3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
1KHKA 3UNYA 3CMRA 4LQYA 1ED8A 3M8WA 5GOVA 1AJAA 3NKRA 1ED9A 4MHXA 2VQRA 5TJ3A 1AJDA 4UPHA 1HJKA 4CYRA 5IJSA 5GRRA 4FDJA 2GSOA 1ZEFA 1KH5A 4LRCA 4GTXA 4GTWA 4CXUA 5LRNA 3Q3QA 4N7TA 1E3CP 3UN3A 5C66A 3WAWA 4UOOA 4CXSA 2IUCB 4LRDA 3OT9A 2XR9A 5K4PA 4LRAA 3M8YA 3MK1A 3UN5A 3T02A 2W5XA 4LR7A 1K7HA 1KHLA 5EGHA 2X98A 1SHNA 2IUCA 3IDDA 2W5TA 4GTYA 1E1ZP 1Y6VA 5IJQA 2IFYA 1AUKA 5DLWA 4B56A 3WAVA 3IGZB 1ALIA 2ZKTA 3BDGA 2XRGA 2GA3A 1ANIA 5DLTA 1P49A 4UPLA 5HRTA 1N2LA 4ZGAA 3BDHA 3DYCA 1EW9A 4ZG6A 2ANHA 2W5QA 5LRMA 4LR9A 1EJJA 1O99A 4KAYA 3SZYA 5EGEA 4UOPA 3SZZA 4KAVA 5L0KA 3TG0A 3BDGB 3ED4A 4ZG7A 3BDFA 4LRFA 3MK2A 5AJ9A 1ELYA 3NKNA 3T00A 3TX0A 1SHQA 1B8JA 1EW2A 4GTZA 1HDHA 4UORA 3IGYB 4FDIA 5L0EA 4KJGA 1E2SP 1ALHA 1URBA 4QAXA 4LREA 4UPKA 1URAA 4MIVA 1AJCA 3NKOA 4MY4A 4NWJA 1O98A 1ALKA 2QZUA 4KM4A 4ZG9A 2W5SA 1KH7A 3KD8A 5LIAA 2GSNA 3NVLA 3DPCA 2G9YA 4KJDA 4NWXA 1ELZA 1ZEBA 1EW8A 1KH9A 1FSUA 3WAYA 2W5WA 1HQAA 1ELXA 4LR2A 2GSUA 3UO0A 5KXAA 5L0BA 3A52A 2W5VA 2W8SA 1KHJA 1ANJA 3NKMA 1EQJA 1KHNA 2GLQA 3NKPA 3M8ZA 3T01A 3MK0A 1EI6A 3TWZA 4UPIA 1Y7AA 5INHA 2D1GA 3WAXA 4YR1A 2W8DA 2W5RA 4TN0A 4CXKA 1ZEDA 1KH4A 4LR8A 3LXQA 3B5QA 5DLVA 3M7VA 1E33P 4LRBA 5LQQA 3E2DA 1ALJA 2RH6A 3UN2A 4CYSA 3WBHA 1AJBA 1N2KA 3NKQA
chains in the Genus database with same CATH superfamily
2BMBA 3GQCA 4IDKB 1SKUB 4O4GB 4PG7A 4O3OA 5A2QY 4PQUB 4RPFA 4FYVB 5D0EA 2V4JB 1RJJA 2DNQA 2B5JB 3M9MB 3SFGA 4H4KA 4DL0C 5KG0A 3M32B 3W66A 2ZHOA 2XGPA 2IPOB 5CCMA 2DRBA 2RJZA 4O3QA 3CJ2A 3QZ7A 4LUBA 2Y9HA 2QIFA 1RT6A 4WKRA 4DV6F 2VC1A 4M5GA 2Y8WA 1S1UA 1NRKA 4Q8EA 2DKOB 4JI7J 3HFZB 2ALZA 1KLMB 4F4AA 2PT0A 3SI8A 1ACMB 1NMEB 4J37A 1SUQB 2K8GA 3PACA 2OELA 1WSVA 3FKBA 1C0TA 4J9QA 1RWKB 1RWPB 5D4NA 3QLHB 2DCUB 2V8HA 4P52A 3ITHB 3H5SA 1TL7A 1WI8A 4RW4B 3QATA 2RNEA 1M5KC 1SH2A 3UNYA 4K2JA 1YWXA 3LP2A 2CYYA 2KYXA 1FDDA 3HP6A 2W2NP 2XWXA 4C11B 2CJBA 1VQ8S 3HHKA 2XLIA 1AZSB 4ED8A 1R0CB 2DD8S 5D4PA 3SIPB 1DTQA 2DR5A 4HI1A 2C1EB 1JLFA 5A8RA 3IR5B 4WCEQ 5E41A 2AT1B 1MU2A 3EDRB 5H9FJ 3PW0A 1CLFA 3H4BA 3ED4A 3CCQS 1RTDB 1LWCB 1MN9A 1SH3A 3BB5A 3DLKB 1N36F 3D6FB 1KFDA 4K4SA 1QJHA 2DO4A 2P8IA 2ZZMA 2CPHA 2XC9A 2KT2A 4C0BA 2OD4A 5KTQA 2GCFA 5I3UA 4P6QA 3TYTA 4FXWA 1GEHA 1X60A 1FDNA 2OEJA 3HULA 1N5TA 4X62F 1EARA 5CQGA 2B3TB 2K3KA 2MJNA 3R5GA 2EK1A 3PNIA 4GTWA 2HGNA 2NXUA 2ZWPA 1REGX 4B3OB 3S1TA 1LW0B 3BO3A 2AD9A 4WKYA 3PZPA 2JEIA 3MK1A 4GVBA 3AJ1A 4LR7A 1YTYA 3HVAA 2X1FA 1C1CB 1YSJA 2NSBA 1Q0NA 4TU7A 3IBFB 1WC0A 2O01C 5IXUA 5GMEA 5LRMA 5L1KA 5EGEA 3DLLQ 2RU9A 1SV5A 3IXQA 3PKYA 2W8LA 3IS9A 5IS2A 4YEAA 2FVSA 1SXLA 4P7TA 4Y2MA 2RF2B 1V9OA 4B9VA 3M1VA 4ZCIA 2HBZB 2XLKA 2K2PA 2RDIA 1NB2A 3FBFA 1O0PA 2VKZG 1JX4A 2GQ2A 1KHNA 2A6OA 2W5RA 2LA6A 2E1CA 5AXNA 2H65B 4OMFG 2VA2A 1S9EA 4MKYA 3Q2TC 1AB8A 3BYPA 4UZBA 2R7WA 3M8PA 4TU9A 4IUFA 3WBZA 1X4EA 4RLEA 3DOLB 4G1QA 4DR7F 4OYIA 1ZM2A 3SZ2A 4GKJJ 2PE8A 3PR5B 5KT2A 1WF2A 1NHKL 3ENWA 4PWUA 3VF0B 1Y7PA 4LJMA 2HFZA 2IAJB 3TJ9A 2ASYA 5LXYA 2BQRA 4UQTA 3CSKA 4FF2A 2MKKA 4P10A 3TRGA 3W63A 1WHWA 2KG0A 3LALA 2MQMA 5KFXA 3R9LA 3T3FA 2BABA 1HNVB 2HQGA 2Q79A 2NZCA 1VCTA 2JEJA 4DUYF 5LMUJ 4PXBA 5GAEU 1BY9A 2I9SA 2ZDOA 2G1DA 3QRRA 3FBEA 3ZC4A 2CDQA 5EN1A 4RWWA 4CXKA 1VBKA 1OQ6A 1JJHA 2FHMA 4ZPWR 2XZWA 1RWVB 1JLBA 4KV8A 3ETOA 1QE1B 1B7YB 1NK4A 2ZH3A 5K14A 1IM6A 2QLWA 3MPUB 1KKHA 2FJXA 4K4UA 1LFWA 2VC0A 5C66A 3BBFA 4ICLA 2R2TA 1S1WB 2C28A 1LWEB 4ZLLA 1FK9B 3CC4S 1RAJA 2HIYA 4IFYB 4EO6A 4B3RF 1UWBB 4I64A 2KG1A 4UW2A 2LQ8A 1NHUA 1UZHA 1RU2A 4HT7A 3GTYX 1RKJA 2V8DA 4K59A 1XTZA 1SC3B 4C8YA 1X0FA 5F8LA 1XIQA 1RT3B 4K4WA 3BQ0A 3OD2A 4I6YA 2HQFA 2A10A 4CDIA 4ZN3A 4ES1A 4ZJOA 4KIAA 2VICA 5DQGA 4M94A 4C3KA 4FNHA 4ZPTR 4DV2F 2MQ8A 2IYGA 4ELTA 2N7CA 3PW4A 4J9MA 3MPVA 4HTJA 1TU0B 2MJUA 1S6PB 4EZ9A 5BYSA 3KLEB 3DM2B 1T03A 4JI4J 3H90A 2MMYA 1CJTB 1S7HA 4TN0A 1QSYA 2ZE2B 1E33P 2AJ0A 4M5LA 4JV0A 1XR5A 4I7FA 4O3PA 2NXEA 4QWDA 2XZTB 3MM5B 4ANCA 4DPYA 3UN3A 1CJVB 5J1PA 3FRYA 3ZTSA 4ZVGA 5KT6A 1S1XA 2ZKTA 4Y28C 1AROP 3SFUA 5M2PA 2RDDA 1I94J 1S12A 3BDHA 3PYDA 2MGZA 4KAYA 3CCZA 1JJCB 4PUOA 5E3CA 4DU7A 1RWOB 3MM9B 1KRPA 2WVEA 1U25A 1NPPA 2C3MA 4LQ3A 4HR2A 3W5XA 4R0JA 4LFAJ 2E9ZA 2DY1A 3GZ7A 5CYMB 4IRDA 1N6QA 4IKAA 3BF4A 4LF4F 2D1GA 2HS0A 1HWIA 3GR0A 1IM4A 2J0QD 5K8MA 2RKIB 1LWFB 4XTTA 4LF8F 1QLNA 3QRPA 4Y0FA 1WG5A 1AA1B 4LRCA 2J6TA 1ZTTA 2FB0A 2KTQA 5DZ7A 5HLFA 5HMYA 1IBKJ 4KSEB 4LQ9A 2CFXA 2R7TA 3BDGA 2CXEA 2CWXA 1U0HB 2R4FA 3GMGA 3PJWA 1Y00A 2Y1RI 5KG2A 3O1LA 3A13A 4IFVA 4ECVA 4ZIWA 2C42A 3QIDA 1HYSB 4B3TJ 1Y11A 2VB6A 3DFEA 1H0HB 1NSAA 5J2NA 1I51B 3JTPA 3G4SS 2AEJA 4Y65A 4Q44A 1F2GA 4UOFA 2NXCA 2ERRA 2H5EA 3V6JA 1ZEBA 1OMSA 4ATNA 3RR8A 3KNAA 4IO1A 2QSFA 4RW6A 2QLXA 1UJ6A 2DJWA 3G6XA 1YBTA 2QL7B 3I0RA 1JJ4A 2Q43A 1VJWA 5KFGA 3LAKA 4KQZA 2CADA 1GMVA 3U1NA 1E6VB 3IGNA 2CPJA 3F0NA 1C0TB 1WOOA 4KPCA 2UXBF 4F50A 3HI9A 1U1QA 4L3NA 1X9MA 1VRUA 1RAFB 3E8OA 2VIHA 1WC5A 2AF6A 3KG0A 2C2EA 3IDDA 3TVYA 2QT7A 1FE4A 1NKBA 4DSKA 3ZXWA 1R31A 3OL8A 3CEDA 2DR8A 4ES2A 3PW5A 1VDHA 2FJAB 2VONA 2BE9B 1DTQB 5KFJA 3BDPA 4H4MB 3WHIA 1HLWA 4F4XA 2CG4A 2AYBA 4WU3A 4ECQA 2E29A 3MAHA 4NLSA 5J2PA 2XMVA 3DKDA 2JLGA 1WDTA 2PA3A 2HBYB 1HNZJ 1YKWA 1KNZA 1FJGJ 2UV8G 4GMKA 4RWXA 1GX5A 1FWKA 5D6GA 3WIUA 4NEYA 3PX4A 4U95A 3I31A 4NA2A 2DT9A 2AX0A 4F02A 2HHXA 1WHVA 1UVLA 4HHHA 2W8SA 2W8KA 2UVWA 1J5EJ 4TQSA 2A2DA 4PZVA 5IOLA 4DL2A 4QWBA 3IM9A 2QX0A 3M8WA 3NEKA 3R1LA 4JB8B 4QW8A 4CNYA 5ADZA 1RK8A 2E1RA 4DCJB 3H2VE 3BEGB 4P72A 3IG1A 1E3CP 3RRKA 5D8HB 5K4PA 1X4GA 5GVQA 2RHQB 1RXOB 4ZKAA 3MGJA 5ITHA 2RT3A 3W9JA 4RNHA 4DG1A 4NX9A 3R5JB 4OV1A 2WZ1A 5D78A 3D1OA 1NJYA 1HARA 3AAWB 3B8HA 3KJQB 3TVZA 5LOQA 4FKYA 1JJ2R 4QR0A 3SCJE 4B9LA 2QL9B 1H2TZ 3M8QB 1AW0A 3HFVA 3MOJB 4MIVA 2WONA 3M8SA 4NMLA 4N56A 2IIHA 3W65A 3NCQA 3C19A 3S8SA 4LVNP 3P49B 4C3MA 4DSFA 2MY8A 3C14A 5F3ZA 3TQEA 1KONA 3MUVP 4JI6F 4QIEA 5FLXY 3M8ZA 3K17A 5HBMA 1JLCB 4TY9A 2P6TA 2OTLS 4YB7A 1Y9OA 2MKYA 2KB2A 2FDNA 2NS1B 4E0DA 3B4DA 3OHAA 2HYIB 1B7FA 2X3GA 2ZBRA 3UE2A 3MEDA 2HVDA 4OIXA 1PJ6A 1ZEFA 3EGVA 3EMTA 1U6BA 3V4IA 4FBUA 3Q22A 3JSBA 3RUBL 1UETA 2M7SA 2OIHA 2KHCA 3RB3A 4OYBA 1YJ9S 5EGHA 3BS9A 1V3RA 2OSRA 3LQVA 1ANIA 2V9KA 2KXHA 3HSJA 5HRTA 3QQCD 2ZC3A 2CJXB 5H9EK 2JLEA 1IKWA 4FYXB 2E5LJ 5LSOA 1NKEA 2RU3A 2F4VJ 1RWNB 2HZVA 4OLOA 3ILIA 2BQUA 3HKWA 4DR5F 2KT3A 5AT1B 4K0KJ 2C22A 1B0TA 2QO3A 4Y00A 2VG6A 2GSNA 4LSNB 3VVTA 1JQGA 1JK9B 4MFBB 4DCOB 4ZPAA 4IR1A 1G1XA 1EI6A 1KFSA 3ZTQA 1SC6A 1S5ZA 3O6QA 1M5VC 3NRBA 1EETB 2LP4A 1U1PA 3PYFA 1Q78A 4KR0B 2IMOA 4HHJA 3MM8A 1KVKA 3ZZOA 1TKZA 4FDFA 1X5SA 5DZ6A 1M5SA 5LJ5Y 1P9QC 1E6YA 1O8BA 2E66A 2BDPA 4NCAA 1QM9A 4ES3A 5KFPA 2GJ2A 1EQ0A 2VBZA 4ENOA 2YKQA 2C3OA 1HDHA 1RAGB 1CPZA 3NNHA 2OPSA 5DG8A 4ZITA 2ZBPA 3R6GB 2FJEB 2XMJA 1U8SA 2XSJA 2Q6BA 2PFFB 2R7UA 2YQ3A 3AODA 2B51A 3TZYA 3MD1A 1SKWA 3M2UA 2XHCA 5EX3A 2I38A 1T02A 4DV1F 3AQOA 4LF9F 1ZEDA 5KFMA 7AT1B 1XMOF 2N82B 2RH6A 2FVRA 1NK6A 2YX1A 3MMCB 4NLYA 1TK0A 1S97A 2MDAA 1SVDA 4P2XA 4B9MA 2ROGA 2MZSA 2N7YA 2EFNA 1MMLA 2ZFHA 1GK8A 4I7FB 5HQLA 4MK9A 2LXIA 1T8EA 5LJ3Y 3IGZB 3MZIA 4ZVTB 5IM0B 4NASA 4I0WA 4NLPA 4W98A 3ZNUA 4A8QA 3OPKA 3UD5A 1YDLA 3R5BA 4QW9A 4DV7F 1NK0A 3Q23A 2LYVA 1EHWA 1P6TA 2ADCA 4FF1A 1IR2A 2YNGA 2EBGA 2UXDF 2I0XA 1U2FA 2MGZB 1MWZA 3OSPA 1IKYA 4DMZA 5LIAA 5L39A 2LVWA 3P5BP 4X2BA 2ZZNA 1WC4A 3DXSX 2YWHA 3M9OB 4DV0F 3DLEA 3R1HA 2L48A 3KK2B 3T01A 2CPZA 2XMAA 3VAMA 4DF4A 2HHUA 2YPZA 2RHSB 2L9WA 4CH1A 4O3SA 2PEHA 2AGOA 1TFWA 4YUDA 4M5DA 5CHCB 2GZOA 3CCJS 1NSQA 2L9DA 2QV6A 4DHVA 4HKQA 5MLCV 3P5TL 4PPDA 3IFEA 2Z30B 4AYBD 1X4AA 2PI5A 4MIWA 1C1BA 4N77A 2HFOA 3ADAC 2JEFA 1B64A 3IBWA 5LMUF 1DQ9A 3KLIA 3CCES 3ENVA 5DQIA 3BDGB 5EHHA 5CABA 1S1TA 3CCSS 3PRDA 4J9NA 3FGVA 2CG8A 3R7NB 2F8MA 1K9MT 3HKZD 1S1VA 4HVZA 5DDPC 1G2EA 3POTB 5M2RA 3I96A 1NSKL 3GJQB 4OLPA 1D3WA 4KRWA 1SKRA 1C0UA 2BJEA 1R8HA 2GHWA 5D3GA 3VAHA 2GIFA 2PMWA 2KH9A 4Y2IA 3W61A 3BH7B 4K4TA 2UUBF 2HHHF 4DOZA 2GC8A 2JHEA 2W7PA 1UA1A 3E2DA 4FPRA 2LXFA 1URRA 1G3OA 3QZ8A 2VPXB 3FVYA 1U1NA 4RW6B 1UPMB 1SC1B 2DY9A 4URQU 4WFZA 3B82A 4B02A 1REVA 2FVQA 2RMLA 1SQEA 4KHPJ 4NXNJ 3C3LA 1XQIA 1HBOB 2POKA 1SJRA 2CNKB 2E7VA 2RS2A 1G6BA 2BXJA 1I3OB 2V69A 3I5BA 2QMWA 1SB6A 4RW9B 4DEZA 3NGKA 3GV8B 5I42A 2EFQA 1QY7A 3LP0A 2A3JA 4CLUA 2HAIA 4OJ3A 2J0WA 3N4WA 1T05A 2BJ8A 3DOMA 4OHVA 2IJRA 4OX7A 1ELOA 5J2PB 4B9NA 1KTQA 2LQBA 1RHUB 1RTJB 2BRKA 2AX1A 1YJ7A 2VUGA 5AJ3J 1N33J 4ECXA 1KN6A 3W3SA 5A8WA 1GXUA 1T3OA 1VQYA 2QGFB 4C0OC 3A8IA 4ZGAA 4LSZB 2IRYA 1FKOA 7FDRA 1MWQA 2CAJA 1S6QA 2W7AA 2NCKL 4H4OA 4KKOA 2FZCB 5KOWA 4OI2A 1HI8A 3VVUA 4LF2A 2WSCC 3QO9A 3LA0A 4NLDA 4C2MA 3FMBA 4NE9C 5I3PA 3LWMA 4C8MA 3MD3A 1QSSA 1BE4A 2IDLA 1B0VA 3OVAA 4YFUA 1HWLA 3TEHB 5F9NA 1VLOA 2VG5B 1IUJA 2XS5A 1X5TA 2NSCA 5DO2A 1VQLS 1KH7A 3SSSA 2HGLA 4YR0A 5CXTA 4PG6A 4JYAF 4DQRA 2O1PA 3A52A 1PAEX 4RNFA 2CQHA 3KXDA 1TL5A 2YKMB 2UXCF 1Y4ZB 3WAXA 2DEIA 2XNQA 1N88A 3GLJA 4ZHRA 3NAHA 2WW8A 2IDEA 3C14B 3UWTA 3NS5A 1X8DA 5HBMB 5ETVA 3CDAA 4DBQA 5C5JA 1Q7YT 3QT6A 3UFCX 3H7HB 1UVJA 1U1LA 3IR6B 1X4HA 1NXIA 2D3O1 4DPXA 1Q79A 3T02A 3BBBA 3J7YI 1K47A 3PW2A 2XB2D 5C42A 1RI7A 3NAIA 3TAMA 3V4IB 2GGPA 1ZOTA 4Q2MA 4TYBA 5FLXU 2U2FA 2YWWA 5E3RA 3H98A 4NCGA 1V5IB 2OPRB 2QMUB 2K3IA 4A8FA 2DISA 3MPYA 2AZ1A 4NZ7A 2WW4A 4XO0A 2MLZA 1WWHA 1CS4A 1K8AT 4OZ1A 1SJ1A 4X4VA 4KM4A 4F0HA 4ECSA 3JQKA 1WACA 1KDNA 1NKCA 2DXFA 5AE3A 4ECZA 1LK7A 1H6KX 2HS3A 2V68A 4B3MJ 1GXTA 4WFYA 2OLWA 1Q81T 5B0FA 2AU0A 1S6OA 4PYAA 1VRTB 3R3TA 5CH7B 2XM3A 1T94A 3K5MA 3ET6A 4NLTA 3HT3A 1HBNB 2DTJA 4NYZA 1CVJA 3FFIB 1HIYA 1HHQA 1HMVB 4LBPA 5T7LA 3FSXA 2WHOA 4OYMA 3W2VB 2RRAA 1L3SA 2W9CB 2DH7A 2UVVA 5HMZA 3CC2S 3OR2B 1H72C 3DCAA 1EP4B 3G6ES 4RO0A 4X66F 1S72S 2WB1D 2R42A 1B0PA 2AMCB 5L0KA 2VPYB 3CDWA 3VZIA 1RKIA 5A0YA 1VQNS 3JQMA 4DUZJ 4JI3F 3VTIA 3FZ2A 5C2GA 5LMNF 2B8QA 4ECUA 2HS4A 2XI3A 2L08A 5LXRA 4PYDA 5SUHA 2XY5A 2GW8A 2H4WB 2HGMA 2DNZA 1FJEB 2DNKA 1HBMB 4LF6F 5G4DA 2FY8A 3J7AN 2JFKA 4AT1B 1OIAA 4DV3F 3R5AA 1ZM4A 2Y0SD 3PEHA 2YH0A 1D9AA 2GJIA 3CJKB 4NPOA 2FHOB 5B08A 3PTWA 4Q8FA 4D3GA 4B3SF 4X4PA 3VV2B 1NPKA 1HQEA 2CVEA 4PR6A 2KVQE 3HM9A 4DQPA 2YKNA 1N8RT 1NDKA 1KSPA 3QWPA 5KFHA 3DNCA 2F4FA 4LF1A 3A3OB 2OFHX 2IC3A 1PO6A 2QZ8A 2D9OA 4C3LA 2RRBA 4DPOA 5A6PA 1PKUA 2FIUA 2C2NA 4OYAA 3N79A 3HCXA 4NMXA 2B9XA 3TOQA 3KJVA 2C2MB 5DG9A 4LRFA 4QZVB 1Q8LA 2Q6CA 4J91A 5B09A 2NQPA 2FPHX 3V5RA 2LEPA 1HWJA 3RW6A 2VDHA 2E1MC 3MPWA 3DRRB 1CQMA 4DPUA 4AUKA 4EK2A 3JSMA 3N6LA 4PXCA 3HVTA 2VQFF 2Z4PA 2UZAA 1GFWB 2LQ5A 4PPZA 1DTTB 1U48A 4LR2A 3MMBB 5CD4H 3PYEA 5KFBA 2DHSA 1U4BA 4RBVA 2GHPA 3BQ2A 3LXQA 3TQ1A 3GFZA 4I69A 2IM0A 4MH8A 4YB6A 3NS7B 5C25A 1FRJA 1RT5A 4OX9J 2MZQA 3QSYB 2QA4S 4A8KA 4MT1A 3OVBA 2DHXA 4M5DB 2C2DA 4KHMA 4JI0F 4EGLA 5ETPA 2NR0A 1VBXA 1EQMA 1SQGA 4OYWA 2KU7A 4JI1F 1S77D 4AQYJ 2ZM6J 3FSYA 3CGIA 4PEOA 1T9UA 3NCPA 4BCAA 5DDRC 1CEZA 2MKIA 3CJTA 1S1TB 2XMKA 2QA2A 3QSIA 1FWLA 2NPIA 2W9BA 4ANDA 4JI2J 2J9DE 1Y10A 2KXFA 3SQGA 3DC2A 4O44A 2P2CB 4N8OA 1M5OC 4HHUA 4N8NA 1R8BA 2RILA 2EW9A 1T9TA 3LF0A 2HFUA 1N2KA 2KXNB 2MZ1A 3VALA 4F8RA 3EGNA 5AXKA 2R3VA 4MHXA 2M3DA 1FESA 2E9RX 2GSOA 4GTXA 3THVA 3ZTRA 4Q2LA 4LF7F 5KFIA 2CQ4A 3IGVA 1REVB 4OHYA 4UT4A 1JLQA 1R43A 3E51A 4RW8B 3ISZA 4PWWA 4ETZA 1WG4A 1UVIA 1RU1A 3P45B 2MKCA 2ZVSA 3ZZYA 2QG9B 3OL6A 2IM1A 4OZ3A 4CH0S 2GS8A 3V2UC 2IRUA 3BDFA 3BSOA 3BN4A 3NKNA 3T1HJ 3MAAA 4AXIA 4WE1B 2OKQA 2J8SA 1PILA 3TW0A 3KLHB 3SXLA 3KDNA 2JOQA 1D9FA 1RACB 2HURA 3BDEA 2FLOA 3GV7B 1N5VA 3MECA 1WELA 2Z56B 1Z4UA 3MI7X 1YX2A 2IA6A 2R7XA 3TVKA 1WC6A 3KK1B 2M52A 3CDUA 2BKNA 2XMWA 5AE1A 3CCMS 2P5VA 1HJKA 1OPZA 2V2QA 2E5GA 2QL5B 3FEZA 1F3VA 3HZEA 4K7QA 3ZFVA 4O3RA 3QGGA 2ACYA 1XN9A 2BJDA 3SYZA 2EFPA 1FJCA 5BR8F 4H4OB 3HX9A 4KKOB 1J2VA 3FCVA 3KNGA 4AXJA 4FS1A 3HO1A 3THPA 1RT2A 5HSPA 5HP1B 2CQ2A 1ZPVA 3DYCA 2DBBA 4R5PB 4IQXA 4JI5J 1MN7A 4F3QA 2OEMA 5IT9U 2CZVC 1S0MA 2DGTA 4MY4A 2XYGB 3T1YF 4U7UK 2A0FB 2ZZTA 2GNKA 2U1AA 4B9SA 4WTOB 1N34F 1J5OA 3C6TA 2UUAF 3FDSA 4I6WA 3DRYA 1EQJA 2QA1A 1FFSB 3I0SA 3MTKA 2VOOA 4F2RA 4NLUA 5J1EA 1R8AA 2BYCA 5A8KA 2EXUA 3D1HA 4PABA 3DRPB 3VWSA 4NA3A 3EVMA 1JWWA 4C98A 1MROA 2H5JB 3IRXB 3A8EA 4USVA 3DMJA 3PYGA 2QYCA 1MLAA 4KHRA 5KT3A 1GTHA 2IBKA 3G6YA 3TA0A 1K7HA 1WJ9A 1RBLA 3SDEA 4IRCA 1GMWD 3M4XA 4LF5J 4X4UA 4F7VA 1WKJA 4JBCA 1Q16B 2Y1JA 3LGNA 1EJJA 3L7OA 4BC7A 4EYHB 1YI2S 2PA8D 2PO4A 2GGPB 2HWHA 2DNOA 2MY7A 2DVIA 2QE5A 3M2VB 4NCGB 4NZ0A 4NWJA 2XCPA 1WI6A 1L5UA 4P73A 4WP8A 1PBUA 3MOZA 3HJFA 2Z2MA 3GILA 1CS4B 4HT5A 1OSCA 2RE1A 2KT5A 2WOMA 4LFBF 3SCLE 2B6AA 1YK9A 1UCNA 4J9PA 4U67Q 1YBUA 5F8IA 2HAFA 3TA1A 3UDLA 4CO4A 1HNIA 5DDOC 2IM3A 3BSNA 1WC3A 1RT7B 2KFYA 2CZ4A 4RBTA 1LQ9A 5IQQA 1Z2ZA 2W24A 3ILJA 1PC5A 2Y1IA 4BBYA 1IR1A 2H54B 3NMRA 1SCJB 1NM2A 2C3UA 4ZVRB 4USKA 2AQ4A 3CVKA 4RZRA 4LRAA 1NCLA 2B4PA 4MK7A 4GTYA 2XWYA 4B56A 3GP9A 2ADBA 2GA3A 5HAOA 4QIVA 3Q8QB 3U1LA 4LR9A 1U1MA 3CJ0A 5H9FK 1N33F 3HHLA 1BUXA 1HR0F 1Q7LB 4UUXA 2G0CA 3LP1A 2GIRA 1EW2A 4NLRA 2HMIB 3RBDA 4XIUA 4E8UA 5F3TA 2W5SA 2DB1A 1KOOA 4DR6F 3GWCA 3ELHA 3DOKA 1OYDA 4HACB 4ZA1A 2CVIA 4ZCMA 1TK8A 1TUGB 4R8UB 1CSJA 2W25A 1X4DA 3CIZA 1N48A 1RT1B 1S9GB 5KG6A 1V6HA 1AJAA 4QU7A 4I68A 2QMXA 1TKTA 1RTHA 5CYQB 1HD1A 2VFTA 4TY8A 2Q66A 1NPRA 4DV4J 2LFVA 3U27A 4Q7AA 4TU8A 3KUEA 2IRXA 3EDQB 3DI6B 3SBMA 2BANA 5IZHA 2AJ4A 5KFZA 1YJTA 1O6XA 2BOAA 3GFXA 3I32A 2AYMA 2X3DA 3QPIA 3SSRA 2R2RA 2AEFA 2PC6A 3OHBA 1VIXA 2ANHA 3LGMA 2RQ4A 3CCTA 2HSEB 1DRZA 4ED4A 2IC3B 3IWXA 3CMES 1WSRA 3K59A 2UP1A 1RT4A 4OYXA 2PFDA 3CJ8A 4OV6A 2LCWA 4OL8A 5K20B 1IKXA 3GE9A 3J81U 4A8YA 2F40A 3OR1A 3KLGB 2HRUA 3E01A 3KD8A 3TZZA 2R7OA 3GCXP 1KH9A 3NY0A 1RISA 4U7CA 1S79A 1YVFA 3CCUS 4CWBA 4P2SA 2IYIA 3S6EA 2BKPA 1B3TA 2W2QP 5C2CA 4NWBA 4F26A 2FJVA 3NLCA 3IMQJ 4CYRA 5B0EA 4DDFA 4F3MA 2F9DA 2X1GA 4N47A 4N7TA 2UU9J 1V5VA 2VPZB 3A8JA 3BGRA 3QT8A 3GR1A 3GIRA 1E1ZP 4WZMA 1WF0A 3V81B 1FERA 1XERA 4F67A 3G9CA 2G4BA 3O3LA 4RW7A 1NZ8A 4MKAA 2RRNA 3KKFA 4RUBA 2YWEA 2HNYB 2DRDA 4WF9Q 1DLOA 1VHFA 4EZ6A 4DV5J 1Z2LA 2JL9A 4KC5A 2VQEJ 2PSZA 1URBA 1S10A 4QAXA 1HNWF 2V8PA 3Q8SB 2CDRB 2XMMA 3ILLA 5DM7Q 1QVGR 4FKXA 5KFYA 2CQDA 4FN5A 2G9YA 4IG0A 4KGXB 2WCXA 5L38A 4A48A 5EWGA 4PXDA 3EX7B 3BV8A 1G4CA 1ANJA 1HW8A 1U1KA 1SH0A 2KM8B 4YDDB 4Z7CA 3KLFA 1QVFR 4Q5VA 4F25A 2E1PA 4EBDA 2CJQA 3GFHA 3G87A 3MAQA 3MR7A 2LEBA 1N0VC 4URGA 3GJRB 5B0BA 2DHGA 3AJDA 4TLRA 4F2SA 4NLOA 5KFFA 3FUYA 1N32F 3GPAA 2NPFA 4X64J 4USTA 2IUCA 2ZJPQ 4WIQA 2ZJQQ 3TJ8A 1JIHA 2R7SA 4QIFA 2YNIB 1NDPA 5CZVA 4UOCA 1F2HA 1VS3A 1NK9A 3A8KA 2OSQA 1FDAA 3O8WA 5I4MA 2X7IA 2GVDA 2G13A 1I5OB 4OI0A 4ZIVA 3QMQA 1TMJA 3C15B 2XBPA 1CULA 4J9RA 3MM7B 2NUUG 2CPDA 4IG3A 4P2FA 2DPIA 2QLJB 2OPPA 3L7UA 2Z58B 3SCIE 5KFDA 5ETTA 1WD6A 1HQAA 1JXEA 4DFPA 1RAEB 4DR3J 5E7OB 5JMNA 1R27B 1VK8A 3OTOF 2WVBA 2O67A 4IH7A 2DNHA 1IBMJ 3AB2B 4J90A 1IBLF 1H74A 1TV6B 4MYTA 4YMEA 4Q0BA 3MECB 3HHDA 2PIIA 1U26A 2IVYA 2F9JA 2HQDA 2WVCA 5ETMA 5F41A 1Y0HA 3M8RA 3K0JA 2HNDA 5MAOA 5KFSA 3CCRS 3H25A 2V34A 1TKDA 1WKKA 5F8NA 2V67A 2K1RA 1RWUA 2GQQA 3TG0A 1K0TA 3FBBA 1JNZB 1RT2B 1NH8A 2ZOGA 1TL1B 2MEWA 2JX2A 2B4UA 3K5PA 5GAHU 1JLGB 1H2UX 3DU5A 1VYAA 1N5YA 2D9PA 4CCHA 2D41A 3FC9A 2BM0A 3TAQA 4ED1A 4ZPVR 3MEGA 2JJ4D 5FDLA 4OFZA 4KO0A 4JI8J 3M2RB 4M5NA 2MQPA 4LSLA 5A8KB 5LRNA 2B0GA 5F8MA 4S0MA 2I1RA 2EK6A 4RX6A 4DL6A 3D54A 3PRBA 4DU8A 4KH0B 5DLWA 2BV3A 1WNEA 4I6AA 2ZBCA 2OPQA 2N4DA 1RHQB 3HHEA 4DSJA 2VG7A 1IWAA 4I2PA 2UVUA 1TZ0A 2FJBB 1QAXA 3LUYA 4ZCKA 3MMAA 3UD3P 4FVCA 1UMJA 4DR1J 1FSUA 1HFEL 3I9ZA 1HQUB 1RUSA 2AYEA 1XNQJ 3JXOA 1RADB 3T9NA 1FKAF 4YR3A 2XYHB 3JAMY 1UW4A 4A8MP 5G0RA 3RYLA 4DR2F 4QIWD 2P6SA 2I5JB 2HG4A 3WQPA 1HWUA 3HSGA 2RDJA 3PXGa 1N5SA 2CPEA 4IO9Q 4HDHA 3W5YA 3I87A 1UPPA 1RBOB 3CB4A 1IKVA 3PX0A 2N4CA 2MTLA 4G3IA 1VK3A 3Q83A 3DDIA 3W8GA 2JLFA 3KHRA 4F4WA 1KEKA 4NCBA 2GV1A 3M30A 1AT1B 3NGDA 1UTAA 2XY7A 3F44A 2KM8C 6FDRA 4DX7A 1O98A 1S9FA 2DO0A 3H59A 1BQNA 1Q53A 2CPIA 5EUHA 3EPIA 2HVHA 4ZDNA 5HK4A 1RGVA 3R2DJ 2W9AA 1HPZB 3RB4A 4C8ZA 4CO3A 2KI2A 2Z2ZA 1RA6A 4YR1A 3TUZC 1WEZA 1KH4A 1RCOB 3DOKB 4Y34A 1YHQS 3JTOA 3G2XA 2BE2A 2CPYA 3FNNA 1Y3KA 3I9V9 1JLAB 3K58A 2LECA 3JYTB 5D4LA 1FT8A 3DRSA 4RU2A 1N52B 2M5YA 3FJ2A 2LA4A 4DV6J 4DSLA 5AXMA 2AP6A 1VQKS 3SV4A 2HKEA 4TY8B 3T1AA 4O4RA 2WVDA 3DYAA 3ZO7A 8RUCA 1TELA 4EMDA 1IJEB 3CCWA 3UDEA 5KT7A 4AE5A 4U6PA 5F8JA 1O5JA 4IR9A 2DCLA 5IV4A 2F5GA 4K4ZA 1TK5A 5AJ9A 5IWAF 1JLEA 1PCAA 4PG8A 1M5PC 1BD6A 5C7PA 4A8SA 1ZM3A 2EI5A 2DIVA 1VI7A 4ERDA 1U47A 1LEOA 1Q4RA 3D68A 3TO8A 1VBYA 3W2WA 2EKYA 4KY3A 3RR7A 1AUSL 3R7SB 5INHA 3EGZA 3OXFA 3G82A 2HFNA 2DYAA 2OJ3A 2AHOB 1XJWB 2C2OB 2NREA 2KYZA 3MXHP 3H5UA 3T19A 3HLUA 3J80Y 1HBUB 1NDLA 5D77A 5CCLA 3BR9A 4HLBA 3Q3QA 3GFYA 2CJAA 5KFLA 2W7OA 2XO6A 3C66A 2JH3A 3AD8C 3DGPB 2MKJA 1N36J 1RB0A 4TYAA 2GVZA 2FTRA 2HNZA 3ICLA 3EJMA 3D6TB 5GAGI 1BHNA 4CIOA 3BGRB 4I2QB 5DDQC 4P7VA 3MK2A 1JKHB 4QWEA 1WTFA 1B8JA 5C24A 1F5BA 3T5KA 4QWAA 4RW7B 3K2YA 1FRHA 1VQ5S 2FQQB 5L8RC 4X62J 1ZS6A 3OUYA 4ZP7A 4PXEA 3F73A 4OZ5A 1LW2A 1RBAA 1XR7A 3NBPA 2HWIA 4UTGA 1BXNA 4X65F 1KBRA 2HK2A 4LFCF 1CJKB 3V6DB 2XMUA 1U09A 3PKMA 4GKKF 3B5QA 2BKOA 2HW3A 2BRLA 3CMAS 1RAHB 2YNHB 4X84A 4A8XA 1EAYC 2DXDA 3QAEA 1ED9A 3PM9A 2VQRA 2D3ZA 1CJUA 5BJRA 2IVMA 2RUSA 5JVHQ 3HF5A 5D4OA 3OBIA 4O4GA 4DR4F 2XQCA 4PQUA 2BZ2A 1UW9A 2V4JA 4CM2A 3SSQA 2B5JA 5KAKA 3CT9A 5GADU 1I1GA 1R8PA 3M32A 2YKAA 1HNXF 1VQOS 3O44A 1ZYQA 2AGQA 3ZTPA 4A8OA 1OS5A 1TR0A 1RP5A 4I1TA 3QIPB 2DGSA 2JDJA 2ALYB 2YX4A 1RWXB 4YY3F 1SKSA 1D8YA 1IJFB 5BXIA 4DZDA 2HQIA 2MZTA 3ENAA 2A1BA 2MZJA 2V6AA 3QFHA 1W2BR 2W5WA 1U7LA 2FGCA 1SUQA 2BVZA 2AV5A 2IM2A 4YP3A 2BR0A 2UVRA 4QR2A 4RBUA 2IMWP 1FKPB 5B0DA 4TNOA 4DR7J 1XWLA 1HI1A 3RRHA 4CQ1A 3QLHA 3UD4P 3ITHA 4C4WA 3ONQA 3WX8A 4RW4A 5ETOA 3W60A 1FRMA 1NJXA 4L72B 4DPWA 3BQ1A 1YBAA 3KFWX 4C11A 3IO1A 4CYUA 4Q0BB 1MSWD 1AZSA 4G65A 3DLGB 1HW9A 3OFEA 3PO5A 2V94A 1Z1ZA 3LPYA 1YJNS 2ROEA 3UR3C 3CD5A 3TNVA 2RH3A 2DR6A 2LU1A 2COLA 4GRSA 1Y5NB 2HLTA 4NXMJ 2CPFA 4ZVQB 1RHJB 4HDGA 5DLFA 2ZNYA 3RG6A 5FJ4A 1RTDA 1TKXB 1LWCA 2K1RB 3OV7A 3NXZA 2HVIA 2J6UA 1R7IA 1T95A 4FS2A 3BM7A 4BLGA 1KHJA 1S0NA 2JZ5A 2CQBA 1S59A 2B4OA 2DGUA 4NLWA 3AOAA 4I4BA 2GA7A 4B3RJ 3J7A1 2VBWA 3ZTOA 2EG2A 2DPJA 2ABYA 3M6VA 2JRSA 1KWMA 1VMBA 2CJYB 2FVPA 1NAQA 5ETSA 2VL1A 1KQKA 4OJ1A 3QGIA 4KO0B 3TUPA 4Q45A 3TR5A 1XC9A 3QGHA 1U8WA 3SQOP 2JNJA 4B3OA 1LW0A 4A46A 2XEXA 1RAOA 5CAAA 3Q24A 2ZHAA 5A2QU 3D7SB 1C1CA 1UEKA 5KT4A 2FHJA 4DV2J 1VISA 1SQFA 4M5MA 1RT6B 4W92B 1N4LA 1S1UB 4CZCA 4DQSA 3HD2A 2M9KA 2XS2A 4ED2A 3IAS9 2B43A 5CYJA 3HT0A 3W9HA 3B4MA 1NB7A 2HEKA 4QU6A 2EVZA 1FHTA 1AUDA 4KTQA 4PG5A 2ZH9A 1X0PA 1U02A 4ER8A 1AFIA 1JB0C 1FF2A 4UPIA 1TL7B 5EDWA 1MMNA 1FA0A 3LP2B 4OYZA 2MHEA 4CP5A 9RUBA 3GV5B 1L3UA 4WBFA 3CNQP 4RUAA 2Z57B 2UUCF 3BO2A 3Q86A 2EG1A 3AD9C 3HSZA 4HYKA 2BW2A 1NU4A 3UPFA 1JLFB 5A8RB 4ZOSA 3DOLA 3HVRA 1I6JA 1KOHA 1U1RA 4MKBA 3MUTP 1MU2B 2E1AA 3MEKA 4AD6A 5T41A 3ZZUA 1P1TA 1YIJS 4IH6A 4Y2KA 4LF4J 3OXGA 1HI0P 3G96A 4GTZA 2IAJA 5HVHA 2J0SD 2W4DA 1TUWA 1X4CA 4WK1A 3TUIC 5EGYA 4CLKA 1KQSR 4LF8J 5F0WA 2LKZA 2GFFA 5CD4A 3H5XA 1XNRF 5HN0A 1HNVA 2HFVA 2BA9A 4RUCA 5I3UB 3TZXA 1VHIA 1WORA 3EM1A 1WHXA 1RLCL 1JNRB 3V6HA 4WP3A 3HXMA 4ZPCA 4OZLA 3NWGA 2YH1A 1NUEA 3AHPA 2FD2A 4OX8A 1Y5IB 4YHHF 4YOEA 1RTZA 2DHHA 3MUMP 3T5HA 2G0IA 2VHGA 4UUWA 4Z2XA 1QE1A 1URNA 1KH5A 3N28A 4F0KA 4F4ZA 4GVBB 3TZWA 5FD1A 1KP6A 5KFNA 4DPTA 1DBDA 3SV3A 3TARA 1S1WA 3GIMA 1LWEA 1X5OA 3CIMA 1FK9A 1VLYA 3J81j 1VC5A 1SV5B 3HDSA 3V6KA 4IFYA 1YJUA 1VR6A 1UWBA 3IS9B 4PQAA 1B99A 3DYAB 2QC3A 1ELYA 3M1VB 2KJWA 4UORA 4Y3CA 1RT3A 4J9VA 1R0BG 3H5YA 2MQOA 2UXBJ 3HZGA 1JLEB 4USMA 1FTCA 2FC8A 4NLVA 4ZVPB 1FFGB 3UO0A 3GU0A 1RQ0A 1FNMA 5KG7A 2RUGA 3AA8A 5E33A 2QJ3A 4JI7F 4IRKA 1S6PA 1S9EB 3W8PA 3KLEA 3DM2A 5KG5A 3GJSB 3UN2A 1CJTA 1AJBA 3CPWR 4TQRA 2ZE2A 4PRFA 3M8PB 7FD1A 4WFNQ 3G82B 3KWMA 3W7BA 3JSRA 2Z2YB 1IR0A 4JOUA 4G1QB 2YNFA 1TFYA 3MM5A 1TAQA 1QAJA 5CA5A 3W64A 5E0OA 5DLTA 3F56A 4F04B 4HL9A 3RGIA 2ZBQA 1QTNB 3EUNA 5HI7A 1L3VA 3R8YA 3N0VA 3CW2C 3O5TB 1Q1KA 4P9SA 4DFKA 2AJQA 1RDRA 3KUGA 1ALKA 3MM9A 3CWJA 4P2MA 4DL5A 4CLYA 2KN4A 3EPGA 3K7RA 1BQMA 3TA2A 3GCWP 4USHA 5CYMA 4H4KC 3GSIA 2DXEA 1JLBB 1A9NB 4KV8B 1HQ2A 5K14B 3J7Z5 5IT0A 4KAIA 5DG7A 8ATCB 5GOVA 3IWNC 2NUHA 4UF4A 3RB0A 4ICLB 4MK8A 2YXLA 2FUG9 4QCLA 1M90T 3KG1A 3IBCB 4Y2CA 4LRDA 1NK5A 3PFOA 4EFAC 3OLBA 3N6NA 1CJUB 4ITSA 4ZP9A 2K7JA 1F5AA 4K50A 2W5TA 3Q8UA 3DHXA 5J1NA 1LOUA 2ZH2A 2QFJA 1QDUB 1SJ4P 3L09A 3VCDA 5SZTA 2LXUA 4HH0A 1NHVA 3IA0A 2MQQA 4M1KA 5B0CA 4D3HA 3N5FA 2GO9A 1O99A 3SZYA 1U0HA 4JI6J 4WU2A 5KFAA 4W90B 1L3TA 2I2YA 3CTRA 2J7UA 3KHGA 2D1CA 2Y3YA 4ZLPA 4GVLA 5BYRA 1HYSA 3DGVA 3FMWA 2ZDPA 4KFBA 3AY0A 2AEMA 2FJWA 1C2PA 1T03B 2GSUA 4JP8A 3VZHA 3OFFA 3R2CJ 4I56A 2MLYA 3BJYA 2B7CB 3AXKA 3ZZPA 3PIOQ 5JVGQ 2KKHA 3EZ5A 4TN2A 2JEGA 3W5ZA 1VQ6S 1YJRA 3H8YA 2HIQA 1E6VA 3UVJA 4UPHA 2ASJA 1T11A 4RNMA 1P27B 4UOOA 1TP7A 3K57A 2CQPA 1FXDA 1S1XB 1SJ3P 5B0AA 4MYUA 2SXLA 3T5LA 3OTEA 1PIEA 4DR5J 2AYGA 2CQCA 1VQPS 1P49A 2H4YB 2KRBA 2ACMA 4CYUB 3K5OA 1FE0A 2DNYA 3UW1A 4PUOB 4C0HA 3RBZA 2ZVIA 4ZG7A 2RSQA 4YR2A 4URSA 4H4MA 2DNMA 4OI4A 3H2UB 3BKTA 1YRXA 3ILOA 4GKJF 3P4UB 2YQ1A 4EBEA 3A3NB 1N6QB 4ID5A 1HKAA 1EIYB 5L1IA 3QJPA 5CZXA 2PN6A 3TWZA 3N6MA 4E2FB 2C3YA 3K8WA 2G1HA 4LR8A 2VKRA 2Y1LB 4XDCA 3HD1A 4U8YA 4O3NA 4CO2A 3CJ4A 4KGKA 1SL2A 2F8EX 5HLFB 3FSIA 5LL6d 4A4JA 2V2KA 1YRTA 2DNLA 1Y6VA 2PI4A 2YKOA 3OTDA 3MFIA 4EU0A 5A6WA 4IFVB 3VAGA 2NYHA 2G2ZA 4OJHA 4ANEA 4KGZB 4WJBA 1U6FA 1NLKL 2BJ1A 4ZVUB 5HL7Q 4DS4A 5J2NB 2OTJS 4DV1J 4LF9J 3LO3A 3OJUA 3C46A 1XMOJ 2GX8A 3M8QA 1S4EA 4PWDA 2CKWA 2WSFC 5KFUA 3TJAA 1CG2A 2G0JA 2LU2A 3MTJA 4P71A 2Z8QA 2VH7A 3I0RB 2LMIA 3NGRA 3LANA 4DN9A 3HFKA 1F3FA 1YGYA 1JLCA 2QEXS 2RB7A 3MR2A 2LDIA 3NKQA 4ZCLA 1ED8A 1UFWA 1U6ZA 1VRUB 1P1LA 3ZZZA 2X51A 4CXUA 4DV7J 4QOTA 2J76E 2ZOFA 4OZNA 3UNGC 3MR5A 2BJ9A 4JI4F 2XR9A 3IAM9 2NZ4A 2UXDJ 2EC2A 1OWXA 2BJ7A 1EJ7L 2M8HA 4NEZA 4C8NA 2YKPA 1BWEA 4DV0J 2BEFA 4TLQA 5L0EA 1KHWA 2MZRA 3E3XA 1GNKA 2DHAA 2JFDA 3TP2A 2GQCA 1LK5A 3R7BB 2ZUAA 2MLXA 3NGUA 1I94F 3L9ZA 1BLUA 1RYRA 4LSNA 4MFBA 3FCHA 1H7WA 1SI9A 1QSLA 4KGVB 1N56A 2FLLA 1PGZA 4UQGA 1UVMA 4OJGA 3N01A 3TAPA 4M5KA 3CMRA 2MSTA 4CTAA 3IG1B 1EETA 1SJFA 2DNGA 3BKFA 4LFAF 4NXMF 4B9TA 3EZOA 2APOA 4ZPDA 1S7IA 4WXOA 1XMQJ 4XDDA 4F3OA 4DG1B 3WC2A 2KFZA 4QPXA 2CQ3A 3ZNJ1 5DJBA 2ZH4A 2DR9A 1D8ZA 2CNOB 3HVWA 2MXYA 4CT8A 3ISND 2QLFB 3FK4A 1N2LA 2EFGA 4YN3B 4C7QA 2VBYA 4I67A 3DU6A 3SZZA 1PJ7A 4KYZA 3I4HX 4Y2AA 2ZWOA 2K7KA 2WONB 2ZC4A 2UUBJ 3PJXA 2HHHJ 3H2LA 4DCPB 1ALHA 4MIAA 1IBKF 3T41A 3L95X 5B0GA 4KB7A 4NWXA 3TEGA 3VGSA 4FF4A 2KL8A 1KQFB 2UUWA 4QR1A 3PFEA 4Z7YA 3FZBA 3S7RA 2J6SA 1FRKA 5KFOA 2CQGA 4R25A 4B3TF 4OI6A 5M2UA 2OO4A 3EXYA 3DLHA 3VAIA 3MEDB 2DEJA 3C2PA 1NO8A 3AXMA 4QIGA 1LXNA 2N3OA 1S49A 1CQNA 5LSLA 3MMCA 4MKVA 4L73A 2W2PP 3BGLA 2K06A 3EZUA 3M8YA 1SL1A 2ZEJA 5KFCA 3JB9k 3T5JA 1F9FA 2V8VA 4NLGA 1VFJA 4N5SA 1IKWB 2YNFB 5HROA 4DX5A 5HJXA 5IM0A 1F9HA 1EKRA 2CA9A 1CBKA 2CNLB 3M05A 4QYZJ 4ZS6A 4ILMA 3QJLA 3NMAA 2NXNA 3CD0A 2GHVC 2MPUA 3I4PA 2ILYA 3KJNB 2VG6B 4J9LA 4J9KA 3GJTB 1UJ5A 3MCMA 1GXLA 5L46A 1VQ4S 4BDPA 5J2MA 4KH1B 1XBWA 3K89A 3D5MA 3NKMA 5KFVA 3AJ2A 2PD1A 4EBCA 4U7UD 3KK2A 1HNZF 3KMQA 1UWAA 1UEVA 4LRBA 4RL1A 2OGUA 3MM8B 1BQMB 2L9NA 1FJGF 1F9EB 5GMKa 1U49A 1TKZB 3JQJA 2EWHA 4B08A 1J5EF 4RJVA 3U02A 4DSEA 2M8DB 1E6YB 4OYOA 3IP0A 2HWTA 2X98A 2FGOA 2IFXA 3DXBA 4IOAQ 2G2YA 3SMZA 5F0UA 1F5CA 4PKDB 2FJDB 4JYAJ 1C4AA 3G6VA 1GT8A 3QJJA 4C8KA 4OZ0A 2OPSB 2UXCJ 4RUHA 1ULRA 3PR4A 1NJWA 2XSJB 2NXJA 5E3AA 3NVLA 2Y0BB 4KJDA 3POTA 3M2UB 1X4BA 4ZVOB 1KVIA 4DQQA 1UKUA 1IBCB 4XAKA 4KFBB 1UAWA 2EC0A 2M2BA 4C6AA 2KRRA 3MEEA 1PJ5A 1PSDA 1FWPA 3T6BA 3CXCR 2GMHA 2M0GB 1NSPA 4MJKA 4ZJLA 2D69A 4FYDA 4ZN1A 3TX8A 3H4DA 3TANA 3FQKA 3UVJB 3OT9A 5ETKA 2EFOA 3EVWA 3IC1A 3UDVA 1H2VZ 1QUVA 1HBOA 1MG7A 2DGXA 1SPBP 1FNOA 3A3PB 4K8RA 5HO4A 5EWEA 3Q2SC 3NS6A 1K1SA 1UEUA 2ZH6A 2YNGB 4RW9A 1FXRA 2CNNB 2DH9A 4UOHA 3NCRA 2F1FA 1IKYB 4X4NA 1T9VA 3EYZA 1VRQC 3R6LB 5B7WA 3KK3A 3DLEB 4L3KA 3X3UA 6FD1A 5K8NA 2DNNA 5ETNA 5L1LA 3U7JA 2AGPA 2C2KB 2E5LF 1QAYA 2HPUA 3D3CJ 2F4VF 1G7CB 1RTJA 2HHTA 3Q8RB 4ID5B 5LQQA 1QAIA 2R7VA 4K0KF 4DX6A 1OY6A 1UFLA 4QPTA 4OQJA 2N3LA 2E9TA 4EWTA 4IQMA 4X66J 1TL3A 3BSCA 1C1BB 5DLGA 1NJIT 4G1IA 2ZH1A 4CXSA 4V1Ak 1NH7A 4G6VB 2H1YA 2BACA 1SC4B 2VBXA 4NLQA 1RYSA 2H48B 4JI3J 3KLIB 4M5HA 4BS2A 5LMNJ 4LT6A 4DQIA 4P75A 2G9OA 3PV8A 5F8HA 2VF3A 1F60B 5KOXA 5KFWA 2FZKB 2BOPA 4LF6J 1CC7A 2D7SA 2ASDA 2VZ9A 3ULHA 1S1VB 4FDIA 4DV3J 4AL6A 1SIWB 1X31C 3MF5A 4DF8A 4V19J 2VG5A 1C0UB 3KLVA 4GC6A 5D3GB 4EUVA 3H20A 4B3SJ 1ELZA 5HATA 2CUYA 4B9UA 4MMOA 1RWMB 1R6YA 3DDKA 2MB0B 2V63A 3NKPA 4UY85 4PWDB 1KHVA 1N5QA 2OHDA 2DIUA 2YKMA 4ZVSB 2R2SA 1F0XA 1AJDA 1SL0A 3EICA 4F4YA 3FRZA 1PYSB 2KFNA 3I56S 2R8KA 2X1AA 3RZAA 3NNCA 2WSEC 4IYQA 5L1JA 2YWFA 1TQLA 2W5XA 2HHSA 4GO5X 2J5AA 5IJQA 3NP5A 1FX2A 4KE5A 2XG8A 1VIOA 2XULA 2LQ9A 2RQKA 4OI1A 1JXLA 2H3EB 1IWGA 5I42B 1W25A 3LP0B 2HHVA 2VQFJ 3CDEA 1S76D 1M1GA 4BC9A 4DL7A 2FYXA 4V19X 2ZHBA 1VQMS 4K4VA 3EVOA 4ZP8A 1SHQA 1D1UA 1T05B 2O66A 3CC7S 2OPRA 3DOMB 1FEHA 4TKTA 1Y5LB 3QRQA 3RAXA 1RHKB 4X4OA 3CJSA 3QBCA 3Q8VA 4ZG9A 1PYOB 4USIA 2D74B 3QT7A 1ELXA 2O5DA 4ZJQA 3GIIA 1ZPWX 3NGTA 4ED0A 5A8WB 2L3MA 3FEYB 3BR8A 3W62A 3QWUA 4IH5A 2CQ1A 4JI0J 1RZMA 1FKOB 1DAXA 1S6QB 1VRTA 3PEJA 1MNEA 3RBEA 3ZZRA 4ELUA 1APSA 4ZLJA 4U8VA 3FQLA 1HBNA 4TVAB 4JI1J 3QO9B 1QTMA 2P9EA 3FFIA 4CTAB 3A1YG 3GONA 4YQWA 4ED7A 1HMVA 1IQTA 4ILLA 4KT0C 2RVJA 3W2VA 4WP9A 2W9CA 3OL9A 3OR2A 1UVKA 1ZTWA 2VFRA 1U24A 2B7BB 1EP4A 1U2CA 2AJFE 3W9IA 1YQHA 1U0SA 1OY8A 5IFMA 2A18A 3IGYB 4ID8A 5THWA 3RU0A 1FRIA 1V3ZA 1P8GA 4ECRA 3VAJA 2XO7A 2J9DA 2OI2A 1Q86T 4USUA 4XPEA 4J5OA 3CD6S 5L0BA 4ZHRB 4LF7J 4AL5A 1LNQA 2P9GA 4F36A 3HPOA 1HBMA 3HHLD 3M6UA 2O3DA 4WFBQ 4KPYA 3R5CA 5LM7E 1RA7A 4UZCA 4U96A 1OJ4A 4LVOP 4J9OA 2E5HA 3CJKA 4FDJA 5GRRA 1CC8A 4K2XA 3R5DA 4ZMMA 2J9EA 3J7YU 4UOGA 5C42B 2HFSA 5F9LA 3GIKA 2JWNA 1VGYA 2YWGA 3TAMB 3GSDA 2B56A 1OO0B 3HMJG 1VQ7S 2YWKA 3IR7B 1PBAA 2GAGC 4UOPA 4QJVA 1LWXA 1ZBTA 5IT4A 4KHPF 3BO4A 4WK3A 4NXNF 2RAQA 4DWIA 5HROB 3PY8A 1XR6A 3NG8A 2HHWA 1FD8A 4NYOA 4CM0A 5D15A 5JXSA 4CLFA 2YX7A 3ZZ0A 3DRRA 1EW8A 2VFVA 2E5IA 4B17A 1DURA 2IY5B 2BE7D 5KT5A 1DTTA 3MMBA 4WFAQ 5J2MB 1Q82T 3ET6B 4WZQA 3HJVA 5BR8J 2W4CA 2PDAA 1FX4A 4CNZA 4QQBA 4WFXA 3VGVA 5T7LB 3AB4B 4OZ2A 4LIWA 4WYLA 2VOPA 1RLDA 2ZH8A 2FHKA 3Q8YA 4FPIA 3NOCA 3IWLA 1B70B 1IN0A 3AQPA 4ZK7M 1J27A 5AJ3F 1U1OA 1PAUB 1PC4A 3UN5A 1WUUA 3D28A 3US5A 4ED6A 1DZ5A 1ZAVA 3QYYA 2I6WA 3T1YJ 4NL5A 3D66A 3NGSA 1N34J 1RAAB 2UUAJ 2QN6B 5D0RA 5A0YB 1EX8A 2BQ3A 1GH8A 3O2IA 4UPKA 3RW7A 4ELVA 2MSSA 1MMDA 2I8EA 3CJ3A 4CH7A 2CWKA 5F8GA 1IVZA 2KZMA 3K8VA 3AH6A 2R8JA 2GO8A 2DITA 4NOHA 2ZBIA 5I3QA 1GMUA 1XMQF 3ETMA 4GC7A 1S0OA 4OI3A 4ZVHA 1WOSA 3NKRA 1HQEB 3CJRA 3VGUA 3L3CA 2YKNB 3NKYA 2AKWB 4X4TA 3MEEB 5K5MA 1VC6A 3MCSA 1S57A 1SBRA 2CPXA 3D0HE 1YLXA 2BM1A 4CRJA 1T9WA 2FLNA 3KJVB 2KHDA 4NZ6A 4RW8A 4G1PA 2VPWB 3MM6A 4LFBJ 2V2ZA 3RTVA 4BWJA 1QUPA 1E2SP 2E44A 3JSMB 3HVTB 2V5HG 2WTFA 3AFGA 2IJFA 4WIIA 4WE1A 4KJIA 3RJMB 3LOUA 1ITPA 4Z37A 3H0PA 1FD2A 3KLHA 1GTEA 2VFUA 1BMQB 2CQ0A 2HHQA 3KK3B 4YB5A 1KVJA 4ETXA 5C25B 1RT5B 4L74A 4FXVA 3SEOA 2VODA 1F6TA 2WRMA 1VOMA 1S99A 4JUZA 3KK1A 3FBCA 4C97A 4B3MF 3NNAA 4OHZA 1HR0J 3BBCA 1FNXH 4P74A 1ZA1B 3U1MA 4M5JA 3J7ZT 5U47A 2HQCA 1TL3B 2IFYA 1B4SA 2JVRA 3JSYA 5IT9Y 1ALIA 4FNIA 3P96A 2OD6A 3L4BC 3C16A 2GAHC 4RU9A 3M6WA 4WPAA 3V4MA 4IOBA 4DR6J 2OAUA 3P3DA 1VC0A 5HP1A 2GJFA 1WEYA 4IOCQ 4OHWA 3H40A 4R5PA 4WWSA 2HBRB 2EBEA 4DL4A 1RAIB 3IRWP 4HTIA 3BH6B 1T9XA 2QFIA 1RWWB 2W9BB 4N41A 1FO1A 3SQGB 4YDXA 4JV2A 4Y6IA 4O44B 3GG0A 1WDDA 2MYFA 2GLQA 4PG4A 1FVSA 2AIRB 1YJWS 3OFGA 3KMSA 4DUZF 2GMJA 4NYPA 4RNOA 3UCUP 1F1BB 2RS8A 1C4CA 1HHSA 2XTJP 3CDBA 4CLWA 5H1SV 3DRPA 4LIRA 2C3PA 4Q43A 2F65A 1ZH5A 1KQGB 2JSXA 5ETQA 2WVFA 3MWBA 3IRXA 1X4FA 1EKSA 2AZ3A 1JLQB 4EO8A 1KHLA 2WB4A 3D4JA 1OQ3A 1U45A 3MFHA 2ZNZA 5D0HA 4QWCA 1R89A 3UCGA 2KO1A 4TXSA 5H9EJ 4CLPA 1NNDA 3MAAB 4NRTA 1RCXB 4K5SA 4BHQA 4ALZA 3ISNC 4U9RA 4ECWA 4LREA 1AJCA 2XYPB 2F63A 4ED5A 2IJNA 3JTNA 4ILRA 3M2VA 2C2ZB 3RB6A 2BW7A 2RQMA 1YZ6A 2EEYA 2PMHA 1RHMB 3WZ0A 2OMOA 2VASA 1SJQA 5K9FA 3C6UA 3G86A 4DXLA 1KHKA 1ZA2B 1RT7A 4ECTA 2BX6A 3N5BA 4GO7X 2VA3A 4FYYB 2EFVA 3OLAA 5LT5A 2XCAA 2W01A 3PIPQ 1RTIA 1X7VA 1AXQA 2HHPA 4LBIA 3RAMA 1HNWJ 5HVGA 2VJVA 2ATLA 2XS7A 3G71S 2V4RA 3D0IE 3TI0A 3DLBA 1UA0A 1VQSA 1BWVA 2XI2A 4OX9F 2AJ2A 1Q95G 2PGCA 4K4XA 3PHEA 1FCAA 4JV1A 3NL0A 2P9CA 1H3DA 1FVQA 1J5OB 3C6TB 2HMIA 2Z0GA 3BN7A 5HMWA 3I0SB 1N32J 3DDNA 3CCVS 5J1EB 4AQYF 4ED3A 1TUVA 4HACA 2ZM6F 1WG1A 3QT5A 2ZH7A 4C9DA 1MROB 1YZ7A 3K5NA 4LQYA 4R8UA 5AE2A 2OUGA 1ZZNA 3DMJB 1IXKA 2V2VA 3PCOB 3CO0P 1RT1A 2CJ9A 1S9GA 1OYEA 4CT9A 2JC1A 1N54B 2WK4A 4JI2F 4PAAA 1M1KT 2DR7A 5CYQA 4J9UE 3P6YC 3SDEB 4DS5A 1R8CA 1T9YA 2ROPA 1DQAA 1L3KA 2CIMA 3GYXB 5AXLA 3OSNA 3DI6A 3J81Y 2AJ1A 3UR0A 2B4VA 4UPLA 4USWA 3K5LA 2OH2A 1D09B 1R6VA 4EI2A 3OL7A 2C2RA 3OTOJ 1KR4A 2E7WA 3HK2A 5D0GA 2Q3PA 1IBLJ 4NLXA 4DZ6A 4CLTA 2B9YA 3VQSA 5KG1A 2WOMB 3KLGA 2B6AB 3T9ZA 2ZJRQ 2WBRA 5J2QA 4OX6A 3BGOP 1A6LA 1HNIB 4DJBA 1Q8BA 2R8IA 3T1HF 2ZD1A 1PYTA 3UI3A 4C8LA 2MKSA 2HVZA 4FBTA 2VU5A 2XZDB 5E5NA 3AOCA 4FF3A 5EWFA 3DHWC 2AWZA 1GAOA 4QBUA 2XNRA 5DM6Q 1H38A 2IVFB 3IN5A 3MCOA 3BGFA 2D3UA 1LKZA 3I5CA 1FXLA 1SHNA 3H42A 3B6BA 3N9UC 2FVCA 4JV5J 4KBIA 3NWRA 5A76A 3V81A 2W1BA 3HHLB 3BSAA 1EW9A 4ZG6A 1RSCA 1ZAXA 1FEEA 3LP1B 2DNRA 2DGQA 3JS9A 2WBMA 1DHMA 1GX6A 2HNYA 1K1QA 4K5RA 2JVOA 3Q0AA 1NJZA 2W4PA 3KUHA 9ATCB 3KDOA 1M5HA 2CQIA 2FZGB 4FXDA 3FCWA 1VQ9S 5DQHA 1PG5B 2ZITA 5BYQA 3D0GE 5KXAA 2LLZA 2LQJA 4JI5F 2R7QA 1FI4A 1DJ0A 1Y7AA 2RD5C 3VAKA 5FIIA 3M7VA 2ZUGA 1AFJA 1TKTB 1RTHB 3AA9A 2DGVA 4LMZA 2R8HA 3DLJA 4USJC 1KD1T 2J9CA 1XK8A 2H9ZA 2M4MA 2BANB 2LDYA 3BYRA 1W7WA 4K4YA 3F41A 2ILZA 3UQSA 1HWKA 1K44A 4NI2A 4NA1A 1WTBA 4WXWA 3NOGA 1FTRA 3KHLA 3DN9A 5DRKA 2DH8A 3W1YC 2XHWA 1TTHB 4C48A 1R0AA 1RT4B 2YNIA 2IHR1 8AT1B 1NBEB 5K8PA 5KG4A 2IBOA 2ZOMA 1TL4A 4DL3A 1NEEA 2JC0A 2XLJA 1BQXA 1IKXB 1WF1A 3LTOA 3PRVA 5IC4B 3E2EA 4KJGA 3OR1B 2FY1A 1LV5A 3X1LB 3E01B 4DUTA 2B9WA 3MM6B 4CO1A 3C15A 2QZUA 2D3OR 4LF5F 5HMXA 3MM7A 4DR2J 2PEBA 5KFRA 2CJKA 2ZKUA 4E98A 3BGUA 2J7KA 1AYEA 2QSWA 3PJ9A 3EE3A 1YG0A 3GYGA 3CD7A 2MQLA 5E3QA 1RHRB 2DK2A 3B54A 3M6XA 4XK8C 3WX4A 3GIJA 4QYRA 2XY6A 4A8WA 4L75A 1OPIA 3OTCA 2RQCA 3GB0A 1H7XA 1TV6A 1TVRA 2HLUA 3GYNA 1Q5YA 3CUNA 3FEXB 2YY3A 2R8GA 1K0VA 3B78A 3AT1B 3UCZP 1VBZA 3I82A 3OVSA 1QD1A 4RNNA 2QRRA 2DNPA 1OY9A 1UJ4A 2AW0A 5HJYA 1BGXT 2EPIA 1DLOB 1MW7A 1ICEB 4H54A 5IQ6A 4OHXA 2J0XA 2YPYA 3MCNA 3T00A 2RIJA 3C16B 4OYPA 5HVFA 4M8LA 3KYLA 1WEXA 2OEKA 3PDNA 2PMZD 4EEYA 4IG0B 3LAMA 1WKLA 2HK3A 1TL1A 2DGWA 3CULA 2A6MA 1W2IA 3WAYA 3D3BJ 1JLGA 3KLFB 1S4FA 5GAHI 1JXVA 3MMJA 3R27A 2W5VA 3KOAA 1O51A 4L76A 1UZDA 4IDKA 3MK0A 5EX0A 4DN0A 2QA4G 3KTQA 1UP1A 3WBHA 1DQ8A 1EZZB 3MR3A 1OSDA 2Z2LA 5HANA 5TJ3A 2KJVA 3LGHA 1WHYA 5IJSA 4YB1P 2HQ3A 2Q1LA 3M2RA 4W4MA 1HHTP 3KG4A 4KGMA 2IUCB 5IWAJ 1MWYA 1AUKA 1LXJA 3LH2S 2XRGA 4C8OA 2B9EA 3BKUA 2XSFA 2GVDB 4O0NA 4DV4F 2QTWA 4RKUC 1KLMA 4KAVA 2V50A 1CULB 3WIVA 1FJ7A 3P8BB 4IG3B 3M9NB 3NKOA 2OPPB 3LW5C 5GMDA 1YJVA 1H73A 5E2QA 3D2WA 5L9NA 1Q8IA 3G8SA 3PW7A 2GMLA 2V0NA 2FHJD 1HQUA 1ZETA 3D6MB 2CZ9A 4X4QA 2Y8YA 5E3PA 1DARA 3PX6A 3MR6A 1TAUA 5DLVA 2M70A 3BZQA 1ALJA 5DS7A 4O23A 1GQEA 4AL7A 3LPEA 2HVEA 3C6UB 4DUYJ 3QFWA 3HHLC 2I5JA 4PCQA 2HNDB 1HD0A 3OTBA 5T14A 4J7CA 3I55S 4J9SA 3PVXA 2HZCA 1RTIB 5L9XA 2ZH5A 3DLKA 1M1HA 2FLPA 3QNWB 2F7VA 1W26A 2V4QA 1FRLA 4X65J 2UU9F 4LFCJ 5JJBA 4EYIB 4HI2A 5HQ8A 4GKKJ 3QAUA 3KHHA 3SCKE 2NYIA 3PG9A 4A47A 1N5YB 2R7RA 2E7XA 4ZVEA 3CMQA 2V8GA 4DR4J 3HSDA 1TMMA 1GMWA 3MEGB 5FDLB 2QLBB 4L6V3 1HPZA 4DV5F 1Y3JA 2VQEF 5HQMA 1HL6A 4CYSA 2EKNA 2W2OP 1HNXJ 4M63A 4FZVA 4LSLB 3KJFB 4WTYA 4O0IA 2W2MP 4UY8T 4DLGA 1YITS 4RR5A 1R3NA 2VD3A 1JLAA 1RABB 3JYTA 4YY3J 3CCLS 2VV5A 3C8YA 3BREA 2BBEA 3VAFA 3CO9A 2YTCA 2MQNA 1KTVA 2OPQB 2RF2A 2YVSA 4FP9A 2B8PA 1FDBA 3QGPA 2X1BA 2OP5A 2VG7B 1EB0A 4I2PB 4F4KA 3BPSP 1NDCA 3MMAB 1A0OB 3UDCA 4X64F 2ASLA 5IC6B 2VJUA 1ZZFA 3AOBA 1N0UA 4WYWA 5LSRA 2A2CA 3MHYA 1YRUA 1WC1A 1X5PA 2J7WA 4X4RA 4CLZA 2IA0A 4DX8H 1WOPA 4HEA9 1K73T 3ZZTA 5G0RB 1UFKA 3G8TA 4DLEA 3CJQA 3MURP 1NK8A 2HBQB 5J2QB 5DGBA 2BUNA 3CJ5A 3TUJC 2VDIA 2NLWA 1FRXA 1T0TV 2ZD1B 2L41A 2KDOA 1HBUA 4BWMA 4ZP6A 4DR3F 4CO5A 2OFGX 5IV3A 1XEZA 2E5JA 3PO4A 1IKVB 2G2OA 3VR1A 1D9DA 3R97A 3JAMU 5KFEA 1IBMF 3BPDA 4MTPA 3VHQA 2UV8A 3DGPA 4YS2A 4ZLNA 3M30B 1UVNA 2LEAA 3WC0A 5KFQA 5KG3A 5KFTA 5ETLA 6AT1B 2H51B 3D6HB 3HHNB 4I2QA 3LWLA 5K8OA 3TX0A 3D67A 1M0SA 3I6PA 3ENQA 1BQNB 3AD7C 3OJSA 4CO0A 4CLLA 1URAA 5GAEI 1NZAA 1JKHA 3EXCX 2DRAA 2MHNA 1ZAWA 4FVMA 1UL3A 4NRUA 4CLSA 2F8HA 3DPCA 4MAKA 4F0MA 1H98A 3S01A 3A12A 3EWGA 3OFHA 2R9LA 2VFSA 3OW2R 1Q8KA 5RUBA 2H5IB 2V9WA 3OXLA 4OZJA 3VQTA 3CF5Q 2BE2B 1CJKA 3V6DA 3Q8PB 3DRSB 2FC9A 2YNHA 1HA1A 2KZZA 4MIBA 1SIZA 3RAQA 3T6JA 1X9WA 1ROFA 3WAVA 2YBVA 3IM8A 5DGAA 3G8QA 1NK7A 4JI8F 3CE8A 5GADI 2HRTA 1KC8T 1KS2A 4NI2B 5KFKA 3MPDA 3A4TA 3QIPA 4DI6A 1R0AB 2QYGA 2BJ3A 3I5AA 1XMBA 3W2WB 3D9BA 1D0EA 2UUTA 4N76A 4ZVFA 3THTA 4DFJA 3RRGA 1JMTA 2UUCJ 3OQ2A 1IQZA 2GIQA 3VGTA 3GG1A 2MKHA 1P9YA 5ETRA 1Q5VA 1BC6A 3EGWB 1A7GE 4DSIA 4DFMA 2HRYA 4R0EA 2XGQA 4FYWB 1LFPA 1FKPA 4X4SA 1CJVA 1S6UA 4DR1F 4LBHA 3WDOA 1DFDA 2M88A 1XNQF 3WAWA 2J8AA 5JUMA 3PHTA 2GVZB 2YQ0A 2KVIA 1TVRB 2HNZB 1KLNA 1RE1B 3J80U 5GAGU 1DY3A 3DLGA 1XNRJ 4CI0B 2W5QA 1T7PA 1S48A 4QYZK 1U2RA 5C24B 2CRLA 1V3SA 3L7PA 2HZAA 4ZPBA 2DGOA 2R2UA 3OUYB 3D1QA 3MDFA 2XMTA 5DETA 1LW2B 3Q89A 3DRXA 3NBPB 1TKXA 4YHHJ 4HH1A 4M5IA 4M95A 2RKIA 3RBXA 2WAQD 1LWFA 1FFWB 2OMLA 2F3JA 1S0VA 4XPCA 2W8DA 4ECYA 1VJQA 4AFFA 2ATCB 1T3NA 1X9SA 4JV5F 1ZM9A
chains in the Genus database with same CATH topology
1KHKA 3UNYA 3CMRA 4LQYA 1ED8A 3M8WA 5GOVA 1AJAA 3NKRA 1ED9A 4MHXA 2VQRA 5TJ3A 1AJDA 4UPHA 1HJKA 4CYRA 5IJSA 5GRRA 4FDJA 2GSOA 1ZEFA 1KH5A 4LRCA 4GTXA 4GTWA 4CXUA 5LRNA 3Q3QA 4N7TA 1E3CP 3UN3A 5C66A 3WAWA 4UOOA 4CXSA 2IUCB 4LRDA 3OT9A 2XR9A 5K4PA 4LRAA 3M8YA 3MK1A 3UN5A 3T02A 2W5XA 4LR7A 1K7HA 1KHLA 5EGHA 2X98A 1SHNA 2IUCA 3IDDA 2W5TA 4GTYA 1E1ZP 1Y6VA 5IJQA 2IFYA 1AUKA 5DLWA 4B56A 3WAVA 3IGZB 1ALIA 2ZKTA 3BDGA 2XRGA 2GA3A 1ANIA 5DLTA 1P49A 4UPLA 5HRTA 1N2LA 4ZGAA 3BDHA 3DYCA 1EW9A 4ZG6A 2ANHA 2W5QA 5LRMA 4LR9A 1EJJA 1O99A 4KAYA 3SZYA 5EGEA 4UOPA 3SZZA 4KAVA 5L0KA 3TG0A 3BDGB 3ED4A 4ZG7A 3BDFA 4LRFA 3MK2A 5AJ9A 1ELYA 3NKNA 3T00A 3TX0A 1SHQA 1B8JA 1EW2A 4GTZA 1HDHA 4UORA 3IGYB 4FDIA 5L0EA 4KJGA 1E2SP 1ALHA 1URBA 4QAXA 4LREA 4UPKA 1URAA 4MIVA 1AJCA 3NKOA 4MY4A 4NWJA 1O98A 1ALKA 2QZUA 4KM4A 4ZG9A 2W5SA 1KH7A 3KD8A 5LIAA 2GSNA 3NVLA 3DPCA 2G9YA 4KJDA 4NWXA 1ELZA 1ZEBA 1EW8A 1KH9A 1FSUA 3WAYA 2W5WA 1HQAA 1ELXA 4LR2A 2GSUA 3UO0A 5KXAA 5L0BA 3A52A 2W5VA 2W8SA 1KHJA 1ANJA 3NKMA 1EQJA 1KHNA 2GLQA 3NKPA 3M8ZA 3T01A 3MK0A 1EI6A 3TWZA 4UPIA 1Y7AA 5INHA 2D1GA 3WAXA 4YR1A 2W8DA 2W5RA 4TN0A 4CXKA 1ZEDA 1KH4A 4LR8A 3LXQA 3B5QA 5DLVA 3M7VA 1E33P 4LRBA 5LQQA 3E2DA 1ALJA 2RH6A 3UN2A 4CYSA 3WBHA 1AJBA 1N2KA 3NKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHK A;  3UNY A;  3CMR A;  4LQY A;  1ED8 A;  3M8W A;  5GOV A;  1AJA A;  3NKR A;  1ED9 A;  4MHX A;  2VQR A;  5TJ3 A;  1AJD A;  4UPH A;  1HJK A;  4CYR A;  5IJS A;  5GRR A;  4FDJ A;  2GSO A;  1ZEF A;  1KH5 A;  4LRC A;  4GTX A;  4GTW A;  4CXU A;  5LRN A;  3Q3Q A;  4N7T A;  1E3C P;  3UN3 A;  5C66 A;  3WAW A;  4UOO A;  4CXS A;  2IUC B;  4LRD A;  3OT9 A;  2XR9 A;  5K4P A;  4LRA A;  3M8Y A;  3MK1 A;  3UN5 A;  3T02 A;  2W5X A;  4LR7 A;  1K7H A;  1KHL A;  5EGH A;  2X98 A;  1SHN A;  2IUC A;  3IDD A;  2W5T A;  4GTY A;  1E1Z P;  1Y6V A;  5IJQ A;  2IFY A;  1AUK A;  5DLW A;  4B56 A;  3WAV A;  3IGZ B;  1ALI A;  2ZKT A;  3BDG A;  2XRG A;  2GA3 A;  1ANI A;  5DLT A;  1P49 A;  4UPL A;  5HRT A;  1N2L A;  4ZGA A;  3BDH A;  3DYC A;  1EW9 A;  4ZG6 A;  2ANH A;  2W5Q A;  5LRM A;  4LR9 A;  1EJJ A;  1O99 A;  4KAY A;  3SZY A;  5EGE A;  4UOP A;  3SZZ A;  4KAV A;  5L0K A;  3TG0 A;  3BDG B;  3ED4 A;  4ZG7 A;  3BDF A;  4LRF A;  3MK2 A;  5AJ9 A;  1ELY A;  3NKN A;  3T00 A;  3TX0 A;  1SHQ A;  1B8J A;  1EW2 A;  4GTZ A;  1HDH A;  4UOR A;  3IGY B;  4FDI A;  5L0E A;  4KJG A;  1E2S P;  1ALH A;  1URB A;  4QAX A;  4LRE A;  4UPK A;  1URA A;  4MIV A;  1AJC A;  3NKO A;  4MY4 A;  4NWJ A;  1O98 A;  1ALK A;  2QZU A;  4KM4 A;  4ZG9 A;  2W5S A;  1KH7 A;  3KD8 A;  5LIA A;  2GSN A;  3NVL A;  3DPC A;  2G9Y A;  4KJD A;  4NWX A;  1ELZ A;  1ZEB A;  1EW8 A;  1KH9 A;  1FSU A;  3WAY A;  2W5W A;  1HQA A;  1ELX A;  4LR2 A;  2GSU A;  3UO0 A;  5KXA A;  5L0B A;  3A52 A;  2W5V A;  2W8S A;  1KHJ A;  1ANJ A;  3NKM A;  1EQJ A;  1KHN A;  2GLQ A;  3NKP A;  3M8Z A;  3T01 A;  3MK0 A;  1EI6 A;  3TWZ A;  4UPI A;  1Y7A A;  5INH A;  2D1G A;  3WAX A;  4YR1 A;  2W8D A;  2W5R A;  4TN0 A;  4CXK A;  1ZED A;  1KH4 A;  4LR8 A;  3LXQ A;  3B5Q A;  5DLV A;  3M7V A;  1E33 P;  4LRB A;  5LQQ A;  3E2D A;  1ALJ A;  2RH6 A;  3UN2 A;  4CYS A;  3WBH A;  1AJB A;  1N2K A;  3NKQ A; 
#chains in the Genus database with same CATH topology
 2BMB A;  3GQC A;  4IDK B;  1SKU B;  4O4G B;  4PG7 A;  4O3O A;  5A2Q Y;  4PQU B;  4RPF A;  4FYV B;  5D0E A;  2V4J B;  1RJJ A;  2DNQ A;  2B5J B;  3M9M B;  3SFG A;  4H4K A;  4DL0 C;  5KG0 A;  3M32 B;  3W66 A;  2ZHO A;  2XGP A;  2IPO B;  5CCM A;  2DRB A;  2RJZ A;  4O3Q A;  3CJ2 A;  3QZ7 A;  4LUB A;  2Y9H A;  2QIF A;  1RT6 A;  4WKR A;  4DV6 F;  2VC1 A;  4M5G A;  2Y8W A;  1S1U A;  1NRK A;  4Q8E A;  2DKO B;  4JI7 J;  3HFZ B;  2ALZ A;  1KLM B;  4F4A A;  2PT0 A;  3SI8 A;  1ACM B;  1NME B;  4J37 A;  1SUQ B;  2K8G A;  3PAC A;  2OEL A;  1WSV A;  3FKB A;  1C0T A;  4J9Q A;  1RWK B;  1RWP B;  5D4N A;  3QLH B;  2DCU B;  2V8H A;  4P52 A;  3ITH B;  3H5S A;  1TL7 A;  1WI8 A;  4RW4 B;  3QAT A;  2RNE A;  1M5K C;  1SH2 A;  3UNY A;  4K2J A;  1YWX A;  3LP2 A;  2CYY A;  2KYX A;  1FDD A;  3HP6 A;  2W2N P;  2XWX A;  4C11 B;  2CJB A;  1VQ8 S;  3HHK A;  2XLI A;  1AZS B;  4ED8 A;  1R0C B;  2DD8 S;  5D4P A;  3SIP B;  1DTQ A;  2DR5 A;  4HI1 A;  2C1E B;  1JLF A;  5A8R A;  3IR5 B;  4WCE Q;  5E41 A;  2AT1 B;  1MU2 A;  3EDR B;  5H9F J;  3PW0 A;  1CLF A;  3H4B A;  3ED4 A;  3CCQ S;  1RTD B;  1LWC B;  1MN9 A;  1SH3 A;  3BB5 A;  3DLK B;  1N36 F;  3D6F B;  1KFD A;  4K4S A;  1QJH A;  2DO4 A;  2P8I A;  2ZZM A;  2CPH A;  2XC9 A;  2KT2 A;  4C0B A;  2OD4 A;  5KTQ A;  2GCF A;  5I3U A;  4P6Q A;  3TYT A;  4FXW A;  1GEH A;  1X60 A;  1FDN A;  2OEJ A;  3HUL A;  1N5T A;  4X62 F;  1EAR A;  5CQG A;  2B3T B;  2K3K A;  2MJN A;  3R5G A;  2EK1 A;  3PNI A;  4GTW A;  2HGN A;  2NXU A;  2ZWP A;  1REG X;  4B3O B;  3S1T A;  1LW0 B;  3BO3 A;  2AD9 A;  4WKY A;  3PZP A;  2JEI A;  3MK1 A;  4GVB A;  3AJ1 A;  4LR7 A;  1YTY A;  3HVA A;  2X1F A;  1C1C B;  1YSJ A;  2NSB A;  1Q0N A;  4TU7 A;  3IBF B;  1WC0 A;  2O01 C;  5IXU A;  5GME A;  5LRM A;  5L1K A;  5EGE A;  3DLL Q;  2RU9 A;  1SV5 A;  3IXQ A;  3PKY A;  2W8L A;  3IS9 A;  5IS2 A;  4YEA A;  2FVS A;  1SXL A;  4P7T A;  4Y2M A;  2RF2 B;  1V9O A;  4B9V A;  3M1V A;  4ZCI A;  2HBZ B;  2XLK A;  2K2P A;  2RDI A;  1NB2 A;  3FBF A;  1O0P A;  2VKZ G;  1JX4 A;  2GQ2 A;  1KHN A;  2A6O A;  2W5R A;  2LA6 A;  2E1C A;  5AXN A;  2H65 B;  4OMF G;  2VA2 A;  1S9E A;  4MKY A;  3Q2T C;  1AB8 A;  3BYP A;  4UZB A;  2R7W A;  3M8P A;  4TU9 A;  4IUF A;  3WBZ A;  1X4E A;  4RLE A;  3DOL B;  4G1Q A;  4DR7 F;  4OYI A;  1ZM2 A;  3SZ2 A;  4GKJ J;  2PE8 A;  3PR5 B;  5KT2 A;  1WF2 A;  1NHK L;  3ENW A;  4PWU A;  3VF0 B;  1Y7P A;  4LJM A;  2HFZ A;  2IAJ B;  3TJ9 A;  2ASY A;  5LXY A;  2BQR A;  4UQT A;  3CSK A;  4FF2 A;  2MKK A;  4P10 A;  3TRG A;  3W63 A;  1WHW A;  2KG0 A;  3LAL A;  2MQM A;  5KFX A;  3R9L A;  3T3F A;  2BAB A;  1HNV B;  2HQG A;  2Q79 A;  2NZC A;  1VCT A;  2JEJ A;  4DUY F;  5LMU J;  4PXB A;  5GAE U;  1BY9 A;  2I9S A;  2ZDO A;  2G1D A;  3QRR A;  3FBE A;  3ZC4 A;  2CDQ A;  5EN1 A;  4RWW A;  4CXK A;  1VBK A;  1OQ6 A;  1JJH A;  2FHM A;  4ZPW R;  2XZW A;  1RWV B;  1JLB A;  4KV8 A;  3ETO A;  1QE1 B;  1B7Y B;  1NK4 A;  2ZH3 A;  5K14 A;  1IM6 A;  2QLW A;  3MPU B;  1KKH A;  2FJX A;  4K4U A;  1LFW A;  2VC0 A;  5C66 A;  3BBF A;  4ICL A;  2R2T A;  1S1W B;  2C28 A;  1LWE B;  4ZLL A;  1FK9 B;  3CC4 S;  1RAJ A;  2HIY A;  4IFY B;  4EO6 A;  4B3R F;  1UWB B;  4I64 A;  2KG1 A;  4UW2 A;  2LQ8 A;  1NHU A;  1UZH A;  1RU2 A;  4HT7 A;  3GTY X;  1RKJ A;  2V8D A;  4K59 A;  1XTZ A;  1SC3 B;  4C8Y A;  1X0F A;  5F8L A;  1XIQ A;  1RT3 B;  4K4W A;  3BQ0 A;  3OD2 A;  4I6Y A;  2HQF A;  2A10 A;  4CDI A;  4ZN3 A;  4ES1 A;  4ZJO A;  4KIA A;  2VIC A;  5DQG A;  4M94 A;  4C3K A;  4FNH A;  4ZPT R;  4DV2 F;  2MQ8 A;  2IYG A;  4ELT A;  2N7C A;  3PW4 A;  4J9M A;  3MPV A;  4HTJ A;  1TU0 B;  2MJU A;  1S6P B;  4EZ9 A;  5BYS A;  3KLE B;  3DM2 B;  1T03 A;  4JI4 J;  3H90 A;  2MMY A;  1CJT B;  1S7H A;  4TN0 A;  1QSY A;  2ZE2 B;  1E33 P;  2AJ0 A;  4M5L A;  4JV0 A;  1XR5 A;  4I7F A;  4O3P A;  2NXE A;  4QWD A;  2XZT B;  3MM5 B;  4ANC A;  4DPY A;  3UN3 A;  1CJV B;  5J1P A;  3FRY A;  3ZTS A;  4ZVG A;  5KT6 A;  1S1X A;  2ZKT A;  4Y28 C;  1ARO P;  3SFU A;  5M2P A;  2RDD A;  1I94 J;  1S12 A;  3BDH A;  3PYD A;  2MGZ A;  4KAY A;  3CCZ A;  1JJC B;  4PUO A;  5E3C A;  4DU7 A;  1RWO B;  3MM9 B;  1KRP A;  2WVE A;  1U25 A;  1NPP A;  2C3M A;  4LQ3 A;  4HR2 A;  3W5X A;  4R0J A;  4LFA J;  2E9Z A;  2DY1 A;  3GZ7 A;  5CYM B;  4IRD A;  1N6Q A;  4IKA A;  3BF4 A;  4LF4 F;  2D1G A;  2HS0 A;  1HWI A;  3GR0 A;  1IM4 A;  2J0Q D;  5K8M A;  2RKI B;  1LWF B;  4XTT A;  4LF8 F;  1QLN A;  3QRP A;  4Y0F A;  1WG5 A;  1AA1 B;  4LRC A;  2J6T A;  1ZTT A;  2FB0 A;  2KTQ A;  5DZ7 A;  5HLF A;  5HMY A;  1IBK J;  4KSE B;  4LQ9 A;  2CFX A;  2R7T A;  3BDG A;  2CXE A;  2CWX A;  1U0H B;  2R4F A;  3GMG A;  3PJW A;  1Y00 A;  2Y1R I;  5KG2 A;  3O1L A;  3A13 A;  4IFV A;  4ECV A;  4ZIW A;  2C42 A;  3QID A;  1HYS B;  4B3T J;  1Y11 A;  2VB6 A;  3DFE A;  1H0H B;  1NSA A;  5J2N A;  1I51 B;  3JTP A;  3G4S S;  2AEJ A;  4Y65 A;  4Q44 A;  1F2G A;  4UOF A;  2NXC A;  2ERR A;  2H5E A;  3V6J A;  1ZEB A;  1OMS A;  4ATN A;  3RR8 A;  3KNA A;  4IO1 A;  2QSF A;  4RW6 A;  2QLX A;  1UJ6 A;  2DJW A;  3G6X A;  1YBT A;  2QL7 B;  3I0R A;  1JJ4 A;  2Q43 A;  1VJW A;  5KFG A;  3LAK A;  4KQZ A;  2CAD A;  1GMV A;  3U1N A;  1E6V B;  3IGN A;  2CPJ A;  3F0N A;  1C0T B;  1WOO A;  4KPC A;  2UXB F;  4F50 A;  3HI9 A;  1U1Q A;  4L3N A;  1X9M A;  1VRU A;  1RAF B;  3E8O A;  2VIH A;  1WC5 A;  2AF6 A;  3KG0 A;  2C2E A;  3IDD A;  3TVY A;  2QT7 A;  1FE4 A;  1NKB A;  4DSK A;  3ZXW A;  1R31 A;  3OL8 A;  3CED A;  2DR8 A;  4ES2 A;  3PW5 A;  1VDH A;  2FJA B;  2VON A;  2BE9 B;  1DTQ B;  5KFJ A;  3BDP A;  4H4M B;  3WHI A;  1HLW A;  4F4X A;  2CG4 A;  2AYB A;  4WU3 A;  4ECQ A;  2E29 A;  3MAH A;  4NLS A;  5J2P A;  2XMV A;  3DKD A;  2JLG A;  1WDT A;  2PA3 A;  2HBY B;  1HNZ J;  1YKW A;  1KNZ A;  1FJG J;  2UV8 G;  4GMK A;  4RWX A;  1GX5 A;  1FWK A;  5D6G A;  3WIU A;  4NEY A;  3PX4 A;  4U95 A;  3I31 A;  4NA2 A;  2DT9 A;  2AX0 A;  4F02 A;  2HHX A;  1WHV A;  1UVL A;  4HHH A;  2W8S A;  2W8K A;  2UVW A;  1J5E J;  4TQS A;  2A2D A;  4PZV A;  5IOL A;  4DL2 A;  4QWB A;  3IM9 A;  2QX0 A;  3M8W A;  3NEK A;  3R1L A;  4JB8 B;  4QW8 A;  4CNY A;  5ADZ A;  1RK8 A;  2E1R A;  4DCJ B;  3H2V E;  3BEG B;  4P72 A;  3IG1 A;  1E3C P;  3RRK A;  5D8H B;  5K4P A;  1X4G A;  5GVQ A;  2RHQ B;  1RXO B;  4ZKA A;  3MGJ A;  5ITH A;  2RT3 A;  3W9J A;  4RNH A;  4DG1 A;  4NX9 A;  3R5J B;  4OV1 A;  2WZ1 A;  5D78 A;  3D1O A;  1NJY A;  1HAR A;  3AAW B;  3B8H A;  3KJQ B;  3TVZ A;  5LOQ A;  4FKY A;  1JJ2 R;  4QR0 A;  3SCJ E;  4B9L A;  2QL9 B;  1H2T Z;  3M8Q B;  1AW0 A;  3HFV A;  3MOJ B;  4MIV A;  2WON A;  3M8S A;  4NML A;  4N56 A;  2IIH A;  3W65 A;  3NCQ A;  3C19 A;  3S8S A;  4LVN P;  3P49 B;  4C3M A;  4DSF A;  2MY8 A;  3C14 A;  5F3Z A;  3TQE A;  1KON A;  3MUV P;  4JI6 F;  4QIE A;  5FLX Y;  3M8Z A;  3K17 A;  5HBM A;  1JLC B;  4TY9 A;  2P6T A;  2OTL S;  4YB7 A;  1Y9O A;  2MKY A;  2KB2 A;  2FDN A;  2NS1 B;  4E0D A;  3B4D A;  3OHA A;  2HYI B;  1B7F A;  2X3G A;  2ZBR A;  3UE2 A;  3MED A;  2HVD A;  4OIX A;  1PJ6 A;  1ZEF A;  3EGV A;  3EMT A;  1U6B A;  3V4I A;  4FBU A;  3Q22 A;  3JSB A;  3RUB L;  1UET A;  2M7S A;  2OIH A;  2KHC A;  3RB3 A;  4OYB A;  1YJ9 S;  5EGH A;  3BS9 A;  1V3R A;  2OSR A;  3LQV A;  1ANI A;  2V9K A;  2KXH A;  3HSJ A;  5HRT A;  3QQC D;  2ZC3 A;  2CJX B;  5H9E K;  2JLE A;  1IKW A;  4FYX B;  2E5L J;  5LSO A;  1NKE A;  2RU3 A;  2F4V J;  1RWN B;  2HZV A;  4OLO A;  3ILI A;  2BQU A;  3HKW A;  4DR5 F;  2KT3 A;  5AT1 B;  4K0K J;  2C22 A;  1B0T A;  2QO3 A;  4Y00 A;  2VG6 A;  2GSN A;  4LSN B;  3VVT A;  1JQG A;  1JK9 B;  4MFB B;  4DCO B;  4ZPA A;  4IR1 A;  1G1X A;  1EI6 A;  1KFS A;  3ZTQ A;  1SC6 A;  1S5Z A;  3O6Q A;  1M5V C;  3NRB A;  1EET B;  2LP4 A;  1U1P A;  3PYF A;  1Q78 A;  4KR0 B;  2IMO A;  4HHJ A;  3MM8 A;  1KVK A;  3ZZO A;  1TKZ A;  4FDF A;  1X5S A;  5DZ6 A;  1M5S A;  5LJ5 Y;  1P9Q C;  1E6Y A;  1O8B A;  2E66 A;  2BDP A;  4NCA A;  1QM9 A;  4ES3 A;  5KFP A;  2GJ2 A;  1EQ0 A;  2VBZ A;  4ENO A;  2YKQ A;  2C3O A;  1HDH A;  1RAG B;  1CPZ A;  3NNH A;  2OPS A;  5DG8 A;  4ZIT A;  2ZBP A;  3R6G B;  2FJE B;  2XMJ A;  1U8S A;  2XSJ A;  2Q6B A;  2PFF B;  2R7U A;  2YQ3 A;  3AOD A;  2B51 A;  3TZY A;  3MD1 A;  1SKW A;  3M2U A;  2XHC A;  5EX3 A;  2I38 A;  1T02 A;  4DV1 F;  3AQO A;  4LF9 F;  1ZED A;  5KFM A;  7AT1 B;  1XMO F;  2N82 B;  2RH6 A;  2FVR A;  1NK6 A;  2YX1 A;  3MMC B;  4NLY A;  1TK0 A;  1S97 A;  2MDA A;  1SVD A;  4P2X A;  4B9M A;  2ROG A;  2MZS A;  2N7Y A;  2EFN A;  1MML A;  2ZFH A;  1GK8 A;  4I7F B;  5HQL A;  4MK9 A;  2LXI A;  1T8E A;  5LJ3 Y;  3IGZ B;  3MZI A;  4ZVT B;  5IM0 B;  4NAS A;  4I0W A;  4NLP A;  4W98 A;  3ZNU A;  4A8Q A;  3OPK A;  3UD5 A;  1YDL A;  3R5B A;  4QW9 A;  4DV7 F;  1NK0 A;  3Q23 A;  2LYV A;  1EHW A;  1P6T A;  2ADC A;  4FF1 A;  1IR2 A;  2YNG A;  2EBG A;  2UXD F;  2I0X A;  1U2F A;  2MGZ B;  1MWZ A;  3OSP A;  1IKY A;  4DMZ A;  5LIA A;  5L39 A;  2LVW A;  3P5B P;  4X2B A;  2ZZN A;  1WC4 A;  3DXS X;  2YWH A;  3M9O B;  4DV0 F;  3DLE A;  3R1H A;  2L48 A;  3KK2 B;  3T01 A;  2CPZ A;  2XMA A;  3VAM A;  4DF4 A;  2HHU A;  2YPZ A;  2RHS B;  2L9W A;  4CH1 A;  4O3S A;  2PEH A;  2AGO A;  1TFW A;  4YUD A;  4M5D A;  5CHC B;  2GZO A;  3CCJ S;  1NSQ A;  2L9D A;  2QV6 A;  4DHV A;  4HKQ A;  5MLC V;  3P5T L;  4PPD A;  3IFE A;  2Z30 B;  4AYB D;  1X4A A;  2PI5 A;  4MIW A;  1C1B A;  4N77 A;  2HFO A;  3ADA C;  2JEF A;  1B64 A;  3IBW A;  5LMU F;  1DQ9 A;  3KLI A;  3CCE S;  3ENV A;  5DQI A;  3BDG B;  5EHH A;  5CAB A;  1S1T A;  3CCS S;  3PRD A;  4J9N A;  3FGV A;  2CG8 A;  3R7N B;  2F8M A;  1K9M T;  3HKZ D;  1S1V A;  4HVZ A;  5DDP C;  1G2E A;  3POT B;  5M2R A;  3I96 A;  1NSK L;  3GJQ B;  4OLP A;  1D3W A;  4KRW A;  1SKR A;  1C0U A;  2BJE A;  1R8H A;  2GHW A;  5D3G A;  3VAH A;  2GIF A;  2PMW A;  2KH9 A;  4Y2I A;  3W61 A;  3BH7 B;  4K4T A;  2UUB F;  2HHH F;  4DOZ A;  2GC8 A;  2JHE A;  2W7P A;  1UA1 A;  3E2D A;  4FPR A;  2LXF A;  1URR A;  1G3O A;  3QZ8 A;  2VPX B;  3FVY A;  1U1N A;  4RW6 B;  1UPM B;  1SC1 B;  2DY9 A;  4URQ U;  4WFZ A;  3B82 A;  4B02 A;  1REV A;  2FVQ A;  2RML A;  1SQE A;  4KHP J;  4NXN J;  3C3L A;  1XQI A;  1HBO B;  2POK A;  1SJR A;  2CNK B;  2E7V A;  2RS2 A;  1G6B A;  2BXJ A;  1I3O B;  2V69 A;  3I5B A;  2QMW A;  1SB6 A;  4RW9 B;  4DEZ A;  3NGK A;  3GV8 B;  5I42 A;  2EFQ A;  1QY7 A;  3LP0 A;  2A3J A;  4CLU A;  2HAI A;  4OJ3 A;  2J0W A;  3N4W A;  1T05 A;  2BJ8 A;  3DOM A;  4OHV A;  2IJR A;  4OX7 A;  1ELO A;  5J2P B;  4B9N A;  1KTQ A;  2LQB A;  1RHU B;  1RTJ B;  2BRK A;  2AX1 A;  1YJ7 A;  2VUG A;  5AJ3 J;  1N33 J;  4ECX A;  1KN6 A;  3W3S A;  5A8W A;  1GXU A;  1T3O A;  1VQY A;  2QGF B;  4C0O C;  3A8I A;  4ZGA A;  4LSZ B;  2IRY A;  1FKO A;  7FDR A;  1MWQ A;  2CAJ A;  1S6Q A;  2W7A A;  2NCK L;  4H4O A;  4KKO A;  2FZC B;  5KOW A;  4OI2 A;  1HI8 A;  3VVU A;  4LF2 A;  2WSC C;  3QO9 A;  3LA0 A;  4NLD A;  4C2M A;  3FMB A;  4NE9 C;  5I3P A;  3LWM A;  4C8M A;  3MD3 A;  1QSS A;  1BE4 A;  2IDL A;  1B0V A;  3OVA A;  4YFU A;  1HWL A;  3TEH B;  5F9N A;  1VLO A;  2VG5 B;  1IUJ A;  2XS5 A;  1X5T A;  2NSC A;  5DO2 A;  1VQL S;  1KH7 A;  3SSS A;  2HGL A;  4YR0 A;  5CXT A;  4PG6 A;  4JYA F;  4DQR A;  2O1P A;  3A52 A;  1PAE X;  4RNF A;  2CQH A;  3KXD A;  1TL5 A;  2YKM B;  2UXC F;  1Y4Z B;  3WAX A;  2DEI A;  2XNQ A;  1N88 A;  3GLJ A;  4ZHR A;  3NAH A;  2WW8 A;  2IDE A;  3C14 B;  3UWT A;  3NS5 A;  1X8D A;  5HBM B;  5ETV A;  3CDA A;  4DBQ A;  5C5J A;  1Q7Y T;  3QT6 A;  3UFC X;  3H7H B;  1UVJ A;  1U1L A;  3IR6 B;  1X4H A;  1NXI A;  2D3O 1;  4DPX A;  1Q79 A;  3T02 A;  3BBB A;  3J7Y I;  1K47 A;  3PW2 A;  2XB2 D;  5C42 A;  1RI7 A;  3NAI A;  3TAM A;  3V4I B;  2GGP A;  1ZOT A;  4Q2M A;  4TYB A;  5FLX U;  2U2F A;  2YWW A;  5E3R A;  3H98 A;  4NCG A;  1V5I B;  2OPR B;  2QMU B;  2K3I A;  4A8F A;  2DIS A;  3MPY A;  2AZ1 A;  4NZ7 A;  2WW4 A;  4XO0 A;  2MLZ A;  1WWH A;  1CS4 A;  1K8A T;  4OZ1 A;  1SJ1 A;  4X4V A;  4KM4 A;  4F0H A;  4ECS A;  3JQK A;  1WAC A;  1KDN A;  1NKC A;  2DXF A;  5AE3 A;  4ECZ A;  1LK7 A;  1H6K X;  2HS3 A;  2V68 A;  4B3M J;  1GXT A;  4WFY A;  2OLW A;  1Q81 T;  5B0F A;  2AU0 A;  1S6O A;  4PYA A;  1VRT B;  3R3T A;  5CH7 B;  2XM3 A;  1T94 A;  3K5M A;  3ET6 A;  4NLT A;  3HT3 A;  1HBN B;  2DTJ A;  4NYZ A;  1CVJ A;  3FFI B;  1HIY A;  1HHQ A;  1HMV B;  4LBP A;  5T7L A;  3FSX A;  2WHO A;  4OYM A;  3W2V B;  2RRA A;  1L3S A;  2W9C B;  2DH7 A;  2UVV A;  5HMZ A;  3CC2 S;  3OR2 B;  1H72 C;  3DCA A;  1EP4 B;  3G6E S;  4RO0 A;  4X66 F;  1S72 S;  2WB1 D;  2R42 A;  1B0P A;  2AMC B;  5L0K A;  2VPY B;  3CDW A;  3VZI A;  1RKI A;  5A0Y A;  1VQN S;  3JQM A;  4DUZ J;  4JI3 F;  3VTI A;  3FZ2 A;  5C2G A;  5LMN F;  2B8Q A;  4ECU A;  2HS4 A;  2XI3 A;  2L08 A;  5LXR A;  4PYD A;  5SUH A;  2XY5 A;  2GW8 A;  2H4W B;  2HGM A;  2DNZ A;  1FJE B;  2DNK A;  1HBM B;  4LF6 F;  5G4D A;  2FY8 A;  3J7A N;  2JFK A;  4AT1 B;  1OIA A;  4DV3 F;  3R5A A;  1ZM4 A;  2Y0S D;  3PEH A;  2YH0 A;  1D9A A;  2GJI A;  3CJK B;  4NPO A;  2FHO B;  5B08 A;  3PTW A;  4Q8F A;  4D3G A;  4B3S F;  4X4P A;  3VV2 B;  1NPK A;  1HQE A;  2CVE A;  4PR6 A;  2KVQ E;  3HM9 A;  4DQP A;  2YKN A;  1N8R T;  1NDK A;  1KSP A;  3QWP A;  5KFH A;  3DNC A;  2F4F A;  4LF1 A;  3A3O B;  2OFH X;  2IC3 A;  1PO6 A;  2QZ8 A;  2D9O A;  4C3L A;  2RRB A;  4DPO A;  5A6P A;  1PKU A;  2FIU A;  2C2N A;  4OYA A;  3N79 A;  3HCX A;  4NMX A;  2B9X A;  3TOQ A;  3KJV A;  2C2M B;  5DG9 A;  4LRF A;  4QZV B;  1Q8L A;  2Q6C A;  4J91 A;  5B09 A;  2NQP A;  2FPH X;  3V5R A;  2LEP A;  1HWJ A;  3RW6 A;  2VDH A;  2E1M C;  3MPW A;  3DRR B;  1CQM A;  4DPU A;  4AUK A;  4EK2 A;  3JSM A;  3N6L A;  4PXC A;  3HVT A;  2VQF F;  2Z4P A;  2UZA A;  1GFW B;  2LQ5 A;  4PPZ A;  1DTT B;  1U48 A;  4LR2 A;  3MMB B;  5CD4 H;  3PYE A;  5KFB A;  2DHS A;  1U4B A;  4RBV A;  2GHP A;  3BQ2 A;  3LXQ A;  3TQ1 A;  3GFZ A;  4I69 A;  2IM0 A;  4MH8 A;  4YB6 A;  3NS7 B;  5C25 A;  1FRJ A;  1RT5 A;  4OX9 J;  2MZQ A;  3QSY B;  2QA4 S;  4A8K A;  4MT1 A;  3OVB A;  2DHX A;  4M5D B;  2C2D A;  4KHM A;  4JI0 F;  4EGL A;  5ETP A;  2NR0 A;  1VBX A;  1EQM A;  1SQG A;  4OYW A;  2KU7 A;  4JI1 F;  1S77 D;  4AQY J;  2ZM6 J;  3FSY A;  3CGI A;  4PEO A;  1T9U A;  3NCP A;  4BCA A;  5DDR C;  1CEZ A;  2MKI A;  3CJT A;  1S1T B;  2XMK A;  2QA2 A;  3QSI A;  1FWL A;  2NPI A;  2W9B A;  4AND A;  4JI2 J;  2J9D E;  1Y10 A;  2KXF A;  3SQG A;  3DC2 A;  4O44 A;  2P2C B;  4N8O A;  1M5O C;  4HHU A;  4N8N A;  1R8B A;  2RIL A;  2EW9 A;  1T9T A;  3LF0 A;  2HFU A;  1N2K A;  2KXN B;  2MZ1 A;  3VAL A;  4F8R A;  3EGN A;  5AXK A;  2R3V A;  4MHX A;  2M3D A;  1FES A;  2E9R X;  2GSO A;  4GTX A;  3THV A;  3ZTR A;  4Q2L A;  4LF7 F;  5KFI A;  2CQ4 A;  3IGV A;  1REV B;  4OHY A;  4UT4 A;  1JLQ A;  1R43 A;  3E51 A;  4RW8 B;  3ISZ A;  4PWW A;  4ETZ A;  1WG4 A;  1UVI A;  1RU1 A;  3P45 B;  2MKC A;  2ZVS A;  3ZZY A;  2QG9 B;  3OL6 A;  2IM1 A;  4OZ3 A;  4CH0 S;  2GS8 A;  3V2U C;  2IRU A;  3BDF A;  3BSO A;  3BN4 A;  3NKN A;  3T1H J;  3MAA A;  4AXI A;  4WE1 B;  2OKQ A;  2J8S A;  1PIL A;  3TW0 A;  3KLH B;  3SXL A;  3KDN A;  2JOQ A;  1D9F A;  1RAC B;  2HUR A;  3BDE A;  2FLO A;  3GV7 B;  1N5V A;  3MEC A;  1WEL A;  2Z56 B;  1Z4U A;  3MI7 X;  1YX2 A;  2IA6 A;  2R7X A;  3TVK A;  1WC6 A;  3KK1 B;  2M52 A;  3CDU A;  2BKN A;  2XMW A;  5AE1 A;  3CCM S;  2P5V A;  1HJK A;  1OPZ A;  2V2Q A;  2E5G A;  2QL5 B;  3FEZ A;  1F3V A;  3HZE A;  4K7Q A;  3ZFV A;  4O3R A;  3QGG A;  2ACY A;  1XN9 A;  2BJD A;  3SYZ A;  2EFP A;  1FJC A;  5BR8 F;  4H4O B;  3HX9 A;  4KKO B;  1J2V A;  3FCV A;  3KNG A;  4AXJ A;  4FS1 A;  3HO1 A;  3THP A;  1RT2 A;  5HSP A;  5HP1 B;  2CQ2 A;  1ZPV A;  3DYC A;  2DBB A;  4R5P B;  4IQX A;  4JI5 J;  1MN7 A;  4F3Q A;  2OEM A;  5IT9 U;  2CZV C;  1S0M A;  2DGT A;  4MY4 A;  2XYG B;  3T1Y F;  4U7U K;  2A0F B;  2ZZT A;  2GNK A;  2U1A A;  4B9S A;  4WTO B;  1N34 F;  1J5O A;  3C6T A;  2UUA F;  3FDS A;  4I6W A;  3DRY A;  1EQJ A;  2QA1 A;  1FFS B;  3I0S A;  3MTK A;  2VOO A;  4F2R A;  4NLU A;  5J1E A;  1R8A A;  2BYC A;  5A8K A;  2EXU A;  3D1H A;  4PAB A;  3DRP B;  3VWS A;  4NA3 A;  3EVM A;  1JWW A;  4C98 A;  1MRO A;  2H5J B;  3IRX B;  3A8E A;  4USV A;  3DMJ A;  3PYG A;  2QYC A;  1MLA A;  4KHR A;  5KT3 A;  1GTH A;  2IBK A;  3G6Y A;  3TA0 A;  1K7H A;  1WJ9 A;  1RBL A;  3SDE A;  4IRC A;  1GMW D;  3M4X A;  4LF5 J;  4X4U A;  4F7V A;  1WKJ A;  4JBC A;  1Q16 B;  2Y1J A;  3LGN A;  1EJJ A;  3L7O A;  4BC7 A;  4EYH B;  1YI2 S;  2PA8 D;  2PO4 A;  2GGP B;  2HWH A;  2DNO A;  2MY7 A;  2DVI A;  2QE5 A;  3M2V B;  4NCG B;  4NZ0 A;  4NWJ A;  2XCP A;  1WI6 A;  1L5U A;  4P73 A;  4WP8 A;  1PBU A;  3MOZ A;  3HJF A;  2Z2M A;  3GIL A;  1CS4 B;  4HT5 A;  1OSC A;  2RE1 A;  2KT5 A;  2WOM A;  4LFB F;  3SCL E;  2B6A A;  1YK9 A;  1UCN A;  4J9P A;  4U67 Q;  1YBU A;  5F8I A;  2HAF A;  3TA1 A;  3UDL A;  4CO4 A;  1HNI A;  5DDO C;  2IM3 A;  3BSN A;  1WC3 A;  1RT7 B;  2KFY A;  2CZ4 A;  4RBT A;  1LQ9 A;  5IQQ A;  1Z2Z A;  2W24 A;  3ILJ A;  1PC5 A;  2Y1I A;  4BBY A;  1IR1 A;  2H54 B;  3NMR A;  1SCJ B;  1NM2 A;  2C3U A;  4ZVR B;  4USK A;  2AQ4 A;  3CVK A;  4RZR A;  4LRA A;  1NCL A;  2B4P A;  4MK7 A;  4GTY A;  2XWY A;  4B56 A;  3GP9 A;  2ADB A;  2GA3 A;  5HAO A;  4QIV A;  3Q8Q B;  3U1L A;  4LR9 A;  1U1M A;  3CJ0 A;  5H9F K;  1N33 F;  3HHL A;  1BUX A;  1HR0 F;  1Q7L B;  4UUX A;  2G0C A;  3LP1 A;  2GIR A;  1EW2 A;  4NLR A;  2HMI B;  3RBD A;  4XIU A;  4E8U A;  5F3T A;  2W5S A;  2DB1 A;  1KOO A;  4DR6 F;  3GWC A;  3ELH A;  3DOK A;  1OYD A;  4HAC B;  4ZA1 A;  2CVI A;  4ZCM A;  1TK8 A;  1TUG B;  4R8U B;  1CSJ A;  2W25 A;  1X4D A;  3CIZ A;  1N48 A;  1RT1 B;  1S9G B;  5KG6 A;  1V6H A;  1AJA A;  4QU7 A;  4I68 A;  2QMX A;  1TKT A;  1RTH A;  5CYQ B;  1HD1 A;  2VFT A;  4TY8 A;  2Q66 A;  1NPR A;  4DV4 J;  2LFV A;  3U27 A;  4Q7A A;  4TU8 A;  3KUE A;  2IRX A;  3EDQ B;  3DI6 B;  3SBM A;  2BAN A;  5IZH A;  2AJ4 A;  5KFZ A;  1YJT A;  1O6X A;  2BOA A;  3GFX A;  3I32 A;  2AYM A;  2X3D A;  3QPI A;  3SSR A;  2R2R A;  2AEF A;  2PC6 A;  3OHB A;  1VIX A;  2ANH A;  3LGM A;  2RQ4 A;  3CCT A;  2HSE B;  1DRZ A;  4ED4 A;  2IC3 B;  3IWX A;  3CME S;  1WSR A;  3K59 A;  2UP1 A;  1RT4 A;  4OYX A;  2PFD A;  3CJ8 A;  4OV6 A;  2LCW A;  4OL8 A;  5K20 B;  1IKX A;  3GE9 A;  3J81 U;  4A8Y A;  2F40 A;  3OR1 A;  3KLG B;  2HRU A;  3E01 A;  3KD8 A;  3TZZ A;  2R7O A;  3GCX P;  1KH9 A;  3NY0 A;  1RIS A;  4U7C A;  1S79 A;  1YVF A;  3CCU S;  4CWB A;  4P2S A;  2IYI A;  3S6E A;  2BKP A;  1B3T A;  2W2Q P;  5C2C A;  4NWB A;  4F26 A;  2FJV A;  3NLC A;  3IMQ J;  4CYR A;  5B0E A;  4DDF A;  4F3M A;  2F9D A;  2X1G A;  4N47 A;  4N7T A;  2UU9 J;  1V5V A;  2VPZ B;  3A8J A;  3BGR A;  3QT8 A;  3GR1 A;  3GIR A;  1E1Z P;  4WZM A;  1WF0 A;  3V81 B;  1FER A;  1XER A;  4F67 A;  3G9C A;  2G4B A;  3O3L A;  4RW7 A;  1NZ8 A;  4MKA A;  2RRN A;  3KKF A;  4RUB A;  2YWE A;  2HNY B;  2DRD A;  4WF9 Q;  1DLO A;  1VHF A;  4EZ6 A;  4DV5 J;  1Z2L A;  2JL9 A;  4KC5 A;  2VQE J;  2PSZ A;  1URB A;  1S10 A;  4QAX A;  1HNW F;  2V8P A;  3Q8S B;  2CDR B;  2XMM A;  3ILL A;  5DM7 Q;  1QVG R;  4FKX A;  5KFY A;  2CQD A;  4FN5 A;  2G9Y A;  4IG0 A;  4KGX B;  2WCX A;  5L38 A;  4A48 A;  5EWG A;  4PXD A;  3EX7 B;  3BV8 A;  1G4C A;  1ANJ A;  1HW8 A;  1U1K A;  1SH0 A;  2KM8 B;  4YDD B;  4Z7C A;  3KLF A;  1QVF R;  4Q5V A;  4F25 A;  2E1P A;  4EBD A;  2CJQ A;  3GFH A;  3G87 A;  3MAQ A;  3MR7 A;  2LEB A;  1N0V C;  4URG A;  3GJR B;  5B0B A;  2DHG A;  3AJD A;  4TLR A;  4F2S A;  4NLO A;  5KFF A;  3FUY A;  1N32 F;  3GPA A;  2NPF A;  4X64 J;  4UST A;  2IUC A;  2ZJP Q;  4WIQ A;  2ZJQ Q;  3TJ8 A;  1JIH A;  2R7S A;  4QIF A;  2YNI B;  1NDP A;  5CZV A;  4UOC A;  1F2H A;  1VS3 A;  1NK9 A;  3A8K A;  2OSQ A;  1FDA A;  3O8W A;  5I4M A;  2X7I A;  2GVD A;  2G13 A;  1I5O B;  4OI0 A;  4ZIV A;  3QMQ A;  1TMJ A;  3C15 B;  2XBP A;  1CUL A;  4J9R A;  3MM7 B;  2NUU G;  2CPD A;  4IG3 A;  4P2F A;  2DPI A;  2QLJ B;  2OPP A;  3L7U A;  2Z58 B;  3SCI E;  5KFD A;  5ETT A;  1WD6 A;  1HQA A;  1JXE A;  4DFP A;  1RAE B;  4DR3 J;  5E7O B;  5JMN A;  1R27 B;  1VK8 A;  3OTO F;  2WVB A;  2O67 A;  4IH7 A;  2DNH A;  1IBM J;  3AB2 B;  4J90 A;  1IBL F;  1H74 A;  1TV6 B;  4MYT A;  4YME A;  4Q0B A;  3MEC B;  3HHD A;  2PII A;  1U26 A;  2IVY A;  2F9J A;  2HQD A;  2WVC A;  5ETM A;  5F41 A;  1Y0H A;  3M8R A;  3K0J A;  2HND A;  5MAO A;  5KFS A;  3CCR S;  3H25 A;  2V34 A;  1TKD A;  1WKK A;  5F8N A;  2V67 A;  2K1R A;  1RWU A;  2GQQ A;  3TG0 A;  1K0T A;  3FBB A;  1JNZ B;  1RT2 B;  1NH8 A;  2ZOG A;  1TL1 B;  2MEW A;  2JX2 A;  2B4U A;  3K5P A;  5GAH U;  1JLG B;  1H2U X;  3DU5 A;  1VYA A;  1N5Y A;  2D9P A;  4CCH A;  2D41 A;  3FC9 A;  2BM0 A;  3TAQ A;  4ED1 A;  4ZPV R;  3MEG A;  2JJ4 D;  5FDL A;  4OFZ A;  4KO0 A;  4JI8 J;  3M2R B;  4M5N A;  2MQP A;  4LSL A;  5A8K B;  5LRN A;  2B0G A;  5F8M A;  4S0M A;  2I1R A;  2EK6 A;  4RX6 A;  4DL6 A;  3D54 A;  3PRB A;  4DU8 A;  4KH0 B;  5DLW A;  2BV3 A;  1WNE A;  4I6A A;  2ZBC A;  2OPQ A;  2N4D A;  1RHQ B;  3HHE A;  4DSJ A;  2VG7 A;  1IWA A;  4I2P A;  2UVU A;  1TZ0 A;  2FJB B;  1QAX A;  3LUY A;  4ZCK A;  3MMA A;  3UD3 P;  4FVC A;  1UMJ A;  4DR1 J;  1FSU A;  1HFE L;  3I9Z A;  1HQU B;  1RUS A;  2AYE A;  1XNQ J;  3JXO A;  1RAD B;  3T9N A;  1FKA F;  4YR3 A;  2XYH B;  3JAM Y;  1UW4 A;  4A8M P;  5G0R A;  3RYL A;  4DR2 F;  4QIW D;  2P6S A;  2I5J B;  2HG4 A;  3WQP A;  1HWU A;  3HSG A;  2RDJ A;  3PXG a;  1N5S A;  2CPE A;  4IO9 Q;  4HDH A;  3W5Y A;  3I87 A;  1UPP A;  1RBO B;  3CB4 A;  1IKV A;  3PX0 A;  2N4C A;  2MTL A;  4G3I A;  1VK3 A;  3Q83 A;  3DDI A;  3W8G A;  2JLF A;  3KHR A;  4F4W A;  1KEK A;  4NCB A;  2GV1 A;  3M30 A;  1AT1 B;  3NGD A;  1UTA A;  2XY7 A;  3F44 A;  2KM8 C;  6FDR A;  4DX7 A;  1O98 A;  1S9F A;  2DO0 A;  3H59 A;  1BQN A;  1Q53 A;  2CPI A;  5EUH A;  3EPI A;  2HVH A;  4ZDN A;  5HK4 A;  1RGV A;  3R2D J;  2W9A A;  1HPZ B;  3RB4 A;  4C8Z A;  4CO3 A;  2KI2 A;  2Z2Z A;  1RA6 A;  4YR1 A;  3TUZ C;  1WEZ A;  1KH4 A;  1RCO B;  3DOK B;  4Y34 A;  1YHQ S;  3JTO A;  3G2X A;  2BE2 A;  2CPY A;  3FNN A;  1Y3K A;  3I9V 9;  1JLA B;  3K58 A;  2LEC A;  3JYT B;  5D4L A;  1FT8 A;  3DRS A;  4RU2 A;  1N52 B;  2M5Y A;  3FJ2 A;  2LA4 A;  4DV6 J;  4DSL A;  5AXM A;  2AP6 A;  1VQK S;  3SV4 A;  2HKE A;  4TY8 B;  3T1A A;  4O4R A;  2WVD A;  3DYA A;  3ZO7 A;  8RUC A;  1TEL A;  4EMD A;  1IJE B;  3CCW A;  3UDE A;  5KT7 A;  4AE5 A;  4U6P A;  5F8J A;  1O5J A;  4IR9 A;  2DCL A;  5IV4 A;  2F5G A;  4K4Z A;  1TK5 A;  5AJ9 A;  5IWA F;  1JLE A;  1PCA A;  4PG8 A;  1M5P C;  1BD6 A;  5C7P A;  4A8S A;  1ZM3 A;  2EI5 A;  2DIV A;  1VI7 A;  4ERD A;  1U47 A;  1LEO A;  1Q4R A;  3D68 A;  3TO8 A;  1VBY A;  3W2W A;  2EKY A;  4KY3 A;  3RR7 A;  1AUS L;  3R7S B;  5INH A;  3EGZ A;  3OXF A;  3G82 A;  2HFN A;  2DYA A;  2OJ3 A;  2AHO B;  1XJW B;  2C2O B;  2NRE A;  2KYZ A;  3MXH P;  3H5U A;  3T19 A;  3HLU A;  3J80 Y;  1HBU B;  1NDL A;  5D77 A;  5CCL A;  3BR9 A;  4HLB A;  3Q3Q A;  3GFY A;  2CJA A;  5KFL A;  2W7O A;  2XO6 A;  3C66 A;  2JH3 A;  3AD8 C;  3DGP B;  2MKJ A;  1N36 J;  1RB0 A;  4TYA A;  2GVZ A;  2FTR A;  2HNZ A;  3ICL A;  3EJM A;  3D6T B;  5GAG I;  1BHN A;  4CIO A;  3BGR B;  4I2Q B;  5DDQ C;  4P7V A;  3MK2 A;  1JKH B;  4QWE A;  1WTF A;  1B8J A;  5C24 A;  1F5B A;  3T5K A;  4QWA A;  4RW7 B;  3K2Y A;  1FRH A;  1VQ5 S;  2FQQ B;  5L8R C;  4X62 J;  1ZS6 A;  3OUY A;  4ZP7 A;  4PXE A;  3F73 A;  4OZ5 A;  1LW2 A;  1RBA A;  1XR7 A;  3NBP A;  2HWI A;  4UTG A;  1BXN A;  4X65 F;  1KBR A;  2HK2 A;  4LFC F;  1CJK B;  3V6D B;  2XMU A;  1U09 A;  3PKM A;  4GKK F;  3B5Q A;  2BKO A;  2HW3 A;  2BRL A;  3CMA S;  1RAH B;  2YNH B;  4X84 A;  4A8X A;  1EAY C;  2DXD A;  3QAE A;  1ED9 A;  3PM9 A;  2VQR A;  2D3Z A;  1CJU A;  5BJR A;  2IVM A;  2RUS A;  5JVH Q;  3HF5 A;  5D4O A;  3OBI A;  4O4G A;  4DR4 F;  2XQC A;  4PQU A;  2BZ2 A;  1UW9 A;  2V4J A;  4CM2 A;  3SSQ A;  2B5J A;  5KAK A;  3CT9 A;  5GAD U;  1I1G A;  1R8P A;  3M32 A;  2YKA A;  1HNX F;  1VQO S;  3O44 A;  1ZYQ A;  2AGQ A;  3ZTP A;  4A8O A;  1OS5 A;  1TR0 A;  1RP5 A;  4I1T A;  3QIP B;  2DGS A;  2JDJ A;  2ALY B;  2YX4 A;  1RWX B;  4YY3 F;  1SKS A;  1D8Y A;  1IJF B;  5BXI A;  4DZD A;  2HQI A;  2MZT A;  3ENA A;  2A1B A;  2MZJ A;  2V6A A;  3QFH A;  1W2B R;  2W5W A;  1U7L A;  2FGC A;  1SUQ A;  2BVZ A;  2AV5 A;  2IM2 A;  4YP3 A;  2BR0 A;  2UVR A;  4QR2 A;  4RBU A;  2IMW P;  1FKP B;  5B0D A;  4TNO A;  4DR7 J;  1XWL A;  1HI1 A;  3RRH A;  4CQ1 A;  3QLH A;  3UD4 P;  3ITH A;  4C4W A;  3ONQ A;  3WX8 A;  4RW4 A;  5ETO A;  3W60 A;  1FRM A;  1NJX A;  4L72 B;  4DPW A;  3BQ1 A;  1YBA A;  3KFW X;  4C11 A;  3IO1 A;  4CYU A;  4Q0B B;  1MSW D;  1AZS A;  4G65 A;  3DLG B;  1HW9 A;  3OFE A;  3PO5 A;  2V94 A;  1Z1Z A;  3LPY A;  1YJN S;  2ROE A;  3UR3 C;  3CD5 A;  3TNV A;  2RH3 A;  2DR6 A;  2LU1 A;  2COL A;  4GRS A;  1Y5N B;  2HLT A;  4NXM J;  2CPF A;  4ZVQ B;  1RHJ B;  4HDG A;  5DLF A;  2ZNY A;  3RG6 A;  5FJ4 A;  1RTD A;  1TKX B;  1LWC A;  2K1R B;  3OV7 A;  3NXZ A;  2HVI A;  2J6U A;  1R7I A;  1T95 A;  4FS2 A;  3BM7 A;  4BLG A;  1KHJ A;  1S0N A;  2JZ5 A;  2CQB A;  1S59 A;  2B4O A;  2DGU A;  4NLW A;  3AOA A;  4I4B A;  2GA7 A;  4B3R J;  3J7A 1;  2VBW A;  3ZTO A;  2EG2 A;  2DPJ A;  2ABY A;  3M6V A;  2JRS A;  1KWM A;  1VMB A;  2CJY B;  2FVP A;  1NAQ A;  5ETS A;  2VL1 A;  1KQK A;  4OJ1 A;  3QGI A;  4KO0 B;  3TUP A;  4Q45 A;  3TR5 A;  1XC9 A;  3QGH A;  1U8W A;  3SQO P;  2JNJ A;  4B3O A;  1LW0 A;  4A46 A;  2XEX A;  1RAO A;  5CAA A;  3Q24 A;  2ZHA A;  5A2Q U;  3D7S B;  1C1C A;  1UEK A;  5KT4 A;  2FHJ A;  4DV2 J;  1VIS A;  1SQF A;  4M5M A;  1RT6 B;  4W92 B;  1N4L A;  1S1U B;  4CZC A;  4DQS A;  3HD2 A;  2M9K A;  2XS2 A;  4ED2 A;  3IAS 9;  2B43 A;  5CYJ A;  3HT0 A;  3W9H A;  3B4M A;  1NB7 A;  2HEK A;  4QU6 A;  2EVZ A;  1FHT A;  1AUD A;  4KTQ A;  4PG5 A;  2ZH9 A;  1X0P A;  1U02 A;  4ER8 A;  1AFI A;  1JB0 C;  1FF2 A;  4UPI A;  1TL7 B;  5EDW A;  1MMN A;  1FA0 A;  3LP2 B;  4OYZ A;  2MHE A;  4CP5 A;  9RUB A;  3GV5 B;  1L3U A;  4WBF A;  3CNQ P;  4RUA A;  2Z57 B;  2UUC F;  3BO2 A;  3Q86 A;  2EG1 A;  3AD9 C;  3HSZ A;  4HYK A;  2BW2 A;  1NU4 A;  3UPF A;  1JLF B;  5A8R B;  4ZOS A;  3DOL A;  3HVR A;  1I6J A;  1KOH A;  1U1R A;  4MKB A;  3MUT P;  1MU2 B;  2E1A A;  3MEK A;  4AD6 A;  5T41 A;  3ZZU A;  1P1T A;  1YIJ S;  4IH6 A;  4Y2K A;  4LF4 J;  3OXG A;  1HI0 P;  3G96 A;  4GTZ A;  2IAJ A;  5HVH A;  2J0S D;  2W4D A;  1TUW A;  1X4C A;  4WK1 A;  3TUI C;  5EGY A;  4CLK A;  1KQS R;  4LF8 J;  5F0W A;  2LKZ A;  2GFF A;  5CD4 A;  3H5X A;  1XNR F;  5HN0 A;  1HNV A;  2HFV A;  2BA9 A;  4RUC A;  5I3U B;  3TZX A;  1VHI A;  1WOR A;  3EM1 A;  1WHX A;  1RLC L;  1JNR B;  3V6H A;  4WP3 A;  3HXM A;  4ZPC A;  4OZL A;  3NWG A;  2YH1 A;  1NUE A;  3AHP A;  2FD2 A;  4OX8 A;  1Y5I B;  4YHH F;  4YOE A;  1RTZ A;  2DHH A;  3MUM P;  3T5H A;  2G0I A;  2VHG A;  4UUW A;  4Z2X A;  1QE1 A;  1URN A;  1KH5 A;  3N28 A;  4F0K A;  4F4Z A;  4GVB B;  3TZW A;  5FD1 A;  1KP6 A;  5KFN A;  4DPT A;  1DBD A;  3SV3 A;  3TAR A;  1S1W A;  3GIM A;  1LWE A;  1X5O A;  3CIM A;  1FK9 A;  1VLY A;  3J81 j;  1VC5 A;  1SV5 B;  3HDS A;  3V6K A;  4IFY A;  1YJU A;  1VR6 A;  1UWB A;  3IS9 B;  4PQA A;  1B99 A;  3DYA B;  2QC3 A;  1ELY A;  3M1V B;  2KJW A;  4UOR A;  4Y3C A;  1RT3 A;  4J9V A;  1R0B G;  3H5Y A;  2MQO A;  2UXB J;  3HZG A;  1JLE B;  4USM A;  1FTC A;  2FC8 A;  4NLV A;  4ZVP B;  1FFG B;  3UO0 A;  3GU0 A;  1RQ0 A;  1FNM A;  5KG7 A;  2RUG A;  3AA8 A;  5E33 A;  2QJ3 A;  4JI7 F;  4IRK A;  1S6P A;  1S9E B;  3W8P A;  3KLE A;  3DM2 A;  5KG5 A;  3GJS B;  3UN2 A;  1CJT A;  1AJB A;  3CPW R;  4TQR A;  2ZE2 A;  4PRF A;  3M8P B;  7FD1 A;  4WFN Q;  3G82 B;  3KWM A;  3W7B A;  3JSR A;  2Z2Y B;  1IR0 A;  4JOU A;  4G1Q B;  2YNF A;  1TFY A;  3MM5 A;  1TAQ A;  1QAJ A;  5CA5 A;  3W64 A;  5E0O A;  5DLT A;  3F56 A;  4F04 B;  4HL9 A;  3RGI A;  2ZBQ A;  1QTN B;  3EUN A;  5HI7 A;  1L3V A;  3R8Y A;  3N0V A;  3CW2 C;  3O5T B;  1Q1K A;  4P9S A;  4DFK A;  2AJQ A;  1RDR A;  3KUG A;  1ALK A;  3MM9 A;  3CWJ A;  4P2M A;  4DL5 A;  4CLY A;  2KN4 A;  3EPG A;  3K7R A;  1BQM A;  3TA2 A;  3GCW P;  4USH A;  5CYM A;  4H4K C;  3GSI A;  2DXE A;  1JLB B;  1A9N B;  4KV8 B;  1HQ2 A;  5K14 B;  3J7Z 5;  5IT0 A;  4KAI A;  5DG7 A;  8ATC B;  5GOV A;  3IWN C;  2NUH A;  4UF4 A;  3RB0 A;  4ICL B;  4MK8 A;  2YXL A;  2FUG 9;  4QCL A;  1M90 T;  3KG1 A;  3IBC B;  4Y2C A;  4LRD A;  1NK5 A;  3PFO A;  4EFA C;  3OLB A;  3N6N A;  1CJU B;  4ITS A;  4ZP9 A;  2K7J A;  1F5A A;  4K50 A;  2W5T A;  3Q8U A;  3DHX A;  5J1N A;  1LOU A;  2ZH2 A;  2QFJ A;  1QDU B;  1SJ4 P;  3L09 A;  3VCD A;  5SZT A;  2LXU A;  4HH0 A;  1NHV A;  3IA0 A;  2MQQ A;  4M1K A;  5B0C A;  4D3H A;  3N5F A;  2GO9 A;  1O99 A;  3SZY A;  1U0H A;  4JI6 J;  4WU2 A;  5KFA A;  4W90 B;  1L3T A;  2I2Y A;  3CTR A;  2J7U A;  3KHG A;  2D1C A;  2Y3Y A;  4ZLP A;  4GVL A;  5BYR A;  1HYS A;  3DGV A;  3FMW A;  2ZDP A;  4KFB A;  3AY0 A;  2AEM A;  2FJW A;  1C2P A;  1T03 B;  2GSU A;  4JP8 A;  3VZH A;  3OFF A;  3R2C J;  4I56 A;  2MLY A;  3BJY A;  2B7C B;  3AXK A;  3ZZP A;  3PIO Q;  5JVG Q;  2KKH A;  3EZ5 A;  4TN2 A;  2JEG A;  3W5Z A;  1VQ6 S;  1YJR A;  3H8Y A;  2HIQ A;  1E6V A;  3UVJ A;  4UPH A;  2ASJ A;  1T11 A;  4RNM A;  1P27 B;  4UOO A;  1TP7 A;  3K57 A;  2CQP A;  1FXD A;  1S1X B;  1SJ3 P;  5B0A A;  4MYU A;  2SXL A;  3T5L A;  3OTE A;  1PIE A;  4DR5 J;  2AYG A;  2CQC A;  1VQP S;  1P49 A;  2H4Y B;  2KRB A;  2ACM A;  4CYU B;  3K5O A;  1FE0 A;  2DNY A;  3UW1 A;  4PUO B;  4C0H A;  3RBZ A;  2ZVI A;  4ZG7 A;  2RSQ A;  4YR2 A;  4URS A;  4H4M A;  2DNM A;  4OI4 A;  3H2U B;  3BKT A;  1YRX A;  3ILO A;  4GKJ F;  3P4U B;  2YQ1 A;  4EBE A;  3A3N B;  1N6Q B;  4ID5 A;  1HKA A;  1EIY B;  5L1I A;  3QJP A;  5CZX A;  2PN6 A;  3TWZ A;  3N6M A;  4E2F B;  2C3Y A;  3K8W A;  2G1H A;  4LR8 A;  2VKR A;  2Y1L B;  4XDC A;  3HD1 A;  4U8Y A;  4O3N A;  4CO2 A;  3CJ4 A;  4KGK A;  1SL2 A;  2F8E X;  5HLF B;  3FSI A;  5LL6 d;  4A4J A;  2V2K A;  1YRT A;  2DNL A;  1Y6V A;  2PI4 A;  2YKO A;  3OTD A;  3MFI A;  4EU0 A;  5A6W A;  4IFV B;  3VAG A;  2NYH A;  2G2Z A;  4OJH A;  4ANE A;  4KGZ B;  4WJB A;  1U6F A;  1NLK L;  2BJ1 A;  4ZVU B;  5HL7 Q;  4DS4 A;  5J2N B;  2OTJ S;  4DV1 J;  4LF9 J;  3LO3 A;  3OJU A;  3C46 A;  1XMO J;  2GX8 A;  3M8Q A;  1S4E A;  4PWD A;  2CKW A;  2WSF C;  5KFU A;  3TJA A;  1CG2 A;  2G0J A;  2LU2 A;  3MTJ A;  4P71 A;  2Z8Q A;  2VH7 A;  3I0R B;  2LMI A;  3NGR A;  3LAN A;  4DN9 A;  3HFK A;  1F3F A;  1YGY A;  1JLC A;  2QEX S;  2RB7 A;  3MR2 A;  2LDI A;  3NKQ A;  4ZCL A;  1ED8 A;  1UFW A;  1U6Z A;  1VRU B;  1P1L A;  3ZZZ A;  2X51 A;  4CXU A;  4DV7 J;  4QOT A;  2J76 E;  2ZOF A;  4OZN A;  3UNG C;  3MR5 A;  2BJ9 A;  4JI4 F;  2XR9 A;  3IAM 9;  2NZ4 A;  2UXD J;  2EC2 A;  1OWX A;  2BJ7 A;  1EJ7 L;  2M8H A;  4NEZ A;  4C8N A;  2YKP A;  1BWE A;  4DV0 J;  2BEF A;  4TLQ A;  5L0E A;  1KHW A;  2MZR A;  3E3X A;  1GNK A;  2DHA A;  2JFD A;  3TP2 A;  2GQC A;  1LK5 A;  3R7B B;  2ZUA A;  2MLX A;  3NGU A;  1I94 F;  3L9Z A;  1BLU A;  1RYR A;  4LSN A;  4MFB A;  3FCH A;  1H7W A;  1SI9 A;  1QSL A;  4KGV B;  1N56 A;  2FLL A;  1PGZ A;  4UQG A;  1UVM A;  4OJG A;  3N01 A;  3TAP A;  4M5K A;  3CMR A;  2MST A;  4CTA A;  3IG1 B;  1EET A;  1SJF A;  2DNG A;  3BKF A;  4LFA F;  4NXM F;  4B9T A;  3EZO A;  2APO A;  4ZPD A;  1S7I A;  4WXO A;  1XMQ J;  4XDD A;  4F3O A;  4DG1 B;  3WC2 A;  2KFZ A;  4QPX A;  2CQ3 A;  3ZNJ 1;  5DJB A;  2ZH4 A;  2DR9 A;  1D8Z A;  2CNO B;  3HVW A;  2MXY A;  4CT8 A;  3ISN D;  2QLF B;  3FK4 A;  1N2L A;  2EFG A;  4YN3 B;  4C7Q A;  2VBY A;  4I67 A;  3DU6 A;  3SZZ A;  1PJ7 A;  4KYZ A;  3I4H X;  4Y2A A;  2ZWO A;  2K7K A;  2WON B;  2ZC4 A;  2UUB J;  3PJX A;  2HHH J;  3H2L A;  4DCP B;  1ALH A;  4MIA A;  1IBK F;  3T41 A;  3L95 X;  5B0G A;  4KB7 A;  4NWX A;  3TEG A;  3VGS A;  4FF4 A;  2KL8 A;  1KQF B;  2UUW A;  4QR1 A;  3PFE A;  4Z7Y A;  3FZB A;  3S7R A;  2J6S A;  1FRK A;  5KFO A;  2CQG A;  4R25 A;  4B3T F;  4OI6 A;  5M2U A;  2OO4 A;  3EXY A;  3DLH A;  3VAI A;  3MED B;  2DEJ A;  3C2P A;  1NO8 A;  3AXM A;  4QIG A;  1LXN A;  2N3O A;  1S49 A;  1CQN A;  5LSL A;  3MMC A;  4MKV A;  4L73 A;  2W2P P;  3BGL A;  2K06 A;  3EZU A;  3M8Y A;  1SL1 A;  2ZEJ A;  5KFC A;  3JB9 k;  3T5J A;  1F9F A;  2V8V A;  4NLG A;  1VFJ A;  4N5S A;  1IKW B;  2YNF B;  5HRO A;  4DX5 A;  5HJX A;  5IM0 A;  1F9H A;  1EKR A;  2CA9 A;  1CBK A;  2CNL B;  3M05 A;  4QYZ J;  4ZS6 A;  4ILM A;  3QJL A;  3NMA A;  2NXN A;  3CD0 A;  2GHV C;  2MPU A;  3I4P A;  2ILY A;  3KJN B;  2VG6 B;  4J9L A;  4J9K A;  3GJT B;  1UJ5 A;  3MCM A;  1GXL A;  5L46 A;  1VQ4 S;  4BDP A;  5J2M A;  4KH1 B;  1XBW A;  3K89 A;  3D5M A;  3NKM A;  5KFV A;  3AJ2 A;  2PD1 A;  4EBC A;  4U7U D;  3KK2 A;  1HNZ F;  3KMQ A;  1UWA A;  1UEV A;  4LRB A;  4RL1 A;  2OGU A;  3MM8 B;  1BQM B;  2L9N A;  1FJG F;  1F9E B;  5GMK a;  1U49 A;  1TKZ B;  3JQJ A;  2EWH A;  4B08 A;  1J5E F;  4RJV A;  3U02 A;  4DSE A;  2M8D B;  1E6Y B;  4OYO A;  3IP0 A;  2HWT A;  2X98 A;  2FGO A;  2IFX A;  3DXB A;  4IOA Q;  2G2Y A;  3SMZ A;  5F0U A;  1F5C A;  4PKD B;  2FJD B;  4JYA J;  1C4A A;  3G6V A;  1GT8 A;  3QJJ A;  4C8K A;  4OZ0 A;  2OPS B;  2UXC J;  4RUH A;  1ULR A;  3PR4 A;  1NJW A;  2XSJ B;  2NXJ A;  5E3A A;  3NVL A;  2Y0B B;  4KJD A;  3POT A;  3M2U B;  1X4B A;  4ZVO B;  1KVI A;  4DQQ A;  1UKU A;  1IBC B;  4XAK A;  4KFB B;  1UAW A;  2EC0 A;  2M2B A;  4C6A A;  2KRR A;  3MEE A;  1PJ5 A;  1PSD A;  1FWP A;  3T6B A;  3CXC R;  2GMH A;  2M0G B;  1NSP A;  4MJK A;  4ZJL A;  2D69 A;  4FYD A;  4ZN1 A;  3TX8 A;  3H4D A;  3TAN A;  3FQK A;  3UVJ B;  3OT9 A;  5ETK A;  2EFO A;  3EVW A;  3IC1 A;  3UDV A;  1H2V Z;  1QUV A;  1HBO A;  1MG7 A;  2DGX A;  1SPB P;  1FNO A;  3A3P B;  4K8R A;  5HO4 A;  5EWE A;  3Q2S C;  3NS6 A;  1K1S A;  1UEU A;  2ZH6 A;  2YNG B;  4RW9 A;  1FXR A;  2CNN B;  2DH9 A;  4UOH A;  3NCR A;  2F1F A;  1IKY B;  4X4N A;  1T9V A;  3EYZ A;  1VRQ C;  3R6L B;  5B7W A;  3KK3 A;  3DLE B;  4L3K A;  3X3U A;  6FD1 A;  5K8N A;  2DNN A;  5ETN A;  5L1L A;  3U7J A;  2AGP A;  2C2K B;  2E5L F;  1QAY A;  2HPU A;  3D3C J;  2F4V F;  1G7C B;  1RTJ A;  2HHT A;  3Q8R B;  4ID5 B;  5LQQ A;  1QAI A;  2R7V A;  4K0K F;  4DX6 A;  1OY6 A;  1UFL A;  4QPT A;  4OQJ A;  2N3L A;  2E9T A;  4EWT A;  4IQM A;  4X66 J;  1TL3 A;  3BSC A;  1C1B B;  5DLG A;  1NJI T;  4G1I A;  2ZH1 A;  4CXS A;  4V1A k;  1NH7 A;  4G6V B;  2H1Y A;  2BAC A;  1SC4 B;  2VBX A;  4NLQ A;  1RYS A;  2H48 B;  4JI3 J;  3KLI B;  4M5H A;  4BS2 A;  5LMN J;  4LT6 A;  4DQI A;  4P75 A;  2G9O A;  3PV8 A;  5F8H A;  2VF3 A;  1F60 B;  5KOX A;  5KFW A;  2FZK B;  2BOP A;  4LF6 J;  1CC7 A;  2D7S A;  2ASD A;  2VZ9 A;  3ULH A;  1S1V B;  4FDI A;  4DV3 J;  4AL6 A;  1SIW B;  1X31 C;  3MF5 A;  4DF8 A;  4V19 J;  2VG5 A;  1C0U B;  3KLV A;  4GC6 A;  5D3G B;  4EUV A;  3H20 A;  4B3S J;  1ELZ A;  5HAT A;  2CUY A;  4B9U A;  4MMO A;  1RWM B;  1R6Y A;  3DDK A;  2MB0 B;  2V63 A;  3NKP A;  4UY8 5;  4PWD B;  1KHV A;  1N5Q A;  2OHD A;  2DIU A;  2YKM A;  4ZVS B;  2R2S A;  1F0X A;  1AJD A;  1SL0 A;  3EIC A;  4F4Y A;  3FRZ A;  1PYS B;  2KFN A;  3I56 S;  2R8K A;  2X1A A;  3RZA A;  3NNC A;  2WSE C;  4IYQ A;  5L1J A;  2YWF A;  1TQL A;  2W5X A;  2HHS A;  4GO5 X;  2J5A A;  5IJQ A;  3NP5 A;  1FX2 A;  4KE5 A;  2XG8 A;  1VIO A;  2XUL A;  2LQ9 A;  2RQK A;  4OI1 A;  1JXL A;  2H3E B;  1IWG A;  5I42 B;  1W25 A;  3LP0 B;  2HHV A;  2VQF J;  3CDE A;  1S76 D;  1M1G A;  4BC9 A;  4DL7 A;  2FYX A;  4V19 X;  2ZHB A;  1VQM S;  4K4V A;  3EVO A;  4ZP8 A;  1SHQ A;  1D1U A;  1T05 B;  2O66 A;  3CC7 S;  2OPR A;  3DOM B;  1FEH A;  4TKT A;  1Y5L B;  3QRQ A;  3RAX A;  1RHK B;  4X4O A;  3CJS A;  3QBC A;  3Q8V A;  4ZG9 A;  1PYO B;  4USI A;  2D74 B;  3QT7 A;  1ELX A;  2O5D A;  4ZJQ A;  3GII A;  1ZPW X;  3NGT A;  4ED0 A;  5A8W B;  2L3M A;  3FEY B;  3BR8 A;  3W62 A;  3QWU A;  4IH5 A;  2CQ1 A;  4JI0 J;  1RZM A;  1FKO B;  1DAX A;  1S6Q B;  1VRT A;  3PEJ A;  1MNE A;  3RBE A;  3ZZR A;  4ELU A;  1APS A;  4ZLJ A;  4U8V A;  3FQL A;  1HBN A;  4TVA B;  4JI1 J;  3QO9 B;  1QTM A;  2P9E A;  3FFI A;  4CTA B;  3A1Y G;  3GON A;  4YQW A;  4ED7 A;  1HMV A;  1IQT A;  4ILL A;  4KT0 C;  2RVJ A;  3W2V A;  4WP9 A;  2W9C A;  3OL9 A;  3OR2 A;  1UVK A;  1ZTW A;  2VFR A;  1U24 A;  2B7B B;  1EP4 A;  1U2C A;  2AJF E;  3W9I A;  1YQH A;  1U0S A;  1OY8 A;  5IFM A;  2A18 A;  3IGY B;  4ID8 A;  5THW A;  3RU0 A;  1FRI A;  1V3Z A;  1P8G A;  4ECR A;  3VAJ A;  2XO7 A;  2J9D A;  2OI2 A;  1Q86 T;  4USU A;  4XPE A;  4J5O A;  3CD6 S;  5L0B A;  4ZHR B;  4LF7 J;  4AL5 A;  1LNQ A;  2P9G A;  4F36 A;  3HPO A;  1HBM A;  3HHL D;  3M6U A;  2O3D A;  4WFB Q;  4KPY A;  3R5C A;  5LM7 E;  1RA7 A;  4UZC A;  4U96 A;  1OJ4 A;  4LVO P;  4J9O A;  2E5H A;  3CJK A;  4FDJ A;  5GRR A;  1CC8 A;  4K2X A;  3R5D A;  4ZMM A;  2J9E A;  3J7Y U;  4UOG A;  5C42 B;  2HFS A;  5F9L A;  3GIK A;  2JWN A;  1VGY A;  2YWG A;  3TAM B;  3GSD A;  2B56 A;  1OO0 B;  3HMJ G;  1VQ7 S;  2YWK A;  3IR7 B;  1PBA A;  2GAG C;  4UOP A;  4QJV A;  1LWX A;  1ZBT A;  5IT4 A;  4KHP F;  3BO4 A;  4WK3 A;  4NXN F;  2RAQ A;  4DWI A;  5HRO B;  3PY8 A;  1XR6 A;  3NG8 A;  2HHW A;  1FD8 A;  4NYO A;  4CM0 A;  5D15 A;  5JXS A;  4CLF A;  2YX7 A;  3ZZ0 A;  3DRR A;  1EW8 A;  2VFV A;  2E5I A;  4B17 A;  1DUR A;  2IY5 B;  2BE7 D;  5KT5 A;  1DTT A;  3MMB A;  4WFA Q;  5J2M B;  1Q82 T;  3ET6 B;  4WZQ A;  3HJV A;  5BR8 J;  2W4C A;  2PDA A;  1FX4 A;  4CNZ A;  4QQB A;  4WFX A;  3VGV A;  5T7L B;  3AB4 B;  4OZ2 A;  4LIW A;  4WYL A;  2VOP A;  1RLD A;  2ZH8 A;  2FHK A;  3Q8Y A;  4FPI A;  3NOC A;  3IWL A;  1B70 B;  1IN0 A;  3AQP A;  4ZK7 M;  1J27 A;  5AJ3 F;  1U1O A;  1PAU B;  1PC4 A;  3UN5 A;  1WUU A;  3D28 A;  3US5 A;  4ED6 A;  1DZ5 A;  1ZAV A;  3QYY A;  2I6W A;  3T1Y J;  4NL5 A;  3D66 A;  3NGS A;  1N34 J;  1RAA B;  2UUA J;  2QN6 B;  5D0R A;  5A0Y B;  1EX8 A;  2BQ3 A;  1GH8 A;  3O2I A;  4UPK A;  3RW7 A;  4ELV A;  2MSS A;  1MMD A;  2I8E A;  3CJ3 A;  4CH7 A;  2CWK A;  5F8G A;  1IVZ A;  2KZM A;  3K8V A;  3AH6 A;  2R8J A;  2GO8 A;  2DIT A;  4NOH A;  2ZBI A;  5I3Q A;  1GMU A;  1XMQ F;  3ETM A;  4GC7 A;  1S0O A;  4OI3 A;  4ZVH A;  1WOS A;  3NKR A;  1HQE B;  3CJR A;  3VGU A;  3L3C A;  2YKN B;  3NKY A;  2AKW B;  4X4T A;  3MEE B;  5K5M A;  1VC6 A;  3MCS A;  1S57 A;  1SBR A;  2CPX A;  3D0H E;  1YLX A;  2BM1 A;  4CRJ A;  1T9W A;  2FLN A;  3KJV B;  2KHD A;  4NZ6 A;  4RW8 A;  4G1P A;  2VPW B;  3MM6 A;  4LFB J;  2V2Z A;  3RTV A;  4BWJ A;  1QUP A;  1E2S P;  2E44 A;  3JSM B;  3HVT B;  2V5H G;  2WTF A;  3AFG A;  2IJF A;  4WII A;  4WE1 A;  4KJI A;  3RJM B;  3LOU A;  1ITP A;  4Z37 A;  3H0P A;  1FD2 A;  3KLH A;  1GTE A;  2VFU A;  1BMQ B;  2CQ0 A;  2HHQ A;  3KK3 B;  4YB5 A;  1KVJ A;  4ETX A;  5C25 B;  1RT5 B;  4L74 A;  4FXV A;  3SEO A;  2VOD A;  1F6T A;  2WRM A;  1VOM A;  1S99 A;  4JUZ A;  3KK1 A;  3FBC A;  4C97 A;  4B3M F;  3NNA A;  4OHZ A;  1HR0 J;  3BBC A;  1FNX H;  4P74 A;  1ZA1 B;  3U1M A;  4M5J A;  3J7Z T;  5U47 A;  2HQC A;  1TL3 B;  2IFY A;  1B4S A;  2JVR A;  3JSY A;  5IT9 Y;  1ALI A;  4FNI A;  3P96 A;  2OD6 A;  3L4B C;  3C16 A;  2GAH C;  4RU9 A;  3M6W A;  4WPA A;  3V4M A;  4IOB A;  4DR6 J;  2OAU A;  3P3D A;  1VC0 A;  5HP1 A;  2GJF A;  1WEY A;  4IOC Q;  4OHW A;  3H40 A;  4R5P A;  4WWS A;  2HBR B;  2EBE A;  4DL4 A;  1RAI B;  3IRW P;  4HTI A;  3BH6 B;  1T9X A;  2QFI A;  1RWW B;  2W9B B;  4N41 A;  1FO1 A;  3SQG B;  4YDX A;  4JV2 A;  4Y6I A;  4O44 B;  3GG0 A;  1WDD A;  2MYF A;  2GLQ A;  4PG4 A;  1FVS A;  2AIR B;  1YJW S;  3OFG A;  3KMS A;  4DUZ F;  2GMJ A;  4NYP A;  4RNO A;  3UCU P;  1F1B B;  2RS8 A;  1C4C A;  1HHS A;  2XTJ P;  3CDB A;  4CLW A;  5H1S V;  3DRP A;  4LIR A;  2C3P A;  4Q43 A;  2F65 A;  1ZH5 A;  1KQG B;  2JSX A;  5ETQ A;  2WVF A;  3MWB A;  3IRX A;  1X4F A;  1EKS A;  2AZ3 A;  1JLQ B;  4EO8 A;  1KHL A;  2WB4 A;  3D4J A;  1OQ3 A;  1U45 A;  3MFH A;  2ZNZ A;  5D0H A;  4QWC A;  1R89 A;  3UCG A;  2KO1 A;  4TXS A;  5H9E J;  4CLP A;  1NND A;  3MAA B;  4NRT A;  1RCX B;  4K5S A;  4BHQ A;  4ALZ A;  3ISN C;  4U9R A;  4ECW A;  4LRE A;  1AJC A;  2XYP B;  2F63 A;  4ED5 A;  2IJN A;  3JTN A;  4ILR A;  3M2V A;  2C2Z B;  3RB6 A;  2BW7 A;  2RQM A;  1YZ6 A;  2EEY A;  2PMH A;  1RHM B;  3WZ0 A;  2OMO A;  2VAS A;  1SJQ A;  5K9F A;  3C6U A;  3G86 A;  4DXL A;  1KHK A;  1ZA2 B;  1RT7 A;  4ECT A;  2BX6 A;  3N5B A;  4GO7 X;  2VA3 A;  4FYY B;  2EFV A;  3OLA A;  5LT5 A;  2XCA A;  2W01 A;  3PIP Q;  1RTI A;  1X7V A;  1AXQ A;  2HHP A;  4LBI A;  3RAM A;  1HNW J;  5HVG A;  2VJV A;  2ATL A;  2XS7 A;  3G71 S;  2V4R A;  3D0I E;  3TI0 A;  3DLB A;  1UA0 A;  1VQS A;  1BWV A;  2XI2 A;  4OX9 F;  2AJ2 A;  1Q95 G;  2PGC A;  4K4X A;  3PHE A;  1FCA A;  4JV1 A;  3NL0 A;  2P9C A;  1H3D A;  1FVQ A;  1J5O B;  3C6T B;  2HMI A;  2Z0G A;  3BN7 A;  5HMW A;  3I0S B;  1N32 J;  3DDN A;  3CCV S;  5J1E B;  4AQY F;  4ED3 A;  1TUV A;  4HAC A;  2ZM6 F;  1WG1 A;  3QT5 A;  2ZH7 A;  4C9D A;  1MRO B;  1YZ7 A;  3K5N A;  4LQY A;  4R8U A;  5AE2 A;  2OUG A;  1ZZN A;  3DMJ B;  1IXK A;  2V2V A;  3PCO B;  3CO0 P;  1RT1 A;  2CJ9 A;  1S9G A;  1OYE A;  4CT9 A;  2JC1 A;  1N54 B;  2WK4 A;  4JI2 F;  4PAA A;  1M1K T;  2DR7 A;  5CYQ A;  4J9U E;  3P6Y C;  3SDE B;  4DS5 A;  1R8C A;  1T9Y A;  2ROP A;  1DQA A;  1L3K A;  2CIM A;  3GYX B;  5AXL A;  3OSN A;  3DI6 A;  3J81 Y;  2AJ1 A;  3UR0 A;  2B4V A;  4UPL A;  4USW A;  3K5L A;  2OH2 A;  1D09 B;  1R6V A;  4EI2 A;  3OL7 A;  2C2R A;  3OTO J;  1KR4 A;  2E7W A;  3HK2 A;  5D0G A;  2Q3P A;  1IBL J;  4NLX A;  4DZ6 A;  4CLT A;  2B9Y A;  3VQS A;  5KG1 A;  2WOM B;  3KLG A;  2B6A B;  3T9Z A;  2ZJR Q;  2WBR A;  5J2Q A;  4OX6 A;  3BGO P;  1A6L A;  1HNI B;  4DJB A;  1Q8B A;  2R8I A;  3T1H F;  2ZD1 A;  1PYT A;  3UI3 A;  4C8L A;  2MKS A;  2HVZ A;  4FBT A;  2VU5 A;  2XZD B;  5E5N A;  3AOC A;  4FF3 A;  5EWF A;  3DHW C;  2AWZ A;  1GAO A;  4QBU A;  2XNR A;  5DM6 Q;  1H38 A;  2IVF B;  3IN5 A;  3MCO A;  3BGF A;  2D3U A;  1LKZ A;  3I5C A;  1FXL A;  1SHN A;  3H42 A;  3B6B A;  3N9U C;  2FVC A;  4JV5 J;  4KBI A;  3NWR A;  5A76 A;  3V81 A;  2W1B A;  3HHL B;  3BSA A;  1EW9 A;  4ZG6 A;  1RSC A;  1ZAX A;  1FEE A;  3LP1 B;  2DNR A;  2DGQ A;  3JS9 A;  2WBM A;  1DHM A;  1GX6 A;  2HNY A;  1K1Q A;  4K5R A;  2JVO A;  3Q0A A;  1NJZ A;  2W4P A;  3KUH A;  9ATC B;  3KDO A;  1M5H A;  2CQI A;  2FZG B;  4FXD A;  3FCW A;  1VQ9 S;  5DQH A;  1PG5 B;  2ZIT A;  5BYQ A;  3D0G E;  5KXA A;  2LLZ A;  2LQJ A;  4JI5 F;  2R7Q A;  1FI4 A;  1DJ0 A;  1Y7A A;  2RD5 C;  3VAK A;  5FII A;  3M7V A;  2ZUG A;  1AFJ A;  1TKT B;  1RTH B;  3AA9 A;  2DGV A;  4LMZ A;  2R8H A;  3DLJ A;  4USJ C;  1KD1 T;  2J9C A;  1XK8 A;  2H9Z A;  2M4M A;  2BAN B;  2LDY A;  3BYR A;  1W7W A;  4K4Y A;  3F41 A;  2ILZ A;  3UQS A;  1HWK A;  1K44 A;  4NI2 A;  4NA1 A;  1WTB A;  4WXW A;  3NOG A;  1FTR A;  3KHL A;  3DN9 A;  5DRK A;  2DH8 A;  3W1Y C;  2XHW A;  1TTH B;  4C48 A;  1R0A A;  1RT4 B;  2YNI A;  2IHR 1;  8AT1 B;  1NBE B;  5K8P A;  5KG4 A;  2IBO A;  2ZOM A;  1TL4 A;  4DL3 A;  1NEE A;  2JC0 A;  2XLJ A;  1BQX A;  1IKX B;  1WF1 A;  3LTO A;  3PRV A;  5IC4 B;  3E2E A;  4KJG A;  3OR1 B;  2FY1 A;  1LV5 A;  3X1L B;  3E01 B;  4DUT A;  2B9W A;  3MM6 B;  4CO1 A;  3C15 A;  2QZU A;  2D3O R;  4LF5 F;  5HMX A;  3MM7 A;  4DR2 J;  2PEB A;  5KFR A;  2CJK A;  2ZKU A;  4E98 A;  3BGU A;  2J7K A;  1AYE A;  2QSW A;  3PJ9 A;  3EE3 A;  1YG0 A;  3GYG A;  3CD7 A;  2MQL A;  5E3Q A;  1RHR B;  2DK2 A;  3B54 A;  3M6X A;  4XK8 C;  3WX4 A;  3GIJ A;  4QYR A;  2XY6 A;  4A8W A;  4L75 A;  1OPI A;  3OTC A;  2RQC A;  3GB0 A;  1H7X A;  1TV6 A;  1TVR A;  2HLU A;  3GYN A;  1Q5Y A;  3CUN A;  3FEX B;  2YY3 A;  2R8G A;  1K0V A;  3B78 A;  3AT1 B;  3UCZ P;  1VBZ A;  3I82 A;  3OVS A;  1QD1 A;  4RNN A;  2QRR A;  2DNP A;  1OY9 A;  1UJ4 A;  2AW0 A;  5HJY A;  1BGX T;  2EPI A;  1DLO B;  1MW7 A;  1ICE B;  4H54 A;  5IQ6 A;  4OHX A;  2J0X A;  2YPY A;  3MCN A;  3T00 A;  2RIJ A;  3C16 B;  4OYP A;  5HVF A;  4M8L A;  3KYL A;  1WEX A;  2OEK A;  3PDN A;  2PMZ D;  4EEY A;  4IG0 B;  3LAM A;  1WKL A;  2HK3 A;  1TL1 A;  2DGW A;  3CUL A;  2A6M A;  1W2I A;  3WAY A;  3D3B J;  1JLG A;  3KLF B;  1S4F A;  5GAH I;  1JXV A;  3MMJ A;  3R27 A;  2W5V A;  3KOA A;  1O51 A;  4L76 A;  1UZD A;  4IDK A;  3MK0 A;  5EX0 A;  4DN0 A;  2QA4 G;  3KTQ A;  1UP1 A;  3WBH A;  1DQ8 A;  1EZZ B;  3MR3 A;  1OSD A;  2Z2L A;  5HAN A;  5TJ3 A;  2KJV A;  3LGH A;  1WHY A;  5IJS A;  4YB1 P;  2HQ3 A;  2Q1L A;  3M2R A;  4W4M A;  1HHT P;  3KG4 A;  4KGM A;  2IUC B;  5IWA J;  1MWY A;  1AUK A;  1LXJ A;  3LH2 S;  2XRG A;  4C8O A;  2B9E A;  3BKU A;  2XSF A;  2GVD B;  4O0N A;  4DV4 F;  2QTW A;  4RKU C;  1KLM A;  4KAV A;  2V50 A;  1CUL B;  3WIV A;  1FJ7 A;  3P8B B;  4IG3 B;  3M9N B;  3NKO A;  2OPP B;  3LW5 C;  5GMD A;  1YJV A;  1H73 A;  5E2Q A;  3D2W A;  5L9N A;  1Q8I A;  3G8S A;  3PW7 A;  2GML A;  2V0N A;  2FHJ D;  1HQU A;  1ZET A;  3D6M B;  2CZ9 A;  4X4Q A;  2Y8Y A;  5E3P A;  1DAR A;  3PX6 A;  3MR6 A;  1TAU A;  5DLV A;  2M70 A;  3BZQ A;  1ALJ A;  5DS7 A;  4O23 A;  1GQE A;  4AL7 A;  3LPE A;  2HVE A;  3C6U B;  4DUY J;  3QFW A;  3HHL C;  2I5J A;  4PCQ A;  2HND B;  1HD0 A;  3OTB A;  5T14 A;  4J7C A;  3I55 S;  4J9S A;  3PVX A;  2HZC A;  1RTI B;  5L9X A;  2ZH5 A;  3DLK A;  1M1H A;  2FLP A;  3QNW B;  2F7V A;  1W26 A;  2V4Q A;  1FRL A;  4X65 J;  2UU9 F;  4LFC J;  5JJB A;  4EYI B;  4HI2 A;  5HQ8 A;  4GKK J;  3QAU A;  3KHH A;  3SCK E;  2NYI A;  3PG9 A;  4A47 A;  1N5Y B;  2R7R A;  2E7X A;  4ZVE A;  3CMQ A;  2V8G A;  4DR4 J;  3HSD A;  1TMM A;  1GMW A;  3MEG B;  5FDL B;  2QLB B;  4L6V 3;  1HPZ A;  4DV5 F;  1Y3J A;  2VQE F;  5HQM A;  1HL6 A;  4CYS A;  2EKN A;  2W2O P;  1HNX J;  4M63 A;  4FZV A;  4LSL B;  3KJF B;  4WTY A;  4O0I A;  2W2M P;  4UY8 T;  4DLG A;  1YIT S;  4RR5 A;  1R3N A;  2VD3 A;  1JLA A;  1RAB B;  3JYT A;  4YY3 J;  3CCL S;  2VV5 A;  3C8Y A;  3BRE A;  2BBE A;  3VAF A;  3CO9 A;  2YTC A;  2MQN A;  1KTV A;  2OPQ B;  2RF2 A;  2YVS A;  4FP9 A;  2B8P A;  1FDB A;  3QGP A;  2X1B A;  2OP5 A;  2VG7 B;  1EB0 A;  4I2P B;  4F4K A;  3BPS P;  1NDC A;  3MMA B;  1A0O B;  3UDC A;  4X64 F;  2ASL A;  5IC6 B;  2VJU A;  1ZZF A;  3AOB A;  1N0U A;  4WYW A;  5LSR A;  2A2C A;  3MHY A;  1YRU A;  1WC1 A;  1X5P A;  2J7W A;  4X4R A;  4CLZ A;  2IA0 A;  4DX8 H;  1WOP A;  4HEA 9;  1K73 T;  3ZZT A;  5G0R B;  1UFK A;  3G8T A;  4DLE A;  3CJQ A;  3MUR P;  1NK8 A;  2HBQ B;  5J2Q B;  5DGB A;  2BUN A;  3CJ5 A;  3TUJ C;  2VDI A;  2NLW A;  1FRX A;  1T0T V;  2ZD1 B;  2L41 A;  2KDO A;  1HBU A;  4BWM A;  4ZP6 A;  4DR3 F;  4CO5 A;  2OFG X;  5IV3 A;  1XEZ A;  2E5J A;  3PO4 A;  1IKV B;  2G2O A;  3VR1 A;  1D9D A;  3R97 A;  3JAM U;  5KFE A;  1IBM F;  3BPD A;  4MTP A;  3VHQ A;  2UV8 A;  3DGP A;  4YS2 A;  4ZLN A;  3M30 B;  1UVN A;  2LEA A;  3WC0 A;  5KFQ A;  5KG3 A;  5KFT A;  5ETL A;  6AT1 B;  2H51 B;  3D6H B;  3HHN B;  4I2Q A;  3LWL A;  5K8O A;  3TX0 A;  3D67 A;  1M0S A;  3I6P A;  3ENQ A;  1BQN B;  3AD7 C;  3OJS A;  4CO0 A;  4CLL A;  1URA A;  5GAE I;  1NZA A;  1JKH A;  3EXC X;  2DRA A;  2MHN A;  1ZAW A;  4FVM A;  1UL3 A;  4NRU A;  4CLS A;  2F8H A;  3DPC A;  4MAK A;  4F0M A;  1H98 A;  3S01 A;  3A12 A;  3EWG A;  3OFH A;  2R9L A;  2VFS A;  3OW2 R;  1Q8K A;  5RUB A;  2H5I B;  2V9W A;  3OXL A;  4OZJ A;  3VQT A;  3CF5 Q;  2BE2 B;  1CJK A;  3V6D A;  3Q8P B;  3DRS B;  2FC9 A;  2YNH A;  1HA1 A;  2KZZ A;  4MIB A;  1SIZ A;  3RAQ A;  3T6J A;  1X9W A;  1ROF A;  3WAV A;  2YBV A;  3IM8 A;  5DGA A;  3G8Q A;  1NK7 A;  4JI8 F;  3CE8 A;  5GAD I;  2HRT A;  1KC8 T;  1KS2 A;  4NI2 B;  5KFK A;  3MPD A;  3A4T A;  3QIP A;  4DI6 A;  1R0A B;  2QYG A;  2BJ3 A;  3I5A A;  1XMB A;  3W2W B;  3D9B A;  1D0E A;  2UUT A;  4N76 A;  4ZVF A;  3THT A;  4DFJ A;  3RRG A;  1JMT A;  2UUC J;  3OQ2 A;  1IQZ A;  2GIQ A;  3VGT A;  3GG1 A;  2MKH A;  1P9Y A;  5ETR A;  1Q5V A;  1BC6 A;  3EGW B;  1A7G E;  4DSI A;  4DFM A;  2HRY A;  4R0E A;  2XGQ A;  4FYW B;  1LFP A;  1FKP A;  4X4S A;  1CJV A;  1S6U A;  4DR1 F;  4LBH A;  3WDO A;  1DFD A;  2M88 A;  1XNQ F;  3WAW A;  2J8A A;  5JUM A;  3PHT A;  2GVZ B;  2YQ0 A;  2KVI A;  1TVR B;  2HNZ B;  1KLN A;  1RE1 B;  3J80 U;  5GAG U;  1DY3 A;  3DLG A;  1XNR J;  4CI0 B;  2W5Q A;  1T7P A;  1S48 A;  4QYZ K;  1U2R A;  5C24 B;  2CRL A;  1V3S A;  3L7P A;  2HZA A;  4ZPB A;  2DGO A;  2R2U A;  3OUY B;  3D1Q A;  3MDF A;  2XMT A;  5DET A;  1LW2 B;  3Q89 A;  3DRX A;  3NBP B;  1TKX A;  4YHH J;  4HH1 A;  4M5I A;  4M95 A;  2RKI A;  3RBX A;  2WAQ D;  1LWF A;  1FFW B;  2OML A;  2F3J A;  1S0V A;  4XPC A;  2W8D A;  4ECY A;  1VJQ A;  4AFF A;  2ATC B;  1T3N A;  1X9S A;  4JV5 F;  1ZM9 A; 
#chains in the Genus database with same CATH homology
 1KHK A;  3UNY A;  3CMR A;  4LQY A;  1ED8 A;  3M8W A;  5GOV A;  1AJA A;  3NKR A;  1ED9 A;  4MHX A;  2VQR A;  5TJ3 A;  1AJD A;  4UPH A;  1HJK A;  4CYR A;  5IJS A;  5GRR A;  4FDJ A;  2GSO A;  1ZEF A;  1KH5 A;  4LRC A;  4GTX A;  4GTW A;  4CXU A;  5LRN A;  3Q3Q A;  4N7T A;  1E3C P;  3UN3 A;  5C66 A;  3WAW A;  4UOO A;  4CXS A;  2IUC B;  4LRD A;  3OT9 A;  2XR9 A;  5K4P A;  4LRA A;  3M8Y A;  3MK1 A;  3UN5 A;  3T02 A;  2W5X A;  4LR7 A;  1K7H A;  1KHL A;  5EGH A;  2X98 A;  1SHN A;  2IUC A;  3IDD A;  2W5T A;  4GTY A;  1E1Z P;  1Y6V A;  5IJQ A;  2IFY A;  1AUK A;  5DLW A;  4B56 A;  3WAV A;  3IGZ B;  1ALI A;  2ZKT A;  3BDG A;  2XRG A;  2GA3 A;  1ANI A;  5DLT A;  1P49 A;  4UPL A;  5HRT A;  1N2L A;  4ZGA A;  3BDH A;  3DYC A;  1EW9 A;  4ZG6 A;  2ANH A;  2W5Q A;  5LRM A;  4LR9 A;  1EJJ A;  1O99 A;  4KAY A;  3SZY A;  5EGE A;  4UOP A;  3SZZ A;  4KAV A;  5L0K A;  3TG0 A;  3BDG B;  3ED4 A;  4ZG7 A;  3BDF A;  4LRF A;  3MK2 A;  5AJ9 A;  1ELY A;  3NKN A;  3T00 A;  3TX0 A;  1SHQ A;  1B8J A;  1EW2 A;  4GTZ A;  1HDH A;  4UOR A;  3IGY B;  4FDI A;  5L0E A;  4KJG A;  1E2S P;  1ALH A;  1URB A;  4QAX A;  4LRE A;  4UPK A;  1URA A;  4MIV A;  1AJC A;  3NKO A;  4MY4 A;  4NWJ A;  1O98 A;  1ALK A;  2QZU A;  4KM4 A;  4ZG9 A;  2W5S A;  1KH7 A;  3KD8 A;  5LIA A;  2GSN A;  3NVL A;  3DPC A;  2G9Y A;  4KJD A;  4NWX A;  1ELZ A;  1ZEB A;  1EW8 A;  1KH9 A;  1FSU A;  3WAY A;  2W5W A;  1HQA A;  1ELX A;  4LR2 A;  2GSU A;  3UO0 A;  5KXA A;  5L0B A;  3A52 A;  2W5V A;  2W8S A;  1KHJ A;  1ANJ A;  3NKM A;  1EQJ A;  1KHN A;  2GLQ A;  3NKP A;  3M8Z A;  3T01 A;  3MK0 A;  1EI6 A;  3TWZ A;  4UPI A;  1Y7A A;  5INH A;  2D1G A;  3WAX A;  4YR1 A;  2W8D A;  2W5R A;  4TN0 A;  4CXK A;  1ZED A;  1KH4 A;  4LR8 A;  3LXQ A;  3B5Q A;  5DLV A;  3M7V A;  1E33 P;  4LRB A;  5LQQ A;  3E2D A;  1ALJ A;  2RH6 A;  3UN2 A;  4CYS A;  3WBH A;  1AJB A;  1N2K A;  3NKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...