZH A;  3HFV A;  1VRU B;  3UCZ P;  4JV5 J;  4FDJ A;  1NCL A;  1ED8 A;  4KGZ B;  4DCJ B;  4RW8 B;  1KDN A;  1T0T V;  1YRU A;  2HHH F;  2XLJ A;  1Y7P A;  1FRH A;  1T9W A;  1FJG F;  1QUP A;  3QT7 A;  3NGD A;  2V2K A;  3X3U A;  1KD1 T;  4K4S A;  2NZ4 A;  1MN7 A;  1S6Q A;  2Z58 B;  3IS9 B;  3PG9 A;  2WVF A;  2JH3 A;  2CJB A;  2RJZ A;  3EZO A;  4CH1 A;  4ID8 A;  4B3T J;  4OI2 A;  1FF2 A;  1DAX A;  1HLW A;  2B8Q A;  1FE4 A;  1H73 A;  5KAK A;  1E33 P;  4ILR A;  4CZC A;  1M5V C;  4NWX A;  4ES2 A;  1TL1 B;  1C0T B;  4P74 A;  4CT9 A;  2IVM A;  4LF5 F;  4KGM A;  2QIF A;  3OT9 A;  4ZA1 A;  1LQ9 A;  3DI6 A;  4KRW A;  3J7Y I;  1I51 B;  3CO0 P;  2ZKT A;  1P8G A;  5DQH A;  4X4S A;  3V81 B;  3EPG A;  4LF9 F;  1GX6 A;  1ZZF A;  1VR6 A;  1ZM9 A;  3GYG A;  3N5F A;  2GMJ A;  3GR1 A;  4N8O A;  4A8S A;  1NB7 A;  1YBA A;  3G6E S;  2VAS A;  1XWL A;  2K3K A;  3CC7 S;  4B3S J;  3R6L B;  2R2S A;  4IUF A;  5C42 A;  3D54 A;  2ROE A;  5HMW A;  2GCF A;  1RI7 A;  2GMH A;  2XI2 A;  2ZBR A;  2I1R A;  1E6V B;  1SKR A;  2XM3 A;  2VFR A;  1N5S A;  4FN5 A;  3U1M A;  4K4W A;  4FYX B;  1HMV B;  3TG0 A;  2JZ5 A;  1FNO A;  1HPZ B;  2UZA A;  1CUL B;  4I69 A;  3TA0 A;  4A4J A;  4USJ C;  3CJK A;  3LWL A;  1MLA A;  2DB1 A;  3B6B A;  2PA3 A;  2YNG B;  3MM6 B;  1W25 A;  4FYD A;  3RBX A;  3A8J A;  4Y2C A;  3NGT A;  4PXC A;  4L74 A;  3GMG A;  2HPU A;  2PEB A;  3I82 A;  3KDN A;  4BWM A;  4YR1 A;  5LJ3 Y;  4G3I A;  2WVE A;  2XS2 A;  2O66 A;  4NA3 A;  2MMY A;  2E1C A;  4RNN A;  4F7V A;  3GYN A;  3DM2 B;  3Q8R B;  2CKW A;  1TKX A;  2IIH A;  4DL5 A;  2IBO A;  1IKW B;  2IRU A;  5KFY A;  4TYB A;  2CZ4 A;  3H8Y A;  3U1N A;  5ADZ A;  1VQ8 S;  1R0A B;  5KG7 A;  1RWP B;  5CYQ B;  4YDD B;  2FPH X;  1RHR B;  5HK4 A;  2HHT A;  3R5G A;  2IM3 A;  2UXB J;  1S9F A;  3UDC A;  1D0E A;  2E5L F;  4RU2 A;  2NYH A;  1NU4 A;  5ITH A;  1H2U X;  4NI2 A;  2AJF E;  3DOK B;  2BE2 B;  2E1P A;  1HNW F;  1KLM A;  4GMK A;  1HW8 A;  2CPF A;  4PXD A;  2RRA A;  2XR9 A;  2JVO A;  3BGR B;  3NS6 A;  4R8U A;  4DI6 A;  3R1L A;  3CIM A;  4OZ3 A;  2ZBP A;  2A0F B;  3WX4 A;  4Q45 A;  1UPM B;  4A8Y A;  1BQX A;  4N47 A;  1SJR A;  4F67 A;  1BLU A;  2B3T B;  3IAS 9;  4GVB B;  4OYP A;  1ZAV A;  2E5H A;  4WFZ A;  2DCU B;  2OKQ A;  3NXZ A;  2ZBI A;  1MNE A;  3M8R A;  2E9T A;  1FD8 A;  4M95 A;  2HVI A;  1K0V A;  2WON A;  4PG7 A;  1X0P A;  3ZTO A;  2F1F A;  4TQS A;  3M2V A;  2J7K A;  4LF2 A;  3OXG A;  3OSN A;  4CO0 A;  3ZZP A;  5IWA J;  4EYH B;  3OVA A;  1VI7 A;  1RKI A;  4TY9 A;  4J9K A;  4AUK A;  1N5T A;  2RHS B;  1LXJ A;  4DS4 A;  2IUC A;  4X84 A;  1RBA A;  1XNR J;  1DHM A;  2B9Y A;  1HQU B;  2JC0 A;  3I0R B;  2MQQ A;  1WD6 A;  3KNA A;  1S1X A;  2YKQ A;  3I4P A;  3P49 B;  5K9F A;  2M4M A;  2ZWP A;  2MXY A;  4LFA F;  1ALI A;  5LSO A;  3PFO A;  1U49 A;  1RBO B;  2HLU A;  4O3R A;  4EK2 A;  3W5X A;  4DR7 F;  1EW2 A;  2MKY A;  5JJB A;  2K2P A;  4CYS A;  2VKZ G;  1NHV A;  4ED1 A;  4M94 A;  1HBU B;  2HS4 A;  2W2N P;  4EUV A;  2UVU A;  4DSI A;  5A0Y B;  2VON A;  5AE2 A;  4LFB J;  2ZBC A;  1N52 B;  1VJW A;  3C16 B;  3KJQ B;  5D78 A;  5DZ6 A;  2AZ3 A;  5HQL A;  1S7H A;  5GAH I;  5L1J A;  3SZ2 A;  2UUA F;  4C3M A;  4ELT A;  2MHN A;  2OSR A;  2RKI B;  4TNO A;  4DV0 F;  1EW8 A;  4M5J A;  2L9W A;  3GII A;  3KLI A;  4LF1 A;  5D4O A;  4LUB A;  2WW4 A;  3TAR A;  3A3P B;  5I3U A;  4K4U A;  2XMU A;  1S4E A;  1WC4 A;  1JXL A;  4JI0 F;  1ELX A;  5FII A;  4E8U A;  2G0J A;  3FQL A;  2EKY A;  3HHL A;  2XYH B;  4OYM A;  4DR1 J;  5IQQ A;  1XNQ J;  1C1C A;  5LIA A;  5HP1 B;  2RVJ A;  3K8W A;  4DXL A;  3RR7 A;  2XTJ P;  1IM6 A;  1RAD B;  4M5K A;  2C3M A;  4Q8F A;  1HHT P;  2N82 B;  1WC1 A;  3E01 B;  2CPY A;  4QPX A;  5FLX Y;  1RWK B;  3T19 A;  4HT7 A;  2W5V A;  1T9Y A;  3W2W A;  3NAI A;  1E3C P;  5AE1 A;  4ZIW A;  1NHK L;  3GJS B;  8ATC B;  4K2X A;  4DX5 A;  2W9C B;  1WHW A;  2GS8 A;  2PEH A;  1VHI A;  2YBV A;  1HBM A;  3MR7 A;  3UD3 P;  2HHS A;  1KOO A;  2G9O A;  3KK1 B;  1JJC B;  2DNO A;  4U96 A;  3HO1 A;  2VF3 A;  5LMN F;  1ZET A;  4PAB A;  3NNC A;  1S79 A;  3MM8 A;  1S6P B;  1X5T A;  3M6W A;  3TWZ A;  5CH7 B;  4ZPB A;  1HQE B;  2DPI A;  5CZV A;  1V5V A;  5KG1 A;  2MY8 A;  3UW1 A;  3PDN A;  3JSM A;  3UDL A;  1RU2 A;  3MD3 A;  1U48 A;  3EVM A;  3DRR A;  4GO7 X;  5IC4 B;  2ZH4 A;  3DOL A;  2DNK A;  5HVH A;  3IMQ J;  1YI2 S;  1BUX A;  1NSA A;  1IQZ A;  1AXQ A;  1SH2 A;  1OJ4 A;  3QFH A;  2RE1 A;  4ID5 A;  3MPU B;  2DR6 A;  2KTQ A;  2AEF A;  4WKY A;  3SSQ A;  5C2C A;  5CYM B;  1QAJ A;  3IAM 9;  1ZTW A;  2CJ9 A;  2KU7 A;  3BV8 A;  4ZIT A;  2N7Y A;  2M52 A;  1PCA A;  2GHV C;  4DN0 A;  3HVT A;  3MMJ A;  5AXL A;  5DDP C;  1H7X A;  4B9U A;  4LQ9 A;  4QWE A;  4OYX A;  3NMR A;  3UNY A;  1YZ6 A;  3ZTP A;  5D0H A;  2YQ3 A;  3MD1 A;  4Y0F A;  4JI5 F;  4HL9 A;  5L38 A;  1YLX A;  2HW3 A;  4KAV A;  3DI6 B;  3EGN A;  3D1O A;  1SJF A;  4WFB Q;  1FRX A;  1QD1 A;  2F5G A;  3EZU A;  3FFI B;  4LSN A;  2DRD A;  4M5D B;  3BB5 A;  4MAK A;  4RNH A;  5D4P A;  4DR2 J;  1S72 S;  1KR4 A;  3L3C A;  3QZ7 A;  2Y0B B;  3KMS A;  5HQM A;  2Q3P A;  1V5I B;  2VD3 A;  1QJH A;  1NSQ A;  1KBR A;  2FB0 A;  4UUW A;  2BMB A;  2CYY A;  3EWG A;  3HLU A;  1LV5 A;  4K5R A;  3GPA A;  4Z2X A;  2ZVS A;  3DDI A;  1R8H A;  4X64 F;  3US5 A;  4NOH A;  4KB7 A;  3MFI A;  3UWT A;  4LF9 J;  2W24 A;  3CXC R;  2PMZ D;  4RW8 A;  1CJU A;  2OJ3 A;  2WCX A;  2R7W A;  4CTA B;  5KFH A;  5DLF A;  1T9X A;  3OTE A;  1Q86 T;  4F02 A;  5K14 A;  2RRB A;  2CNN B;  1P49 A;  4F3M A;  1OO0 B;  3AXM A;  4LJM A;  1RU1 A;  4QPT A;  1IBL J;  1FKO B;  2Z2Y B;  1T03 B;  4B3R J;  4PWD B;  5K20 B;  4DV7 J;  1ZZN A;  2RH3 A;  3PW4 A;  1GXU A;  1YIT S;  2J8S A;  2PO4 A;  2NXN A;  1R7I A;  3GZ7 A;  3FEZ A;  3T1H F;  4K0K F;  2AT1 B;  2KDO A;  1H0H B;  3G8Q A;  4MK7 A;  4CLS A;  2JFD A;  5JMN A;  5J2M B;  4YR3 A;  4KR0 B;  1K47 A;  5B0D A;  3QGG A;  4JI1 J;  3GYX B;  5KFX A;  1JWW A;  2OPQ A;  9ATC B;  3PY8 A;  4ELU A;  1R0A A;  1GXT A;  2NR0 A;  3O6Q A;  2DGS A;  3EJM A;  4WXW A;  5GME A;  2HS3 A;  1JLF A;  1KWM A;  2CJA A;  1UJ4 A;  3QNW B;  4OFZ A;  4ZPT R;  3J80 U;  2CAD A;  2IJR A;  2BDP A;  1ZPW X;  3I5C A;  2XYP B;  3NKQ A;  3ISZ A;  1YBU A;  1X4G A;  2BBE A;  2QMU B;  3KJV B;  2AU0 A;  1HWJ A;  4A8X A;  3PR5 B;  4NWB A;  2IAJ B;  3NGU A;  4LQ3 A;  2ASY A;  4QWB A;  3OHB A;  2FY8 A;  3KLF B;  3M8S A;  2B7B B;  4NRT A;  3BQ2 A;  4DV4 J;  1URN A;  5E3P A;  4JYA F;  2YKM A;  1MW7 A;  1VYA A;  3QGI A;  1ELZ A;  2H4Y B;  2HQC A;  3CCE S;  4HAC B;  5KFB A;  1RAH B;  1FT8 A;  2DVI A;  1JKH A;  3ICL A;  2W5Q A;  3T3F A;  3GFY A;  2HUR A;  1T9U A;  4XK8 C;  2RML A;  3QAE A;  4FZV A;  2RT3 A;  1SCJ B;  1R8B A;  2CG4 A;  3IXQ A;  5L39 A;  5J2Q A;  1KFS A;  2YKO A;  2R7S A;  2QT7 A;  5HL7 Q;  4DPU A;  1DTT B;  2LKZ A;  4OV1 A;  2FJX A;  2G9Y A;  3MCO A;  4PAA A;  3LUY A;  4N5S A;  1I94 F;  1X4A A;  5KFA A;  4B3T F;  3D67 A;  3U7J A;  4WU2 A;  3HJV A;  1RB0 A;  1MWQ A;  1T9T A;  2RB7 A;  1I3O B;  2CJY B;  3VAH A;  3CJQ A;  5HQ8 A;  3BEG B;  2JL9 A;  1TZ0 A;  5LRN A;  1S7I A;  3VWS A;  4FXW A;  2LEB A;  3MCS A;  5FDL A;  1NPP A;  1S6U A;  2XSF A;  3OV7 A;  3OUY A;  1KLM B;  3D4J A;  2LQ5 A;  2R8I A;  4F50 A;  1M1K T;  4GKJ F;  2LU2 A;  2IA6 A;  4RNM A;  1G2E A;  3A52 A;  2F8M A;  1RHM B;  4TQR A;  1FJG J;  4ECU A;  2HRT A;  3VGV A;  3MED B;  1XC9 A;  1WOP A;  5J1E A;  1RAI B;  4AE5 A;  3EX7 B;  1CQN A;  4QZV B;  3I32 A;  1RTH A;  3TX0 A;  4QBU A;  5EGH A;  4ITS A;  5M2U A;  1N88 A;  3KJF B;  1PYT A;  3T1A A;  3NOC A;  3PZP A;  3MPV A;  2LCW A;  4YR0 A;  4JV2 A;  1PIE A;  1H2V Z;  2ASJ A;  1RT6 B;  5DQG A;  4C8Z A;  3FRZ A;  2RU3 A;  3JQJ A;  1BWE A;  1T11 A;  3THP A;  4NCG A;  1B64 A;  5I3U B;  1S9E B;  2RQ4 A;  1U1O A;  1WC3 A;  3DXB A;  3H4B A;  2BAB A;  5KG3 A;  1FI4 A;  4ZN1 A;  3KK3 A;  2RH6 A;  3O44 A;  1RWM B;  1ZBT A;  3BM7 A;  1RAO A;  3GE9 A;  3HHL D;  3RU0 A;  2QMW A;  4UPK A;  1WKL A;  2E7W A;  2MZR A;  1REG X;  2UV8 G;  3R5C A;  5KFD A;  3C19 A;  4DF4 A;  2BKO A;  3B4D A;  1HFE L;  2G0C A;  4Y28 C;  3QLH A;  2HK2 A;  4UOG A;  3QRP A;  1IN0 A;  1P27 B;  2ILZ A;  3R9L A;  3NGK A;  3TOQ A;  2UXB F;  2K3I A;  2C2E A;  1VQM S;  3GIK A;  2DEI A;  4M63 A;  2FY1 A;  2MKJ A;  5IXU A;  4P7V A;  4O3Q A;  2D3O 1;  1GX5 A;  3AQO A;  2MJU A;  3TAN A;  1VBK A;  1XEZ A;  3C6U A;  2ATL A;  3QT6 A;  1W2B R;  4LFC F;  1JLG A;  4I56 A;  4PYD A;  3IP0 A;  1F2G A;  2QRR A;  2ZOM A;  2ZWO A;  4MKV A;  1RAC B;  3R97 A;  4ECS A;  1R6Y A;  3UN2 A;  4RNF A;  3PKY A;  3BGO P;  3QT5 A;  4G6V B;  1CBK A;  4LMZ A;  3PNI A;  3ZO7 A;  2NS1 B;  3JAM Y;  2G1D A;  2MQO A;  1SKW A;  5KFG A;  1ZEF A;  3U27 A;  1O99 A;  2N4D A;  3R7N B;  4USK A;  2E9R X;  2HNZ B;  3M2U B;  1ACM B;  1KTV A;  3T6J A;  3LAK A;  1S57 A;  2FHJ A;  4F2S A;  4RKU C;  3TVK A;  3IR5 B;  8RUC A;  1RDR A;  3W5Z A;  1HNI B;  1JLA B;  3AB4 B;  1SJ1 A;  2CUY A;  1XR7 A;  2RIJ A;  5F3T A;  2GSO A;  5IWA F;  3HSD A;  1UWA A;  4I2Q A;  2ZEJ A;  3TW0 A;  3DGP B;  5A76 A;  5LMU F;  5B0G A;  2GA7 A;  2L3M A;  3RW7 A;  3RB6 A;  1OY6 A;  3MM7 A;  1ZM2 A;  1UJ5 A;  1TL7 A;  2FUG 9;  2HBZ B;  2P6S A;  3ADA C;  2QX0 A;  4ZVS B;  5CYJ A;  2MHE A;  2XS5 A;  1ALK A;  3UCU P;  3MEE B;  3OR2 B;  2BJ7 A;  4WYW A;  5CZX A;  4DJB A;  1UA1 A;  2B8P A;  4NX9 A;  4Z37 A;  3NS7 B;  4LFA J;  3KLE A;  2JFK A;  5BJR A;  1K1S A;  2UUW A;  4DV5 F;  4NZ0 A;  1FEE A;  3VAF A;  3R5D A;  2IDL A;  3IWN C;  5DLV A;  2EXU A;  3DRX A;  3IS9 A;  2UXC F;  3M8Q B;  4UTG A;  2D9O A;  5FD1 A;  1UVL A;  3CDU A;  4LR2 A;  4PR6 A;  3ZZO A;  3JS9 A;  1YJW S;  4HI1 A;  2BW2 A;  3AT1 B;  1CJU B;  4P52 A;  1S0M A;  1NJI T;  3DRP A;  1FKP A;  1KHJ A;  3E51 A;  2DRB A;  1DQA A;  1P1L A;  2GML A;  2FDN A;  2WOM A;  3HF5 A;  4ZKA A;  2XC9 A;  2HMI B;  2CZ9 A;  1I1G A;  3TYT A;  3V2U C;  2BAN A;  2RF2 B;  1Q53 A;  2MQM A;  4CM0 A;  1X9S A;  1D8Y A;  2AJ0 A;  3HUL A;  2DIU A;  1HW9 A;  2HGN A;  3MMC B;  1S48 A;  4DHV A;  2W9B B;  2DNQ A;  4HHH A;  3HZG A;  4QIV A;  4F04 B;  2B4V A;  3T02 A;  4K59 A;  2HWH A;  2XRG A;  4ZP7 A;  3A13 A;  2PC6 A;  2W1B A;  4OZL A;  1JB0 C;  5ETO A;  3RYL A;  2O01 C;  1EET A;  2XZD B;  4H4K A;  3BPS P;  5BYR A;  1IKY A;  4IRD A;  4OX6 A;  3KG4 A;  1U1L A;  5F8H A;  1LWC B;  1R6V A;  2K7J A;  2PT0 A;  1RUS A;  3T1H J;  4FXD A;  4F4K A;  4K0K J;  1U0H A;  3Q3Q A;  4XDC A;  4KM4 A;  4ZP8 A;  2XNQ A;  1SQG A;  3OR1 A;  2HAF A;  2KJV A;  1VCT A;  4CDI A;  4YME A;  3KUH A;  2ZNZ A;  4ZJL A;  3HFK A;  5A6W A;  4DG1 B;  1BD6 A;  1M1G A;  4FYW B;  3T5H A;  3MF5 A;  4KJD A;  4KT0 C;  2SXL A;  2IJN A;  2FLO A;  1N32 J;  5K8N A;  4WTO B;  2JJ4 D;  4BC9 A;  1TFY A;  4HKQ A;  2DGQ A;  4DU8 A;  2VG7 B;  4ZVU B;  4OYB A;  7FD1 A;  2B43 A;  3M8Y A;  4NXN J;  1BMQ B;  2BM1 A;  2H51 B;  2QA1 A;  2ZUG A;  4KV8 B;  4ANE A;  1DZ5 A;  2GJF A;  4DX8 H;  2KXN B;  3QAT A;  3K89 A;  1OWX A;  3BO4 A;  3VAK A;  1JLB A;  1DLO A;  3OD2 A;  2LMI A;  1OYD A;  4QYZ J;  1S6O A;  3RZA A;  4LF8 J;  2RAQ A;  3K5N A;  3W8P A;  2CDR B;  3K8V A;  2MLY A;  3I4H X;  3MEC B;  1FD2 A;  3NLC A;  3UDV A;  3CMA S;  2CJQ A;  3M8P B;  2V8P A;  2MKC A;  3I0S A;  3CCT A;  4CH0 S;  4X65 F;  3H5Y A;  1GQE A;  3WAX A;  1ZAW A;  1O51 A;  4RR5 A;  4CXK A;  2MZT A;  4QQB A;  4FNI A;  1YJ7 A;  4KFB B;  3W2V A;  4KKO A;  3CCQ S;  2BKN A;  1Q79 A;  4JP8 A;  2V34 A;  1EIY B;  4WP3 A;  1IKX A;  4ZLL A;  3J7A N;  4ZPW R;  2OH2 A;  3RG6 A;  1KC8 T;  1IXK A;  1WAC A;  1VGY A;  5KG5 A;  1IJF B;  2EVZ A;  2ZNY A;  1LK5 A;  5BYQ A;  3OJS A;  2Q66 A;  1IVZ A;  2XO6 A;  5KT6 A;  2NXJ A;  2V2Z A;  4OX9 F;  2GSU A;  2ZH7 A;  2YWK A;  4NXN F;  1VIX A;  2VKR A;  4DUZ J;  2E9Z A;  2DCL A;  3PYD A;  2R8J A;  2F8H A;  1VQ7 S;  2UU9 J;  2FLL A;  1O6X A;  1VDH A;  2MQL A;  1RTI B;  2J6T A;  4PUO B;  2HZA A;  4OX7 A;  2QLB B;  4DQQ A;  1EP4 B;  2DK2 A;  2VDH A;  3CUN A;  2MJN A;  2Z0G A;  4NI2 B;  2JSX A;  3M4X A;  1S9G A;  3AOB A;  2W9A A;  1NAQ A;  1A0O B;  1S99 A;  4TYA A;  2J9D E;  2VG5 B;  1WC6 A;  2R7O A;  3H2U B;  2V8D A;  3TZY A;  2V4R A;  4W92 B;  2KT2 A;  5LT5 A;  2POK A;  1PO6 A;  1M5S A;  1RWU A;  2KYZ A;  1KH5 A;  4LRD A;  3UR0 A;  3DLH A;  1PAE X;  5EX0 A;  4B56 A;  4HR2 A;  2CQ1 A;  4WBF A;  5A0Y A;  1SC6 A;  4TLR A;  3VQT A;  3CMQ A;  3SV4 A;  5ETP A;  3SEO A;  2V8G A;  4DFJ A;  3KOA A;  5DDR C;  1MN9 A;  4N7T A;  4PPZ A;  1FEH A;  5EUH A;  2BM0 A;  3G9C A;  1K9M T;  3POT B;  2Z2L A;  1YK9 A;  1CJT B;  5IV4 A;  4U67 Q;  2HHH J;  4K50 A;  3J7Y U;  1U8W A;  4JI6 J;  2HEK A;  2ATC B;  4X4U A;  2V8V A;  2W4D A;  3M2V B;  2M7S A;  5HAT A;  1IBL F;  1FXL A;  1N34 J;  3HD1 A;  2VHG A;  4C97 A;  3TQ1 A;  4FVM A;  1OQ3 A;  3S7R A;  4EU0 A;  3T1Y F;  1UTA A;  1WSV A;  1HWK A;  3K17 A;  3V6D A;  2H65 B;  2UUC J;  4J91 A;  5K4P A;  3FEY B;  4ZG9 A;  2D3O R;  3NRB A;  4LF4 F;  1LFW A;  1ZOT A;  2GO9 A;  2AW0 A;  2CQC A;  4OYW A;  1IKV A;  3B82 A;  5EWE A;  2PDA A;  2E5G A;  3NKP A;  2XWX A;  4ECW A;  3AA8 A;  2ZFH A;  5SUH A;  5GMK a;  4ZDN A;  3D6M B;  4K4T A;  3BDP A;  3SQO P;  5KFO A;  2VPX B;  1RA7 A;  2CPD A;  3DDK A;  2MKS A;  1HBM B;  4OLO A;  4YR2 A;  2HGL A;  1CVJ A;  2I6W A;  4DS5 A;  1FHT A;  1VBY A;  5B0E A;  2VIH A;  4PCQ A;  4OHX A;  3TUZ C;  1VK8 A;  2IPO B;  4OI3 A;  5E33 A;  2AYB A;  5IJS A;  1SJQ A;  2GLQ A;  3LQV A;  1YSJ A;  1UEV A;  2WON B;  3D28 A;  4DBQ A;  1NND A;  4ECQ A;  2GIF A;  3SCI E;  1EAY C;  1W26 A;  1VFJ A;  3MWB A;  3N79 A;  3OTD A;  2ACY A;  4ZCM A;  3I56 S;  1XMO J;  3CDA A;  3CJ0 A;  5K8P A;  3ED4 A;  2NSB A;  3GR0 A;  2M9K A;  3HX9 A;  4WPA A;  1XR6 A;  3DPC A;  2ZM6 F;  3F73 A;  1N33 J;  3H5X A;  4UPH A;  2H54 B;  3TJ9 A;  1WC5 A;  3PYE A;  3QPI A;  2UVW A;  1IR0 A;  1L5U A;  3WX8 A;  2OPS B;  4UOR A;  3QSY B;  1CSJ A;  2IDE A;  2IY5 B;  3HVT B;  2ABY A;  3NG8 A;  4B08 A;  4C6A A;  3N6N A;  4P2X A;  2IJF A;  3IRW P;  3LXQ A;  1FXR A;  1B0T A;  2DNH A;  2DGU A;  1UW9 A;  2VFT A;  2JEJ A;  2HQG A;  5A8K B;  3VAG A;  5DDO C;  4DZ6 A;  1RT1 A;  1C0U A;  4EWT A;  2RDJ A;  2GQ2 A;  2XMM A;  2E7X A;  5D0R A;  3I5B A;  4ECT A;  1VQL S;  2B4P A;  4JV5 F;  4M5D A;  3CCZ A;  4PWU A;  3P6Y C;  2CFX A;  3BKF A;  3R7S B;  4J9R A;  3RRH A;  4ZIV A;  4DF8 A;  4IO9 Q;  2M88 A;  3S1T A;  3UVJ B;  1U1P A;  1MMD A;  3BR9 A;  4QOT A;  3M9N B;  1HQE A;  3LPE A;  3UD5 A;  1SC3 B;  2GX8 A;  3CGI A;  2OO4 A;  3HVA A;  2ZVI A;  3FMB A;  2HLT A;  3H2V E;  4LRE A;  1XJW B;  2HK3 A;  1A9N B;  1B8J A;  4F2R A;  3DRR B;  2V9K A;  3LP1 A;  4KSE B;  4G1P A;  2AGP A;  1QTN B;  2FLN A;  2NUU G;  2BJ9 A;  3VAI A;  1S1U B;  1T02 A;  2B9W A;  5THW A;  3R8Y A;  5HMX A;  3EXY A;  3KHR A;  1GT8 A;  2N7C A;  3D68 A;  5K14 B;  1XMQ F;  3NBP B;  3DN9 A;  3TVY A;  2FVC A;  4CT8 A;  4P2F A;  3CCM S;  1FRL A;  1RLC L;  4IH5 A;  5E7O B;  2UXD J;  3GB0 A;  2AEJ A;  1Z2Z A;  4PPD A;  4K4X A;  4IR1 A;  3UI3 A;  2ACM A;  2M3D A;  2HBR B;  4N8N A;  2NCK L;  4RW6 A;  3THV A;  3OSP A;  4L3K A;  2M0G B;  4KJG A;  4X66 J;  1QAY A;  4DPW A;  4DV6 F;  1XBW A;  2VFV A;  3QGH A;  2J7W A;  4MK8 A;  5KFE A;  5IFM A;  1NKE A;  1IWA A;  4K4Z A;  3P3D A;  3SFG A;  2GA3 A;  2HFO A;  3W9J A;  1WG5 A;  1RHU B;  2E7V A;  4ZPV R;  3FFI A;  2HVH A;  1GXL A;  4JOU A;  4NWJ A;  3MM8 B;  4LQY A;  2RUS A;  2YNI A;  3J80 Y;  4RO0 A;  1RZM A;  2CPX A;  1RYS A;  5KFR A;  1KQK A;  4I4B A;  2HWI A;  4DWI A;  2JOQ A;  2BRL A;  4DL3 A;  2HHV A;  3OTO J;  1AFI A;  2P6T A;  2V50 A;  2HQF A;  3BDE A;  2NUH A;  4IH6 A;  2C2R A;  4NEY A;  4YB7 A;  2WZ1 A;  3MEC A;  4ZVH A;  3QJP A;  2QFJ A;  1AA1 B;  2HWT A;  4GKK F;  1AJD A;  3D0I E;  2BJE A;  2PII A;  3SQG A;  1QE1 A;  4M5M A;  3MR3 A;  1N8R T;  2P9E A;  3L7P A;  3MDF A;  4KFB A;  4ZK7 M;  4YOE A;  3FK4 A;  1RGV A;  5IV3 A;  3W65 A;  2IVY A;  1PG5 B;  2Q43 A;  3P5T L;  4CNY A;  4WKR A;  2IYG A;  1R43 A;  1WG4 A;  4FKX A;  2KKH A;  5LSL A;  1Q0N A;  1WTF A;  2P5V A;  1YJN S;  4YP3 A;  1F5B A;  3A12 A;  5IT4 A;  1SB6 A;  1VQS A;  2B4O A;  5A8R A;  2YTC A;  4M1K A;  3GSI A;  3CJ2 A;  4MKA A;  5RUB A;  2XBP A;  1FNX H;  4FF4 A;  2EC0 A;  1UZD A;  4LSL A;  1AYE A;  1RTD A;  3C15 B;  1KTQ A;  1O5J A;  1TR0 A;  3I96 A;  2DGX A;  2V0N A;  3CCV S;  1R8A A;  3KLV A;  3DCA A;  3FCW A;  4L76 A;  2JX2 A;  2JRS A;  4RW7 A;  1QVF R;  1LNQ A;  1NM2 A;  3MCN A;  2MDA A;  2J6S A;  1CC7 A;  2MYF A;  2KB2 A;  7AT1 B;  5T14 A;  1URR A;  4OHZ A;  2X1F A;  4ILM A;  1NJY A;  2R3V A;  3G82 A;  3SV3 A;  1L3U A;  3LTO A;  1M5P C;  1B7F A;  5KFM A;  2G2O A;  2VB6 A;  4OJH A;  3NCR A;  2WSC C;  3DLG B;  3GG0 A;  2QO3 A;  2ZE2 B;  5H9E J;  2AZ1 A;  3EIC A;  3HHN B;  2EPI A;  2C42 A;  2I5J A;  5H9E K;  2MKH A;  4IOB A;  2FJV A;  1XTZ A;  4CLW A;  5KFJ A;  1NB2 A;  2FC8 A;  4DQI A;  2KT5 A;  3ZZZ A;  5KFP A;  3CCW A;  4FPI A;  2DIT A;  2N3O A;  3PHE A;  4DCP B;  1F5A A;  5CAA A;  2YH1 A;  1WUU A;  1SQF A;  3DC2 A;  1NJW A;  3EE3 A;  2CQ4 A;  2ZZN A;  1TU0 B;  2C3O A;  1LFP A;  1X0F A;  1JJ2 R;  3G4S S;  2XNR A;  2E1R A;  1E6Y A;  2HG4 A;  5HLF A;  3D6F B;  2HHW A;  2LP4 A;  1FWL A;  2EFP A;  2DHH A;  5D6G A;  1J5E F;  2WTF A;  3HT0 A;  2XYG B;  2L48 A;  1K7H A;  4V1A k;  2B6A B;  1N32 F;  3OL7 A;  1T7P A;  2IM1 A;  2W2O P;  3CSK A;  4ZVF A;  4YHH J;  1N6Q A;  3CJ5 A;  5KFU A;  3IR6 B;  5C2G A;  1EAR A;  3PRB A;  9RUB A;  5DDQ C;  4NLY A;  4P72 A;  1IBK F;  1NXI A;  1O8B A;  3SXL A;  3M2R B;  4GC7 A;  5J1E B;  1NPR A;  4DV1 J;  1R31 A;  1GNK A;  3RBZ A;  2RQC A;  3H42 A;  1KHL A;  1X4E A;  2F3J A;  4Y2I A;  1FRM A;  1PJ5 A;  5T41 A;  3MR2 A;  2QTW A;  3MGJ A;  2KVI A;  4MH8 A;  4Q2M A;  1CJK B;  4QIF A;  2HS0 A;  5J2P B;  1RT5 A;  2WVB A;  4Y00 A;  1AJC A;  4RW9 A;  4IFV B;  3UCG A;  4M5L A;  4X65 J;  2DNR A;  3GSD A;  1QSS A;  2Y8W A;  4C8Y A;  1FK9 B;  3M2U A;  1PJ7 A;  2I38 A;  2MGZ B;  3N0V A;  1A6L A;  3DU5 A;  4USU A;  1C1B B;  4ZMM A;  2F4V F;  5E3A A;  4H4K C;  2ZJQ Q;  2OPS A;  1M1H A;  4RUH A;  2BUN A;  4DL2 A;  1SHN A;  5FDL B;  2CPJ A;  1M5O C;  1B3T A;  3WHI A;  4JI1 F;  4ZPA A;  4OX9 J;  4CYU B;  4WFN Q;  1REV A;  2FHM A;  3WBH A;  3QO9 A;  5JVG Q;  1HI8 A;  4AND A;  4J9P A;  2R7R A;  3ULH A;  4Q2L A;  3JTN A;  4IYQ A;  5F8G A;  4LRC A;  2XO7 A;  2VPY B;  1U02 A;  2ZDO A;  1RT1 B;  3ELH A;  3H20 A;  1KHW A;  4IFY B;  3QJJ A;  1ITP A;  1URB A;  4IDK A;  3EGZ A;  5C66 A;  3R2D J;  3M8W A;  3FRY A;  3NVL A;  3FCV A;  3OL8 A;  4K2J A;  3V4M A;  2C2N A;  3BDG B;  1AUK A;  3AH6 A;  3EGV A;  1RT2 B;  4YEA A;  2LXI A;  3KHL A;  2VFS A;  3KLH A;  1GEH A;  3IBC B;  2C3P A;  3BSO A;  1CPZ A;  4ECR A;  2LA4 A;  4NCB A;  4CLF A;  3LP1 B;  3BSN A;  3DYC A;  1TMM A;  3AD8 C;  2B51 A;  2HAI A;  3LP2 A;  4LIR A;  2FJB B;  1JMT A;  5D77 A;  1D09 B;  3EYZ A;  3CJ8 A;  4S0M A;  4G1I A;  3BH7 B;  1IBM F;  4ZLJ A;  4PG8 A;  3DRS A;  4ZHR A;  2I8E A;  2U2F A;  1L3S A;  1N34 F;  2LEP A;  1T3O A;  2YQ0 A;  2BQU A;  1NHU A;  3P5B P;  4I2Q B;  1UVM A;  3UN5 A;  4K4Y A;  2VG6 B;  3Q8S B;  3C3L A;  2D7S A;  1Q5V A;  2XSJ A;  2EI5 A;  3W64 A;  2DGO A;  3D0G E;  3FEX B;  1C0U B;  1Q7L B;  3R5A A;  2R8H A;  3TP2 A;  4DFP A;  4ZJO A;  4J9O A;  2DR5 A;  1CJV B;  2W25 A;  1BE4 A;  2HKE A;  3DHW C;  3KXD A;  5K8O A;  4O0I A;  4EMD A;  4O3S A;  1TAU A;  3W9I A;  3JQK A;  3KWM A;  2OPR B;  3IA0 A;  1WKK A;  4JUZ A;  3ZZR A;  5C25 A;  4YB6 A;  1AT1 B;  2RIL A;  1DTQ A;  1Y5L B;  4I1T A;  2LQ8 A;  3CO9 A;  3AAW B;  2QJ3 A;  3I6P A;  4C8M A;  4C3L A;  1U1R A;  1GK8 A;  3PW5 A;  1IUJ A;  1VRU A;  1B7Y B;  1UWB B;  3P45 B;  4OHV A;  4CLT A;  4N41 A;  4C9D A;  2XZW A;  4FDI A;  1ULR A;  4FBT A;  1MML A;  3DLE B;  2GNK A;  1FSU A;  2J76 E;  2H5I B;  2L08 A;  3PX0 A;  3RB0 A;  4C2M A;  1NSK L;  1JNZ B;  3VTI A;  4ED8 A;  5G4D A;  2IRY A;  1UZH A;  4LF6 F;  3NBP A;  1JXV A;  2KM8 C;  3GIJ A;  4KO0 A;  2WOM B;  5E3R A;  3CCU S;  2W2Q P;  1LOU A;  3QT8 A;  1KON A;  4KE5 A;  3EDQ B;  3R2C J;  1WF1 A;  3ILI A;  3CIZ A;  1RE1 B;  5GRR A;  3PCO B;  3W66 A;  4ES1 A;  3AXK A;  4NXM J;  3F0N A;  2W9B A;  2R2T A;  1T9V A;  2ANH A;  1TL7 B;  4ZP6 A;  3AY0 A;  1VC5 A;  3PW0 A;  4MMO A;  1RK8 A;  1YJR A;  2QL9 B;  3G6Y A;  2AX1 A;  4MT1 A;  1YTY A;  2VJV A;  1N2K A;  2LDI A;  3HVW A;  4UPI A;  1NKC A;  2OHD A;  1O98 A;  1H74 A;  3FSX A;  1OPI A;  1J27 A;  4UY8 5;  2ROP A;  7FDR A;  1RHK B;  1RT7 B;  3I9V 9;  3PHT A;  1S59 A;  5G0R A;  4F3O A;  1WF0 A;  3D1Q A;  3W2V B;  2ALZ A;  1VLY A;  3M6V A;  2YNH B;  1XN9 A;  3NKR A;  3PRV A;  3N9U C;  3IWX A;  3CTR A;  3O2I A;  3KUG A;  2YKA A;  3D5M A;  1D9A A;  3KKF A;  5HO4 A;  1HHQ A;  5KFI A;  4OZ1 A;  3TX8 A;  4QWA A;  4I6Y A;  4CYR A;  2AYG A;  3MM9 B;  2Y8Y A;  2QEX S;  4CO3 A;  1I94 J;  2EFG A;  4WWS A;  2RHQ B;  1R89 A;  1OS5 A;  2A10 A;  1S76 D;  4HLB A;  1G6B A;  3W9H A;  2R8G A;  2VPW B;  3ILO A;  1P9Q C;  5A8R B;  1H2T Z;  3MMA A;  2MZQ A;  2UXD F;  1CLF A;  5KFL A;  2MTL A;  1DJ0 A;  4AXI A;  3Q2S C;  1SPB P;  2CQI A;  2GAG C;  1E6Y B;  3OBI A;  4RLE A;  3W7B A;  3KLG A;  5HLF B;  3CUL A;  3CNQ P;  4BS2 A;  4NLU A;  4FF3 A;  2KXH A;  2Z57 B;  3DMJ A;  3U02 A;  3PIO Q;  1U8S A;  1Q82 T;  1NDL A;  3OFG A;  1HI0 P;  1BY9 A;  1KSP A;  5D0G A;  3KK2 A;  3J81 j;  2LU1 A;  5LXR A;  1Y3J A;  1M90 T;  4DR2 F;  5F9N A;  2JHE A;  4KHP F;  3BGR A;  3OFE A;  2KT3 A;  3OPK A;  4DV5 J;  4P9S A;  4ZVG A;  5H9F J;  1TL4 A;  3M32 B;  2R7V A;  4AD6 A;  5EGE A;  2YX7 A;  3SSR A;  3OTO F;  2LQJ A;  4MKB A;  3TAM A;  2AD9 A;  2XEX A;  2D74 B;  2CVI A;  4F4W A;  2HBY B;  2ZH9 A;  2CJX B;  2VA2 A;  2MB0 B;  4MIW A;  1VQK S;  2G2Y A;  2JEI A;  1K0T A;  3MK1 A;  5I3Q A;  3U1L A;  2XHC A;  4HEA 9;  4BDP A;  3DDN A;  2VU5 A;  4F0K A;  5A8W B;  4FBU A;  1LW0 B;  2HVD A;  2JC1 A;  1UVK A;  2UV8 A;  4YUD A;  3MR5 A;  2AHO B;  2DJW A;  1OQ6 A;  3M30 B;  1F9F A;  1FRI A;  3NEK A;  1JLC A;  1ZA1 B;  1F3F A;  1TFW A;  1VQ4 S;  3UE2 A;  1C1B A;  2VPZ B;  4Z7C A;  2HQ3 A;  3I0R A;  3I0S B;  1QVG R;  2K8G A;  4P75 A;  5HRO A;  3DYA B;  4B3M J;  1NK0 A;  3HZE A;  4AQY J;  5HJY A;  5L0E A;  1U2R A;  1IKX B;  4Y65 A;  4ED5 A;  1RT3 B;  2RU9 A;  5LM7 E;  1IR1 A;  1BHN A;  2XUL A;  1M0S A;  3C14 B;  4PG5 A;  5GMD A;  2Z30 B;  4IFY A;  2OMO A;  3AFG A;  4PKD B;  4P2M A;  4R5P A;  4JV1 A;  4WFA Q;  4A8W A;  5IOL A;  4OYZ A;  4MIA A;  2OI2 A;  4ALZ A;  3V6J A;  5L0K A;  1N2L A;  3HI9 A;  4LBP A;  4HHU A;  2P8I A;  1R0B G;  1SC1 B;  2KVQ E;  5DS7 A;  5KTQ A;  4B3O A;  4J37 A;  2AJQ A;  3TO8 A;  3VQS A;  1U09 A;  2UVR A;  1WC0 A;  5SZT A;  4ECY A;  1EP4 A;  4OYA A;  4B9S A;  3JTO A;  3BJY A;  5KOW A;  5DM7 Q;  2A2C A;  2F63 A;  4I7F B;  3M8Z A;  4ED0 A;  5KFS A;  4IQX A;  2MGZ A;  3LP2 B;  4GRS A;  2UP1 A;  1S1W B;  1BXN A;  2MEW A;  3DU6 A;  4M5G A;  5LOQ A;  1PGZ A;  2AP6 A;  4BBY A;  2QV6 A;  3V5R A;  2W5X A;  1YBT A;  4OJG A;  4M5I A;  4DCO B;  1NJX A;  2KXF A;  4ICL A;  4OZ2 A;  4Y6I A;  1VQ5 S;  2H5J B;  1REV B;  4USV A;  2NPF A;  3IG1 B;  2AGO A;  3GIR A;  3QJL A;  2HBQ B;  2AF6 A;  1KQG B;  3PX4 A;  2VUG A;  3POT A;  2IFX A;  4WFY A;  4EGL A;  2YKN B;  3RAM A;  5F8M A;  1EKS A;  4DL0 C;  2C1E B;  2NYI A;  5KFQ A;  4C8N A;  2KL8 A;  3W61 A;  1X4H A;  2PN6 A;  3IN5 A;  3PW2 A;  2KFN A;  2QLF B;  4KGV B;  4WP9 A;  4B9M A;  1FFG B;  3KFW X;  3FDS A;  4KH0 B;  3MUV P;  1NJZ A;  1CC8 A;  1HBN A;  2GW8 A;  1TV6 A;  4ZP9 A;  1MU2 A;  2G1H A;  2XGQ A;  1S4F A;  3UD4 P;  5AE3 A;  2EWH A;  1DY3 A;  1XQI A;  3NS5 A;  1JJ4 A;  4A48 A;  4DMZ A;  4QU7 A;  2W2P P;  3J81 U;  5LL6 d;  5KG6 A;  1GTH A;  1SI9 A;  4I6W A;  2N3L A;  1OMS A;  2HQD A;  4J9Q A;  4XAK A;  3Q83 A;  1RHJ B;  2ZHO A;  3VV2 B;  4UT4 A;  3MOZ A;  3IGZ B;  1NUE A;  2OLW A;  2GGP B;  4ZCI A;  1RP5 A;  2KO1 A;  2AJ2 A;  1TUV A;  1NPK A;  1VS3 A;  4FXV A;  4EBC A;  2VG6 A;  2EW9 A;  1LWF A;  4USI A;  4Q43 A;  2G4B A;  2ZZT A;  3UVJ A;  1GMV A;  3DHX A;  4OZN A;  5ETS A;  1IBK J;  4P2S A;  1RT4 A;  1TKT A;  1C4A A;  1PC4 A;  1OY8 A;  1Q1K A;  2QGF B;  2U1A A;  3A8K A;  1CJV A;  4NA1 A;  4E2F B;  5KFF A;  1WWH A;  2FZG B;  3EUN A;  4DR5 F;  4U8V A;  3CME S;  1VOM A;  2V4J B;  3JYT B;  3N01 A;  3V4I A;  4B9L A;  3X1L B;  5EN1 A;  2F4F A;  5C24 B;  5ETL A;  1HPZ A;  5M2P A;  2VOO A;  2HHP A;  3KG1 A;  1RAA B;  3CJK B;  1WHX A;  3E2E A;  2MST A;  1S1V A;  2Q79 A;  3D7S B;  4BWJ A;  2LLZ A;  1ROF A;  1UWB A;  2OPP B;  3C46 A;  2XMK A;  2YPZ A;  3CJ4 A;  4C3K A;  5DG9 A;  4DL7 A;  3DLE A;  5CHC B;  3FC9 A;  4OZ0 A;  4ZCK A;  4CLP A;  1WSR A;  3DOM A;  2D41 A; 
#chains in the Genus database with same CATH homology
 5DLV A;  1ED8 A;  3MK1 A;  2W5T A;  1ELZ A;  1EW8 A;  4LR2 A;  2W8D A;  1EI6 A;  1KH7 A;  4LRF A;  2W5Q A;  1ELX A;  5K4P A;  1KHJ A;  4ZG9 A;  3B5Q A;  3UN5 A;  5LIA A;  5INH A;  1E33 P;  1ELY A;  4NWX A;  3BDH A;  3NKP A;  2G9Y A;  2IUC B;  4UPL A;  5LRM A;  3OT9 A;  5L0E A;  2D1G A;  2W5V A;  2ZKT A;  3BDG A;  5AJ9 A;  3T02 A;  3T01 A;  4CXU A;  1ALJ A;  1E1Z P;  2XRG A;  5TJ3 A;  1EJJ A;  1E3C P;  1ED9 A;  3E2D A;  5LRN A;  3A52 A;  5IJS A;  2IFY A;  2W5W A;  2GLQ A;  5L0K A;  1N2L A;  4FDI A;  1FSU A;  1KHN A;  1HQA A;  3Q3Q A;  3TWZ A;  3ED4 A;  4KM4 A;  5GOV A;  3TG0 A;  2GSN A;  3DPC A;  3WAV A;  4MY4 A;  4UPH A;  5EGH A;  3TX0 A;  3WAW A;  4UOO A;  3M8Z A;  4UOR A;  5GRR A;  4KJD A;  5LQQ A;  2W8S A;  2X98 A;  2W5X A;  4YR1 A;  2ANH A;  4LRB A;  3LXQ A;  4LR8 A;  1ANI A;  3SZY A;  3M8Y A;  1K7H A;  1Y7A A;  3NKM A;  2VQR A;  2RH6 A;  4ZG7 A;  1N2K A;  2QZU A;  3UNY A;  1HJK A;  3CMR A;  4UPK A;  4ZG6 A;  3BDF A;  4GTW A;  4KAY A;  4UPI A;  1O98 A;  4KAV A;  5DLT A;  3MK2 A;  4UOP A;  3UN3 A;  5L0B A;  3WAX A;  3IGY B;  4MHX A;  3T00 A;  2GA3 A;  4LRE A;  1AJB A;  1EQJ A;  1B8J A;  4LR9 A;  1URA A;  3NKR A;  3SZZ A;  1KHL A;  4LR7 A;  2XR9 A;  4CXK A;  4ZGA A;  4LRA A;  1EW9 A;  4QAX A;  1AJC A;  5KXA A;  4CYR A;  4TN0 A;  1Y6V A;  1ALH A;  3UN2 A;  5HRT A;  3IGZ B;  5IJQ A;  1AJA A;  2GSU A;  2W5S A;  4GTY A;  1P49 A;  1ZEF A;  1ZED A;  1O99 A;  1SHQ A;  1KHK A;  1ZEB A;  1SHN A;  2W5R A;  3NKN A;  5DLW A;  4MIV A;  3NKO A;  3WBH A;  2IUC A;  3MK0 A;  2GSO A;  1KH9 A;  4NWJ A;  4LRC A;  3IDD A;  4LQY A;  4GTZ A;  3KD8 A;  4KJG A;  1URB A;  5C66 A;  1KH5 A;  3M8W A;  4LRD A;  3NVL A;  1HDH A;  1ALI A;  3WAY A;  4GTX A;  3BDG B;  4B56 A;  1AUK A;  1EW2 A;  1ANJ A;  1ALK A;  4CYS A;  5EGE A;  3NKQ A;  1KH4 A;  4N7T A;  3UO0 A;  3M7V A;  1E2S P;  1AJD A;  3DYC A;  4CXS A;  4FDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...