3M8WA

Phosphopentomutase from bacillus cereus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 140
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8wA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8wA01
2GSNA 3UN3A 4LRCA 5L0BA 1O98A 2G9YA 3WAVA 4UORA 4YR1A 4CXKA 4UOPA 2IUCA 4CYSA 3MK0A 5GRRA 1KHLA 1ZEFA 4FDJA 1KHKA 1EJJA 2GA3A 3NKPA 3T01A 5IJSA 5L0KA 1AJBA 3M8YA 4ZG7A 4CXSA 3NKNA 1KH5A 4MHXA 1ALIA 3B5QA 1E2SP 3BDFA 1SHQA 3KD8A 1B8JA 3BDGA 5KXAA 2W5SA 4QAXA 3CMRA 1ANJA 4UPLA 3E2DA 4KJDA 4FDIA 3M8WA 3WAXA 3BDHA 2XR9A 1ED9A 2IUCB 4LQYA 1EW2A 2ZKTA 4ZG9A 5HRTA 3DYCA 3M8ZA 2VQRA 4UPKA 1EQJA 4MIVA 4NWXA 5L0EA 4ZG6A 3BDGB 1AUKA 1ELZA 1HJKA 3Q3QA 3TX0A 1ED8A 3UO0A 3SZZA 2ANHA 4LREA 5K4PA 4UPHA 1Y7AA 2W5RA 3NVLA 3WBHA 2W8DA 1E33P 4LRFA 4LR7A 4LRBA 3NKRA 3UN2A 4LR8A 5LRMA 2IFYA 4GTZA 1P49A 3T00A 1EI6A 3UNYA 4GTWA 1K7HA 2W5QA 2GLQA 4LR2A 1ANIA 1ALKA 4CXUA 1URAA 3LXQA 4KM4A 5EGHA 2W8SA 5LRNA 1KH9A 1N2KA 1AJDA 5DLTA 5TJ3A 4UOOA 3IGZB 2W5TA 1N2LA 1EW9A 1HQAA 3IDDA 2GSUA 4TN0A 4UPIA 5DLWA 2W5WA 4ZGAA 1URBA 5LIAA 4LRDA 5INHA 1ALJA 1ALHA 1E1ZP 4KJGA 3UN5A 2W5VA 4LRAA 1ZEBA 1O99A 3MK1A 4GTYA 4N7TA 1KH4A 1KH7A 4B56A 1SHNA 2D1GA 3A52A 1Y6VA 3NKMA 3ED4A 1ZEDA 3NKQA 3NKOA 2XRGA 4CYRA 1KHNA 3SZYA 1AJCA 1E3CP 2GSOA 1FSUA 3WAYA 4NWJA 2RH6A 2W5XA 5LQQA 4LR9A 5IJQA 1KHJA 3TG0A 1ELXA 4KAVA 1EW8A 3M7VA 1ELYA 2QZUA 3OT9A 2X98A 3DPCA 3MK2A 1AJAA 1HDHA 3TWZA 4MY4A 3IGYB 3WAWA 5AJ9A 5GOVA 3T02A 4KAYA 5DLVA 5C66A 5EGEA 4GTXA
chains in the Genus database with same CATH superfamily
1VQ9S 1XBWA 2G1DA 2IM2A 4GMKA 3KLFB 5M2PA 3HO1A 3FC9A 3M2UA 2MJNA 2J6TA 2CAJA 4P7VA 2E5GA 4ZA1A 3SMZA 1N52B 1L3TA 1WKKA 3TA2A 1KHLA 4C0OC 4GKKJ 1ZEFA 2BANA 1VGYA 2X3GA 4TN2A 1T3OA 2F65A 2H9ZA 3DHWC 1B99A 2Q1LA 1UW9A 1WI8A 3NGTA 3PJ9A 5KFCA 2Q3PA 2YY3A 1KVIA 1F9EB 5L39A 2J0WA 4UUXA 5CQGA 3NKNA 2AKWB 1LNQA 2BANB 4J9QA 2XSFA 1N54B 2Z56B 4KBIA 4ZPTR 5LSOA 4ZVHA 2GQCA 3F41A 1W26A 3SCIE 3QFWA 4RL1A 3ZTSA 1XK8A 4M5HA 3V81B 4BBYA 1KOOA 2DNHA 2X51A 3BYRA 4OYXA 4ER8A 2KB2A 5T7LB 2K8GA 2IUCB 1XR6A 1FD2A 3ZZYA 4B02A 3ZTRA 3OTEA 4OYOA 4QOTA 4X84A 2V34A 1RT6A 2JOQA 3E3XA 4CYUA 1CBKA 3HVWA 3KLVA 3RBXA 2KZMA 4GRSA 1UVJA 3IM9A 3OUYB 2P9GA 2YX1A 2YWHA 2IMWP 5KFVA 5KOWA 5E2QA 1Q1KA 2CJQA 1ELZA 2R7OA 5G0RB 4MAKA 1MMLA 1BHNA 1RGVA 2EC2A 3CJ0A 3DRRA 3TOQA 1U2CA 1X4FA 3I4PA 7AT1B 2A2DA 1U1MA 1N5QA 4IRKA 2BW2A 1SC1B 5FD1A 3TAPA 1RBLA 2H65B 3BBBA 3OTOJ 3OL9A 2HVDA 4LBPA 3NVLA 1CJKB 2ZH1A 1HNVA 1N32J 2GQ2A 1VBKA 4NLYA 1F2GA 2EBGA 4HKQA 2XG8A 1S0NA 3FUYA 3R5AA 3QZ8A 3OXFA 2FJWA 1SQGA 3NAHA 3CJ2A 1YZ7A 1FERA 2R2UA 2RIJA 3PRDA 1TL1B 1K7HA 1RQ0A 2DXEA 5C7PA 2MKKA 3MFIA 2DXDA 2OFGX 1VFJA 1RT3B 1NKCA 3IS9B 2ZH7A 3P45B 1S1UB 3PXGa 1U02A 4DL0C 2AD9A 2CQDA 2IM3A 4UOGA 4J9RA 3OSPA 4K4VA 1DJ0A 5IT9U 3HT0A 4IG3A 1RTHB 3D1HA 1OQ3A 1S1WB 2YH0A 2F3JA 2KXFA 2LVWA 4HDHA 3EVMA 4PPDA 3DLJA 4EMDA 2GVDA 2QX0A 2W9CB 3BB5A 5KFHA 1SH0A 1FFSB 2CQGA 3OJSA 4ZCIA 1ALJA 2AYMA 4ZVTB 3M32A 1FDBA 4YR2A 2DNPA 3UN5A 2D3UA 1DY3A 4NPOA 4KTQA 2C2MB 1SHQA 4OHVA 1KH4A 2CQ2A 1TL1A 3M6UA 5DRKA 1JB0C 3QATA 3D1OA 1FRLA 4X64F 1WG4A 5KFEA 2BJEA 5K8OA 3T41A 2ZKUA 1S9EB 1TL7B 5HP1A 4IRCA 4NYPA 2B51A 5AXKA 2QLBB 1WEYA 3KNAA 4K0KF 1XJWB 4IFVB 3D6MB 4B08A 3OFGA 3BQ0A 2JHEA 5E33A 1YJVA 1LWCB 1SL1A 2KZZA 4KAVA 1CS4A 4GVLA 1XIQA 2XLKA 3DC2A 4LUBA 4UW2A 1IKWA 5DQHA 2NYIA 5K20B 3T5KA 2Q6CA 2M8DB 1RWWB 2YKOA 5AJ3J 4JV5J 2XQCA 1KLMB 3LP2A 3KWMA 2GMHA 1OO0B 3H5SA 2OO4A 4NEZA 3SCLE 4P6QA 2MGZB 2RHQB 4C98A 2RUGA 3J7A1 5C66A 3KUHA 2OPQA 3DYAA 4C97A 3HF5A 4I2QB 4JI1J 2MZRA 2YPYA 1OWXA 3LQVA 4U67Q 2HBYB 1HQUA 1LW0A 3G6YA 4I2PA 1JMTA 3P96A 3QO9B 1WF0A 3S1TA 2B8PA 3IR7B 4M5MA 4DV4J 4A8OA 4KAIA 3POTA 3PIPQ 1D8YA 1RZMA 1UKUA 1VHFA 3BEGB 3NKPA 1EQ0A 2AJ1A 2B9WA 2ZUAA 2H4WB 2FLPA 3DLKB 4XDDA 1AZSA 1DTQA 2LEAA 3HX9A 1X4CA 1G4CA 3DGPA 1BXNA 5KFTA 1X0PA 5LJ3Y 1RLDA 1VYAA 3KLGA 4EGLA 2KM8C 3CXCR 2ERRA 2DNRA 2C28A 4ECSA 4M95A 3GJTB 3OV7A 2HBZB 2YKMB 3GIJA 2AQ4A 1KLMA 1XMOJ 2KJWA 1DTTB 3MHYA 3KTQA 3BM7A 3RBEA 1NBEB 3RW6A 1WHWA 4ILLA 3GCXP 3LP0A 3FBEA 1ZM2A 3M8WA 2XSJA 1A6LA 4R8UA 1HI1A 2DH8A 1HKAA 3BGLA 3K58A 5I42A 1NK0A 2HNYB 4C6AA 1HQUB 1LW0B 2CJYB 3D3CJ 4FVMA 4L74A 4RX6A 4I67A 1HD1A 4U9RA 4ECQA 1HHTP 2MB0B 5I3UA 5T41A 3CEDA 2GMJA 8ATCB 1SQEA 2KO1A 4UOCA 4ZVEA 1KNZA 1EQJA 1BC6A 5L0EA 3K0JA 1ZM9A 4X65F 2VJUA 3R1HA 2V2VA 4WYLA 1RABB 2QA2A 3UR0A 2FB0A 2J6SA 2AX0A 3MM8A 2DD8S 1HNWJ 1RYSA 3IS9A 1VISA 2OPRA 1WEXA 1HWIA 4C48A 4I64A 2L48A 2NXEA 2C2RA 1JKHB 3OW2R 5E3PA 2VU5A 3TI0A 2BQ3A 1G6BA 1EHWA 3KOAA 5A76A 5E0OA 1RAJA 5FLXY 5F3ZA 3RAMA 5FJ4A 1F0XA 1S6QB 2AEFA 2I6WA 2ZD1A 3TRGA 5EHHA 2XLIA 4DV5J 3GB0A 1S9GA 4J5OA 3WDOA 1JLEA 1P9YA 2V2QA 2DBBA 4NLDA 4NZ6A 2QEXS 1ANIA 1N33F 4Y2MA 5KT5A 2XMAA 2RMLA 3OLAA 5HO4A 3EDRB 3NXZA 3G82B 5LM7E 1DZ5A 5DLTA 3CJ4A 3NOGA 2HNZB 5B0AA 4DHVA 2FUG9 3KLHA 1C0UA 1NHVA 5CYQA 1N2LA 1F2HA 4PCQA 3AJ2A 3WHIA 2VG5B 1ACMB 1NZAA 3G82A 1H3DA 1C1BB 1RAGB 1RP5A 2OD4A 3MEDB 4I6YA 2A6MA 3VGVA 3PIOQ 2YTCA 4WIQA 1JJ2R 4GKKF 1Q0NA 2GAHC 4DPUA 1LWFB 4KO0B 5C24A 4NLRA 2NR0A 4OZ0A 1YBTA 5J1PA 2I2YA 2KTQA 2NXCA 1JLGA 3N0VA 3CO9A 5CAAA 1UVLA 4QIVA 4O4RA 4M1KA 4XTTA 3KJNB 2UXDF 4N7TA 2BJ9A 2QRRA 1HBNB 4UQTA 1XC9A 2OTJS 3PEHA 1IBMJ 1KBRA 2VQEJ 3H8YA 2BJDA 2B7CB 2DGVA 4NEYA 3A12A 1ZS6A 3CJ5A 3FBBA 2PSZA 1TTHB 1VHIA 1VRQC 4IOBA 1WF1A 3CCTA 2DGWA 1PJ6A 4EUVA 3NMRA 3WAYA 1IR2A 5HMZA 4BLGA 1WG5A 1V3SA 4JB8B 1AUDA 4IQXA 1IKVA 1L3SA 3SI8A 1EW8A 4NRTA 4CIOA 3FZBA 3OSNA 2XGQA 3T1HJ 2X98A 5A2QU 2Y1JA 3DGVA 2R3VA 4DWIA 1DRZA 3QGIA 3I56S 1UEVA 3SCKE 2R8IA 3MD1A 2RNEA 4ZJQA 2MGZA 3V6KA 3Q8UA 4DL5A 2BR0A 2LQJA 2V8DA 3EXCX 2UVVA 4KAYA 1HWLA 1RT7B 4JI3F 4GTXA 2WOMB 2CIMA 4H4MB 2HHTA 2J5AA 2VL1A 3OVSA 1N5SA 3K2YA 2VBZA 2ZBRA 4DUZJ 1RT2B 3RG6A 3MM9B 4DS5A 1JLFA 3T3FA 2KDOA 4DUTA 2V8HA 3R5DA 5L8RC 3IG1B 2IFXA 2KM8B 3BDPA 4LF8F 3S7RA 2VFSA 5CYMA 3DRPA 5KFJA 1GFWB 3M8QA 1VK3A 4UY8T 1RWMB 1CJTA 1NCLA 3TJ8A 3BN7A 3RRKA 4K4ZA 1T03A 2VV5A 4IDKA 5GAGU 4Q44A 4LFBF 2NS1B 3K5MA 2R7UA 1WJ9A 3ISND 5KFUA 4HHJA 5B09A 2CVEA 4DFPA 2W9BA 2HQ3A 2UVWA 3E2DA 4V19X 2V6AA 3DMJA 4HYKA 3RB3A 1VQ6S 1N5YB 1HPZA 4H4OA 2AZ3A 4IOAQ 1ED9A 4V1Ak 3G9CA 2WTFA 3CPWR 5KT3A 3DI6B 3PYEA 2G0IA 2QO3A 2M8HA 3T5HA 4V19J 1AYEA 1UFWA 2KJVA 5D77A 4UPKA 1VQOS 4J9UE 2VJVA 4NWXA 2HWHA 2Y1LB 4YB6A 5D4NA 4F02A 3PV8A 1Y9OA 4B9LA 3KJFB 3Q3QA 1RI7A 2HZCA 3M32B 4MYUA 4WK1A 3SZZA 3EYZA 2KXNB 2AP6A 2VFUA 4F25A 3G6XA 5LMUF 4B3OB 1TL7A 4ETZA 3U02A 5HP1B 1O8BA 2RDDA 3NKYA 4K2XA 1OPZA 4X4VA 2MKSA 2W5RA 3MURP 2H3EB 2FIUA 1M1HA 3T5JA 2W8DA 2MKHA 4LRFA 4NLQA 4AYBD 3LWMA 4NLGA 1LW2B 2YNHB 5F41A 2G0CA 2PEBA 3A1YG 3OFEA 2RDIA 2FTRA 1KP6A 3N5BA 4GTZA 3HHLD 4ILRA 1FKAF 2Q6BA 4FKYA 2RSQA 1RBAA 2DHGA 4NX9A 2JL9A 1S1VB 3OXGA 3UPFA 2DPIA 1QUVA 1C2PA 3M9NB 1ZH5A 2E7WA 1S12A 2EK1A 3T1AA 3RRGA 1FWKA 1N2KA 3CJRA 2J6UA 1TZ0A 2P9CA 3E01A 3U1NA 1YJ7A 4C7QA 4LVOP 1OY8A 1VK8A 3M1VA 1HI8A 3H40A 1XMQF 4TN0A 4DJBA 1BLUA 3AA8A 5DS7A 3GFZA 3W2VB 4UT4A 1HNXF 1RLCL 2EEYA 1C1BA 3MEDA 4LF1A 4DCOB 2F40A 4J9SA 2PDAA 4ES3A 4LSNA 1CJVB 2HIQA 5DLGA 1LV5A 2F9DA 4G1PA 4C8LA 3OR2A 1ALHA 2BABA 1X9SA 1LFWA 3R27A 1VC5A 2KYXA 1IKYA 4QIWD 3HI9A 2GHWA 1UZHA 2YKNA 4QIEA 2FY8A 1W25A 1X5TA 3N4WA 2V2ZA 2ZJQQ 3QMQA 2VG6B 4I68A 4DU7A 3MR3A 2CQBA 4IUFA 1UVNA 4B56A 1TUVA 3KHGA 4TY8A 4B17A 4E8UA 2MQMA 3M2VB 3SFGA 3BN4A 3D54A 1MW7A 2JFDA 2ZITA 2CA9A 3D68A 4MIWA 4R8UB 3KHHA 2QMUB 1FX4A 2MZQA 3H2UB 3BBFA 4MK9A 1K1SA 1BQXA 3GIMA 1UVMA 2BE9B 1FSUA 2P6SA 2GSOA 1FJGJ 4CDIA 3IGYB 1DQ9A 5IJQA 3ZC4A 2X7IA 2EFVA 3CSKA 3MAHA 5H9FK 3KLGB 2BM0A 2VFVA 3S01A 2XMVA 1TKTA 2GHPA 2ZE2A 4L73A 1UEKA 4M5DA 2WVEA 1DURA 1FFWB 1RTZA 3FEXB 4CM2A 4DSEA 3R97A 1GMWD 5K8PA 1GMUA 5KFDA 3CMQA 2D74B 1XNRF 3MEKA 3EZOA 2F7VA 2Z4PA 3GWCA 4OI3A 5IOLA 3D0HE 4FBTA 2YNGA 4HH0A 1H7WA 2H51B 4J7CA 2HWIA 3Q8PB 1S7IA 2KN4A 2W1BA 2D3O1 5D78A 3KMQA 3TJAA 1PC4A 2XGPA 1HQEB 2FHJA 3ZNJ1 1HHQA 5HI7A 3IP0A 4QR0A 3G8TA 3SQOP 2C3OA 1N0VC 5IWAJ 4WIIA 3U1MA 4DR3J 1NB7A 2B9EA 4EU0A 3GFYA 3Q2SC 4PZVA 2W2NP 4YN3B 2MPUA 2YNIA 1GTHA 2YWGA 5DDPC 4B9MA 1FO1A 1TV6B 3MMAB 3R6GB 5ETSA 5L1KA 1D9FA 4LR2A 4DQSA 4M5GA 4KPYA 3LA0A 4ICLB 3H7HB 1F3VA 3MPWA 4FS1A 8AT1B 2JLFA 1RU1A 4OMFG 4CH0S 2OH2A 2MLYA 1K1QA 2E1PA 3G96A 1Y5LB 1EW2A 5C25B 3A8JA 4K4UA 4F4YA 1RDRA 1SQFA 2HHQA 4TYBA 4ZKAA 2V4RA 3V6HA 1AFJA 1FRXA 2DIUA 4A8WA 2FJVA 3GONA 3R3TA 5C2GA 1FK9B 3J7Z5 1RU2A 5LMNF 2E1MC 1FA0A 2KYZA 4EZ6A 2EC0A 3LP2B 1M5KC 4FXWA 1X4HA 3K5LA 4W92B 4RBTA 2POKA 3BH6B 2P8IA 5ETKA 1CC8A 2YQ1A 4O3PA 5KFZA 4O3RA 3F44A 4OZ1A 3UNGC 3FMBA 3LANA 1EX8A 1S9FA 3MGJA 4F2SA 1Q95G 1WHYA 4R5PB 2DR7A 4UPHA 2F4FA 5JVHQ 4DLGA 2A2CA 1U48A 2OUGA 1HWKA 2AGPA 4RKUC 5C24B 4Z2XA 5GAGI 1B3TA 4IR9A 2ABYA 2GIQA 1S6PA 1NHKL 2DR9A 2LP4A 1SVDA 3BGRB 2JFKA 3IAM9 4DL4A 1C1CB 4QYZJ 1UWBA 4KSEB 4L76A 2W5QA 1URAA 3GFHA 5E3QA 4HT5A 5F0WA 4MJKA 3U1LA 4CLZA 2OIHA 1UW4A 1JLCA 2JZ5A 4DX7A 2FJEB 1WSRA 3FEYB 2QLJB 3LGNA 4CLUA 3QNWB 2EXUA 4ZN1A 1NSQA 4NI2B 4ECXA 2B4PA 4DV5F 3R9LA 2EI5A 2L9WA 4DMZA 4USIA 1SUQB 2CJAA 4O4GA 1FT8A 2BV3A 2DO4A 2HNYA 3FRYA 2R7VA 5KFKA 1BQNA 5LIAA 2ZVSA 5B0EA 4RNOA 2UUCJ 4ZHRA 2J8AA 1U0SA 3C8YA 2E1CA 5KFXA 2MSSA 3MCMA 1J27A 2HVHA 3BGRA 3LO3A 1GX6A 3CIZA 3TVKA 3KHRA 2UUAF 1RHJB 1U26A 1VQSA 2AX1A 2OEKA 3D6HB 2GMLA 4NA3A 1RWPB 2IA0A 2V8PA 2HAFA 2WB4A 4ED1A 1B64A 2E5HA 3T1HF 2QSFA 3KKFA 2DVIA 2CQ0A 3RTVA 5F8HA 1Y6VA 2ZDOA 3DLKA 5A6PA 2XY6A 3CJTA 3IWNC 2IJFA 1U25A 2XMJA 2OGUA 5KT2A 3UFCX 4YY3F 4DR2J 1YTYA 2HHPA 5EWFA 1Q8BA 2LEBA 2W5XA 3E51A 3DOLA 2DGOA 1PSDA 3FSXA 4OHXA 4O3QA 3JYTB 4K0KJ 1XNQJ 2ZHAA 1S79A 4NZ0A 1UL3A 3PR4A 2G9OA 2J9CA 4DV2F 4ZPVR 1PG5B 4P2FA 3LP0B 2X1FA 4DR4J 1D9AA 5C25A 4I4BA 4ES2A 3B8HA 1NJXA 3GQCA 3QGGA 3NCQA 5D0GA 3MR7A 2E9TA 5KFIA 4CLKA 5I3UB 1XNQF 2GSNA 3DCAA 2KVIA 1R0CB 2JEJA 4LRCA 1KQGB 1F6TA 1VQYA 3BZQA 2B56A 1PBAA 4DSFA 3PY8A 1CS4B 5L0BA 4DV7J 4H54A 1VR6A 1RA7A 4CTAA 4N56A 2IUCA 4CYSA 3GJRB 3RJMB 2OFHX 1X4GA 3A13A 3O44A 2DEJA 2H5JB 3N28A 4A8KA 2V0NA 2JRSA 4M5JA 1ZZFA 2XYGB 1RAIB 2FGOA 1HMVA 1WDDA 4FPRA 2GC8A 3AY0A 2MJUA 4WFXA 3UI3A 2K1RA 5E3AA 4B9UA 4BS2A 2A3JA 3AH6A 2OEJA 1ALIA 4NA1A 1HBNA 2KRRA 3VAKA 4LMZA 1NK8A 2YVSA 2CDQA 2YWWA 3VQSA 3BKFA 3MPYA 5F8JA 4QW9A 4QAXA 4OL8A 2QL9B 3BPDA 3FCVA 3MF5A 5MAOA 1HA1A 4U96A 4C2MA 4FF2A 1XMOF 1P1TA 2HS3A 2AGOA 3CDEA 4ZIVA 2QL7B 2HQCA 3EZUA 1JLCB 3BR8A 4C4WA 4CM0A 2CPFA 3ETMA 5HBMA 3OR1B 4RR5A 4M94A 3CIMA 1CULA 2QJ3A 2APOA 3CCUS 4JV5F 2VQRA 3MUTP 4PRFA 2Z0GA 3MMBB 4K59A 1C1CA 1FHTA 3NBPA 1MNEA 3A3OB 1QE1B 4F26A 3UO0A 2HEKA 4OX9F 4OJ3A 4LSZB 1FX2A 1S1UA 4CLPA 2XBPA 2UUTA 1FXRA 1YZ6A 2CG4A 1V5VA 3I0RA 4WTYA 1AUSL 1X5OA 2YKQA 1YRUA 4Q2LA 4IG0A 3PNIA 4G1QB 4G1IA 3J80Y 1YJWS 2XS7A 1FKOA 3R5GA 1OYDA 1SPBP 1TL5A 2GVZB 5A8RA 3CMAS 2UXCJ 2MLXA 3BV8A 3RYLA 3HCXA 1BQNB 4EBCA 1T11A 1ULRA 3FCHA 4KGVB 2ACYA 4ZVSB 4O3SA 3E2EA 3ZZ0A 1YITS 2DTJA 2DH9A 1RWNB 1RT4A 3CJSA 1WEZA 3EICA 3LXQA 1M1GA 4K50A 1CG2A 1QY7A 1RHUB 2ZD1B 3DLGB 2WVCA 3DRRB 4QPXA 2WCXA 3HHKA 4YQWA 2BVZA 4PWDA 5TJ3A 4C8ZA 1TKTB 1QE1A 3DDNA 1MU2A 5DDQC 2IPOB 2XO7A 3F0NA 4HTIA 1SL0A 1GH8A 4OV1A 4MTPA 1J2VA 2IM1A 2K2PA 1ZEDA 3EWGA 1T7PA 1KD1T 1HBMB 2HLUA 1MSWD 1QSLA 1UP1A 1REVA 4O4GB 5E3CA 4ZGAA 2HAIA 2IBOA 3NOCA 4IDKB 1C0TB 3MEEA 4ZJOA 4Q43A 1VC0A 2EK6A 2N3LA 2O66A 2XSJB 2CPZA 4DL6A 4DPWA 1I6JA 1IM6A 2VB6A 3QSIA 3PKYA 1X0FA 2FHKA 2LDYA 3ZZZA 1YWXA 1XMQJ 4G6VB 3P5TL 1IM4A 4FNHA 4OJ1A 1SHNA 2Y3YA 2D1GA 3TEGA 4FYXB 1UETA 3K5OA 2AYGA 3TZYA 4ZVPB 1HMVB 1WTFA 3ZZOA 2E5JA 3JAMY 2OPRB 3L7UA 3Q0AA 4ERDA 4QWDA 3IBFB 3V2UC 4LF5F 5KFYA 2DH7A 1V3ZA 3OTBA 4M5LA 3RW7A 1U6BA 1KEKA 1KONA 2HBRB 2KU7A 2LQ5A 2U2FA 3NGKA 1FJCA 2QZUA 1HW8A 3VAFA 3JSYA 4J91A 2MKYA 5DJBA 1AZSB 4EZ9A 5DDOC 3HHNB 3K17A 4FKXA 1Z4UA 3QGHA 4KYZA 4WXOA 3OD2A 4DN0A 4WZMA 5EGEA 3P5BP 3G71S 4F8RA 2XZDB 4KFBA 2R7SA 4CP5A 3UN3A 4CNYA 1K73T 1IJEB 4ED6A 3UD4P 3VGSA 1YIJS 2FZKB 1BD6A 2FY1A 1QJHA 3W5ZA 1YG0A 2PC6A 2V5HG 4LFAJ 5RUBA 4A8XA 3PTWA 4PQUA 4ECZA 5ETMA 4DZDA 4X4OA 2R7XA 1R0AB 2XWXA 1H73A 1WWHA 2P9EA 4RU2A 5HAOA 4WZQA 1AJBA 4RW4B 5J2PB 2C3YA 1ZA2B 4KGZB 4DS4A 1XR7A 4HT7A 4L3KA 4MHXA 5HATA 2RILA 1ZZNA 5HBMB 1SJ3P 1CJVA 4OI1A 4XO0A 3I5BA 4Q8EA 4WXWA 3HFKA 3SIPB 3NGDA 2RE1A 3FRZA 1TK8A 1EP4A 1W2IA 2ASYA 3DRSB 1FKPA 4OLPA 5DZ6A 3UR3C 1TKDA 4F4KA 1ITPA 2W5SA 1MWZA 1S1XA 1QM9A 3G86A 3CCQS 2MEWA 3NAIA 1VRUA 4USTA 4OHWA 4LBIA 4U7CA 2BMBA 3GYGA 1MLAA 4F4ZA 2V2KA 1HPZB 1MROA 4H4OB 5GMKa 2E7XA 4U95A 3LWLA 1VCTA 2NCKL 3H90A 5ITHA 1S9GB 4X4TA 1Q8IA 2HZVA 2R8KA 2W7OA 3AAWB 4Q8FA 4KPCA 1NJWA 1TP7A 1FD8A 3NGSA 5JXSA 2HMIA 1SCJB 3OVBA 1MWYA 4J9NA 1VRTB 3HULA 3MM5B 3X3UA 1E6VA 1GK8A 3QWUA 4FXVA 1U0HA 4DV1J 2QGFB 1B7YB 3BPSP 3PACA 4F4WA 2COLA 3P49B 1CEZA 4P2MA 1U1NA 4NCBA 2WHOA 1A0OB 4HLBA 5KOXA 1WKLA 1T0TV 5SZTA 3IMQJ 4WFBQ 2F1FA 5K14B 4ZLNA 2YWEA 4S0MA 1UWAA 1S4EA 2YNGB 1FDDA 2WSFC 4K7QA 2DHSA 4C8OA 2QMXA 3EGZA 4QCLA 4NXMJ 1Y5NB 2MQOA 2BJ8A 3M9OB 2UVRA 1MMDA 5IT0A 1JWWA 1RTHA 1UJ6A 3AFGA 2Y9HA 3R8YA 3IGZB 1HNXJ 2V9WA 4JI6J 2BX6A 1JLAA 4U7UK 5F9NA 3C14B 3HPOA 2ZUGA 3H25A 4RWXA 5IC6B 5KFQA 1Q79A 4LF6J 3I32A 3UVJA 3AB4B 1Z2ZA 4DX5A 2AU0A 5IZHA 5DGAA 3WIUA 4ID8A 1N34F 4B3RF 4WCEQ 2C42A 1N5YA 2F4VF 1R31A 4QQBA 2DHAA 2DY1A 1NZ8A 3E01B 2W5VA 2VOPA 2AIRB 4NCGA 2VBXA 1O99A 3MK1A 2RF2B 8RUCA 3FBFA 5DM7Q 4DR5J 2BBEA 1VIXA 4GTYA 2BJ3A 1RHKB 5HMWA 1D1UA 1X31C 2ZVIA 4DV7F 3A52A 1CQNA 3B4DA 1R7IA 3BO2A 5J2MA 2JEGA 1FVQA 4X62J 1VIOA 2D7SA 3CJ3A 2V4JB 3X1LB 2WBRA 2J7KA 4CWBA 3Q2TC 3SDEA 1S0OA 1PAUB 2D3OR 1JLFB 3D6TB 5LQQA 3M8PB 4ED0A 2J9DA 5LOQA 3MAAA 4P75A 5D8HB 2Q79A 3SEOA 1NSKL 4DEZA 1WORA 3AQPA 3GCWP 3DPCA 1AJAA 3MECB 2BKOA 1RT1B 2AHOB 3LTOA 4C3MA 3V4IA 3P6YC 4USVA 5IM0A 3PX4A 1S6PB 2JEIA 1AXQA 3D66A 5GOVA 2O01C 2XCAA 4H4KA 5HVHA 4EO6A 4A4JA 1VQMS 2CPIA 1NXIA 2FJAB 1NLKL 3TZWA 5CCLA 1QDUB 5U47A 2IY5B 4CXKA 1SIZA 2HQFA 4FYWB 4PABA 4BCAA 2XYHB 3K8VA 5IT4A 3CD6S 4GC6A 3IXQA 1TL3B 4K8RA 1S4FA 3L3CA 3N6NA 3SDEB 1FNOA 4N8NA 5IV3A 2GA3A 2YKAA 1Y3JA 1YX2A 3C15A 3JQMA 5L46A 1VQNS 1RWOB 3EJMA 2JJ4D 3GZ7A 5CD4A 2MZJA 2QT7A 3B5QA 4ID5A 3UWTA 3QZ7A 2ZBPA 4B3OA 5L9NA 2HMIB 2HQDA 4ZPAA 4K4XA 4EYHB 3EPIA 4P10A 5KFPA 1GT8A 1ANJA 1YVFA 3JXOA 1TUGB 3HSZA 3QAEA 3VAHA 7FDRA 1BMQB 4MFBA 4DV0F 4WU2A 5L1JA 3JB9k 1H98A 1RT2A 3D0IE 3CWJA 2EFNA 1OJ4A 2XHWA 1VRUB 5L9XA 4IH7A 1KKHA 4LQ3A 3ZTQA 1TAUA 4CH7A 2FJXA 1Q16B 1UEUA 3Q89A 5HQ8A 2NPFA 4B3RJ 4HACA 3W60A 4KGKA 2WBMA 5EDWA 2LLZA 4MIBA 1EJ7L 3GG1A 3FK4A 5KFOA 3RRHA 4OFZA 3W9HA 1M0SA 2NPIA 4OJGA 2VPZB 4DX6A 4JUZA 1S57A 5J2QB 2XI3A 1HLWA 2M4MA 2DNNA 1X5PA 2XMTA 2ZBQA 4ZN3A 1FESA 2M3DA 2DGXA 3K5PA 5D4LA 2RQCA 4F36A 1IBCB 3D0GE 2C3UA 1NRKA 2VQFF 4N77A 3IN5A 2E5LJ 3CMES 1HIYA 4WTOB 3D4JA 4WP9A 4DSIA 2HQIA 3NY0A 5EX0A 4RPFA 4DV6F 2O5DA 2DNMA 4J9VA 1BY9A 3MD3A 3KK3B 4B3SJ 2DPJA 1RT7A 3FSYA 3GV5B 1DQAA 2QYCA 4Y2KA 4KM4A 2F9JA 3GYNA 5AE2A 5JMNA 3V6DA 1RE1B 3TUJC 2GW8A 3BO3A 3KLEA 5CZVA 1LQ9A 3BSNA 5T7LA 4ZP7A 1NSAA 3MDFA 3FMWA 4FVCA 2AEJA 3TQ1A 5J1EB 3M2RA 3V81A 3V6DB 2MMYA 1B70B 2I9SA 3WIVA 4CO0A 2E9ZA 4OI6A 1URBA 4QPTA 1V3RA 1YDLA 4IQMA 1VI7A 1LWEB 2VQFJ 1OQ6A 2PMHA 1MWQA 3H59A 4ZVUB 2EFQA 2K7JA 2AJFE 3DOKA 3T1YF 1N36J 5G0RA 3EPGA 2C2DA 1OY9A 1Q53A 2RS8A 3LP1A 1KVJA 1TQLA 3MM6A 4BWMA 3CCMS 1OYEA 1ZEBA 3ZNUA 1RKJA 1LWEA 4ED5A 1N4LA 4RUAA 2NXUA 1FVSA 2MHNA 3BGUA 1QAJA 4Q45A 1H74A 2UP1A 4OJHA 2DNQA 3C6UB 3GR0A 2ZH6A 1VMBA 1KFDA 1YJUA 4ETXA 2GA7A 4UQGA 2R2SA 3N79A 1Y11A 3RB6A 1KHNA 2MY8A 3NBPB 1HR0J 3GMGA 5LT5A 5E41A 2GVZA 3PX0A 1YJ9S 1IN0A 3LALA 3PEJA 4JOUA 4I6WA 4IYQA 4LR9A 3LF0A 3N5FA 5EGYA 1NPRA 1ELXA 4YUDA 1S1WA 4U8YA 1FTCA 5CYQB 1YSJA 4URQU 5I3QA 3NKOA 5KG4A 4LFAF 4Y00A 4B9SA 3HD2A 5DLFA 1HDHA 1BQMA 2BJ7A 2ZC3A 3JSBA 2DNYA 2QL5B 1GXLA 3TWZA 3UCGA 4MY4A 3WAWA 5KG1A 4RUCA 2EBEA 3CCES 2MSTA 2YKPA 2AYBA 4ZOSA 4TNOA 1HHSA 3ENWA 1O98A 1DHMA 3SSQA 3MCSA 1YLXA 2YWFA 1KR4A 2LEPA 1FJEB 1S97A 2HVIA 3M8QB 1P1LA 3T01A 4K4TA 3IR5B 5IJSA 1RT5B 3JSRA 1UAWA 4CTAB 3WC2A 1G2EA 2SXLA 2JLGA 2A10A 3DXSX 1X4DA 4F50A 1S1TB 4QWBA 1NDPA 4E2FB 1N6QB 1PAEX 3VZIA 4M8LA 3PW0A 2RRAA 3A4TA 2BM1A 2PIIA 2IC3B 3VF0B 1SKSA 2Q43A 3QIPB 3MPVA 4HR2A 3PG9A 3NNHA 3GU0A 3D2WA 1UFKA 2DT9A 4NYOA 5BJRA 3NNCA 5B0FA 1Q7LB 3ONQA 2AYEA 3EMTA 3FVYA 3AOBA 1HBUB 2HNDB 2E1AA 2VC0A 3ICLA 3LAMA 4HDGA 5BXIA 4DFKA 1R8BA 2HHUA 1BE4A 2M5YA 2AEMA 3CUNA 2KHCA 3I9ZA 5CHCB 2G2YA 3WX4A 3VGUA 4IFVA 4F04B 1CVJA 2VG6A 4O23A 1UWBB 2ALYB 1C4CA 1WC4A 2CNKB 3HZEA 1HNZJ 1PGZA 3FQLA 2VG7B 3C6TA 1S77D 4KQZA 4PG8A 2FYXA 2W24A 1B7FA 1PYTA 5EWGA 3KDNA 2MZ1A 2V4JA 3OTDA 4BC7A 3P3DA 2OAUA 2L9NA 3PYGA 4WBFA 1OIAA 4JI2J 1Y7AA 2FLOA 1UVKA 1Z2LA 3MM6B 4HVZA 2RVJA 4C0BA 2ATCB 3Q8VA 4RU9A 4C8MA 2LDIA 5J2NA 2ADCA 2WVDA 3POTB 4L75A 3TARA 1T94A 3PM9A 2E9RX 1JJ4A 4JP8A 4JYAF 1WHXA 3KUGA 2R2TA 4B3SF 2R42A 3CT9A 5H9EJ 1ZTTA 4RW6A 2BRKA 3O3LA 3U27A 2X1BA 4MYTA 1KRPA 4GTWA 4A8YA 2EFGA 3ILLA 3QSYB 4N41A 2YBVA 4IKAA 4PQAA 4TKTA 4UTGA 2Z2YB 3QAUA 1R0BG 2EW9A 2BQUA 3CC7S 2HG4A 1X4EA 3I87A 4YMEA 2KT2A 4N5SA 1R8CA 1WC0A 4UOOA 2ZHOA 5KFSA 2CJBA 1ZOTA 2IDEA 4WK3A 4YDXA 2R8HA 3AD9C 2HS4A 1PCAA 2DR6A 3FSIA 2BQRA 4DR6J 2UXDJ 2HFSA 3SV3A 3GSDA 3TUZC 4DCJB 1RWXB 1FRKA 4PXBA 2YQ3A 3CB4A 3DOLB 2R8JA 4KHPF 1TR0A 2V69A 5DG7A 1NK6A 4OI2A 2W2OP 1IR1A 2HZAA 3HD1A 2XI2A 4DXLA 4KJGA 4YB5A 3I0SB 3SQGB 3ZTPA 3TZZA 2J0SD 2FPHX 1HD0A 4LRAA 3DU5A 2AV5A 3TUPA 2UV8G 1HW9A 4L3NA 2OPPB 4C3KA 4DR3F 1XERA 4DUZF 1Q82T 4HI2A 1L5UA 3SZYA 1FRHA 3BQ1A 3DMJB 3KK2A 1KVKA 5MLCV 2DRBA 2DNZA 4UOHA 2CVIA 1Q7YT 2G4BA 4JI6F 1T9YA 2HS0A 2J7WA 3DM2A 1RTJB 2EG2A 2HGLA 3TAMA 1EB0A 3R7NB 2BE2A 5D0RA 1A9NB 1SIWB 5AJ3F 3H2LA 3P4UB 4Q2MA 5E7OB 1S6QA 1BWEA 3MK2A 1ZA1B 1JLBA 2VASA 3C16B 2XCPA 2LU2A 2MTLA 5KXAA 1H6KX 2CKWA 3NNAA 2WONA 4RJVA 4HI1A 3TJ9A 1P27B 5EX3A 4DL3A 4X4SA 4O44B 4FXDA 4I7FA 2FLNA 2VQEF 2OP5A 4DF8A 4OQJA 3EZ5A 4UOPA 2ZBCA 3GR1A 2ZH5A 5GRRA 1KQKA 2W8LA 2YNHA 4CI0B 4ED7A 2BDPA 4NXNJ 1KHWA 3QFHA 2HHVA 3CCRS 3GTYX 4DPTA 2FHOB 1WDTA 5LMUJ 3KDOA 2CQPA 3EDQB 2R7WA 3MMAA 3EXYA 4TXSA 4K4WA 1LWFA 4KO0A 4A47A 2V9KA 4ZVQB 3T9NA 4OZNA 3KJVA 3QO9A 1S5ZA 4LSNB 3A8IA 2FC9A 3TEHB 4W90B 2E5LF 1B8JA 5BR8F 1SV5B 4IH6A 3G6VA 4J9LA 2BACA 4LF5J 4P2XA 2IRYA 4JV0A 3M1VB 2VFRA 1UZDA 1NH7A 3HSGA 3BDHA 3AJDA 4ZHRB 3VAJA 2NSCA 2VICA 2FHMA 4LQYA 2QTWA 1H7XA 1IJFB 4CH1A 4KT0C 3QJLA 2VPXB 3M2UB 2HK2A 3S6EA 3ENAA 2E66A 2VIHA 3EUNA 3NS7B 4Y2IA 4CO3A 1QLNA 3HK2A 4LFBJ 3IBCB 2LXUA 1TK5A 3MWBA 1Q81T 2QA4S 1N34J 2PD1A 4NOHA 4QIGA 2DR5A 3DRSA 2VDHA 5H1SV 3MR5A 3HVRA 1XNRJ 1YK9A 1VBXA 1SKRA 4J9OA 4DL7A 2VZ9A 2UVUA 3SBMA 2RU9A 2X1AA 1ZBTA 3PJXA 4KHRA 1EJJA 1HNIB 5C42B 5LSLA 4NLTA 4KR0B 2UU9F 3KG0A 2OMLA 2MQPA 3FQKA 3OL7A 1R8AA 2BYCA 5BR8J 1T9WA 4I69A 3QRPA 4LR7A 1Y0HA 4BDPA 1JLQA 1VC6A 2BKNA 2EWHA 1E6YB 3VZHA 3ZO7A 2K3IA 2IYGA 5J2MB 1FNXH 1EIYB 3T6BA 1RCOB 1GMVA 4TU8A 1FXDA 1PYOB 4DPOA 1MN7A 1E6YA 2B7BB 3QWPA 3AT1B 1NK4A 2BUNA 1EETA 1RTDB 2UXCF 2QZ8A 1WHVA 4TVAB 3OQ2A 1NJZA 5DDRC 3MOJB 4DOZA 1YI2S 2GSUA 2FGCA 2VONA 1S6OA 4QYRA 2VBWA 4NMLA 3PVXA 5K8MA 3GILA 1M5SA 2Y0BB 3IRXA 4OZ2A 3T6JA 5HLFA 3MCNA 2IVFB 1LOUA 5DQIA 4KE5A 3VR1A 3CCWA 4DN9A 3I0SA 2AT1B 3SQGA 3SYZA 3KG4A 2XEXA 3CULA 2N3OA 2HWTA 4Y65A 2W9CA 2W4CA 1FEHA 2CZVC 2RQMA 2YNIB 4P9SA 4M5KA 5ETTA 2M2BA 1GNKA 5KAKA 5HROB 4QWEA 4DR5F 3GE9A 4RW7B 3AODA 4WF9Q 5FDLA 1HBOB 1PC5A 1HBUA 2CNOB 3ILOA 5HQMA 4RW8A 2D9OA 4KGMA 5GAEI 2MXYA 1N0UA 1I94F 4ZK7M 2HHHF 2HGMA 1NUEA 3I6PA 3KK1A 1VBZA 1WOSA 1JNZB 3C16A 2NQPA 1DFDA 1WKJA 4ZCKA 4PAAA 4Z37A 3J81j 3W2VA 4F3OA 3TG0A 1PO6A 3OT9A 1APSA 1FWLA 4RWWA 2HFNA 4MK8A 3HHLB 3CJKB 3QLHA 2ZNYA 1T02A 3HZGA 1LWCA 1OY6A 1VJQA 2O3DA 2VFTA 5KFFA 3VWSA 2OI2A 4HHHA 2HGNA 2R2RA 4OZLA 3CCJS 1IBKF 4ELTA 5AJ9A 1Q86T 4AXIA 1IQZA 3MECA 4PR6A 3HHLA 3W66A 3SZ2A 4LF4F 3W8GA 1RWKB 1LFPA 4R5PA 4Y3CA 3WAVA 2ZFHA 1K47A 4YR1A 2WAQD 2I38A 1EKSA 3D1QA 4F67A 2NXNA 4A46A 4ZLLA 4K2JA 5L0KA 3TNVA 1OS5A 1FE0A 5IQ6A 3RBDA 5BYQA 2ASDA 4CXSA 3V6JA 2F8MA 3M6WA 3SSSA 4LF4J 2OPSA 2R7TA 4OX7A 3QYYA 3MUVP 2HRUA 3D7SB 3GLJA 1CULB 3KJVB 1R27B 5KFBA 4UZBA 1SJRA 1A7GE 5LJ5Y 2KVQE 1X9WA 1U24A 4QBUA 3TA1A 5EWEA 3RR8A 3KLIA 3R5JB 4ECYA 2XNQA 3LGMA 4OYZA 2WZ1A 2CWKA 1NHUA 1X8DA 3DOMB 1L3VA 1NU4A 2CQIA 3PW2A 3C3LA 4KV8A 2Z8QA 3AXMA 4ED4A 1UMJA 2OTLS 2KI2A 1FWPA 2Z2LA 1DLOB 1FFGB 3DYCA 3M8ZA 2ASJA 5HRTA 4K4YA 4LF9J 4ED8A 3ENQA 4J9MA 1ROFA 2DHHA 4QZVB 2GIRA 3L7PA 3QBCA 3ZZTA 2PI4A 2KFNA 1RWVB 3PCOB 4C11A 5BYSA 4R0JA 1AUKA 4B9TA 3PHTA 4Y2AA 3LH2S 1S10A 2B6AB 2VBYA 4ES1A 4OHZA 4WFAQ 3GIIA 1NDKA 3MM7B 4LT6A 4GC7A 2AGQA 2CPDA 3R7BB 4ZPDA 4KHPJ 4O3NA 3ILJA 1S7HA 4FBUA 4IG3B 1E33P 1YRXA 4BC9A 3CC4S 3NRBA 3H5YA 2IAJA 4Q7AA 3NKRA 1QSSA 1FRIA 6FDRA 3RUBL 1HBOA 4CLWA 4CO4A 1CLFA 4P2SA 1P49A 2OELA 5B0GA 3BKUA 1T9UA 3PJWA 1QD1A 2B9YA 4RNHA 4ZVGA 2C1EB 3KLHB 3H4BA 1YBAA 2NREA 5LRNA 3W64A 4EFAC 1DARA 1WELA 1LK7A 2AWZA 3PYDA 5ADZA 4K5SA 4I1TA 3WC0A 4N76A 2RRNA 1ZAWA 3QJPA 1KSPA 4TU7A 3BYPA 1IBKJ 2UUWA 4A8QA 3IDDA 1JXEA 1G7CB 3MOZA 4YOEA 1RB0A 1U6ZA 2JC0A 3TR5A 3D9BA 5AE1A 1IBMF 2YNFB 3O2IA 1S48A 4LRDA 3W2WB 3K57A 3V5RA 4X62F 1UFLA 3J7YU 5GAHU 3J81Y 2DGQA 4NLWA 1CC7A 2NUUG 4QU6A 4JI0J 1IKYB 1T9VA 1T9TA 4RW9B 5K5MA 1HQ2A 3PFEA 5IFMA 5H9EK 1VQ8S 1EP4B 4NLPA 3AOAA 2ROGA 1JK9B 2FQQB 4OI0A 1XR5A 1U4BA 2JEFA 4HHUA 1UA1A 3OL8A 2HK3A 2WVFA 3EGWB 3H0PA 3ED4A 1K0VA 1JLAB 4QR2A 3TYTA 2Y8WA 5J2QA 3I9V9 2DNGA 2RAQA 5ETOA 5EUHA 1HYSB 1KFSA 1YQHA 1I94J 2GCFA 1U1PA 3V4MA 1OMSA 2D9PA 1TKXB 2QN6B 4MMOA 1M5OC 5CH7B 2LKZA 1WOOA 4EBDA 1PJ5A 1KTVA 2OSQA 3I0RB 3M30A 2V68A 4AUKA 1U47A 1KC8T 1ZM3A 2KT3A 1RT6B 3FGVA 3DRYA 4WFZA 2LU1A 2WOMA 3CVKA 3HT3A 4C8NA 2ZJRQ 4ZPBA 4IRDA 4FF1A 2GGPB 2IRUA 2FD2A 4YEAA 1NK7A 3BQ2A 1VQ5S 4X65J 3TW0A 3THVA 2N4CA 4ZPWR 4DR7F 4ECVA 3KLIB 4QJVA 2HPUA 1ZTWA 1SB6A 1DTQB 3OHAA 2MY7A 1S0MA 4AL5A 2BRLA 2G9YA 4GVBA 4DV3J 4PPZA 2CFXA 4B9VA 5L1LA 1WUUA 3BKTA 3TA0A 5A0YB 4ZCLA 1RTIB 4RO0A 5BYRA 4CT9A 3J80U 3RB4A 1K8AT 2XC9A 2K7KA 3ENVA 1DTTA 2A0FB 4X66J 4ZG7A 5M2UA 1U6FA 2HLTA 1SC3B 2OEMA 4ZVOB 1KH5A 1RTIA 5HJYA 3ET6A 2Y1IA 5IV4A 2U1AA 4JI8J 2Y8YA 1IWGA 3M30B 2OPPA 2LXIA 2CZ4A 1K9MT 3DLEB 4P72A 1E2SP 3MM8B 1S1TA 2J9DE 4WJBA 1FJGF 2AMCB 4B3MJ 4UPLA 2NSBA 3KJQB 1KQFB 5KFGA 4WPAA 4FDIA 2IRXA 2PT0A 3VVUA 5KTQA 4LFCF 2P5VA 5I42B 2XZTB 4OZ5A 3UW1A 3DM2B 2G2ZA 3GJSB 2A1BA 3VCDA 2FVPA 4ZG9A 5A6WA 3U7JA 1SC6A 4RBVA 1AROP 3O5TB 1NH8A 4MIVA 3PR5B 4PG6A 3H5UA 3NEKA 5DGBA 2ZDPA 1RADB 2QLXA 3IG1A 4DZ6A 5JJBA 1U1KA 4LSLA 1TV6A 5AXNA 1DQ8A 1U7LA 2MDAA 5KG7A 3LOUA 4CO2A 3M8SA 2RHSB 4A8MP 3B82A 2PMWA 3ET6B 2K1RB 4LREA 3AD8C 4RUBA 4WE1B 5M2RA 4DFMA 3UCUP 5D4OA 1IR0A 3CJ8A 2X1GA 3NWGA 1CSJA 1VJWA 2B5JB 2I5JA 2LQ9A 3CO0P 3IAS9 3J7YI 2UUBJ 2V8GA 1QAIA 3G8SA 3PKMA 4LRBA 4M63A 1JIHA 2ZOFA 1HL6A 4IO1A 4YFUA 1RT1A 2H1YA 4Z7CA 3THPA 3QLHB 4ZCMA 5GADI 2W9AA 5HJXA 2R9LA 3T5LA 3KLFA 1FJ7A 4C3LA 2XO6A 3QJJA 2RKIB 5KFLA 1ALKA 5GAEU 2N7CA 2G2OA 4P71A 2RB7A 3ILIA 3J7AN 3NL0A 2GJ2A 1CQMA 4JI5J 5F9LA 1QAYA 4LQ9A 1Q4RA 4U6PA 4USUA 2I8EA 4K4SA 3H4DA 4H4KC 2Z58B 3EVWA 1ELOA 5F8NA 2Z2MA 2IM0A 2QE5A 2IDLA 1TKZA 2D1CA 1KN6A 1GAOA 2WW8A 4ECRA 2GJIA 4NCGB 4YS2A 4DV3F 1NKEA 5A8WB 1EKRA 2CJ9A 3HKWA 1KDNA 2GO9A 3MTKA 4URSA 3IRWP 3ZZPA 3UDVA 2R8GA 5GMEA 2ZH8A 2RH3A 2CJXB 2RKIA 4XPCA 3HKZD 3DGPB 2DCLA 6AT1B 1NK9A 5HN0A 1TAQA 2HBQB 2AJQA 4NLUA 3VVTA 5D6GA 1X4BA 4KGXB 3OJUA 5LL6d 2FVCA 3ZTOA 2PO4A 4FYVB 1MU2B 3QT6A 5F8IA 3JSMB 2LECA 3I96A 4CRJA 1SL2A 1ICEB 3W1YC 4FF4A 2KL8A 5IS2A 1H2UX 1D8ZA 2HVZA 3Q8RB 2ZE2B 3V4IB 3I31A 3FJ2A 1ELYA 2CDRB 1MG7A 2E7VA 2ZH3A 4IO9Q 4PG5A 2DGTA 4ZLJA 2B9XA 2B6AA 1FDNA 1JQGA 2O67A 3BO4A 1UVIA 1G3OA 3C15B 1RA6A 2GGPA 3OFHA 2WSCC 1U2FA 5F8MA 5DLVA 1P8GA 2ZC4A 4PYDA 4ZMMA 3L09A 2IYIA 2DNOA 1WOPA 2NZCA 3VTIA 5D3GA 3R2CJ 4QR1A 1XQIA 4KJIA 3TX8A 4UORA 3MTJA 5E5NA 3K89A 4TQSA 5KFMA 1T03B 3MK0A 2NYHA 1RBOB 2XMWA 5D0HA 1T05B 3AD7C 4DQPA 1BGXT 4PUOA 1LWXA 1U49A 1EARA 1LEOA 1JLBB 2PA8D 4UF4A 4F0MA 1K44A 1N32F 1R6VA 2DR8A 2QG9B 2DYAA 1QAXA 2N7YA 4USJC 3MR6A 1FRMA 2Y0SD 3B54A 4ANDA 3GFXA 9ATCB 4Q5VA 4E98A 3DI6A 5HLFB 2FJDB 1RAAB 5INHA 2XMUA 1PILA 2WB1D 3J7ZT 3NCRA 2VG5A 4M5DB 1F3FA 3L4BC 3GIRA 4JV2A 5LMNJ 2ASLA 2VODA 4JYAJ 4KJDA 3NGRA 3B4MA 2N4DA 1UA0A 2QFIA 4Y28C 2HFUA 2ZH2A 1SV5A 4TLRA 3W2WA 3CDUA 3HSJA 1MN9A 2FJBB 1S0VA 3NGUA 4OYAA 4P73A 4WKRA 3IC1A 4QW8A 5B08A 4RNMA 1NJYA 1SJQA 3KNGA 1ZAXA 2P6TA 2DISA 2M52A 1F60B 2UXBF 5L38A 4OX9J 4XPEA 4OZ3A 2XLJA 2BEFA 2HFOA 3G4SS 1HJKA 2CPHA 3Q22A 2CUYA 3RBZA 4AD6A 1F1BB 3HJVA 3TAQA 2W7AA 3HMJG 3BREA 1JXLA 3ITHB 2D41A 3M6VA 1IBLJ 3ZZRA 2RDJA 4ZP8A 3UE2A 2RT3A 2YKNB 2VKZG 1UJ4A 5KT7A 4TLQA 1F9FA 5KG6A 4KFBB 4PXEA 1U8SA 1HNIA 2CQCA 3ZXWA 5C42A 2J0QD 1WI6A 3NKMA 2E1RA 3R2DJ 2AJ0A 1HYSA 2HHXA 4AT1B 2KG1A 3WX8A 1HNVB 1XTZA 1I5OB 4ANCA 2ILYA 1I3OB 2EFOA 1Q8LA 1R43A 2VPWB 1RUSA 1U1QA 1ZETA 3W9JA 3CCSS 2W01A 3T00A 3GPAA 1MROB 3KHLA 4J9KA 1V6HA 5ETQA 4CLLA 3T1YJ 1N36F 1M5PC 3LPEA 1X9MA 2VPYB 3B78A 1S1XB 1RT3A 4XDCA 1RACB 1Y4ZB 1H72C 1N88A 2IHR1 4DQIA 1O5JA 2IJRA 4OYWA 4IH5A 2DO0A 3GP9A 1TU0B 3LPYA 4KB7A 3R7SB 2Q66A 3KUEA 4M5NA 1M90T 3GIKA 4NLOA 4WWSA 1OSCA 4TYAA 3Q83A 4MT1A 3C19A 2BOAA 1PYSB 5KG0A 4OHYA 2E5IA 5J1NA 4UUWA 3Q8QB 2B4OA 1U2RA 2D69A 2GFFA 3AHPA 4BWJA 3SCJE 1TFWA 1EETB 1RTDA 3MXHP 1Q5VA 5HMYA 1NKBA 2MHEA 3CCLS 3W9IA 4J37A 4USWA 2MQQA 3IGVA 3DDIA 5FIIA 3G2XA 3MM7A 4UY85 4DV2J 5KG2A 1RHMB 1V5IB 3ETOA 2EG1A 3BH7B 4HEA9 4JBCA 4PEOA 5AXLA 3VHQA 3HFZB 4YR0A 3Q24A 4IFYB 2C2ZB 5ETNA 3BSOA 1J5EF 2UUCF 1U8WA 5SUHA 4ZVRB 5D3GB 4HACB 2NZ4A 1AJCA 3OBIA 4AXJA 5CA5A 4NWJA 4ELUA 1PJ7A 1HR0F 2RH6A 2HQGA 3ELHA 1M1KT 2PA3A 2FLLA 2CQ4A 5C5JA 3DLGA 1FNMA 4DSKA 3VAGA 2A18A 3IA0A 5KFWA 3QT8A 1TMMA 3AXKA 4MK7A 2WRMA 4ZS6A 3OXLA 2Z57B 2V4QA 5CXTA 1JLEB 2W2QP 3CD5A 1WTBA 2JC1A 1YGYA 2NUHA 5GMDA 4LF9F 2HIYA 4ENOA 1RT5A 1SH3A 1XWLA 2G1HA 3HDSA 2EFPA 4JI0F 2UXBJ 3BDFA 2GHVC 1UPPA 3DXBA 4Y2CA 2DNKA 2JVOA 1RISA 5I3PA 3G87A 2R7QA 2KFYA 1B0VA 2IMOA 2IC3A 4JI1F 4C8YA 3CD7A 1GTEA 3K5NA 3J81U 4FDJA 1QTNB 2C2KB 1VQLS 1GXTA 1YJTA 3NG8A 3MUMP 4YY3J 4DR2F 2MZTA 3R5CA 2XM3A 3A8EA 4PXCA 1CPZA 3DKDA 3DLHA 4DSLA 5KT4A 4DG1B 3BJYA 1WSVA 2LA4A 4D3HA 1SKUB 4Y34A 3UQSA 3BGOP 4AFFA 2WW4A 3KD8A 1E3CP 5F0UA 4NXMF 3BDGA 2CQ1A 3G6ES 2WONB 4MKYA 3HLUA 4ICLA 4NASA 2G13A 3GJQB 4RBUA 5KFNA 2LCWA 3MCOA 3EX7B 1BQMB 2ZZTA 3CDWA 2DITA 1JJCB 1IKVB 3GV8B 2ZH9A 3VV2B 1LK5A 4TU9A 2QA4G 1B0PA 3PRBA 2F5GA 2R4FA 4O0NA 4EEYA 2PGCA 4URGA 4DF4A 4B3TJ 4LJMA 2FVQA 4CO1A 1ZYQA 3H98A 3LP1B 3TVYA 4JI5F 4LF8J 2ANHA 3HXMA 5HK4A 2PMZD 1DAXA 1NAQA 2CNNB 1FKOB 1GXUA 1H0HB 1N5TA 1W7WA 2VD3A 3AQOA 3O6QA 4NLXA 2CPXA 1H2VZ 2XWYA 4EI2A 1D0EA 1KTQA 1I51B 4QWAA 3WBHA 4A8FA 5KG5A 2EKNA 2ROEA 3KXDA 3NS6A 1NM2A 4NRUA 2OPQB 1BUXA 2C3MA 3DYAB 4ZP9A 7FD1A 3W8PA 3TZXA 4LBHA 3PW7A 3L95X 3VGTA 1JX4A 2QYGA 2QLFB 1GQEA 2XZWA 1BWVA 1F5CA 1GMWA 2GJFA 2PE8A 1FRJA 4KH0B 2X3DA 2CXEA 3P8BB 4IFYA 3UN2A 1IWAA 1WC5A 5AT1B 2OSRA 1B4SA 3SXLA 4DPYA 4LFCJ 3OUYA 2KFZA 1RKIA 3MPDA 4TY8B 4XAKA 3LW5C 2K3KA 3UNYA 4DU8A 4RNFA 2XNRA 4U7UD 1D3WA 1EQMA 4NL5A 4NLSA 1IUJA 4ZVFA 1SJ4P 2AW0A 1ZPVA 2W8SA 3UCZP 3FCWA 5EGHA 2DIVA 5A2QY 2IAJB 4CLTA 1S76D 4R0EA 4C8KA 4LVNP 1RSCA 1Y3KA 4NMXA 4ZJLA 2YKMA 3H42A 3M6XA 2VF3A 4DR6F 4OLOA 2JLEA 2VKRA 1FDAA 4OI4A 3DOMA 4C0HA 4YHHJ 2BA9A 2DEIA 3B6BA 4AQYJ 1HNWF 2R7RA 2L08A 2RS2A 4CLYA 4TY9A 2HURA 1Z1ZA 3CW2C 4F0HA 2XS5A 3MPUB 1AW0A 2W4PA 3RB0A 2VHGA 1FTRA 1T95A 5A0YA 2KH9A 1VQ4S 2L9DA 1GX5A 3SV4A 3MEGB 2GQQA 4CYRA 3NKQA 4L72B 5CYMB 3D5MA 1Y00A 1FI4A 4W98A 2MKIA 1R0AA 2GZOA 1LW2A 5I4MA 5LSRA 1S49A 2XY7A 3QRRA 4X4QA 4Q0BA 1JKHA 1KHJA 1FCAA 2ACMA 4KHMA 1N33J 2F8HA 4I7FB 1U1LA 4YP3A 2ZHBA 3FZ2A 2NXJA 3ZFVA 2M88A 2GIFA 3L7OA 2GX8A 2HFZA 2J0XA 3W65A 4DR4F 2H5IB 2ZBIA 4JI4J 1KHVA 4P52A 2HHHJ 5IM0B 2DB1A 3T02A 1SI9A 2RQ4A 3VAIA 1LXJA 4PKDB 1YJNS 4L6V3 3IWXA 2LQ8A 2GS8A 3GYXB 1S9EA 3N6LA 2QC3A 1WACA 3UDLA 2ILZA 3ULHA 3HP6A 4DSJA 5B0DA 1WNEA 4NWBA 1Y5IB 3C6UA 3N6MA 2Z2ZA 4OYPA 4RW4A 4ATNA 5J2PA 4HTJA 3OTOF 4ECWA 1U1RA 4ECTA 3R1LA 3CF5Q 4USKA 3VAMA 2ATLA 2V94A 3AA9A 2CPYA 3M8YA 4IG0B 3BDEA 2IIHA 2OJ3A 1D09B 3CJKA 1L3KA 3DOKB 1PIEA 3BF4A 3I5CA 2DRAA 2XS2A 2JNJA 2F8EX 2YXLA 2IVMA 4FZVA 1RAOA 5D4PA 2OLWA 2B8QA 3CJQA 5IC4B 3MI7X 3UD5A 2ALZA 2BW7A 2HVEA 2W2MP 2DCUB 2MLZA 3H2VE 1IKXA 3LUYA 3PFOA 3MMBA 4FNIA 2L41A 3KMSA 3F73A 4JI7J 3CMRA 3GG0A 4YB1P 1O6XA 2OD6A 5LXRA 2C2OB 4CYUB 3WAXA 3K59A 2V8VA 3OFFA 1IVZA 4DR1J 2XR9A 2YX4A 4PWWA 1WC1A 2QA1A 1NSPA 1RCXB 4XK8C 4EBEA 1D9DA 4EO8A 3I4HX 3TP2A 2J7UA 1AB8A 1SJ1A 5B0CA 3KYLA 4DV1F 1SXLA 2GAGC 3KFWX 3Q23A 2E29A 2BJ1A 1NMEB 3M4XA 3O1LA 2ZJPQ 3C2PA 4X2BA 3BSCA 3NLCA 4FP9A 4RLEA 4ZP6A 5K9FA 3TX0A 2KT5A 4YHHF 2F63A 3CGIA 2IA6A 1XMBA 2G0JA 1SJFA 2FVSA 4DCPB 2YWKA 2VH7A 4I0WA 4OIXA 3RGIA 1VS3A 5HL7Q 3VQTA 2B3TB 1UCNA 3UVJB 3CC2S 5K4PA 3BSAA 3CNQP 5C2CA 1TL4A 4ZLPA 3QRQA 1M5HA 1JLQB 2JX2A 3JQJA 4ITSA 4KRWA 4NLVA 4WE1A 2CNLB 4D3GA 1C4AA 2KKHA 4F4AA 1AT1B 1WD6A 4KH1B 5DG8A 3PO5A 3M8RA 4LF7F 2WVBA 1C0TA 3I82A 3MEEB 4GVBB 2B0GA 4DFJA 1VBYA 3DLBA 4DI6A 1G1XA 3EE3A 2RU3A 3BR9A 3JAMU 2I1RA 1NDLA 3IO1A 5G4DA 3WZ0A 2PFFB 1HWUA 1Y10A 1URNA 4HH1A 2FHJD 4ZPCA 3IBWA 2ZEJA 1EAYC 1AJDA 2L3MA 1RXOB 3DLLQ 2VG7A 1TK0A 2XULA 2YQ0A 4DQRA 2CG8A 5E3RA 1O0PA 2GVDB 4UPIA 5DLWA 5B7WA 4FN5A 1NDCA 1FXLA 1REVB 1WG1A 4OX6A 5HMXA 2EPIA 3W5XA 3HVAA 3AB2B 3D3BJ 2HRYA 2RF2A 2CQHA 3CE8A 3Q8SB 3KK3A 4DG1A 3MAQA 4F7VA 2ZOMA 4CQ1A 4USMA 3MZIA 3HHDA 5HANA 3RAQA 2QMWA 5K14A 2V50A 3DHXA 4GKJF 2AJ2A 4LF2A 4OYBA 1NB2A 2KHDA 1HQEA 2DRDA 3A3PB 3K7RA 1T8EA 4ILMA 4X4NA 2ROPA 1HFEL 3OHBA 2DJWA 1S6UA 3R6LB 4KV8B 1R8PA 3A8KA 4LSLB 4CLSA 2XMKA 5A8KB 4IR1A 2CYYA 3F56A 1FK9A 3JTPA 2JDJA 4NE9C 2ZH4A 1ZPWX 4RZRA 1QUPA 1RK8A 2MYFA 4HL9A 4F3MA 4LIWA 4ECUA 2B5JA 2I5JB 3NS5A 1SC4B 1AA1B 4I2PB 4MKVA 4I56A 1J5OB 1VLOA 5IT9Y 5ETLA 3FNNA 4AL7A 1I1GA 2P2CB 3OLBA 4OYIA 1J5EJ 1TVRA 4X4RA 1EZZB 1REGX 3A3NB 1RAEB 2RJZA 3MAAB 3MMCA 1S99A 4EYIB 4J90A 2I0XA 5HVFA 2ZM6F 5LXYA 1AFIA 1KS2A 5GADU 2VC1A 4DQQA 3CTRA 4G1QA 4KIAA 3PW5A 4PXDA 2HKEA 3OPKA 1FKPB 2H5EA 2J8SA 2H54B 2QV6A 3IFEA 3LAKA 3OR1A 1MMNA 3QT5A 2XMMA 4OZJA 2B4VA 4I6AA 2HYIB 2GV1A 5GAHI 1NNDA 2QLWA 4O3OA 3HM9A 2C22A 1SKWA 2YX7A 5HROA 1N5VA 1UPMB 4F3QA 5AXMA 5IWAF 1KHKA 2OPSB 4F0KA 2M0GB 2DY9A 3OVAA 3KK2B 4LF6F 4P7TA 2ZZNA 1U1OA 1N8RT 3S8SA 3R5BA 1NEEA 3EM1A 2YH1A 1T05A 1PKUA 4LIRA 3MMJA 3OR2B 4RW8B 2BE2B 4KY3A 4YR3A 3PYFA 3IRXB 3GV7B 2XB2D 2VOOA 2HHSA 4XIUA 3QIDA 3AJ1A 1F9HA 4C11B 2W4DA 4E0DA 3JTOA 2ADBA 4N8OA 4X66F 1N48A 1H2TZ 3KG1A 1FF2A 3M05A 3N01A 4JI7F 2MKJA 2ZNZA 2AJ4A 4DR7J 1ZAVA 2BXJA 2ZKTA 2DK2A 3SFUA 4RNNA 4KC5A 3GSIA 6FD1A 4MFBB 1O51A 4I2QA 1S72S 2RUSA 4FYDA 1RTJA 3TAMB 3EGNA 3CDAA 2MKCA 2FVRA 2RQKA 3KLEB 1NO8A 2CJKA 2ZZMA 1ED8A 2AZ1A 3W5YA 3KK1B 1HWJA 3MEGA 4WKYA 2QIFA 1VQ7S 3PHEA 2KG0A 4JI2F 2WSEC 3DNCA 3RAXA 2UUAJ 1U45A 4JV1A 1JXVA 1QTMA 2CZ9A 2UV8A 5FDLB 2XTJP 4EK2A 4DV4F 1IBLF 1TKXA 2GNKA 4Q0BB 4M5IA 3C14A 3M9MB 2M70A 3ITHA 4CLFA 2YPZA 3ISZA 2BOPA 2HNZA 1VLYA 2PFDA 1TUWA 5KT6A 2FZGB 3TO8A 4BHQA 4C9DA 5CYJA 3W3SA 2CRLA 2O1PA 5A8WA 4CCHA 2AF6A 4UOFA 4PUOB 4EWTA 3ISNC 2UU9J 2GLQA 2OKQA 4CXUA 3BGFA 5DQGA 2UZAA 3DFEA 1DBDA 1HI0P 3JQKA 4WYWA 1LXNA 2VA3A 3JYTA 2LQBA 2CPJA 3HFVA 3QT7A 3TVZA 2FC8A 4RW9A 2M7SA 4B3TF 2PI5A 2D3ZA 1RHRB 2V63A 2W5TA 3MFHA 1RHQB 2W7PA 1HQAA 3RU0A 4WP8A 5GVQA 1WC3A 5J2NB 2YNFA 3FDSA 1Q5YA 3DU6A 3W61A 5A8KA 5CD4H 2A6OA 2JVRA 2W8KA 3PX6A 4JI3J 5T14A 4O0IA 2RRBA 3HJFA 2DGUA 1XN9A 4W4MA 3US5A 2W5WA 3IM8A 1Y7PA 1UTAA 5J1EA 1CJTB 1E1ZP 5HVGA 3HVTB 1RYRA 1X7VA 2FDNA 4OYMA 3UD3P 2CWXA 3D6FB 4PYAA 1TELA 2LA6A 2JWNA 3UDCA 1CJUB 2HFVA 5F8GA 3H5XA 3C66A 2OHDA 5K8NA 3T9ZA 4WFYA 4DV6J 1JJHA 1TMJA 3ADAC 4GKJJ 2VUGA 1KH7A 1KQSR 1SUQA 2WK4A 4WU3A 3PRVA 5KG3A 1CJUA 1P9QC 2CADA 2MQNA 2VDIA 3I5AA 2EVZA 4USHA 1KOHA 3RZAA 4J9PA 1QSYA 2XRGA 2C2NA 3DN9A 3NMAA 3AOCA 3Q86A 2EKYA 4A48A 3OL6A 2W2PP 4N47A 4DPXA 1Q8KA 1XEZA 1CJKA 3IR6B 2KXHA 1YBUA 3QQCD 4AL6A 4F2RA 3TUIC 4DUYJ 3M7VA 4NA2A 2NLWA 4U8VA 2HRTA 1JNRB 3NCPA 1R6YA 3E8OA 5CABA 3O8WA 5ETRA 1RAFB 4X4UA 2IVYA 5L1IA 2GO8A 2MQ8A 4Y6IA 3TQEA 1IKXB 2KRBA 2ZM6J 2XHCA 1YRTA 5EN1A 1H38A 3MR2A 3JTNA 1RJJA 2MQLA 1NPPA 2PN6A 3IGNA 1R89A 2Z30B 3MM9A 5THWA 1VOMA 5IXUA 1F5AA 4O44A 4FPIA 3PZPA 4RW7A 1FE4A 2B4UA 3FFIB 3CCVS 2F4VJ 3QPIA 4YDDB 1SH2A 2DKOB 1TL3A 4DX8H 5CZXA 3C6TB 2IBKA 4B9NA 1S59A 2C3PA 1LKZA 4ALZA 4DR1F 2ZWOA 1VQKS 1E6VB 1RWUA 2BKPA 3W7BA 3Q8YA 5DETA 2HHWA 1M5VC 5H9FJ 4ANEA 2J76E 3PO4A 3D67A 2HNDA 1FEEA 3NP5A 4GO7X 4DBQA 5DZ7A 1NK5A 1VDHA 2H48B 2JH3A 2MZSA 3C46A 3THTA 2LXFA 1C0UB 2N82B 9RUBA 3L9ZA 4A8SA 2BE7D 4QIFA 3G8QA 4FS2A 3DDKA 4NZ7A 4PWDB 1VQPS 4WP3A 1IKWB 1B0TA 2BZ2A 5HSPA 1WC6A 3M2RB 5HQLA 3SSRA 3PW4A 1URRA 2V67A 4MIAA 1L3UA 4FDFA 4ZG6A 2H4YB 1X60A 1JLGB 3T19A 3BDGB 3W63A 1K0TA 1OPIA 3FEZA 1KLNA 1T9XA 3HHLC 1WF2A 2LMIA 2QSWA 3OTCA 2QFJA 4MH8A 1F5BA 1U09A 2IJNA 1RAHB 1UJ5A 4YB7A 2W25A 1ZM4A 2JSXA 5FLXU 1S1VA 5JVGQ 2UUBF 4LF7J 1QVFR 2HW3A 3DRPB 4PG4A 4ZDNA 5F8LA 3M8PA 2PEHA 3NWRA 4PWUA 3UDEA 2DXFA 1HARA 4CT8A 4X64J 4KKOA 2DHXA 3HHEA 2FZCB 5AE3A 4PQUB 4QYZK 2K06A 5DG9A 4DLEA 3WQPA 1Q78A 4MKAA 4LR8A 5LRMA 2IFYA 1TFYA 4G3IA 1TVRB 2E44A 4CNZA 2VA2A 5KFAA 2HSEB 4H4MA 1V9OA 1YJRA 1EI6A 1R3NA 1GEHA 1TKZB 4K5RA 5IQQA 1W2BR 4DUYF 1J5OA 4QU7A 4GO5X 1KH9A 4RW6B 4Z7YA 3RR7A 4DV0J 2J9EA 4F4XA 4OV6A 5ETVA 3MMCB 2DGSA 4FYYB 2Y1RI 3HVTA 5A8RB 5CCMA 3HSDA 4UZCA 1PBUA 1QVGR 1EW9A 3H20A 2ZOGA 3PDNA 1SBRA 2ZWPA 1DLOA 3CCZA 3M2VA 3ZZUA 4ZIWA 1P6TA 1X5SA 3FKBA 3DLEA 1RT4B 1HBMA 4PG7A 4AQYF 3JSMA 4KKOB 4X4PA 1R8HA 3N9UC 5D0EA 2LYVA 2M9KA 2W9BB 3CDBA 3CD0A 1KWMA 3QGPA 4DDFA 4ELVA 5ETPA 1X4AA 4R25A 2C2EA 3K8WA 4TQRA 4B3MF 3VALA 3D28A 4CO5A 4DL2A 1VRTA 3MM5A 5D15A 3BS9A 3EGVA 2LFVA 3W62A 4NYZA 5DM6Q 4QWCA 3I55S 1YHQS 4RUHA 2CQ3A 1T3NA 1N56A 4NXNF 4AE5A 4NI2A 1IQTA 1IXKA 4G65A 4FF3A 1OSDA 3LGHA 4CZCA 2DNLA 4ED2A 3FFIA 3QIPA 1YKWA 4JI8F 1U0HB 3IWLA 4ID5B 1NPKA 4P74A 3FBCA 3BBCA 5KFRA 4OX8A 3WBZA 5B0BA 2XYPB 1NJIT 4IOCQ 2XY5A 5F3TA 4ZITA 1N6QA 2OMOA 3JS9A 4Y0FA 4ED3A 4NCAA 4WFNQ 3TANA 2RD5C 5DO2A 4MKBA 1HNZF 2CPEA 3EVOA 4JI4F 5JUMA 2B43A 3DRXA
chains in the Genus database with same CATH topology
2GSNA 3UN3A 4LRCA 5L0BA 1O98A 2G9YA 3WAVA 4UORA 4YR1A 4CXKA 4UOPA 2IUCA 4CYSA 3MK0A 5GRRA 1KHLA 1ZEFA 4FDJA 1KHKA 1EJJA 2GA3A 3NKPA 3T01A 5IJSA 5L0KA 1AJBA 3M8YA 4ZG7A 4CXSA 3NKNA 1KH5A 4MHXA 1ALIA 3B5QA 1E2SP 3BDFA 1SHQA 3KD8A 1B8JA 3BDGA 5KXAA 2W5SA 4QAXA 3CMRA 1ANJA 4UPLA 3E2DA 4KJDA 4FDIA 3M8WA 3WAXA 3BDHA 2XR9A 1ED9A 2IUCB 4LQYA 1EW2A 2ZKTA 4ZG9A 5HRTA 3DYCA 3M8ZA 2VQRA 4UPKA 1EQJA 4MIVA 4NWXA 5L0EA 4ZG6A 3BDGB 1AUKA 1ELZA 1HJKA 3Q3QA 3TX0A 1ED8A 3UO0A 3SZZA 2ANHA 4LREA 5K4PA 4UPHA 1Y7AA 2W5RA 3NVLA 3WBHA 2W8DA 1E33P 4LRFA 4LR7A 4LRBA 3NKRA 3UN2A 4LR8A 5LRMA 2IFYA 4GTZA 1P49A 3T00A 1EI6A 3UNYA 4GTWA 1K7HA 2W5QA 2GLQA 4LR2A 1ANIA 1ALKA 4CXUA 1URAA 3LXQA 4KM4A 5EGHA 2W8SA 5LRNA 1KH9A 1N2KA 1AJDA 5DLTA 5TJ3A 4UOOA 3IGZB 2W5TA 1N2LA 1EW9A 1HQAA 3IDDA 2GSUA 4TN0A 4UPIA 5DLWA 2W5WA 4ZGAA 1URBA 5LIAA 4LRDA 5INHA 1ALJA 1ALHA 1E1ZP 4KJGA 3UN5A 2W5VA 4LRAA 1ZEBA 1O99A 3MK1A 4GTYA 4N7TA 1KH4A 1KH7A 4B56A 1SHNA 2D1GA 3A52A 1Y6VA 3NKMA 3ED4A 1ZEDA 3NKQA 3NKOA 2XRGA 4CYRA 1KHNA 3SZYA 1AJCA 1E3CP 2GSOA 1FSUA 3WAYA 4NWJA 2RH6A 2W5XA 5LQQA 4LR9A 5IJQA 1KHJA 3TG0A 1ELXA 4KAVA 1EW8A 3M7VA 1ELYA 2QZUA 3OT9A 2X98A 3DPCA 3MK2A 1AJAA 1HDHA 3TWZA 4MY4A 3IGYB 3WAWA 5AJ9A 5GOVA 3T02A 4KAYA 5DLVA 5C66A 5EGEA 4GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSN A;  3UN3 A;  4LRC A;  5L0B A;  1O98 A;  2G9Y A;  3WAV A;  4UOR A;  4YR1 A;  4CXK A;  4UOP A;  2IUC A;  4CYS A;  3MK0 A;  5GRR A;  1KHL A;  1ZEF A;  4FDJ A;  1KHK A;  1EJJ A;  2GA3 A;  3NKP A;  3T01 A;  5IJS A;  5L0K A;  1AJB A;  3M8Y A;  4ZG7 A;  4CXS A;  3NKN A;  1KH5 A;  4MHX A;  1ALI A;  3B5Q A;  1E2S P;  3BDF A;  1SHQ A;  3KD8 A;  1B8J A;  3BDG A;  5KXA A;  2W5S A;  4QAX A;  3CMR A;  1ANJ A;  4UPL A;  3E2D A;  4KJD A;  4FDI A;  3M8W A;  3WAX A;  3BDH A;  2XR9 A;  1ED9 A;  2IUC B;  4LQY A;  1EW2 A;  2ZKT A;  4ZG9 A;  5HRT A;  3DYC A;  3M8Z A;  2VQR A;  4UPK A;  1EQJ A;  4MIV A;  4NWX A;  5L0E A;  4ZG6 A;  3BDG B;  1AUK A;  1ELZ A;  1HJK A;  3Q3Q A;  3TX0 A;  1ED8 A;  3UO0 A;  3SZZ A;  2ANH A;  4LRE A;  5K4P A;  4UPH A;  1Y7A A;  2W5R A;  3NVL A;  3WBH A;  2W8D A;  1E33 P;  4LRF A;  4LR7 A;  4LRB A;  3NKR A;  3UN2 A;  4LR8 A;  5LRM A;  2IFY A;  4GTZ A;  1P49 A;  3T00 A;  1EI6 A;  3UNY A;  4GTW A;  1K7H A;  2W5Q A;  2GLQ A;  4LR2 A;  1ANI A;  1ALK A;  4CXU A;  1URA A;  3LXQ A;  4KM4 A;  5EGH A;  2W8S A;  5LRN A;  1KH9 A;  1N2K A;  1AJD A;  5DLT A;  5TJ3 A;  4UOO A;  3IGZ B;  2W5T A;  1N2L A;  1EW9 A;  1HQA A;  3IDD A;  2GSU A;  4TN0 A;  4UPI A;  5DLW A;  2W5W A;  4ZGA A;  1URB A;  5LIA A;  4LRD A;  5INH A;  1ALJ A;  1ALH A;  1E1Z P;  4KJG A;  3UN5 A;  2W5V A;  4LRA A;  1ZEB A;  1O99 A;  3MK1 A;  4GTY A;  4N7T A;  1KH4 A;  1KH7 A;  4B56 A;  1SHN A;  2D1G A;  3A52 A;  1Y6V A;  3NKM A;  3ED4 A;  1ZED A;  3NKQ A;  3NKO A;  2XRG A;  4CYR A;  1KHN A;  3SZY A;  1AJC A;  1E3C P;  2GSO A;  1FSU A;  3WAY A;  4NWJ A;  2RH6 A;  2W5X A;  5LQQ A;  4LR9 A;  5IJQ A;  1KHJ A;  3TG0 A;  1ELX A;  4KAV A;  1EW8 A;  3M7V A;  1ELY A;  2QZU A;  3OT9 A;  2X98 A;  3DPC A;  3MK2 A;  1AJA A;  1HDH A;  3TWZ A;  4MY4 A;  3IGY B;  3WAW A;  5AJ9 A;  5GOV A;  3T02 A;  4KAY A;  5DLV A;  5C66 A;  5EGE A;  4GTX A; 
#chains in the Genus database with same CATH topology
 1VQ9 S;  1XBW A;  2G1D A;  2IM2 A;  4GMK A;  3KLF B;  5M2P A;  3HO1 A;  3FC9 A;  3M2U A;  2MJN A;  2J6T A;  2CAJ A;  4P7V A;  2E5G A;  4ZA1 A;  3SMZ A;  1N52 B;  1L3T A;  1WKK A;  3TA2 A;  1KHL A;  4C0O C;  4GKK J;  1ZEF A;  2BAN A;  1VGY A;  2X3G A;  4TN2 A;  1T3O A;  2F65 A;  2H9Z A;  3DHW C;  1B99 A;  2Q1L A;  1UW9 A;  1WI8 A;  3NGT A;  3PJ9 A;  5KFC A;  2Q3P A;  2YY3 A;  1KVI A;  1F9E B;  5L39 A;  2J0W A;  4UUX A;  5CQG A;  3NKN A;  2AKW B;  1LNQ A;  2BAN B;  4J9Q A;  2XSF A;  1N54 B;  2Z56 B;  4KBI A;  4ZPT R;  5LSO A;  4ZVH A;  2GQC A;  3F41 A;  1W26 A;  3SCI E;  3QFW A;  4RL1 A;  3ZTS A;  1XK8 A;  4M5H A;  3V81 B;  4BBY A;  1KOO A;  2DNH A;  2X51 A;  3BYR A;  4OYX A;  4ER8 A;  2KB2 A;  5T7L B;  2K8G A;  2IUC B;  1XR6 A;  1FD2 A;  3ZZY A;  4B02 A;  3ZTR A;  3OTE A;  4OYO A;  4QOT A;  4X84 A;  2V34 A;  1RT6 A;  2JOQ A;  3E3X A;  4CYU A;  1CBK A;  3HVW A;  3KLV A;  3RBX A;  2KZM A;  4GRS A;  1UVJ A;  3IM9 A;  3OUY B;  2P9G A;  2YX1 A;  2YWH A;  2IMW P;  5KFV A;  5KOW A;  5E2Q A;  1Q1K A;  2CJQ A;  1ELZ A;  2R7O A;  5G0R B;  4MAK A;  1MML A;  1BHN A;  1RGV A;  2EC2 A;  3CJ0 A;  3DRR A;  3TOQ A;  1U2C A;  1X4F A;  3I4P A;  7AT1 B;  2A2D A;  1U1M A;  1N5Q A;  4IRK A;  2BW2 A;  1SC1 B;  5FD1 A;  3TAP A;  1RBL A;  2H65 B;  3BBB A;  3OTO J;  3OL9 A;  2HVD A;  4LBP A;  3NVL A;  1CJK B;  2ZH1 A;  1HNV A;  1N32 J;  2GQ2 A;  1VBK A;  4NLY A;  1F2G A;  2EBG A;  4HKQ A;  2XG8 A;  1S0N A;  3FUY A;  3R5A A;  3QZ8 A;  3OXF A;  2FJW A;  1SQG A;  3NAH A;  3CJ2 A;  1YZ7 A;  1FER A;  2R2U A;  2RIJ A;  3PRD A;  1TL1 B;  1K7H A;  1RQ0 A;  2DXE A;  5C7P A;  2MKK A;  3MFI A;  2DXD A;  2OFG X;  1VFJ A;  1RT3 B;  1NKC A;  3IS9 B;  2ZH7 A;  3P45 B;  1S1U B;  3PXG a;  1U02 A;  4DL0 C;  2AD9 A;  2CQD A;  2IM3 A;  4UOG A;  4J9R A;  3OSP A;  4K4V A;  1DJ0 A;  5IT9 U;  3HT0 A;  4IG3 A;  1RTH B;  3D1H A;  1OQ3 A;  1S1W B;  2YH0 A;  2F3J A;  2KXF A;  2LVW A;  4HDH A;  3EVM A;  4PPD A;  3DLJ A;  4EMD A;  2GVD A;  2QX0 A;  2W9C B;  3BB5 A;  5KFH A;  1SH0 A;  1FFS B;  2CQG A;  3OJS A;  4ZCI A;  1ALJ A;  2AYM A;  4ZVT B;  3M32 A;  1FDB A;  4YR2 A;  2DNP A;  3UN5 A;  2D3U A;  1DY3 A;  4NPO A;  4KTQ A;  2C2M B;  1SHQ A;  4OHV A;  1KH4 A;  2CQ2 A;  1TL1 A;  3M6U A;  5DRK A;  1JB0 C;  3QAT A;  3D1O A;  1FRL A;  4X64 F;  1WG4 A;  5KFE A;  2BJE A;  5K8O A;  3T41 A;  2ZKU A;  1S9E B;  1TL7 B;  5HP1 A;  4IRC A;  4NYP A;  2B51 A;  5AXK A;  2QLB B;  1WEY A;  3KNA A;  4K0K F;  1XJW B;  4IFV B;  3D6M B;  4B08 A;  3OFG A;  3BQ0 A;  2JHE A;  5E33 A;  1YJV A;  1LWC B;  1SL1 A;  2KZZ A;  4KAV A;  1CS4 A;  4GVL A;  1XIQ A;  2XLK A;  3DC2 A;  4LUB A;  4UW2 A;  1IKW A;  5DQH A;  2NYI A;  5K20 B;  3T5K A;  2Q6C A;  2M8D B;  1RWW B;  2YKO A;  5AJ3 J;  4JV5 J;  2XQC A;  1KLM B;  3LP2 A;  3KWM A;  2GMH A;  1OO0 B;  3H5S A;  2OO4 A;  4NEZ A;  3SCL E;  4P6Q A;  2MGZ B;  2RHQ B;  4C98 A;  2RUG A;  3J7A 1;  5C66 A;  3KUH A;  2OPQ A;  3DYA A;  4C97 A;  3HF5 A;  4I2Q B;  4JI1 J;  2MZR A;  2YPY A;  1OWX A;  3LQV A;  4U67 Q;  2HBY B;  1HQU A;  1LW0 A;  3G6Y A;  4I2P A;  1JMT A;  3P96 A;  3QO9 B;  1WF0 A;  3S1T A;  2B8P A;  3IR7 B;  4M5M A;  4DV4 J;  4A8O A;  4KAI A;  3POT A;  3PIP Q;  1D8Y A;  1RZM A;  1UKU A;  1VHF A;  3BEG B;  3NKP A;  1EQ0 A;  2AJ1 A;  2B9W A;  2ZUA A;  2H4W B;  2FLP A;  3DLK B;  4XDD A;  1AZS A;  1DTQ A;  2LEA A;  3HX9 A;  1X4C A;  1G4C A;  3DGP A;  1BXN A;  5KFT A;  1X0P A;  5LJ3 Y;  1RLD A;  1VYA A;  3KLG A;  4EGL A;  2KM8 C;  3CXC R;  2ERR A;  2DNR A;  2C28 A;  4ECS A;  4M95 A;  3GJT B;  3OV7 A;  2HBZ B;  2YKM B;  3GIJ A;  2AQ4 A;  1KLM A;  1XMO J;  2KJW A;  1DTT B;  3MHY A;  3KTQ A;  3BM7 A;  3RBE A;  1NBE B;  3RW6 A;  1WHW A;  4ILL A;  3GCX P;  3LP0 A;  3FBE A;  1ZM2 A;  3M8W A;  2XSJ A;  1A6L A;  4R8U A;  1HI1 A;  2DH8 A;  1HKA A;  3BGL A;  3K58 A;  5I42 A;  1NK0 A;  2HNY B;  4C6A A;  1HQU B;  1LW0 B;  2CJY B;  3D3C J;  4FVM A;  4L74 A;  4RX6 A;  4I67 A;  1HD1 A;  4U9R A;  4ECQ A;  1HHT P;  2MB0 B;  5I3U A;  5T41 A;  3CED A;  2GMJ A;  8ATC B;  1SQE A;  2KO1 A;  4UOC A;  4ZVE A;  1KNZ A;  1EQJ A;  1BC6 A;  5L0E A;  3K0J A;  1ZM9 A;  4X65 F;  2VJU A;  3R1H A;  2V2V A;  4WYL A;  1RAB B;  2QA2 A;  3UR0 A;  2FB0 A;  2J6S A;  2AX0 A;  3MM8 A;  2DD8 S;  1HNW J;  1RYS A;  3IS9 A;  1VIS A;  2OPR A;  1WEX A;  1HWI A;  4C48 A;  4I64 A;  2L48 A;  2NXE A;  2C2R A;  1JKH B;  3OW2 R;  5E3P A;  2VU5 A;  3TI0 A;  2BQ3 A;  1G6B A;  1EHW A;  3KOA A;  5A76 A;  5E0O A;  1RAJ A;  5FLX Y;  5F3Z A;  3RAM A;  5FJ4 A;  1F0X A;  1S6Q B;  2AEF A;  2I6W A;  2ZD1 A;  3TRG A;  5EHH A;  2XLI A;  4DV5 J;  3GB0 A;  1S9G A;  4J5O A;  3WDO A;  1JLE A;  1P9Y A;  2V2Q A;  2DBB A;  4NLD A;  4NZ6 A;  2QEX S;  1ANI A;  1N33 F;  4Y2M A;  5KT5 A;  2XMA A;  2RML A;  3OLA A;  5HO4 A;  3EDR B;  3NXZ A;  3G82 B;  5LM7 E;  1DZ5 A;  5DLT A;  3CJ4 A;  3NOG A;  2HNZ B;  5B0A A;  4DHV A;  2FUG 9;  3KLH A;  1C0U A;  1NHV A;  5CYQ A;  1N2L A;  1F2H A;  4PCQ A;  3AJ2 A;  3WHI A;  2VG5 B;  1ACM B;  1NZA A;  3G82 A;  1H3D A;  1C1B B;  1RAG B;  1RP5 A;  2OD4 A;  3MED B;  4I6Y A;  2A6M A;  3VGV A;  3PIO Q;  2YTC A;  4WIQ A;  1JJ2 R;  4GKK F;  1Q0N A;  2GAH C;  4DPU A;  1LWF B;  4KO0 B;  5C24 A;  4NLR A;  2NR0 A;  4OZ0 A;  1YBT A;  5J1P A;  2I2Y A;  2KTQ A;  2NXC A;  1JLG A;  3N0V A;  3CO9 A;  5CAA A;  1UVL A;  4QIV A;  4O4R A;  4M1K A;  4XTT A;  3KJN B;  2UXD F;  4N7T A;  2BJ9 A;  2QRR A;  1HBN B;  4UQT A;  1XC9 A;  2OTJ S;  3PEH A;  1IBM J;  1KBR A;  2VQE J;  3H8Y A;  2BJD A;  2B7C B;  2DGV A;  4NEY A;  3A12 A;  1ZS6 A;  3CJ5 A;  3FBB A;  2PSZ A;  1TTH B;  1VHI A;  1VRQ C;  4IOB A;  1WF1 A;  3CCT A;  2DGW A;  1PJ6 A;  4EUV A;  3NMR A;  3WAY A;  1IR2 A;  5HMZ A;  4BLG A;  1WG5 A;  1V3S A;  4JB8 B;  1AUD A;  4IQX A;  1IKV A;  1L3S A;  3SI8 A;  1EW8 A;  4NRT A;  4CIO A;  3FZB A;  3OSN A;  2XGQ A;  3T1H J;  2X98 A;  5A2Q U;  2Y1J A;  3DGV A;  2R3V A;  4DWI A;  1DRZ A;  3QGI A;  3I56 S;  1UEV A;  3SCK E;  2R8I A;  3MD1 A;  2RNE A;  4ZJQ A;  2MGZ A;  3V6K A;  3Q8U A;  4DL5 A;  2BR0 A;  2LQJ A;  2V8D A;  3EXC X;  2UVV A;  4KAY A;  1HWL A;  1RT7 B;  4JI3 F;  4GTX A;  2WOM B;  2CIM A;  4H4M B;  2HHT A;  2J5A A;  2VL1 A;  3OVS A;  1N5S A;  3K2Y A;  2VBZ A;  2ZBR A;  4DUZ J;  1RT2 B;  3RG6 A;  3MM9 B;  4DS5 A;  1JLF A;  3T3F A;  2KDO A;  4DUT A;  2V8H A;  3R5D A;  5L8R C;  3IG1 B;  2IFX A;  2KM8 B;  3BDP A;  4LF8 F;  3S7R A;  2VFS A;  5CYM A;  3DRP A;  5KFJ A;  1GFW B;  3M8Q A;  1VK3 A;  4UY8 T;  1RWM B;  1CJT A;  1NCL A;  3TJ8 A;  3BN7 A;  3RRK A;  4K4Z A;  1T03 A;  2VV5 A;  4IDK A;  5GAG U;  4Q44 A;  4LFB F;  2NS1 B;  3K5M A;  2R7U A;  1WJ9 A;  3ISN D;  5KFU A;  4HHJ A;  5B09 A;  2CVE A;  4DFP A;  2W9B A;  2HQ3 A;  2UVW A;  3E2D A;  4V19 X;  2V6A A;  3DMJ A;  4HYK A;  3RB3 A;  1VQ6 S;  1N5Y B;  1HPZ A;  4H4O A;  2AZ3 A;  4IOA Q;  1ED9 A;  4V1A k;  3G9C A;  2WTF A;  3CPW R;  5KT3 A;  3DI6 B;  3PYE A;  2G0I A;  2QO3 A;  2M8H A;  3T5H A;  4V19 J;  1AYE A;  1UFW A;  2KJV A;  5D77 A;  4UPK A;  1VQO S;  4J9U E;  2VJV A;  4NWX A;  2HWH A;  2Y1L B;  4YB6 A;  5D4N A;  4F02 A;  3PV8 A;  1Y9O A;  4B9L A;  3KJF B;  3Q3Q A;  1RI7 A;  2HZC A;  3M32 B;  4MYU A;  4WK1 A;  3SZZ A;  3EYZ A;  2KXN B;  2AP6 A;  2VFU A;  4F25 A;  3G6X A;  5LMU F;  4B3O B;  1TL7 A;  4ETZ A;  3U02 A;  5HP1 B;  1O8B A;  2RDD A;  3NKY A;  4K2X A;  1OPZ A;  4X4V A;  2MKS A;  2W5R A;  3MUR P;  2H3E B;  2FIU A;  1M1H A;  3T5J A;  2W8D A;  2MKH A;  4LRF A;  4NLQ A;  4AYB D;  3LWM A;  4NLG A;  1LW2 B;  2YNH B;  5F41 A;  2G0C A;  2PEB A;  3A1Y G;  3OFE A;  2RDI A;  2FTR A;  1KP6 A;  3N5B A;  4GTZ A;  3HHL D;  4ILR A;  1FKA F;  2Q6B A;  4FKY A;  2RSQ A;  1RBA A;  2DHG A;  4NX9 A;  2JL9 A;  1S1V B;  3OXG A;  3UPF A;  2DPI A;  1QUV A;  1C2P A;  3M9N B;  1ZH5 A;  2E7W A;  1S12 A;  2EK1 A;  3T1A A;  3RRG A;  1FWK A;  1N2K A;  3CJR A;  2J6U A;  1TZ0 A;  2P9C A;  3E01 A;  3U1N A;  1YJ7 A;  4C7Q A;  4LVO P;  1OY8 A;  1VK8 A;  3M1V A;  1HI8 A;  3H40 A;  1XMQ F;  4TN0 A;  4DJB A;  1BLU A;  3AA8 A;  5DS7 A;  3GFZ A;  3W2V B;  4UT4 A;  1HNX F;  1RLC L;  2EEY A;  1C1B A;  3MED A;  4LF1 A;  4DCO B;  2F40 A;  4J9S A;  2PDA A;  4ES3 A;  4LSN A;  1CJV B;  2HIQ A;  5DLG A;  1LV5 A;  2F9D A;  4G1P A;  4C8L A;  3OR2 A;  1ALH A;  2BAB A;  1X9S A;  1LFW A;  3R27 A;  1VC5 A;  2KYX A;  1IKY A;  4QIW D;  3HI9 A;  2GHW A;  1UZH A;  2YKN A;  4QIE A;  2FY8 A;  1W25 A;  1X5T A;  3N4W A;  2V2Z A;  2ZJQ Q;  3QMQ A;  2VG6 B;  4I68 A;  4DU7 A;  3MR3 A;  2CQB A;  4IUF A;  1UVN A;  4B56 A;  1TUV A;  3KHG A;  4TY8 A;  4B17 A;  4E8U A;  2MQM A;  3M2V B;  3SFG A;  3BN4 A;  3D54 A;  1MW7 A;  2JFD A;  2ZIT A;  2CA9 A;  3D68 A;  4MIW A;  4R8U B;  3KHH A;  2QMU B;  1FX4 A;  2MZQ A;  3H2U B;  3BBF A;  4MK9 A;  1K1S A;  1BQX A;  3GIM A;  1UVM A;  2BE9 B;  1FSU A;  2P6S A;  2GSO A;  1FJG J;  4CDI A;  3IGY B;  1DQ9 A;  5IJQ A;  3ZC4 A;  2X7I A;  2EFV A;  3CSK A;  3MAH A;  5H9F K;  3KLG B;  2BM0 A;  2VFV A;  3S01 A;  2XMV A;  1TKT A;  2GHP A;  2ZE2 A;  4L73 A;  1UEK A;  4M5D A;  2WVE A;  1DUR A;  1FFW B;  1RTZ A;  3FEX B;  4CM2 A;  4DSE A;  3R97 A;  1GMW D;  5K8P A;  1GMU A;  5KFD A;  3CMQ A;  2D74 B;  1XNR F;  3MEK A;  3EZO A;  2F7V A;  2Z4P A;  3GWC A;  4OI3 A;  5IOL A;  3D0H E;  4FBT A;  2YNG A;  4HH0 A;  1H7W A;  2H51 B;  4J7C A;  2HWI A;  3Q8P B;  1S7I A;  2KN4 A;  2W1B A;  2D3O 1;  5D78 A;  3KMQ A;  3TJA A;  1PC4 A;  2XGP A;  1HQE B;  2FHJ A;  3ZNJ 1;  1HHQ A;  5HI7 A;  3IP0 A;  4QR0 A;  3G8T A;  3SQO P;  2C3O A;  1N0V C;  5IWA J;  4WII A;  3U1M A;  4DR3 J;  1NB7 A;  2B9E A;  4EU0 A;  3GFY A;  3Q2S C;  4PZV A;  2W2N P;  4YN3 B;  2MPU A;  2YNI A;  1GTH A;  2YWG A;  5DDP C;  4B9M A;  1FO1 A;  1TV6 B;  3MMA B;  3R6G B;  5ETS A;  5L1K A;  1D9F A;  4LR2 A;  4DQS A;  4M5G A;  4KPY A;  3LA0 A;  4ICL B;  3H7H B;  1F3V A;  3MPW A;  4FS1 A;  8AT1 B;  2JLF A;  1RU1 A;  4OMF G;  4CH0 S;  2OH2 A;  2MLY A;  1K1Q A;  2E1P A;  3G96 A;  1Y5L B;  1EW2 A;  5C25 B;  3A8J A;  4K4U A;  4F4Y A;  1RDR A;  1SQF A;  2HHQ A;  4TYB A;  4ZKA A;  2V4R A;  3V6H A;  1AFJ A;  1FRX A;  2DIU A;  4A8W A;  2FJV A;  3GON A;  3R3T A;  5C2G A;  1FK9 B;  3J7Z 5;  1RU2 A;  5LMN F;  2E1M C;  1FA0 A;  2KYZ A;  4EZ6 A;  2EC0 A;  3LP2 B;  1M5K C;  4FXW A;  1X4H A;  3K5L A;  4W92 B;  4RBT A;  2POK A;  3BH6 B;  2P8I A;  5ETK A;  1CC8 A;  2YQ1 A;  4O3P A;  5KFZ A;  4O3R A;  3F44 A;  4OZ1 A;  3UNG C;  3FMB A;  3LAN A;  1EX8 A;  1S9F A;  3MGJ A;  4F2S A;  1Q95 G;  1WHY A;  4R5P B;  2DR7 A;  4UPH A;  2F4F A;  5JVH Q;  4DLG A;  2A2C A;  1U48 A;  2OUG A;  1HWK A;  2AGP A;  4RKU C;  5C24 B;  4Z2X A;  5GAG I;  1B3T A;  4IR9 A;  2ABY A;  2GIQ A;  1S6P A;  1NHK L;  2DR9 A;  2LP4 A;  1SVD A;  3BGR B;  2JFK A;  3IAM 9;  4DL4 A;  1C1C B;  4QYZ J;  1UWB A;  4KSE B;  4L76 A;  2W5Q A;  1URA A;  3GFH A;  5E3Q A;  4HT5 A;  5F0W A;  4MJK A;  3U1L A;  4CLZ A;  2OIH A;  1UW4 A;  1JLC A;  2JZ5 A;  4DX7 A;  2FJE B;  1WSR A;  3FEY B;  2QLJ B;  3LGN A;  4CLU A;  3QNW B;  2EXU A;  4ZN1 A;  1NSQ A;  4NI2 B;  4ECX A;  2B4P A;  4DV5 F;  3R9L A;  2EI5 A;  2L9W A;  4DMZ A;  4USI A;  1SUQ B;  2CJA A;  4O4G A;  1FT8 A;  2BV3 A;  2DO4 A;  2HNY A;  3FRY A;  2R7V A;  5KFK A;  1BQN A;  5LIA A;  2ZVS A;  5B0E A;  4RNO A;  2UUC J;  4ZHR A;  2J8A A;  1U0S A;  3C8Y A;  2E1C A;  5KFX A;  2MSS A;  3MCM A;  1J27 A;  2HVH A;  3BGR A;  3LO3 A;  1GX6 A;  3CIZ A;  3TVK A;  3KHR A;  2UUA F;  1RHJ B;  1U26 A;  1VQS A;  2AX1 A;  2OEK A;  3D6H B;  2GML A;  4NA3 A;  1RWP B;  2IA0 A;  2V8P A;  2HAF A;  2WB4 A;  4ED1 A;  1B64 A;  2E5H A;  3T1H F;  2QSF A;  3KKF A;  2DVI A;  2CQ0 A;  3RTV A;  5F8H A;  1Y6V A;  2ZDO A;  3DLK A;  5A6P A;  2XY6 A;  3CJT A;  3IWN C;  2IJF A;  1U25 A;  2XMJ A;  2OGU A;  5KT2 A;  3UFC X;  4YY3 F;  4DR2 J;  1YTY A;  2HHP A;  5EWF A;  1Q8B A;  2LEB A;  2W5X A;  3E51 A;  3DOL A;  2DGO A;  1PSD A;  3FSX A;  4OHX A;  4O3Q A;  3JYT B;  4K0K J;  1XNQ J;  2ZHA A;  1S79 A;  4NZ0 A;  1UL3 A;  3PR4 A;  2G9O A;  2J9C A;  4DV2 F;  4ZPV R;  1PG5 B;  4P2F A;  3LP0 B;  2X1F A;  4DR4 J;  1D9A A;  5C25 A;  4I4B A;  4ES2 A;  3B8H A;  1NJX A;  3GQC A;  3QGG A;  3NCQ A;  5D0G A;  3MR7 A;  2E9T A;  5KFI A;  4CLK A;  5I3U B;  1XNQ F;  2GSN A;  3DCA A;  2KVI A;  1R0C B;  2JEJ A;  4LRC A;  1KQG B;  1F6T A;  1VQY A;  3BZQ A;  2B56 A;  1PBA A;  4DSF A;  3PY8 A;  1CS4 B;  5L0B A;  4DV7 J;  4H54 A;  1VR6 A;  1RA7 A;  4CTA A;  4N56 A;  2IUC A;  4CYS A;  3GJR B;  3RJM B;  2OFH X;  1X4G A;  3A13 A;  3O44 A;  2DEJ A;  2H5J B;  3N28 A;  4A8K A;  2V0N A;  2JRS A;  4M5J A;  1ZZF A;  2XYG B;  1RAI B;  2FGO A;  1HMV A;  1WDD A;  4FPR A;  2GC8 A;  3AY0 A;  2MJU A;  4WFX A;  3UI3 A;  2K1R A;  5E3A A;  4B9U A;  4BS2 A;  2A3J A;  3AH6 A;  2OEJ A;  1ALI A;  4NA1 A;  1HBN A;  2KRR A;  3VAK A;  4LMZ A;  1NK8 A;  2YVS A;  2CDQ A;  2YWW A;  3VQS A;  3BKF A;  3MPY A;  5F8J A;  4QW9 A;  4QAX A;  4OL8 A;  2QL9 B;  3BPD A;  3FCV A;  3MF5 A;  5MAO A;  1HA1 A;  4U96 A;  4C2M A;  4FF2 A;  1XMO F;  1P1T A;  2HS3 A;  2AGO A;  3CDE A;  4ZIV A;  2QL7 B;  2HQC A;  3EZU A;  1JLC B;  3BR8 A;  4C4W A;  4CM0 A;  2CPF A;  3ETM A;  5HBM A;  3OR1 B;  4RR5 A;  4M94 A;  3CIM A;  1CUL A;  2QJ3 A;  2APO A;  3CCU S;  4JV5 F;  2VQR A;  3MUT P;  4PRF A;  2Z0G A;  3MMB B;  4K59 A;  1C1C A;  1FHT A;  3NBP A;  1MNE A;  3A3O B;  1QE1 B;  4F26 A;  3UO0 A;  2HEK A;  4OX9 F;  4OJ3 A;  4LSZ B;  1FX2 A;  1S1U A;  4CLP A;  2XBP A;  2UUT A;  1FXR A;  1YZ6 A;  2CG4 A;  1V5V A;  3I0R A;  4WTY A;  1AUS L;  1X5O A;  2YKQ A;  1YRU A;  4Q2L A;  4IG0 A;  3PNI A;  4G1Q B;  4G1I A;  3J80 Y;  1YJW S;  2XS7 A;  1FKO A;  3R5G A;  1OYD A;  1SPB P;  1TL5 A;  2GVZ B;  5A8R A;  3CMA S;  2UXC J;  2MLX A;  3BV8 A;  3RYL A;  3HCX A;  1BQN B;  4EBC A;  1T11 A;  1ULR A;  3FCH A;  4KGV B;  2ACY A;  4ZVS B;  4O3S A;  3E2E A;  3ZZ0 A;  1YIT S;  2DTJ A;  2DH9 A;  1RWN B;  1RT4 A;  3CJS A;  1WEZ A;  3EIC A;  3LXQ A;  1M1G A;  4K50 A;  1CG2 A;  1QY7 A;  1RHU B;  2ZD1 B;  3DLG B;  2WVC A;  3DRR B;  4QPX A;  2WCX A;  3HHK A;  4YQW A;  2BVZ A;  4PWD A;  5TJ3 A;  4C8Z A;  1TKT B;  1QE1 A;  3DDN A;  1MU2 A;  5DDQ C;  2IPO B;  2XO7 A;  3F0N A;  4HTI A;  1SL0 A;  1GH8 A;  4OV1 A;  4MTP A;  1J2V A;  2IM1 A;  2K2P A;  1ZED A;  3EWG A;  1T7P A;  1KD1 T;  1HBM B;  2HLU A;  1MSW D;  1QSL A;  1UP1 A;  1REV A;  4O4G B;  5E3C A;  4ZGA A;  2HAI A;  2IBO A;  3NOC A;  4IDK B;  1C0T B;  3MEE A;  4ZJO A;  4Q43 A;  1VC0 A;  2EK6 A;  2N3L A;  2O66 A;  2XSJ B;  2CPZ A;  4DL6 A;  4DPW A;  1I6J A;  1IM6 A;  2VB6 A;  3QSI A;  3PKY A;  1X0F A;  2FHK A;  2LDY A;  3ZZZ A;  1YWX A;  1XMQ J;  4G6V B;  3P5T L;  1IM4 A;  4FNH A;  4OJ1 A;  1SHN A;  2Y3Y A;  2D1G A;  3TEG A;  4FYX B;  1UET A;  3K5O A;  2AYG A;  3TZY A;  4ZVP B;  1HMV B;  1WTF A;  3ZZO A;  2E5J A;  3JAM Y;  2OPR B;  3L7U A;  3Q0A A;  4ERD A;  4QWD A;  3IBF B;  3V2U C;  4LF5 F;  5KFY A;  2DH7 A;  1V3Z A;  3OTB A;  4M5L A;  3RW7 A;  1U6B A;  1KEK A;  1KON A;  2HBR B;  2KU7 A;  2LQ5 A;  2U2F A;  3NGK A;  1FJC A;  2QZU A;  1HW8 A;  3VAF A;  3JSY A;  4J91 A;  2MKY A;  5DJB A;  1AZS B;  4EZ9 A;  5DDO C;  3HHN B;  3K17 A;  4FKX A;  1Z4U A;  3QGH A;  4KYZ A;  4WXO A;  3OD2 A;  4DN0 A;  4WZM A;  5EGE A;  3P5B P;  3G71 S;  4F8R A;  2XZD B;  4KFB A;  2R7S A;  4CP5 A;  3UN3 A;  4CNY A;  1K73 T;  1IJE B;  4ED6 A;  3UD4 P;  3VGS A;  1YIJ S;  2FZK B;  1BD6 A;  2FY1 A;  1QJH A;  3W5Z A;  1YG0 A;  2PC6 A;  2V5H G;  4LFA J;  5RUB A;  4A8X A;  3PTW A;  4PQU A;  4ECZ A;  5ETM A;  4DZD A;  4X4O A;  2R7X A;  1R0A B;  2XWX A;  1H73 A;  1WWH A;  2P9E A;  4RU2 A;  5HAO A;  4WZQ A;  1AJB A;  4RW4 B;  5J2P B;  2C3Y A;  1ZA2 B;  4KGZ B;  4DS4 A;  1XR7 A;  4HT7 A;  4L3K A;  4MHX A;  5HAT A;  2RIL A;  1ZZN A;  5HBM B;  1SJ3 P;  1CJV A;  4OI1 A;  4XO0 A;  3I5B A;  4Q8E A;  4WXW A;  3HFK A;  3SIP B;  3NGD A;  2RE1 A;  3FRZ A;  1TK8 A;  1EP4 A;  1W2I A;  2ASY A;  3DRS B;  1FKP A;  4OLP A;  5DZ6 A;  3UR3 C;  1TKD A;  4F4K A;  1ITP A;  2W5S A;  1MWZ A;  1S1X A;  1QM9 A;  3G86 A;  3CCQ S;  2MEW A;  3NAI A;  1VRU A;  4UST A;  4OHW A;  4LBI A;  4U7C A;  2BMB A;  3GYG A;  1MLA A;  4F4Z A;  2V2K A;  1HPZ B;  1MRO A;  4H4O B;  5GMK a;  2E7X A;  4U95 A;  3LWL A;  1VCT A;  2NCK L;  3H90 A;  5ITH A;  1S9G B;  4X4T A;  1Q8I A;  2HZV A;  2R8K A;  2W7O A;  3AAW B;  4Q8F A;  4KPC A;  1NJW A;  1TP7 A;  1FD8 A;  3NGS A;  5JXS A;  2HMI A;  1SCJ B;  3OVB A;  1MWY A;  4J9N A;  1VRT B;  3HUL A;  3MM5 B;  3X3U A;  1E6V A;  1GK8 A;  3QWU A;  4FXV A;  1U0H A;  4DV1 J;  2QGF B;  1B7Y B;  3BPS P;  3PAC A;  4F4W A;  2COL A;  3P49 B;  1CEZ A;  4P2M A;  1U1N A;  4NCB A;  2WHO A;  1A0O B;  4HLB A;  5KOX A;  1WKL A;  1T0T V;  5SZT A;  3IMQ J;  4WFB Q;  2F1F A;  5K14 B;  4ZLN A;  2YWE A;  4S0M A;  1UWA A;  1S4E A;  2YNG B;  1FDD A;  2WSF C;  4K7Q A;  2DHS A;  4C8O A;  2QMX A;  3EGZ A;  4QCL A;  4NXM J;  1Y5N B;  2MQO A;  2BJ8 A;  3M9O B;  2UVR A;  1MMD A;  5IT0 A;  1JWW A;  1RTH A;  1UJ6 A;  3AFG A;  2Y9H A;  3R8Y A;  3IGZ B;  1HNX J;  2V9W A;  4JI6 J;  2BX6 A;  1JLA A;  4U7U K;  5F9N A;  3C14 B;  3HPO A;  2ZUG A;  3H25 A;  4RWX A;  5IC6 B;  5KFQ A;  1Q79 A;  4LF6 J;  3I32 A;  3UVJ A;  3AB4 B;  1Z2Z A;  4DX5 A;  2AU0 A;  5IZH A;  5DGA A;  3WIU A;  4ID8 A;  1N34 F;  4B3R F;  4WCE Q;  2C42 A;  1N5Y A;  2F4V F;  1R31 A;  4QQB A;  2DHA A;  2DY1 A;  1NZ8 A;  3E01 B;  2W5V A;  2VOP A;  2AIR B;  4NCG A;  2VBX A;  1O99 A;  3MK1 A;  2RF2 B;  8RUC A;  3FBF A;  5DM7 Q;  4DR5 J;  2BBE A;  1VIX A;  4GTY A;  2BJ3 A;  1RHK B;  5HMW A;  1D1U A;  1X31 C;  2ZVI A;  4DV7 F;  3A52 A;  1CQN A;  3B4D A;  1R7I A;  3BO2 A;  5J2M A;  2JEG A;  1FVQ A;  4X62 J;  1VIO A;  2D7S A;  3CJ3 A;  2V4J B;  3X1L B;  2WBR A;  2J7K A;  4CWB A;  3Q2T C;  3SDE A;  1S0O A;  1PAU B;  2D3O R;  1JLF B;  3D6T B;  5LQQ A;  3M8P B;  4ED0 A;  2J9D A;  5LOQ A;  3MAA A;  4P75 A;  5D8H B;  2Q79 A;  3SEO A;  1NSK L;  4DEZ A;  1WOR A;  3AQP A;  3GCW P;  3DPC A;  1AJA A;  3MEC B;  2BKO A;  1RT1 B;  2AHO B;  3LTO A;  4C3M A;  3V4I A;  3P6Y C;  4USV A;  5IM0 A;  3PX4 A;  1S6P B;  2JEI A;  1AXQ A;  3D66 A;  5GOV A;  2O01 C;  2XCA A;  4H4K A;  5HVH A;  4EO6 A;  4A4J A;  1VQM S;  2CPI A;  1NXI A;  2FJA B;  1NLK L;  3TZW A;  5CCL A;  1QDU B;  5U47 A;  2IY5 B;  4CXK A;  1SIZ A;  2HQF A;  4FYW B;  4PAB A;  4BCA A;  2XYH B;  3K8V A;  5IT4 A;  3CD6 S;  4GC6 A;  3IXQ A;  1TL3 B;  4K8R A;  1S4F A;  3L3C A;  3N6N A;  3SDE B;  1FNO A;  4N8N A;  5IV3 A;  2GA3 A;  2YKA A;  1Y3J A;  1YX2 A;  3C15 A;  3JQM A;  5L46 A;  1VQN S;  1RWO B;  3EJM A;  2JJ4 D;  3GZ7 A;  5CD4 A;  2MZJ A;  2QT7 A;  3B5Q A;  4ID5 A;  3UWT A;  3QZ7 A;  2ZBP A;  4B3O A;  5L9N A;  2HMI B;  2HQD A;  4ZPA A;  4K4X A;  4EYH B;  3EPI A;  4P10 A;  5KFP A;  1GT8 A;  1ANJ A;  1YVF A;  3JXO A;  1TUG B;  3HSZ A;  3QAE A;  3VAH A;  7FDR A;  1BMQ B;  4MFB A;  4DV0 F;  4WU2 A;  5L1J A;  3JB9 k;  1H98 A;  1RT2 A;  3D0I E;  3CWJ A;  2EFN A;  1OJ4 A;  2XHW A;  1VRU B;  5L9X A;  4IH7 A;  1KKH A;  4LQ3 A;  3ZTQ A;  1TAU A;  4CH7 A;  2FJX A;  1Q16 B;  1UEU A;  3Q89 A;  5HQ8 A;  2NPF A;  4B3R J;  4HAC A;  3W60 A;  4KGK A;  2WBM A;  5EDW A;  2LLZ A;  4MIB A;  1EJ7 L;  3GG1 A;  3FK4 A;  5KFO A;  3RRH A;  4OFZ A;  3W9H A;  1M0S A;  2NPI A;  4OJG A;  2VPZ B;  4DX6 A;  4JUZ A;  1S57 A;  5J2Q B;  2XI3 A;  1HLW A;  2M4M A;  2DNN A;  1X5P A;  2XMT A;  2ZBQ A;  4ZN3 A;  1FES A;  2M3D A;  2DGX A;  3K5P A;  5D4L A;  2RQC A;  4F36 A;  1IBC B;  3D0G E;  2C3U A;  1NRK A;  2VQF F;  4N77 A;  3IN5 A;  2E5L J;  3CME S;  1HIY A;  4WTO B;  3D4J A;  4WP9 A;  4DSI A;  2HQI A;  3NY0 A;  5EX0 A;  4RPF A;  4DV6 F;  2O5D A;  2DNM A;  4J9V A;  1BY9 A;  3MD3 A;  3KK3 B;  4B3S J;  2DPJ A;  1RT7 A;  3FSY A;  3GV5 B;  1DQA A;  2QYC A;  4Y2K A;  4KM4 A;  2F9J A;  3GYN A;  5AE2 A;  5JMN A;  3V6D A;  1RE1 B;  3TUJ C;  2GW8 A;  3BO3 A;  3KLE A;  5CZV A;  1LQ9 A;  3BSN A;  5T7L A;  4ZP7 A;  1NSA A;  3MDF A;  3FMW A;  4FVC A;  2AEJ A;  3TQ1 A;  5J1E B;  3M2R A;  3V81 A;  3V6D B;  2MMY A;  1B70 B;  2I9S A;  3WIV A;  4CO0 A;  2E9Z A;  4OI6 A;  1URB A;  4QPT A;  1V3R A;  1YDL A;  4IQM A;  1VI7 A;  1LWE B;  2VQF J;  1OQ6 A;  2PMH A;  1MWQ A;  3H59 A;  4ZVU B;  2EFQ A;  2K7J A;  2AJF E;  3DOK A;  3T1Y F;  1N36 J;  5G0R A;  3EPG A;  2C2D A;  1OY9 A;  1Q53 A;  2RS8 A;  3LP1 A;  1KVJ A;  1TQL A;  3MM6 A;  4BWM A;  3CCM S;  1OYE A;  1ZEB A;  3ZNU A;  1RKJ A;  1LWE A;  4ED5 A;  1N4L A;  4RUA A;  2NXU A;  1FVS A;  2MHN A;  3BGU A;  1QAJ A;  4Q45 A;  1H74 A;  2UP1 A;  4OJH A;  2DNQ A;  3C6U B;  3GR0 A;  2ZH6 A;  1VMB A;  1KFD A;  1YJU A;  4ETX A;  2GA7 A;  4UQG A;  2R2S A;  3N79 A;  1Y11 A;  3RB6 A;  1KHN A;  2MY8 A;  3NBP B;  1HR0 J;  3GMG A;  5LT5 A;  5E41 A;  2GVZ A;  3PX0 A;  1YJ9 S;  1IN0 A;  3LAL A;  3PEJ A;  4JOU A;  4I6W A;  4IYQ A;  4LR9 A;  3LF0 A;  3N5F A;  5EGY A;  1NPR A;  1ELX A;  4YUD A;  1S1W A;  4U8Y A;  1FTC A;  5CYQ B;  1YSJ A;  4URQ U;  5I3Q A;  3NKO A;  5KG4 A;  4LFA F;  4Y00 A;  4B9S A;  3HD2 A;  5DLF A;  1HDH A;  1BQM A;  2BJ7 A;  2ZC3 A;  3JSB A;  2DNY A;  2QL5 B;  1GXL A;  3TWZ A;  3UCG A;  4MY4 A;  3WAW A;  5KG1 A;  4RUC A;  2EBE A;  3CCE S;  2MST A;  2YKP A;  2AYB A;  4ZOS A;  4TNO A;  1HHS A;  3ENW A;  1O98 A;  1DHM A;  3SSQ A;  3MCS A;  1YLX A;  2YWF A;  1KR4 A;  2LEP A;  1FJE B;  1S97 A;  2HVI A;  3M8Q B;  1P1L A;  3T01 A;  4K4T A;  3IR5 B;  5IJS A;  1RT5 B;  3JSR A;  1UAW A;  4CTA B;  3WC2 A;  1G2E A;  2SXL A;  2JLG A;  2A10 A;  3DXS X;  1X4D A;  4F50 A;  1S1T B;  4QWB A;  1NDP A;  4E2F B;  1N6Q B;  1PAE X;  3VZI A;  4M8L A;  3PW0 A;  2RRA A;  3A4T A;  2BM1 A;  2PII A;  2IC3 B;  3VF0 B;  1SKS A;  2Q43 A;  3QIP B;  3MPV A;  4HR2 A;  3PG9 A;  3NNH A;  3GU0 A;  3D2W A;  1UFK A;  2DT9 A;  4NYO A;  5BJR A;  3NNC A;  5B0F A;  1Q7L B;  3ONQ A;  2AYE A;  3EMT A;  3FVY A;  3AOB A;  1HBU B;  2HND B;  2E1A A;  2VC0 A;  3ICL A;  3LAM A;  4HDG A;  5BXI A;  4DFK A;  1R8B A;  2HHU A;  1BE4 A;  2M5Y A;  2AEM A;  3CUN A;  2KHC A;  3I9Z A;  5CHC B;  2G2Y A;  3WX4 A;  3VGU A;  4IFV A;  4F04 B;  1CVJ A;  2VG6 A;  4O23 A;  1UWB B;  2ALY B;  1C4C A;  1WC4 A;  2CNK B;  3HZE A;  1HNZ J;  1PGZ A;  3FQL A;  2VG7 B;  3C6T A;  1S77 D;  4KQZ A;  4PG8 A;  2FYX A;  2W24 A;  1B7F A;  1PYT A;  5EWG A;  3KDN A;  2MZ1 A;  2V4J A;  3OTD A;  4BC7 A;  3P3D A;  2OAU A;  2L9N A;  3PYG A;  4WBF A;  1OIA A;  4JI2 J;  1Y7A A;  2FLO A;  1UVK A;  1Z2L A;  3MM6 B;  4HVZ A;  2RVJ A;  4C0B A;  2ATC B;  3Q8V A;  4RU9 A;  4C8M A;  2LDI A;  5J2N A;  2ADC A;  2WVD A;  3POT B;  4L75 A;  3TAR A;  1T94 A;  3PM9 A;  2E9R X;  1JJ4 A;  4JP8 A;  4JYA F;  1WHX A;  3KUG A;  2R2T A;  4B3S F;  2R42 A;  3CT9 A;  5H9E J;  1ZTT A;  4RW6 A;  2BRK A;  3O3L A;  3U27 A;  2X1B A;  4MYT A;  1KRP A;  4GTW A;  4A8Y A;  2EFG A;  3ILL A;  3QSY B;  4N41 A;  2YBV A;  4IKA A;  4PQA A;  4TKT A;  4UTG A;  2Z2Y B;  3QAU A;  1R0B G;  2EW9 A;  2BQU A;  3CC7 S;  2HG4 A;  1X4E A;  3I87 A;  4YME A;  2KT2 A;  4N5S A;  1R8C A;  1WC0 A;  4UOO A;  2ZHO A;  5KFS A;  2CJB A;  1ZOT A;  2IDE A;  4WK3 A;  4YDX A;  2R8H A;  3AD9 C;  2HS4 A;  1PCA A;  2DR6 A;  3FSI A;  2BQR A;  4DR6 J;  2UXD J;  2HFS A;  3SV3 A;  3GSD A;  3TUZ C;  4DCJ B;  1RWX B;  1FRK A;  4PXB A;  2YQ3 A;  3CB4 A;  3DOL B;  2R8J A;  4KHP F;  1TR0 A;  2V69 A;  5DG7 A;  1NK6 A;  4OI2 A;  2W2O P;  1IR1 A;  2HZA A;  3HD1 A;  2XI2 A;  4DXL A;  4KJG A;  4YB5 A;  3I0S B;  3SQG B;  3ZTP A;  3TZZ A;  2J0S D;  2FPH X;  1HD0 A;  4LRA A;  3DU5 A;  2AV5 A;  3TUP A;  2UV8 G;  1HW9 A;  4L3N A;  2OPP B;  4C3K A;  4DR3 F;  1XER A;  4DUZ F;  1Q82 T;  4HI2 A;  1L5U A;  3SZY A;  1FRH A;  3BQ1 A;  3DMJ B;  3KK2 A;  1KVK A;  5MLC V;  2DRB A;  2DNZ A;  4UOH A;  2CVI A;  1Q7Y T;  2G4B A;  4JI6 F;  1T9Y A;  2HS0 A;  2J7W A;  3DM2 A;  1RTJ B;  2EG2 A;  2HGL A;  3TAM A;  1EB0 A;  3R7N B;  2BE2 A;  5D0R A;  1A9N B;  1SIW B;  5AJ3 F;  3H2L A;  3P4U B;  4Q2M A;  5E7O B;  1S6Q A;  1BWE A;  3MK2 A;  1ZA1 B;  1JLB A;  2VAS A;  3C16 B;  2XCP A;  2LU2 A;  2MTL A;  5KXA A;  1H6K X;  2CKW A;  3NNA A;  2WON A;  4RJV A;  4HI1 A;  3TJ9 A;  1P27 B;  5EX3 A;  4DL3 A;  4X4S A;  4O44 B;  4FXD A;  4I7F A;  2FLN A;  2VQE F;  2OP5 A;  4DF8 A;  4OQJ A;  3EZ5 A;  4UOP A;  2ZBC A;  3GR1 A;  2ZH5 A;  5GRR A;  1KQK A;  2W8L A;  2YNH A;  4CI0 B;  4ED7 A;  2BDP A;  4NXN J;  1KHW A;  3QFH A;  2HHV A;  3CCR S;  3GTY X;  4DPT A;  2FHO B;  1WDT A;  5LMU J;  3KDO A;  2CQP A;  3EDQ B;  2R7W A;  3MMA A;  3EXY A;  4TXS A;  4K4W A;  1LWF A;  4KO0 A;  4A47 A;  2V9K A;  4ZVQ B;  3T9N A;  4OZN A;  3KJV A;  3QO9 A;  1S5Z A;  4LSN B;  3A8I A;  2FC9 A;  3TEH B;  4W90 B;  2E5L F;  1B8J A;  5BR8 F;  1SV5 B;  4IH6 A;  3G6V A;  4J9L A;  2BAC A;  4LF5 J;  4P2X A;  2IRY A;  4JV0 A;  3M1V B;  2VFR A;  1UZD A;  1NH7 A;  3HSG A;  3BDH A;  3AJD A;  4ZHR B;  3VAJ A;  2NSC A;  2VIC A;  2FHM A;  4LQY A;  2QTW A;  1H7X A;  1IJF B;  4CH1 A;  4KT0 C;  3QJL A;  2VPX B;  3M2U B;  2HK2 A;  3S6E A;  3ENA A;  2E66 A;  2VIH A;  3EUN A;  3NS7 B;  4Y2I A;  4CO3 A;  1QLN A;  3HK2 A;  4LFB J;  3IBC B;  2LXU A;  1TK5 A;  3MWB A;  1Q81 T;  2QA4 S;  1N34 J;  2PD1 A;  4NOH A;  4QIG A;  2DR5 A;  3DRS A;  2VDH A;  5H1S V;  3MR5 A;  3HVR A;  1XNR J;  1YK9 A;  1VBX A;  1SKR A;  4J9O A;  4DL7 A;  2VZ9 A;  2UVU A;  3SBM A;  2RU9 A;  2X1A A;  1ZBT A;  3PJX A;  4KHR A;  1EJJ A;  1HNI B;  5C42 B;  5LSL A;  4NLT A;  4KR0 B;  2UU9 F;  3KG0 A;  2OML A;  2MQP A;  3FQK A;  3OL7 A;  1R8A A;  2BYC A;  5BR8 J;  1T9W A;  4I69 A;  3QRP A;  4LR7 A;  1Y0H A;  4BDP A;  1JLQ A;  1VC6 A;  2BKN A;  2EWH A;  1E6Y B;  3VZH A;  3ZO7 A;  2K3I A;  2IYG A;  5J2M B;  1FNX H;  1EIY B;  3T6B A;  1RCO B;  1GMV A;  4TU8 A;  1FXD A;  1PYO B;  4DPO A;  1MN7 A;  1E6Y A;  2B7B B;  3QWP A;  3AT1 B;  1NK4 A;  2BUN A;  1EET A;  1RTD B;  2UXC F;  2QZ8 A;  1WHV A;  4TVA B;  3OQ2 A;  1NJZ A;  5DDR C;  3MOJ B;  4DOZ A;  1YI2 S;  2GSU A;  2FGC A;  2VON A;  1S6O A;  4QYR A;  2VBW A;  4NML A;  3PVX A;  5K8M A;  3GIL A;  1M5S A;  2Y0B B;  3IRX A;  4OZ2 A;  3T6J A;  5HLF A;  3MCN A;  2IVF B;  1LOU A;  5DQI A;  4KE5 A;  3VR1 A;  3CCW A;  4DN9 A;  3I0S A;  2AT1 B;  3SQG A;  3SYZ A;  3KG4 A;  2XEX A;  3CUL A;  2N3O A;  2HWT A;  4Y65 A;  2W9C A;  2W4C A;  1FEH A;  2CZV C;  2RQM A;  2YNI B;  4P9S A;  4M5K A;  5ETT A;  2M2B A;  1GNK A;  5KAK A;  5HRO B;  4QWE A;  4DR5 F;  3GE9 A;  4RW7 B;  3AOD A;  4WF9 Q;  5FDL A;  1HBO B;  1PC5 A;  1HBU A;  2CNO B;  3ILO A;  5HQM A;  4RW8 A;  2D9O A;  4KGM A;  5GAE I;  2MXY A;  1N0U A;  1I94 F;  4ZK7 M;  2HHH F;  2HGM A;  1NUE A;  3I6P A;  3KK1 A;  1VBZ A;  1WOS A;  1JNZ B;  3C16 A;  2NQP A;  1DFD A;  1WKJ A;  4ZCK A;  4PAA A;  4Z37 A;  3J81 j;  3W2V A;  4F3O A;  3TG0 A;  1PO6 A;  3OT9 A;  1APS A;  1FWL A;  4RWW A;  2HFN A;  4MK8 A;  3HHL B;  3CJK B;  3QLH A;  2ZNY A;  1T02 A;  3HZG A;  1LWC A;  1OY6 A;  1VJQ A;  2O3D A;  2VFT A;  5KFF A;  3VWS A;  2OI2 A;  4HHH A;  2HGN A;  2R2R A;  4OZL A;  3CCJ S;  1IBK F;  4ELT A;  5AJ9 A;  1Q86 T;  4AXI A;  1IQZ A;  3MEC A;  4PR6 A;  3HHL A;  3W66 A;  3SZ2 A;  4LF4 F;  3W8G A;  1RWK B;  1LFP A;  4R5P A;  4Y3C A;  3WAV A;  2ZFH A;  1K47 A;  4YR1 A;  2WAQ D;  2I38 A;  1EKS A;  3D1Q A;  4F67 A;  2NXN A;  4A46 A;  4ZLL A;  4K2J A;  5L0K A;  3TNV A;  1OS5 A;  1FE0 A;  5IQ6 A;  3RBD A;  5BYQ A;  2ASD A;  4CXS A;  3V6J A;  2F8M A;  3M6W A;  3SSS A;  4LF4 J;  2OPS A;  2R7T A;  4OX7 A;  3QYY A;  3MUV P;  2HRU A;  3D7S B;  3GLJ A;  1CUL B;  3KJV B;  1R27 B;  5KFB A;  4UZB A;  1SJR A;  1A7G E;  5LJ5 Y;  2KVQ E;  1X9W A;  1U24 A;  4QBU A;  3TA1 A;  5EWE A;  3RR8 A;  3KLI A;  3R5J B;  4ECY A;  2XNQ A;  3LGM A;  4OYZ A;  2WZ1 A;  2CWK A;  1NHU A;  1X8D A;  3DOM B;  1L3V A;  1NU4 A;  2CQI A;  3PW2 A;  3C3L A;  4KV8 A;  2Z8Q A;  3AXM A;  4ED4 A;  1UMJ A;  2OTL S;  2KI2 A;  1FWP A;  2Z2L A;  1DLO B;  1FFG B;  3DYC A;  3M8Z A;  2ASJ A;  5HRT A;  4K4Y A;  4LF9 J;  4ED8 A;  3ENQ A;  4J9M A;  1ROF A;  2DHH A;  4QZV B;  2GIR A;  3L7P A;  3QBC A;  3ZZT A;  2PI4 A;  2KFN A;  1RWV B;  3PCO B;  4C11 A;  5BYS A;  4R0J A;  1AUK A;  4B9T A;  3PHT A;  4Y2A A;  3LH2 S;  1S10 A;  2B6A B;  2VBY A;  4ES1 A;  4OHZ A;  4WFA Q;  3GII A;  1NDK A;  3MM7 B;  4LT6 A;  4GC7 A;  2AGQ A;  2CPD A;  3R7B B;  4ZPD A;  4KHP J;  4O3N A;  3ILJ A;  1S7H A;  4FBU A;  4IG3 B;  1E33 P;  1YRX A;  4BC9 A;  3CC4 S;  3NRB A;  3H5Y A;  2IAJ A;  4Q7A A;  3NKR A;  1QSS A;  1FRI A;  6FDR A;  3RUB L;  1HBO A;  4CLW A;  4CO4 A;  1CLF A;  4P2S A;  1P49 A;  2OEL A;  5B0G A;  3BKU A;  1T9U A;  3PJW A;  1QD1 A;  2B9Y A;  4RNH A;  4ZVG A;  2C1E B;  3KLH B;  3H4B A;  1YBA A;  2NRE A;  5LRN A;  3W64 A;  4EFA C;  1DAR A;  1WEL A;  1LK7 A;  2AWZ A;  3PYD A;  5ADZ A;  4K5S A;  4I1T A;  3WC0 A;  4N76 A;  2RRN A;  1ZAW A;  3QJP A;  1KSP A;  4TU7 A;  3BYP A;  1IBK J;  2UUW A;  4A8Q A;  3IDD A;  1JXE A;  1G7C B;  3MOZ A;  4YOE A;  1RB0 A;  1U6Z A;  2JC0 A;  3TR5 A;  3D9B A;  5AE1 A;  1IBM F;  2YNF B;  3O2I A;  1S48 A;  4LRD A;  3W2W B;  3K57 A;  3V5R A;  4X62 F;  1UFL A;  3J7Y U;  5GAH U;  3J81 Y;  2DGQ A;  4NLW A;  1CC7 A;  2NUU G;  4QU6 A;  4JI0 J;  1IKY B;  1T9V A;  1T9T A;  4RW9 B;  5K5M A;  1HQ2 A;  3PFE A;  5IFM A;  5H9E K;  1VQ8 S;  1EP4 B;  4NLP A;  3AOA A;  2ROG A;  1JK9 B;  2FQQ B;  4OI0 A;  1XR5 A;  1U4B A;  2JEF A;  4HHU A;  1UA1 A;  3OL8 A;  2HK3 A;  2WVF A;  3EGW B;  3H0P A;  3ED4 A;  1K0V A;  1JLA B;  4QR2 A;  3TYT A;  2Y8W A;  5J2Q A;  3I9V 9;  2DNG A;  2RAQ A;  5ETO A;  5EUH A;  1HYS B;  1KFS A;  1YQH A;  1I94 J;  2GCF A;  1U1P A;  3V4M A;  1OMS A;  2D9P A;  1TKX B;  2QN6 B;  4MMO A;  1M5O C;  5CH7 B;  2LKZ A;  1WOO A;  4EBD A;  1PJ5 A;  1KTV A;  2OSQ A;  3I0R B;  3M30 A;  2V68 A;  4AUK A;  1U47 A;  1KC8 T;  1ZM3 A;  2KT3 A;  1RT6 B;  3FGV A;  3DRY A;  4WFZ A;  2LU1 A;  2WOM A;  3CVK A;  3HT3 A;  4C8N A;  2ZJR Q;  4ZPB A;  4IRD A;  4FF1 A;  2GGP B;  2IRU A;  2FD2 A;  4YEA A;  1NK7 A;  3BQ2 A;  1VQ5 S;  4X65 J;  3TW0 A;  3THV A;  2N4C A;  4ZPW R;  4DR7 F;  4ECV A;  3KLI B;  4QJV A;  2HPU A;  1ZTW A;  1SB6 A;  1DTQ B;  3OHA A;  2MY7 A;  1S0M A;  4AL5 A;  2BRL A;  2G9Y A;  4GVB A;  4DV3 J;  4PPZ A;  2CFX A;  4B9V A;  5L1L A;  1WUU A;  3BKT A;  3TA0 A;  5A0Y B;  4ZCL A;  1RTI B;  4RO0 A;  5BYR A;  4CT9 A;  3J80 U;  3RB4 A;  1K8A T;  2XC9 A;  2K7K A;  3ENV A;  1DTT A;  2A0F B;  4X66 J;  4ZG7 A;  5M2U A;  1U6F A;  2HLT A;  1SC3 B;  2OEM A;  4ZVO B;  1KH5 A;  1RTI A;  5HJY A;  3ET6 A;  2Y1I A;  5IV4 A;  2U1A A;  4JI8 J;  2Y8Y A;  1IWG A;  3M30 B;  2OPP A;  2LXI A;  2CZ4 A;  1K9M T;  3DLE B;  4P72 A;  1E2S P;  3MM8 B;  1S1T A;  2J9D E;  4WJB A;  1FJG F;  2AMC B;  4B3M J;  4UPL A;  2NSB A;  3KJQ B;  1KQF B;  5KFG A;  4WPA A;  4FDI A;  2IRX A;  2PT0 A;  3VVU A;  5KTQ A;  4LFC F;  2P5V A;  5I42 B;  2XZT B;  4OZ5 A;  3UW1 A;  3DM2 B;  2G2Z A;  3GJS B;  2A1B A;  3VCD A;  2FVP A;  4ZG9 A;  5A6W A;  3U7J A;  1SC6 A;  4RBV A;  1ARO P;  3O5T B;  1NH8 A;  4MIV A;  3PR5 B;  4PG6 A;  3H5U A;  3NEK A;  5DGB A;  2ZDP A;  1RAD B;  2QLX A;  3IG1 A;  4DZ6 A;  5JJB A;  1U1K A;  4LSL A;  1TV6 A;  5AXN A;  1DQ8 A;  1U7L A;  2MDA A;  5KG7 A;  3LOU A;  4CO2 A;  3M8S A;  2RHS B;  4A8M P;  3B82 A;  2PMW A;  3ET6 B;  2K1R B;  4LRE A;  3AD8 C;  4RUB A;  4WE1 B;  5M2R A;  4DFM A;  3UCU P;  5D4O A;  1IR0 A;  3CJ8 A;  2X1G A;  3NWG A;  1CSJ A;  1VJW A;  2B5J B;  2I5J A;  2LQ9 A;  3CO0 P;  3IAS 9;  3J7Y I;  2UUB J;  2V8G A;  1QAI A;  3G8S A;  3PKM A;  4LRB A;  4M63 A;  1JIH A;  2ZOF A;  1HL6 A;  4IO1 A;  4YFU A;  1RT1 A;  2H1Y A;  4Z7C A;  3THP A;  3QLH B;  4ZCM A;  5GAD I;  2W9A A;  5HJX A;  2R9L A;  3T5L A;  3KLF A;  1FJ7 A;  4C3L A;  2XO6 A;  3QJJ A;  2RKI B;  5KFL A;  1ALK A;  5GAE U;  2N7C A;  2G2O A;  4P71 A;  2RB7 A;  3ILI A;  3J7A N;  3NL0 A;  2GJ2 A;  1CQM A;  4JI5 J;  5F9L A;  1QAY A;  4LQ9 A;  1Q4R A;  4U6P A;  4USU A;  2I8E A;  4K4S A;  3H4D A;  4H4K C;  2Z58 B;  3EVW A;  1ELO A;  5F8N A;  2Z2M A;  2IM0 A;  2QE5 A;  2IDL A;  1TKZ A;  2D1C A;  1KN6 A;  1GAO A;  2WW8 A;  4ECR A;  2GJI A;  4NCG B;  4YS2 A;  4DV3 F;  1NKE A;  5A8W B;  1EKR A;  2CJ9 A;  3HKW A;  1KDN A;  2GO9 A;  3MTK A;  4URS A;  3IRW P;  3ZZP A;  3UDV A;  2R8G A;  5GME A;  2ZH8 A;  2RH3 A;  2CJX B;  2RKI A;  4XPC A;  3HKZ D;  3DGP B;  2DCL A;  6AT1 B;  1NK9 A;  5HN0 A;  1TAQ A;  2HBQ B;  2AJQ A;  4NLU A;  3VVT A;  5D6G A;  1X4B A;  4KGX B;  3OJU A;  5LL6 d;  2FVC A;  3ZTO A;  2PO4 A;  4FYV B;  1MU2 B;  3QT6 A;  5F8I A;  3JSM B;  2LEC A;  3I96 A;  4CRJ A;  1SL2 A;  1ICE B;  3W1Y C;  4FF4 A;  2KL8 A;  5IS2 A;  1H2U X;  1D8Z A;  2HVZ A;  3Q8R B;  2ZE2 B;  3V4I B;  3I31 A;  3FJ2 A;  1ELY A;  2CDR B;  1MG7 A;  2E7V A;  2ZH3 A;  4IO9 Q;  4PG5 A;  2DGT A;  4ZLJ A;  2B9X A;  2B6A A;  1FDN A;  1JQG A;  2O67 A;  3BO4 A;  1UVI A;  1G3O A;  3C15 B;  1RA6 A;  2GGP A;  3OFH A;  2WSC C;  1U2F A;  5F8M A;  5DLV A;  1P8G A;  2ZC4 A;  4PYD A;  4ZMM A;  3L09 A;  2IYI A;  2DNO A;  1WOP A;  2NZC A;  3VTI A;  5D3G A;  3R2C J;  4QR1 A;  1XQI A;  4KJI A;  3TX8 A;  4UOR A;  3MTJ A;  5E5N A;  3K89 A;  4TQS A;  5KFM A;  1T03 B;  3MK0 A;  2NYH A;  1RBO B;  2XMW A;  5D0H A;  1T05 B;  3AD7 C;  4DQP A;  1BGX T;  4PUO A;  1LWX A;  1U49 A;  1EAR A;  1LEO A;  1JLB B;  2PA8 D;  4UF4 A;  4F0M A;  1K44 A;  1N32 F;  1R6V A;  2DR8 A;  2QG9 B;  2DYA A;  1QAX A;  2N7Y A;  4USJ C;  3MR6 A;  1FRM A;  2Y0S D;  3B54 A;  4AND A;  3GFX A;  9ATC B;  4Q5V A;  4E98 A;  3DI6 A;  5HLF B;  2FJD B;  1RAA B;  5INH A;  2XMU A;  1PIL A;  2WB1 D;  3J7Z T;  3NCR A;  2VG5 A;  4M5D B;  1F3F A;  3L4B C;  3GIR A;  4JV2 A;  5LMN J;  2ASL A;  2VOD A;  4JYA J;  4KJD A;  3NGR A;  3B4M A;  2N4D A;  1UA0 A;  2QFI A;  4Y28 C;  2HFU A;  2ZH2 A;  1SV5 A;  4TLR A;  3W2W A;  3CDU A;  3HSJ A;  1MN9 A;  2FJB B;  1S0V A;  3NGU A;  4OYA A;  4P73 A;  4WKR A;  3IC1 A;  4QW8 A;  5B08 A;  4RNM A;  1NJY A;  1SJQ A;  3KNG A;  1ZAX A;  2P6T A;  2DIS A;  2M52 A;  1F60 B;  2UXB F;  5L38 A;  4OX9 J;  4XPE A;  4OZ3 A;  2XLJ A;  2BEF A;  2HFO A;  3G4S S;  1HJK A;  2CPH A;  3Q22 A;  2CUY A;  3RBZ A;  4AD6 A;  1F1B B;  3HJV A;  3TAQ A;  2W7A A;  3HMJ G;  3BRE A;  1JXL A;  3ITH B;  2D41 A;  3M6V A;  1IBL J;  3ZZR A;  2RDJ A;  4ZP8 A;  3UE2 A;  2RT3 A;  2YKN B;  2VKZ G;  1UJ4 A;  5KT7 A;  4TLQ A;  1F9F A;  5KG6 A;  4KFB B;  4PXE A;  1U8S A;  1HNI A;  2CQC A;  3ZXW A;  5C42 A;  2J0Q D;  1WI6 A;  3NKM A;  2E1R A;  3R2D J;  2AJ0 A;  1HYS A;  2HHX A;  4AT1 B;  2KG1 A;  3WX8 A;  1HNV B;  1XTZ A;  1I5O B;  4ANC A;  2ILY A;  1I3O B;  2EFO A;  1Q8L A;  1R43 A;  2VPW B;  1RUS A;  1U1Q A;  1ZET A;  3W9J A;  3CCS S;  2W01 A;  3T00 A;  3GPA A;  1MRO B;  3KHL A;  4J9K A;  1V6H A;  5ETQ A;  4CLL A;  3T1Y J;  1N36 F;  1M5P C;  3LPE A;  1X9M A;  2VPY B;  3B78 A;  1S1X B;  1RT3 A;  4XDC A;  1RAC B;  1Y4Z B;  1H72 C;  1N88 A;  2IHR 1;  4DQI A;  1O5J A;  2IJR A;  4OYW A;  4IH5 A;  2DO0 A;  3GP9 A;  1TU0 B;  3LPY A;  4KB7 A;  3R7S B;  2Q66 A;  3KUE A;  4M5N A;  1M90 T;  3GIK A;  4NLO A;  4WWS A;  1OSC A;  4TYA A;  3Q83 A;  4MT1 A;  3C19 A;  2BOA A;  1PYS B;  5KG0 A;  4OHY A;  2E5I A;  5J1N A;  4UUW A;  3Q8Q B;  2B4O A;  1U2R A;  2D69 A;  2GFF A;  3AHP A;  4BWJ A;  3SCJ E;  1TFW A;  1EET B;  1RTD A;  3MXH P;  1Q5V A;  5HMY A;  1NKB A;  2MHE A;  3CCL S;  3W9I A;  4J37 A;  4USW A;  2MQQ A;  3IGV A;  3DDI A;  5FII A;  3G2X A;  3MM7 A;  4UY8 5;  4DV2 J;  5KG2 A;  1RHM B;  1V5I B;  3ETO A;  2EG1 A;  3BH7 B;  4HEA 9;  4JBC A;  4PEO A;  5AXL A;  3VHQ A;  3HFZ B;  4YR0 A;  3Q24 A;  4IFY B;  2C2Z B;  5ETN A;  3BSO A;  1J5E F;  2UUC F;  1U8W A;  5SUH A;  4ZVR B;  5D3G B;  4HAC B;  2NZ4 A;  1AJC A;  3OBI A;  4AXJ A;  5CA5 A;  4NWJ A;  4ELU A;  1PJ7 A;  1HR0 F;  2RH6 A;  2HQG A;  3ELH A;  1M1K T;  2PA3 A;  2FLL A;  2CQ4 A;  5C5J A;  3DLG A;  1FNM A;  4DSK A;  3VAG A;  2A18 A;  3IA0 A;  5KFW A;  3QT8 A;  1TMM A;  3AXK A;  4MK7 A;  2WRM A;  4ZS6 A;  3OXL A;  2Z57 B;  2V4Q A;  5CXT A;  1JLE B;  2W2Q P;  3CD5 A;  1WTB A;  2JC1 A;  1YGY A;  2NUH A;  5GMD A;  4LF9 F;  2HIY A;  4ENO A;  1RT5 A;  1SH3 A;  1XWL A;  2G1H A;  3HDS A;  2EFP A;  4JI0 F;  2UXB J;  3BDF A;  2GHV C;  1UPP A;  3DXB A;  4Y2C A;  2DNK A;  2JVO A;  1RIS A;  5I3P A;  3G87 A;  2R7Q A;  2KFY A;  1B0V A;  2IMO A;  2IC3 A;  4JI1 F;  4C8Y A;  3CD7 A;  1GTE A;  3K5N A;  3J81 U;  4FDJ A;  1QTN B;  2C2K B;  1VQL S;  1GXT A;  1YJT A;  3NG8 A;  3MUM P;  4YY3 J;  4DR2 F;  2MZT A;  3R5C A;  2XM3 A;  3A8E A;  4PXC A;  1CPZ A;  3DKD A;  3DLH A;  4DSL A;  5KT4 A;  4DG1 B;  3BJY A;  1WSV A;  2LA4 A;  4D3H A;  1SKU B;  4Y34 A;  3UQS A;  3BGO P;  4AFF A;  2WW4 A;  3KD8 A;  1E3C P;  5F0U A;  4NXM F;  3BDG A;  2CQ1 A;  3G6E S;  2WON B;  4MKY A;  3HLU A;  4ICL A;  4NAS A;  2G13 A;  3GJQ B;  4RBU A;  5KFN A;  2LCW A;  3MCO A;  3EX7 B;  1BQM B;  2ZZT A;  3CDW A;  2DIT A;  1JJC B;  1IKV B;  3GV8 B;  2ZH9 A;  3VV2 B;  1LK5 A;  4TU9 A;  2QA4 G;  1B0P A;  3PRB A;  2F5G A;  2R4F A;  4O0N A;  4EEY A;  2PGC A;  4URG A;  4DF4 A;  4B3T J;  4LJM A;  2FVQ A;  4CO1 A;  1ZYQ A;  3H98 A;  3LP1 B;  3TVY A;  4JI5 F;  4LF8 J;  2ANH A;  3HXM A;  5HK4 A;  2PMZ D;  1DAX A;  1NAQ A;  2CNN B;  1FKO B;  1GXU A;  1H0H B;  1N5T A;  1W7W A;  2VD3 A;  3AQO A;  3O6Q A;  4NLX A;  2CPX A;  1H2V Z;  2XWY A;  4EI2 A;  1D0E A;  1KTQ A;  1I51 B;  4QWA A;  3WBH A;  4A8F A;  5KG5 A;  2EKN A;  2ROE A;  3KXD A;  3NS6 A;  1NM2 A;  4NRU A;  2OPQ B;  1BUX A;  2C3M A;  3DYA B;  4ZP9 A;  7FD1 A;  3W8P A;  3TZX A;  4LBH A;  3PW7 A;  3L95 X;  3VGT A;  1JX4 A;  2QYG A;  2QLF B;  1GQE A;  2XZW A;  1BWV A;  1F5C A;  1GMW A;  2GJF A;  2PE8 A;  1FRJ A;  4KH0 B;  2X3D A;  2CXE A;  3P8B B;  4IFY A;  3UN2 A;  1IWA A;  1WC5 A;  5AT1 B;  2OSR A;  1B4S A;  3SXL A;  4DPY A;  4LFC J;  3OUY A;  2KFZ A;  1RKI A;  3MPD A;  4TY8 B;  4XAK A;  3LW5 C;  2K3K A;  3UNY A;  4DU8 A;  4RNF A;  2XNR A;  4U7U D;  1D3W A;  1EQM A;  4NL5 A;  4NLS A;  1IUJ A;  4ZVF A;  1SJ4 P;  2AW0 A;  1ZPV A;  2W8S A;  3UCZ P;  3FCW A;  5EGH A;  2DIV A;  5A2Q Y;  2IAJ B;  4CLT A;  1S76 D;  4R0E A;  4C8K A;  4LVN P;  1RSC A;  1Y3K A;  4NMX A;  4ZJL A;  2YKM A;  3H42 A;  3M6X A;  2VF3 A;  4DR6 F;  4OLO A;  2JLE A;  2VKR A;  1FDA A;  4OI4 A;  3DOM A;  4C0H A;  4YHH J;  2BA9 A;  2DEI A;  3B6B A;  4AQY J;  1HNW F;  2R7R A;  2L08 A;  2RS2 A;  4CLY A;  4TY9 A;  2HUR A;  1Z1Z A;  3CW2 C;  4F0H A;  2XS5 A;  3MPU B;  1AW0 A;  2W4P A;  3RB0 A;  2VHG A;  1FTR A;  1T95 A;  5A0Y A;  2KH9 A;  1VQ4 S;  2L9D A;  1GX5 A;  3SV4 A;  3MEG B;  2GQQ A;  4CYR A;  3NKQ A;  4L72 B;  5CYM B;  3D5M A;  1Y00 A;  1FI4 A;  4W98 A;  2MKI A;  1R0A A;  2GZO A;  1LW2 A;  5I4M A;  5LSR A;  1S49 A;  2XY7 A;  3QRR A;  4X4Q A;  4Q0B A;  1JKH A;  1KHJ A;  1FCA A;  2ACM A;  4KHM A;  1N33 J;  2F8H A;  4I7F B;  1U1L A;  4YP3 A;  2ZHB A;  3FZ2 A;  2NXJ A;  3ZFV A;  2M88 A;  2GIF A;  3L7O A;  2GX8 A;  2HFZ A;  2J0X A;  3W65 A;  4DR4 F;  2H5I B;  2ZBI A;  4JI4 J;  1KHV A;  4P52 A;  2HHH J;  5IM0 B;  2DB1 A;  3T02 A;  1SI9 A;  2RQ4 A;  3VAI A;  1LXJ A;  4PKD B;  1YJN S;  4L6V 3;  3IWX A;  2LQ8 A;  2GS8 A;  3GYX B;  1S9E A;  3N6L A;  2QC3 A;  1WAC A;  3UDL A;  2ILZ A;  3ULH A;  3HP6 A;  4DSJ A;  5B0D A;  1WNE A;  4NWB A;  1Y5I B;  3C6U A;  3N6M A;  2Z2Z A;  4OYP A;  4RW4 A;  4ATN A;  5J2P A;  4HTJ A;  3OTO F;  4ECW A;  1U1R A;  4ECT A;  3R1L A;  3CF5 Q;  4USK A;  3VAM A;  2ATL A;  2V94 A;  3AA9 A;  2CPY A;  3M8Y A;  4IG0 B;  3BDE A;  2IIH A;  2OJ3 A;  1D09 B;  3CJK A;  1L3K A;  3DOK B;  1PIE A;  3BF4 A;  3I5C A;  2DRA A;  2XS2 A;  2JNJ A;  2F8E X;  2YXL A;  2IVM A;  4FZV A;  1RAO A;  5D4P A;  2OLW A;  2B8Q A;  3CJQ A;  5IC4 B;  3MI7 X;  3UD5 A;  2ALZ A;  2BW7 A;  2HVE A;  2W2M P;  2DCU B;  2MLZ A;  3H2V E;  1IKX A;  3LUY A;  3PFO A;  3MMB A;  4FNI A;  2L41 A;  3KMS A;  3F73 A;  4JI7 J;  3CMR A;  3GG0 A;  4YB1 P;  1O6X A;  2OD6 A;  5LXR A;  2C2O B;  4CYU B;  3WAX A;  3K59 A;  2V8V A;  3OFF A;  1IVZ A;  4DR1 J;  2XR9 A;  2YX4 A;  4PWW A;  1WC1 A;  2QA1 A;  1NSP A;  1RCX B;  4XK8 C;  4EBE A;  1D9D A;  4EO8 A;  3I4H X;  3TP2 A;  2J7U A;  1AB8 A;  1SJ1 A;  5B0C A;  3KYL A;  4DV1 F;  1SXL A;  2GAG C;  3KFW X;  3Q23 A;  2E29 A;  2BJ1 A;  1NME B;  3M4X A;  3O1L A;  2ZJP Q;  3C2P A;  4X2B A;  3BSC A;  3NLC A;  4FP9 A;  4RLE A;  4ZP6 A;  5K9F A;  3TX0 A;  2KT5 A;  4YHH F;  2F63 A;  3CGI A;  2IA6 A;  1XMB A;  2G0J A;  1SJF A;  2FVS A;  4DCP B;  2YWK A;  2VH7 A;  4I0W A;  4OIX A;  3RGI A;  1VS3 A;  5HL7 Q;  3VQT A;  2B3T B;  1UCN A;  3UVJ B;  3CC2 S;  5K4P A;  3BSA A;  3CNQ P;  5C2C A;  1TL4 A;  4ZLP A;  3QRQ A;  1M5H A;  1JLQ B;  2JX2 A;  3JQJ A;  4ITS A;  4KRW A;  4NLV A;  4WE1 A;  2CNL B;  4D3G A;  1C4A A;  2KKH A;  4F4A A;  1AT1 B;  1WD6 A;  4KH1 B;  5DG8 A;  3PO5 A;  3M8R A;  4LF7 F;  2WVB A;  1C0T A;  3I82 A;  3MEE B;  4GVB B;  2B0G A;  4DFJ A;  1VBY A;  3DLB A;  4DI6 A;  1G1X A;  3EE3 A;  2RU3 A;  3BR9 A;  3JAM U;  2I1R A;  1NDL A;  3IO1 A;  5G4D A;  3WZ0 A;  2PFF B;  1HWU A;  1Y10 A;  1URN A;  4HH1 A;  2FHJ D;  4ZPC A;  3IBW A;  2ZEJ A;  1EAY C;  1AJD A;  2L3M A;  1RXO B;  3DLL Q;  2VG7 A;  1TK0 A;  2XUL A;  2YQ0 A;  4DQR A;  2CG8 A;  5E3R A;  1O0P A;  2GVD B;  4UPI A;  5DLW A;  5B7W A;  4FN5 A;  1NDC A;  1FXL A;  1REV B;  1WG1 A;  4OX6 A;  5HMX A;  2EPI A;  3W5X A;  3HVA A;  3AB2 B;  3D3B J;  2HRY A;  2RF2 A;  2CQH A;  3CE8 A;  3Q8S B;  3KK3 A;  4DG1 A;  3MAQ A;  4F7V A;  2ZOM A;  4CQ1 A;  4USM A;  3MZI A;  3HHD A;  5HAN A;  3RAQ A;  2QMW A;  5K14 A;  2V50 A;  3DHX A;  4GKJ F;  2AJ2 A;  4LF2 A;  4OYB A;  1NB2 A;  2KHD A;  1HQE A;  2DRD A;  3A3P B;  3K7R A;  1T8E A;  4ILM A;  4X4N A;  2ROP A;  1HFE L;  3OHB A;  2DJW A;  1S6U A;  3R6L B;  4KV8 B;  1R8P A;  3A8K A;  4LSL B;  4CLS A;  2XMK A;  5A8K B;  4IR1 A;  2CYY A;  3F56 A;  1FK9 A;  3JTP A;  2JDJ A;  4NE9 C;  2ZH4 A;  1ZPW X;  4RZR A;  1QUP A;  1RK8 A;  2MYF A;  4HL9 A;  4F3M A;  4LIW A;  4ECU A;  2B5J A;  2I5J B;  3NS5 A;  1SC4 B;  1AA1 B;  4I2P B;  4MKV A;  4I56 A;  1J5O B;  1VLO A;  5IT9 Y;  5ETL A;  3FNN A;  4AL7 A;  1I1G A;  2P2C B;  3OLB A;  4OYI A;  1J5E J;  1TVR A;  4X4R A;  1EZZ B;  1REG X;  3A3N B;  1RAE B;  2RJZ A;  3MAA B;  3MMC A;  1S99 A;  4EYI B;  4J90 A;  2I0X A;  5HVF A;  2ZM6 F;  5LXY A;  1AFI A;  1KS2 A;  5GAD U;  2VC1 A;  4DQQ A;  3CTR A;  4G1Q A;  4KIA A;  3PW5 A;  4PXD A;  2HKE A;  3OPK A;  1FKP B;  2H5E A;  2J8S A;  2H54 B;  2QV6 A;  3IFE A;  3LAK A;  3OR1 A;  1MMN A;  3QT5 A;  2XMM A;  4OZJ A;  2B4V A;  4I6A A;  2HYI B;  2GV1 A;  5GAH I;  1NND A;  2QLW A;  4O3O A;  3HM9 A;  2C22 A;  1SKW A;  2YX7 A;  5HRO A;  1N5V A;  1UPM B;  4F3Q A;  5AXM A;  5IWA F;  1KHK A;  2OPS B;  4F0K A;  2M0G B;  2DY9 A;  3OVA A;  3KK2 B;  4LF6 F;  4P7T A;  2ZZN A;  1U1O A;  1N8R T;  3S8S A;  3R5B A;  1NEE A;  3EM1 A;  2YH1 A;  1T05 A;  1PKU A;  4LIR A;  3MMJ A;  3OR2 B;  4RW8 B;  2BE2 B;  4KY3 A;  4YR3 A;  3PYF A;  3IRX B;  3GV7 B;  2XB2 D;  2VOO A;  2HHS A;  4XIU A;  3QID A;  3AJ1 A;  1F9H A;  4C11 B;  2W4D A;  4E0D A;  3JTO A;  2ADB A;  4N8O A;  4X66 F;  1N48 A;  1H2T Z;  3KG1 A;  1FF2 A;  3M05 A;  3N01 A;  4JI7 F;  2MKJ A;  2ZNZ A;  2AJ4 A;  4DR7 J;  1ZAV A;  2BXJ A;  2ZKT A;  2DK2 A;  3SFU A;  4RNN A;  4KC5 A;  3GSI A;  6FD1 A;  4MFB B;  1O51 A;  4I2Q A;  1S72 S;  2RUS A;  4FYD A;  1RTJ A;  3TAM B;  3EGN A;  3CDA A;  2MKC A;  2FVR A;  2RQK A;  3KLE B;  1NO8 A;  2CJK A;  2ZZM A;  1ED8 A;  2AZ1 A;  3W5Y A;  3KK1 B;  1HWJ A;  3MEG A;  4WKY A;  2QIF A;  1VQ7 S;  3PHE A;  2KG0 A;  4JI2 F;  2WSE C;  3DNC A;  3RAX A;  2UUA J;  1U45 A;  4JV1 A;  1JXV A;  1QTM A;  2CZ9 A;  2UV8 A;  5FDL B;  2XTJ P;  4EK2 A;  4DV4 F;  1IBL F;  1TKX A;  2GNK A;  4Q0B B;  4M5I A;  3C14 A;  3M9M B;  2M70 A;  3ITH A;  4CLF A;  2YPZ A;  3ISZ A;  2BOP A;  2HNZ A;  1VLY A;  2PFD A;  1TUW A;  5KT6 A;  2FZG B;  3TO8 A;  4BHQ A;  4C9D A;  5CYJ A;  3W3S A;  2CRL A;  2O1P A;  5A8W A;  4CCH A;  2AF6 A;  4UOF A;  4PUO B;  4EWT A;  3ISN C;  2UU9 J;  2GLQ A;  2OKQ A;  4CXU A;  3BGF A;  5DQG A;  2UZA A;  3DFE A;  1DBD A;  1HI0 P;  3JQK A;  4WYW A;  1LXN A;  2VA3 A;  3JYT A;  2LQB A;  2CPJ A;  3HFV A;  3QT7 A;  3TVZ A;  2FC8 A;  4RW9 A;  2M7S A;  4B3T F;  2PI5 A;  2D3Z A;  1RHR B;  2V63 A;  2W5T A;  3MFH A;  1RHQ B;  2W7P A;  1HQA A;  3RU0 A;  4WP8 A;  5GVQ A;  1WC3 A;  5J2N B;  2YNF A;  3FDS A;  1Q5Y A;  3DU6 A;  3W61 A;  5A8K A;  5CD4 H;  2A6O A;  2JVR A;  2W8K A;  3PX6 A;  4JI3 J;  5T14 A;  4O0I A;  2RRB A;  3HJF A;  2DGU A;  1XN9 A;  4W4M A;  3US5 A;  2W5W A;  3IM8 A;  1Y7P A;  1UTA A;  5J1E A;  1CJT B;  1E1Z P;  5HVG A;  3HVT B;  1RYR A;  1X7V A;  2FDN A;  4OYM A;  3UD3 P;  2CWX A;  3D6F B;  4PYA A;  1TEL A;  2LA6 A;  2JWN A;  3UDC A;  1CJU B;  2HFV A;  5F8G A;  3H5X A;  3C66 A;  2OHD A;  5K8N A;  3T9Z A;  4WFY A;  4DV6 J;  1JJH A;  1TMJ A;  3ADA C;  4GKJ J;  2VUG A;  1KH7 A;  1KQS R;  1SUQ A;  2WK4 A;  4WU3 A;  3PRV A;  5KG3 A;  1CJU A;  1P9Q C;  2CAD A;  2MQN A;  2VDI A;  3I5A A;  2EVZ A;  4USH A;  1KOH A;  3RZA A;  4J9P A;  1QSY A;  2XRG A;  2C2N A;  3DN9 A;  3NMA A;  3AOC A;  3Q86 A;  2EKY A;  4A48 A;  3OL6 A;  2W2P P;  4N47 A;  4DPX A;  1Q8K A;  1XEZ A;  1CJK A;  3IR6 B;  2KXH A;  1YBU A;  3QQC D;  4AL6 A;  4F2R A;  3TUI C;  4DUY J;  3M7V A;  4NA2 A;  2NLW A;  4U8V A;  2HRT A;  1JNR B;  3NCP A;  1R6Y A;  3E8O A;  5CAB A;  3O8W A;  5ETR A;  1RAF B;  4X4U A;  2IVY A;  5L1I A;  2GO8 A;  2MQ8 A;  4Y6I A;  3TQE A;  1IKX B;  2KRB A;  2ZM6 J;  2XHC A;  1YRT A;  5EN1 A;  1H38 A;  3MR2 A;  3JTN A;  1RJJ A;  2MQL A;  1NPP A;  2PN6 A;  3IGN A;  1R89 A;  2Z30 B;  3MM9 A;  5THW A;  1VOM A;  5IXU A;  1F5A A;  4O44 A;  4FPI A;  3PZP A;  4RW7 A;  1FE4 A;  2B4U A;  3FFI B;  3CCV S;  2F4V J;  3QPI A;  4YDD B;  1SH2 A;  2DKO B;  1TL3 A;  4DX8 H;  5CZX A;  3C6T B;  2IBK A;  4B9N A;  1S59 A;  2C3P A;  1LKZ A;  4ALZ A;  4DR1 F;  2ZWO A;  1VQK S;  1E6V B;  1RWU A;  2BKP A;  3W7B A;  3Q8Y A;  5DET A;  2HHW A;  1M5V C;  5H9F J;  4ANE A;  2J76 E;  3PO4 A;  3D67 A;  2HND A;  1FEE A;  3NP5 A;  4GO7 X;  4DBQ A;  5DZ7 A;  1NK5 A;  1VDH A;  2H48 B;  2JH3 A;  2MZS A;  3C46 A;  3THT A;  2LXF A;  1C0U B;  2N82 B;  9RUB A;  3L9Z A;  4A8S A;  2BE7 D;  4QIF A;  3G8Q A;  4FS2 A;  3DDK A;  4NZ7 A;  4PWD B;  1VQP S;  4WP3 A;  1IKW B;  1B0T A;  2BZ2 A;  5HSP A;  1WC6 A;  3M2R B;  5HQL A;  3SSR A;  3PW4 A;  1URR A;  2V67 A;  4MIA A;  1L3U A;  4FDF A;  4ZG6 A;  2H4Y B;  1X60 A;  1JLG B;  3T19 A;  3BDG B;  3W63 A;  1K0T A;  1OPI A;  3FEZ A;  1KLN A;  1T9X A;  3HHL C;  1WF2 A;  2LMI A;  2QSW A;  3OTC A;  2QFJ A;  4MH8 A;  1F5B A;  1U09 A;  2IJN A;  1RAH B;  1UJ5 A;  4YB7 A;  2W25 A;  1ZM4 A;  2JSX A;  5FLX U;  1S1V A;  5JVG Q;  2UUB F;  4LF7 J;  1QVF R;  2HW3 A;  3DRP B;  4PG4 A;  4ZDN A;  5F8L A;  3M8P A;  2PEH A;  3NWR A;  4PWU A;  3UDE A;  2DXF A;  1HAR A;  4CT8 A;  4X64 J;  4KKO A;  2DHX A;  3HHE A;  2FZC B;  5AE3 A;  4PQU B;  4QYZ K;  2K06 A;  5DG9 A;  4DLE A;  3WQP A;  1Q78 A;  4MKA A;  4LR8 A;  5LRM A;  2IFY A;  1TFY A;  4G3I A;  1TVR B;  2E44 A;  4CNZ A;  2VA2 A;  5KFA A;  2HSE B;  4H4M A;  1V9O A;  1YJR A;  1EI6 A;  1R3N A;  1GEH A;  1TKZ B;  4K5R A;  5IQQ A;  1W2B R;  4DUY F;  1J5O A;  4QU7 A;  4GO5 X;  1KH9 A;  4RW6 B;  4Z7Y A;  3RR7 A;  4DV0 J;  2J9E A;  4F4X A;  4OV6 A;  5ETV A;  3MMC B;  2DGS A;  4FYY B;  2Y1R I;  3HVT A;  5A8R B;  5CCM A;  3HSD A;  4UZC A;  1PBU A;  1QVG R;  1EW9 A;  3H20 A;  2ZOG A;  3PDN A;  1SBR A;  2ZWP A;  1DLO A;  3CCZ A;  3M2V A;  3ZZU A;  4ZIW A;  1P6T A;  1X5S A;  3FKB A;  3DLE A;  1RT4 B;  1HBM A;  4PG7 A;  4AQY F;  3JSM A;  4KKO B;  4X4P A;  1R8H A;  3N9U C;  5D0E A;  2LYV A;  2M9K A;  2W9B B;  3CDB A;  3CD0 A;  1KWM A;  3QGP A;  4DDF A;  4ELV A;  5ETP A;  1X4A A;  4R25 A;  2C2E A;  3K8W A;  4TQR A;  4B3M F;  3VAL A;  3D28 A;  4CO5 A;  4DL2 A;  1VRT A;  3MM5 A;  5D15 A;  3BS9 A;  3EGV A;  2LFV A;  3W62 A;  4NYZ A;  5DM6 Q;  4QWC A;  3I55 S;  1YHQ S;  4RUH A;  2CQ3 A;  1T3N A;  1N56 A;  4NXN F;  4AE5 A;  4NI2 A;  1IQT A;  1IXK A;  4G65 A;  4FF3 A;  1OSD A;  3LGH A;  4CZC A;  2DNL A;  4ED2 A;  3FFI A;  3QIP A;  1YKW A;  4JI8 F;  1U0H B;  3IWL A;  4ID5 B;  1NPK A;  4P74 A;  3FBC A;  3BBC A;  5KFR A;  4OX8 A;  3WBZ A;  5B0B A;  2XYP B;  1NJI T;  4IOC Q;  2XY5 A;  5F3T A;  4ZIT A;  1N6Q A;  2OMO A;  3JS9 A;  4Y0F A;  4ED3 A;  4NCA A;  4WFN Q;  3TAN A;  2RD5 C;  5DO2 A;  4MKB A;  1HNZ F;  2CPE A;  3EVO A;  4JI4 F;  5JUM A;  2B43 A;  3DRX A; 
#chains in the Genus database with same CATH homology
 2GSN A;  3UN3 A;  4LRC A;  5L0B A;  1O98 A;  2G9Y A;  3WAV A;  4UOR A;  4YR1 A;  4CXK A;  4UOP A;  2IUC A;  4CYS A;  3MK0 A;  5GRR A;  1KHL A;  1ZEF A;  4FDJ A;  1KHK A;  1EJJ A;  2GA3 A;  3NKP A;  3T01 A;  5IJS A;  5L0K A;  1AJB A;  3M8Y A;  4ZG7 A;  4CXS A;  3NKN A;  1KH5 A;  4MHX A;  1ALI A;  3B5Q A;  1E2S P;  3BDF A;  1SHQ A;  3KD8 A;  1B8J A;  3BDG A;  5KXA A;  2W5S A;  4QAX A;  3CMR A;  1ANJ A;  4UPL A;  3E2D A;  4KJD A;  4FDI A;  3M8W A;  3WAX A;  3BDH A;  2XR9 A;  1ED9 A;  2IUC B;  4LQY A;  1EW2 A;  2ZKT A;  4ZG9 A;  5HRT A;  3DYC A;  3M8Z A;  2VQR A;  4UPK A;  1EQJ A;  4MIV A;  4NWX A;  5L0E A;  4ZG6 A;  3BDG B;  1AUK A;  1ELZ A;  1HJK A;  3Q3Q A;  3TX0 A;  1ED8 A;  3UO0 A;  3SZZ A;  2ANH A;  4LRE A;  5K4P A;  4UPH A;  1Y7A A;  2W5R A;  3NVL A;  3WBH A;  2W8D A;  1E33 P;  4LRF A;  4LR7 A;  4LRB A;  3NKR A;  3UN2 A;  4LR8 A;  5LRM A;  2IFY A;  4GTZ A;  1P49 A;  3T00 A;  1EI6 A;  3UNY A;  4GTW A;  1K7H A;  2W5Q A;  2GLQ A;  4LR2 A;  1ANI A;  1ALK A;  4CXU A;  1URA A;  3LXQ A;  4KM4 A;  5EGH A;  2W8S A;  5LRN A;  1KH9 A;  1N2K A;  1AJD A;  5DLT A;  5TJ3 A;  4UOO A;  3IGZ B;  2W5T A;  1N2L A;  1EW9 A;  1HQA A;  3IDD A;  2GSU A;  4TN0 A;  4UPI A;  5DLW A;  2W5W A;  4ZGA A;  1URB A;  5LIA A;  4LRD A;  5INH A;  1ALJ A;  1ALH A;  1E1Z P;  4KJG A;  3UN5 A;  2W5V A;  4LRA A;  1ZEB A;  1O99 A;  3MK1 A;  4GTY A;  4N7T A;  1KH4 A;  1KH7 A;  4B56 A;  1SHN A;  2D1G A;  3A52 A;  1Y6V A;  3NKM A;  3ED4 A;  1ZED A;  3NKQ A;  3NKO A;  2XRG A;  4CYR A;  1KHN A;  3SZY A;  1AJC A;  1E3C P;  2GSO A;  1FSU A;  3WAY A;  4NWJ A;  2RH6 A;  2W5X A;  5LQQ A;  4LR9 A;  5IJQ A;  1KHJ A;  3TG0 A;  1ELX A;  4KAV A;  1EW8 A;  3M7V A;  1ELY A;  2QZU A;  3OT9 A;  2X98 A;  3DPC A;  3MK2 A;  1AJA A;  1HDH A;  3TWZ A;  4MY4 A;  3IGY B;  3WAW A;  5AJ9 A;  5GOV A;  3T02 A;  4KAY A;  5DLV A;  5C66 A;  5EGE A;  4GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...