3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
3WAXA 4LR8A 4KJDA 1AUKA 3B5QA 3NVLA 5LRMA 1KHKA 2GSNA 5L0KA 1P49A 3BDGA 5IJQA 3CMRA 3UNYA 3A52A 1E33P 1FSUA 2XR9A 3UN5A 3BDGB 1EW8A 4NWXA 5TJ3A 4LRCA 1URAA 4NWJA 3WAWA 3ED4A 3M8ZA 4LRDA 4TN0A 2GSUA 5IJSA 1SHNA 2GSOA 1AJDA 5L0BA 3TWZA 1AJCA 1ALKA 1O99A 3MK2A 5DLTA 1Y6VA 4FDIA 4N7TA 4QAXA 4B56A 4UOOA 2G9YA 4KM4A 3WAVA 3WBHA 4LR7A 2RH6A 4YR1A 4ZG9A 1EW2A 4CXKA 4CYSA 4LRFA 5C66A 3IGZB 2W5TA 1ELXA 2IUCB 2W8SA 5KXAA 4KJGA 4UPIA 3OT9A 2W5XA 3BDFA 5GOVA 4KAYA 3NKMA 3KD8A 1EQJA 1Y7AA 1ZEDA 4LQYA 2D1GA 1KHJA 2ANHA 3UN3A 5LQQA 3NKNA 2VQRA 3MK1A 3NKOA 5EGHA 2W5RA 3T01A 3SZZA 4MHXA 1ANJA 4ZGAA 4UORA 4ZG7A 1HJKA 3NKQA 5K4PA 3IGYB 1ANIA 3TX0A 1ELYA 5LRNA 1ALIA 4GTXA 5DLWA 1ED9A 1N2LA 1ED8A 3LXQA 2IUCA 5GRRA 4ZG6A 2GLQA 4LR2A 1URBA 3E2DA 2XRGA 1KHNA 2W5WA 1KH7A 5L0EA 1ZEFA 2IFYA 4KAVA 3DYCA 3M8YA 3UN2A 5DLVA 1EW9A 3MK0A 2GA3A 5HRTA 1O98A 4LRAA 4LREA 1ALHA 4FDJA 3BDHA 1AJBA 2W8DA 1ZEBA 1ALJA 2X98A 3M8WA 2W5QA 2W5SA 3SZYA 1E2SP 3UO0A 2QZUA 1HQAA 5EGEA 5INHA 1EJJA 1SHQA 3NKPA 3IDDA 4GTYA 3DPCA 3T00A 3T02A 1HDHA 1KHLA 2W5VA 3NKRA 4GTWA 4UPLA 1KH5A 4CXUA 3M7VA 1ELZA 4GTZA 4MY4A 4UPKA 1AJAA 4UPHA 4LR9A 4CYRA 1B8JA 3Q3QA 5AJ9A 1E1ZP 1E3CP 1K7HA 4MIVA 4LRBA 4UOPA 3WAYA 1EI6A 2ZKTA 3TG0A 4CXSA 1KH4A 5LIAA 1KH9A 1N2KA
chains in the Genus database with same CATH superfamily
3B5QA 1TR0A 1SV5B 3DI6B 3UNYA 1FE4A 5CQGA 4OIXA 3HKZD 4ED4A 2C3MA 2YNHB 3TUIC 2W2NP 5EDWA 4LSLB 2ROGA 4RNNA 5EHHA 1OIAA 1Q79A 4DCPB 1UEVA 1WEYA 2CZVC 1HMVA 2ZUAA 2DO0A 4CYSA 5KOXA 1PAUB 3BKUA 4DN0A 2BKOA 1R43A 3OTDA 2HKEA 3HHEA 2VBYA 4OX9J 4M5IA 2VQRA 5A0YB 2KXNB 4DSKA 1DQ9A 1ZOTA 4P9SA 2HQ3A 4NXMJ 1HJKA 4RNMA 1V6HA 4J9VA 2ZEJA 4RWWA 1KBRA 5AE2A 2VQFF 3K2YA 5KFOA 3EPIA 1PKUA 2FGOA 3NCPA 3A4TA 4WTOB 1WTFA 3BGFA 2QG9B 1KH5A 3CGIA 2ZDPA 3FMBA 4Q44A 3PTWA 1RUSA 4WPAA 2HNDA 1V5VA 1SKSA 3SCKE 1RT2B 3CCJS 2ASYA 2E5LJ 2W2QP 3MAHA 3G8SA 3K0JA 1OSDA 3DNCA 3D0GE 3TZWA 4DJBA 1E6YA 4ZVFA 2NUHA 4C7QA 4DPXA 2RS8A 5LMNJ 2AZ1A 3QJPA 5IQQA 2VODA 2C3YA 1N5YA 4ELUA 3V81A 2AX0A 4J9RA 2JEFA 3RTVA 2CQBA 1HWJA 1Q16B 4DUYF 1N6QA 2Z8QA 2V4JA 4GC7A 1DLOA 1TUVA 3MWBA 3TI0A 3MR6A 3L7UA 2J7WA 1XMQF 3QT7A 2FJWA 3US5A 4G1QA 3TAPA 4ZVRB 1G3OA 4LREA 3OUYA 1F5BA 2B4VA 3RRHA 3IRXB 4EK2A 3T9NA 1UWBA 1S1XA 3ZO7A 4FPIA 2H4WB 2XCPA 1KFDA 2IC3A 4LIWA 5LJ3Y 2MHEA 4P2SA 4KJIA 2CQ2A 2VDHA 2MZJA 2I6WA 5HVFA 5BR8F 4IH6A 2BANA 1LFPA 4NE9C 1IKYB 1JLEB 1YJRA 4CLKA 3R5JB 3FZ2A 3W64A 2CDRB 1IBKJ 5L1JA 2YWEA 4KR0B 1URAA 3RZAA 2QL7B 2MZQA 4R5PB 2AJFE 2LEPA 2XGPA 4CLWA 3G8QA 1NEEA 3KLEA 9ATCB 3FNNA 3ZTPA 5KFRA 3PIOQ 3C14A 4WIIA 2RHQB 1UA1A 3VAMA 2VG6B 5L38A 1S59A 5CD4H 2KFZA 1D8ZA 3BDEA 4PQUA 1DZ5A 3DLEB 4H4MB 4KJGA 1FK9B 4DX5A 1ZH5A 2W2MP 3TRGA 4CO1A 1FJGJ 1ICEB 4Y00A 3M2RA 2AQ4A 5DG8A 3NCRA 4BHQA 2RT3A 3T5HA 4LUBA 2B4UA 3H25A 2W25A 2GA3A 4XTTA 2EG2A 2EBEA 2ZOMA 2W5SA 3ENAA 1R8AA 3R2DJ 3OFEA 2LQ9A 4ZLLA 1ZPWX 1D0EA 6FDRA 2Q1LA 2D41A 4URSA 4A8XA 1N88A 2EWHA 3M05A 5FD1A 3IRWP 2HFOA 4PUOA 3UDCA 3WZ0A 4B3MF 3NKYA 3PJXA 2W2PP 4OZ1A 3IG1A 1ZAXA 4DV3F 2GQCA 1U0HB 3L9ZA 3P5TL 3D66A 1UVNA 3CCMS 2AMCB 4ZOSA 2OIHA 4F50A 2CPXA 2ZH6A 5HO4A 4FBTA 1AZSB 1RT6A 4OLOA 1X5OA 4ZG6A 2XRGA 1LWFB 1UETA 2MXYA 5KFNA 1X9MA 2HHSA 4Q5VA 2BZ2A 2QEXS 2CNLB 4I2QA 1AXQA 4BC7A 2AGPA 4OI1A 5C25A 4WU3A 4IH7A 2MZSA 5J1EA 1N36J 5BYSA 2GO9A 4OX9F 4RJVA 2AV5A 2OSQA 2HAIA 3DLGA 2R3VA 4NXMF 5F0WA 1FJ7A 1QAIA 3KWMA 5IT4A 7FD1A 3O1LA 2CYYA 4LF5J 5LXYA 1KHVA 4QU7A 2W9BB 3MAAB 1NLKL 3V6KA 2HEKA 3MHYA 3C6UA 2PE8A 2L48A 5C7PA 2VHGA 3HULA 3GLJA 3LOUA 2HBZB 1HW8A 1V3ZA 3SBMA 2EXUA 2BM0A 2XSJA 4K4TA 1U2FA 4C6AA 2DCLA 2XMVA 2E5LF 1D09B 1JLCB 2VDIA 3OVSA 1BQNA 2HFSA 2NCKL 3NMAA 4DL5A 2WHOA 2GHVC 3DHWC 2FQQB 1RTZA 2G0CA 1N5TA 5DLVA 1S4FA 4YB7A 5LMNF 4N56A 5HSPA 5FLXU 3K59A 1HI0P 1F5AA 4MK8A 2L9NA 4KHPJ 2OPQA 2LCWA 3FK4A 1U49A 3RAXA 4Y34A 1S1TA 4LR8A 2B9EA 3FBBA 3N6MA 2FHMA 1GX5A 3BGOP 1AFJA 4DPOA 4NWJA 3Q2TC 2AEMA 3THTA 2DYAA 4B9UA 4NEZA 5MLCV 2EC0A 1JXLA 2IM2A 3KHHA 3NNHA 4P75A 1R6YA 2QE5A 4ZP9A 1SVDA 2YKNB 3AQPA 3R27A 4G6VB 4NX9A 3UCUP 5AXLA 4ZKAA 1N4LA 1O8BA 2HRYA 4H4OB 5A8WB 1ITPA 1IBKF 5DQIA 4I56A 4OHYA 4NCBA 3W2WA 4NLTA 1U09A 1WSVA 1BUXA 2OELA 5I42A 1UCNA 1RCXB 4RO0A 5CCMA 4NCGA 1Y7PA 1YBUA 1EP4B 1RTHA 4RBUA 6AT1B 1Q81T 4OJHA 3GJQB 2ALYB 3CCVS 3TG0A 2FIUA 1FJGF 1UJ4A 1XEZA 2BA9A 3NY0A 3I4HX 2B9XA 3QGPA 4LF7J 3CCES 4K0KJ 4ENOA 2L3MA 3JSYA 1OJ4A 2OLWA 2CJAA 3MURP 5HJXA 2ROEA 4QYZJ 1W7WA 2C3UA 1RLCL 3BYRA 3G86A 1RGVA 4EBDA 2H4YB 1XNRJ 1HWUA 3A8JA 1DJ0A 4ZITA 2D74B 4ZMMA 4UUWA 2HZAA 5CCLA 5KG1A 2CPFA 2JSXA 2RE1A 5L0EA 2UVVA 3A8EA 2KXFA 4RW6A 3MI7X 3D1QA 4OX6A 1Z2ZA 3GFXA 1RP5A 1Y5LB 3UI3A 3G87A 1MU2B 3C3LA 4LFAJ 2BJ8A 3CW2C 3M9OB 2P9CA 3GTYX 2YWHA 3C19A 3PW0A 3HSGA 5K8PA 1GQEA 5KFYA 3BKFA 1QM9A 3HF5A 2HBRB 3DU5A 1H74A 1U6BA 1S5ZA 2IY5B 1X4FA 1WC4A 2W7OA 4K8RA 2K7JA 1S6PA 3G6ES 1LK5A 2XO7A 2MHNA 1OS5A 4DQSA 4UOOA 1HQUA 4RBVA 2W4DA 2FB0A 1N36F 2IA0A 5D0EA 2QGFB 3KLHB 2M70A 4X4QA 2L08A 4UF4A 2Z58B 4TLRA 2HGLA 1ANJA 1PC4A 1NSAA 2P8IA 4R8UA 3TX0A 4LF5F 2LXUA 2OEJA 2KM8B 3QLHA 5AXKA 2Q66A 1QTNB 4HR2A 2CKWA 3MXHP 2NXJA 3A3PB 2A2CA 1CC8A 2IDEA 2LEBA 2RDDA 3ZTQA 2RU3A 4Q8EA 4F04B 2QT7A 3MGJA 5G4DA 1TK0A 4IFVA 4HL9A 2VH7A 2NXCA 5HK4A 5C42A 4UOPA 3CDUA 3VGSA 2CQDA 3ZZOA 3G4SS 3OTOJ 5LRMA 2M3DA 5B0BA 4NL5A 2B9YA 1W2IA 1N52B 1XMBA 2DHGA 2XLKA 5HLFA 1T7PA 3MMAB 2IBOA 4XDDA 3TQEA 4J37A 1YITS 2RQCA 3GIRA 1N33J 3Q8YA 3MCMA 4ECQA 1SJRA 3TJ8A 1RISA 4HLBA 4KHPF 4PABA 1YJWS 2U1AA 1JLAB 3SZ2A 2QLBB 3OXGA 2F4FA 1HNZJ 1GXLA 4X4OA 3DC2A 3M2UA 5KT2A 2DRDA 4DR5J 4ZP6A 2VU5A 3DRRA 1TL7A 3HSJA 3CJ4A 1OQ6A 1VOMA 1IBMJ 7AT1B 2RAQA 1LXNA 3J7YU 2EVZA 4F02A 1SH0A 1FXLA 1FRKA 2CPIA 4Y2MA 5J2NB 2BJ7A 4WFAQ 3MM8B 4U67Q 1G4CA 2PGCA 4DDFA 3VAFA 2CQGA 3I0RA 3KLGB 4IG0A 4K4SA 4NRUA 1RT3A 4LQ3A 5F3TA 1QAXA 2KZZA 5IV4A 2DH8A 2WBRA 2YNIB 4DSFA 4O4GA 1K7HA 1EARA 2ZZTA 4F3QA 4JI2J 5AXMA 2E1RA 1IKXA 2OFHX 2GAHC 1M5PC 2R2SA 3OFGA 3VHQA 1RT7A 2ERRA 3VGTA 1YHQS 3P45B 5HATA 3THPA 4MK7A 2UUTA 2HWTA 4WJBA 5D0HA 1XC9A 2UXDJ 1M1KT 3QGGA 5HMZA 3B4MA 4ZS6A 4LF7F 4TY9A 4X4UA 3NBPA 4K0KF 1VBZA 2V2QA 2DNQA 2IUCA 3QNWB 1FRXA 3PYGA 2DD8S 2OUGA 1TFWA 4CH1A 2FDNA 1CJKB 1M5KC 2DHSA 4M94A 3JQJA 4OYBA 2XMKA 3PG9A 3UO0A 4CH0S 4DV4J 4USTA 4UPLA 1QAJA 2B5JB 1ZA2B 1XNRF 1EB0A 3HPOA 2FLOA 2HFZA 3VCDA 4IFYA 4Y3CA 1SXLA 4OI0A 3KLFB 3VF0B 1NSPA 5D3GB 3IA0A 4BC9A 2DXFA 3GQCA 1LWCB 2O1PA 4KGZB 2I8EA 3NGUA 2E66A 2ZNZA 1KLNA 3EDQB 4ZN1A 1C2PA 4LFAF 4F2RA 2J6TA 3CCQS 2ZHAA 4ZPAA 2B7CB 2YQ1A 1U45A 2JLFA 5C66A 2OEKA 1RKJA 4DL4A 1HNIA 3BN7A 2COLA 3UN3A 5GMKa 1NK8A 4OL8A 1R8HA 1GMUA 1B99A 2XNRA 4QYRA 2ZH2A 2HHQA 3CUNA 2R7VA 2V4QA 1SIZA 1FX2A 1IKVA 3TP2A 1YRTA 3GZ7A 4PPDA 2QZUA 3GV7B 4ILMA 3BPDA 2FPHX 2V8HA 1K1SA 1JXVA 4NI2B 2I0XA 1KC8T 2EFOA 3V6JA 4Q2MA 2IIHA 2KL8A 1AFIA 3SDEB 1KWMA 2J6UA 2Z2MA 3NAHA 2BYCA 4YB1P 1HPZA 1DTQB 5E3AA 3THVA 1JJHA 2XI3A 2IRXA 3VWSA 2MKIA 3J7YI 4K4YA 2FJBB 4PXEA 5DLFA 2OPPB 4ICLA 2QJ3A 1Q8KA 5GAHU 4WBFA 2MSTA 2ILYA 3EMTA 3LGHA 2VKRA 3FQLA 4PPZA 2IJNA 2VUGA 4DHVA 4LIRA 1SC4B 2EK6A 3BB5A 5IQ6A 3OTOF 2HNZB 4B3OA 4KIAA 1HQEA 1SUQB 3FFIB 3ADAC 5EX3A 1TL5A 2BVZA 4FYVB 1M5SA 5J2QB 1WF1A 3DOLB 3MZIA 2CNKB 1V9OA 4Y6IA 2H1YA 2KXHA 4C8LA 1NBEB 5D78A 5DRKA 3WC2A 1YK9A 4CI0B 1N33F 5CAAA 2DR9A 4ANDA 3W60A 3M8WA 5C5JA 1WACA 3OW2R 2O67A 4NLGA 1PJ7A 1JJCB 1TV6A 2WVFA 2CPHA 5J2MA 1FJCA 1HNZF 3H2VE 4USWA 4RZRA 4DR5F 3CEDA 3PYEA 2ZC3A 1X4HA 5F0UA 2IAJB 5K9FA 1IBMF 4QWEA 3ED4A 4ED1A 5DG7A 4YB5A 4B02A 2DIUA 4QBUA 5AE3A 1VQYA 5IZHA 4DV5J 2HSEB 1JIHA 3KJNB 1WWHA 5L9XA 3LP2B 4ED6A 4MIWA 1VQ9S 3GIIA 3FVYA 5DETA 1FNMA 4LVNP 1X4DA 1F5CA 5KFKA 1Z4UA 2FLNA 2PA3A 4ZVTB 2H9ZA 4JI2F 4KYZA 1RB0A 3BZQA 1BQMB 1NZ8A 2DR5A 3EYZA 3M6UA 3L95X 2LYVA 3BSCA 3MAQA 4UOCA 4ATNA 1N0UA 2ZBQA 1RKIA 2QYCA 2KHDA 1IXKA 4QR0A 1Q95G 3LP0B 4MKVA 4DX8H 4EBEA 2Y1JA 2UXDF 1KKHA 2A18A 1BE4A 3MUVP 1HDHA 2RMLA 4NMXA 2VG7A 3EPGA 4C3MA 3O2IA 2GJIA 4P73A 4LR9A 3GFZA 1YRUA 5AJ9A 1URRA 1HD0A 4OHVA 2D3O1 3GFYA 1YLXA 1P49A 1S6OA 3M8SA 2Y9HA 1YG0A 3IM8A 3KUHA 4O3QA 1BWVA 3TWZA 3OTCA 4DV4F 1Q0NA 2L41A 3OJSA 2UP1A 2C22A 5KT7A 2V0NA 2D1CA 2F9DA 3QZ8A 5LOQA 3BDFA 3OVAA 2M8HA 4UQGA 1IKWA 2N4CA 2B6AA 2D3UA 3MCNA 3IBFB 3BYPA 5D4OA 1IQZA 4R0JA 4AD6A 4KO0B 1T9VA 3A8IA 3KG4A 2UVWA 2O5DA 2WBMA 3DYCA 1O51A 4F3OA 3Q86A 3MECA 1T8EA 3NS7B 4DFMA 4KPCA 2KJVA 2RKIB 3QPIA 2JH3A 3KLIB 2C2MB 2K06A 2XO6A 3DXSX 3VAJA 3HJFA 3R7BB 3BV8A 1FD2A 2PMWA 2XSFA 4E2FB 4F4YA 3ENQA 5GMEA 3MOZA 4OZ0A 1R8BA 1GNKA 4J9UE 1ZYQA 4F4XA 3GJTB 4XPEA 3FQKA 2W8KA 3IS9B 4I4BA 2KFYA 2IVMA 5FLXY 4DUZJ 1KP6A 5DDOC 1U6ZA 3P6YC 3BS9A 2GVDA 1UKUA 4LR7A 2FJDB 2KYZA 4IO9Q 2WB1D 4DWIA 3QSIA 3T9ZA 3QZ7A 2G2ZA 3Q8RB 2KG0A 2FJVA 3FSYA 4UW2A 2E5HA 1U1KA 4Y2KA 4ZPCA 4TYBA 5IC6B 1N8RT 4J9OA 1WEXA 3EGNA 1LW0A 1OSCA 2EBGA 4LBPA 5SUHA 4C8YA 3MPWA 2WTFA 3KFWX 2BDPA 3EJMA 3MEEB 2IVFB 4F67A 3HK2A 1RWPB 4D3GA 2GGPA 4Z7CA 2KO1A 1CC7A 1UJ6A 1NH7A 4XPCA 5KG6A 4C3KA 1RTIB 1X4BA 3W8PA 3WBZA 2FY8A 2RILA 2NUUG 4QPTA 3IRXA 1GH8A 3S1TA 3GMGA 2ZUGA 4BDPA 5F9LA 2DO4A 1HR0J 1VQ4S 4DV6J 3EGZA 4ILRA 1RTJB 2XWXA 5IJSA 4F4AA 3PJWA 3RYLA 4F7VA 1S9GB 1AB8A 2FY1A 2RQ4A 2V50A 4TNOA 1S4EA 4ZPTR 4RNOA 1NZAA 2XBPA 2CA9A 4OI2A 3PHEA 1HYSA 1P1TA 1QE1A 3A3OB 1ELXA 1SL1A 2GHPA 3DDKA 1KFSA 3PEJA 4CM2A 4LJMA 5J2PB 1U1LA 4ZPVR 2BACA 1I94J 4H4MA 3MTJA 1OY9A 2CPEA 2R8HA 4A47A 4DV5F 1H72C 1FK9A 2G1DA 2RQMA 3RW6A 5H9FJ 4RW9A 3O6QA 1RU2A 4KQZA 1Q7YT 1KQFB 2MQLA 1FTRA 1OMSA 1XWLA 1KTVA 3R5AA 2ZJRQ 3HVAA 5KG5A 4OZ5A 1SHNA 2YWFA 4OFZA 2LDYA 3OD2A 3T5KA 3CB4A 3MPVA 3C6TB 1SH3A 4DMZA 2EC2A 1HBNB 4ZLPA 1QY7A 3QIPB 4NXNJ 3I31A 5DGBA 3ELHA 2DH7A 1ZM2A 1U0HA 1NDCA 5LQQA 1V5IB 2V9WA 4NPOA 4F0HA 3R5DA 1WORA 5M2PA 2HAFA 3BJYA 3R1HA 3CDEA 1N2LA 3GG0A 2B51A 3PW5A 2CAJA 4U7CA 4C8NA 1VQPS 1P27B 4AL6A 4ELVA 1YJVA 4MK9A 4MTPA 2DNZA 3QJLA 3G82A 5JUMA 4EGLA 4M5GA 2XZDB 2DNKA 5D0RA 2R7OA 5B7WA 1LFWA 3HFVA 2DY9A 4F4ZA 3J80U 3PJ9A 3WHIA 4C0BA 4OYXA 3JAMU 2GSNA 3DMJB 4ES3A 2IM3A 2YKPA 2FHJA 2CQ0A 4DV2J 3HDSA 5GAEU 4P7VA 1LOUA 3FC9A 2IYGA 4YR3A 3VVUA 3FSXA 1M5HA 4HACB 2Q6BA 2ASLA 1JLGA 4DR6J 2YBVA 1ALKA 2XMJA 3KK1B 4U8VA 2UV8G 1Y6VA 1R6VA 2G0JA 5J1NA 2VJVA 3OV7A 2C2OB 5CABA 1J2VA 2FZCB 3MAAA 2RDIA 3JYTB 1UAWA 3ZZUA 2E29A 2P6SA 1HBUB 3G8TA 3M8RA 3IAS9 3RAQA 2HWHA 3DYAB 1GTHA 2WOMA 1WNEA 1NJIT 4XO0A 4PXBA 2QL5B 2UUBJ 3QWPA 5GVQA 1N5QA 4JI3J 3IBCB 4DUZF 1RI7A 5CZXA 2JX2A 2WSCC 1LKZA 3NGRA 4EO8A 2DHHA 1J27A 1HBMB 2BJ3A 3L09A 2JEIA 3C16B 2DRBA 1FERA 2CQCA 1UWAA 1H6KX 2LDIA 4AUKA 5ETPA 5ETNA 3KMSA 3MMBA 4W90B 4AL5A 3V4IA 2V9KA 1JLFB 2CPJA 2NYHA 3A13A 2B3TB 1S72S 3B78A 3DLHA 2F63A 1R8CA 4JB8B 3IR7B 3WDOA 1JXEA 2GJFA 3JSBA 3U1NA 3TVYA 1VQMS 3M1VB 1AW0A 1RHQB 2YPZA 2HIQA 1PYTA 2JEGA 3K57A 1MMNA 1S7HA 3HLUA 4XIUA 2W8SA 5KXAA 4L76A 4JI8J 1KHJA 3OR2B 2V94A 3GYGA 4JBCA 3QT8A 2PI4A 2ZWOA 2OFGX 3HHLD 1HR0F 4DV6F 4ID5B 1T94A 4NA3A 1U24A 4EYIB 2YTCA 3DLLQ 1URBA 2O3DA 2OGUA 3Q23A 1VJQA 1OY6A 1YJ7A 5A8WA 3PR4A 1BMQB 3IN5A 1PC5A 4C97A 4HYKA 2M52A 2VG5B 1VQNS 2LFVA 2GHWA 5I4MA 3OR1B 4ED3A 2GW8A 2UXCJ 3HCXA 1SKRA 3ZZPA 2MQOA 2QFIA 3KTQA 4LF1A 2K8GA 4YR2A 2DBBA 3ONQA 5HVGA 3D3CJ 1JQGA 3DRPA 3CCWA 2RF2B 3AHPA 1IBCB 3WX4A 5IXUA 4F2SA 3R7NB 1NXIA 4DS5A 1IWAA 5EN1A 2VA3A 2GNKA 4YS2A 3SQGA 3OXLA 3JSRA 1JB0C 3J7Z5 2D9PA 4PG8A 2ASDA 5KFQA 1REVB 4K59A 2ZH4A 1KLMB 1OYEA 2W9CB 3DLKB 3IO1A 3FJ2A 4JI7J 5F8HA 2Q79A 3IGNA 3EVOA 4I69A 3BGLA 1TUWA 5JXSA 5DM6Q 4USMA 2DK2A 3H2UB 4C2MA 4DFJA 1F6TA 2BEFA 5K14B 3K5OA 1B7YB 4CIOA 3PRBA 3I9ZA 2PEHA 1L3TA 3R8YA 1NNDA 3ZZZA 4NXNF 1XNQJ 4CYUB 1F1BB 2C2RA 1ELZA 4HT7A 4A48A 2VOOA 1RAEB 4C11B 1JJ4A 2Z4PA 5D4PA 4N8NA 1Y3KA 1SBRA 2LKZA 3ILIA 3HT0A 4WKRA 3M8ZA 1XQIA 3GJSB 1YWXA 2X1FA 3SSRA 1Q1KA 4QW8A 3LTOA 1U02A 4ED5A 1MROB 1UZDA 2ZM6J 1NKBA 4ZJLA 4WXWA 2XS7A 1FFGB 1FKOB 1F2GA 4KFBB 2E5JA 5HAOA 2HQDA 3D7SB 3HVTB 3UR0A 2XGQA 1UVLA 1GX6A 1N5SA 2GZOA 4W98A 4NA2A 3RBXA 2Z2LA 4DV2F 4P7TA 5DGAA 3NG8A 3D1HA 4LF8J 3VZIA 4C48A 4DR6F 3UW1A 3E8OA 2FGCA 2NSCA 3GYXB 5JJBA 1FKPA 1BXNA 1VC6A 3N6LA 2W5QA 3PFEA 4DU8A 5KFIA 3T02A 1S1VA 4ZJQA 2YKMB 2GO8A 3NEKA 2KG1A 1RTDB 1EIYB 3M2VA 5HL7Q 3DRYA 2UUBF 3A52A 4JI3F 3HP6A 5M2UA 3CULA 1OYDA 4ZCIA 2E7XA 5JVGQ 1DURA 5HJYA 5ETQA 3HSDA 3T1YJ 1O99A 1M90T 3DGVA 4TYAA 3DXBA 1SIWB 4KHMA 2EW9A 5GADU 3WAVA 3MFHA 3W5YA 2C2KB 3EVWA 5KTQA 4HDHA 1JLQB 3OXFA 4I7FB 4A46A 1J5OB 1NSQA 5L1KA 2E5IA 2YNGB 1KHNA 5KFHA 1T9WA 3W9JA 1L5UA 4WZQA 5E33A 2NLWA 4A8OA 4C0HA 4FXWA 3W7BA 4QPXA 2UUCJ 2ZVSA 3ILJA 1K1QA 3FCHA 5F8MA 3DDNA 3GPAA 4JI8F 1OO0B 1IR1A 2RSQA 4GMKA 3WAYA 3DOMB 1JLBB 3QRQA 3T19A 3WQPA 3W5ZA 1RT5B 3LWMA 2KZMA 3KLGA 3MEDA 2J9EA 3E51A 2J6SA 4JV0A 2MSSA 1SC6A 1T03A 2F8HA 5KFJA 4WE1B 1RZMA 5KT6A 6FD1A 4B56A 4C8OA 3B8HA 4ZN3A 2YWWA 1JX4A 1EJ7L 3IP0A 4ZVGA 2EG1A 1WEZA 1N56A 2UXCF 4F4WA 4KGXB 1UFWA 4JV2A 1VISA 2KN4A 1KEKA 3FCVA 2DCUB 1REGX 4CO0A 2DNGA 1NK9A 3EICA 1RWUA 2K2PA 1CJUA 4O4RA 2B7BB 4DSJA 1KONA 3A1YG 4IG3B 4K2JA 5CYJA 2G4BA 1RAOA 1HNVA 2CPYA 3RAMA 1TKXB 1X9SA 3CCTA 4KTQA 2N82B 3LPYA 1XR7A 2WSEC 4I2PA 3I0SA 2CJ9A 2C2NA 1KHLA 1IBLJ 1FXRA 1Q82T 4LF4J 3I5BA 2N4DA 3P49B 5DS7A 2I5JA 3MR3A 3KJFB 4RL1A 4CNYA 5THWA 2QYGA 3UDVA 1D8YA 2LU2A 3DCAA 2AJ2A 3BREA 4ELTA 3IMQJ 1B64A 4JI7F 1B0VA 1P6TA 1CULA 1YGYA 3PZPA 3Q22A 3CCRS 4P52A 3AH6A 5CYQA 1H2VZ 3MMCB 3M8QA 4RLEA 4JI6J 3T6JA 4PRFA 5D3GA 1XNQF 2F7VA 4I6YA 4KM4A 4L72B 1VJWA 4B9VA 1S0VA 3GR0A 2IVYA 3FEYB 4K4WA 4O3SA 1A6LA 4FNIA 1MMDA 2BE2A 5LL6d 1FX4A 1CJTA 4ZG7A 4CO2A 3GV8B 3MM5A 5AJ3J 2CPZA 3P5BP 3GU0A 2ZBRA 1RAFB 2FJXA 3IXQA 4DG1B 3V6DB 1FEEA 3IWLA 2ZM6F 2XTJP 1ZEBA 1RJJA 4QZVB 3NGSA 3UD3P 5EGEA 5AT1B 1RWVB 1R0AB 5BYQA 4ZHRA 3SQOP 2OD6A 1FDDA 3GP9A 3PV8A 3DRSA 3PXGa 3D6HB 1NU4A 4DL3A 4Y0FA 4JP8A 4LF8F 2R8IA 3UN5A 1XK8A 5DQGA 2F8MA 4UTGA 2Z0GA 1TQLA 3HHDA 2YXLA 5CD4A 1VRTA 3AXKA 4EI2A 1WOOA 1ZM9A 4EFAC 3D6TB 2KH9A 1DTQA 3MR2A 4DL7A 1T11A 1R0BG 3RBDA 3AY0A 4P10A 4OI6A 7FDRA 1JWWA 5KG7A 1NK5A 2VFTA 5DM7Q 3NWGA 3WX8A 4LBHA 3KUGA 2JRSA 2EFPA 3JTNA 3D28A 5CA5A 1NHKL 2KTQA 3D67A 2OKQA 1TL4A 3EGWB 3I87A 2HZCA 2R7SA 4ZK7M 4KAVA 3T1YF 4WK3A 2HNZA 2VA2A 4KB7A 2XMWA 3TA1A 3KHLA 1S1UB 2DNLA 1YSJA 2ZOGA 5KFMA 3ENVA 3DOLA 4I6AA 2DGUA 4GTZA 1FCAA 2PO4A 4CZCA 2VJUA 3K58A 3PACA 2LVWA 1NK0A 2V8PA 2HNDB 4PCQA 1IUJA 1AT1B 3TZZA 1Y5IB 1YIJS 3CIMA 1C4AA 1E6YB 1RHUB 4EZ6A 2G13A 5EWEA 2EKYA 2KB2A 1WF2A 2JHEA 3MFIA 4FVMA 4HVZA 3SSSA 1N5YB 1TAUA 2UUCF 3CO9A 3D9BA 4RPFA 3V81B 1KQKA 2QZ8A 3FMWA 3OBIA 2MZ1A 3Q8VA 1N6QB 2V2KA 1DRZA 4QJVA 5B0GA 1APSA 1DLOB 2QMXA 1WHXA 2CADA 4X84A 2Y1RI 4QWCA 1C1BA 4FF2A 2WZ1A 2ZBIA 3UN2A 2CJYB 2AWZA 4G1QB 1BQMA 5ETMA 2RNEA 3OUYB 3QSYB 4RNHA 1QUPA 3MR7A 1N48A 1UWBB 1OPIA 1VYAA 1S1XB 3KXDA 2VV5A 3B4DA 2IC3B 2LQ5A 4IRKA 4UT4A 1TL1A 3WAXA 1XERA 4FP9A 3EGVA 1KHKA 1KVKA 1FSUA 1S12A 3GV5B 3C46A 4WFYA 2A0FB 4OZJA 2M2BA 2DNMA 2CVEA 1UPMB 2J7UA 1RAJA 5LJ5Y 3E01A 3KLEB 3VALA 3C14B 1IBLF 4KPYA 4JOUA 5E5NA 4LF4F 5KAKA 4G65A 4PQUB 1OWXA 2DNYA 2JEJA 3W9IA 2J0WA 1ZEDA 3J80Y 2PFFB 3LH2S 1ELOA 1N32J 3BO4A 3QAEA 4OV1A 2LQ8A 3M2RB 1H38A 1MNEA 3GSIA 3D6FB 4GVBB 2WONA 2CQ1A 3KJQB 3N6NA 4U6PA 2J8AA 4JI6F 3J81U 1ALHA 4DN9A 4YDDB 3BBFA 1DQ8A 1DAXA 1IM4A 3R7SB 4CM0A 2HVEA 2JC0A 1X5PA 2NQPA 2VFSA 1QDUB 3M6WA 1GXTA 5IWAJ 1EHWA 2BRLA 3GB0A 3BPSP 4IDKA 1ZTTA 1F3VA 2J9DE 5AJ3F 2BR0A 4WFNQ 1X4GA 4PUOB 4LRCA 2GSUA 4ECSA 1OQ3A 4LVOP 2MLYA 3IG1B 4AXIA 2OPSB 2AGQA 3QBCA 3OLBA 2YH0A 4ITSA 3NP5A 3PFOA 5DZ6A 3PX0A 1ZTWA 3BM7A 1ZA1B 5KG2A 3ZNJ1 2E9RX 4CO3A 2V8DA 2R7UA 2IJFA 3BBCA 1FE0A 4EEYA 2FJAB 3MM7B 4USUA 2VICA 2HNYA 3RB4A 1KDNA 4LMZA 4YMEA 2O01C 2QFJA 4HKQA 4F26A 1ELYA 1DQAA 2KJWA 2LXIA 3N4WA 5B0EA 1QAYA 4X62J 4U7UD 5A76A 1NJWA 3EZOA 1CPZA 2M5YA 4M5DA 3CPWR 2HURA 1ALJA 2VC1A 1TVRA 1U4BA 1VR6A 3OQ2A 1Y4ZB 4I2QB 1U1QA 4J9PA 5H9EJ 2QV6A 1IM6A 5C25B 2MQPA 2AYBA 2BQRA 3BGUA 4PWDA 5J1EB 3U1LA 3ZZRA 2HWIA 1U1NA 3HI9A 2XC9A 3DLGB 4EU0A 3BF4A 3DGPA 3D1OA 3DM2A 4S0MA 1JKHA 1RTIA 4WCEQ 1HARA 2ZD1A 3L4BC 1RU1A 2WVDA 3SV4A 2DGOA 4Z2XA 3DOKA 1FFWB 3C6UB 4N7TA 2Y0SD 2P9GA 1YRXA 4ZIVA 1S9EA 2MKYA 1DFDA 3W66A 2VQEJ 1RHKB 2RJZA 3M30B 2Z56B 5L1LA 2ZOFA 2W8LA 4O3PA 2WVBA 2CZ4A 1SQFA 1SC1B 4PYAA 4M63A 2V8VA 2KU7A 1BQNB 4A8KA 4WTYA 1VQ6S 3C15A 1E6VA 4RUAA 3SFGA 2ZDOA 3A8KA 4LSNA 1S1WA 2J76E 2W8DA 2M0GB 1Q7LB 1KTQA 3AB4B 1T9TA 2XWYA 4NLSA 4A4JA 3EX7B 1L3UA 4WKYA 2QLWA 4CT9A 2WAQD 1UFLA 3CNQP 2XHCA 3X3UA 3CC7S 1EI6A 3QGHA 4DV7J 4X4VA 3NVLA 2PD1A 2OTLS 2YKAA 2NXEA 4NWXA 1FDAA 5DDPC 1HWLA 4PYDA 1Y00A 2VD3A 1VK8A 4GVLA 3RRGA 2CIMA 3FEXB 4P6QA 5DLTA 3PO5A 4WXOA 2OPRA 1GK8A 1W2BR 2ZH5A 4ZG9A 1MWYA 2XLIA 3KYLA 2DB1A 2DKOB 2Y8WA 3KD8A 1LNQA 2HHPA 3CTRA 1MN7A 2HVHA 2E9TA 2E1PA 2HHTA 3QIPA 3BH7B 3W2WB 2FC9A 3FDSA 2Y3YA 1F9EB 1U26A 4MYTA 5HBMA 4DPWA 5I42B 4O3NA 2KYXA 4AL7A 3QGIA 4A8WA 4NCGB 4ES2A 4URGA 2MQMA 1T9XA 3HD1A 5L39A 2XYHB 1RTHB 4CXUA 2KVQE 1HL6A 2B56A 4CLZA 4IH5A 3IM9A 4MIVA 2DGQA 1CLFA 5B0FA 1N32F 1CQMA 3TVZA 3U1MA 5K8NA 2EFGA 2N7CA 2KDOA 5I3UA 3D68A 4OYIA 2BUNA 1U2CA 2MKJA 3W8GA 4W4MA 1VHFA 3I56S 1NDLA 2G2YA 5IWAF 4KGMA 2E7WA 1VHIA 2XLJA 1S6QA 1Y7AA 4ECTA 1CVJA 2KVIA 2FLPA 1IR2A 5HROA 4RUHA 2FTRA 5LMUJ 4QWBA 2RRAA 4HHHA 4XK8C 2ZHBA 3AOCA 3CJ2A 2LEAA 4C9DA 2XHWA 2CJBA 2V63A 3SIPB 4DS4A 1IR0A 4RW6B 4KKOA 3DYAA 2PT0A 3TUPA 2VONA 2VB6A 5KFFA 3POTB 1C0UA 2YKOA 2IMWP 3EWGA 4OI4A 5HQMA 5G0RA 3CO0P 4NZ6A 2PA8D 1HBMA 4N5SA 4KSEB 4X62F 2WRMA 2KI2A 4A8MP 4B3TJ 4OZLA 2A6OA 3H5UA 2DH9A 1AJDA 4MT1A 2GQQA 1S6PB 5DZ7A 3AJ2A 2HHXA 4YFUA 1H2UX 3W65A 1TMJA 1HQUB 4DZ6A 3ISZA 1Q8LA 5E3QA 1EKRA 5M2RA 2HMIB 5KG3A 1HW9A 3M1VA 2PFDA 4C4WA 2R8JA 1RA7A 1PJ6A 2OAUA 3N5FA 1TL3A 4MAKA 3W5XA 3HHLB 3GCWP 1FEHA 1U48A 1C1CB 1EQMA 2POKA 1HLWA 3MK0A 1M1HA 2V2VA 3TQ1A 2O66A 3PKYA 3M9NB 1TMMA 4PWUA 4RUBA 2YWKA 4JI1J 2GA7A 3UDEA 5RUBA 3EE3A 3D4JA 2VQEF 1GMWD 3IAM9 4IFVB 2AYGA 2ZH7A 3BH6B 5T7LA 2XB2D 5C42B 3HD2A 4U8YA 4K2XA 3ZNUA 4KY3A 4J91A 4OX7A 1E33P 3K5NA 5U47A 1YBAA 3I96A 5E2QA 2FVQA 4OJ1A 3HSZA 2PEBA 2KT2A 4YR0A 3X1LB 4X2BA 3RR7A 3BEGB 2FVCA 2ZE2A 1NJYA 1UFKA 2QLJB 1A9NB 1MMLA 2DHAA 5HANA 4DCJB 2DTJA 5KFVA 1SJFA 2JJ4D 1VC0A 2RF2A 4Z7YA 4DV7F 5CXTA 4MYUA 3SFUA 3PW4A 2ASJA 1KQSR 2Q3PA 2F40A 8RUCA 4AFFA 5E3RA 2W4PA 1TL7B 4FYYB 1T3OA 2AJ4A 3NS6A 1VBKA 2XS5A 5FIIA 3ZTOA 1HBOB 2ADBA 2Q43A 2HZVA 5CHCB 4LF2A 3TUJC 3DRXA 1H7WA 3TAQA 4A8YA 4IG0B 2XYGB 3DU6A 1YI2S 4NEYA 5BXIA 4O4GB 2AD9A 3G2XA 1F2HA 5IJQA 2V34A 4Q0BB 1K0TA 1WI6A 2D3ZA 1ROFA 4V1Ak 5KT5A 3U02A 2FVPA 2Z30B 4IOBA 4ID8A 4KH0B 4TU9A 2N7YA 4DR4J 3PW7A 4WFBQ 1AYEA 1XMOJ 1N5VA 3CCLS 1U8WA 3TOQA 1P8GA 4RW8A 4EZ9A 1CS4A 3H5XA 4DPTA 3M8PB 3D0HE 3ISNC 3KHGA 1D1UA 1XBWA 1HHTP 3NBPB 1WHWA 1MWZA 5GAGU 1YJUA 3H2LA 4B3SJ 4FF1A 4DFPA 3AOAA 2YVSA 4AXJA 1SJ3P 4CH7A 1TUGB 3KK3A 4KT0C 3HKWA 5D15A 5ADZA 1YQHA 1P1LA 3M6VA 3M7VA 4ER8A 4ZPDA 3BO2A 2N3LA 3OJUA 4UZCA 4K5RA 2V5HG 4IFYB 4KH1B 2VPYB 5LMUF 5L0KA 3KK2B 2G0IA 2JVRA 3TA2A 2NXUA 2XQCA 4ZVQB 2ZH9A 3M32B 2LA6A 3GWCA 3MEGA 5HMXA 1RTDA 2AIRB 1WC5A 2CG4A 2JLGA 4CCHA 3C8YA 1ACMB 4DQQA 1NHUA 4K4UA 2MKKA 1ZM3A 3R5CA 1WI8A 2FUG9 3CJQA 4IO1A 4CLSA 1WHVA 1QUVA 3NGDA 2GFFA 2DR8A 4B3TF 3FSIA 2DJWA 2IA6A 1TKTA 3FCWA 2V2ZA 1O98A 3CDWA 2Z57B 3D54A 3T00A 5HQ8A 2XMAA 3NKRA 5HP1A 1Q78A 1BY9A 5I3QA 4J9NA 5L46A 1HNXJ 2CQIA 3MM9B 2XS2A 5T41A 2CQHA 2DY1A 4A8SA 1XN9A 4B9MA 3D3BJ 2FHKA 3TARA 1HPZB 2KM8C 3CD0A 1FKAF 1MG7A 2ZKUA 4KV8B 3MCOA 4DSEA 5EWGA 2CQPA 1Y10A 3BSOA 3DOMA 4JI1F 1C0TB 2ABYA 3H5SA 1L3KA 1ZAWA 1TFYA 3QRRA 1MN9A 3FKBA 2XNQA 2BBEA 4Q8FA 4O0NA 4K4VA 1HHQA 2W5XA 5GOVA 4RWXA 3R1LA 1NB2A 1NDPA 4UUXA 2C2DA 1K9MT 2NS1B 4DPUA 2A6MA 4DR2J 1HQEB 2RRBA 1S76D 3ET6A 4DBQA 1KRPA 2CNNB 2K1RA 4N47A 4WU2A 1ZZNA 1H98A 2RUSA 2ZH8A 4O0IA 3E2EA 2N3OA 2NZCA 5IFMA 4NLWA 4OYWA 3BGRB 4FYWB 1TV6B 3LGNA 2LU1A 4IG3A 1O5JA 4QIGA 2QSWA 3FZBA 3Q3QA 3RJMB 1QSLA 1KH4A 3JQKA 2GC8A 2D3OR 3QO9A 4L73A 8AT1B 2M88A 3HMJG 1PIEA 3T3FA 4FS1A 3K5PA 4HI1A 3J81Y 4O44A 1X9WA 2W7PA 4W92B 2IMOA 3CJRA 3SEOA 5KFXA 3VAHA 4MIAA 4CTAB 5JMNA 4ECYA 2DNPA 1GAOA 4OYAA 5KFSA 1AA1B 4UQTA 4CWBA 5KFDA 2I2YA 2HK3A 2MGZA 2W01A 1VLYA 1NUEA 3NXZA 1SJ4P 3CIZA 1RDRA 1S57A 2LECA 4DR4F 2X51A 5BYRA 2WCXA 4NLVA 2EFQA 3EXYA 2IRYA 1XMOF 3K5LA 3NMRA 2HGNA 2MY7A 1Y3JA 2ZBPA 2UUWA 2VG7B 1WJ9A 3HHKA 1VRUB 2HRTA 1SQGA 3V2UC 5C24A 4LRBA 3PO4A 3J7A1 1N2KA 4DXLA 3BR9A 4BS2A 3WC0A 2DPJA 1EETA 4C0OC 4B3SF 1RWMB 2MZRA 4LFBJ 3H5YA 4M5LA 4FKXA 2YX7A 2B4PA 4FXVA 4NWBA 1SI9A 5B08A 1RT4A 1ZBTA 1S48A 3CJTA 1VQ5S 4B08A 2QA2A 3AAWB 3MUMP 4YR1A 2VL1A 4F25A 3ILOA 3TJAA 2JNJA 2X1AA 4ECZA 4O3RA 4DV0J 4DR7J 2FVRA 2BOPA 1IKWB 1OPZA 2B6AB 3OHAA 2AU0A 1RWNB 3ZZ0A 2HHWA 1S49A 3CD5A 1U2RA 1S7IA 1GEHA 3H20A 1ZEFA 4GO7X 3MECB 3N28A 1KS2A 2JWNA 3SZYA 1VK3A 1MSWD 1SHQA 1QSYA 4TY8A 3TAMB 2I38A 1NPPA 2F9JA 2E1CA 4KC5A 3ITHA 3HZGA 2H51B 5FJ4A 5ITHA 3CMRA 1S1UA 5A8KB 5DO2A 2C2EA 3A3NB 2DGWA 4RU9A 3WAWA 1EX8A 4TXSA 3CMAS 1TELA 4ZPWR 4NLXA 5A8RA 3QMQA 2HHUA 4ZA1A 3V4MA 1G1XA 4I6WA 1Z1ZA 1FVSA 3IC1A 3TA0A 3LALA 3ZZYA 1Q5YA 2B43A 2DNOA 1MLAA 1WELA 2GVDB 1HNXF 3LAKA 1HI8A 1LWEA 4BBYA 4LF6J 4HHUA 3BBBA 2BKNA 2RS2A 3VV2B 5IM0A 2UXBJ 1UEKA 4ZGAA 5IT9Y 3PRDA 1LW0B 3OFHA 2C2ZB 1WTBA 1KH7A 1CJVA 2G1HA 2HYIB 2XY6A 2GGPB 4C8ZA 4GKJJ 2DR7A 3F56A 1S6UA 4EWTA 4MFBA 4P71A 3OVBA 3NWRA 3UD4P 1WHYA 1WC0A 4DR2F 5F8GA 3BDGA 3KMQA 1DTTA 2DR6A 1H7XA 1RBAA 1K44A 3RUBL 3TEHB 3VVTA 1T05A 1M1GA 4NLQA 3R5GA 1Q53A 3U27A 4FYDA 4C8MA 4N41A 4HTJA 4Q45A 4O3OA 4FDIA 2MLZA 2OHDA 4YDXA 5LT5A 4NYZA 2X7IA 1HYSB 1WDTA 1QE1B 3UR3C 1X60A 2M9KA 3BN4A 3LQVA 1X31C 2BKPA 5L8RC 2XY7A 3CCSS 2ANHA 3BQ1A 2AF6A 2DISA 5D8HB 5E0OA 3RRKA 4QQBA 3JB9k 1HIYA 2AHOB 3N9UC 3CF5Q 3JS9A 1RT1B 4KAIA 1VQ7S 3VTIA 3CMES 3DKDA 3LF0A 4CLFA 3BDPA 3PX4A 4YOEA 1TKZA 2X3GA 3H42A 4WYWA 3HHNB 4RW9B 4B3RJ 2AW0A 3NGTA 1AJAA 2K3IA 1FVQA 2E9ZA 2R8KA 4GVBA 4J90A 3Q8QB 5ETOA 1BC6A 3IFEA 1WOPA 1SV5A 1UW9A 2QO3A 3DI6A 4DR3J 3I55S 3RBZA 3C2PA 4M5HA 4DPYA 4J9QA 2YNHA 4LSLA 1RWXB 1DBDA 1I51B 2LMIA 1Q4RA 3LP1B 2P5VA 4OYMA 4MIBA 2WSFC 4QAXA 3Q8UA 4K5SA 3WBHA 1SQEA 5GAHI 1M5OC 4MKAA 3N79A 4PG7A 2OPSA 5A0YA 3OFFA 3UVJB 4C98A 4MJKA 2UUAJ 1P9QC 3CSKA 1FRIA 1N0VC 1ED9A 4LFBF 1UJ5A 5KFPA 3MM7A 2PN6A 4TQSA 2IM0A 2XG8A 1TZ0A 1Q5VA 4Y65A 1NB7A 2CQ3A 4DOZA 4OYPA 2J9DA 3SV3A 4DV0F 4DR7F 3G82B 1H3DA 2E44A 3T1HJ 4IOCQ 3MEKA 4DQIA 1RT2A 1V3RA 1QJHA 1AROP 1S10A 3JTOA 3B54A 1EZZB 2HVIA 4NCAA 4NRTA 3TX8A 3H90A 3NCQA 1JLGB 1U1PA 4ES1A 3GIJA 1QVFR 2QLFB 4OJ3A 5D0GA 4I68A 2RDJA 1IQTA 2NSBA 2C3OA 4USIA 4LF9J 5L1IA 2R2RA 2WOMB 1ZAVA 4AT1B 3M30A 3FEZA 2M8DB 3EXCX 1G2EA 1QVGR 5HRTA 1AJBA 2GIRA 1JK9B 3MPDA 1R7IA 2ATCB 4ECUA 5K5MA 4HTIA 2QTWA 2F8EX 3Q8PB 3AJ1A 4F4KA 4ZLNA 2A1BA 4ZVPB 1UTAA 4ED0A 1X4CA 4LF6F 3K8VA 5F3ZA 1IKYA 3Q83A 2UXBF 1JLEA 3H40A 4KJDA 2JZ5A 2VOPA 1T9UA 3MMBB 3P96A 1FA0A 3V4IB 5B0CA 4DCOB 4R5PA 3VZHA 4PG4A 4PG6A 4TQRA 2EK1A 2XMUA 1S97A 4GKJF 2HS3A 4CLLA 4F0MA 3R5BA 3M6XA 2VG6A 2Z2ZA 2HBYB 1VBXA 4ZCLA 3DLEA 4CLTA 2IPOB 4CQ1A 5LSRA 3M9MB 1FNOA 4X4SA 4JI4J 1FWKA 2RRNA 4M8LA 3MM6B 1RXOB 1WG4A 4OZ3A 1TK8A 1DHMA 5DLWA 5GRRA 2GAGC 1YVFA 5C2GA 1WC6A 2XMMA 5KFCA 3I5CA 1F60B 1HD1A 3BO3A 3JXOA 1RAAB 1K8AT 3N0VA 1XIQA 5EWFA 3Q24A 4UPKA 1FESA 2DNNA 1U7LA 2VFVA 1B8JA 3ZXWA 4RX6A 1CG2A 4DLEA 1KH9A 4O23A 1FHTA 2YX4A 2ACYA 1RYRA 1LQ9A 3SCJE 3DRPB 2EFVA 2KT5A 2W9AA 4B3RF 3ENWA 3SQGB 3UD5A 2XY5A 2NR0A 1VQSA 5A6PA 1FXDA 1AZSA 1R0CB 4DR3F 2IDLA 4G1IA 3MF5A 2Y0BB 3A12A 1LWFA 2Z2YB 5D6GA 2SXLA 2IFYA 3CJ8A 4IOAQ 4PZVA 3LPEA 5K8MA 2GV1A 1UW4A 3JSMB 1YJ9S 5F41A 4YY3J 2MZTA 4CP5A 1PYOB 4ED2A 2UUAF 1AUKA 4NLDA 3DN9A 2G2OA 2DGSA 1TTHB 3GCXP 3HT3A 2FZKB 1FDBA 2W9BA 3POTA 2RIJA 1VQ8S 4NZ0A 4P2MA 4DU7A 3GIKA 3L7OA 2PIIA 3S8SA 3AODA 1LW2B 4QIWD 2V68A 4M5MA 2JC1A 3PY8A 4RNFA 1XR5A 1WKJA 3CJSA 3JTPA 3T1HF 4UPIA 1VGYA 8ATCB 2H54B 1QLNA 4HHJA 1JLCA 1YTYA 1F3FA 1PILA 1UL3A 1G6BA 4GKKJ 4MH8A 1YX2A 4DV1J 1ALIA 4NMLA 2VPZB 1R3NA 4H54A 5ETKA 3LXQA 3S7RA 2BE9B 3M8YA 2YQ3A 2HMIA 3CE8A 3BDHA 4JUZA 2QL9B 1FKPB 2RB7A 3Q2SC 1IN0A 4IRCA 3GFHA 4GRSA 3HHLA 1S1VB 3D2WA 4JI0J 4FZVA 3IR5B 3EUNA 1C1CA 4F0KA 4LF9F 1E3CP 4CT8A 1NK4A 1SB6A 3GSDA 2MTLA 3GONA 2BE7D 1M0SA 1FDNA 3M2VB 4UY8T 2J5AA 2YX1A 3HFKA 3W62A 3F73A 2MJNA 5HMWA 3QT5A 4TKTA 4NZ7A 4F8RA 2PSZA 1T95A 3EZUA 3I9V9 2QA4G 1CQNA 4DUTA 3KDNA 2C3PA 2YKNA 4N77A 4ZVSB 1Y9OA 4BLGA 2P9EA 2BJDA 4RKUC 4H4OA 4LQYA 3AA9A 2ZC4A 5E3CA 1W26A 2W5RA 1R31A 1PCAA 4ZCMA 2OSRA 3I32A 5AXNA 1QD1A 1NAQA 4QWAA 1I94F 3R2CJ 3OL8A 1B3TA 3CJKB 1EP4A 4M5KA 1R27B 5HVHA 1HA1A 3PKMA 4MY4A 2QSFA 4JI4F 3CJ5A 4OZ2A 1E1ZP 5H9EK 3HZEA 4ECVA 1HBOA 1NH8A 4OJGA 2V8GA 2FYXA 4M1KA 2VIHA 3UNGC 4RW4B 1XTZA 4CO5A 3H7HB 3MEDB 5KFLA 2JDJA 4LRDA 5DDQC 3KG0A 2KRRA 5C2CA 1T03B 2UZAA 3GJRB 5LSOA 5GAEI 1ZZFA 4Q0BA 2EFNA 4KGVB 4QW9A 2MYFA 5FDLB 2PC6A 2DEJA 5DQHA 4OV6A 4KAYA 2GVZB 4L3KA 3OTEA 2HW3A 1CJUB 1H73A 1ED8A 1Q8IA 1URNA 1DY3A 3M8PA 2FJEB 3MMJA 4N8OA 4DL6A 3TNVA 2W7AA 4NLYA 3WIUA 1HNVB 3AQOA 3S01A 1MU2A 1ZETA 3GE9A 1HQAA 1EJJA 4I2PB 3I0SB 4RUCA 4OYZA 3KJVB 3I82A 3VR1A 2I5JB 2JFDA 3NOCA 2HHVA 4ERDA 2BJ1A 1RLDA 1KOOA 1KR4A 2J7KA 3TO8A 3AOBA 1EW8A 4FVCA 4IQMA 1HHSA 1CULB 2GQ2A 3F44A 5CYMB 1CEZA 5K20B 3RBEA 1B0PA 2CJXB 5CYQB 3KK2A 1UEUA 3M8QB 2GMHA 1TAQA 2VPXB 1RYSA 2ILZA 4LRFA 3M32A 3KLHA 2H65B 2ZFHA 2MMYA 4YY3F 4H4KA 4WYLA 2R7WA 3NKMA 3RGIA 3H4DA 1IWGA 2F3JA 3SCIE 2UU9J 3BR8A 2BE2B 3H98A 1X8DA 1CJTB 2AYEA 4DEZA 2APOA 3MM5B 4EUVA 1WC3A 4L75A 2CFXA 5LM7E 2QC3A 4U9RA 1SCJB 1PBAA 2IYIA 2DHXA 1YJNS 3OL7A 1FNXH 3W2VB 3UFCX 1A0OB 2VF3A 2XYPB 2R4FA 5E7OB 3CJ3A 3N01A 4LSZB 2OI2A 1U0SA 4D3HA 4DSIA 1VC5A 2OTJS 4ZHRB 3T5LA 3NRBA 5IOLA 1V3SA 4GKKF 3O44A 3DRSB 2ZZMA 2HVZA 4DV1F 4UZBA 2JOQA 3MUTP 4J7CA 1X7VA 3J7ZT 1FFSB 4FPRA 1JMTA 2WVEA 1Y5NB 3MMAA 1NKEA 3GYNA 4ETZA 3MM9A 4ZIWA 1K47A 2BW2A 1ZS6A 1VRTB 2JFKA 4J9KA 4I67A 4DF4A 2IJRA 4JI0F 4KV8A 1X5TA 1JLAA 3K89A 3NL0A 2W5TA 4A8FA 2H5JB 2OH2A 1C0TA 2FZGB 4ETXA 4Q2LA 1T9YA 4P2FA 4CO4A 3T01A 3NKQA 5KFTA 1F9HA 2Y1IA 2BX6A 5T14A 4ZPBA 2QLXA 2YNFB 3ETOA 3R97A 1GFWB 2Y8YA 4WIQA 2Q6CA 5J2NA 3MM8A 2G9OA 3BQ2A 2VBXA 1EAYC 4WWSA 1WG1A 1RA6A 1TU0B 4L3NA 2YNIA 3AJDA 1JNZB 2MEWA 1KN6A 3EZ5A 5B09A 2BV3A 3H4BA 4IYQA 5JVHQ 4WP3A 5HMYA 2K7KA 2R7TA 1PSDA 5KFGA 4OX8A 3BGRA 1KSPA 1C4CA 5DDRC 2BMBA 3DFEA 2KRBA 2MQQA 2OEMA 1T0TV 2KHCA 1NPKA 3CC4S 4ANCA 2P6TA 2LP4A 3DHXA 1NMEB 3I6PA 1KVJA 2C42A 1S99A 3D0IE 3IBWA 1MWQA 3NKOA 3HFZB 4CTAA 2QX0A 2KT3A 2H5IB 1YJTA 3RU0A 4PEOA 2V6AA 3UE2A 1W25A 1LEOA 1K0VA 1C1BB 3KUEA 4M95A 2IFXA 4ZDNA 1CJKA 2AJ1A 2NPFA 1RHJB 3L3CA 2MPUA 1WG5A 3PYFA 4FDJA 2HQGA 3AT1B 2GIQA 2X1GA 1E2SP 1HNWJ 4HI2A 4GTWA 2B5JA 3K5MA 2DIVA 2HVDA 4G1PA 4PWWA 2BJ9A 3FRZA 1TL1B 3K17A 4CXSA 1T02A 3KLFA 4K7QA 5LXRA 1LWCA 1I3OB 2R7QA 3VQSA 2HLUA 2MY8A 4LFCJ 1VRUA 1VFJA 2GSOA 3CD7A 4WP8A 2RQKA 2CWXA 4RW7B 3E01B 4Y2AA 3AD8C 4K4XA 2E1MC 4BWMA 4ZCKA 4QR1A 3UCGA 3V6HA 5IT0A 1I6JA 2VZ9A 2V69A 4G3IA 5GADI 1S0NA 2DRAA 3FBEA 2BRKA 4GO5X 3SMZA 3QAUA 4J5OA 1S79A 1RBOB 3DDIA 3NLCA 3E2DA 2W5WA 2HS4A 2KKHA 2RD5C 2WONB 3RB0A 1Y0HA 1J5EJ 3NKPA 3QIDA 4NI2A 4UOHA 4URQU 1FI4A 3K8WA 4ED8A 3MCSA 2HIYA 5DLGA 3SDEA 5KFWA 5IV3A 5DJBA 4CYRA 2FLLA 2UU9F 2CZ9A 2YQ0A 2DITA 1GTEA 3VQTA 2QMUB 4IDKB 3V5RA 5EGYA 2AEFA 1HMVB 3R6GB 3TAMA 2HS0A 4QYZK 3G71S 3CMQA 2OPPA 4MKYA 2ZNYA 2HFVA 3UCZP 2ZITA 5KFEA 2MKHA 1H0HB 2LLZA 4OLPA 3ZTRA 5A8KA 4X66J 5MAOA 4QOTA 3S6EA 4TU8A 1NCLA 3HJVA 2QN6B 3ICLA 2ADCA 2OJ3A 2DNHA 2HNYB 1SUQA 3FFIA 4PG5A 2M4MA 2F4VJ 4UORA 1QSSA 5K4PA 3F41A 1NM2A 4OZNA 5J2QA 1UVIA 1SL0A 1YZ7A 2GLQA 4F3MA 1UVJA 3NNAA 1YKWA 5DG9A 4CNZA 1U1RA 2R7XA 3SI8A 2A10A 4M5DB 4WF9Q 2X98A 3VAKA 1TVRB 2QIFA 1RAIB 1R89A 1WDDA 3T41A 1VCTA 2WVCA 4DR1J 1PG5B 5F8JA 4PWDB 3OHBA 1B4SA 1SL2A 2GIFA 1HWIA 2E1AA 5K8OA 2IAJA 2J0SD 1Q8BA 4DLGA 3DGPB 3FRYA 3DM2B 1JKHB 2HPUA 3EDRB 2ZD1B 5F9NA 1H2TZ 4NLRA 4I1TA 1FRJA 2IM1A 1X5SA 3AD9C 2V4JB 3SCLE 4KE5A 1VIOA 3DOKB 4U95A 3LP2A 1N34J 4NA1A 1RAGB 4QR2A 1S9EB 3HVWA 2HBQB 5L9NA 2D9OA 2XZTB 3LUYA 4ZVEA 1FWPA 3BKTA 1O6XA 4L74A 1UZHA 1EQ0A 3C15B 2CJQA 1ZPVA 1S77D 2BW7A 1E6VB 1WUUA 2J8SA 3MOJB 3U7JA 4LSNB 3LP0A 1S1WB 2BANB 5ETSA 3K7RA 1B7FA 2YH1A 1NKCA 3MR5A 4FS2A 2WB4A 4JI5J 1WOSA 1NK7A 3TZYA 1FO1A 1ZM4A 4TLQA 1EKSA 1RT1A 3D5MA 4V19X 4ANEA 2HQIA 1VQOS 4FN5A 3HX9A 4CLPA 4ZJOA 4LQ9A 4DI6A 2DXEA 3CD6S 4ZVHA 1OY8A 2YY3A 3MDFA 2W4CA 3FGVA 2KFNA 5A2QU 3CCUS 2XZWA 1HNWF 4FKYA 2YWGA 4X64J 2OPRB 4DL0C 3NNCA 1SC3B 3P4UB 5SZTA 5J1PA 3LP1A 2YKQA 3DLBA 4IRDA 1X0FA 4X4RA 4WK1A 3W63A 2LQJA 4Q7AA 4KO0A 5KFAA 4LFCF 3T5JA 2HG4A 4UY85 3EM1A 1GXUA 1B70B 3HVRA 3GILA 3QFHA 5HBMB 1NJXA 3UVJA 1KNZA 2RKIA 3LAMA 3FUYA 4AYBD 1NHVA 3KLIA 3IDDA 1NO8A 2ACMA 2MJUA 3MTKA 5ETTA 1SJ1A 4YP3A 3OL6A 3IWXA 3I5AA 4OHWA 4F36A 3SYZA 3B6BA 1SH2A 3G9CA 4HH0A 3VGUA 2QA1A 3H0PA 1VLOA 4USVA 4NYOA 2HQFA 2BQUA 3IS9A 4FDFA 3KNAA 5KG0A 2H48B 3CVKA 4DQRA 2GX8A 5I3UB 2R7RA 1J5EF 4FF4A 4EMDA 4A8QA 1RT6B 4NOHA 1KVIA 2CVIA 3TYTA 2ZWPA 3OLAA 2NYIA 5I3PA 2MDAA 2QA4S 4USHA 3GR1A 1PAEX 1S6QB 3AFGA 5EX0A 2FHOB 2DGVA 3NOGA 1VIXA 5HROB 5LRNA 1RACB 4NASA 2C1EB 3I4PA 3MEEA 4DL2A 3N5BA 1SKWA 4IR9A 1EW9A 4X65J 2FHJD 4BWJA 2NREA 3KNGA 4KKOB 2LA4A 2BM1A 4X66F 1LWXA 3NS5A 3AB2B 2OMLA 2PI5A 1WD6A 4DFKA 1C0UB 1RHMB 2ZH1A 1PGZA 4USJC 5B0DA 4B9SA 2F4VF 2AP6A 4YEAA 4YUDA 4QIVA 1B0TA 5G0RB 2J0QD 4NYPA 3CT9A 3VAIA 2X1BA 1RTJA 4N76A 2XSJB 2HHHJ 1FRMA 3J7AN 1S9GA 2J0XA 1TP7A 3QYYA 3AXMA 1KHWA 4HEA9 1YDLA 3PYDA 1VBYA 4DR1F 1XJWB 2VFRA 1JJ2R 1TKDA 3QJJA 2GJ2A 4J9LA 4U96A 2CUYA 2I9SA 4WP9A 3MPYA 4IKAA 5J2PA 3TW0A 1NPRA 3T1AA 4KRWA 4DX7A 4CDIA 4M5JA 1TL3B 4Y2CA 4ECRA 2OD4A 3ZZTA 4TN2A 2OPQB 2B0GA 1KQGB 4X4NA 5HQLA 3MM6A 1S1TB 1HWKA 5KG4A 2XM3A 3RR8A 1N34F 1I1GA 2EPIA 4RBTA 4WFXA 3KOAA 5IT9U 4L6V3 2PMHA 2JL9A 2VBZA 2ZBCA 4I0WA 2RU9A 2AKWB 4B17A 1RADB 4FF3A 2I1RA 2ZKTA 5T7LB 2A3JA 3AD7C 2HLTA 5KT3A 4C3LA 2IBKA 1SPBP 1U6FA 2F65A 2CJKA 3CDBA 3W9HA 3ZFVA 3CJ0A 3C6TA 3MK2A 1VQLS 2ZE2B 2FD2A 4V19J 1HBNA 4AQYJ 3QATA 3BSAA 4KGKA 1UVMA 4JI5F 4P74A 2RH6A 1HI1A 1EW2A 5CH7B 2DEIA 4ILLA 1EQJA 2ALZA 4DSLA 3B82A 4PQAA 1GT8A 4IR1A 2ROPA 2W24A 1BQXA 2D69A 2LQBA 5IS2A 5HN0A 4R0EA 1PO6A 4LRAA 3ZTSA 2PMZD 4B9NA 3Q0AA 2GCFA 1RWKB 4X64F 5H1SV 1VRQC 3CC2S 4I64A 3IWNC 3DPCA 2BQ3A 2JLEA 3BSNA 3PX6A 1NJZA 4WFZA 3P3DA 3CCZA 4U7UK 3ISND 3RB3A 2AX1A 2VPWB 2VBWA 4Q43A 1IVZA 2MKCA 2OMOA 3DMJA 3R3TA 4IUFA 2XR9A 3R9LA 3JSMA 3KKFA 4HACA 1UPPA 2LXFA 4YHHJ 2EI5A 2MLXA 2CQ4A 3KLVA 3KK1A 3PR5B 2WK4A 1MW7A 5EUHA 1CSJA 2EKNA 1L3VA 4OHZA 1A7GE 3LANA 3JYTA 3OT9A 4RW8B 1HBUA 2L9DA 1CS4B 3KG1A 1LW2A 2ZH3A 2D1GA 4PXDA 1WSRA 1BGXT 4CLYA 1RHRB 4ZVOB 2M7SA 4NLUA 5F8IA 2E5GA 5KFBA 4J9MA 1Q86T 3QWUA 3SSQA 1FRLA 1JNRB 3H8YA 4MKBA 2HQCA 1SKUB 3G6XA 1DARA 3KK3B 4TVAB 2EEYA 2V67A 3C16A 2IRUA 2MQNA 4ALZA 2CXEA 2IHR1 4PKDB 2BOAA 2WW8A 3PCOB 2RH3A 2CPDA 1JLFA 2R9LA 3L7PA 4WZMA 1LK7A 1YZ6A 4QU6A 2B8QA 2XULA 1GMWA 3UWTA 4X65F 2MQ8A 2K3KA 3MEGB 2F1FA 3PVXA 1FF2A 1O0PA 1BD6A 4R8UB 4NLOA 3QLHB 3TVKA 1UVKA 4EO6A 3OR2A 5F8LA 3RB6A 4TU7A 3T6BA 1IJEB 3MK1A 1NDKA 5EGHA 1P9YA 4ID5A 1RBLA 4MHXA 3QQCD 1RCOB 2GS8A 5GMDA 2HHHF 2AEJA 4YN3B 3GG1A 1WF0A 5E41A 3WIVA 2DT9A 1TKTB 3GIMA 1CBKA 2NPIA 2UV8A 2VKZG 3OSNA 2VG5A 1D3WA 4USKA 1R8PA 4K50A 5HP1B 3OR1A 4RU2A 2VASA 1VMBA 3UQSA 4OHXA 5HLFB 2ATLA 4DX6A 3HXMA 1NRKA 3O8WA 2FVSA 3M4XA 3P8BB 4LBIA 4HT5A 3CJKA 2AZ3A 3ILLA 5ETRA 2BABA 3HHLC 1UMJA 3W1YC 1PBUA 2RVJA 3QRPA 2H5EA 5D4NA 3G96A 5E3PA 5L0BA 4JV5J 3VGVA 2QRRA 4B9TA 3BQ0A 2P2CB 3M2UB 2DGTA 2CDQA 4RW4A 2U2FA 2R42A 3C66A 1M5VC 1RSCA 3DRRB 4XAKA 4QIFA 1QTMA 1F9FA 5KOWA 1REVA 2HFNA 1KLMA 1X4EA 2W9CA 3SZZA 4BCAA 3DLKA 2ZZNA 2ZJQQ 4FXDA 2DNRA 4YQWA 3I0RB 4FBUA 1TK5A 5FDLA 2E7VA 1RT3B 3ET6B 4DZDA 3G6YA 4HH1A 3ULHA 2HRUA 1T3NA 5KT4A 3OL9A 2K1RB 4ECXA 3PEHA 2GVZA 5K14A 1S0OA 1FTCA 4AQYF 4R25A 1U1OA 1RQ0A 4CYUA 1IKXB 1RWWB 1RT7B 4C11A 2CWKA 9RUBA 1F0XA 1KOHA 2MB0B 2XMTA 2DPIA 3TANA 2RUGA 3O5TB 2AGOA 4JYAJ 3OPKA 1X4AA 3KJVA 1IJFB 2DXDA 5AE1A 3RW7A 3QO9B 4TN0A 2J9CA 4OYOA 2XCAA 4RR5A 1MROA 3TEGA 4O44B 1PJ5A 1Z2LA 5KFUA 3ZC4A 3DLJA 1FKOA 1WKLA 4KFBA 4OI3A 2V4RA 3HVTA 2AJQA 4X4TA 5BJRA 2IUCB 1HFEL 5CYMA 1VDHA 1FT8A 1VS3A 2JVOA 1K73T 2CNOB 2GMJA 2H3EB 2MGZB 3FBFA 5H9FK 2NZ4A 4YHHF 1KD1T 2B4OA 2L9WA 2F5GA 2R2TA 4EYHB 2ZHOA 2Y1LB 2DVIA 2AJ0A 2VC0A 4M5NA 1S0MA 1D9AA 2YKMA 3MD1A 4B9LA 3IR6B 2BJEA 1PYSB 3D6MB 5C24B 1WC1A 4J9SA 3W2VA 3HO1A 2XI2A 4Y2IA 5IC4B 1EETB 4OQJA 4PR6A 2GMLA 1Y11A 2VQFJ 1HNIB 4XDCA 1RT4B 2W2OP 2NXNA 4K4ZA 1FRHA 3JQMA 2G9YA 4PXCA 3F0NA 1U1MA 1BHNA 2CRLA 1UA0A 1LXJA 4E98A 1IKVB 5KFZA 1JLQA 2UVRA 4Z37A 3O3LA 4I7FA 3NKNA 1J5OA 1SJQA 2W1BA 1ANIA 2MKSA 3FBCA 3QT6A 2YNGA 4E0DA 4H4KC 3TZXA 3W61A 4OMFG 2OP5A 1XR6A 3KDOA 1RABB 4GTYA 4ECWA 3LWLA 4TY8B 2HK2A 3PHTA 5D4LA 1D9FA 3G6VA 2YNFA 4UPHA 3SXLA 3E3XA 4YB6A 2YPYA 1UP1A 1AUSL 1JLBA 4ICLB 3CDAA 4KHRA 1RT5A 5LIAA 3ITHB 1U8SA 4X4PA 4DUYJ 3NGKA 3LO3A 1N54B 4LT6A 2D7SA 2R2UA 5TJ3A 5A6WA 2OO4A 3TUZC 4IQXA 3NAIA 1X0PA 3AA8A 1XMQJ 4WE1A 1YBTA 5A8RB 3CWJA 3OSPA 1ULRA 2CG8A 2X3DA 4AE5A 4E8UA 1RWOB 2DGXA 4B3OB 2RHSB 3IGVA 5ETLA 2XEXA 3IGZB 3MPUB 4PAAA 3PDNA 2UVUA 1LWEB 3CXCR 5BR8J 2ZVIA 3PRVA 3RG6A 5IM0B 3R6LB 4FNHA 3IGYB 1D9DA 4NLPA 4QIEA 4JV5F 3LA0A 5J2MB 2C28A 2B8PA 2AT1B 3PNIA 1TKXA 3J81j 4FYXB 1CJVB 5A2QY 2A2DA 1BWEA 2BXJA 1LV5A 1L3SA 3Q89A 2HFUA 5GAGI 1U25A 5HI7A 5INHA 1VQKS 4ED7A 4DQPA 4MMOA 1G7CB 1FJEB 4KBIA 3PM9A 3TJ9A 4MFBB 1U47A 4JV1A 5F8NA 3ETMA 5ETVA 3KHRA 3TR5A 1FD8A 2HGMA 1I5OB 3HM9A 2QMWA 1WKKA 3BDGB 2R8GA 1BLUA 1DTTB 3EVMA 4ZVUB 3LW5C 4EBCA 5B0AA 4ZP7A 1T05B 1AJCA 1VI7A 3MMCA 1RE1B 2PDAA 4QWDA 1HKAA 3LGMA 1GMVA 4P2XA 4Y28C 3UDLA 3PW2A 4P72A 4CXKA 2VFUA 4RW7A 1FWLA 4GC6A 4JYAF 2ZJPQ 3MD3A 1NK6A 4QCLA 2B9WA 1S9FA 2FC8A 4CLUA 4HDGA 3UPFA 4GTXA 5D77A 3OTBA 4ZP8A 3QFWA 5LSLA 1RK8A 4DG1A 4LR2A 4B3MJ 3Q8SB 4DF8A 3V6DA 3VAGA 3W3SA 4ZLJA 3PIPQ 4DV3J 3JAMY 1RAHB 2WW4A 3H59A 1R0AA 2W5VA 1AUDA 1TKZB 5CZVA 4C8KA 2AYMA 4UOGA 1NSKL 1HQ2A 4CRJA 4UOFA
chains in the Genus database with same CATH topology
3WAXA 4LR8A 4KJDA 1AUKA 3B5QA 3NVLA 5LRMA 1KHKA 2GSNA 5L0KA 1P49A 3BDGA 5IJQA 3CMRA 3UNYA 3A52A 1E33P 1FSUA 2XR9A 3UN5A 3BDGB 1EW8A 4NWXA 5TJ3A 4LRCA 1URAA 4NWJA 3WAWA 3ED4A 3M8ZA 4LRDA 4TN0A 2GSUA 5IJSA 1SHNA 2GSOA 1AJDA 5L0BA 3TWZA 1AJCA 1ALKA 1O99A 3MK2A 5DLTA 1Y6VA 4FDIA 4N7TA 4QAXA 4B56A 4UOOA 2G9YA 4KM4A 3WAVA 3WBHA 4LR7A 2RH6A 4YR1A 4ZG9A 1EW2A 4CXKA 4CYSA 4LRFA 5C66A 3IGZB 2W5TA 1ELXA 2IUCB 2W8SA 5KXAA 4KJGA 4UPIA 3OT9A 2W5XA 3BDFA 5GOVA 4KAYA 3NKMA 3KD8A 1EQJA 1Y7AA 1ZEDA 4LQYA 2D1GA 1KHJA 2ANHA 3UN3A 5LQQA 3NKNA 2VQRA 3MK1A 3NKOA 5EGHA 2W5RA 3T01A 3SZZA 4MHXA 1ANJA 4ZGAA 4UORA 4ZG7A 1HJKA 3NKQA 5K4PA 3IGYB 1ANIA 3TX0A 1ELYA 5LRNA 1ALIA 4GTXA 5DLWA 1ED9A 1N2LA 1ED8A 3LXQA 2IUCA 5GRRA 4ZG6A 2GLQA 4LR2A 1URBA 3E2DA 2XRGA 1KHNA 2W5WA 1KH7A 5L0EA 1ZEFA 2IFYA 4KAVA 3DYCA 3M8YA 3UN2A 5DLVA 1EW9A 3MK0A 2GA3A 5HRTA 1O98A 4LRAA 4LREA 1ALHA 4FDJA 3BDHA 1AJBA 2W8DA 1ZEBA 1ALJA 2X98A 3M8WA 2W5QA 2W5SA 3SZYA 1E2SP 3UO0A 2QZUA 1HQAA 5EGEA 5INHA 1EJJA 1SHQA 3NKPA 3IDDA 4GTYA 3DPCA 3T00A 3T02A 1HDHA 1KHLA 2W5VA 3NKRA 4GTWA 4UPLA 1KH5A 4CXUA 3M7VA 1ELZA 4GTZA 4MY4A 4UPKA 1AJAA 4UPHA 4LR9A 4CYRA 1B8JA 3Q3QA 5AJ9A 1E1ZP 1E3CP 1K7HA 4MIVA 4LRBA 4UOPA 3WAYA 1EI6A 2ZKTA 3TG0A 4CXSA 1KH4A 5LIAA 1KH9A 1N2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAX A;  4LR8 A;  4KJD A;  1AUK A;  3B5Q A;  3NVL A;  5LRM A;  1KHK A;  2GSN A;  5L0K A;  1P49 A;  3BDG A;  5IJQ A;  3CMR A;  3UNY A;  3A52 A;  1E33 P;  1FSU A;  2XR9 A;  3UN5 A;  3BDG B;  1EW8 A;  4NWX A;  5TJ3 A;  4LRC A;  1URA A;  4NWJ A;  3WAW A;  3ED4 A;  3M8Z A;  4LRD A;  4TN0 A;  2GSU A;  5IJS A;  1SHN A;  2GSO A;  1AJD A;  5L0B A;  3TWZ A;  1AJC A;  1ALK A;  1O99 A;  3MK2 A;  5DLT A;  1Y6V A;  4FDI A;  4N7T A;  4QAX A;  4B56 A;  4UOO A;  2G9Y A;  4KM4 A;  3WAV A;  3WBH A;  4LR7 A;  2RH6 A;  4YR1 A;  4ZG9 A;  1EW2 A;  4CXK A;  4CYS A;  4LRF A;  5C66 A;  3IGZ B;  2W5T A;  1ELX A;  2IUC B;  2W8S A;  5KXA A;  4KJG A;  4UPI A;  3OT9 A;  2W5X A;  3BDF A;  5GOV A;  4KAY A;  3NKM A;  3KD8 A;  1EQJ A;  1Y7A A;  1ZED A;  4LQY A;  2D1G A;  1KHJ A;  2ANH A;  3UN3 A;  5LQQ A;  3NKN A;  2VQR A;  3MK1 A;  3NKO A;  5EGH A;  2W5R A;  3T01 A;  3SZZ A;  4MHX A;  1ANJ A;  4ZGA A;  4UOR A;  4ZG7 A;  1HJK A;  3NKQ A;  5K4P A;  3IGY B;  1ANI A;  3TX0 A;  1ELY A;  5LRN A;  1ALI A;  4GTX A;  5DLW A;  1ED9 A;  1N2L A;  1ED8 A;  3LXQ A;  2IUC A;  5GRR A;  4ZG6 A;  2GLQ A;  4LR2 A;  1URB A;  3E2D A;  2XRG A;  1KHN A;  2W5W A;  1KH7 A;  5L0E A;  1ZEF A;  2IFY A;  4KAV A;  3DYC A;  3M8Y A;  3UN2 A;  5DLV A;  1EW9 A;  3MK0 A;  2GA3 A;  5HRT A;  1O98 A;  4LRA A;  4LRE A;  1ALH A;  4FDJ A;  3BDH A;  1AJB A;  2W8D A;  1ZEB A;  1ALJ A;  2X98 A;  3M8W A;  2W5Q A;  2W5S A;  3SZY A;  1E2S P;  3UO0 A;  2QZU A;  1HQA A;  5EGE A;  5INH A;  1EJJ A;  1SHQ A;  3NKP A;  3IDD A;  4GTY A;  3DPC A;  3T00 A;  3T02 A;  1HDH A;  1KHL A;  2W5V A;  3NKR A;  4GTW A;  4UPL A;  1KH5 A;  4CXU A;  3M7V A;  1ELZ A;  4GTZ A;  4MY4 A;  4UPK A;  1AJA A;  4UPH A;  4LR9 A;  4CYR A;  1B8J A;  3Q3Q A;  5AJ9 A;  1E1Z P;  1E3C P;  1K7H A;  4MIV A;  4LRB A;  4UOP A;  3WAY A;  1EI6 A;  2ZKT A;  3TG0 A;  4CXS A;  1KH4 A;  5LIA A;  1KH9 A;  1N2K A; 
#chains in the Genus database with same CATH topology
 3B5Q A;  1TR0 A;  1SV5 B;  3DI6 B;  3UNY A;  1FE4 A;  5CQG A;  4OIX A;  3HKZ D;  4ED4 A;  2C3M A;  2YNH B;  3TUI C;  2W2N P;  5EDW A;  4LSL B;  2ROG A;  4RNN A;  5EHH A;  1OIA A;  1Q79 A;  4DCP B;  1UEV A;  1WEY A;  2CZV C;  1HMV A;  2ZUA A;  2DO0 A;  4CYS A;  5KOX A;  1PAU B;  3BKU A;  4DN0 A;  2BKO A;  1R43 A;  3OTD A;  2HKE A;  3HHE A;  2VBY A;  4OX9 J;  4M5I A;  2VQR A;  5A0Y B;  2KXN B;  4DSK A;  1DQ9 A;  1ZOT A;  4P9S A;  2HQ3 A;  4NXM J;  1HJK A;  4RNM A;  1V6H A;  4J9V A;  2ZEJ A;  4RWW A;  1KBR A;  5AE2 A;  2VQF F;  3K2Y A;  5KFO A;  3EPI A;  1PKU A;  2FGO A;  3NCP A;  3A4T A;  4WTO B;  1WTF A;  3BGF A;  2QG9 B;  1KH5 A;  3CGI A;  2ZDP A;  3FMB A;  4Q44 A;  3PTW A;  1RUS A;  4WPA A;  2HND A;  1V5V A;  1SKS A;  3SCK E;  1RT2 B;  3CCJ S;  2ASY A;  2E5L J;  2W2Q P;  3MAH A;  3G8S A;  3K0J A;  1OSD A;  3DNC A;  3D0G E;  3TZW A;  4DJB A;  1E6Y A;  4ZVF A;  2NUH A;  4C7Q A;  4DPX A;  2RS8 A;  5LMN J;  2AZ1 A;  3QJP A;  5IQQ A;  2VOD A;  2C3Y A;  1N5Y A;  4ELU A;  3V81 A;  2AX0 A;  4J9R A;  2JEF A;  3RTV A;  2CQB A;  1HWJ A;  1Q16 B;  4DUY F;  1N6Q A;  2Z8Q A;  2V4J A;  4GC7 A;  1DLO A;  1TUV A;  3MWB A;  3TI0 A;  3MR6 A;  3L7U A;  2J7W A;  1XMQ F;  3QT7 A;  2FJW A;  3US5 A;  4G1Q A;  3TAP A;  4ZVR B;  1G3O A;  4LRE A;  3OUY A;  1F5B A;  2B4V A;  3RRH A;  3IRX B;  4EK2 A;  3T9N A;  1UWB A;  1S1X A;  3ZO7 A;  4FPI A;  2H4W B;  2XCP A;  1KFD A;  2IC3 A;  4LIW A;  5LJ3 Y;  2MHE A;  4P2S A;  4KJI A;  2CQ2 A;  2VDH A;  2MZJ A;  2I6W A;  5HVF A;  5BR8 F;  4IH6 A;  2BAN A;  1LFP A;  4NE9 C;  1IKY B;  1JLE B;  1YJR A;  4CLK A;  3R5J B;  3FZ2 A;  3W64 A;  2CDR B;  1IBK J;  5L1J A;  2YWE A;  4KR0 B;  1URA A;  3RZA A;  2QL7 B;  2MZQ A;  4R5P B;  2AJF E;  2LEP A;  2XGP A;  4CLW A;  3G8Q A;  1NEE A;  3KLE A;  9ATC B;  3FNN A;  3ZTP A;  5KFR A;  3PIO Q;  3C14 A;  4WII A;  2RHQ B;  1UA1 A;  3VAM A;  2VG6 B;  5L38 A;  1S59 A;  5CD4 H;  2KFZ A;  1D8Z A;  3BDE A;  4PQU A;  1DZ5 A;  3DLE B;  4H4M B;  4KJG A;  1FK9 B;  4DX5 A;  1ZH5 A;  2W2M P;  3TRG A;  4CO1 A;  1FJG J;  1ICE B;  4Y00 A;  3M2R A;  2AQ4 A;  5DG8 A;  3NCR A;  4BHQ A;  2RT3 A;  3T5H A;  4LUB A;  2B4U A;  3H25 A;  2W25 A;  2GA3 A;  4XTT A;  2EG2 A;  2EBE A;  2ZOM A;  2W5S A;  3ENA A;  1R8A A;  3R2D J;  3OFE A;  2LQ9 A;  4ZLL A;  1ZPW X;  1D0E A;  6FDR A;  2Q1L A;  2D41 A;  4URS A;  4A8X A;  1N88 A;  2EWH A;  3M05 A;  5FD1 A;  3IRW P;  2HFO A;  4PUO A;  3UDC A;  3WZ0 A;  4B3M F;  3NKY A;  3PJX A;  2W2P P;  4OZ1 A;  3IG1 A;  1ZAX A;  4DV3 F;  2GQC A;  1U0H B;  3L9Z A;  3P5T L;  3D66 A;  1UVN A;  3CCM S;  2AMC B;  4ZOS A;  2OIH A;  4F50 A;  2CPX A;  2ZH6 A;  5HO4 A;  4FBT A;  1AZS B;  1RT6 A;  4OLO A;  1X5O A;  4ZG6 A;  2XRG A;  1LWF B;  1UET A;  2MXY A;  5KFN A;  1X9M A;  2HHS A;  4Q5V A;  2BZ2 A;  2QEX S;  2CNL B;  4I2Q A;  1AXQ A;  4BC7 A;  2AGP A;  4OI1 A;  5C25 A;  4WU3 A;  4IH7 A;  2MZS A;  5J1E A;  1N36 J;  5BYS A;  2GO9 A;  4OX9 F;  4RJV A;  2AV5 A;  2OSQ A;  2HAI A;  3DLG A;  2R3V A;  4NXM F;  5F0W A;  1FJ7 A;  1QAI A;  3KWM A;  5IT4 A;  7FD1 A;  3O1L A;  2CYY A;  4LF5 J;  5LXY A;  1KHV A;  4QU7 A;  2W9B B;  3MAA B;  1NLK L;  3V6K A;  2HEK A;  3MHY A;  3C6U A;  2PE8 A;  2L48 A;  5C7P A;  2VHG A;  3HUL A;  3GLJ A;  3LOU A;  2HBZ B;  1HW8 A;  1V3Z A;  3SBM A;  2EXU A;  2BM0 A;  2XSJ A;  4K4T A;  1U2F A;  4C6A A;  2DCL A;  2XMV A;  2E5L F;  1D09 B;  1JLC B;  2VDI A;  3OVS A;  1BQN A;  2HFS A;  2NCK L;  3NMA A;  4DL5 A;  2WHO A;  2GHV C;  3DHW C;  2FQQ B;  1RTZ A;  2G0C A;  1N5T A;  5DLV A;  1S4F A;  4YB7 A;  5LMN F;  4N56 A;  5HSP A;  5FLX U;  3K59 A;  1HI0 P;  1F5A A;  4MK8 A;  2L9N A;  4KHP J;  2OPQ A;  2LCW A;  3FK4 A;  1U49 A;  3RAX A;  4Y34 A;  1S1T A;  4LR8 A;  2B9E A;  3FBB A;  3N6M A;  2FHM A;  1GX5 A;  3BGO P;  1AFJ A;  4DPO A;  4NWJ A;  3Q2T C;  2AEM A;  3THT A;  2DYA A;  4B9U A;  4NEZ A;  5MLC V;  2EC0 A;  1JXL A;  2IM2 A;  3KHH A;  3NNH A;  4P75 A;  1R6Y A;  2QE5 A;  4ZP9 A;  1SVD A;  2YKN B;  3AQP A;  3R27 A;  4G6V B;  4NX9 A;  3UCU P;  5AXL A;  4ZKA A;  1N4L A;  1O8B A;  2HRY A;  4H4O B;  5A8W B;  1ITP A;  1IBK F;  5DQI A;  4I56 A;  4OHY A;  4NCB A;  3W2W A;  4NLT A;  1U09 A;  1WSV A;  1BUX A;  2OEL A;  5I42 A;  1UCN A;  1RCX B;  4RO0 A;  5CCM A;  4NCG A;  1Y7P A;  1YBU A;  1EP4 B;  1RTH A;  4RBU A;  6AT1 B;  1Q81 T;  4OJH A;  3GJQ B;  2ALY B;  3CCV S;  3TG0 A;  2FIU A;  1FJG F;  1UJ4 A;  1XEZ A;  2BA9 A;  3NY0 A;  3I4H X;  2B9X A;  3QGP A;  4LF7 J;  3CCE S;  4K0K J;  4ENO A;  2L3M A;  3JSY A;  1OJ4 A;  2OLW A;  2CJA A;  3MUR P;  5HJX A;  2ROE A;  4QYZ J;  1W7W A;  2C3U A;  1RLC L;  3BYR A;  3G86 A;  1RGV A;  4EBD A;  2H4Y B;  1XNR J;  1HWU A;  3A8J A;  1DJ0 A;  4ZIT A;  2D74 B;  4ZMM A;  4UUW A;  2HZA A;  5CCL A;  5KG1 A;  2CPF A;  2JSX A;  2RE1 A;  5L0E A;  2UVV A;  3A8E A;  2KXF A;  4RW6 A;  3MI7 X;  3D1Q A;  4OX6 A;  1Z2Z A;  3GFX A;  1RP5 A;  1Y5L B;  3UI3 A;  3G87 A;  1MU2 B;  3C3L A;  4LFA J;  2BJ8 A;  3CW2 C;  3M9O B;  2P9C A;  3GTY X;  2YWH A;  3C19 A;  3PW0 A;  3HSG A;  5K8P A;  1GQE A;  5KFY A;  3BKF A;  1QM9 A;  3HF5 A;  2HBR B;  3DU5 A;  1H74 A;  1U6B A;  1S5Z A;  2IY5 B;  1X4F A;  1WC4 A;  2W7O A;  4K8R A;  2K7J A;  1S6P A;  3G6E S;  1LK5 A;  2XO7 A;  2MHN A;  1OS5 A;  4DQS A;  4UOO A;  1HQU A;  4RBV A;  2W4D A;  2FB0 A;  1N36 F;  2IA0 A;  5D0E A;  2QGF B;  3KLH B;  2M70 A;  4X4Q A;  2L08 A;  4UF4 A;  2Z58 B;  4TLR A;  2HGL A;  1ANJ A;  1PC4 A;  1NSA A;  2P8I A;  4R8U A;  3TX0 A;  4LF5 F;  2LXU A;  2OEJ A;  2KM8 B;  3QLH A;  5AXK A;  2Q66 A;  1QTN B;  4HR2 A;  2CKW A;  3MXH P;  2NXJ A;  3A3P B;  2A2C A;  1CC8 A;  2IDE A;  2LEB A;  2RDD A;  3ZTQ A;  2RU3 A;  4Q8E A;  4F04 B;  2QT7 A;  3MGJ A;  5G4D A;  1TK0 A;  4IFV A;  4HL9 A;  2VH7 A;  2NXC A;  5HK4 A;  5C42 A;  4UOP A;  3CDU A;  3VGS A;  2CQD A;  3ZZO A;  3G4S S;  3OTO J;  5LRM A;  2M3D A;  5B0B A;  4NL5 A;  2B9Y A;  1W2I A;  1N52 B;  1XMB A;  2DHG A;  2XLK A;  5HLF A;  1T7P A;  3MMA B;  2IBO A;  4XDD A;  3TQE A;  4J37 A;  1YIT S;  2RQC A;  3GIR A;  1N33 J;  3Q8Y A;  3MCM A;  4ECQ A;  1SJR A;  3TJ8 A;  1RIS A;  4HLB A;  4KHP F;  4PAB A;  1YJW S;  2U1A A;  1JLA B;  3SZ2 A;  2QLB B;  3OXG A;  2F4F A;  1HNZ J;  1GXL A;  4X4O A;  3DC2 A;  3M2U A;  5KT2 A;  2DRD A;  4DR5 J;  4ZP6 A;  2VU5 A;  3DRR A;  1TL7 A;  3HSJ A;  3CJ4 A;  1OQ6 A;  1VOM A;  1IBM J;  7AT1 B;  2RAQ A;  1LXN A;  3J7Y U;  2EVZ A;  4F02 A;  1SH0 A;  1FXL A;  1FRK A;  2CPI A;  4Y2M A;  5J2N B;  2BJ7 A;  4WFA Q;  3MM8 B;  4U67 Q;  1G4C A;  2PGC A;  4DDF A;  3VAF A;  2CQG A;  3I0R A;  3KLG B;  4IG0 A;  4K4S A;  4NRU A;  1RT3 A;  4LQ3 A;  5F3T A;  1QAX A;  2KZZ A;  5IV4 A;  2DH8 A;  2WBR A;  2YNI B;  4DSF A;  4O4G A;  1K7H A;  1EAR A;  2ZZT A;  4F3Q A;  4JI2 J;  5AXM A;  2E1R A;  1IKX A;  2OFH X;  2GAH C;  1M5P C;  2R2S A;  3OFG A;  3VHQ A;  1RT7 A;  2ERR A;  3VGT A;  1YHQ S;  3P45 B;  5HAT A;  3THP A;  4MK7 A;  2UUT A;  2HWT A;  4WJB A;  5D0H A;  1XC9 A;  2UXD J;  1M1K T;  3QGG A;  5HMZ A;  3B4M A;  4ZS6 A;  4LF7 F;  4TY9 A;  4X4U A;  3NBP A;  4K0K F;  1VBZ A;  2V2Q A;  2DNQ A;  2IUC A;  3QNW B;  1FRX A;  3PYG A;  2DD8 S;  2OUG A;  1TFW A;  4CH1 A;  2FDN A;  1CJK B;  1M5K C;  2DHS A;  4M94 A;  3JQJ A;  4OYB A;  2XMK A;  3PG9 A;  3UO0 A;  4CH0 S;  4DV4 J;  4UST A;  4UPL A;  1QAJ A;  2B5J B;  1ZA2 B;  1XNR F;  1EB0 A;  3HPO A;  2FLO A;  2HFZ A;  3VCD A;  4IFY A;  4Y3C A;  1SXL A;  4OI0 A;  3KLF B;  3VF0 B;  1NSP A;  5D3G B;  3IA0 A;  4BC9 A;  2DXF A;  3GQC A;  1LWC B;  2O1P A;  4KGZ B;  2I8E A;  3NGU A;  2E66 A;  2ZNZ A;  1KLN A;  3EDQ B;  4ZN1 A;  1C2P A;  4LFA F;  4F2R A;  2J6T A;  3CCQ S;  2ZHA A;  4ZPA A;  2B7C B;  2YQ1 A;  1U45 A;  2JLF A;  5C66 A;  2OEK A;  1RKJ A;  4DL4 A;  1HNI A;  3BN7 A;  2COL A;  3UN3 A;  5GMK a;  1NK8 A;  4OL8 A;  1R8H A;  1GMU A;  1B99 A;  2XNR A;  4QYR A;  2ZH2 A;  2HHQ A;  3CUN A;  2R7V A;  2V4Q A;  1SIZ A;  1FX2 A;  1IKV A;  3TP2 A;  1YRT A;  3GZ7 A;  4PPD A;  2QZU A;  3GV7 B;  4ILM A;  3BPD A;  2FPH X;  2V8H A;  1K1S A;  1JXV A;  4NI2 B;  2I0X A;  1KC8 T;  2EFO A;  3V6J A;  4Q2M A;  2IIH A;  2KL8 A;  1AFI A;  3SDE B;  1KWM A;  2J6U A;  2Z2M A;  3NAH A;  2BYC A;  4YB1 P;  1HPZ A;  1DTQ B;  5E3A A;  3THV A;  1JJH A;  2XI3 A;  2IRX A;  3VWS A;  2MKI A;  3J7Y I;  4K4Y A;  2FJB B;  4PXE A;  5DLF A;  2OPP B;  4ICL A;  2QJ3 A;  1Q8K A;  5GAH U;  4WBF A;  2MST A;  2ILY A;  3EMT A;  3LGH A;  2VKR A;  3FQL A;  4PPZ A;  2IJN A;  2VUG A;  4DHV A;  4LIR A;  1SC4 B;  2EK6 A;  3BB5 A;  5IQ6 A;  3OTO F;  2HNZ B;  4B3O A;  4KIA A;  1HQE A;  1SUQ B;  3FFI B;  3ADA C;  5EX3 A;  1TL5 A;  2BVZ A;  4FYV B;  1M5S A;  5J2Q B;  1WF1 A;  3DOL B;  3MZI A;  2CNK B;  1V9O A;  4Y6I A;  2H1Y A;  2KXH A;  4C8L A;  1NBE B;  5D78 A;  5DRK A;  3WC2 A;  1YK9 A;  4CI0 B;  1N33 F;  5CAA A;  2DR9 A;  4AND A;  3W60 A;  3M8W A;  5C5J A;  1WAC A;  3OW2 R;  2O67 A;  4NLG A;  1PJ7 A;  1JJC B;  1TV6 A;  2WVF A;  2CPH A;  5J2M A;  1FJC A;  1HNZ F;  3H2V E;  4USW A;  4RZR A;  4DR5 F;  3CED A;  3PYE A;  2ZC3 A;  1X4H A;  5F0U A;  2IAJ B;  5K9F A;  1IBM F;  4QWE A;  3ED4 A;  4ED1 A;  5DG7 A;  4YB5 A;  4B02 A;  2DIU A;  4QBU A;  5AE3 A;  1VQY A;  5IZH A;  4DV5 J;  2HSE B;  1JIH A;  3KJN B;  1WWH A;  5L9X A;  3LP2 B;  4ED6 A;  4MIW A;  1VQ9 S;  3GII A;  3FVY A;  5DET A;  1FNM A;  4LVN P;  1X4D A;  1F5C A;  5KFK A;  1Z4U A;  2FLN A;  2PA3 A;  4ZVT B;  2H9Z A;  4JI2 F;  4KYZ A;  1RB0 A;  3BZQ A;  1BQM B;  1NZ8 A;  2DR5 A;  3EYZ A;  3M6U A;  3L95 X;  2LYV A;  3BSC A;  3MAQ A;  4UOC A;  4ATN A;  1N0U A;  2ZBQ A;  1RKI A;  2QYC A;  2KHD A;  1IXK A;  4QR0 A;  1Q95 G;  3LP0 B;  4MKV A;  4DX8 H;  4EBE A;  2Y1J A;  2UXD F;  1KKH A;  2A18 A;  1BE4 A;  3MUV P;  1HDH A;  2RML A;  4NMX A;  2VG7 A;  3EPG A;  4C3M A;  3O2I A;  2GJI A;  4P73 A;  4LR9 A;  3GFZ A;  1YRU A;  5AJ9 A;  1URR A;  1HD0 A;  4OHV A;  2D3O 1;  3GFY A;  1YLX A;  1P49 A;  1S6O A;  3M8S A;  2Y9H A;  1YG0 A;  3IM8 A;  3KUH A;  4O3Q A;  1BWV A;  3TWZ A;  3OTC A;  4DV4 F;  1Q0N A;  2L41 A;  3OJS A;  2UP1 A;  2C22 A;  5KT7 A;  2V0N A;  2D1C A;  2F9D A;  3QZ8 A;  5LOQ A;  3BDF A;  3OVA A;  2M8H A;  4UQG A;  1IKW A;  2N4C A;  2B6A A;  2D3U A;  3MCN A;  3IBF B;  3BYP A;  5D4O A;  1IQZ A;  4R0J A;  4AD6 A;  4KO0 B;  1T9V A;  3A8I A;  3KG4 A;  2UVW A;  2O5D A;  2WBM A;  3DYC A;  1O51 A;  4F3O A;  3Q86 A;  3MEC A;  1T8E A;  3NS7 B;  4DFM A;  4KPC A;  2KJV A;  2RKI B;  3QPI A;  2JH3 A;  3KLI B;  2C2M B;  2K06 A;  2XO6 A;  3DXS X;  3VAJ A;  3HJF A;  3R7B B;  3BV8 A;  1FD2 A;  2PMW A;  2XSF A;  4E2F B;  4F4Y A;  3ENQ A;  5GME A;  3MOZ A;  4OZ0 A;  1R8B A;  1GNK A;  4J9U E;  1ZYQ A;  4F4X A;  3GJT B;  4XPE A;  3FQK A;  2W8K A;  3IS9 B;  4I4B A;  2KFY A;  2IVM A;  5FLX Y;  4DUZ J;  1KP6 A;  5DDO C;  1U6Z A;  3P6Y C;  3BS9 A;  2GVD A;  1UKU A;  4LR7 A;  2FJD B;  2KYZ A;  4IO9 Q;  2WB1 D;  4DWI A;  3QSI A;  3T9Z A;  3QZ7 A;  2G2Z A;  3Q8R B;  2KG0 A;  2FJV A;  3FSY A;  4UW2 A;  2E5H A;  1U1K A;  4Y2K A;  4ZPC A;  4TYB A;  5IC6 B;  1N8R T;  4J9O A;  1WEX A;  3EGN A;  1LW0 A;  1OSC A;  2EBG A;  4LBP A;  5SUH A;  4C8Y A;  3MPW A;  2WTF A;  3KFW X;  2BDP A;  3EJM A;  3MEE B;  2IVF B;  4F67 A;  3HK2 A;  1RWP B;  4D3G A;  2GGP A;  4Z7C A;  2KO1 A;  1CC7 A;  1UJ6 A;  1NH7 A;  4XPC A;  5KG6 A;  4C3K A;  1RTI B;  1X4B A;  3W8P A;  3WBZ A;  2FY8 A;  2RIL A;  2NUU G;  4QPT A;  3IRX A;  1GH8 A;  3S1T A;  3GMG A;  2ZUG A;  4BDP A;  5F9L A;  2DO4 A;  1HR0 J;  1VQ4 S;  4DV6 J;  3EGZ A;  4ILR A;  1RTJ B;  2XWX A;  5IJS A;  4F4A A;  3PJW A;  3RYL A;  4F7V A;  1S9G B;  1AB8 A;  2FY1 A;  2RQ4 A;  2V50 A;  4TNO A;  1S4E A;  4ZPT R;  4RNO A;  1NZA A;  2XBP A;  2CA9 A;  4OI2 A;  3PHE A;  1HYS A;  1P1T A;  1QE1 A;  3A3O B;  1ELX A;  1SL1 A;  2GHP A;  3DDK A;  1KFS A;  3PEJ A;  4CM2 A;  4LJM A;  5J2P B;  1U1L A;  4ZPV R;  2BAC A;  1I94 J;  4H4M A;  3MTJ A;  1OY9 A;  2CPE A;  2R8H A;  4A47 A;  4DV5 F;  1H72 C;  1FK9 A;  2G1D A;  2RQM A;  3RW6 A;  5H9F J;  4RW9 A;  3O6Q A;  1RU2 A;  4KQZ A;  1Q7Y T;  1KQF B;  2MQL A;  1FTR A;  1OMS A;  1XWL A;  1KTV A;  3R5A A;  2ZJR Q;  3HVA A;  5KG5 A;  4OZ5 A;  1SHN A;  2YWF A;  4OFZ A;  2LDY A;  3OD2 A;  3T5K A;  3CB4 A;  3MPV A;  3C6T B;  1SH3 A;  4DMZ A;  2EC2 A;  1HBN B;  4ZLP A;  1QY7 A;  3QIP B;  4NXN J;  3I31 A;  5DGB A;  3ELH A;  2DH7 A;  1ZM2 A;  1U0H A;  1NDC A;  5LQQ A;  1V5I B;  2V9W A;  4NPO A;  4F0H A;  3R5D A;  1WOR A;  5M2P A;  2HAF A;  3BJY A;  3R1H A;  3CDE A;  1N2L A;  3GG0 A;  2B51 A;  3PW5 A;  2CAJ A;  4U7C A;  4C8N A;  1VQP S;  1P27 B;  4AL6 A;  4ELV A;  1YJV A;  4MK9 A;  4MTP A;  2DNZ A;  3QJL A;  3G82 A;  5JUM A;  4EGL A;  4M5G A;  2XZD B;  2DNK A;  5D0R A;  2R7O A;  5B7W A;  1LFW A;  3HFV A;  2DY9 A;  4F4Z A;  3J80 U;  3PJ9 A;  3WHI A;  4C0B A;  4OYX A;  3JAM U;  2GSN A;  3DMJ B;  4ES3 A;  2IM3 A;  2YKP A;  2FHJ A;  2CQ0 A;  4DV2 J;  3HDS A;  5GAE U;  4P7V A;  1LOU A;  3FC9 A;  2IYG A;  4YR3 A;  3VVU A;  3FSX A;  1M5H A;  4HAC B;  2Q6B A;  2ASL A;  1JLG A;  4DR6 J;  2YBV A;  1ALK A;  2XMJ A;  3KK1 B;  4U8V A;  2UV8 G;  1Y6V A;  1R6V A;  2G0J A;  5J1N A;  2VJV A;  3OV7 A;  2C2O B;  5CAB A;  1J2V A;  2FZC B;  3MAA A;  2RDI A;  3JYT B;  1UAW A;  3ZZU A;  2E29 A;  2P6S A;  1HBU B;  3G8T A;  3M8R A;  3IAS 9;  3RAQ A;  2HWH A;  3DYA B;  1GTH A;  2WOM A;  1WNE A;  1NJI T;  4XO0 A;  4PXB A;  2QL5 B;  2UUB J;  3QWP A;  5GVQ A;  1N5Q A;  4JI3 J;  3IBC B;  4DUZ F;  1RI7 A;  5CZX A;  2JX2 A;  2WSC C;  1LKZ A;  3NGR A;  4EO8 A;  2DHH A;  1J27 A;  1HBM B;  2BJ3 A;  3L09 A;  2JEI A;  3C16 B;  2DRB A;  1FER A;  2CQC A;  1UWA A;  1H6K X;  2LDI A;  4AUK A;  5ETP A;  5ETN A;  3KMS A;  3MMB A;  4W90 B;  4AL5 A;  3V4I A;  2V9K A;  1JLF B;  2CPJ A;  2NYH A;  3A13 A;  2B3T B;  1S72 S;  3B78 A;  3DLH A;  2F63 A;  1R8C A;  4JB8 B;  3IR7 B;  3WDO A;  1JXE A;  2GJF A;  3JSB A;  3U1N A;  3TVY A;  1VQM S;  3M1V B;  1AW0 A;  1RHQ B;  2YPZ A;  2HIQ A;  1PYT A;  2JEG A;  3K57 A;  1MMN A;  1S7H A;  3HLU A;  4XIU A;  2W8S A;  5KXA A;  4L76 A;  4JI8 J;  1KHJ A;  3OR2 B;  2V94 A;  3GYG A;  4JBC A;  3QT8 A;  2PI4 A;  2ZWO A;  2OFG X;  3HHL D;  1HR0 F;  4DV6 F;  4ID5 B;  1T94 A;  4NA3 A;  1U24 A;  4EYI B;  2YTC A;  3DLL Q;  1URB A;  2O3D A;  2OGU A;  3Q23 A;  1VJQ A;  1OY6 A;  1YJ7 A;  5A8W A;  3PR4 A;  1BMQ B;  3IN5 A;  1PC5 A;  4C97 A;  4HYK A;  2M52 A;  2VG5 B;  1VQN S;  2LFV A;  2GHW A;  5I4M A;  3OR1 B;  4ED3 A;  2GW8 A;  2UXC J;  3HCX A;  1SKR A;  3ZZP A;  2MQO A;  2QFI A;  3KTQ A;  4LF1 A;  2K8G A;  4YR2 A;  2DBB A;  3ONQ A;  5HVG A;  3D3C J;  1JQG A;  3DRP A;  3CCW A;  2RF2 B;  3AHP A;  1IBC B;  3WX4 A;  5IXU A;  4F2S A;  3R7N B;  1NXI A;  4DS5 A;  1IWA A;  5EN1 A;  2VA3 A;  2GNK A;  4YS2 A;  3SQG A;  3OXL A;  3JSR A;  1JB0 C;  3J7Z 5;  2D9P A;  4PG8 A;  2ASD A;  5KFQ A;  1REV B;  4K59 A;  2ZH4 A;  1KLM B;  1OYE A;  2W9C B;  3DLK B;  3IO1 A;  3FJ2 A;  4JI7 J;  5F8H A;  2Q79 A;  3IGN A;  3EVO A;  4I69 A;  3BGL A;  1TUW A;  5JXS A;  5DM6 Q;  4USM A;  2DK2 A;  3H2U B;  4C2M A;  4DFJ A;  1F6T A;  2BEF A;  5K14 B;  3K5O A;  1B7Y B;  4CIO A;  3PRB A;  3I9Z A;  2PEH A;  1L3T A;  3R8Y A;  1NND A;  3ZZZ A;  4NXN F;  1XNQ J;  4CYU B;  1F1B B;  2C2R A;  1ELZ A;  4HT7 A;  4A48 A;  2VOO A;  1RAE B;  4C11 B;  1JJ4 A;  2Z4P A;  5D4P A;  4N8N A;  1Y3K A;  1SBR A;  2LKZ A;  3ILI A;  3HT0 A;  4WKR A;  3M8Z A;  1XQI A;  3GJS B;  1YWX A;  2X1F A;  3SSR A;  1Q1K A;  4QW8 A;  3LTO A;  1U02 A;  4ED5 A;  1MRO B;  1UZD A;  2ZM6 J;  1NKB A;  4ZJL A;  4WXW A;  2XS7 A;  1FFG B;  1FKO B;  1F2G A;  4KFB B;  2E5J A;  5HAO A;  2HQD A;  3D7S B;  3HVT B;  3UR0 A;  2XGQ A;  1UVL A;  1GX6 A;  1N5S A;  2GZO A;  4W98 A;  4NA2 A;  3RBX A;  2Z2L A;  4DV2 F;  4P7T A;  5DGA A;  3NG8 A;  3D1H A;  4LF8 J;  3VZI A;  4C48 A;  4DR6 F;  3UW1 A;  3E8O A;  2FGC A;  2NSC A;  3GYX B;  5JJB A;  1FKP A;  1BXN A;  1VC6 A;  3N6L A;  2W5Q A;  3PFE A;  4DU8 A;  5KFI A;  3T02 A;  1S1V A;  4ZJQ A;  2YKM B;  2GO8 A;  3NEK A;  2KG1 A;  1RTD B;  1EIY B;  3M2V A;  5HL7 Q;  3DRY A;  2UUB F;  3A52 A;  4JI3 F;  3HP6 A;  5M2U A;  3CUL A;  1OYD A;  4ZCI A;  2E7X A;  5JVG Q;  1DUR A;  5HJY A;  5ETQ A;  3HSD A;  3T1Y J;  1O99 A;  1M90 T;  3DGV A;  4TYA A;  3DXB A;  1SIW B;  4KHM A;  2EW9 A;  5GAD U;  3WAV A;  3MFH A;  3W5Y A;  2C2K B;  3EVW A;  5KTQ A;  4HDH A;  1JLQ B;  3OXF A;  4I7F B;  4A46 A;  1J5O B;  1NSQ A;  5L1K A;  2E5I A;  2YNG B;  1KHN A;  5KFH A;  1T9W A;  3W9J A;  1L5U A;  4WZQ A;  5E33 A;  2NLW A;  4A8O A;  4C0H A;  4FXW A;  3W7B A;  4QPX A;  2UUC J;  2ZVS A;  3ILJ A;  1K1Q A;  3FCH A;  5F8M A;  3DDN A;  3GPA A;  4JI8 F;  1OO0 B;  1IR1 A;  2RSQ A;  4GMK A;  3WAY A;  3DOM B;  1JLB B;  3QRQ A;  3T19 A;  3WQP A;  3W5Z A;  1RT5 B;  3LWM A;  2KZM A;  3KLG A;  3MED A;  2J9E A;  3E51 A;  2J6S A;  4JV0 A;  2MSS A;  1SC6 A;  1T03 A;  2F8H A;  5KFJ A;  4WE1 B;  1RZM A;  5KT6 A;  6FD1 A;  4B56 A;  4C8O A;  3B8H A;  4ZN3 A;  2YWW A;  1JX4 A;  1EJ7 L;  3IP0 A;  4ZVG A;  2EG1 A;  1WEZ A;  1N56 A;  2UXC F;  4F4W A;  4KGX B;  1UFW A;  4JV2 A;  1VIS A;  2KN4 A;  1KEK A;  3FCV A;  2DCU B;  1REG X;  4CO0 A;  2DNG A;  1NK9 A;  3EIC A;  1RWU A;  2K2P A;  1CJU A;  4O4R A;  2B7B B;  4DSJ A;  1KON A;  3A1Y G;  4IG3 B;  4K2J A;  5CYJ A;  2G4B A;  1RAO A;  1HNV A;  2CPY A;  3RAM A;  1TKX B;  1X9S A;  3CCT A;  4KTQ A;  2N82 B;  3LPY A;  1XR7 A;  2WSE C;  4I2P A;  3I0S A;  2CJ9 A;  2C2N A;  1KHL A;  1IBL J;  1FXR A;  1Q82 T;  4LF4 J;  3I5B A;  2N4D A;  3P49 B;  5DS7 A;  2I5J A;  3MR3 A;  3KJF B;  4RL1 A;  4CNY A;  5THW A;  2QYG A;  3UDV A;  1D8Y A;  2LU2 A;  3DCA A;  2AJ2 A;  3BRE A;  4ELT A;  3IMQ J;  1B64 A;  4JI7 F;  1B0V A;  1P6T A;  1CUL A;  1YGY A;  3PZP A;  3Q22 A;  3CCR S;  4P52 A;  3AH6 A;  5CYQ A;  1H2V Z;  3MMC B;  3M8Q A;  4RLE A;  4JI6 J;  3T6J A;  4PRF A;  5D3G A;  1XNQ F;  2F7V A;  4I6Y A;  4KM4 A;  4L72 B;  1VJW A;  4B9V A;  1S0V A;  3GR0 A;  2IVY A;  3FEY B;  4K4W A;  4O3S A;  1A6L A;  4FNI A;  1MMD A;  2BE2 A;  5LL6 d;  1FX4 A;  1CJT A;  4ZG7 A;  4CO2 A;  3GV8 B;  3MM5 A;  5AJ3 J;  2CPZ A;  3P5B P;  3GU0 A;  2ZBR A;  1RAF B;  2FJX A;  3IXQ A;  4DG1 B;  3V6D B;  1FEE A;  3IWL A;  2ZM6 F;  2XTJ P;  1ZEB A;  1RJJ A;  4QZV B;  3NGS A;  3UD3 P;  5EGE A;  5AT1 B;  1RWV B;  1R0A B;  5BYQ A;  4ZHR A;  3SQO P;  2OD6 A;  1FDD A;  3GP9 A;  3PV8 A;  3DRS A;  3PXG a;  3D6H B;  1NU4 A;  4DL3 A;  4Y0F A;  4JP8 A;  4LF8 F;  2R8I A;  3UN5 A;  1XK8 A;  5DQG A;  2F8M A;  4UTG A;  2Z0G A;  1TQL A;  3HHD A;  2YXL A;  5CD4 A;  1VRT A;  3AXK A;  4EI2 A;  1WOO A;  1ZM9 A;  4EFA C;  3D6T B;  2KH9 A;  1DTQ A;  3MR2 A;  4DL7 A;  1T11 A;  1R0B G;  3RBD A;  3AY0 A;  4P10 A;  4OI6 A;  7FDR A;  1JWW A;  5KG7 A;  1NK5 A;  2VFT A;  5DM7 Q;  3NWG A;  3WX8 A;  4LBH A;  3KUG A;  2JRS A;  2EFP A;  3JTN A;  3D28 A;  5CA5 A;  1NHK L;  2KTQ A;  3D67 A;  2OKQ A;  1TL4 A;  3EGW B;  3I87 A;  2HZC A;  2R7S A;  4ZK7 M;  4KAV A;  3T1Y F;  4WK3 A;  2HNZ A;  2VA2 A;  4KB7 A;  2XMW A;  3TA1 A;  3KHL A;  1S1U B;  2DNL A;  1YSJ A;  2ZOG A;  5KFM A;  3ENV A;  3DOL A;  4I6A A;  2DGU A;  4GTZ A;  1FCA A;  2PO4 A;  4CZC A;  2VJU A;  3K58 A;  3PAC A;  2LVW A;  1NK0 A;  2V8P A;  2HND B;  4PCQ A;  1IUJ A;  1AT1 B;  3TZZ A;  1Y5I B;  1YIJ S;  3CIM A;  1C4A A;  1E6Y B;  1RHU B;  4EZ6 A;  2G13 A;  5EWE A;  2EKY A;  2KB2 A;  1WF2 A;  2JHE A;  3MFI A;  4FVM A;  4HVZ A;  3SSS A;  1N5Y B;  1TAU A;  2UUC F;  3CO9 A;  3D9B A;  4RPF A;  3V81 B;  1KQK A;  2QZ8 A;  3FMW A;  3OBI A;  2MZ1 A;  3Q8V A;  1N6Q B;  2V2K A;  1DRZ A;  4QJV A;  5B0G A;  1APS A;  1DLO B;  2QMX A;  1WHX A;  2CAD A;  4X84 A;  2Y1R I;  4QWC A;  1C1B A;  4FF2 A;  2WZ1 A;  2ZBI A;  3UN2 A;  2CJY B;  2AWZ A;  4G1Q B;  1BQM A;  5ETM A;  2RNE A;  3OUY B;  3QSY B;  4RNH A;  1QUP A;  3MR7 A;  1N48 A;  1UWB B;  1OPI A;  1VYA A;  1S1X B;  3KXD A;  2VV5 A;  3B4D A;  2IC3 B;  2LQ5 A;  4IRK A;  4UT4 A;  1TL1 A;  3WAX A;  1XER A;  4FP9 A;  3EGV A;  1KHK A;  1KVK A;  1FSU A;  1S12 A;  3GV5 B;  3C46 A;  4WFY A;  2A0F B;  4OZJ A;  2M2B A;  2DNM A;  2CVE A;  1UPM B;  2J7U A;  1RAJ A;  5LJ5 Y;  3E01 A;  3KLE B;  3VAL A;  3C14 B;  1IBL F;  4KPY A;  4JOU A;  5E5N A;  4LF4 F;  5KAK A;  4G65 A;  4PQU B;  1OWX A;  2DNY A;  2JEJ A;  3W9I A;  2J0W A;  1ZED A;  3J80 Y;  2PFF B;  3LH2 S;  1ELO A;  1N32 J;  3BO4 A;  3QAE A;  4OV1 A;  2LQ8 A;  3M2R B;  1H38 A;  1MNE A;  3GSI A;  3D6F B;  4GVB B;  2WON A;  2CQ1 A;  3KJQ B;  3N6N A;  4U6P A;  2J8A A;  4JI6 F;  3J81 U;  1ALH A;  4DN9 A;  4YDD B;  3BBF A;  1DQ8 A;  1DAX A;  1IM4 A;  3R7S B;  4CM0 A;  2HVE A;  2JC0 A;  1X5P A;  2NQP A;  2VFS A;  1QDU B;  3M6W A;  1GXT A;  5IWA J;  1EHW A;  2BRL A;  3GB0 A;  3BPS P;  4IDK A;  1ZTT A;  1F3V A;  2J9D E;  5AJ3 F;  2BR0 A;  4WFN Q;  1X4G A;  4PUO B;  4LRC A;  2GSU A;  4ECS A;  1OQ3 A;  4LVO P;  2MLY A;  3IG1 B;  4AXI A;  2OPS B;  2AGQ A;  3QBC A;  3OLB A;  2YH0 A;  4ITS A;  3NP5 A;  3PFO A;  5DZ6 A;  3PX0 A;  1ZTW A;  3BM7 A;  1ZA1 B;  5KG2 A;  3ZNJ 1;  2E9R X;  4CO3 A;  2V8D A;  2R7U A;  2IJF A;  3BBC A;  1FE0 A;  4EEY A;  2FJA B;  3MM7 B;  4USU A;  2VIC A;  2HNY A;  3RB4 A;  1KDN A;  4LMZ A;  4YME A;  2O01 C;  2QFJ A;  4HKQ A;  4F26 A;  1ELY A;  1DQA A;  2KJW A;  2LXI A;  3N4W A;  5B0E A;  1QAY A;  4X62 J;  4U7U D;  5A76 A;  1NJW A;  3EZO A;  1CPZ A;  2M5Y A;  4M5D A;  3CPW R;  2HUR A;  1ALJ A;  2VC1 A;  1TVR A;  1U4B A;  1VR6 A;  3OQ2 A;  1Y4Z B;  4I2Q B;  1U1Q A;  4J9P A;  5H9E J;  2QV6 A;  1IM6 A;  5C25 B;  2MQP A;  2AYB A;  2BQR A;  3BGU A;  4PWD A;  5J1E B;  3U1L A;  3ZZR A;  2HWI A;  1U1N A;  3HI9 A;  2XC9 A;  3DLG B;  4EU0 A;  3BF4 A;  3DGP A;  3D1O A;  3DM2 A;  4S0M A;  1JKH A;  1RTI A;  4WCE Q;  1HAR A;  2ZD1 A;  3L4B C;  1RU1 A;  2WVD A;  3SV4 A;  2DGO A;  4Z2X A;  3DOK A;  1FFW B;  3C6U B;  4N7T A;  2Y0S D;  2P9G A;  1YRX A;  4ZIV A;  1S9E A;  2MKY A;  1DFD A;  3W66 A;  2VQE J;  1RHK B;  2RJZ A;  3M30 B;  2Z56 B;  5L1L A;  2ZOF A;  2W8L A;  4O3P A;  2WVB A;  2CZ4 A;  1SQF A;  1SC1 B;  4PYA A;  4M63 A;  2V8V A;  2KU7 A;  1BQN B;  4A8K A;  4WTY A;  1VQ6 S;  3C15 A;  1E6V A;  4RUA A;  3SFG A;  2ZDO A;  3A8K A;  4LSN A;  1S1W A;  2J76 E;  2W8D A;  2M0G B;  1Q7L B;  1KTQ A;  3AB4 B;  1T9T A;  2XWY A;  4NLS A;  4A4J A;  3EX7 B;  1L3U A;  4WKY A;  2QLW A;  4CT9 A;  2WAQ D;  1UFL A;  3CNQ P;  2XHC A;  3X3U A;  3CC7 S;  1EI6 A;  3QGH A;  4DV7 J;  4X4V A;  3NVL A;  2PD1 A;  2OTL S;  2YKA A;  2NXE A;  4NWX A;  1FDA A;  5DDP C;  1HWL A;  4PYD A;  1Y00 A;  2VD3 A;  1VK8 A;  4GVL A;  3RRG A;  2CIM A;  3FEX B;  4P6Q A;  5DLT A;  3PO5 A;  4WXO A;  2OPR A;  1GK8 A;  1W2B R;  2ZH5 A;  4ZG9 A;  1MWY A;  2XLI A;  3KYL A;  2DB1 A;  2DKO B;  2Y8W A;  3KD8 A;  1LNQ A;  2HHP A;  3CTR A;  1MN7 A;  2HVH A;  2E9T A;  2E1P A;  2HHT A;  3QIP A;  3BH7 B;  3W2W B;  2FC9 A;  3FDS A;  2Y3Y A;  1F9E B;  1U26 A;  4MYT A;  5HBM A;  4DPW A;  5I42 B;  4O3N A;  2KYX A;  4AL7 A;  3QGI A;  4A8W A;  4NCG B;  4ES2 A;  4URG A;  2MQM A;  1T9X A;  3HD1 A;  5L39 A;  2XYH B;  1RTH B;  4CXU A;  2KVQ E;  1HL6 A;  2B56 A;  4CLZ A;  4IH5 A;  3IM9 A;  4MIV A;  2DGQ A;  1CLF A;  5B0F A;  1N32 F;  1CQM A;  3TVZ A;  3U1M A;  5K8N A;  2EFG A;  2N7C A;  2KDO A;  5I3U A;  3D68 A;  4OYI A;  2BUN A;  1U2C A;  2MKJ A;  3W8G A;  4W4M A;  1VHF A;  3I56 S;  1NDL A;  2G2Y A;  5IWA F;  4KGM A;  2E7W A;  1VHI A;  2XLJ A;  1S6Q A;  1Y7A A;  4ECT A;  1CVJ A;  2KVI A;  2FLP A;  1IR2 A;  5HRO A;  4RUH A;  2FTR A;  5LMU J;  4QWB A;  2RRA A;  4HHH A;  4XK8 C;  2ZHB A;  3AOC A;  3CJ2 A;  2LEA A;  4C9D A;  2XHW A;  2CJB A;  2V63 A;  3SIP B;  4DS4 A;  1IR0 A;  4RW6 B;  4KKO A;  3DYA A;  2PT0 A;  3TUP A;  2VON A;  2VB6 A;  5KFF A;  3POT B;  1C0U A;  2YKO A;  2IMW P;  3EWG A;  4OI4 A;  5HQM A;  5G0R A;  3CO0 P;  4NZ6 A;  2PA8 D;  1HBM A;  4N5S A;  4KSE B;  4X62 F;  2WRM A;  2KI2 A;  4A8M P;  4B3T J;  4OZL A;  2A6O A;  3H5U A;  2DH9 A;  1AJD A;  4MT1 A;  2GQQ A;  1S6P B;  5DZ7 A;  3AJ2 A;  2HHX A;  4YFU A;  1H2U X;  3W65 A;  1TMJ A;  1HQU B;  4DZ6 A;  3ISZ A;  1Q8L A;  5E3Q A;  1EKR A;  5M2R A;  2HMI B;  5KG3 A;  1HW9 A;  3M1V A;  2PFD A;  4C4W A;  2R8J A;  1RA7 A;  1PJ6 A;  2OAU A;  3N5F A;  1TL3 A;  4MAK A;  3W5X A;  3HHL B;  3GCW P;  1FEH A;  1U48 A;  1C1C B;  1EQM A;  2POK A;  1HLW A;  3MK0 A;  1M1H A;  2V2V A;  3TQ1 A;  2O66 A;  3PKY A;  3M9N B;  1TMM A;  4PWU A;  4RUB A;  2YWK A;  4JI1 J;  2GA7 A;  3UDE A;  5RUB A;  3EE3 A;  3D4J A;  2VQE F;  1GMW D;  3IAM 9;  4IFV B;  2AYG A;  2ZH7 A;  3BH6 B;  5T7L A;  2XB2 D;  5C42 B;  3HD2 A;  4U8Y A;  4K2X A;  3ZNU A;  4KY3 A;  4J91 A;  4OX7 A;  1E33 P;  3K5N A;  5U47 A;  1YBA A;  3I96 A;  5E2Q A;  2FVQ A;  4OJ1 A;  3HSZ A;  2PEB A;  2KT2 A;  4YR0 A;  3X1L B;  4X2B A;  3RR7 A;  3BEG B;  2FVC A;  2ZE2 A;  1NJY A;  1UFK A;  2QLJ B;  1A9N B;  1MML A;  2DHA A;  5HAN A;  4DCJ B;  2DTJ A;  5KFV A;  1SJF A;  2JJ4 D;  1VC0 A;  2RF2 A;  4Z7Y A;  4DV7 F;  5CXT A;  4MYU A;  3SFU A;  3PW4 A;  2ASJ A;  1KQS R;  2Q3P A;  2F40 A;  8RUC A;  4AFF A;  5E3R A;  2W4P A;  1TL7 B;  4FYY B;  1T3O A;  2AJ4 A;  3NS6 A;  1VBK A;  2XS5 A;  5FII A;  3ZTO A;  1HBO B;  2ADB A;  2Q43 A;  2HZV A;  5CHC B;  4LF2 A;  3TUJ C;  3DRX A;  1H7W A;  3TAQ A;  4A8Y A;  4IG0 B;  2XYG B;  3DU6 A;  1YI2 S;  4NEY A;  5BXI A;  4O4G B;  2AD9 A;  3G2X A;  1F2H A;  5IJQ A;  2V34 A;  4Q0B B;  1K0T A;  1WI6 A;  2D3Z A;  1ROF A;  4V1A k;  5KT5 A;  3U02 A;  2FVP A;  2Z30 B;  4IOB A;  4ID8 A;  4KH0 B;  4TU9 A;  2N7Y A;  4DR4 J;  3PW7 A;  4WFB Q;  1AYE A;  1XMO J;  1N5V A;  3CCL S;  1U8W A;  3TOQ A;  1P8G A;  4RW8 A;  4EZ9 A;  1CS4 A;  3H5X A;  4DPT A;  3M8P B;  3D0H E;  3ISN C;  3KHG A;  1D1U A;  1XBW A;  1HHT P;  3NBP B;  1WHW A;  1MWZ A;  5GAG U;  1YJU A;  3H2L A;  4B3S J;  4FF1 A;  4DFP A;  3AOA A;  2YVS A;  4AXJ A;  1SJ3 P;  4CH7 A;  1TUG B;  3KK3 A;  4KT0 C;  3HKW A;  5D15 A;  5ADZ A;  1YQH A;  1P1L A;  3M6V A;  3M7V A;  4ER8 A;  4ZPD A;  3BO2 A;  2N3L A;  3OJU A;  4UZC A;  4K5R A;  2V5H G;  4IFY B;  4KH1 B;  2VPY B;  5LMU F;  5L0K A;  3KK2 B;  2G0I A;  2JVR A;  3TA2 A;  2NXU A;  2XQC A;  4ZVQ B;  2ZH9 A;  3M32 B;  2LA6 A;  3GWC A;  3MEG A;  5HMX A;  1RTD A;  2AIR B;  1WC5 A;  2CG4 A;  2JLG A;  4CCH A;  3C8Y A;  1ACM B;  4DQQ A;  1NHU A;  4K4U A;  2MKK A;  1ZM3 A;  3R5C A;  1WI8 A;  2FUG 9;  3CJQ A;  4IO1 A;  4CLS A;  1WHV A;  1QUV A;  3NGD A;  2GFF A;  2DR8 A;  4B3T F;  3FSI A;  2DJW A;  2IA6 A;  1TKT A;  3FCW A;  2V2Z A;  1O98 A;  3CDW A;  2Z57 B;  3D54 A;  3T00 A;  5HQ8 A;  2XMA A;  3NKR A;  5HP1 A;  1Q78 A;  1BY9 A;  5I3Q A;  4J9N A;  5L46 A;  1HNX J;  2CQI A;  3MM9 B;  2XS2 A;  5T41 A;  2CQH A;  2DY1 A;  4A8S A;  1XN9 A;  4B9M A;  3D3B J;  2FHK A;  3TAR A;  1HPZ B;  2KM8 C;  3CD0 A;  1FKA F;  1MG7 A;  2ZKU A;  4KV8 B;  3MCO A;  4DSE A;  5EWG A;  2CQP A;  1Y10 A;  3BSO A;  3DOM A;  4JI1 F;  1C0T B;  2ABY A;  3H5S A;  1L3K A;  1ZAW A;  1TFY A;  3QRR A;  1MN9 A;  3FKB A;  2XNQ A;  2BBE A;  4Q8F A;  4O0N A;  4K4V A;  1HHQ A;  2W5X A;  5GOV A;  4RWX A;  3R1L A;  1NB2 A;  1NDP A;  4UUX A;  2C2D A;  1K9M T;  2NS1 B;  4DPU A;  2A6M A;  4DR2 J;  1HQE B;  2RRB A;  1S76 D;  3ET6 A;  4DBQ A;  1KRP A;  2CNN B;  2K1R A;  4N47 A;  4WU2 A;  1ZZN A;  1H98 A;  2RUS A;  2ZH8 A;  4O0I A;  3E2E A;  2N3O A;  2NZC A;  5IFM A;  4NLW A;  4OYW A;  3BGR B;  4FYW B;  1TV6 B;  3LGN A;  2LU1 A;  4IG3 A;  1O5J A;  4QIG A;  2QSW A;  3FZB A;  3Q3Q A;  3RJM B;  1QSL A;  1KH4 A;  3JQK A;  2GC8 A;  2D3O R;  3QO9 A;  4L73 A;  8AT1 B;  2M88 A;  3HMJ G;  1PIE A;  3T3F A;  4FS1 A;  3K5P A;  4HI1 A;  3J81 Y;  4O44 A;  1X9W A;  2W7P A;  4W92 B;  2IMO A;  3CJR A;  3SEO A;  5KFX A;  3VAH A;  4MIA A;  4CTA B;  5JMN A;  4ECY A;  2DNP A;  1GAO A;  4OYA A;  5KFS A;  1AA1 B;  4UQT A;  4CWB A;  5KFD A;  2I2Y A;  2HK3 A;  2MGZ A;  2W01 A;  1VLY A;  1NUE A;  3NXZ A;  1SJ4 P;  3CIZ A;  1RDR A;  1S57 A;  2LEC A;  4DR4 F;  2X51 A;  5BYR A;  2WCX A;  4NLV A;  2EFQ A;  3EXY A;  2IRY A;  1XMO F;  3K5L A;  3NMR A;  2HGN A;  2MY7 A;  1Y3J A;  2ZBP A;  2UUW A;  2VG7 B;  1WJ9 A;  3HHK A;  1VRU B;  2HRT A;  1SQG A;  3V2U C;  5C24 A;  4LRB A;  3PO4 A;  3J7A 1;  1N2K A;  4DXL A;  3BR9 A;  4BS2 A;  3WC0 A;  2DPJ A;  1EET A;  4C0O C;  4B3S F;  1RWM B;  2MZR A;  4LFB J;  3H5Y A;  4M5L A;  4FKX A;  2YX7 A;  2B4P A;  4FXV A;  4NWB A;  1SI9 A;  5B08 A;  1RT4 A;  1ZBT A;  1S48 A;  3CJT A;  1VQ5 S;  4B08 A;  2QA2 A;  3AAW B;  3MUM P;  4YR1 A;  2VL1 A;  4F25 A;  3ILO A;  3TJA A;  2JNJ A;  2X1A A;  4ECZ A;  4O3R A;  4DV0 J;  4DR7 J;  2FVR A;  2BOP A;  1IKW B;  1OPZ A;  2B6A B;  3OHA A;  2AU0 A;  1RWN B;  3ZZ0 A;  2HHW A;  1S49 A;  3CD5 A;  1U2R A;  1S7I A;  1GEH A;  3H20 A;  1ZEF A;  4GO7 X;  3MEC B;  3N28 A;  1KS2 A;  2JWN A;  3SZY A;  1VK3 A;  1MSW D;  1SHQ A;  1QSY A;  4TY8 A;  3TAM B;  2I38 A;  1NPP A;  2F9J A;  2E1C A;  4KC5 A;  3ITH A;  3HZG A;  2H51 B;  5FJ4 A;  5ITH A;  3CMR A;  1S1U A;  5A8K B;  5DO2 A;  2C2E A;  3A3N B;  2DGW A;  4RU9 A;  3WAW A;  1EX8 A;  4TXS A;  3CMA S;  1TEL A;  4ZPW R;  4NLX A;  5A8R A;  3QMQ A;  2HHU A;  4ZA1 A;  3V4M A;  1G1X A;  4I6W A;  1Z1Z A;  1FVS A;  3IC1 A;  3TA0 A;  3LAL A;  3ZZY A;  1Q5Y A;  2B43 A;  2DNO A;  1MLA A;  1WEL A;  2GVD B;  1HNX F;  3LAK A;  1HI8 A;  1LWE A;  4BBY A;  4LF6 J;  4HHU A;  3BBB A;  2BKN A;  2RS2 A;  3VV2 B;  5IM0 A;  2UXB J;  1UEK A;  4ZGA A;  5IT9 Y;  3PRD A;  1LW0 B;  3OFH A;  2C2Z B;  1WTB A;  1KH7 A;  1CJV A;  2G1H A;  2HYI B;  2XY6 A;  2GGP B;  4C8Z A;  4GKJ J;  2DR7 A;  3F56 A;  1S6U A;  4EWT A;  4MFB A;  4P71 A;  3OVB A;  3NWR A;  3UD4 P;  1WHY A;  1WC0 A;  4DR2 F;  5F8G A;  3BDG A;  3KMQ A;  1DTT A;  2DR6 A;  1H7X A;  1RBA A;  1K44 A;  3RUB L;  3TEH B;  3VVT A;  1T05 A;  1M1G A;  4NLQ A;  3R5G A;  1Q53 A;  3U27 A;  4FYD A;  4C8M A;  4N41 A;  4HTJ A;  4Q45 A;  4O3O A;  4FDI A;  2MLZ A;  2OHD A;  4YDX A;  5LT5 A;  4NYZ A;  2X7I A;  1HYS B;  1WDT A;  1QE1 B;  3UR3 C;  1X60 A;  2M9K A;  3BN4 A;  3LQV A;  1X31 C;  2BKP A;  5L8R C;  2XY7 A;  3CCS S;  2ANH A;  3BQ1 A;  2AF6 A;  2DIS A;  5D8H B;  5E0O A;  3RRK A;  4QQB A;  3JB9 k;  1HIY A;  2AHO B;  3N9U C;  3CF5 Q;  3JS9 A;  1RT1 B;  4KAI A;  1VQ7 S;  3VTI A;  3CME S;  3DKD A;  3LF0 A;  4CLF A;  3BDP A;  3PX4 A;  4YOE A;  1TKZ A;  2X3G A;  3H42 A;  4WYW A;  3HHN B;  4RW9 B;  4B3R J;  2AW0 A;  3NGT A;  1AJA A;  2K3I A;  1FVQ A;  2E9Z A;  2R8K A;  4GVB A;  4J90 A;  3Q8Q B;  5ETO A;  1BC6 A;  3IFE A;  1WOP A;  1SV5 A;  1UW9 A;  2QO3 A;  3DI6 A;  4DR3 J;  3I55 S;  3RBZ A;  3C2P A;  4M5H A;  4DPY A;  4J9Q A;  2YNH A;  4LSL A;  1RWX B;  1DBD A;  1I51 B;  2LMI A;  1Q4R A;  3LP1 B;  2P5V A;  4OYM A;  4MIB A;  2WSF C;  4QAX A;  3Q8U A;  4K5S A;  3WBH A;  1SQE A;  5GAH I;  1M5O C;  4MKA A;  3N79 A;  4PG7 A;  2OPS A;  5A0Y A;  3OFF A;  3UVJ B;  4C98 A;  4MJK A;  2UUA J;  1P9Q C;  3CSK A;  1FRI A;  1N0V C;  1ED9 A;  4LFB F;  1UJ5 A;  5KFP A;  3MM7 A;  2PN6 A;  4TQS A;  2IM0 A;  2XG8 A;  1TZ0 A;  1Q5V A;  4Y65 A;  1NB7 A;  2CQ3 A;  4DOZ A;  4OYP A;  2J9D A;  3SV3 A;  4DV0 F;  4DR7 F;  3G82 B;  1H3D A;  2E44 A;  3T1H J;  4IOC Q;  3MEK A;  4DQI A;  1RT2 A;  1V3R A;  1QJH A;  1ARO P;  1S10 A;  3JTO A;  3B54 A;  1EZZ B;  2HVI A;  4NCA A;  4NRT A;  3TX8 A;  3H90 A;  3NCQ A;  1JLG B;  1U1P A;  4ES1 A;  3GIJ A;  1QVF R;  2QLF B;  4OJ3 A;  5D0G A;  4I68 A;  2RDJ A;  1IQT A;  2NSB A;  2C3O A;  4USI A;  4LF9 J;  5L1I A;  2R2R A;  2WOM B;  1ZAV A;  4AT1 B;  3M30 A;  3FEZ A;  2M8D B;  3EXC X;  1G2E A;  1QVG R;  5HRT A;  1AJB A;  2GIR A;  1JK9 B;  3MPD A;  1R7I A;  2ATC B;  4ECU A;  5K5M A;  4HTI A;  2QTW A;  2F8E X;  3Q8P B;  3AJ1 A;  4F4K A;  4ZLN A;  2A1B A;  4ZVP B;  1UTA A;  4ED0 A;  1X4C A;  4LF6 F;  3K8V A;  5F3Z A;  1IKY A;  3Q83 A;  2UXB F;  1JLE A;  3H40 A;  4KJD A;  2JZ5 A;  2VOP A;  1T9U A;  3MMB B;  3P96 A;  1FA0 A;  3V4I B;  5B0C A;  4DCO B;  4R5P A;  3VZH A;  4PG4 A;  4PG6 A;  4TQR A;  2EK1 A;  2XMU A;  1S97 A;  4GKJ F;  2HS3 A;  4CLL A;  4F0M A;  3R5B A;  3M6X A;  2VG6 A;  2Z2Z A;  2HBY B;  1VBX A;  4ZCL A;  3DLE A;  4CLT A;  2IPO B;  4CQ1 A;  5LSR A;  3M9M B;  1FNO A;  4X4S A;  4JI4 J;  1FWK A;  2RRN A;  4M8L A;  3MM6 B;  1RXO B;  1WG4 A;  4OZ3 A;  1TK8 A;  1DHM A;  5DLW A;  5GRR A;  2GAG C;  1YVF A;  5C2G A;  1WC6 A;  2XMM A;  5KFC A;  3I5C A;  1F60 B;  1HD1 A;  3BO3 A;  3JXO A;  1RAA B;  1K8A T;  3N0V A;  1XIQ A;  5EWF A;  3Q24 A;  4UPK A;  1FES A;  2DNN A;  1U7L A;  2VFV A;  1B8J A;  3ZXW A;  4RX6 A;  1CG2 A;  4DLE A;  1KH9 A;  4O23 A;  1FHT A;  2YX4 A;  2ACY A;  1RYR A;  1LQ9 A;  3SCJ E;  3DRP B;  2EFV A;  2KT5 A;  2W9A A;  4B3R F;  3ENW A;  3SQG B;  3UD5 A;  2XY5 A;  2NR0 A;  1VQS A;  5A6P A;  1FXD A;  1AZS A;  1R0C B;  4DR3 F;  2IDL A;  4G1I A;  3MF5 A;  2Y0B B;  3A12 A;  1LWF A;  2Z2Y B;  5D6G A;  2SXL A;  2IFY A;  3CJ8 A;  4IOA Q;  4PZV A;  3LPE A;  5K8M A;  2GV1 A;  1UW4 A;  3JSM B;  1YJ9 S;  5F41 A;  4YY3 J;  2MZT A;  4CP5 A;  1PYO B;  4ED2 A;  2UUA F;  1AUK A;  4NLD A;  3DN9 A;  2G2O A;  2DGS A;  1TTH B;  3GCX P;  3HT3 A;  2FZK B;  1FDB A;  2W9B A;  3POT A;  2RIJ A;  1VQ8 S;  4NZ0 A;  4P2M A;  4DU7 A;  3GIK A;  3L7O A;  2PII A;  3S8S A;  3AOD A;  1LW2 B;  4QIW D;  2V68 A;  4M5M A;  2JC1 A;  3PY8 A;  4RNF A;  1XR5 A;  1WKJ A;  3CJS A;  3JTP A;  3T1H F;  4UPI A;  1VGY A;  8ATC B;  2H54 B;  1QLN A;  4HHJ A;  1JLC A;  1YTY A;  1F3F A;  1PIL A;  1UL3 A;  1G6B A;  4GKK J;  4MH8 A;  1YX2 A;  4DV1 J;  1ALI A;  4NML A;  2VPZ B;  1R3N A;  4H54 A;  5ETK A;  3LXQ A;  3S7R A;  2BE9 B;  3M8Y A;  2YQ3 A;  2HMI A;  3CE8 A;  3BDH A;  4JUZ A;  2QL9 B;  1FKP B;  2RB7 A;  3Q2S C;  1IN0 A;  4IRC A;  3GFH A;  4GRS A;  3HHL A;  1S1V B;  3D2W A;  4JI0 J;  4FZV A;  3IR5 B;  3EUN A;  1C1C A;  4F0K A;  4LF9 F;  1E3C P;  4CT8 A;  1NK4 A;  1SB6 A;  3GSD A;  2MTL A;  3GON A;  2BE7 D;  1M0S A;  1FDN A;  3M2V B;  4UY8 T;  2J5A A;  2YX1 A;  3HFK A;  3W62 A;  3F73 A;  2MJN A;  5HMW A;  3QT5 A;  4TKT A;  4NZ7 A;  4F8R A;  2PSZ A;  1T95 A;  3EZU A;  3I9V 9;  2QA4 G;  1CQN A;  4DUT A;  3KDN A;  2C3P A;  2YKN A;  4N77 A;  4ZVS B;  1Y9O A;  4BLG A;  2P9E A;  2BJD A;  4RKU C;  4H4O A;  4LQY A;  3AA9 A;  2ZC4 A;  5E3C A;  1W26 A;  2W5R A;  1R31 A;  1PCA A;  4ZCM A;  2OSR A;  3I32 A;  5AXN A;  1QD1 A;  1NAQ A;  4QWA A;  1I94 F;  3R2C J;  3OL8 A;  1B3T A;  3CJK B;  1EP4 A;  4M5K A;  1R27 B;  5HVH A;  1HA1 A;  3PKM A;  4MY4 A;  2QSF A;  4JI4 F;  3CJ5 A;  4OZ2 A;  1E1Z P;  5H9E K;  3HZE A;  4ECV A;  1HBO A;  1NH8 A;  4OJG A;  2V8G A;  2FYX A;  4M1K A;  2VIH A;  3UNG C;  4RW4 B;  1XTZ A;  4CO5 A;  3H7H B;  3MED B;  5KFL A;  2JDJ A;  4LRD A;  5DDQ C;  3KG0 A;  2KRR A;  5C2C A;  1T03 B;  2UZA A;  3GJR B;  5LSO A;  5GAE I;  1ZZF A;  4Q0B A;  2EFN A;  4KGV B;  4QW9 A;  2MYF A;  5FDL B;  2PC6 A;  2DEJ A;  5DQH A;  4OV6 A;  4KAY A;  2GVZ B;  4L3K A;  3OTE A;  2HW3 A;  1CJU B;  1H73 A;  1ED8 A;  1Q8I A;  1URN A;  1DY3 A;  3M8P A;  2FJE B;  3MMJ A;  4N8O A;  4DL6 A;  3TNV A;  2W7A A;  4NLY A;  3WIU A;  1HNV B;  3AQO A;  3S01 A;  1MU2 A;  1ZET A;  3GE9 A;  1HQA A;  1EJJ A;  4I2P B;  3I0S B;  4RUC A;  4OYZ A;  3KJV B;  3I82 A;  3VR1 A;  2I5J B;  2JFD A;  3NOC A;  2HHV A;  4ERD A;  2BJ1 A;  1RLD A;  1KOO A;  1KR4 A;  2J7K A;  3TO8 A;  3AOB A;  1EW8 A;  4FVC A;  4IQM A;  1HHS A;  1CUL B;  2GQ2 A;  3F44 A;  5CYM B;  1CEZ A;  5K20 B;  3RBE A;  1B0P A;  2CJX B;  5CYQ B;  3KK2 A;  1UEU A;  3M8Q B;  2GMH A;  1TAQ A;  2VPX B;  1RYS A;  2ILZ A;  4LRF A;  3M32 A;  3KLH A;  2H65 B;  2ZFH A;  2MMY A;  4YY3 F;  4H4K A;  4WYL A;  2R7W A;  3NKM A;  3RGI A;  3H4D A;  1IWG A;  2F3J A;  3SCI E;  2UU9 J;  3BR8 A;  2BE2 B;  3H98 A;  1X8D A;  1CJT B;  2AYE A;  4DEZ A;  2APO A;  3MM5 B;  4EUV A;  1WC3 A;  4L75 A;  2CFX A;  5LM7 E;  2QC3 A;  4U9R A;  1SCJ B;  1PBA A;  2IYI A;  2DHX A;  1YJN S;  3OL7 A;  1FNX H;  3W2V B;  3UFC X;  1A0O B;  2VF3 A;  2XYP B;  2R4F A;  5E7O B;  3CJ3 A;  3N01 A;  4LSZ B;  2OI2 A;  1U0S A;  4D3H A;  4DSI A;  1VC5 A;  2OTJ S;  4ZHR B;  3T5L A;  3NRB A;  5IOL A;  1V3S A;  4GKK F;  3O44 A;  3DRS B;  2ZZM A;  2HVZ A;  4DV1 F;  4UZB A;  2JOQ A;  3MUT P;  4J7C A;  1X7V A;  3J7Z T;  1FFS B;  4FPR A;  1JMT A;  2WVE A;  1Y5N B;  3MMA A;  1NKE A;  3GYN A;  4ETZ A;  3MM9 A;  4ZIW A;  1K47 A;  2BW2 A;  1ZS6 A;  1VRT B;  2JFK A;  4J9K A;  4I67 A;  4DF4 A;  2IJR A;  4JI0 F;  4KV8 A;  1X5T A;  1JLA A;  3K89 A;  3NL0 A;  2W5T A;  4A8F A;  2H5J B;  2OH2 A;  1C0T A;  2FZG B;  4ETX A;  4Q2L A;  1T9Y A;  4P2F A;  4CO4 A;  3T01 A;  3NKQ A;  5KFT A;  1F9H A;  2Y1I A;  2BX6 A;  5T14 A;  4ZPB A;  2QLX A;  2YNF B;  3ETO A;  3R97 A;  1GFW B;  2Y8Y A;  4WIQ A;  2Q6C A;  5J2N A;  3MM8 A;  2G9O A;  3BQ2 A;  2VBX A;  1EAY C;  4WWS A;  1WG1 A;  1RA6 A;  1TU0 B;  4L3N A;  2YNI A;  3AJD A;  1JNZ B;  2MEW A;  1KN6 A;  3EZ5 A;  5B09 A;  2BV3 A;  3H4B A;  4IYQ A;  5JVH Q;  4WP3 A;  5HMY A;  2K7K A;  2R7T A;  1PSD A;  5KFG A;  4OX8 A;  3BGR A;  1KSP A;  1C4C A;  5DDR C;  2BMB A;  3DFE A;  2KRB A;  2MQQ A;  2OEM A;  1T0T V;  2KHC A;  1NPK A;  3CC4 S;  4ANC A;  2P6T A;  2LP4 A;  3DHX A;  1NME B;  3I6P A;  1KVJ A;  2C42 A;  1S99 A;  3D0I E;  3IBW A;  1MWQ A;  3NKO A;  3HFZ B;  4CTA A;  2QX0 A;  2KT3 A;  2H5I B;  1YJT A;  3RU0 A;  4PEO A;  2V6A A;  3UE2 A;  1W25 A;  1LEO A;  1K0V A;  1C1B B;  3KUE A;  4M95 A;  2IFX A;  4ZDN A;  1CJK A;  2AJ1 A;  2NPF A;  1RHJ B;  3L3C A;  2MPU A;  1WG5 A;  3PYF A;  4FDJ A;  2HQG A;  3AT1 B;  2GIQ A;  2X1G A;  1E2S P;  1HNW J;  4HI2 A;  4GTW A;  2B5J A;  3K5M A;  2DIV A;  2HVD A;  4G1P A;  4PWW A;  2BJ9 A;  3FRZ A;  1TL1 B;  3K17 A;  4CXS A;  1T02 A;  3KLF A;  4K7Q A;  5LXR A;  1LWC A;  1I3O B;  2R7Q A;  3VQS A;  2HLU A;  2MY8 A;  4LFC J;  1VRU A;  1VFJ A;  2GSO A;  3CD7 A;  4WP8 A;  2RQK A;  2CWX A;  4RW7 B;  3E01 B;  4Y2A A;  3AD8 C;  4K4X A;  2E1M C;  4BWM A;  4ZCK A;  4QR1 A;  3UCG A;  3V6H A;  5IT0 A;  1I6J A;  2VZ9 A;  2V69 A;  4G3I A;  5GAD I;  1S0N A;  2DRA A;  3FBE A;  2BRK A;  4GO5 X;  3SMZ A;  3QAU A;  4J5O A;  1S79 A;  1RBO B;  3DDI A;  3NLC A;  3E2D A;  2W5W A;  2HS4 A;  2KKH A;  2RD5 C;  2WON B;  3RB0 A;  1Y0H A;  1J5E J;  3NKP A;  3QID A;  4NI2 A;  4UOH A;  4URQ U;  1FI4 A;  3K8W A;  4ED8 A;  3MCS A;  2HIY A;  5DLG A;  3SDE A;  5KFW A;  5IV3 A;  5DJB A;  4CYR A;  2FLL A;  2UU9 F;  2CZ9 A;  2YQ0 A;  2DIT A;  1GTE A;  3VQT A;  2QMU B;  4IDK B;  3V5R A;  5EGY A;  2AEF A;  1HMV B;  3R6G B;  3TAM A;  2HS0 A;  4QYZ K;  3G71 S;  3CMQ A;  2OPP A;  4MKY A;  2ZNY A;  2HFV A;  3UCZ P;  2ZIT A;  5KFE A;  2MKH A;  1H0H B;  2LLZ A;  4OLP A;  3ZTR A;  5A8K A;  4X66 J;  5MAO A;  4QOT A;  3S6E A;  4TU8 A;  1NCL A;  3HJV A;  2QN6 B;  3ICL A;  2ADC A;  2OJ3 A;  2DNH A;  2HNY B;  1SUQ A;  3FFI A;  4PG5 A;  2M4M A;  2F4V J;  4UOR A;  1QSS A;  5K4P A;  3F41 A;  1NM2 A;  4OZN A;  5J2Q A;  1UVI A;  1SL0 A;  1YZ7 A;  2GLQ A;  4F3M A;  1UVJ A;  3NNA A;  1YKW A;  5DG9 A;  4CNZ A;  1U1R A;  2R7X A;  3SI8 A;  2A10 A;  4M5D B;  4WF9 Q;  2X98 A;  3VAK A;  1TVR B;  2QIF A;  1RAI B;  1R89 A;  1WDD A;  3T41 A;  1VCT A;  2WVC A;  4DR1 J;  1PG5 B;  5F8J A;  4PWD B;  3OHB A;  1B4S A;  1SL2 A;  2GIF A;  1HWI A;  2E1A A;  5K8O A;  2IAJ A;  2J0S D;  1Q8B A;  4DLG A;  3DGP B;  3FRY A;  3DM2 B;  1JKH B;  2HPU A;  3EDR B;  2ZD1 B;  5F9N A;  1H2T Z;  4NLR A;  4I1T A;  1FRJ A;  2IM1 A;  1X5S A;  3AD9 C;  2V4J B;  3SCL E;  4KE5 A;  1VIO A;  3DOK B;  4U95 A;  3LP2 A;  1N34 J;  4NA1 A;  1RAG B;  4QR2 A;  1S9E B;  3HVW A;  2HBQ B;  5L9N A;  2D9O A;  2XZT B;  3LUY A;  4ZVE A;  1FWP A;  3BKT A;  1O6X A;  4L74 A;  1UZH A;  1EQ0 A;  3C15 B;  2CJQ A;  1ZPV A;  1S77 D;  2BW7 A;  1E6V B;  1WUU A;  2J8S A;  3MOJ B;  3U7J A;  4LSN B;  3LP0 A;  1S1W B;  2BAN B;  5ETS A;  3K7R A;  1B7F A;  2YH1 A;  1NKC A;  3MR5 A;  4FS2 A;  2WB4 A;  4JI5 J;  1WOS A;  1NK7 A;  3TZY A;  1FO1 A;  1ZM4 A;  4TLQ A;  1EKS A;  1RT1 A;  3D5M A;  4V19 X;  4ANE A;  2HQI A;  1VQO S;  4FN5 A;  3HX9 A;  4CLP A;  4ZJO A;  4LQ9 A;  4DI6 A;  2DXE A;  3CD6 S;  4ZVH A;  1OY8 A;  2YY3 A;  3MDF A;  2W4C A;  3FGV A;  2KFN A;  5A2Q U;  3CCU S;  2XZW A;  1HNW F;  4FKY A;  2YWG A;  4X64 J;  2OPR B;  4DL0 C;  3NNC A;  1SC3 B;  3P4U B;  5SZT A;  5J1P A;  3LP1 A;  2YKQ A;  3DLB A;  4IRD A;  1X0F A;  4X4R A;  4WK1 A;  3W63 A;  2LQJ A;  4Q7A A;  4KO0 A;  5KFA A;  4LFC F;  3T5J A;  2HG4 A;  4UY8 5;  3EM1 A;  1GXU A;  1B70 B;  3HVR A;  3GIL A;  3QFH A;  5HBM B;  1NJX A;  3UVJ A;  1KNZ A;  2RKI A;  3LAM A;  3FUY A;  4AYB D;  1NHV A;  3KLI A;  3IDD A;  1NO8 A;  2ACM A;  2MJU A;  3MTK A;  5ETT A;  1SJ1 A;  4YP3 A;  3OL6 A;  3IWX A;  3I5A A;  4OHW A;  4F36 A;  3SYZ A;  3B6B A;  1SH2 A;  3G9C A;  4HH0 A;  3VGU A;  2QA1 A;  3H0P A;  1VLO A;  4USV A;  4NYO A;  2HQF A;  2BQU A;  3IS9 A;  4FDF A;  3KNA A;  5KG0 A;  2H48 B;  3CVK A;  4DQR A;  2GX8 A;  5I3U B;  2R7R A;  1J5E F;  4FF4 A;  4EMD A;  4A8Q A;  1RT6 B;  4NOH A;  1KVI A;  2CVI A;  3TYT A;  2ZWP A;  3OLA A;  2NYI A;  5I3P A;  2MDA A;  2QA4 S;  4USH A;  3GR1 A;  1PAE X;  1S6Q B;  3AFG A;  5EX0 A;  2FHO B;  2DGV A;  3NOG A;  1VIX A;  5HRO B;  5LRN A;  1RAC B;  4NAS A;  2C1E B;  3I4P A;  3MEE A;  4DL2 A;  3N5B A;  1SKW A;  4IR9 A;  1EW9 A;  4X65 J;  2FHJ D;  4BWJ A;  2NRE A;  3KNG A;  4KKO B;  2LA4 A;  2BM1 A;  4X66 F;  1LWX A;  3NS5 A;  3AB2 B;  2OML A;  2PI5 A;  1WD6 A;  4DFK A;  1C0U B;  1RHM B;  2ZH1 A;  1PGZ A;  4USJ C;  5B0D A;  4B9S A;  2F4V F;  2AP6 A;  4YEA A;  4YUD A;  4QIV A;  1B0T A;  5G0R B;  2J0Q D;  4NYP A;  3CT9 A;  3VAI A;  2X1B A;  1RTJ A;  4N76 A;  2XSJ B;  2HHH J;  1FRM A;  3J7A N;  1S9G A;  2J0X A;  1TP7 A;  3QYY A;  3AXM A;  1KHW A;  4HEA 9;  1YDL A;  3PYD A;  1VBY A;  4DR1 F;  1XJW B;  2VFR A;  1JJ2 R;  1TKD A;  3QJJ A;  2GJ2 A;  4J9L A;  4U96 A;  2CUY A;  2I9S A;  4WP9 A;  3MPY A;  4IKA A;  5J2P A;  3TW0 A;  1NPR A;  3T1A A;  4KRW A;  4DX7 A;  4CDI A;  4M5J A;  1TL3 B;  4Y2C A;  4ECR A;  2OD4 A;  3ZZT A;  4TN2 A;  2OPQ B;  2B0G A;  1KQG B;  4X4N A;  5HQL A;  3MM6 A;  1S1T B;  1HWK A;  5KG4 A;  2XM3 A;  3RR8 A;  1N34 F;  1I1G A;  2EPI A;  4RBT A;  4WFX A;  3KOA A;  5IT9 U;  4L6V 3;  2PMH A;  2JL9 A;  2VBZ A;  2ZBC A;  4I0W A;  2RU9 A;  2AKW B;  4B17 A;  1RAD B;  4FF3 A;  2I1R A;  2ZKT A;  5T7L B;  2A3J A;  3AD7 C;  2HLT A;  5KT3 A;  4C3L A;  2IBK A;  1SPB P;  1U6F A;  2F65 A;  2CJK A;  3CDB A;  3W9H A;  3ZFV A;  3CJ0 A;  3C6T A;  3MK2 A;  1VQL S;  2ZE2 B;  2FD2 A;  4V19 J;  1HBN A;  4AQY J;  3QAT A;  3BSA A;  4KGK A;  1UVM A;  4JI5 F;  4P74 A;  2RH6 A;  1HI1 A;  1EW2 A;  5CH7 B;  2DEI A;  4ILL A;  1EQJ A;  2ALZ A;  4DSL A;  3B82 A;  4PQA A;  1GT8 A;  4IR1 A;  2ROP A;  2W24 A;  1BQX A;  2D69 A;  2LQB A;  5IS2 A;  5HN0 A;  4R0E A;  1PO6 A;  4LRA A;  3ZTS A;  2PMZ D;  4B9N A;  3Q0A A;  2GCF A;  1RWK B;  4X64 F;  5H1S V;  1VRQ C;  3CC2 S;  4I64 A;  3IWN C;  3DPC A;  2BQ3 A;  2JLE A;  3BSN A;  3PX6 A;  1NJZ A;  4WFZ A;  3P3D A;  3CCZ A;  4U7U K;  3ISN D;  3RB3 A;  2AX1 A;  2VPW B;  2VBW A;  4Q43 A;  1IVZ A;  2MKC A;  2OMO A;  3DMJ A;  3R3T A;  4IUF A;  2XR9 A;  3R9L A;  3JSM A;  3KKF A;  4HAC A;  1UPP A;  2LXF A;  4YHH J;  2EI5 A;  2MLX A;  2CQ4 A;  3KLV A;  3KK1 A;  3PR5 B;  2WK4 A;  1MW7 A;  5EUH A;  1CSJ A;  2EKN A;  1L3V A;  4OHZ A;  1A7G E;  3LAN A;  3JYT A;  3OT9 A;  4RW8 B;  1HBU A;  2L9D A;  1CS4 B;  3KG1 A;  1LW2 A;  2ZH3 A;  2D1G A;  4PXD A;  1WSR A;  1BGX T;  4CLY A;  1RHR B;  4ZVO B;  2M7S A;  4NLU A;  5F8I A;  2E5G A;  5KFB A;  4J9M A;  1Q86 T;  3QWU A;  3SSQ A;  1FRL A;  1JNR B;  3H8Y A;  4MKB A;  2HQC A;  1SKU B;  3G6X A;  1DAR A;  3KK3 B;  4TVA B;  2EEY A;  2V67 A;  3C16 A;  2IRU A;  2MQN A;  4ALZ A;  2CXE A;  2IHR 1;  4PKD B;  2BOA A;  2WW8 A;  3PCO B;  2RH3 A;  2CPD A;  1JLF A;  2R9L A;  3L7P A;  4WZM A;  1LK7 A;  1YZ6 A;  4QU6 A;  2B8Q A;  2XUL A;  1GMW A;  3UWT A;  4X65 F;  2MQ8 A;  2K3K A;  3MEG B;  2F1F A;  3PVX A;  1FF2 A;  1O0P A;  1BD6 A;  4R8U B;  4NLO A;  3QLH B;  3TVK A;  1UVK A;  4EO6 A;  3OR2 A;  5F8L A;  3RB6 A;  4TU7 A;  3T6B A;  1IJE B;  3MK1 A;  1NDK A;  5EGH A;  1P9Y A;  4ID5 A;  1RBL A;  4MHX A;  3QQC D;  1RCO B;  2GS8 A;  5GMD A;  2HHH F;  2AEJ A;  4YN3 B;  3GG1 A;  1WF0 A;  5E41 A;  3WIV A;  2DT9 A;  1TKT B;  3GIM A;  1CBK A;  2NPI A;  2UV8 A;  2VKZ G;  3OSN A;  2VG5 A;  1D3W A;  4USK A;  1R8P A;  4K50 A;  5HP1 B;  3OR1 A;  4RU2 A;  2VAS A;  1VMB A;  3UQS A;  4OHX A;  5HLF B;  2ATL A;  4DX6 A;  3HXM A;  1NRK A;  3O8W A;  2FVS A;  3M4X A;  3P8B B;  4LBI A;  4HT5 A;  3CJK A;  2AZ3 A;  3ILL A;  5ETR A;  2BAB A;  3HHL C;  1UMJ A;  3W1Y C;  1PBU A;  2RVJ A;  3QRP A;  2H5E A;  5D4N A;  3G96 A;  5E3P A;  5L0B A;  4JV5 J;  3VGV A;  2QRR A;  4B9T A;  3BQ0 A;  2P2C B;  3M2U B;  2DGT A;  2CDQ A;  4RW4 A;  2U2F A;  2R42 A;  3C66 A;  1M5V C;  1RSC A;  3DRR B;  4XAK A;  4QIF A;  1QTM A;  1F9F A;  5KOW A;  1REV A;  2HFN A;  1KLM A;  1X4E A;  2W9C A;  3SZZ A;  4BCA A;  3DLK A;  2ZZN A;  2ZJQ Q;  4FXD A;  2DNR A;  4YQW A;  3I0R B;  4FBU A;  1TK5 A;  5FDL A;  2E7V A;  1RT3 B;  3ET6 B;  4DZD A;  3G6Y A;  4HH1 A;  3ULH A;  2HRU A;  1T3N A;  5KT4 A;  3OL9 A;  2K1R B;  4ECX A;  3PEH A;  2GVZ A;  5K14 A;  1S0O A;  1FTC A;  4AQY F;  4R25 A;  1U1O A;  1RQ0 A;  4CYU A;  1IKX B;  1RWW B;  1RT7 B;  4C11 A;  2CWK A;  9RUB A;  1F0X A;  1KOH A;  2MB0 B;  2XMT A;  2DPI A;  3TAN A;  2RUG A;  3O5T B;  2AGO A;  4JYA J;  3OPK A;  1X4A A;  3KJV A;  1IJF B;  2DXD A;  5AE1 A;  3RW7 A;  3QO9 B;  4TN0 A;  2J9C A;  4OYO A;  2XCA A;  4RR5 A;  1MRO A;  3TEG A;  4O44 B;  1PJ5 A;  1Z2L A;  5KFU A;  3ZC4 A;  3DLJ A;  1FKO A;  1WKL A;  4KFB A;  4OI3 A;  2V4R A;  3HVT A;  2AJQ A;  4X4T A;  5BJR A;  2IUC B;  1HFE L;  5CYM A;  1VDH A;  1FT8 A;  1VS3 A;  2JVO A;  1K73 T;  2CNO B;  2GMJ A;  2H3E B;  2MGZ B;  3FBF A;  5H9F K;  2NZ4 A;  4YHH F;  1KD1 T;  2B4O A;  2L9W A;  2F5G A;  2R2T A;  4EYH B;  2ZHO A;  2Y1L B;  2DVI A;  2AJ0 A;  2VC0 A;  4M5N A;  1S0M A;  1D9A A;  2YKM A;  3MD1 A;  4B9L A;  3IR6 B;  2BJE A;  1PYS B;  3D6M B;  5C24 B;  1WC1 A;  4J9S A;  3W2V A;  3HO1 A;  2XI2 A;  4Y2I A;  5IC4 B;  1EET B;  4OQJ A;  4PR6 A;  2GML A;  1Y11 A;  2VQF J;  1HNI B;  4XDC A;  1RT4 B;  2W2O P;  2NXN A;  4K4Z A;  1FRH A;  3JQM A;  2G9Y A;  4PXC A;  3F0N A;  1U1M A;  1BHN A;  2CRL A;  1UA0 A;  1LXJ A;  4E98 A;  1IKV B;  5KFZ A;  1JLQ A;  2UVR A;  4Z37 A;  3O3L A;  4I7F A;  3NKN A;  1J5O A;  1SJQ A;  2W1B A;  1ANI A;  2MKS A;  3FBC A;  3QT6 A;  2YNG A;  4E0D A;  4H4K C;  3TZX A;  3W61 A;  4OMF G;  2OP5 A;  1XR6 A;  3KDO A;  1RAB B;  4GTY A;  4ECW A;  3LWL A;  4TY8 B;  2HK2 A;  3PHT A;  5D4L A;  1D9F A;  3G6V A;  2YNF A;  4UPH A;  3SXL A;  3E3X A;  4YB6 A;  2YPY A;  1UP1 A;  1AUS L;  1JLB A;  4ICL B;  3CDA A;  4KHR A;  1RT5 A;  5LIA A;  3ITH B;  1U8S A;  4X4P A;  4DUY J;  3NGK A;  3LO3 A;  1N54 B;  4LT6 A;  2D7S A;  2R2U A;  5TJ3 A;  5A6W A;  2OO4 A;  3TUZ C;  4IQX A;  3NAI A;  1X0P A;  3AA8 A;  1XMQ J;  4WE1 A;  1YBT A;  5A8R B;  3CWJ A;  3OSP A;  1ULR A;  2CG8 A;  2X3D A;  4AE5 A;  4E8U A;  1RWO B;  2DGX A;  4B3O B;  2RHS B;  3IGV A;  5ETL A;  2XEX A;  3IGZ B;  3MPU B;  4PAA A;  3PDN A;  2UVU A;  1LWE B;  3CXC R;  5BR8 J;  2ZVI A;  3PRV A;  3RG6 A;  5IM0 B;  3R6L B;  4FNH A;  3IGY B;  1D9D A;  4NLP A;  4QIE A;  4JV5 F;  3LA0 A;  5J2M B;  2C28 A;  2B8P A;  2AT1 B;  3PNI A;  1TKX A;  3J81 j;  4FYX B;  1CJV B;  5A2Q Y;  2A2D A;  1BWE A;  2BXJ A;  1LV5 A;  1L3S A;  3Q89 A;  2HFU A;  5GAG I;  1U25 A;  5HI7 A;  5INH A;  1VQK S;  4ED7 A;  4DQP A;  4MMO A;  1G7C B;  1FJE B;  4KBI A;  3PM9 A;  3TJ9 A;  4MFB B;  1U47 A;  4JV1 A;  5F8N A;  3ETM A;  5ETV A;  3KHR A;  3TR5 A;  1FD8 A;  2HGM A;  1I5O B;  3HM9 A;  2QMW A;  1WKK A;  3BDG B;  2R8G A;  1BLU A;  1DTT B;  3EVM A;  4ZVU B;  3LW5 C;  4EBC A;  5B0A A;  4ZP7 A;  1T05 B;  1AJC A;  1VI7 A;  3MMC A;  1RE1 B;  2PDA A;  4QWD A;  1HKA A;  3LGM A;  1GMV A;  4P2X A;  4Y28 C;  3UDL A;  3PW2 A;  4P72 A;  4CXK A;  2VFU A;  4RW7 A;  1FWL A;  4GC6 A;  4JYA F;  2ZJP Q;  3MD3 A;  1NK6 A;  4QCL A;  2B9W A;  1S9F A;  2FC8 A;  4CLU A;  4HDG A;  3UPF A;  4GTX A;  5D77 A;  3OTB A;  4ZP8 A;  3QFW A;  5LSL A;  1RK8 A;  4DG1 A;  4LR2 A;  4B3M J;  3Q8S B;  4DF8 A;  3V6D A;  3VAG A;  3W3S A;  4ZLJ A;  3PIP Q;  4DV3 J;  3JAM Y;  1RAH B;  2WW4 A;  3H59 A;  1R0A A;  2W5V A;  1AUD A;  1TKZ B;  5CZV A;  4C8K A;  2AYM A;  4UOG A;  1NSK L;  1HQ2 A;  4CRJ A;  4UOF A; 
#chains in the Genus database with same CATH homology
 3WAX A;  4LR8 A;  4KJD A;  1AUK A;  3B5Q A;  3NVL A;  5LRM A;  1KHK A;  2GSN A;  5L0K A;  1P49 A;  3BDG A;  5IJQ A;  3CMR A;  3UNY A;  3A52 A;  1E33 P;  1FSU A;  2XR9 A;  3UN5 A;  3BDG B;  1EW8 A;  4NWX A;  5TJ3 A;  4LRC A;  1URA A;  4NWJ A;  3WAW A;  3ED4 A;  3M8Z A;  4LRD A;  4TN0 A;  2GSU A;  5IJS A;  1SHN A;  2GSO A;  1AJD A;  5L0B A;  3TWZ A;  1AJC A;  1ALK A;  1O99 A;  3MK2 A;  5DLT A;  1Y6V A;  4FDI A;  4N7T A;  4QAX A;  4B56 A;  4UOO A;  2G9Y A;  4KM4 A;  3WAV A;  3WBH A;  4LR7 A;  2RH6 A;  4YR1 A;  4ZG9 A;  1EW2 A;  4CXK A;  4CYS A;  4LRF A;  5C66 A;  3IGZ B;  2W5T A;  1ELX A;  2IUC B;  2W8S A;  5KXA A;  4KJG A;  4UPI A;  3OT9 A;  2W5X A;  3BDF A;  5GOV A;  4KAY A;  3NKM A;  3KD8 A;  1EQJ A;  1Y7A A;  1ZED A;  4LQY A;  2D1G A;  1KHJ A;  2ANH A;  3UN3 A;  5LQQ A;  3NKN A;  2VQR A;  3MK1 A;  3NKO A;  5EGH A;  2W5R A;  3T01 A;  3SZZ A;  4MHX A;  1ANJ A;  4ZGA A;  4UOR A;  4ZG7 A;  1HJK A;  3NKQ A;  5K4P A;  3IGY B;  1ANI A;  3TX0 A;  1ELY A;  5LRN A;  1ALI A;  4GTX A;  5DLW A;  1ED9 A;  1N2L A;  1ED8 A;  3LXQ A;  2IUC A;  5GRR A;  4ZG6 A;  2GLQ A;  4LR2 A;  1URB A;  3E2D A;  2XRG A;  1KHN A;  2W5W A;  1KH7 A;  5L0E A;  1ZEF A;  2IFY A;  4KAV A;  3DYC A;  3M8Y A;  3UN2 A;  5DLV A;  1EW9 A;  3MK0 A;  2GA3 A;  5HRT A;  1O98 A;  4LRA A;  4LRE A;  1ALH A;  4FDJ A;  3BDH A;  1AJB A;  2W8D A;  1ZEB A;  1ALJ A;  2X98 A;  3M8W A;  2W5Q A;  2W5S A;  3SZY A;  1E2S P;  3UO0 A;  2QZU A;  1HQA A;  5EGE A;  5INH A;  1EJJ A;  1SHQ A;  3NKP A;  3IDD A;  4GTY A;  3DPC A;  3T00 A;  3T02 A;  1HDH A;  1KHL A;  2W5V A;  3NKR A;  4GTW A;  4UPL A;  1KH5 A;  4CXU A;  3M7V A;  1ELZ A;  4GTZ A;  4MY4 A;  4UPK A;  1AJA A;  4UPH A;  4LR9 A;  4CYR A;  1B8J A;  3Q3Q A;  5AJ9 A;  1E1Z P;  1E3C P;  1K7H A;  4MIV A;  4LRB A;  4UOP A;  3WAY A;  1EI6 A;  2ZKT A;  3TG0 A;  4CXS A;  1KH4 A;  5LIA A;  1KH9 A;  1N2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...