3M8WA

Phosphopentomutase from bacillus cereus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
total genus 140
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8wA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8wA01
3T00A 1B8JA 1E3CP 3WAYA 4LR9A 5LQQA 2W8SA 5DLWA 1KH4A 3ED4A 3M8WA 2RH6A 2W5SA 1EW9A 3M8ZA 4MHXA 2W5RA 1ALIA 1HJKA 5K4PA 4UORA 5INHA 4GTZA 2D1GA 1ANJA 1O99A 2VQRA 5TJ3A 1KHKA 3NKMA 3E2DA 4QAXA 4ZG7A 1HDHA 4KAVA 2GA3A 2GSUA 4LREA 2G9YA 2W5WA 3NKRA 4FDIA 5AJ9A 3IGYB 4CXSA 2IUCA 3UN2A 4UPHA 1ZEDA 3WBHA 2ZKTA 3B5QA 3LXQA 5DLTA 5GRRA 2IFYA 2W5TA 5EGHA 3BDFA 1SHQA 4KAYA 1SHNA 4KJDA 5LIAA 1KHLA 5IJQA 1Y7AA 2X98A 1AJCA 4FDJA 1E1ZP 1HQAA 4LR2A 5GOVA 4LRBA 1E33P 4MY4A 3CMRA 4TN0A 4B56A 4CYSA 4GTYA 1O98A 1N2LA 4KM4A 4MIVA 3SZZA 4UOOA 3M7VA 5EGEA 4UPIA 3NVLA 3MK1A 5IJSA 2XR9A 1Y6VA 4KJGA 2GSOA 1P49A 2IUCB 5KXAA 3M8YA 1ED9A 4ZG6A 4N7TA 5LRMA 4CYRA 5L0BA 1EQJA 3UNYA 1EW8A 4CXKA 1ALHA 3NKQA 3BDHA 3TX0A 1ELZA 1KHJA 1EW2A 1N2KA 3NKNA 5L0KA 5L0EA 1K7HA 4LRFA 3T01A 3UO0A 4GTWA 4UPLA 3SZYA 3TWZA 3WAXA 2XRGA 3OT9A 4LRCA 3IDDA 1ZEBA 3A52A 3KD8A 1ZEFA 3MK0A 4ZGAA 4GTXA 3UN5A 3Q3QA 3UN3A 2W8DA 3IGZB 3MK2A 4UOPA 5LRNA 2W5VA 4LRAA 3NKPA 4LRDA 1AJDA 3DPCA 3BDGA 3BDGB 1KHNA 2GSNA 3T02A 3WAWA 5HRTA 2W5QA 4CXUA 5DLVA 5C66A 1EJJA 1ELXA 4LQYA 1KH7A 2GLQA 3NKOA 4NWJA 1KH9A 2QZUA 1AJBA 1AUKA 1E2SP 1FSUA 1URAA 1KH5A 4NWXA 4UPKA 4ZG9A 3TG0A 1ANIA 2W5XA 2ANHA 3WAVA 4LR7A 1ALJA 3DYCA 4YR1A 1ALKA 1EI6A 1ELYA 1URBA 1ED8A 1AJAA 4LR8A
chains in the Genus database with same CATH superfamily
2AJFE 1J5EJ 1R3NA 1SJQA 2YNIA 1WF2A 4LF7F 5FJ4A 3SCJE 3S7RA 3IRXA 3R5JB 1D9DA 2LECA 4X4NA 2RQKA 3NKMA 1XNQF 3OXLA 4L3NA 4JI4J 3PRBA 2HQGA 2RUGA 2YX1A 3FBCA 3I9ZA 3BO3A 1KVKA 3TEGA 2G0IA 4YN3B 1VC5A 3OL9A 3FUYA 1BC6A 4B3TJ 3QGHA 1GH8A 2MKKA 3CCQS 2ZH5A 4X62J 3T1YJ 3BH7B 2HFSA 3OXFA 3V6HA 5DJBA 1MN9A 3P5BP 3TJ9A 4QWBA 2VG7B 3UCGA 1YJNS 4LFCJ 4IRDA 3UVJA 2QGFB 3DOMA 2W24A 3MM9A 2X1FA 4OZ0A 3T5KA 2VA3A 2BMBA 3OD2A 4UT4A 3H20A 3SV4A 1RT1B 2W2OP 4WZQA 2HS3A 3N9UC 3I31A 1IKWB 1IUJA 2GHWA 1SKUB 2QZUA 2AU0A 5LXRA 2Q66A 4ZJLA 2P6SA 1UMJA 3DYCA 2RHSB 5CYQA 2RDDA 4KC5A 4XIUA 4L75A 5RUBA 3TUIC 4P2XA 2RH6A 4LMZA 4OX6A 1HQUB 3N79A 4GO5X 4ZVGA 2QMUB 4S0MA 2HFZA 2M8DB 3GU0A 2ZITA 3IGYB 2UUBJ 4UPHA 5DLTA 2OSQA 4NLYA 1AFIA 5HMZA 1XTZA 4O3QA 4OI0A 4GMKA 2QLFB 2WW8A 1YKWA 2K1RB 1Y7PA 3TARA 2QV6A 3RRGA 3DGVA 3OW2R 1AT1B 1CC7A 3US5A 2QC3A 4YR0A 3D4JA 5HK4A 3G2XA 3ZFVA 1D9FA 2VBYA 1ZTTA 3IMQJ 2GIQA 4LQ9A 2BRKA 2R4FA 3KJVB 3CDEA 2ASYA 1D0EA 4B17A 1FXLA 3ETOA 3W63A 4OIXA 2ZOFA 3ZTQA 4DQRA 1YWXA 1IBKF 1R89A 2LXIA 4HTIA 3S01A 3M8ZA 3IR6B 1WF1A 1RWXB 2L08A 2BEFA 4AE5A 3J80U 3MUVP 1GK8A 2VF3A 5D0HA 3UDVA 4B9NA 2NXNA 4KAYA 1R8PA 3HJFA 5LSOA 1RWMB 1RHKB 2D3UA 5IQ6A 4Q44A 4XDCA 3VAMA 2OP5A 2FUG9 4ANEA 1XMOF 4ZVSB 1VLOA 1TL7A 4DEZA 1VBYA 2EPIA 3H2VE 3HSZA 1FKPA 4C3KA 4WTOB 1VIXA 2YNFB 1UTAA 3W60A 2MDAA 5B0FA 4USUA 4Y2MA 3E51A 3T01A 3IDDA 3VQTA 3E01B 2JEGA 5EWEA 2LA6A 1VYAA 1RAHB 4ILRA 2VJVA 2V2KA 4JV5F 4DV1F 1RTDA 4RWXA 4LFAF 4CLKA 3BGFA 3Q2SC 4EMDA 4L3KA 4CZCA 3MEDB 1ZOTA 2NQPA 1X5OA 5IT4A 1YJVA 4J5OA 2DO0A 3N6NA 1BWVA 1HMVA 1NJZA 1JKHB 4B3OB 1TELA 3DMJB 2E9ZA 2HK3A 4Y2KA 4YOEA 2WVDA 1YDLA 1OPZA 2F9JA 5DG9A 4OZ3A 3A3PB 4FDJA 5KG6A 2W4PA 1L3UA 2DR6A 1FT8A 1IKVA 2CQ0A 2R7SA 3PFOA 4DV3J 2FZCB 1KHJA 5GADU 3KHGA 4IO9Q 2V4JB 1JJ2R 2HBZB 2EK6A 1AW0A 1ZM4A 2ASDA 4NEZA 3UQSA 3A13A 2J0XA 4NCAA 4KRWA 4JI6J 4B3SF 4MFBB 3ITHA 1DFDA 1JWWA 2QRRA 1IVZA 2RB7A 1ED8A 4N47A 2MYFA 1DQ9A 1JLQB 1WEXA 4XPCA 4M5GA 5KFLA 1RT5B 4C8MA 1KH4A 2RH3A 5DLWA 3MM6A 4ZP7A 4B9LA 2BW7A 1EKRA 5K14A 4DSEA 3IBCB 3P3DA 5K4PA 3VGTA 1PO6A 2W9AA 2AX0A 4LREA 2WVEA 1HBMA 2BJEA 4X66J 3QGPA 3HHEA 2CPZA 1E1ZP 2NYIA 3HF5A 1M1KT 3FQLA 2C3PA 1KFSA 2KFYA 2BRLA 3FFIA 4M1KA 5KFRA 2YWHA 5IXUA 4H4OA 4WXWA 4W90B 1SL0A 3FDSA 4C4WA 1IQTA 4QR2A 1K1SA 3JAMY 1ZEBA 2NPFA 3THVA 4U7UK 2G4BA 3DRPA 4AL7A 1RLCL 3DOKA 4LF6J 3QAUA 1DLOB 1RCOB 2LYVA 2Y1RI 2QJ3A 4USJC 1S59A 3C3LA 1HWJA 2MQNA 3N4WA 4YR1A 3LOUA 3C66A 5HATA 4A8SA 2XMVA 1XMQF 1MMNA 2OGUA 1B99A 1N6QA 2J9DA 3D1HA 4ZDNA 5AJ9A 4NZ7A 1VC6A 1SJ3P 3H5UA 4K0KF 4PXDA 4RL1A 4EFAC 3LWLA 1X4GA 5L1KA 2FVSA 3DLBA 2DHGA 4ZKAA 4C48A 3HFZB 2G2OA 3OV7A 1KKHA 2XB2D 1B0PA 1HBOB 4OI6A 4YEAA 5EUHA 3GIJA 2CVIA 1TKDA 1UWBB 3R97A 1WSRA 4Q5VA 4ZVRB 4OX8A 1WHWA 2B6AB 5L0KA 2E44A 4Q8FA 1XQIA 3C6UB 3DU6A 1TUVA 4OJ3A 3MM7A 2DNGA 1S12A 3N6MA 1MMLA 3NNCA 2DITA 5T14A 2CWXA 3EZUA 3KK2A 2FIUA 2WVCA 3UWTA 3MM6B 4GVBB 2UXCJ 2RKIB 5D78A 2L9WA 1HWKA 2EVZA 4JV1A 4RW8A 4KAIA 2OPSB 1LKZA 1OJ4A 4BC9A 1YLXA 1FFSB 1X31C 3MMCA 1JQGA 2XBPA 4ATNA 2FD2A 3TYTA 3D6MB 4X4UA 3D3CJ 3PW0A 2RU9A 2B4UA 3M7VA 4NOHA 3C14B 4TLQA 2A18A 4NLDA 4J9UE 2V9KA 3NBPA 2IRUA 2YY3A 4JI8F 5L0BA 2F65A 1NH8A 2YKQA 4Y28C 2DGVA 3JTOA 1RDRA 2B56A 4JI1F 3KD8A 1SVDA 1S1TB 1CQNA 2OTJS 5H9FK 1CVJA 3KMQA 4ECZA 3JYTA 2QSWA 1ELXA 3BJYA 4DV5J 1Q95G 1NSQA 1UA1A 1AYEA 4KGMA 4ZPVR 5DS7A 5A8WA 2OEKA 3I5AA 5J2NB 4NI2B 2VH7A 4P73A 2X3DA 1IXKA 4NL5A 1CC8A 4FYYB 3CC2S 3M6WA 2Z8QA 5DQGA 3EE3A 1RISA 4DJBA 2NPIA 3GCWP 4DR3F 1SBRA 4WFZA 3EM1A 1A6LA 4QWCA 1UL3A 3OFEA 1TU0B 4USKA 2YTCA 5FIIA 2DGQA 3QGGA 4DDFA 2GIRA 1E6VA 3K89A 4ZLNA 3QIPB 3T1HF 3TAMB 1KLMB 4EK2A 1V6HA 4P7TA 3FSXA 5IT0A 3ENWA 1Y10A 1NSAA 2QMXA 3W7BA 3MECB 3BDHA 4J7CA 4RNNA 2R9LA 4FDFA 3A3NB 1T05B 4X4TA 5BXIA 3SQGB 2MXYA 4HT7A 3UN3A 4CCHA 2VC0A 1U1QA 3BBCA 2VASA 1VQOS 3J7YI 4B3RF 1VRUB 3M2VA 3I5BA 1ACMB 1UFKA 3AY0A 5KFNA 2FVQA 3F56A 1HHTP 3JXOA 3NS7B 4UOHA 3M2UA 2ROEA 4XO0A 3MMCB 4ES3A 4F4ZA 1RBLA 2A2CA 4F4YA 1NDKA 1F0XA 1QM9A 4OL8A 2NLWA 1O98A 2YQ0A 1RWWB 1S9EA 3M6UA 2EI5A 3EZOA 4IQXA 1FCAA 1BE4A 4YB1P 3I55S 1A7GE 3D0GE 3GSDA 3TRGA 3GIIA 5GAEI 5L1JA 2BJ1A 4RBTA 3NAIA 5KOXA 3LP1A 4C9DA 1LWXA 3RBXA 1NB7A 4C8NA 1F5AA 3CCES 2BABA 3G96A 3UW1A 2KXNB 3R5BA 1D3WA 1NO8A 2IJNA 2XWXA 4L6V3 2AWZA 2UUWA 2QA1A 1U1OA 2R8JA 1KTVA 1Q8KA 1U02A 4P2SA 1T02A 6FDRA 1S9GA 2IRXA 2F63A 3W64A 2AJ0A 1Q78A 3HFVA 1MN7A 4OQJA 4I2QA 4OX7A 2XO7A 2ZC4A 1AFJA 5KG0A 1FDNA 4O0IA 2XULA 2V2VA 1H73A 4JI5J 2J5AA 2VHGA 1RLDA 4NMXA 2JLGA 1YTYA 1NJXA 3CJKB 4DR6J 1HD0A 4DUYF 2XZTB 5DDPC 2YXLA 4AXIA 2IUCA 2C3OA 4NLSA 4LVOP 1HW9A 3G86A 3OVBA 1R8HA 5A6WA 4OI1A 4TY8B 3PV8A 4F25A 1B70B 2WSFC 2HK2A 4X2BA 1P1LA 2Z57B 3SBMA 4QWDA 4A8MP 1X9SA 1D1UA 5ETVA 2MPUA 1FDDA 2AYMA 2PN6A 2AJ2A 3K2YA 3F0NA 4I56A 3Q23A 1SI9A 4WCEQ 4C11A 1UWAA 1P6TA 5KFKA 2PA8D 1LFWA 2XGPA 3A3OB 4M95A 4CXUA 2OPPB 1R0AA 3NS6A 1FX2A 5J1EB 5KT7A 2FGCA 3DYAA 1M5OC 3CCWA 2DGXA 1QSLA 1RJJA 4ICLB 3RG6A 1PJ6A 3P96A 3OFFA 2WB4A 1RCXB 1HBUA 1WOPA 4B08A 1QE1A 2KHCA 2FPHX 3J81j 1U8SA 2E5LJ 1NUEA 4QJVA 1KHKA 4Y0FA 1M1GA 2W9BB 3G6VA 2YKPA 3UPFA 1RTHA 2PMZD 1IR2A 4A48A 2CYYA 3QLHA 5KT2A 4PKDB 4I7FB 2CJYB 2KFZA 2GMHA 3MEGA 2CZVC 1VS3A 1LNQA 2Z2YB 1OIAA 3TUPA 2HGNA 4OYOA 3CTRA 5HANA 3CB4A 4DCJB 4Z2XA 2VG5A 3MMBB 1HBNA 4FYWB 3LP1B 2HRYA 3KNAA 4B3MF 3TANA 3WX8A 2Y3YA 2W2QP 1FKOB 3AD7C 3BYRA 4QWAA 1JK9B 2OELA 3U1MA 1HNIA 1HR0J 3O5TB 2HHXA 2B5JA 3A8KA 4PG4A 5E5NA 3H59A 4O3PA 1SJFA 6AT1B 3SMZA 2EC2A 1KVIA 3AD8C 4QZVB 2FJAB 1W26A 5M2PA 2VL1A 3KLFA 1LOUA 3RB6A 2GHVC 4F3MA 4KT0C 2ZFHA 2DVIA 4RW9B 2GSUA 1EB0A 2DEIA 3VHQA 2MQMA 4OJGA 3Q24A 1RBAA 4QWEA 2DR8A 1MNEA 4LUBA 2VPZB 2F4VF 1SKRA 5KFJA 1T9YA 1XR6A 5KFHA 4KSEB 1ELOA 4ECQA 4DV2J 3H4DA 3DLKA 2RE1A 3O1LA 1PYOB 2YQ1A 2WZ1A 1HFEL 2DNLA 3T41A 3BSAA 2V5HG 3K59A 1N32F 3WIUA 3AFGA 1U45A 4PG7A 4ANCA 2BJ8A 4DV4F 2Q6BA 3MOZA 4JI0F 2K3KA 3WC2A 3PHEA 1X4HA 2O66A 2ZDPA 1ANIA 4J9OA 3R1LA 3T5JA 1U1NA 3P5TL 4DOZA 4WK3A 1M1HA 3FSIA 1JIHA 1CJVA 2ZM6J 4DR4J 4TN2A 2B9WA 5TJ3A 4LF8J 2XI2A 5A8RB 3NKRA 2FVPA 4KQZA 4AFFA 1LFPA 2B7BB 5C2CA 3EPGA 3C15A 5DZ7A 3JS9A 3ZXWA 1TVRB 2G13A 3MEGB 1IJFB 3C19A 5HVFA 2MKHA 4CO4A 4DS5A 4I4BA 4UOGA 4R5PA 2QX0A 2HGMA 1DZ5A 5CYJA 5K8MA 1MU2A 3JAMU 2R7QA 2HHPA 1V9OA 5K8PA 4UPLA 2AV5A 3OFHA 2RRBA 4IO1A 4GTXA 2B5JB 4WFYA 4NPOA 3D6FB 1D9AA 1XEZA 4ZCKA 3VAKA 2OLWA 4UPKA 4CLWA 4ZCMA 2D74B 1TQLA 1TL4A 4FXVA 4I1TA 4DN9A 3ILIA 3WBZA 4ED2A 2W8SA 2E5IA 1F2HA 1SUQA 2IYGA 1JMTA 2VPWB 4ECUA 1T11A 2XYGB 4NLVA 4ZG7A 2DNNA 3FZBA 1QTMA 3DC2A 3HHLB 1KWMA 2ZOMA 3ZO7A 2BVZA 4DSKA 1U1RA 4IFVB 3SZZA 1CJUB 2K8GA 3GYXB 3NVLA 2FTRA 4EYIB 4FNHA 4DN0A 1FJGJ 1ED9A 2CNNB 4DG1A 1VBXA 5A0YB 1TKXA 4ILMA 4RUBA 2VONA 2MY7A 3OBIA 3OSNA 5HMWA 1C4CA 1LW2B 1F1BB 4DV7F 2YX7A 1A9NB 4A8OA 4E2FB 4JBCA 5IT9Y 3CCTA 1ZBTA 3HP6A 1WUUA 1EIYB 1S72S 4LF2A 3J81Y 2J9EA 3I82A 4QIWD 1S76D 3HHNB 4WJBA 2HNYB 2W1BA 1KTQA 1WG4A 4NWBA 1UFLA 2FJEB 1NNDA 3H2LA 3G8QA 4HVZA 3RR8A 2MB0B 4K4WA 4M5NA 4A47A 2BQ3A 2PI4A 3MM5A 2Q6CA 3D0HE 3HD1A 2HWHA 5HLFB 4D3GA 4KE5A 1VHIA 1RBOB 3TZYA 3CEDA 2RAQA 1B64A 4LBHA 3D68A 1RQ0A 1RWPB 2UUAF 4CI0B 4P2FA 3BGUA 4KM4A 4AD6A 2CQIA 5ETKA 2FJVA 3FNNA 3QGIA 4J91A 3RBDA 1FJCA 1HD1A 3NLCA 3J7Z5 2HWTA 2XHWA 4PWDB 4XDDA 1LK7A 4BWMA 1T94A 5DLGA 1F2GA 5HROB 3FBBA 1ELZA 1N0VC 3S1TA 1J5EF 3OUYA 2QFIA 3CCJS 2P8IA 4KO0B 3MPWA 2N3OA 2HVDA 2KZZA 2Z30B 4F04B 1HWIA 4MKYA 1HNVB 2RILA 2UV8G 3JTPA 3A8IA 2EKNA 4JI4F 3BREA 4ZITA 2BE2B 2F8HA 3HSGA 1EI6A 1M5VC 2VFUA 3WAYA 3BKTA 4ZJOA 4OZ2A 1ZAXA 5B0AA 2YVSA 5CAAA 5C2GA 2PMWA 4B3TF 5JJBA 3T1AA 3PIPQ 2ATLA 2VIHA 4X62F 3I5CA 3T1YF 1TV6A 4OZLA 3E2DA 4ANDA 3DM2B 2PDAA 4IKAA 2ZJRQ 1UJ4A 2K06A 4MKVA 1YJ7A 3E8OA 2W9CA 4LFCF 1UPPA 4WU2A 4BHQA 2E7XA 3PJXA 3WIVA 2ZHAA 2CPDA 2V2ZA 4PYAA 2HFOA 2RMLA 4ED4A 4DUZJ 5B08A 4DG1B 3HVTA 4WIIA 3M32A 2DGWA 1RT6A 4CIOA 1VQNS 4RR5A 4DCOB 3EGNA 1H98A 2ZZMA 1H6KX 1UVKA 3M9MB 5HBMA 3TA2A 5DM6Q 3OJUA 4WE1B 3PXGa 4PXBA 4UOPA 1S6OA 1NZAA 4NLRA 2Q43A 2DNRA 3DGPA 1IWGA 2C2DA 2GW8A 4F0MA 3DLJA 1JXLA 1S1XA 3MMAA 2G2YA 2BR0A 2UUBF 4CQ1A 2BJ7A 2RUSA 2NREA 2KVQE 2RU3A 3HPOA 5T41A 5HSPA 2DNOA 4W4MA 3N01A 4IDKA 1HJKA 1SKSA 2QE5A 1Q16B 1TKTA 5IFMA 1TKZB 4B9MA 3TZXA 1BY9A 3G82B 3ZZ0A 3GPAA 1VQSA 1ZAWA 1QUVA 5HL7Q 1JLCB 2CVEA 4QR1A 4HACB 1FRXA 2K7JA 1R43A 4ES2A 3OFGA 3Q83A 5KG1A 1T9UA 4CLFA 2B9XA 2DCLA 1S97A 2MZQA 4F0KA 3V4MA 1X4EA 3RB4A 1RT2A 4JV0A 1URRA 1ZM9A 3FCWA 1R6VA 2Y0SD 4PPZA 4B9VA 2BJ3A 3GWCA 3PYEA 3OR2B 1VGYA 4LSNB 2DNZA 2D9OA 1U2RA 3TAPA 4KJIA 1HWLA 1VBZA 4L73A 3QJLA 4OHXA 4N56A 3VV2B 2G2ZA 1CJTB 3HO1A 3TA0A 3NGKA 3KHRA 1TL3A 1TAQA 4W98A 4CRJA 2QLJB 4M5KA 3OR1B 1G2EA 3H7HB 1N36J 2W8LA 4Y3CA 2VQRA 5F8GA 3DLGB 2VDIA 2XM3A 5HN0A 2JX2A 1CPZA 2CQHA 3LUYA 3LXQA 5FLXY 1CG2A 4A8KA 4DSFA 1R6YA 1UA0A 4QU6A 5KFOA 2P9GA 4DBQA 1K44A 1TL1B 1C1BA 3MTKA 2BKPA 1QAXA 4PG5A 2GSOA 3F73A 3QBCA 2MQLA 2W7OA 3RYLA 3MR3A 1YRXA 4K4UA 3GE9A 3Q8YA 3D2WA 1J5OB 3NKNA 1NXIA 3HM9A 2OAUA 2FLOA 5L1LA 2XRGA 3OT9A 1WF0A 3ZTOA 2MLXA 4R0EA 4LBPA 5CHCB 4A8YA 3LALA 1N5VA 1WNEA 2HHUA 3MCSA 2R7UA 3QZ7A 2LKZA 4C3MA 2C1EB 4NLPA 4RNHA 3HSDA 5J2PA 3NWGA 2CRLA 4KYZA 3VAIA 2XY5A 2QYGA 5LQQA 1M5HA 2YX4A 1IKYB 3R2CJ 4ID5B 4IDKB 2FJBB 2Y1LB 5SZTA 1L3VA 4RO0A 4EYHB 4DV3F 1KS2A 1F3VA 2HQFA 5C25A 3Q8QB 2RQCA 3OTDA 4ES1A 3OL6A 1B0VA 2HLUA 4ELVA 4KH0B 1F5CA 1NPPA 4RU2A 5BR8J 5D3GB 4M5MA 2DPIA 2WVBA 4DX5A 2MGZB 3FRZA 3MK1A 5IJSA 4O44A 2XR9A 5KXAA 3PX4A 4JI6F 3PNIA 4G1PA 2C2EA 4HDHA 2NXJA 4RW6A 3KHHA 1GTHA 2EW9A 3VAJA 1KN6A 1RXOB 3KG1A 1WTBA 1EETA 2JLEA 2C2KB 2OFGX 4PEOA 1WOOA 1AJDA 4OI4A 1FNMA 2ZVIA 1E6YB 4YY3J 1VQLS 2XTJP 5FDLB 4ELTA 2FLLA 4YDDB 4X66F 3AJ2A 5C7PA 1GNKA 5IV3A 2XHCA 3HZEA 3GQCA 1RHQB 1EARA 4ZHRA 3VF0B 2V94A 3GR1A 2EFPA 1PG5B 5ETRA 3GV5B 2ZWOA 1GMVA 1QVFR 1YHQS 5EWGA 1FERA 2IVFB 2YPZA 1UEKA 1T9TA 1MLAA 1FTCA 4PUOA 2GQ2A 4F4AA 1MSWD 4B56A 4O23A 4O3RA 2DT9A 4R8UA 4K4TA 4DF4A 4LF6F 2FJDB 1Y6VA 2KT2A 1JXVA 1JLAA 3KLGA 1UZDA 3KLEB 5I3QA 1XNRJ 3CJ2A 5AXKA 2O1PA 4FS2A 2YKAA 1X9WA 4Y2CA 4LF9F 2YKMB 3R3TA 2J6SA 4DSIA 1XK8A 3R6GB 4ZPAA 3MM8B 1HARA 4I2PA 2Y1IA 3W9IA 1I94J 2IC3B 2MZ1A 1UPMB 3N0VA 4RW7B 1ALKA 4KV8B 2YWKA 2ZH7A 3JSBA 1JJ4A 1TP7A 3BQ0A 5J2QB 3WX4A 4CTAA 4P9SA 4Q45A 2LU2A 2DXEA 2G9YA 1RSCA 3W1YC 4FF2A 2D69A 2GVZA 4HLBA 4PZVA 1N5YA 1JLGB 3HCXA 5A6PA 1Y00A 1AUDA 3I87A 3AQOA 5HP1B 4V1Ak 2RT3A 2RRAA 3LH2S 4UPIA 2ZD1B 3P8BB 1PBUA 4EUVA 1SIZA 3V81B 5F0WA 3SSRA 3U1LA 2LQ5A 2DXFA 4V19J 5MAOA 1EETB 3H5SA 3LAKA 3GIRA 3MK0A 2UXCF 2CQPA 5DG8A 1L3KA 2W5VA 1U25A 3R7NB 1KHNA 2ZEJA 2W7AA 3Q8VA 2FJXA 5B0DA 3JQKA 4DQSA 1O51A 2VD3A 3IGVA 3M1VA 2EFQA 1NEEA 2C3UA 4ZOSA 3J80Y 3F41A 2F8EX 5BYSA 1REVB 2V69A 4MIAA 1CULB 5KT5A 3K58A 1OPIA 1G3OA 3JSMA 2MJNA 2G9OA 4Y6IA 5HMXA 1S7IA 5B0GA 4TNOA 1MROA 5G0RA 2AJ1A 5IV4A 1M0SA 1AJCA 2F3JA 1RAJA 4OMFG 2YWGA 3ZZZA 2M9KA 1U0HA 2KDOA 1RWNB 1ZM3A 5CZXA 4UUWA 3QFHA 1IKXA 1HPZA 4G65A 5E3RA 1V3RA 1Y3KA 4DV5F 2ZHBA 2DR5A 1FDAA 2XYPB 3HMJG 2GA7A 2M70A 3AXMA 4WP9A 4YMEA 5IT9U 5L8RC 1EW2A 2M2BA 3THTA 3J81U 2BXJA 1U47A 3CJ3A 2VJUA 2MKYA 3T3FA 3E2EA 4UQTA 4I2PB 2PIIA 1P27B 3CUNA 3H8YA 4CNZA 3MURP 2POKA 4LSLB 5IQQA 4ZP9A 5JUMA 2RF2A 4CLLA 5L46A 3IA0A 4MT1A 1YVFA 2YH1A 3BF4A 2ROPA 4CTAB 4NLTA 2HBYB 3DRRA 3BV8A 2IDEA 3O6QA 1WKJA 2CA9A 3K8VA 3QMQA 2XLJA 2COLA 2OPQB 5E7OB 4ITSA 3UR3C 4I6WA 1FJEB 1OO0B 4ZCLA 4KR0B 4IRCA 3BGLA 3IS9B 2IPOB 1WHYA 1WACA 3KUEA 1S6PA 3AJDA 4USWA 3CSKA 2XSJB 1DQAA 4ZLJA 4TKTA 4ETXA 2NSCA 1U8WA 2WTFA 3W5ZA 3QO9A 2DHAA 4Q8EA 3NKQA 3BGRA 3RB0A 3C6TB 1WEYA 1ZS6A 2D41A 1TFWA 4LRCA 5THWA 3V2UC 1HYSA 5HRTA 2KFNA 1AUSL 3ZNJ1 1AZSA 1M5PC 2KHDA 2IM3A 1XERA 3MUTP 2CPIA 1RTIA 2ZBQA 1S1UA 1RT4B 3W2WB 2C3YA 3GLJA 3G9CA 2CADA 1EP4A 2PI5A 3L7OA 3CMAS 2HZVA 3MEEA 4F67A 5HAOA 2HNDA 4RNOA 4KAVA 3RW6A 3HD2A 2HVZA 4JI7J 4QYZK 1SV5B 5EGHA 1CBKA 3M8QB 2L9DA 3MPUB 1Q4RA 1S6QA 4UQGA 2DIVA 1T03A 2CNOB 1S57A 3VAFA 2HHQA 3CCUS 3R2DJ 2R7VA 1HLWA 4Q2MA 3PX6A 2ZKUA 1TR0A 3M8YA 4WIQA 3KG4A 2KTQA 1IQZA 2MHNA 2Q3PA 2BKOA 1XC9A 3ISND 4N77A 1LWCA 4KB7A 1XMBA 3NGTA 4FNIA 2JL9A 2KZMA 4JI5F 2E9RX 4DU8A 3G8TA 1N56A 4DR6F 2HBRB 2HQDA 5DLVA 5KG3A 2GGPB 2KVIA 3SDEA 1UVNA 4PG8A 2DIUA 5D0GA 5ETMA 3M8PA 1ALJA 4LSZB 1G7CB 3EICA 3UD5A 1VQMS 2FHJA 2LXFA 3L7UA 2VQFJ 2DPJA 4X4RA 3FBFA 3MTJA 4WYWA 3RBZA 2KN4A 3FGVA 3QT7A 1R8BA 2P9CA 2F40A 3KG0A 1CS4B 1IWAA 4OZ5A 1WJ9A 3QT6A 4DZ6A 1SHQA 2H5EA 4I68A 1SL1A 1S48A 1VQ8S 3CPWR 3B6BA 2ZBRA 4A8XA 2XY7A 2CIMA 2WOMB 3C2PA 3W2VB 2UZAA 5D77A 2YNGA 3CJTA 3I96A 3JTNA 4Q43A 2CZ9A 1WKKA 2OFHX 1YG0A 2XQCA 2LQ8A 4ALZA 4FF1A 1BQMB 4M5DB 5LXYA 1URNA 5CYMB 4GTWA 1WORA 3M05A 1APSA 1Q7LB 3DDNA 3QAEA 1DTQB 3AA9A 2E5LF 3NNHA 1HYSB 4PAAA 2CNKB 1CEZA 1WC6A 2CPFA 4ED0A 2GQQA 1I3OB 1OYDA 3TG0A 2UUCJ 1OQ3A 3SCKE 3B4MA 4K5SA 1S1UB 4B9SA 3AODA 2EG2A 5HQLA 4NCBA 3CCLS 1PC4A 1V3SA 2DYAA 3MEEB 2C3MA 1KOHA 4OZ1A 4FDIA 4OHZA 1RHMB 2B4VA 3EDQB 4ZVOB 3BQ1A 1U2CA 3GJSB 2VG7A 1KOOA 1HQAA 4RNMA 1KEKA 2E5GA 2HFVA 1HR0F 1RTJB 2DNYA 3R8YA 2VZ9A 3CJ4A 2VBXA 5F3ZA 2ZE2B 3POTB 1RT1A 3AT1B 4QQBA 1GX5A 5K20B 1IKWA 2OEMA 5L0EA 2WW4A 2WBRA 2I1RA 4DV7J 4ZGAA 2MTLA 5LRNA 3CD5A 1GT8A 1FF2A 3MEKA 4DSLA 2QL7B 2AT1B 5I3PA 1AJBA 4YDXA 2B9YA 2LLZA 2BANA 3CE8A 4RKUC 1NK5A 3CULA 4K59A 4DR2J 1FFWB 1PCAA 5D0EA 2GAGC 4ECYA 4MK8A 4JYAJ 3FKBA 3CC7S 3FCVA 1NRKA 3BR8A 2K1RA 3PX0A 4ZP6A 2M7SA 3RUBL 4DQQA 5E3PA 3LAMA 4DV2F 5GAHU 1GX6A 3AOCA 3MUMP 3FCHA 4WBFA 2HHWA 1HQEB 3QT8A 3VCDA 2AJ4A 1H3DA 4N8OA 1U4BA 4ZJQA 3GYNA 3NP5A 1OSDA 3EGVA 3CJSA 2BM1A 3CT9A 3I0RB 1BD6A 2V9WA 1EQJA 1KVJA 2D3ZA 2HHHJ 2P5VA 1FE0A 2OSRA 1M5SA 2V0NA 1FNOA 4F36A 5H1SV 3IAS9 3LW5C 2ZM6F 4DR4F 4DQPA 1B3TA 1MW7A 4FYDA 1UAWA 4LF8F 4O3OA 2CJ9A 2HS4A 4DF8A 3LP2B 2KKHA 2QL9B 2ANHA 1PIEA 4O4GB 5J2MA 4ED8A 2M0GB 4NA3A 2M8HA 3KNGA 5KG5A 3LPYA 3X1LB 2H9ZA 1ALIA 1S77D 3LANA 4OX9J 1FVQA 2D1GA 3HHLD 4UY8T 1ITPA 3U1NA 1FWKA 4IG0A 5HJXA 2LVWA 2W8KA 2IHR1 2GNKA 3V6JA 3MD3A 2YNFA 5KFAA 3GFHA 2XGQA 3K8WA 2WONB 5LIAA 4GRSA 5IJQA 3CCZA 2XLIA 1P8GA 4ZVTB 1JLBB 3AB2B 3M9OB 3E01A 2JC0A 5DDOC 3NGDA 2ACYA 1OQ6A 2Z56B 1N48A 2HQCA 2HAFA 4F3QA 3EWGA 1TL5A 3H98A 4ETZA 5AJ3J 2J0QD 1SC3B 2CQ4A 4NYOA 7FD1A 3MEDA 4ZK7M 4BBYA 4LF4J 3LO3A 2MZRA 3W62A 2FGOA 1JKHA 4Q0BB 4B3OA 4FKYA 3KWMA 3DMJA 1NH7A 2DY9A 2BANB 4QR0A 3QIDA 3LA0A 3T6BA 2XSFA 2OO4A 2RJZA 5LJ5Y 1O5JA 2XZDB 4F3OA 2PMHA 4WP8A 2GAHC 2EFNA 1FKAF 2HZCA 2A6MA 2VA2A 1FJGF 1R0BG 1EQ0A 4JI2F 2HQ3A 3QRQA 5GMEA 2GMJA 1X7VA 1RZMA 2JSXA 1RAGB 3L7PA 2AYGA 4YQWA 2OTLS 1VBKA 1NLKL 5KT3A 4LR2A 1P1TA 4QCLA 5DQHA 2V4JA 4KY3A 2IM0A 5F8MA 3LF0A 2NUHA 2Z2LA 5KFEA 1N54B 2NZ4A 4M5LA 4KPYA 4Q2LA 3FSYA 1YRUA 3CF5Q 4MFBA 3I0SB 3AB4B 4TYAA 4DL0C 1S9FA 3RW7A 4CH1A 4ZVPB 2JEFA 2PEHA 1JLQA 3PO5A 3D7SB 1RT5A 3EGZA 3BR9A 3MXHP 4L76A 4ZPDA 1KH7A 3EXYA 4MAKA 4I69A 3R9LA 1NK4A 3WC0A 3HKZD 3Q8UA 4KTQA 2ZUGA 3IWXA 1RU2A 4G6VB 5J2MB 3ILJA 3VR1A 4C97A 4ZN1A 2XYHB 4J90A 4FZVA 2Z0GA 1FXRA 2R7WA 1UW4A 4TLRA 3GV8B 3FMBA 2HMIA 3S6EA 4IG0B 3AQPA 1T9WA 3IM9A 1ZEDA 2HS0A 1S0MA 3QJPA 2N7YA 5K5MA 2VG6B 2NZCA 3GG0A 3HZGA 2AYEA 3F44A 3K5NA 3DLHA 1YJUA 5DDQC 1O6XA 1YBAA 2HURA 9RUBA 1Q82T 1S1VB 2HIYA 1BUXA 5M2RA 3DFEA 2J0WA 1DLOA 3EDRB 4XPEA 4K7QA 2DRDA 1RAFB 1WWHA 2CG4A 4QW8A 4RW4B 4C0OC 4ZVFA 2Q1LA 1NM2A 1Q5VA 1JB0C 2H5JB 1H2TZ 4ID8A 1LWEB 1RT7B 3BPDA 1F60B 2GSNA 3MR2A 3I4HX 3FEZA 3I32A 4LQYA 4URSA 4H4KA 2JJ4D 1TZ0A 5L39A 2EXUA 3M30B 1PC5A 3Q8SB 2ZJQQ 2E1PA 3B8HA 3CO9A 4CO1A 1J27A 3NXZA 2AW0A 1O99A 4DUZF 4J9MA 1HBOA 2WHOA 3PR5B 2B4OA 2JEIA 4TU7A 1UWBA 2B6AA 2QLWA 3IXQA 5EWFA 3C6UA 4H4MA 4IFYB 4DUTA 1FK9B 4FP9A 4ECSA 2PD1A 2ATCB 3CJQA 4O0NA 2O3DA 5D6GA 1WDDA 2AX1A 3OHBA 1C1CB 2B4PA 3T5LA 3BO4A 3OLBA 4Q7AA 2W8DA 3BKUA 5HO4A 3A4TA 4PXEA 1M5KC 4GVBA 2RKIA 3PRVA 1WHVA 2FZGB 5KFSA 3G6YA 1FD2A 4UOCA 2OPSA 4HHHA 2XMWA 2XMKA 3PJ9A 3IBFB 6FD1A 4N41A 3PW2A 1VK3A 2DGUA 5B0CA 3HDSA 2DGOA 2HQIA 4DPUA 1RYSA 4WTYA 2HMIB 3C14A 4KKOB 4AYBD 5F8IA 4LJMA 3D6TB 1REGX 3GB0A 2EFVA 1V3ZA 2J7WA 1S1TA 3L4BC 4OV6A 2L48A 5DDRC 2XMMA 3TR5A 2YH0A 1I1GA 3NY0A 4C8LA 1SB6A 5J2NA 2OUGA 3PG9A 4NI2A 1RKJA 4LF9J 2MY8A 1N36F 1TMJA 4FYVB 3GJRB 1TMMA 4ILLA 4ZPWR 3DLLQ 1J2VA 1U6BA 3VAHA 4LIRA 1JLEB 1VIOA 4P75A 2DD8S 2PGCA 1NKEA 1E3CP 3FMWA 2KO1A 5A8KB 3OLAA 2PEBA 4TQSA 2IJFA 4BWJA 1IM6A 4OI3A 2NXCA 3QIPA 2FVCA 5INHA 3TAMA 1KLMA 3OQ2A 3IR5B 3SI8A 1TTHB 5C42B 2JNJA 1B0TA 4FN5A 5IS2A 3MPDA 3CDWA 4USIA 4HYKA 2IVYA 4LVNP 2HHTA 5T7LB 3MECA 3VTIA 1T05A 2IM2A 4M63A 2MEWA 3SQGA 2CAJA 4H4MB 3G4SS 1Q8LA 4Y34A 5JMNA 4G3IA 1GXLA 1IBCB 3TX0A 1VRUA 3MPYA 3W65A 3UCZP 4CO5A 1HNWJ 2DGSA 1Z4UA 4K4ZA 3SZ2A 2XY6A 2E7VA 1V5VA 4WKRA 2GVDB 2CJBA 4U7CA 1NK6A 4HKQA 1X60A 4JB8B 2AD9A 5BR8F 4ZLPA 4AL5A 2U1AA 4PYDA 2IMWP 2E5JA 1SKWA 4QIVA 2UXBJ 4I0WA 1Y0HA 5CZVA 3W5XA 4QAXA 3NMAA 2R7TA 4NLWA 4B02A 1P9QC 3K7RA 4DFPA 4DR7J 4UZCA 5LMUF 2AEJA 2DRBA 4K50A 3GMGA 4YHHJ 2BOPA 3DRSB 4RLEA 4HH0A 4YY3F 2HHSA 1Q8BA 2W01A 2KXHA 2ZZNA 3N5FA 1Q81T 2R8IA 2CZ4A 3MF5A 4ZIWA 4ZVHA 4ZIVA 2HLTA 3BQ2A 2VODA 3A52A 1I5OB 1HNZJ 5KFXA 3QSYB 3CJKA 1Y9OA 4X4OA 1KC8T 1ZM2A 5E41A 1KH9A 4DL6A 4FXWA 1X8DA 2GS8A 1WG5A 5C24B 4J9RA 5SUHA 3PIOQ 1OSCA 1ZA1B 4LR8A 1KP6A 3DLEB 4RUCA 2FJWA 1C2PA 1D8YA 4TY8A 2PFFB 2ZUAA 1UEUA 2W4CA 3H42A 1NBEB 1U49A 4N8NA 5HVHA 3D1OA 1FI4A 4URGA 1XNRF 3CCMS 4OV1A 8ATCB 1U24A 2FLNA 1JLFA 4MK7A 1GXTA 4CM2A 1G6BA 4DHVA 1WD6A 1LXNA 2O01C 1HNXJ 4MYTA 1YJ9S 2JLFA 5H9EK 1I94F 2OPPA 4CYRA 4I64A 1XBWA 4IH7A 2LEBA 4XTTA 5J1EA 1GAOA 3CIZA 3RB3A 2I0XA 3DI6A 2IJRA 4NLUA 1BXNA 1KQKA 4ICLA 3VGSA 4NA2A 2MQPA 1UETA 2W9BA 2V50A 4ENOA 4GC7A 4ED6A 1XR7A 1UCNA 3AA8A 5GMKa 1Y5NB 4GC6A 2B7CB 2BM0A 1RAEB 4I7FA 2HW3A 3T5HA 1VQ4S 5DQIA 3RAXA 4HL9A 2G0CA 2DB1A 3T19A 2C22A 4NA1A 1YZ6A 4RJVA 2I5JB 1FWLA 1WC1A 4K2XA 3VGVA 1BLUA 2BA9A 2J6TA 1SHNA 3V6DA 3MMBA 5CABA 2M52A 3OTBA 5AE2A 1FKOA 1ZETA 2VU5A 2YNHA 4KJGA 2JH3A 3ETMA 2B8PA 3NGRA 2B51A 4USHA 4JI3J 5K9FA 3W9JA 2DH7A 3KLIB 4LFBJ 1IM4A 1C0TB 4X4QA 2W25A 3ZTRA 1DBDA 1HI1A 3TWZA 4FF4A 5KFGA 3ZZRA 1FFGB 1YBTA 2XWYA 3P45B 5F3TA 1FRIA 4C8YA 5GAGU 3PZPA 2F5GA 1KH5A 4K4VA 3PJWA 5JVHQ 2UP1A 1PYTA 4RW9A 1W25A 2XMJA 1QAYA 2HBQB 2AJQA 3G71S 4I6YA 5FD1A 2AGOA 3M8WA 2LA4A 2Y8WA 3W9HA 2E66A 1MMDA 3FBEA 5HMYA 3TQEA 5DRKA 2HRUA 1JLFB 3OPKA 3RAMA 5B0EA 4USTA 3IG1B 5EHHA 1PAUB 3CNQP 3CMRA 3OTOF 4KBIA 4UOOA 2UVUA 4PXCA 2DRAA 2V8DA 5J1PA 2B9EA 1U1MA 2Z2MA 1LWFB 4FF3A 3N28A 5I3UB 2J7UA 4WPAA 5IM0B 2NYHA 4EZ6A 2I9SA 1H74A 3TNVA 3DI6B 5LSRA 2QL5B 4LRDA 4CH0S 2MMYA 3WAWA 1GTEA 3W3SA 4DQIA 5AE1A 2J8AA 5L9XA 4K8RA 2QO3A 2GLQA 1IR1A 3MAHA 5A8RA 1C0UB 4IG3B 4ZPBA 3TUZC 5HJYA 2CPEA 4NLXA 3H40A 2J76E 1N34J 3KLHB 2VDHA 1TVRA 1KDNA 3M8RA 1RU1A 4X4SA 1BHNA 2OMLA 3RAQA 2YWEA 2OPRA 2XI3A 5D4LA 2ZKTA 2H3EB 3V6DB 1FA0A 3ISZA 4HDGA 3P4UB 4F4KA 2CDRB 3TVZA 2FC9A 2C28A 5AXLA 3NCPA 2YNHB 4WKYA 1KR4A 1VCTA 2DGTA 2O67A 2HNZB 5GAEU 3HULA 3TW0A 2X1AA 2WSCC 2IFXA 3PDNA 1OWXA 2VPXB 1NK9A 3RJMB 4FYXB 2DHSA 2QSFA 1FD8A 3ILLA 4DV0J 2D7SA 4DV6J 1W7WA 1WTFA 2HFNA 4DS4A 2F8MA 1SPBP 2QA4G 4JI7F 1FRHA 2CQCA 4PQUB 1URAA 4NCGB 4MMOA 3CCSS 3GONA 3HHLA 2ZBIA 4FPIA 4Y2AA 4DX7A 5B0BA 1OS5A 1R27B 4IFVA 4HH1A 2LQBA 2MSSA 4A46A 1CJUA 2YBVA 3CO0P 1V5IB 5KT4A 2W5WA 1ZZNA 1QAIA 1S0VA 3W5YA 1K0TA 2HAIA 4J37A 1SH0A 5A0YA 4NZ0A 3CMES 1X5PA 3MFIA 2VQEJ 1KD1T 4P74A 4CO0A 1LW2A 2ILZA 3KUHA 2V67A 2A1BA 3BGOP 4X64J 4YR3A 3KK3B 1U1PA 4OLPA 4WP3A 3RRKA 4ELUA 2IBKA 5GADI 3PYGA 5KFFA 2M88A 2HNYA 1DTTB 2VQFF 3SZYA 1YX2A 4L74A 1WSVA 5JXSA 3IGZB 2W2PP 4WF9Q 5HVGA 1WELA 5ETNA 1NAQA 4C8KA 5HLFA 3J7A1 4LF5J 1TK5A 1OY6A 1X4FA 5D4PA 2NR0A 2DK2A 2C2MB 3UDLA 3GCXP 3T00A 4F8RA 3ELHA 5AT1B 4MHXA 3IWLA 1QVGR 2X51A 3KK1B 3C46A 2MLZA 1X9MA 3NMRA 1S99A 2OPRB 3LP0B 1GMWD 3RGIA 4K5RA 3B5QA 4PWDA 2RS2A 3PW7A 1WC5A 3PEHA 4F7VA 5CXTA 2ZZTA 2YNIB 2J8SA 5HROA 5D8HB 5IWAJ 1RAIB 4M5IA 3IRXB 4DL4A 4J9VA 1NJWA 3BSOA 4KO0A 2PE8A 4DLGA 1U0SA 3QNWB 3SFUA 2U2FA 1HNVA 3AHPA 2JEJA 2UUCF 4X4VA 4M5JA 2BE2A 5KFQA 3JSYA 3CD6S 2V68A 2P9EA 4YP3A 4ZCIA 4DL7A 2NCKL 1DHMA 4DXLA 3GFXA 2FHJD 3D66A 4C7QA 3UVJB 3DOMB 1Y4ZB 3DM2A 3MM9B 1WC4A 2A2DA 5ETLA 5CD4A 4OZNA 3RRHA 3NKYA 3QATA 4NRTA 1SIWB 3BBFA 3ED4A 2W5SA 2FQQB 1MWQA 5GMDA 3H2UB 4NEYA 4NX9A 4UORA 3FEXB 1EX8A 3SIPB 4DZDA 5D0RA 3IBWA 2DNPA 4JI2J 2GC8A 5GRRA 5CYQB 1S0NA 2ZOGA 1VQ9S 2C2OB 2P6TA 1WC0A 3R5AA 3ZNUA 2QMWA 4WE1A 3PTWA 5MLCV 2E5HA 2KM8C 1L5UA 1X0PA 4M5HA 4DFKA 2H4YB 5B7WA 3MR6A 1FXDA 5DETA 5KFYA 4A8WA 4DR2F 4ZA1A 1X4BA 1Q1KA 1YQHA 3E3XA 4JYAF 2DKOB 2GHPA 1QDUB 3QJJA 3NGSA 2YWFA 1F3FA 3KJQB 4MKBA 2YKNA 2CFXA 1GMUA 5I4MA 1TKZA 4GVLA 4DPWA 3OJSA 3G82A 2V8VA 4EEYA 4NXMJ 4K2JA 4DU7A 1JLCA 1WDTA 3EYZA 3G6XA 4HACA 2W5RA 1NDPA 3IC1A 2UV8A 2WAQD 2ZC3A 2JRSA 3EVWA 3IAM9 2XNQA 2OH2A 4IYQA 3SSQA 2R2UA 2HHHF 4PWWA 3B54A 4D3HA 3VALA 1F9EB 4AL6A 2G0JA 2OI2A 2UU9F 4K4XA 1T9XA 2FHKA 5G4DA 2APOA 3OR2A 3LPEA 3W8GA 4LSNA 4KHPJ 2BUNA 1LV5A 2ERRA 2EK1A 1EQMA 5EDWA 3NGUA 4UF4A 1QJHA 1DURA 3GG1A 2IIHA 4RBVA 2DHHA 1CJTA 1TL7B 4F0HA 2ZVSA 3LQVA 4NLOA 1FKPB 5GVQA 4OX9F 3OR1A 3PRDA 1TUGB 3SFGA 3UI3A 2JDJA 4QOTA 1I51B 2ZH8A 2EFOA 4IOAQ 5D15A 3SXLA 3DLGA 1GEHA 3VZHA 1W2IA 3MCOA 1HA1A 3VWSA 2R8GA 4CH7A 3HLUA 1IJEB 1Z2ZA 4QPTA 3WDOA 1TL1A 3WZ0A 2IMOA 1LW0A 1KQFB 2FHMA 5KFMA 1RTDB 5F9NA 1K8AT 2NXUA 4CO3A 3UN2A 4F2SA 2W5TA 1SQFA 2LCWA 4KJDA 1S49A 1DJ0A 3R1HA 1J5OA 1UVIA 5AJ3F 1HMVB 1JJHA 4LF4F 2A10A 2QA4S 3JB9k 3CWJA 1FE4A 4U96A 2KB2A 2KU7A 4IR1A 1UW9A 1Z2LA 4FKXA 2VKZG 2J7KA 2DY1A 2KYZA 1KBRA 3KFWX 4AQYJ 1IKVB 3TZWA 1DAXA 4YB7A 2CQBA 1UVMA 9ATCB 3D5MA 5ETQA 1TK0A 1WHXA 3MDFA 1IKYA 2JVOA 2BZ2A 1FWPA 2R2SA 1MWZA 2LDYA 1NSKL 1EJJA 4ID5A 4EBEA 2CJKA 2A3JA 2C42A 2YKNB 1AUKA 3L3CA 4ZG9A 2FY8A 1UP1A 1Q5YA 4QIFA 1K73T 3RTVA 5KFPA 5D3GA 4OHYA 4PPDA 2MLYA 1FRLA 3R6LB 3ITHB 2MGZA 4AT1B 4QPXA 3ZZPA 3RBEA 4DPXA 4CT8A 4ED1A 5KT6A 4KPCA 2B43A 5DZ6A 2OEJA 3CJ8A 2DR9A 5HI7A 2JFDA 3SCLE 5K14B 2ZH9A 3PKMA 1Q0NA 4NASA 3QFWA 2XO6A 3HHDA 2YWWA 3CIMA 2EKYA 1IBLJ 1HBMB 1E6YA 2LEPA 5FDLA 2ILYA 1TUWA 1K7HA 2R8KA 4B9TA 3FFIB 2UVRA 4U9RA 1FTRA 2CQ1A 1C4AA 2KJWA 4YR2A 2PFDA 2FZKB 2IM1A 4H4OB 2VBWA 2JFKA 2VOPA 4YS2A 2FY1A 2BJ9A 2KG0A 1CQMA 3EUNA 4DL5A 3OSPA 1LEOA 3BPSP 3DDKA 4CLZA 2VFVA 3DRPB 3FRYA 3DOKB 2X1BA 1KQSR 3D3BJ 1H2VZ 5GAGI 2HHVA 1QD1A 3K5MA 2DR7A 1LW0B 3SSSA 3A8JA 5E3CA 1TAUA 2MQOA 4YUDA 3TVKA 2BW2A 4YB5A 3MZIA 3KLEA 4A8FA 5DLFA 1FEHA 3UD4P 3ICLA 1KHLA 2HZAA 1N6QB 4CP5A 4DCPB 2YKMA 3N5BA 3BEGB 5EGEA 4X65J 2FDNA 2M3DA 1F5BA 2ZH3A 4ZG6A 3FVYA 3MM8A 1HHSA 2DEJA 3AOBA 4CXKA 1Q7YT 1N2KA 2KG1A 2IC3A 4G1QA 3Q8PB 1PAEX 4RW7A 4KV8A 2YQ3A 2DHXA 3U7JA 2HPUA 3QWUA 3OTEA 3T02A 2L9NA 4ZPTR 1VQYA 4GKKJ 3BDPA 5HQ8A 3UD3P 2C2RA 1ZPWX 1HQ2A 5J2QA 3LGMA 1WEZA 3CGIA 2RRNA 3WAVA 1AROP 2XCPA 1KNZA 3D9BA 3VVUA 1JX4A 4NYZA 4LR9A 4R25A 1JLGA 1RAOA 3MM7B 2LMIA 2NS1B 4HR2A 3MCMA 1RA7A 2NSBA 3QPIA 2GMLA 5HP1A 1K0VA 2ZD1A 2ZH1A 3KK2B 1KFDA 3BN4A 4NRUA 3FJ2A 1RB0A 3V81A 1VOMA 5GOVA 4LIWA 5LMUJ 4RW8B 1Y3JA 2V63A 1G1XA 2O5DA 3IR7B 3AXKA 3TI0A 3A8EA 1RWKB 2QA2A 3BH6B 4P10A 3HX9A 2RQ4A 1NHVA 2QEXS 1PJ5A 2L41A 3ADAC 5HQMA 4DLEA 1H0HB 5M2UA 3KDNA 3V4IA 2XS7A 5LMNJ 4Y2IA 2MKJA 4QIGA 1REVA 2VFSA 2D3OR 2VICA 3NBPB 1RGVA 3Q22A 1UFWA 4DL3A 3ZZYA 4AUKA 1IBMJ 2W2MP 3KMSA 2J6UA 1CULA 2VC1A 4RUHA 1U1KA 1F9FA 2DNMA 1B7FA 3BSNA 4CNYA 2K7KA 5F8LA 3Q2TC 4LR7A 2AQ4A 1NDLA 3D0IE 5E0OA 2AEMA 1U48A 4PG6A 1H7WA 4GKJJ 2DNHA 2CXEA 2XNRA 3JYTB 1QSYA 1U7LA 2DTJA 4OZJA 2IY5B 2H51B 5K8NA 5A8WB 4WYLA 3BZQA 4BS2A 5AE3A 4J9NA 4CM0A 4DR5J 2AZ1A 3PO4A 4W92B 4PRFA 1EZZB 3EPIA 2OD6A 3VAGA 3QT5A 3QWPA 2BE7D 4GTYA 1RADB 2AF6A 3ZC4A 4F02A 2CQDA 1N8RT 3O3LA 3PEJA 5KFCA 3TQ1A 5EGYA 2J0SD 3CJ5A 3MR7A 3KTQA 1E6VB 2VB6A 1S1WA 4G1QB 2W4DA 2XS5A 4Z7CA 4LSLA 1VFJA 3X3UA 1N33J 2VV5A 1YSJA 3ULHA 4WFNQ 4RZRA 2W7PA 3R5DA 3HFKA 1NCLA 4U7UD 4NWJA 2UVWA 4C98A 4NWXA 3RU0A 2GO9A 1PKUA 1SJ1A 3K5LA 3EZ5A 2OPQA 3OVSA 2GJ2A 4MK9A 3M6VA 2H1YA 1N88A 1Q79A 2W2NP 4DX6A 3IS9A 3D6HB 3LTOA 1ZPVA 1EAYC 1RP5A 3CVKA 1RUSA 1FNXH 2XSJA 4PWUA 1EHWA 2UXDJ 2V8PA 3M2VB 3LWMA 1R8CA 3TP2A 5EN1A 5BYRA 4EI2A 3SQOP 3KDOA 4C2MA 2N7CA 4WK1A 1HNWF 1EJ7L 3C6TA 2DXDA 1ZA2B 4DR1J 1HI0P 3MWBA 3HHKA 2I38A 3SEOA 3M2UB 1L3TA 1U09A 4FVMA 4U95A 5CH7B 4NXNJ 3HT3A 3R7SB 3I4PA 1QLNA 1VK8A 4KHMA 4ZLLA 1ULRA 3V4IB 1S9EB 5K8OA 2R2RA 2ZBPA 1RT4A 5KG2A 2UXBF 2PA3A 3W2WA 2H54B 2A0FB 1BQNA 4OJHA 4OYMA 3DXBA 2YKOA 4J9LA 4TVAB 5F8NA 1OY8A 3NKOA 3MAAA 1T3OA 1SXLA 4DR7F 3FK4A 1YK9A 4QYZJ 2OMOA 1NDCA 2CWKA 5ETOA 1SV5A 2AKWB 4YHHF 3M8QA 1D8ZA 1JNRB 2M5YA 4FBTA 1S9GB 2HRTA 4A4JA 1HKAA 1ROFA 1N4LA 1FEEA 4F50A 4I2QB 2CQ3A 4HEA9 4OLOA 2MQQA 4X84A 3MCNA 2GJFA 2IFYA 3BBBA 4O4RA 5AXNA 1VHFA 2X98A 1MWYA 4WFXA 4LRBA 5DO2A 3EVMA 1LXJA 2BOAA 5BJRA 1HNZF 3OTOJ 4O3SA 2IUCB 1SQEA 4E8UA 4TY9A 4KH1B 1UEVA 2GGPA 2RDJA 3UNYA 1FESA 1S1WB 4RX6A 1Q86T 3PM9A 2ZJPQ 1I6JA 2QG9B 4WXOA 4Y65A 2RHQB 3Q86A 4KFBA 2R8HA 3TOQA 2K3IA 5C66A 4BLGA 3GIMA 4C11B 1VI7A 1CLFA 4LF1A 1CS4A 3HK2A 3GR0A 3R5GA 3W8PA 2ADCA 4EBDA 2WSEC 1R0AB 4I6AA 2IVMA 2R7OA 2WOMA 1HNXF 3W2VA 1RK8A 2VFRA 1RWVB 5DGAA 2QLXA 1HL6A 5C5JA 1WKLA 3DYAB 1YIJS 4ER8A 2GIFA 2XS2A 1N5QA 1NZ8A 4UTGA 3GZ7A 2CKWA 5CQGA 1BQMA 3OXGA 1RACB 1HBUB 1QE1B 3UDEA 4M5DA 2AIRB 2ASJA 5CYMA 5LM7E 4LF7J 2ZH6A 4IOBA 1DTQA 1RTHB 2KL8A 1M90T 3QLHB 1XNQJ 2E1RA 4C6AA 1PGZA 5A2QY 1XIQA 3HJVA 4CT9A 3CD7A 3UNGC 1F6TA 3O8WA 4ZVEA 3PKYA 1FDBA 3WHIA 2MZJA 3DOLA 2B3TB 2R42A 1BQNB 3TJAA 3BDGA 2VG5B 1HBNB 4MH8A 4IRKA 3MAAB 1Q8IA 2OD4A 2BE9B 1E2SP 2ZNZA 2WB1D 4J9SA 1VDHA 1AJAA 1HNIB 2LP4A 3QZ8A 2QFJA 1GMWA 3ZZUA 4OHWA 3C8YA 2R7XA 5KFZA 3Q89A 2CNLB 4DSJA 4DPOA 4ZVUB 2BYCA 2E29A 1RTJA 4JI3F 3R27A 2ZBCA 2DJWA 2ZE2A 3POTA 4LFBF 3BDFA 2H5IB 3KLFB 1RWUA 4F4WA 2WK4A 2MHEA 2RDIA 2CPYA 3BB5A 2OHDA 2QLBB 2N4DA 3BN7A 3UDCA 3U27A 4DX8H 2QYCA 2ABYA 1OMSA 2VOOA 1NK7A 4AXJA 4TXSA 3P49B 3GTYX 3VVTA 4LQ3A 3DXSX 2DO4A 1UJ6A 1HIYA 2ZWPA 2WRMA 2BX6A 1TFYA 2OKQA 1ZEFA 3UFCX 3MK2A 1FVSA 3EX7B 4KFBB 3DLKB 4ED5A 3GIKA 3BSCA 1YITS 4WFBQ 3HVAA 1PYSB 5L38A 2R2TA 1SC6A 4U8VA 1ICEB 2CJQA 5EX0A 4F2RA 2EBEA 2RNEA 1HQEA 4UY85 1L3SA 3FQKA 1W2BR 2EC0A 1S4EA 2LFVA 5KFIA 4P2MA 3PVXA 4EO6A 3WBHA 3IP0A 3PHTA 3TUJC 3I0RA 4DFMA 2JVRA 3M9NB 1KRPA 3NAHA 2CQGA 1KLNA 4TN0A 4CLUA 1IBKJ 1CJVB 4P72A 4NMLA 2KT5A 1HW8A 3NWRA 4J9PA 1XR5A 4MKAA 2VUGA 4N7TA 1N52B 3C15B 1SJ4P 3UCUP 2WCXA 2E7WA 3LP2A 4KGZB 1BWEA 4GO7X 3NL0A 2E1CA 4H4KC 2V8HA 2KI2A 1T7PA 1N34F 5E3QA 4IH6A 3H5XA 4K4YA 4O4GA 4KGKA 1XMOJ 4NYPA 1IR0A 3DOLB 3GV7B 2X7IA 2Z58B 3BDGB 4R5PB 3W61A 2F7VA 3FC9A 3BYPA 2BDPA 1MU2B 1Y5LB 1VLYA 2IAJA 5KFUA 2J9CA 2D3O1 3D28A 3HVRA 2GCFA 2WONA 2EG1A 3L09A 3K5OA 5F8HA 3UR0A 3SYZA 1JLBA 2Z2ZA 4MYUA 3ENAA 1N5SA 1ANJA 1X5SA 2VPYB 1VQKS 2ZH2A 3T9NA 2YPYA 4OJ1A 3IN5A 3CXCR 3U02A 4JV5J 4USVA 4DV1J 5CCMA 4HT5A 4LFAJ 2QIFA 2N82B 1SUQB 2XLKA 2OJ3A 3AD9C 4MY4A 3TJ8A 4ED7A 4DV0F 4DWIA 1BGXT 4MIVA 2FB0A 4DV6F 3S8SA 1WOSA 2AEFA 5E33A 5KFWA 5F9LA 4HI2A 1RHUB 2XCAA 4CLPA 4E0DA 4Q0BA 2P2CB 3GJTB 2H65B 3THPA 1RABB 2G1DA 5KTQA 5I42A 3NKPA 4OYPA 3TA1A 2B0GA 2HG4A 5DGBA 2HWIA 1TKXB 1JNZB 3M2RA 1KHVA 4PQAA 3TX8A 2JZ5A 2IRYA 4MTPA 1S4FA 1S79A 3TAQA 4IR9A 1ELYA 4DPTA 1T3NA 2VQEF 1VQ6S 1B8JA 4UW2A 4WFAQ 4X64F 5F41A 5E3AA 1K1QA 4B3SJ 1BQXA 2XEXA 2LXUA 1RHJB 5F8JA 5KFDA 3NG8A 2RD5C 4TYBA 2GX8A 3I0SA 3T6JA 1YGYA 4CYSA 3MM5B 1H38A 2UU9J 2G1HA 1XWLA 3O2IA 2HVIA 3OL8A 4ZS6A 4ECXA 4C8ZA 2UUTA 1T8EA 2RVJA 2MJUA 4N76A 3KJFB 4DL2A 2XC9A 4LF5F 1NSPA 4FPRA 4MIBA 4LRFA 2H48B 4J9KA 2PT0A 2XMTA 2EWHA 1RT3A 3DPCA 1FRMA 2R7RA 2W5QA 3BM7A 3HSJA 4JUZA 1AXQA 4NE9C 2BKNA 4ERDA 1U6ZA 1T0TV 1Q53A 2IAJB 2CPJA 4KIAA 3OUYB 5KFVA 2QT7A 3I56S 5IWAF 2UVVA 2ROGA 2VG6A 2AZ3A 3L9ZA 2DH8A 4M94A 5ITHA 2KJVA 3G8SA 4K4SA 1HDHA 2KXFA 4CWBA 3M6XA 1S1VA 4OYAA 3V5RA 3H90A 1OYEA 2KH9A 1NKCA 1XMQJ 4PR6A 4RW4A 1F9HA 1FJ7A 5KG7A 4Z37A 2WBMA 3NS5A 1TV6B 2IA6A 3N6LA 1LWEA 2MQ8A 1RT7A 3ONQA 4MIWA 2B8QA 3J7ZT 1PJ7A 4NLQA 2HEKA 2W9CB 3EJMA 5LSLA 3TO8A 4K0KJ 2LQJA 3Q8RB 2MSTA 2QTWA 3M30A 3UO0A 3KKFA 3OHAA 2I8EA 2GJIA 5I42B 4FBUA 1RE1B 3M4XA 3VGUA 3DHWC 3HVTB 3M32B 2V2QA 1RT6B 3KYLA 3M2RB 1VJQA 1FHTA 1NMEB 4C3LA 5HBMB 1GXUA 4DPYA 3Q0AA 3WAXA 1X4DA 2MKSA 3DGPB 1O0PA 1S1XB 3A1YG 3MMAB 3B78A 1NHUA 1S0OA 4J9QA 4IFYA 1KSPA 1FK9A 2V8GA 1SJRA 1T9VA 4YB6A 3IFEA 1C1CA 4ZVQB 3H4BA 2CJXB 2MZSA 5D4NA 1TKTB 4Z7YA 3NCQA 2AGPA 3HKWA 2MZTA 3H5YA 3I6PA 1NHKL 3CD0A 2SXLA 2Y0BB 3K17A 1QUPA 3GJQB 3ZTPA 3EVOA 4TU8A 5DG7A 3MHYA 4OI2A 3NOGA 3B4DA 4NXMF 1K9MT 1S10A 3ET6A 1RT3B 1RT2B 1XN9A 3RZAA 2KYXA 3PYFA 2AYBA 2IDLA 2VFTA 4WU3A 4JI8J 3KOAA 2XZWA 4KKOA 3HI9A 1P9YA 2CPXA 2D9PA 1ZYQA 1X5TA 3KJNB 1X4AA 4JI1J 2AMCB 4QU7A 1NKBA 5B09A 1ZH5A 3JSRA 4QYRA 1X0FA 4KHPF 3L95X 3NEKA 3ISNC 2HGLA 4TU9A 1FO1A 2LEAA 4G1IA 1TL3B 1D09B 3SCIE 3OTCA 3PACA 1NPRA 4EO8A 1NU4A 1E33P 2RQMA 3DKDA 4ECTA 2DNQA 2HVHA 4RUAA 1QY7A 1CSJA 2JOQA 4DR3J 3DNCA 1P49A 2ADBA 3ILOA 4PCQA 2FLPA 3IRWP 2GO8A 2X1GA 3MPVA 4QIEA 1NK0A 1JLEA 1SC1B 3CJRA 1C1BB 2R3VA 5LJ3Y 3CCRS 4IOCQ 2E1MC 1YJTA 1ZZFA 2F1FA 3VZIA 3T1HJ 5A8KA 1SCJB 5ADZA 3BS9A 3KUGA 4HHJA 4OYZA 3HT0A 4C8OA 3MAQA 2IYIA 2XMAA 4LBIA 5C42A 8AT1B 3AAWB 5AXMA 1URBA 3GILA 1K47A 4NZ6A 7AT1B 4QBUA 3QRPA 5IC4B 5CD4H 2VBZA 5T7LA 4KGXB 4BC7A 1PSDA 2FHOB 3MMJA 1VMBA 1QSSA 1SQGA 3C16A 5J2PB 1RHRB 4B3RJ 4AQYF 3GSIA 3J7AN 4EGLA 4UZBA 1DRZA 2VKRA 3V6KA 3MD1A 4RU9A 2K2PA 2CDQA 2FYXA 4P52A 2I6WA 1WI6A 5C25B 5A2QU 4ZMMA 1A0OB 2ALYB 7FDRA 2JWNA 3AH6A 3QYYA 1EW8A 1R31A 2GVDA 3D1QA 5LL6d 1UVJA 1VQPS 4O44B 2GZOA 1AA1B 4P6QA 1Y11A 2HIQA 3ET6B 3NOCA 1NJYA 4EZ9A 3NRBA 2V34A 4ZN3A 4RW6B 3JQMA 1KONA 3IM8A 4URQU 3EMTA 3M8SA 2KM8B 3GFYA 1SH3A 3PR4A 1S5ZA 3EGWB 2Q79A 3FEYB 1UKUA 4MJKA 1B7YB 3KHLA 2RS8A 3DRSA 2DISA 1IBLF 5ETPA 5KOWA 3RR7A 1VRQC 2F9DA 4OYBA 5H9FJ 1Z1ZA 1Y7AA 4F26A 1WG1A 2DH9A 1YBUA 4ZHRB 1NJIT 2GQCA 1N2LA 3QQCD 3K5PA 4IH5A 1S6UA 2GV1A 5KFTA 4DUYJ 2PC6A 5LRMA 1VISA 4PUOB 1KQGB 3QRRA 5C24A 4R8UB 2X3GA 3UN5A 2A6OA 1JLAB 3DLEA 3KLGB 2EBGA 2E1AA 2CUYA 1B4SA 3CCVS 3FZ2A 2BBEA 3MI7X 3ENVA 4C0HA 2AGQA 1UZHA 1JJCB 4EU0A 4FVCA 4KHRA 4U67Q 4XK8C 1EW9A 1Y5IB 5ETTA 1VQ7S 1HWUA 1RTZA 4X65F 1DARA 3D54A 4EWTA 1PILA 1VRTA 4ZPCA 3C16B 5H9EJ 2F4FA 1XJWB 3IGNA 3LGNA 4USMA 1DQ8A 2ACMA 3NCRA 2BQUA 1X4CA 2V6AA 3DU5A 5U47A 4GKKF 3TEHB 2HVEA 2KRBA 2GVZB 2LDIA 1N5YB 4OFZA 4CYUA 2DCUB 3VQSA 1FX4A 5BYQA 1EKSA 1PBAA 2IA0A 3BKFA 1NPKA 4FXDA 1UVLA 3Q3QA 4CLYA 5J1NA 5DM7Q 3HHLC 3K0JA 4WWSA 3CDAA 3TVYA 5CA5A 1NB2A 1BMQB 1R8AA 2I5JA 2BJDA 4WZMA 3CDUA 4B3MJ 2Y9HA 1U1LA 1UJ5A 5CCLA 1LK5A 2HFUA 3DHXA 1H2UX 1ZAVA 3CDBA 4EBCA 5A76A 5ETSA 2RSQA 2CG8A 4HTJA 3M1VB 2ZNYA 3H0PA 2HYIB 2CPHA 3R5CA 3KLIA 2BQRA 1C0TA 3DCAA 3SV3A 4A8QA 1SC4B 5LMNF 3O44A 2BV3A 4JOUA 1YJWS 3JSMB 4BDPA 2MKCA 2C2ZB 4UUXA 1VC0A 4I67A 4IQMA 2EEYA 4B9UA 1IBMF 2LQ9A 2Z4PA 1AB8A 2KT3A 2M4MA 1MROB 5G0RB 1YI2S 5EX3A 3ZZOA 3UE2A 3T9ZA 4OYIA 1LQ9A 1RI7A 2OIHA 1U0HB 4U6PA 4GKJF 2F4VJ 1IKXB 3B82A 4X4PA 4LRAA 1HPZB 1QAJA 1CJKA 4P7VA 3I9V9 5E2QA 3WQPA 4C0BA 4TQRA 4XAKA 4F4XA 3PFEA 4CDIA 4DR5F 3DRYA 5KG4A 5L1IA 4RBUA 2JC1A 5D4OA 2KRRA 1N5TA 2FVRA 3AJ1A 1R0CB 3G87A 1N32J 4NLGA 1O8BA 3IG1A 1OY9A 2PO4A 1RWOB 1S7HA 4P71A 2ZHOA 2E9TA 5KAKA 3GFZA 4GTZA 4DV4J 3DN9A 2ALZA 4U8YA 1VRTB 3EXCX 4JI0J 4CXSA 4M8LA 4E98A 3MGJA 5IZHA 2RF2B 5GAHI 1LWFA 3LGHA 5I3UA 1DY3A 5IM0A 5F0UA 4BCAA 1GQEA 4PABA 1FRKA 3JQJA 1N33F 3DRRB 1VR6A 4ED3A 2HSEB 1IN0A 3P6YC 4CYUB 4DI6A 4CLTA 3MOJB 4OHVA 1C0UA 1S6PB 3NNAA 5IOLA 4JP8A 4IG3A 3K57A 2BACA 4UOFA 2FC8A 1SH2A 2LU1A 5JVGQ 4ZP8A 3KLHA 5L9NA 4OYXA 4LT6A 2ZH4A 2UXDF 3PCOB 3QO9B 2N4CA 3BGRB 5LOQA 2W5XA 4DFJA 3ZZTA 3W66A 4DR1F 1WC3A 1QTNB 1AZSB 2NUUG 3QSIA 2L3MA 2GA3A 4NXNF 5IC6B 1RTIB 1GFWB 2N3LA 2MKIA 3OL7A 4H54A 1KHWA 3PW4A 2HNZA 3IO1A 1YZ7A 4YFUA 1EP4B 1HI8A 2Y1JA 2DNKA 2NXEA 3TZZA 3CC4S 5FLXU 3H25A 2HNDB 1U6FA 4RWWA 1U26A 4ECRA 4CO2A 3GYGA 1T95A 4DMZA 4L72B 1N0UA 1VQ5S 1S6QB 1ALHA 3D67A 2V4RA 1T03B 4PQUA 4NCGA 2XMUA 3R7BB 2IBOA 3DRXA 2CJAA 2XG8A 1CJKB 2CQ2A 3PYDA 3G6ES 2DBBA 3GP9A 3CW2C 1LWCB 3OVAA 1NK8A 2ZDOA 1JXEA 3CJ0A 5KFBA 1FRJA 2C2NA 1HQUA 3AOAA 3ENQA 2WVFA 3SDEB 1H7XA 3DDIA 3M8PB 1H72C 2PSZA 2AHOB 4N5SA 1R7IA 3KK3A 2V4QA 1RA6A 4JV2A 2Y8YA 4FS1A 3HXMA 1RKIA 1U2FA 2QZ8A 4RNFA 2J9DE 8RUCA 1DTTA 3PY8A 1YJRA 3ZTSA 3KXDA 2HKEA 3PW5A 4ECVA 1YRTA 4ECWA 1G4CA 3KLVA 3CMQA 4HHUA 2H4WB 1RYRA 3MFHA 1VJWA 3J7YU 1HHQA 2RIJA 3BO2A 4OYWA 2UUAJ 4IUFA 2D1CA 2YNGB 4QW9A 2EFGA 3HVWA 3A12A 2QN6B 5LT5A 1RAAB 3MR5A 3KJVA 4CLSA 1TK8A 1ZTWA 2GFFA 3BDEA 2ASLA 1FSUA 4R0JA 3KK1A 1WI8A 2I2YA 3LP0A 2AP6A 4HI1A 1MG7A 4V19X 4RPFA 3IWNC 4Y00A 4KGVB 1SL2A 4O3NA 2JHEA
chains in the Genus database with same CATH topology
3T00A 1B8JA 1E3CP 3WAYA 4LR9A 5LQQA 2W8SA 5DLWA 1KH4A 3ED4A 3M8WA 2RH6A 2W5SA 1EW9A 3M8ZA 4MHXA 2W5RA 1ALIA 1HJKA 5K4PA 4UORA 5INHA 4GTZA 2D1GA 1ANJA 1O99A 2VQRA 5TJ3A 1KHKA 3NKMA 3E2DA 4QAXA 4ZG7A 1HDHA 4KAVA 2GA3A 2GSUA 4LREA 2G9YA 2W5WA 3NKRA 4FDIA 5AJ9A 3IGYB 4CXSA 2IUCA 3UN2A 4UPHA 1ZEDA 3WBHA 2ZKTA 3B5QA 3LXQA 5DLTA 5GRRA 2IFYA 2W5TA 5EGHA 3BDFA 1SHQA 4KAYA 1SHNA 4KJDA 5LIAA 1KHLA 5IJQA 1Y7AA 2X98A 1AJCA 4FDJA 1E1ZP 1HQAA 4LR2A 5GOVA 4LRBA 1E33P 4MY4A 3CMRA 4TN0A 4B56A 4CYSA 4GTYA 1O98A 1N2LA 4KM4A 4MIVA 3SZZA 4UOOA 3M7VA 5EGEA 4UPIA 3NVLA 3MK1A 5IJSA 2XR9A 1Y6VA 4KJGA 2GSOA 1P49A 2IUCB 5KXAA 3M8YA 1ED9A 4ZG6A 4N7TA 5LRMA 4CYRA 5L0BA 1EQJA 3UNYA 1EW8A 4CXKA 1ALHA 3NKQA 3BDHA 3TX0A 1ELZA 1KHJA 1EW2A 1N2KA 3NKNA 5L0KA 5L0EA 1K7HA 4LRFA 3T01A 3UO0A 4GTWA 4UPLA 3SZYA 3TWZA 3WAXA 2XRGA 3OT9A 4LRCA 3IDDA 1ZEBA 3A52A 3KD8A 1ZEFA 3MK0A 4ZGAA 4GTXA 3UN5A 3Q3QA 3UN3A 2W8DA 3IGZB 3MK2A 4UOPA 5LRNA 2W5VA 4LRAA 3NKPA 4LRDA 1AJDA 3DPCA 3BDGA 3BDGB 1KHNA 2GSNA 3T02A 3WAWA 5HRTA 2W5QA 4CXUA 5DLVA 5C66A 1EJJA 1ELXA 4LQYA 1KH7A 2GLQA 3NKOA 4NWJA 1KH9A 2QZUA 1AJBA 1AUKA 1E2SP 1FSUA 1URAA 1KH5A 4NWXA 4UPKA 4ZG9A 3TG0A 1ANIA 2W5XA 2ANHA 3WAVA 4LR7A 1ALJA 3DYCA 4YR1A 1ALKA 1EI6A 1ELYA 1URBA 1ED8A 1AJAA 4LR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T00 A;  1B8J A;  1E3C P;  3WAY A;  4LR9 A;  5LQQ A;  2W8S A;  5DLW A;  1KH4 A;  3ED4 A;  3M8W A;  2RH6 A;  2W5S A;  1EW9 A;  3M8Z A;  4MHX A;  2W5R A;  1ALI A;  1HJK A;  5K4P A;  4UOR A;  5INH A;  4GTZ A;  2D1G A;  1ANJ A;  1O99 A;  2VQR A;  5TJ3 A;  1KHK A;  3NKM A;  3E2D A;  4QAX A;  4ZG7 A;  1HDH A;  4KAV A;  2GA3 A;  2GSU A;  4LRE A;  2G9Y A;  2W5W A;  3NKR A;  4FDI A;  5AJ9 A;  3IGY B;  4CXS A;  2IUC A;  3UN2 A;  4UPH A;  1ZED A;  3WBH A;  2ZKT A;  3B5Q A;  3LXQ A;  5DLT A;  5GRR A;  2IFY A;  2W5T A;  5EGH A;  3BDF A;  1SHQ A;  4KAY A;  1SHN A;  4KJD A;  5LIA A;  1KHL A;  5IJQ A;  1Y7A A;  2X98 A;  1AJC A;  4FDJ A;  1E1Z P;  1HQA A;  4LR2 A;  5GOV A;  4LRB A;  1E33 P;  4MY4 A;  3CMR A;  4TN0 A;  4B56 A;  4CYS A;  4GTY A;  1O98 A;  1N2L A;  4KM4 A;  4MIV A;  3SZZ A;  4UOO A;  3M7V A;  5EGE A;  4UPI A;  3NVL A;  3MK1 A;  5IJS A;  2XR9 A;  1Y6V A;  4KJG A;  2GSO A;  1P49 A;  2IUC B;  5KXA A;  3M8Y A;  1ED9 A;  4ZG6 A;  4N7T A;  5LRM A;  4CYR A;  5L0B A;  1EQJ A;  3UNY A;  1EW8 A;  4CXK A;  1ALH A;  3NKQ A;  3BDH A;  3TX0 A;  1ELZ A;  1KHJ A;  1EW2 A;  1N2K A;  3NKN A;  5L0K A;  5L0E A;  1K7H A;  4LRF A;  3T01 A;  3UO0 A;  4GTW A;  4UPL A;  3SZY A;  3TWZ A;  3WAX A;  2XRG A;  3OT9 A;  4LRC A;  3IDD A;  1ZEB A;  3A52 A;  3KD8 A;  1ZEF A;  3MK0 A;  4ZGA A;  4GTX A;  3UN5 A;  3Q3Q A;  3UN3 A;  2W8D A;  3IGZ B;  3MK2 A;  4UOP A;  5LRN A;  2W5V A;  4LRA A;  3NKP A;  4LRD A;  1AJD A;  3DPC A;  3BDG A;  3BDG B;  1KHN A;  2GSN A;  3T02 A;  3WAW A;  5HRT A;  2W5Q A;  4CXU A;  5DLV A;  5C66 A;  1EJJ A;  1ELX A;  4LQY A;  1KH7 A;  2GLQ A;  3NKO A;  4NWJ A;  1KH9 A;  2QZU A;  1AJB A;  1AUK A;  1E2S P;  1FSU A;  1URA A;  1KH5 A;  4NWX A;  4UPK A;  4ZG9 A;  3TG0 A;  1ANI A;  2W5X A;  2ANH A;  3WAV A;  4LR7 A;  1ALJ A;  3DYC A;  4YR1 A;  1ALK A;  1EI6 A;  1ELY A;  1URB A;  1ED8 A;  1AJA A;  4LR8 A; 
#chains in the Genus database with same CATH topology
 2AJF E;  1J5E J;  1R3N A;  1SJQ A;  2YNI A;  1WF2 A;  4LF7 F;  5FJ4 A;  3SCJ E;  3S7R A;  3IRX A;  3R5J B;  1D9D A;  2LEC A;  4X4N A;  2RQK A;  3NKM A;  1XNQ F;  3OXL A;  4L3N A;  4JI4 J;  3PRB A;  2HQG A;  2RUG A;  2YX1 A;  3FBC A;  3I9Z A;  3BO3 A;  1KVK A;  3TEG A;  2G0I A;  4YN3 B;  1VC5 A;  3OL9 A;  3FUY A;  1BC6 A;  4B3T J;  3QGH A;  1GH8 A;  2MKK A;  3CCQ S;  2ZH5 A;  4X62 J;  3T1Y J;  3BH7 B;  2HFS A;  3OXF A;  3V6H A;  5DJB A;  1MN9 A;  3P5B P;  3TJ9 A;  4QWB A;  2VG7 B;  3UCG A;  1YJN S;  4LFC J;  4IRD A;  3UVJ A;  2QGF B;  3DOM A;  2W24 A;  3MM9 A;  2X1F A;  4OZ0 A;  3T5K A;  2VA3 A;  2BMB A;  3OD2 A;  4UT4 A;  3H20 A;  3SV4 A;  1RT1 B;  2W2O P;  4WZQ A;  2HS3 A;  3N9U C;  3I31 A;  1IKW B;  1IUJ A;  2GHW A;  1SKU B;  2QZU A;  2AU0 A;  5LXR A;  2Q66 A;  4ZJL A;  2P6S A;  1UMJ A;  3DYC A;  2RHS B;  5CYQ A;  2RDD A;  4KC5 A;  4XIU A;  4L75 A;  5RUB A;  3TUI C;  4P2X A;  2RH6 A;  4LMZ A;  4OX6 A;  1HQU B;  3N79 A;  4GO5 X;  4ZVG A;  2QMU B;  4S0M A;  2HFZ A;  2M8D B;  3GU0 A;  2ZIT A;  3IGY B;  2UUB J;  4UPH A;  5DLT A;  2OSQ A;  4NLY A;  1AFI A;  5HMZ A;  1XTZ A;  4O3Q A;  4OI0 A;  4GMK A;  2QLF B;  2WW8 A;  1YKW A;  2K1R B;  1Y7P A;  3TAR A;  2QV6 A;  3RRG A;  3DGV A;  3OW2 R;  1AT1 B;  1CC7 A;  3US5 A;  2QC3 A;  4YR0 A;  3D4J A;  5HK4 A;  3G2X A;  3ZFV A;  1D9F A;  2VBY A;  1ZTT A;  3IMQ J;  2GIQ A;  4LQ9 A;  2BRK A;  2R4F A;  3KJV B;  3CDE A;  2ASY A;  1D0E A;  4B17 A;  1FXL A;  3ETO A;  3W63 A;  4OIX A;  2ZOF A;  3ZTQ A;  4DQR A;  1YWX A;  1IBK F;  1R89 A;  2LXI A;  4HTI A;  3S01 A;  3M8Z A;  3IR6 B;  1WF1 A;  1RWX B;  2L08 A;  2BEF A;  4AE5 A;  3J80 U;  3MUV P;  1GK8 A;  2VF3 A;  5D0H A;  3UDV A;  4B9N A;  2NXN A;  4KAY A;  1R8P A;  3HJF A;  5LSO A;  1RWM B;  1RHK B;  2D3U A;  5IQ6 A;  4Q44 A;  4XDC A;  3VAM A;  2OP5 A;  2FUG 9;  4ANE A;  1XMO F;  4ZVS B;  1VLO A;  1TL7 A;  4DEZ A;  1VBY A;  2EPI A;  3H2V E;  3HSZ A;  1FKP A;  4C3K A;  4WTO B;  1VIX A;  2YNF B;  1UTA A;  3W60 A;  2MDA A;  5B0F A;  4USU A;  4Y2M A;  3E51 A;  3T01 A;  3IDD A;  3VQT A;  3E01 B;  2JEG A;  5EWE A;  2LA6 A;  1VYA A;  1RAH B;  4ILR A;  2VJV A;  2V2K A;  4JV5 F;  4DV1 F;  1RTD A;  4RWX A;  4LFA F;  4CLK A;  3BGF A;  3Q2S C;  4EMD A;  4L3K A;  4CZC A;  3MED B;  1ZOT A;  2NQP A;  1X5O A;  5IT4 A;  1YJV A;  4J5O A;  2DO0 A;  3N6N A;  1BWV A;  1HMV A;  1NJZ A;  1JKH B;  4B3O B;  1TEL A;  3DMJ B;  2E9Z A;  2HK3 A;  4Y2K A;  4YOE A;  2WVD A;  1YDL A;  1OPZ A;  2F9J A;  5DG9 A;  4OZ3 A;  3A3P B;  4FDJ A;  5KG6 A;  2W4P A;  1L3U A;  2DR6 A;  1FT8 A;  1IKV A;  2CQ0 A;  2R7S A;  3PFO A;  4DV3 J;  2FZC B;  1KHJ A;  5GAD U;  3KHG A;  4IO9 Q;  2V4J B;  1JJ2 R;  2HBZ B;  2EK6 A;  1AW0 A;  1ZM4 A;  2ASD A;  4NEZ A;  3UQS A;  3A13 A;  2J0X A;  4NCA A;  4KRW A;  4JI6 J;  4B3S F;  4MFB B;  3ITH A;  1DFD A;  1JWW A;  2QRR A;  1IVZ A;  2RB7 A;  1ED8 A;  4N47 A;  2MYF A;  1DQ9 A;  1JLQ B;  1WEX A;  4XPC A;  4M5G A;  5KFL A;  1RT5 B;  4C8M A;  1KH4 A;  2RH3 A;  5DLW A;  3MM6 A;  4ZP7 A;  4B9L A;  2BW7 A;  1EKR A;  5K14 A;  4DSE A;  3IBC B;  3P3D A;  5K4P A;  3VGT A;  1PO6 A;  2W9A A;  2AX0 A;  4LRE A;  2WVE A;  1HBM A;  2BJE A;  4X66 J;  3QGP A;  3HHE A;  2CPZ A;  1E1Z P;  2NYI A;  3HF5 A;  1M1K T;  3FQL A;  2C3P A;  1KFS A;  2KFY A;  2BRL A;  3FFI A;  4M1K A;  5KFR A;  2YWH A;  5IXU A;  4H4O A;  4WXW A;  4W90 B;  1SL0 A;  3FDS A;  4C4W A;  1IQT A;  4QR2 A;  1K1S A;  3JAM Y;  1ZEB A;  2NPF A;  3THV A;  4U7U K;  2G4B A;  3DRP A;  4AL7 A;  1RLC L;  3DOK A;  4LF6 J;  3QAU A;  1DLO B;  1RCO B;  2LYV A;  2Y1R I;  2QJ3 A;  4USJ C;  1S59 A;  3C3L A;  1HWJ A;  2MQN A;  3N4W A;  4YR1 A;  3LOU A;  3C66 A;  5HAT A;  4A8S A;  2XMV A;  1XMQ F;  1MMN A;  2OGU A;  1B99 A;  1N6Q A;  2J9D A;  3D1H A;  4ZDN A;  5AJ9 A;  4NZ7 A;  1VC6 A;  1SJ3 P;  3H5U A;  4K0K F;  4PXD A;  4RL1 A;  4EFA C;  3LWL A;  1X4G A;  5L1K A;  2FVS A;  3DLB A;  2DHG A;  4ZKA A;  4C48 A;  3HFZ B;  2G2O A;  3OV7 A;  1KKH A;  2XB2 D;  1B0P A;  1HBO B;  4OI6 A;  4YEA A;  5EUH A;  3GIJ A;  2CVI A;  1TKD A;  1UWB B;  3R97 A;  1WSR A;  4Q5V A;  4ZVR B;  4OX8 A;  1WHW A;  2B6A B;  5L0K A;  2E44 A;  4Q8F A;  1XQI A;  3C6U B;  3DU6 A;  1TUV A;  4OJ3 A;  3MM7 A;  2DNG A;  1S12 A;  3N6M A;  1MML A;  3NNC A;  2DIT A;  5T14 A;  2CWX A;  3EZU A;  3KK2 A;  2FIU A;  2WVC A;  3UWT A;  3MM6 B;  4GVB B;  2UXC J;  2RKI B;  5D78 A;  2L9W A;  1HWK A;  2EVZ A;  4JV1 A;  4RW8 A;  4KAI A;  2OPS B;  1LKZ A;  1OJ4 A;  4BC9 A;  1YLX A;  1FFS B;  1X31 C;  3MMC A;  1JQG A;  2XBP A;  4ATN A;  2FD2 A;  3TYT A;  3D6M B;  4X4U A;  3D3C J;  3PW0 A;  2RU9 A;  2B4U A;  3M7V A;  4NOH A;  3C14 B;  4TLQ A;  2A18 A;  4NLD A;  4J9U E;  2V9K A;  3NBP A;  2IRU A;  2YY3 A;  4JI8 F;  5L0B A;  2F65 A;  1NH8 A;  2YKQ A;  4Y28 C;  2DGV A;  3JTO A;  1RDR A;  2B56 A;  4JI1 F;  3KD8 A;  1SVD A;  1S1T B;  1CQN A;  2OTJ S;  5H9F K;  1CVJ A;  3KMQ A;  4ECZ A;  3JYT A;  2QSW A;  1ELX A;  3BJY A;  4DV5 J;  1Q95 G;  1NSQ A;  1UA1 A;  1AYE A;  4KGM A;  4ZPV R;  5DS7 A;  5A8W A;  2OEK A;  3I5A A;  5J2N B;  4NI2 B;  2VH7 A;  4P73 A;  2X3D A;  1IXK A;  4NL5 A;  1CC8 A;  4FYY B;  3CC2 S;  3M6W A;  2Z8Q A;  5DQG A;  3EE3 A;  1RIS A;  4DJB A;  2NPI A;  3GCW P;  4DR3 F;  1SBR A;  4WFZ A;  3EM1 A;  1A6L A;  4QWC A;  1UL3 A;  3OFE A;  1TU0 B;  4USK A;  2YTC A;  5FII A;  2DGQ A;  3QGG A;  4DDF A;  2GIR A;  1E6V A;  3K89 A;  4ZLN A;  3QIP B;  3T1H F;  3TAM B;  1KLM B;  4EK2 A;  1V6H A;  4P7T A;  3FSX A;  5IT0 A;  3ENW A;  1Y10 A;  1NSA A;  2QMX A;  3W7B A;  3MEC B;  3BDH A;  4J7C A;  4RNN A;  2R9L A;  4FDF A;  3A3N B;  1T05 B;  4X4T A;  5BXI A;  3SQG B;  2MXY A;  4HT7 A;  3UN3 A;  4CCH A;  2VC0 A;  1U1Q A;  3BBC A;  2VAS A;  1VQO S;  3J7Y I;  4B3R F;  1VRU B;  3M2V A;  3I5B A;  1ACM B;  1UFK A;  3AY0 A;  5KFN A;  2FVQ A;  3F56 A;  1HHT P;  3JXO A;  3NS7 B;  4UOH A;  3M2U A;  2ROE A;  4XO0 A;  3MMC B;  4ES3 A;  4F4Z A;  1RBL A;  2A2C A;  4F4Y A;  1NDK A;  1F0X A;  1QM9 A;  4OL8 A;  2NLW A;  1O98 A;  2YQ0 A;  1RWW B;  1S9E A;  3M6U A;  2EI5 A;  3EZO A;  4IQX A;  1FCA A;  1BE4 A;  4YB1 P;  3I55 S;  1A7G E;  3D0G E;  3GSD A;  3TRG A;  3GII A;  5GAE I;  5L1J A;  2BJ1 A;  4RBT A;  3NAI A;  5KOX A;  3LP1 A;  4C9D A;  1LWX A;  3RBX A;  1NB7 A;  4C8N A;  1F5A A;  3CCE S;  2BAB A;  3G96 A;  3UW1 A;  2KXN B;  3R5B A;  1D3W A;  1NO8 A;  2IJN A;  2XWX A;  4L6V 3;  2AWZ A;  2UUW A;  2QA1 A;  1U1O A;  2R8J A;  1KTV A;  1Q8K A;  1U02 A;  4P2S A;  1T02 A;  6FDR A;  1S9G A;  2IRX A;  2F63 A;  3W64 A;  2AJ0 A;  1Q78 A;  3HFV A;  1MN7 A;  4OQJ A;  4I2Q A;  4OX7 A;  2XO7 A;  2ZC4 A;  1AFJ A;  5KG0 A;  1FDN A;  4O0I A;  2XUL A;  2V2V A;  1H73 A;  4JI5 J;  2J5A A;  2VHG A;  1RLD A;  4NMX A;  2JLG A;  1YTY A;  1NJX A;  3CJK B;  4DR6 J;  1HD0 A;  4DUY F;  2XZT B;  5DDP C;  2YXL A;  4AXI A;  2IUC A;  2C3O A;  4NLS A;  4LVO P;  1HW9 A;  3G86 A;  3OVB A;  1R8H A;  5A6W A;  4OI1 A;  4TY8 B;  3PV8 A;  4F25 A;  1B70 B;  2WSF C;  2HK2 A;  4X2B A;  1P1L A;  2Z57 B;  3SBM A;  4QWD A;  4A8M P;  1X9S A;  1D1U A;  5ETV A;  2MPU A;  1FDD A;  2AYM A;  2PN6 A;  2AJ2 A;  3K2Y A;  3F0N A;  4I56 A;  3Q23 A;  1SI9 A;  4WCE Q;  4C11 A;  1UWA A;  1P6T A;  5KFK A;  2PA8 D;  1LFW A;  2XGP A;  3A3O B;  4M95 A;  4CXU A;  2OPP B;  1R0A A;  3NS6 A;  1FX2 A;  5J1E B;  5KT7 A;  2FGC A;  3DYA A;  1M5O C;  3CCW A;  2DGX A;  1QSL A;  1RJJ A;  4ICL B;  3RG6 A;  1PJ6 A;  3P96 A;  3OFF A;  2WB4 A;  1RCX B;  1HBU A;  1WOP A;  4B08 A;  1QE1 A;  2KHC A;  2FPH X;  3J81 j;  1U8S A;  2E5L J;  1NUE A;  4QJV A;  1KHK A;  4Y0F A;  1M1G A;  2W9B B;  3G6V A;  2YKP A;  3UPF A;  1RTH A;  2PMZ D;  1IR2 A;  4A48 A;  2CYY A;  3QLH A;  5KT2 A;  4PKD B;  4I7F B;  2CJY B;  2KFZ A;  2GMH A;  3MEG A;  2CZV C;  1VS3 A;  1LNQ A;  2Z2Y B;  1OIA A;  3TUP A;  2HGN A;  4OYO A;  3CTR A;  5HAN A;  3CB4 A;  4DCJ B;  4Z2X A;  2VG5 A;  3MMB B;  1HBN A;  4FYW B;  3LP1 B;  2HRY A;  3KNA A;  4B3M F;  3TAN A;  3WX8 A;  2Y3Y A;  2W2Q P;  1FKO B;  3AD7 C;  3BYR A;  4QWA A;  1JK9 B;  2OEL A;  3U1M A;  1HNI A;  1HR0 J;  3O5T B;  2HHX A;  2B5J A;  3A8K A;  4PG4 A;  5E5N A;  3H59 A;  4O3P A;  1SJF A;  6AT1 B;  3SMZ A;  2EC2 A;  1KVI A;  3AD8 C;  4QZV B;  2FJA B;  1W26 A;  5M2P A;  2VL1 A;  3KLF A;  1LOU A;  3RB6 A;  2GHV C;  4F3M A;  4KT0 C;  2ZFH A;  2DVI A;  4RW9 B;  2GSU A;  1EB0 A;  2DEI A;  3VHQ A;  2MQM A;  4OJG A;  3Q24 A;  1RBA A;  4QWE A;  2DR8 A;  1MNE A;  4LUB A;  2VPZ B;  2F4V F;  1SKR A;  5KFJ A;  1T9Y A;  1XR6 A;  5KFH A;  4KSE B;  1ELO A;  4ECQ A;  4DV2 J;  3H4D A;  3DLK A;  2RE1 A;  3O1L A;  1PYO B;  2YQ1 A;  2WZ1 A;  1HFE L;  2DNL A;  3T41 A;  3BSA A;  2V5H G;  3K59 A;  1N32 F;  3WIU A;  3AFG A;  1U45 A;  4PG7 A;  4ANC A;  2BJ8 A;  4DV4 F;  2Q6B A;  3MOZ A;  4JI0 F;  2K3K A;  3WC2 A;  3PHE A;  1X4H A;  2O66 A;  2ZDP A;  1ANI A;  4J9O A;  3R1L A;  3T5J A;  1U1N A;  3P5T L;  4DOZ A;  4WK3 A;  1M1H A;  3FSI A;  1JIH A;  1CJV A;  2ZM6 J;  4DR4 J;  4TN2 A;  2B9W A;  5TJ3 A;  4LF8 J;  2XI2 A;  5A8R B;  3NKR A;  2FVP A;  4KQZ A;  4AFF A;  1LFP A;  2B7B B;  5C2C A;  3EPG A;  3C15 A;  5DZ7 A;  3JS9 A;  3ZXW A;  1TVR B;  2G13 A;  3MEG B;  1IJF B;  3C19 A;  5HVF A;  2MKH A;  4CO4 A;  4DS5 A;  4I4B A;  4UOG A;  4R5P A;  2QX0 A;  2HGM A;  1DZ5 A;  5CYJ A;  5K8M A;  1MU2 A;  3JAM U;  2R7Q A;  2HHP A;  1V9O A;  5K8P A;  4UPL A;  2AV5 A;  3OFH A;  2RRB A;  4IO1 A;  4GTX A;  2B5J B;  4WFY A;  4NPO A;  3D6F B;  1D9A A;  1XEZ A;  4ZCK A;  3VAK A;  2OLW A;  4UPK A;  4CLW A;  4ZCM A;  2D74 B;  1TQL A;  1TL4 A;  4FXV A;  4I1T A;  4DN9 A;  3ILI A;  3WBZ A;  4ED2 A;  2W8S A;  2E5I A;  1F2H A;  1SUQ A;  2IYG A;  1JMT A;  2VPW B;  4ECU A;  1T11 A;  2XYG B;  4NLV A;  4ZG7 A;  2DNN A;  3FZB A;  1QTM A;  3DC2 A;  3HHL B;  1KWM A;  2ZOM A;  3ZO7 A;  2BVZ A;  4DSK A;  1U1R A;  4IFV B;  3SZZ A;  1CJU B;  2K8G A;  3GYX B;  3NVL A;  2FTR A;  4EYI B;  4FNH A;  4DN0 A;  1FJG J;  1ED9 A;  2CNN B;  4DG1 A;  1VBX A;  5A0Y B;  1TKX A;  4ILM A;  4RUB A;  2VON A;  2MY7 A;  3OBI A;  3OSN A;  5HMW A;  1C4C A;  1LW2 B;  1F1B B;  4DV7 F;  2YX7 A;  1A9N B;  4A8O A;  4E2F B;  4JBC A;  5IT9 Y;  3CCT A;  1ZBT A;  3HP6 A;  1WUU A;  1EIY B;  1S72 S;  4LF2 A;  3J81 Y;  2J9E A;  3I82 A;  4QIW D;  1S76 D;  3HHN B;  4WJB A;  2HNY B;  2W1B A;  1KTQ A;  1WG4 A;  4NWB A;  1UFL A;  2FJE B;  1NND A;  3H2L A;  3G8Q A;  4HVZ A;  3RR8 A;  2MB0 B;  4K4W A;  4M5N A;  4A47 A;  2BQ3 A;  2PI4 A;  3MM5 A;  2Q6C A;  3D0H E;  3HD1 A;  2HWH A;  5HLF B;  4D3G A;  4KE5 A;  1VHI A;  1RBO B;  3TZY A;  3CED A;  2RAQ A;  1B64 A;  4LBH A;  3D68 A;  1RQ0 A;  1RWP B;  2UUA F;  4CI0 B;  4P2F A;  3BGU A;  4KM4 A;  4AD6 A;  2CQI A;  5ETK A;  2FJV A;  3FNN A;  3QGI A;  4J91 A;  3RBD A;  1FJC A;  1HD1 A;  3NLC A;  3J7Z 5;  2HWT A;  2XHW A;  4PWD B;  4XDD A;  1LK7 A;  4BWM A;  1T94 A;  5DLG A;  1F2G A;  5HRO B;  3FBB A;  1ELZ A;  1N0V C;  3S1T A;  1J5E F;  3OUY A;  2QFI A;  3CCJ S;  2P8I A;  4KO0 B;  3MPW A;  2N3O A;  2HVD A;  2KZZ A;  2Z30 B;  4F04 B;  1HWI A;  4MKY A;  1HNV B;  2RIL A;  2UV8 G;  3JTP A;  3A8I A;  2EKN A;  4JI4 F;  3BRE A;  4ZIT A;  2BE2 B;  2F8H A;  3HSG A;  1EI6 A;  1M5V C;  2VFU A;  3WAY A;  3BKT A;  4ZJO A;  4OZ2 A;  1ZAX A;  5B0A A;  2YVS A;  5CAA A;  5C2G A;  2PMW A;  4B3T F;  5JJB A;  3T1A A;  3PIP Q;  2ATL A;  2VIH A;  4X62 F;  3I5C A;  3T1Y F;  1TV6 A;  4OZL A;  3E2D A;  4AND A;  3DM2 B;  2PDA A;  4IKA A;  2ZJR Q;  1UJ4 A;  2K06 A;  4MKV A;  1YJ7 A;  3E8O A;  2W9C A;  4LFC F;  1UPP A;  4WU2 A;  4BHQ A;  2E7X A;  3PJX A;  3WIV A;  2ZHA A;  2CPD A;  2V2Z A;  4PYA A;  2HFO A;  2RML A;  4ED4 A;  4DUZ J;  5B08 A;  4DG1 B;  3HVT A;  4WII A;  3M32 A;  2DGW A;  1RT6 A;  4CIO A;  1VQN S;  4RR5 A;  4DCO B;  3EGN A;  1H98 A;  2ZZM A;  1H6K X;  1UVK A;  3M9M B;  5HBM A;  3TA2 A;  5DM6 Q;  3OJU A;  4WE1 B;  3PXG a;  4PXB A;  4UOP A;  1S6O A;  1NZA A;  4NLR A;  2Q43 A;  2DNR A;  3DGP A;  1IWG A;  2C2D A;  2GW8 A;  4F0M A;  3DLJ A;  1JXL A;  1S1X A;  3MMA A;  2G2Y A;  2BR0 A;  2UUB F;  4CQ1 A;  2BJ7 A;  2RUS A;  2NRE A;  2KVQ E;  2RU3 A;  3HPO A;  5T41 A;  5HSP A;  2DNO A;  4W4M A;  3N01 A;  4IDK A;  1HJK A;  1SKS A;  2QE5 A;  1Q16 B;  1TKT A;  5IFM A;  1TKZ B;  4B9M A;  3TZX A;  1BY9 A;  3G82 B;  3ZZ0 A;  3GPA A;  1VQS A;  1ZAW A;  1QUV A;  5HL7 Q;  1JLC B;  2CVE A;  4QR1 A;  4HAC B;  1FRX A;  2K7J A;  1R43 A;  4ES2 A;  3OFG A;  3Q83 A;  5KG1 A;  1T9U A;  4CLF A;  2B9X A;  2DCL A;  1S97 A;  2MZQ A;  4F0K A;  3V4M A;  1X4E A;  3RB4 A;  1RT2 A;  4JV0 A;  1URR A;  1ZM9 A;  3FCW A;  1R6V A;  2Y0S D;  4PPZ A;  4B9V A;  2BJ3 A;  3GWC A;  3PYE A;  3OR2 B;  1VGY A;  4LSN B;  2DNZ A;  2D9O A;  1U2R A;  3TAP A;  4KJI A;  1HWL A;  1VBZ A;  4L73 A;  3QJL A;  4OHX A;  4N56 A;  3VV2 B;  2G2Z A;  1CJT B;  3HO1 A;  3TA0 A;  3NGK A;  3KHR A;  1TL3 A;  1TAQ A;  4W98 A;  4CRJ A;  2QLJ B;  4M5K A;  3OR1 B;  1G2E A;  3H7H B;  1N36 J;  2W8L A;  4Y3C A;  2VQR A;  5F8G A;  3DLG B;  2VDI A;  2XM3 A;  5HN0 A;  2JX2 A;  1CPZ A;  2CQH A;  3LUY A;  3LXQ A;  5FLX Y;  1CG2 A;  4A8K A;  4DSF A;  1R6Y A;  1UA0 A;  4QU6 A;  5KFO A;  2P9G A;  4DBQ A;  1K44 A;  1TL1 B;  1C1B A;  3MTK A;  2BKP A;  1QAX A;  4PG5 A;  2GSO A;  3F73 A;  3QBC A;  2MQL A;  2W7O A;  3RYL A;  3MR3 A;  1YRX A;  4K4U A;  3GE9 A;  3Q8Y A;  3D2W A;  1J5O B;  3NKN A;  1NXI A;  3HM9 A;  2OAU A;  2FLO A;  5L1L A;  2XRG A;  3OT9 A;  1WF0 A;  3ZTO A;  2MLX A;  4R0E A;  4LBP A;  5CHC B;  4A8Y A;  3LAL A;  1N5V A;  1WNE A;  2HHU A;  3MCS A;  2R7U A;  3QZ7 A;  2LKZ A;  4C3M A;  2C1E B;  4NLP A;  4RNH A;  3HSD A;  5J2P A;  3NWG A;  2CRL A;  4KYZ A;  3VAI A;  2XY5 A;  2QYG A;  5LQQ A;  1M5H A;  2YX4 A;  1IKY B;  3R2C J;  4ID5 B;  4IDK B;  2FJB B;  2Y1L B;  5SZT A;  1L3V A;  4RO0 A;  4EYH B;  4DV3 F;  1KS2 A;  1F3V A;  2HQF A;  5C25 A;  3Q8Q B;  2RQC A;  3OTD A;  4ES1 A;  3OL6 A;  1B0V A;  2HLU A;  4ELV A;  4KH0 B;  1F5C A;  1NPP A;  4RU2 A;  5BR8 J;  5D3G B;  4M5M A;  2DPI A;  2WVB A;  4DX5 A;  2MGZ B;  3FRZ A;  3MK1 A;  5IJS A;  4O44 A;  2XR9 A;  5KXA A;  3PX4 A;  4JI6 F;  3PNI A;  4G1P A;  2C2E A;  4HDH A;  2NXJ A;  4RW6 A;  3KHH A;  1GTH A;  2EW9 A;  3VAJ A;  1KN6 A;  1RXO B;  3KG1 A;  1WTB A;  1EET A;  2JLE A;  2C2K B;  2OFG X;  4PEO A;  1WOO A;  1AJD A;  4OI4 A;  1FNM A;  2ZVI A;  1E6Y B;  4YY3 J;  1VQL S;  2XTJ P;  5FDL B;  4ELT A;  2FLL A;  4YDD B;  4X66 F;  3AJ2 A;  5C7P A;  1GNK A;  5IV3 A;  2XHC A;  3HZE A;  3GQC A;  1RHQ B;  1EAR A;  4ZHR A;  3VF0 B;  2V94 A;  3GR1 A;  2EFP A;  1PG5 B;  5ETR A;  3GV5 B;  2ZWO A;  1GMV A;  1QVF R;  1YHQ S;  5EWG A;  1FER A;  2IVF B;  2YPZ A;  1UEK A;  1T9T A;  1MLA A;  1FTC A;  4PUO A;  2GQ2 A;  4F4A A;  1MSW D;  4B56 A;  4O23 A;  4O3R A;  2DT9 A;  4R8U A;  4K4T A;  4DF4 A;  4LF6 F;  2FJD B;  1Y6V A;  2KT2 A;  1JXV A;  1JLA A;  3KLG A;  1UZD A;  3KLE B;  5I3Q A;  1XNR J;  3CJ2 A;  5AXK A;  2O1P A;  4FS2 A;  2YKA A;  1X9W A;  4Y2C A;  4LF9 F;  2YKM B;  3R3T A;  2J6S A;  4DSI A;  1XK8 A;  3R6G B;  4ZPA A;  3MM8 B;  1HAR A;  4I2P A;  2Y1I A;  3W9I A;  1I94 J;  2IC3 B;  2MZ1 A;  1UPM B;  3N0V A;  4RW7 B;  1ALK A;  4KV8 B;  2YWK A;  2ZH7 A;  3JSB A;  1JJ4 A;  1TP7 A;  3BQ0 A;  5J2Q B;  3WX4 A;  4CTA A;  4P9S A;  4Q45 A;  2LU2 A;  2DXE A;  2G9Y A;  1RSC A;  3W1Y C;  4FF2 A;  2D69 A;  2GVZ A;  4HLB A;  4PZV A;  1N5Y A;  1JLG B;  3HCX A;  5A6P A;  1Y00 A;  1AUD A;  3I87 A;  3AQO A;  5HP1 B;  4V1A k;  2RT3 A;  2RRA A;  3LH2 S;  4UPI A;  2ZD1 B;  3P8B B;  1PBU A;  4EUV A;  1SIZ A;  3V81 B;  5F0W A;  3SSR A;  3U1L A;  2LQ5 A;  2DXF A;  4V19 J;  5MAO A;  1EET B;  3H5S A;  3LAK A;  3GIR A;  3MK0 A;  2UXC F;  2CQP A;  5DG8 A;  1L3K A;  2W5V A;  1U25 A;  3R7N B;  1KHN A;  2ZEJ A;  2W7A A;  3Q8V A;  2FJX A;  5B0D A;  3JQK A;  4DQS A;  1O51 A;  2VD3 A;  3IGV A;  3M1V A;  2EFQ A;  1NEE A;  2C3U A;  4ZOS A;  3J80 Y;  3F41 A;  2F8E X;  5BYS A;  1REV B;  2V69 A;  4MIA A;  1CUL B;  5KT5 A;  3K58 A;  1OPI A;  1G3O A;  3JSM A;  2MJN A;  2G9O A;  4Y6I A;  5HMX A;  1S7I A;  5B0G A;  4TNO A;  1MRO A;  5G0R A;  2AJ1 A;  5IV4 A;  1M0S A;  1AJC A;  2F3J A;  1RAJ A;  4OMF G;  2YWG A;  3ZZZ A;  2M9K A;  1U0H A;  2KDO A;  1RWN B;  1ZM3 A;  5CZX A;  4UUW A;  3QFH A;  1IKX A;  1HPZ A;  4G65 A;  5E3R A;  1V3R A;  1Y3K A;  4DV5 F;  2ZHB A;  2DR5 A;  1FDA A;  2XYP B;  3HMJ G;  2GA7 A;  2M70 A;  3AXM A;  4WP9 A;  4YME A;  5IT9 U;  5L8R C;  1EW2 A;  2M2B A;  3THT A;  3J81 U;  2BXJ A;  1U47 A;  3CJ3 A;  2VJU A;  2MKY A;  3T3F A;  3E2E A;  4UQT A;  4I2P B;  2PII A;  1P27 B;  3CUN A;  3H8Y A;  4CNZ A;  3MUR P;  2POK A;  4LSL B;  5IQQ A;  4ZP9 A;  5JUM A;  2RF2 A;  4CLL A;  5L46 A;  3IA0 A;  4MT1 A;  1YVF A;  2YH1 A;  3BF4 A;  2ROP A;  4CTA B;  4NLT A;  2HBY B;  3DRR A;  3BV8 A;  2IDE A;  3O6Q A;  1WKJ A;  2CA9 A;  3K8V A;  3QMQ A;  2XLJ A;  2COL A;  2OPQ B;  5E7O B;  4ITS A;  3UR3 C;  4I6W A;  1FJE B;  1OO0 B;  4ZCL A;  4KR0 B;  4IRC A;  3BGL A;  3IS9 B;  2IPO B;  1WHY A;  1WAC A;  3KUE A;  1S6P A;  3AJD A;  4USW A;  3CSK A;  2XSJ B;  1DQA A;  4ZLJ A;  4TKT A;  4ETX A;  2NSC A;  1U8W A;  2WTF A;  3W5Z A;  3QO9 A;  2DHA A;  4Q8E A;  3NKQ A;  3BGR A;  3RB0 A;  3C6T B;  1WEY A;  1ZS6 A;  2D41 A;  1TFW A;  4LRC A;  5THW A;  3V2U C;  1HYS A;  5HRT A;  2KFN A;  1AUS L;  3ZNJ 1;  1AZS A;  1M5P C;  2KHD A;  2IM3 A;  1XER A;  3MUT P;  2CPI A;  1RTI A;  2ZBQ A;  1S1U A;  1RT4 B;  3W2W B;  2C3Y A;  3GLJ A;  3G9C A;  2CAD A;  1EP4 A;  2PI5 A;  3L7O A;  3CMA S;  2HZV A;  3MEE A;  4F67 A;  5HAO A;  2HND A;  4RNO A;  4KAV A;  3RW6 A;  3HD2 A;  2HVZ A;  4JI7 J;  4QYZ K;  1SV5 B;  5EGH A;  1CBK A;  3M8Q B;  2L9D A;  3MPU B;  1Q4R A;  1S6Q A;  4UQG A;  2DIV A;  1T03 A;  2CNO B;  1S57 A;  3VAF A;  2HHQ A;  3CCU S;  3R2D J;  2R7V A;  1HLW A;  4Q2M A;  3PX6 A;  2ZKU A;  1TR0 A;  3M8Y A;  4WIQ A;  3KG4 A;  2KTQ A;  1IQZ A;  2MHN A;  2Q3P A;  2BKO A;  1XC9 A;  3ISN D;  4N77 A;  1LWC A;  4KB7 A;  1XMB A;  3NGT A;  4FNI A;  2JL9 A;  2KZM A;  4JI5 F;  2E9R X;  4DU8 A;  3G8T A;  1N56 A;  4DR6 F;  2HBR B;  2HQD A;  5DLV A;  5KG3 A;  2GGP B;  2KVI A;  3SDE A;  1UVN A;  4PG8 A;  2DIU A;  5D0G A;  5ETM A;  3M8P A;  1ALJ A;  4LSZ B;  1G7C B;  3EIC A;  3UD5 A;  1VQM S;  2FHJ A;  2LXF A;  3L7U A;  2VQF J;  2DPJ A;  4X4R A;  3FBF A;  3MTJ A;  4WYW A;  3RBZ A;  2KN4 A;  3FGV A;  3QT7 A;  1R8B A;  2P9C A;  2F40 A;  3KG0 A;  1CS4 B;  1IWA A;  4OZ5 A;  1WJ9 A;  3QT6 A;  4DZ6 A;  1SHQ A;  2H5E A;  4I68 A;  1SL1 A;  1S48 A;  1VQ8 S;  3CPW R;  3B6B A;  2ZBR A;  4A8X A;  2XY7 A;  2CIM A;  2WOM B;  3C2P A;  3W2V B;  2UZA A;  5D77 A;  2YNG A;  3CJT A;  3I96 A;  3JTN A;  4Q43 A;  2CZ9 A;  1WKK A;  2OFH X;  1YG0 A;  2XQC A;  2LQ8 A;  4ALZ A;  4FF1 A;  1BQM B;  4M5D B;  5LXY A;  1URN A;  5CYM B;  4GTW A;  1WOR A;  3M05 A;  1APS A;  1Q7L B;  3DDN A;  3QAE A;  1DTQ B;  3AA9 A;  2E5L F;  3NNH A;  1HYS B;  4PAA A;  2CNK B;  1CEZ A;  1WC6 A;  2CPF A;  4ED0 A;  2GQQ A;  1I3O B;  1OYD A;  3TG0 A;  2UUC J;  1OQ3 A;  3SCK E;  3B4M A;  4K5S A;  1S1U B;  4B9S A;  3AOD A;  2EG2 A;  5HQL A;  4NCB A;  3CCL S;  1PC4 A;  1V3S A;  2DYA A;  3MEE B;  2C3M A;  1KOH A;  4OZ1 A;  4FDI A;  4OHZ A;  1RHM B;  2B4V A;  3EDQ B;  4ZVO B;  3BQ1 A;  1U2C A;  3GJS B;  2VG7 A;  1KOO A;  1HQA A;  4RNM A;  1KEK A;  2E5G A;  2HFV A;  1HR0 F;  1RTJ B;  2DNY A;  3R8Y A;  2VZ9 A;  3CJ4 A;  2VBX A;  5F3Z A;  2ZE2 B;  3POT B;  1RT1 A;  3AT1 B;  4QQB A;  1GX5 A;  5K20 B;  1IKW A;  2OEM A;  5L0E A;  2WW4 A;  2WBR A;  2I1R A;  4DV7 J;  4ZGA A;  2MTL A;  5LRN A;  3CD5 A;  1GT8 A;  1FF2 A;  3MEK A;  4DSL A;  2QL7 B;  2AT1 B;  5I3P A;  1AJB A;  4YDX A;  2B9Y A;  2LLZ A;  2BAN A;  3CE8 A;  4RKU C;  1NK5 A;  3CUL A;  4K59 A;  4DR2 J;  1FFW B;  1PCA A;  5D0E A;  2GAG C;  4ECY A;  4MK8 A;  4JYA J;  3FKB A;  3CC7 S;  3FCV A;  1NRK A;  3BR8 A;  2K1R A;  3PX0 A;  4ZP6 A;  2M7S A;  3RUB L;  4DQQ A;  5E3P A;  3LAM A;  4DV2 F;  5GAH U;  1GX6 A;  3AOC A;  3MUM P;  3FCH A;  4WBF A;  2HHW A;  1HQE B;  3QT8 A;  3VCD A;  2AJ4 A;  1H3D A;  4N8O A;  1U4B A;  4ZJQ A;  3GYN A;  3NP5 A;  1OSD A;  3EGV A;  3CJS A;  2BM1 A;  3CT9 A;  3I0R B;  1BD6 A;  2V9W A;  1EQJ A;  1KVJ A;  2D3Z A;  2HHH J;  2P5V A;  1FE0 A;  2OSR A;  1M5S A;  2V0N A;  1FNO A;  4F36 A;  5H1S V;  3IAS 9;  3LW5 C;  2ZM6 F;  4DR4 F;  4DQP A;  1B3T A;  1MW7 A;  4FYD A;  1UAW A;  4LF8 F;  4O3O A;  2CJ9 A;  2HS4 A;  4DF8 A;  3LP2 B;  2KKH A;  2QL9 B;  2ANH A;  1PIE A;  4O4G B;  5J2M A;  4ED8 A;  2M0G B;  4NA3 A;  2M8H A;  3KNG A;  5KG5 A;  3LPY A;  3X1L B;  2H9Z A;  1ALI A;  1S77 D;  3LAN A;  4OX9 J;  1FVQ A;  2D1G A;  3HHL D;  4UY8 T;  1ITP A;  3U1N A;  1FWK A;  4IG0 A;  5HJX A;  2LVW A;  2W8K A;  2IHR 1;  2GNK A;  3V6J A;  3MD3 A;  2YNF A;  5KFA A;  3GFH A;  2XGQ A;  3K8W A;  2WON B;  5LIA A;  4GRS A;  5IJQ A;  3CCZ A;  2XLI A;  1P8G A;  4ZVT B;  1JLB B;  3AB2 B;  3M9O B;  3E01 A;  2JC0 A;  5DDO C;  3NGD A;  2ACY A;  1OQ6 A;  2Z56 B;  1N48 A;  2HQC A;  2HAF A;  4F3Q A;  3EWG A;  1TL5 A;  3H98 A;  4ETZ A;  5AJ3 J;  2J0Q D;  1SC3 B;  2CQ4 A;  4NYO A;  7FD1 A;  3MED A;  4ZK7 M;  4BBY A;  4LF4 J;  3LO3 A;  2MZR A;  3W62 A;  2FGO A;  1JKH A;  4Q0B B;  4B3O A;  4FKY A;  3KWM A;  3DMJ A;  1NH7 A;  2DY9 A;  2BAN B;  4QR0 A;  3QID A;  3LA0 A;  3T6B A;  2XSF A;  2OO4 A;  2RJZ A;  5LJ5 Y;  1O5J A;  2XZD B;  4F3O A;  2PMH A;  4WP8 A;  2GAH C;  2EFN A;  1FKA F;  2HZC A;  2A6M A;  2VA2 A;  1FJG F;  1R0B G;  1EQ0 A;  4JI2 F;  2HQ3 A;  3QRQ A;  5GME A;  2GMJ A;  1X7V A;  1RZM A;  2JSX A;  1RAG B;  3L7P A;  2AYG A;  4YQW A;  2OTL S;  1VBK A;  1NLK L;  5KT3 A;  4LR2 A;  1P1T A;  4QCL A;  5DQH A;  2V4J A;  4KY3 A;  2IM0 A;  5F8M A;  3LF0 A;  2NUH A;  2Z2L A;  5KFE A;  1N54 B;  2NZ4 A;  4M5L A;  4KPY A;  4Q2L A;  3FSY A;  1YRU A;  3CF5 Q;  4MFB A;  3I0S B;  3AB4 B;  4TYA A;  4DL0 C;  1S9F A;  3RW7 A;  4CH1 A;  4ZVP B;  2JEF A;  2PEH A;  1JLQ A;  3PO5 A;  3D7S B;  1RT5 A;  3EGZ A;  3BR9 A;  3MXH P;  4L76 A;  4ZPD A;  1KH7 A;  3EXY A;  4MAK A;  4I69 A;  3R9L A;  1NK4 A;  3WC0 A;  3HKZ D;  3Q8U A;  4KTQ A;  2ZUG A;  3IWX A;  1RU2 A;  4G6V B;  5J2M B;  3ILJ A;  3VR1 A;  4C97 A;  4ZN1 A;  2XYH B;  4J90 A;  4FZV A;  2Z0G A;  1FXR A;  2R7W A;  1UW4 A;  4TLR A;  3GV8 B;  3FMB A;  2HMI A;  3S6E A;  4IG0 B;  3AQP A;  1T9W A;  3IM9 A;  1ZED A;  2HS0 A;  1S0M A;  3QJP A;  2N7Y A;  5K5M A;  2VG6 B;  2NZC A;  3GG0 A;  3HZG A;  2AYE A;  3F44 A;  3K5N A;  3DLH A;  1YJU A;  5DDQ C;  1O6X A;  1YBA A;  2HUR A;  9RUB A;  1Q82 T;  1S1V B;  2HIY A;  1BUX A;  5M2R A;  3DFE A;  2J0W A;  1DLO A;  3EDR B;  4XPE A;  4K7Q A;  2DRD A;  1RAF B;  1WWH A;  2CG4 A;  4QW8 A;  4RW4 B;  4C0O C;  4ZVF A;  2Q1L A;  1NM2 A;  1Q5V A;  1JB0 C;  2H5J B;  1H2T Z;  4ID8 A;  1LWE B;  1RT7 B;  3BPD A;  1F60 B;  2GSN A;  3MR2 A;  3I4H X;  3FEZ A;  3I32 A;  4LQY A;  4URS A;  4H4K A;  2JJ4 D;  1TZ0 A;  5L39 A;  2EXU A;  3M30 B;  1PC5 A;  3Q8S B;  2ZJQ Q;  2E1P A;  3B8H A;  3CO9 A;  4CO1 A;  1J27 A;  3NXZ A;  2AW0 A;  1O99 A;  4DUZ F;  4J9M A;  1HBO A;  2WHO A;  3PR5 B;  2B4O A;  2JEI A;  4TU7 A;  1UWB A;  2B6A A;  2QLW A;  3IXQ A;  5EWF A;  3C6U A;  4H4M A;  4IFY B;  4DUT A;  1FK9 B;  4FP9 A;  4ECS A;  2PD1 A;  2ATC B;  3CJQ A;  4O0N A;  2O3D A;  5D6G A;  1WDD A;  2AX1 A;  3OHB A;  1C1C B;  2B4P A;  3T5L A;  3BO4 A;  3OLB A;  4Q7A A;  2W8D A;  3BKU A;  5HO4 A;  3A4T A;  4PXE A;  1M5K C;  4GVB A;  2RKI A;  3PRV A;  1WHV A;  2FZG B;  5KFS A;  3G6Y A;  1FD2 A;  4UOC A;  2OPS A;  4HHH A;  2XMW A;  2XMK A;  3PJ9 A;  3IBF B;  6FD1 A;  4N41 A;  3PW2 A;  1VK3 A;  2DGU A;  5B0C A;  3HDS A;  2DGO A;  2HQI A;  4DPU A;  1RYS A;  4WTY A;  2HMI B;  3C14 A;  4KKO B;  4AYB D;  5F8I A;  4LJM A;  3D6T B;  1REG X;  3GB0 A;  2EFV A;  1V3Z A;  2J7W A;  1S1T A;  3L4B C;  4OV6 A;  2L48 A;  5DDR C;  2XMM A;  3TR5 A;  2YH0 A;  1I1G A;  3NY0 A;  4C8L A;  1SB6 A;  5J2N A;  2OUG A;  3PG9 A;  4NI2 A;  1RKJ A;  4LF9 J;  2MY8 A;  1N36 F;  1TMJ A;  4FYV B;  3GJR B;  1TMM A;  4ILL A;  4ZPW R;  3DLL Q;  1J2V A;  1U6B A;  3VAH A;  4LIR A;  1JLE B;  1VIO A;  4P75 A;  2DD8 S;  2PGC A;  1NKE A;  1E3C P;  3FMW A;  2KO1 A;  5A8K B;  3OLA A;  2PEB A;  4TQS A;  2IJF A;  4BWJ A;  1IM6 A;  4OI3 A;  2NXC A;  3QIP A;  2FVC A;  5INH A;  3TAM A;  1KLM A;  3OQ2 A;  3IR5 B;  3SI8 A;  1TTH B;  5C42 B;  2JNJ A;  1B0T A;  4FN5 A;  5IS2 A;  3MPD A;  3CDW A;  4USI A;  4HYK A;  2IVY A;  4LVN P;  2HHT A;  5T7L B;  3MEC A;  3VTI A;  1T05 A;  2IM2 A;  4M63 A;  2MEW A;  3SQG A;  2CAJ A;  4H4M B;  3G4S S;  1Q8L A;  4Y34 A;  5JMN A;  4G3I A;  1GXL A;  1IBC B;  3TX0 A;  1VRU A;  3MPY A;  3W65 A;  3UCZ P;  4CO5 A;  1HNW J;  2DGS A;  1Z4U A;  4K4Z A;  3SZ2 A;  2XY6 A;  2E7V A;  1V5V A;  4WKR A;  2GVD B;  2CJB A;  4U7C A;  1NK6 A;  4HKQ A;  1X60 A;  4JB8 B;  2AD9 A;  5BR8 F;  4ZLP A;  4AL5 A;  2U1A A;  4PYD A;  2IMW P;  2E5J A;  1SKW A;  4QIV A;  2UXB J;  4I0W A;  1Y0H A;  5CZV A;  3W5X A;  4QAX A;  3NMA A;  2R7T A;  4NLW A;  4B02 A;  1P9Q C;  3K7R A;  4DFP A;  4DR7 J;  4UZC A;  5LMU F;  2AEJ A;  2DRB A;  4K50 A;  3GMG A;  4YHH J;  2BOP A;  3DRS B;  4RLE A;  4HH0 A;  4YY3 F;  2HHS A;  1Q8B A;  2W01 A;  2KXH A;  2ZZN A;  3N5F A;  1Q81 T;  2R8I A;  2CZ4 A;  3MF5 A;  4ZIW A;  4ZVH A;  4ZIV A;  2HLT A;  3BQ2 A;  2VOD A;  3A52 A;  1I5O B;  1HNZ J;  5KFX A;  3QSY B;  3CJK A;  1Y9O A;  4X4O A;  1KC8 T;  1ZM2 A;  5E41 A;  1KH9 A;  4DL6 A;  4FXW A;  1X8D A;  2GS8 A;  1WG5 A;  5C24 B;  4J9R A;  5SUH A;  3PIO Q;  1OSC A;  1ZA1 B;  4LR8 A;  1KP6 A;  3DLE B;  4RUC A;  2FJW A;  1C2P A;  1D8Y A;  4TY8 A;  2PFF B;  2ZUA A;  1UEU A;  2W4C A;  3H42 A;  1NBE B;  1U49 A;  4N8N A;  5HVH A;  3D1O A;  1FI4 A;  4URG A;  1XNR F;  3CCM S;  4OV1 A;  8ATC B;  1U24 A;  2FLN A;  1JLF A;  4MK7 A;  1GXT A;  4CM2 A;  1G6B A;  4DHV A;  1WD6 A;  1LXN A;  2O01 C;  1HNX J;  4MYT A;  1YJ9 S;  2JLF A;  5H9E K;  1I94 F;  2OPP A;  4CYR A;  4I64 A;  1XBW A;  4IH7 A;  2LEB A;  4XTT A;  5J1E A;  1GAO A;  3CIZ A;  3RB3 A;  2I0X A;  3DI6 A;  2IJR A;  4NLU A;  1BXN A;  1KQK A;  4ICL A;  3VGS A;  4NA2 A;  2MQP A;  1UET A;  2W9B A;  2V50 A;  4ENO A;  4GC7 A;  4ED6 A;  1XR7 A;  1UCN A;  3AA8 A;  5GMK a;  1Y5N B;  4GC6 A;  2B7C B;  2BM0 A;  1RAE B;  4I7F A;  2HW3 A;  3T5H A;  1VQ4 S;  5DQI A;  3RAX A;  4HL9 A;  2G0C A;  2DB1 A;  3T19 A;  2C22 A;  4NA1 A;  1YZ6 A;  4RJV A;  2I5J B;  1FWL A;  1WC1 A;  4K2X A;  3VGV A;  1BLU A;  2BA9 A;  2J6T A;  1SHN A;  3V6D A;  3MMB A;  5CAB A;  2M52 A;  3OTB A;  5AE2 A;  1FKO A;  1ZET A;  2VU5 A;  2YNH A;  4KJG A;  2JH3 A;  3ETM A;  2B8P A;  3NGR A;  2B51 A;  4USH A;  4JI3 J;  5K9F A;  3W9J A;  2DH7 A;  3KLI B;  4LFB J;  1IM4 A;  1C0T B;  4X4Q A;  2W25 A;  3ZTR A;  1DBD A;  1HI1 A;  3TWZ A;  4FF4 A;  5KFG A;  3ZZR A;  1FFG B;  1YBT A;  2XWY A;  3P45 B;  5F3T A;  1FRI A;  4C8Y A;  5GAG U;  3PZP A;  2F5G A;  1KH5 A;  4K4V A;  3PJW A;  5JVH Q;  2UP1 A;  1PYT A;  4RW9 A;  1W25 A;  2XMJ A;  1QAY A;  2HBQ B;  2AJQ A;  3G71 S;  4I6Y A;  5FD1 A;  2AGO A;  3M8W A;  2LA4 A;  2Y8W A;  3W9H A;  2E66 A;  1MMD A;  3FBE A;  5HMY A;  3TQE A;  5DRK A;  2HRU A;  1JLF B;  3OPK A;  3RAM A;  5B0E A;  4UST A;  3IG1 B;  5EHH A;  1PAU B;  3CNQ P;  3CMR A;  3OTO F;  4KBI A;  4UOO A;  2UVU A;  4PXC A;  2DRA A;  2V8D A;  5J1P A;  2B9E A;  1U1M A;  2Z2M A;  1LWF B;  4FF3 A;  3N28 A;  5I3U B;  2J7U A;  4WPA A;  5IM0 B;  2NYH A;  4EZ6 A;  2I9S A;  1H74 A;  3TNV A;  3DI6 B;  5LSR A;  2QL5 B;  4LRD A;  4CH0 S;  2MMY A;  3WAW A;  1GTE A;  3W3S A;  4DQI A;  5AE1 A;  2J8A A;  5L9X A;  4K8R A;  2QO3 A;  2GLQ A;  1IR1 A;  3MAH A;  5A8R A;  1C0U B;  4IG3 B;  4ZPB A;  3TUZ C;  5HJY A;  2CPE A;  4NLX A;  3H40 A;  2J76 E;  1N34 J;  3KLH B;  2VDH A;  1TVR A;  1KDN A;  3M8R A;  1RU1 A;  4X4S A;  1BHN A;  2OML A;  3RAQ A;  2YWE A;  2OPR A;  2XI3 A;  5D4L A;  2ZKT A;  2H3E B;  3V6D B;  1FA0 A;  3ISZ A;  4HDG A;  3P4U B;  4F4K A;  2CDR B;  3TVZ A;  2FC9 A;  2C28 A;  5AXL A;  3NCP A;  2YNH B;  4WKY A;  1KR4 A;  1VCT A;  2DGT A;  2O67 A;  2HNZ B;  5GAE U;  3HUL A;  3TW0 A;  2X1A A;  2WSC C;  2IFX A;  3PDN A;  1OWX A;  2VPX B;  1NK9 A;  3RJM B;  4FYX B;  2DHS A;  2QSF A;  1FD8 A;  3ILL A;  4DV0 J;  2D7S A;  4DV6 J;  1W7W A;  1WTF A;  2HFN A;  4DS4 A;  2F8M A;  1SPB P;  2QA4 G;  4JI7 F;  1FRH A;  2CQC A;  4PQU B;  1URA A;  4NCG B;  4MMO A;  3CCS S;  3GON A;  3HHL A;  2ZBI A;  4FPI A;  4Y2A A;  4DX7 A;  5B0B A;  1OS5 A;  1R27 B;  4IFV A;  4HH1 A;  2LQB A;  2MSS A;  4A46 A;  1CJU A;  2YBV A;  3CO0 P;  1V5I B;  5KT4 A;  2W5W A;  1ZZN A;  1QAI A;  1S0V A;  3W5Y A;  1K0T A;  2HAI A;  4J37 A;  1SH0 A;  5A0Y A;  4NZ0 A;  3CME S;  1X5P A;  3MFI A;  2VQE J;  1KD1 T;  4P74 A;  4CO0 A;  1LW2 A;  2ILZ A;  3KUH A;  2V67 A;  2A1B A;  3BGO P;  4X64 J;  4YR3 A;  3KK3 B;  1U1P A;  4OLP A;  4WP3 A;  3RRK A;  4ELU A;  2IBK A;  5GAD I;  3PYG A;  5KFF A;  2M88 A;  2HNY A;  1DTT B;  2VQF F;  3SZY A;  1YX2 A;  4L74 A;  1WSV A;  5JXS A;  3IGZ B;  2W2P P;  4WF9 Q;  5HVG A;  1WEL A;  5ETN A;  1NAQ A;  4C8K A;  5HLF A;  3J7A 1;  4LF5 J;  1TK5 A;  1OY6 A;  1X4F A;  5D4P A;  2NR0 A;  2DK2 A;  2C2M B;  3UDL A;  3GCX P;  3T00 A;  4F8R A;  3ELH A;  5AT1 B;  4MHX A;  3IWL A;  1QVG R;  2X51 A;  3KK1 B;  3C46 A;  2MLZ A;  1X9M A;  3NMR A;  1S99 A;  2OPR B;  3LP0 B;  1GMW D;  3RGI A;  4K5R A;  3B5Q A;  4PWD A;  2RS2 A;  3PW7 A;  1WC5 A;  3PEH A;  4F7V A;  5CXT A;  2ZZT A;  2YNI B;  2J8S A;  5HRO A;  5D8H B;  5IWA J;  1RAI B;  4M5I A;  3IRX B;  4DL4 A;  4J9V A;  1NJW A;  3BSO A;  4KO0 A;  2PE8 A;  4DLG A;  1U0S A;  3QNW B;  3SFU A;  2U2F A;  1HNV A;  3AHP A;  2JEJ A;  2UUC F;  4X4V A;  4M5J A;  2BE2 A;  5KFQ A;  3JSY A;  3CD6 S;  2V68 A;  2P9E A;  4YP3 A;  4ZCI A;  4DL7 A;  2NCK L;  1DHM A;  4DXL A;  3GFX A;  2FHJ D;  3D66 A;  4C7Q A;  3UVJ B;  3DOM B;  1Y4Z B;  3DM2 A;  3MM9 B;  1WC4 A;  2A2D A;  5ETL A;  5CD4 A;  4OZN A;  3RRH A;  3NKY A;  3QAT A;  4NRT A;  1SIW B;  3BBF A;  3ED4 A;  2W5S A;  2FQQ B;  1MWQ A;  5GMD A;  3H2U B;  4NEY A;  4NX9 A;  4UOR A;  3FEX B;  1EX8 A;  3SIP B;  4DZD A;  5D0R A;  3IBW A;  2DNP A;  4JI2 J;  2GC8 A;  5GRR A;  5CYQ B;  1S0N A;  2ZOG A;  1VQ9 S;  2C2O B;  2P6T A;  1WC0 A;  3R5A A;  3ZNU A;  2QMW A;  4WE1 A;  3PTW A;  5MLC V;  2E5H A;  2KM8 C;  1L5U A;  1X0P A;  4M5H A;  4DFK A;  2H4Y B;  5B7W A;  3MR6 A;  1FXD A;  5DET A;  5KFY A;  4A8W A;  4DR2 F;  4ZA1 A;  1X4B A;  1Q1K A;  1YQH A;  3E3X A;  4JYA F;  2DKO B;  2GHP A;  1QDU B;  3QJJ A;  3NGS A;  2YWF A;  1F3F A;  3KJQ B;  4MKB A;  2YKN A;  2CFX A;  1GMU A;  5I4M A;  1TKZ A;  4GVL A;  4DPW A;  3OJS A;  3G82 A;  2V8V A;  4EEY A;  4NXM J;  4K2J A;  4DU7 A;  1JLC A;  1WDT A;  3EYZ A;  3G6X A;  4HAC A;  2W5R A;  1NDP A;  3IC1 A;  2UV8 A;  2WAQ D;  2ZC3 A;  2JRS A;  3EVW A;  3IAM 9;  2XNQ A;  2OH2 A;  4IYQ A;  3SSQ A;  2R2U A;  2HHH F;  4PWW A;  3B54 A;  4D3H A;  3VAL A;  1F9E B;  4AL6 A;  2G0J A;  2OI2 A;  2UU9 F;  4K4X A;  1T9X A;  2FHK A;  5G4D A;  2APO A;  3OR2 A;  3LPE A;  3W8G A;  4LSN A;  4KHP J;  2BUN A;  1LV5 A;  2ERR A;  2EK1 A;  1EQM A;  5EDW A;  3NGU A;  4UF4 A;  1QJH A;  1DUR A;  3GG1 A;  2IIH A;  4RBV A;  2DHH A;  1CJT A;  1TL7 B;  4F0H A;  2ZVS A;  3LQV A;  4NLO A;  1FKP B;  5GVQ A;  4OX9 F;  3OR1 A;  3PRD A;  1TUG B;  3SFG A;  3UI3 A;  2JDJ A;  4QOT A;  1I51 B;  2ZH8 A;  2EFO A;  4IOA Q;  5D15 A;  3SXL A;  3DLG A;  1GEH A;  3VZH A;  1W2I A;  3MCO A;  1HA1 A;  3VWS A;  2R8G A;  4CH7 A;  3HLU A;  1IJE B;  1Z2Z A;  4QPT A;  3WDO A;  1TL1 A;  3WZ0 A;  2IMO A;  1LW0 A;  1KQF B;  2FHM A;  5KFM A;  1RTD B;  5F9N A;  1K8A T;  2NXU A;  4CO3 A;  3UN2 A;  4F2S A;  2W5T A;  1SQF A;  2LCW A;  4KJD A;  1S49 A;  1DJ0 A;  3R1H A;  1J5O A;  1UVI A;  5AJ3 F;  1HMV B;  1JJH A;  4LF4 F;  2A10 A;  2QA4 S;  3JB9 k;  3CWJ A;  1FE4 A;  4U96 A;  2KB2 A;  2KU7 A;  4IR1 A;  1UW9 A;  1Z2L A;  4FKX A;  2VKZ G;  2J7K A;  2DY1 A;  2KYZ A;  1KBR A;  3KFW X;  4AQY J;  1IKV B;  3TZW A;  1DAX A;  4YB7 A;  2CQB A;  1UVM A;  9ATC B;  3D5M A;  5ETQ A;  1TK0 A;  1WHX A;  3MDF A;  1IKY A;  2JVO A;  2BZ2 A;  1FWP A;  2R2S A;  1MWZ A;  2LDY A;  1NSK L;  1EJJ A;  4ID5 A;  4EBE A;  2CJK A;  2A3J A;  2C42 A;  2YKN B;  1AUK A;  3L3C A;  4ZG9 A;  2FY8 A;  1UP1 A;  1Q5Y A;  4QIF A;  1K73 T;  3RTV A;  5KFP A;  5D3G A;  4OHY A;  4PPD A;  2MLY A;  1FRL A;  3R6L B;  3ITH B;  2MGZ A;  4AT1 B;  4QPX A;  3ZZP A;  3RBE A;  4DPX A;  4CT8 A;  4ED1 A;  5KT6 A;  4KPC A;  2B43 A;  5DZ6 A;  2OEJ A;  3CJ8 A;  2DR9 A;  5HI7 A;  2JFD A;  3SCL E;  5K14 B;  2ZH9 A;  3PKM A;  1Q0N A;  4NAS A;  3QFW A;  2XO6 A;  3HHD A;  2YWW A;  3CIM A;  2EKY A;  1IBL J;  1HBM B;  1E6Y A;  2LEP A;  5FDL A;  2ILY A;  1TUW A;  1K7H A;  2R8K A;  4B9T A;  3FFI B;  2UVR A;  4U9R A;  1FTR A;  2CQ1 A;  1C4A A;  2KJW A;  4YR2 A;  2PFD A;  2FZK B;  2IM1 A;  4H4O B;  2VBW A;  2JFK A;  2VOP A;  4YS2 A;  2FY1 A;  2BJ9 A;  2KG0 A;  1CQM A;  3EUN A;  4DL5 A;  3OSP A;  1LEO A;  3BPS P;  3DDK A;  4CLZ A;  2VFV A;  3DRP B;  3FRY A;  3DOK B;  2X1B A;  1KQS R;  3D3B J;  1H2V Z;  5GAG I;  2HHV A;  1QD1 A;  3K5M A;  2DR7 A;  1LW0 B;  3SSS A;  3A8J A;  5E3C A;  1TAU A;  2MQO A;  4YUD A;  3TVK A;  2BW2 A;  4YB5 A;  3MZI A;  3KLE A;  4A8F A;  5DLF A;  1FEH A;  3UD4 P;  3ICL A;  1KHL A;  2HZA A;  1N6Q B;  4CP5 A;  4DCP B;  2YKM A;  3N5B A;  3BEG B;  5EGE A;  4X65 J;  2FDN A;  2M3D A;  1F5B A;  2ZH3 A;  4ZG6 A;  3FVY A;  3MM8 A;  1HHS A;  2DEJ A;  3AOB A;  4CXK A;  1Q7Y T;  1N2K A;  2KG1 A;  2IC3 A;  4G1Q A;  3Q8P B;  1PAE X;  4RW7 A;  4KV8 A;  2YQ3 A;  2DHX A;  3U7J A;  2HPU A;  3QWU A;  3OTE A;  3T02 A;  2L9N A;  4ZPT R;  1VQY A;  4GKK J;  3BDP A;  5HQ8 A;  3UD3 P;  2C2R A;  1ZPW X;  1HQ2 A;  5J2Q A;  3LGM A;  1WEZ A;  3CGI A;  2RRN A;  3WAV A;  1ARO P;  2XCP A;  1KNZ A;  3D9B A;  3VVU A;  1JX4 A;  4NYZ A;  4LR9 A;  4R25 A;  1JLG A;  1RAO A;  3MM7 B;  2LMI A;  2NS1 B;  4HR2 A;  3MCM A;  1RA7 A;  2NSB A;  3QPI A;  2GML A;  5HP1 A;  1K0V A;  2ZD1 A;  2ZH1 A;  3KK2 B;  1KFD A;  3BN4 A;  4NRU A;  3FJ2 A;  1RB0 A;  3V81 A;  1VOM A;  5GOV A;  4LIW A;  5LMU J;  4RW8 B;  1Y3J A;  2V63 A;  1G1X A;  2O5D A;  3IR7 B;  3AXK A;  3TI0 A;  3A8E A;  1RWK B;  2QA2 A;  3BH6 B;  4P10 A;  3HX9 A;  2RQ4 A;  1NHV A;  2QEX S;  1PJ5 A;  2L41 A;  3ADA C;  5HQM A;  4DLE A;  1H0H B;  5M2U A;  3KDN A;  3V4I A;  2XS7 A;  5LMN J;  4Y2I A;  2MKJ A;  4QIG A;  1REV A;  2VFS A;  2D3O R;  2VIC A;  3NBP B;  1RGV A;  3Q22 A;  1UFW A;  4DL3 A;  3ZZY A;  4AUK A;  1IBM J;  2W2M P;  3KMS A;  2J6U A;  1CUL A;  2VC1 A;  4RUH A;  1U1K A;  1F9F A;  2DNM A;  1B7F A;  3BSN A;  4CNY A;  2K7K A;  5F8L A;  3Q2T C;  4LR7 A;  2AQ4 A;  1NDL A;  3D0I E;  5E0O A;  2AEM A;  1U48 A;  4PG6 A;  1H7W A;  4GKJ J;  2DNH A;  2CXE A;  2XNR A;  3JYT B;  1QSY A;  1U7L A;  2DTJ A;  4OZJ A;  2IY5 B;  2H51 B;  5K8N A;  5A8W B;  4WYL A;  3BZQ A;  4BS2 A;  5AE3 A;  4J9N A;  4CM0 A;  4DR5 J;  2AZ1 A;  3PO4 A;  4W92 B;  4PRF A;  1EZZ B;  3EPI A;  2OD6 A;  3VAG A;  3QT5 A;  3QWP A;  2BE7 D;  4GTY A;  1RAD B;  2AF6 A;  3ZC4 A;  4F02 A;  2CQD A;  1N8R T;  3O3L A;  3PEJ A;  5KFC A;  3TQ1 A;  5EGY A;  2J0S D;  3CJ5 A;  3MR7 A;  3KTQ A;  1E6V B;  2VB6 A;  1S1W A;  4G1Q B;  2W4D A;  2XS5 A;  4Z7C A;  4LSL A;  1VFJ A;  3X3U A;  1N33 J;  2VV5 A;  1YSJ A;  3ULH A;  4WFN Q;  4RZR A;  2W7P A;  3R5D A;  3HFK A;  1NCL A;  4U7U D;  4NWJ A;  2UVW A;  4C98 A;  4NWX A;  3RU0 A;  2GO9 A;  1PKU A;  1SJ1 A;  3K5L A;  3EZ5 A;  2OPQ A;  3OVS A;  2GJ2 A;  4MK9 A;  3M6V A;  2H1Y A;  1N88 A;  1Q79 A;  2W2N P;  4DX6 A;  3IS9 A;  3D6H B;  3LTO A;  1ZPV A;  1EAY C;  1RP5 A;  3CVK A;  1RUS A;  1FNX H;  2XSJ A;  4PWU A;  1EHW A;  2UXD J;  2V8P A;  3M2V B;  3LWM A;  1R8C A;  3TP2 A;  5EN1 A;  5BYR A;  4EI2 A;  3SQO P;  3KDO A;  4C2M A;  2N7C A;  4WK1 A;  1HNW F;  1EJ7 L;  3C6T A;  2DXD A;  1ZA2 B;  4DR1 J;  1HI0 P;  3MWB A;  3HHK A;  2I38 A;  3SEO A;  3M2U B;  1L3T A;  1U09 A;  4FVM A;  4U95 A;  5CH7 B;  4NXN J;  3HT3 A;  3R7S B;  3I4P A;  1QLN A;  1VK8 A;  4KHM A;  4ZLL A;  1ULR A;  3V4I B;  1S9E B;  5K8O A;  2R2R A;  2ZBP A;  1RT4 A;  5KG2 A;  2UXB F;  2PA3 A;  3W2W A;  2H54 B;  2A0F B;  1BQN A;  4OJH A;  4OYM A;  3DXB A;  2YKO A;  4J9L A;  4TVA B;  5F8N A;  1OY8 A;  3NKO A;  3MAA A;  1T3O A;  1SXL A;  4DR7 F;  3FK4 A;  1YK9 A;  4QYZ J;  2OMO A;  1NDC A;  2CWK A;  5ETO A;  1SV5 A;  2AKW B;  4YHH F;  3M8Q A;  1D8Z A;  1JNR B;  2M5Y A;  4FBT A;  1S9G B;  2HRT A;  4A4J A;  1HKA A;  1ROF A;  1N4L A;  1FEE A;  4F50 A;  4I2Q B;  2CQ3 A;  4HEA 9;  4OLO A;  2MQQ A;  4X84 A;  3MCN A;  2GJF A;  2IFY A;  3BBB A;  4O4R A;  5AXN A;  1VHF A;  2X98 A;  1MWY A;  4WFX A;  4LRB A;  5DO2 A;  3EVM A;  1LXJ A;  2BOA A;  5BJR A;  1HNZ F;  3OTO J;  4O3S A;  2IUC B;  1SQE A;  4E8U A;  4TY9 A;  4KH1 B;  1UEV A;  2GGP A;  2RDJ A;  3UNY A;  1FES A;  1S1W B;  4RX6 A;  1Q86 T;  3PM9 A;  2ZJP Q;  1I6J A;  2QG9 B;  4WXO A;  4Y65 A;  2RHQ B;  3Q86 A;  4KFB A;  2R8H A;  3TOQ A;  2K3I A;  5C66 A;  4BLG A;  3GIM A;  4C11 B;  1VI7 A;  1CLF A;  4LF1 A;  1CS4 A;  3HK2 A;  3GR0 A;  3R5G A;  3W8P A;  2ADC A;  4EBD A;  2WSE C;  1R0A B;  4I6A A;  2IVM A;  2R7O A;  2WOM A;  1HNX F;  3W2V A;  1RK8 A;  2VFR A;  1RWV B;  5DGA A;  2QLX A;  1HL6 A;  5C5J A;  1WKL A;  3DYA B;  1YIJ S;  4ER8 A;  2GIF A;  2XS2 A;  1N5Q A;  1NZ8 A;  4UTG A;  3GZ7 A;  2CKW A;  5CQG A;  1BQM A;  3OXG A;  1RAC B;  1HBU B;  1QE1 B;  3UDE A;  4M5D A;  2AIR B;  2ASJ A;  5CYM A;  5LM7 E;  4LF7 J;  2ZH6 A;  4IOB A;  1DTQ A;  1RTH B;  2KL8 A;  1M90 T;  3QLH B;  1XNQ J;  2E1R A;  4C6A A;  1PGZ A;  5A2Q Y;  1XIQ A;  3HJV A;  4CT9 A;  3CD7 A;  3UNG C;  1F6T A;  3O8W A;  4ZVE A;  3PKY A;  1FDB A;  3WHI A;  2MZJ A;  3DOL A;  2B3T B;  2R42 A;  1BQN B;  3TJA A;  3BDG A;  2VG5 B;  1HBN B;  4MH8 A;  4IRK A;  3MAA B;  1Q8I A;  2OD4 A;  2BE9 B;  1E2S P;  2ZNZ A;  2WB1 D;  4J9S A;  1VDH A;  1AJA A;  1HNI B;  2LP4 A;  3QZ8 A;  2QFJ A;  1GMW A;  3ZZU A;  4OHW A;  3C8Y A;  2R7X A;  5KFZ A;  3Q89 A;  2CNL B;  4DSJ A;  4DPO A;  4ZVU B;  2BYC A;  2E29 A;  1RTJ A;  4JI3 F;  3R27 A;  2ZBC A;  2DJW A;  2ZE2 A;  3POT A;  4LFB F;  3BDF A;  2H5I B;  3KLF B;  1RWU A;  4F4W A;  2WK4 A;  2MHE A;  2RDI A;  2CPY A;  3BB5 A;  2OHD A;  2QLB B;  2N4D A;  3BN7 A;  3UDC A;  3U27 A;  4DX8 H;  2QYC A;  2ABY A;  1OMS A;  2VOO A;  1NK7 A;  4AXJ A;  4TXS A;  3P49 B;  3GTY X;  3VVT A;  4LQ3 A;  3DXS X;  2DO4 A;  1UJ6 A;  1HIY A;  2ZWP A;  2WRM A;  2BX6 A;  1TFY A;  2OKQ A;  1ZEF A;  3UFC X;  3MK2 A;  1FVS A;  3EX7 B;  4KFB B;  3DLK B;  4ED5 A;  3GIK A;  3BSC A;  1YIT S;  4WFB Q;  3HVA A;  1PYS B;  5L38 A;  2R2T A;  1SC6 A;  4U8V A;  1ICE B;  2CJQ A;  5EX0 A;  4F2R A;  2EBE A;  2RNE A;  1HQE A;  4UY8 5;  1L3S A;  3FQK A;  1W2B R;  2EC0 A;  1S4E A;  2LFV A;  5KFI A;  4P2M A;  3PVX A;  4EO6 A;  3WBH A;  3IP0 A;  3PHT A;  3TUJ C;  3I0R A;  4DFM A;  2JVR A;  3M9N B;  1KRP A;  3NAH A;  2CQG A;  1KLN A;  4TN0 A;  4CLU A;  1IBK J;  1CJV B;  4P72 A;  4NML A;  2KT5 A;  1HW8 A;  3NWR A;  4J9P A;  1XR5 A;  4MKA A;  2VUG A;  4N7T A;  1N52 B;  3C15 B;  1SJ4 P;  3UCU P;  2WCX A;  2E7W A;  3LP2 A;  4KGZ B;  1BWE A;  4GO7 X;  3NL0 A;  2E1C A;  4H4K C;  2V8H A;  2KI2 A;  1T7P A;  1N34 F;  5E3Q A;  4IH6 A;  3H5X A;  4K4Y A;  4O4G A;  4KGK A;  1XMO J;  4NYP A;  1IR0 A;  3DOL B;  3GV7 B;  2X7I A;  2Z58 B;  3BDG B;  4R5P B;  3W61 A;  2F7V A;  3FC9 A;  3BYP A;  2BDP A;  1MU2 B;  1Y5L B;  1VLY A;  2IAJ A;  5KFU A;  2J9C A;  2D3O 1;  3D28 A;  3HVR A;  2GCF A;  2WON A;  2EG1 A;  3L09 A;  3K5O A;  5F8H A;  3UR0 A;  3SYZ A;  1JLB A;  2Z2Z A;  4MYU A;  3ENA A;  1N5S A;  1ANJ A;  1X5S A;  2VPY B;  1VQK S;  2ZH2 A;  3T9N A;  2YPY A;  4OJ1 A;  3IN5 A;  3CXC R;  3U02 A;  4JV5 J;  4USV A;  4DV1 J;  5CCM A;  4HT5 A;  4LFA J;  2QIF A;  2N82 B;  1SUQ B;  2XLK A;  2OJ3 A;  3AD9 C;  4MY4 A;  3TJ8 A;  4ED7 A;  4DV0 F;  4DWI A;  1BGX T;  4MIV A;  2FB0 A;  4DV6 F;  3S8S A;  1WOS A;  2AEF A;  5E33 A;  5KFW A;  5F9L A;  4HI2 A;  1RHU B;  2XCA A;  4CLP A;  4E0D A;  4Q0B A;  2P2C B;  3GJT B;  2H65 B;  3THP A;  1RAB B;  2G1D A;  5KTQ A;  5I42 A;  3NKP A;  4OYP A;  3TA1 A;  2B0G A;  2HG4 A;  5DGB A;  2HWI A;  1TKX B;  1JNZ B;  3M2R A;  1KHV A;  4PQA A;  3TX8 A;  2JZ5 A;  2IRY A;  4MTP A;  1S4F A;  1S79 A;  3TAQ A;  4IR9 A;  1ELY A;  4DPT A;  1T3N A;  2VQE F;  1VQ6 S;  1B8J A;  4UW2 A;  4WFA Q;  4X64 F;  5F41 A;  5E3A A;  1K1Q A;  4B3S J;  1BQX A;  2XEX A;  2LXU A;  1RHJ B;  5F8J A;  5KFD A;  3NG8 A;  2RD5 C;  4TYB A;  2GX8 A;  3I0S A;  3T6J A;  1YGY A;  4CYS A;  3MM5 B;  1H38 A;  2UU9 J;  2G1H A;  1XWL A;  3O2I A;  2HVI A;  3OL8 A;  4ZS6 A;  4ECX A;  4C8Z A;  2UUT A;  1T8E A;  2RVJ A;  2MJU A;  4N76 A;  3KJF B;  4DL2 A;  2XC9 A;  4LF5 F;  1NSP A;  4FPR A;  4MIB A;  4LRF A;  2H48 B;  4J9K A;  2PT0 A;  2XMT A;  2EWH A;  1RT3 A;  3DPC A;  1FRM A;  2R7R A;  2W5Q A;  3BM7 A;  3HSJ A;  4JUZ A;  1AXQ A;  4NE9 C;  2BKN A;  4ERD A;  1U6Z A;  1T0T V;  1Q53 A;  2IAJ B;  2CPJ A;  4KIA A;  3OUY B;  5KFV A;  2QT7 A;  3I56 S;  5IWA F;  2UVV A;  2ROG A;  2VG6 A;  2AZ3 A;  3L9Z A;  2DH8 A;  4M94 A;  5ITH A;  2KJV A;  3G8S A;  4K4S A;  1HDH A;  2KXF A;  4CWB A;  3M6X A;  1S1V A;  4OYA A;  3V5R A;  3H90 A;  1OYE A;  2KH9 A;  1NKC A;  1XMQ J;  4PR6 A;  4RW4 A;  1F9H A;  1FJ7 A;  5KG7 A;  4Z37 A;  2WBM A;  3NS5 A;  1TV6 B;  2IA6 A;  3N6L A;  1LWE A;  2MQ8 A;  1RT7 A;  3ONQ A;  4MIW A;  2B8Q A;  3J7Z T;  1PJ7 A;  4NLQ A;  2HEK A;  2W9C B;  3EJM A;  5LSL A;  3TO8 A;  4K0K J;  2LQJ A;  3Q8R B;  2MST A;  2QTW A;  3M30 A;  3UO0 A;  3KKF A;  3OHA A;  2I8E A;  2GJI A;  5I42 B;  4FBU A;  1RE1 B;  3M4X A;  3VGU A;  3DHW C;  3HVT B;  3M32 B;  2V2Q A;  1RT6 B;  3KYL A;  3M2R B;  1VJQ A;  1FHT A;  1NME B;  4C3L A;  5HBM B;  1GXU A;  4DPY A;  3Q0A A;  3WAX A;  1X4D A;  2MKS A;  3DGP B;  1O0P A;  1S1X B;  3A1Y G;  3MMA B;  3B78 A;  1NHU A;  1S0O A;  4J9Q A;  4IFY A;  1KSP A;  1FK9 A;  2V8G A;  1SJR A;  1T9V A;  4YB6 A;  3IFE A;  1C1C A;  4ZVQ B;  3H4B A;  2CJX B;  2MZS A;  5D4N A;  1TKT B;  4Z7Y A;  3NCQ A;  2AGP A;  3HKW A;  2MZT A;  3H5Y A;  3I6P A;  1NHK L;  3CD0 A;  2SXL A;  2Y0B B;  3K17 A;  1QUP A;  3GJQ B;  3ZTP A;  3EVO A;  4TU8 A;  5DG7 A;  3MHY A;  4OI2 A;  3NOG A;  3B4D A;  4NXM F;  1K9M T;  1S10 A;  3ET6 A;  1RT3 B;  1RT2 B;  1XN9 A;  3RZA A;  2KYX A;  3PYF A;  2AYB A;  2IDL A;  2VFT A;  4WU3 A;  4JI8 J;  3KOA A;  2XZW A;  4KKO A;  3HI9 A;  1P9Y A;  2CPX A;  2D9P A;  1ZYQ A;  1X5T A;  3KJN B;  1X4A A;  4JI1 J;  2AMC B;  4QU7 A;  1NKB A;  5B09 A;  1ZH5 A;  3JSR A;  4QYR A;  1X0F A;  4KHP F;  3L95 X;  3NEK A;  3ISN C;  2HGL A;  4TU9 A;  1FO1 A;  2LEA A;  4G1I A;  1TL3 B;  1D09 B;  3SCI E;  3OTC A;  3PAC A;  1NPR A;  4EO8 A;  1NU4 A;  1E33 P;  2RQM A;  3DKD A;  4ECT A;  2DNQ A;  2HVH A;  4RUA A;  1QY7 A;  1CSJ A;  2JOQ A;  4DR3 J;  3DNC A;  1P49 A;  2ADB A;  3ILO A;  4PCQ A;  2FLP A;  3IRW P;  2GO8 A;  2X1G A;  3MPV A;  4QIE A;  1NK0 A;  1JLE A;  1SC1 B;  3CJR A;  1C1B B;  2R3V A;  5LJ3 Y;  3CCR S;  4IOC Q;  2E1M C;  1YJT A;  1ZZF A;  2F1F A;  3VZI A;  3T1H J;  5A8K A;  1SCJ B;  5ADZ A;  3BS9 A;  3KUG A;  4HHJ A;  4OYZ A;  3HT0 A;  4C8O A;  3MAQ A;  2IYI A;  2XMA A;  4LBI A;  5C42 A;  8AT1 B;  3AAW B;  5AXM A;  1URB A;  3GIL A;  1K47 A;  4NZ6 A;  7AT1 B;  4QBU A;  3QRP A;  5IC4 B;  5CD4 H;  2VBZ A;  5T7L A;  4KGX B;  4BC7 A;  1PSD A;  2FHO B;  3MMJ A;  1VMB A;  1QSS A;  1SQG A;  3C16 A;  5J2P B;  1RHR B;  4B3R J;  4AQY F;  3GSI A;  3J7A N;  4EGL A;  4UZB A;  1DRZ A;  2VKR A;  3V6K A;  3MD1 A;  4RU9 A;  2K2P A;  2CDQ A;  2FYX A;  4P52 A;  2I6W A;  1WI6 A;  5C25 B;  5A2Q U;  4ZMM A;  1A0O B;  2ALY B;  7FDR A;  2JWN A;  3AH6 A;  3QYY A;  1EW8 A;  1R31 A;  2GVD A;  3D1Q A;  5LL6 d;  1UVJ A;  1VQP S;  4O44 B;  2GZO A;  1AA1 B;  4P6Q A;  1Y11 A;  2HIQ A;  3ET6 B;  3NOC A;  1NJY A;  4EZ9 A;  3NRB A;  2V34 A;  4ZN3 A;  4RW6 B;  3JQM A;  1KON A;  3IM8 A;  4URQ U;  3EMT A;  3M8S A;  2KM8 B;  3GFY A;  1SH3 A;  3PR4 A;  1S5Z A;  3EGW B;  2Q79 A;  3FEY B;  1UKU A;  4MJK A;  1B7Y B;  3KHL A;  2RS8 A;  3DRS A;  2DIS A;  1IBL F;  5ETP A;  5KOW A;  3RR7 A;  1VRQ C;  2F9D A;  4OYB A;  5H9F J;  1Z1Z A;  1Y7A A;  4F26 A;  1WG1 A;  2DH9 A;  1YBU A;  4ZHR B;  1NJI T;  2GQC A;  1N2L A;  3QQC D;  3K5P A;  4IH5 A;  1S6U A;  2GV1 A;  5KFT A;  4DUY J;  2PC6 A;  5LRM A;  1VIS A;  4PUO B;  1KQG B;  3QRR A;  5C24 A;  4R8U B;  2X3G A;  3UN5 A;  2A6O A;  1JLA B;  3DLE A;  3KLG B;  2EBG A;  2E1A A;  2CUY A;  1B4S A;  3CCV S;  3FZ2 A;  2BBE A;  3MI7 X;  3ENV A;  4C0H A;  2AGQ A;  1UZH A;  1JJC B;  4EU0 A;  4FVC A;  4KHR A;  4U67 Q;  4XK8 C;  1EW9 A;  1Y5I B;  5ETT A;  1VQ7 S;  1HWU A;  1RTZ A;  4X65 F;  1DAR A;  3D54 A;  4EWT A;  1PIL A;  1VRT A;  4ZPC A;  3C16 B;  5H9E J;  2F4F A;  1XJW B;  3IGN A;  3LGN A;  4USM A;  1DQ8 A;  2ACM A;  3NCR A;  2BQU A;  1X4C A;  2V6A A;  3DU5 A;  5U47 A;  4GKK F;  3TEH B;  2HVE A;  2KRB A;  2GVZ B;  2LDI A;  1N5Y B;  4OFZ A;  4CYU A;  2DCU B;  3VQS A;  1FX4 A;  5BYQ A;  1EKS A;  1PBA A;  2IA0 A;  3BKF A;  1NPK A;  4FXD A;  1UVL A;  3Q3Q A;  4CLY A;  5J1N A;  5DM7 Q;  3HHL C;  3K0J A;  4WWS A;  3CDA A;  3TVY A;  5CA5 A;  1NB2 A;  1BMQ B;  1R8A A;  2I5J A;  2BJD A;  4WZM A;  3CDU A;  4B3M J;  2Y9H A;  1U1L A;  1UJ5 A;  5CCL A;  1LK5 A;  2HFU A;  3DHX A;  1H2U X;  1ZAV A;  3CDB A;  4EBC A;  5A76 A;  5ETS A;  2RSQ A;  2CG8 A;  4HTJ A;  3M1V B;  2ZNY A;  3H0P A;  2HYI B;  2CPH A;  3R5C A;  3KLI A;  2BQR A;  1C0T A;  3DCA A;  3SV3 A;  4A8Q A;  1SC4 B;  5LMN F;  3O44 A;  2BV3 A;  4JOU A;  1YJW S;  3JSM B;  4BDP A;  2MKC A;  2C2Z B;  4UUX A;  1VC0 A;  4I67 A;  4IQM A;  2EEY A;  4B9U A;  1IBM F;  2LQ9 A;  2Z4P A;  1AB8 A;  2KT3 A;  2M4M A;  1MRO B;  5G0R B;  1YI2 S;  5EX3 A;  3ZZO A;  3UE2 A;  3T9Z A;  4OYI A;  1LQ9 A;  1RI7 A;  2OIH A;  1U0H B;  4U6P A;  4GKJ F;  2F4V J;  1IKX B;  3B82 A;  4X4P A;  4LRA A;  1HPZ B;  1QAJ A;  1CJK A;  4P7V A;  3I9V 9;  5E2Q A;  3WQP A;  4C0B A;  4TQR A;  4XAK A;  4F4X A;  3PFE A;  4CDI A;  4DR5 F;  3DRY A;  5KG4 A;  5L1I A;  4RBU A;  2JC1 A;  5D4O A;  2KRR A;  1N5T A;  2FVR A;  3AJ1 A;  1R0C B;  3G87 A;  1N32 J;  4NLG A;  1O8B A;  3IG1 A;  1OY9 A;  2PO4 A;  1RWO B;  1S7H A;  4P71 A;  2ZHO A;  2E9T A;  5KAK A;  3GFZ A;  4GTZ A;  4DV4 J;  3DN9 A;  2ALZ A;  4U8Y A;  1VRT B;  3EXC X;  4JI0 J;  4CXS A;  4M8L A;  4E98 A;  3MGJ A;  5IZH A;  2RF2 B;  5GAH I;  1LWF A;  3LGH A;  5I3U A;  1DY3 A;  5IM0 A;  5F0U A;  4BCA A;  1GQE A;  4PAB A;  1FRK A;  3JQJ A;  1N33 F;  3DRR B;  1VR6 A;  4ED3 A;  2HSE B;  1IN0 A;  3P6Y C;  4CYU B;  4DI6 A;  4CLT A;  3MOJ B;  4OHV A;  1C0U A;  1S6P B;  3NNA A;  5IOL A;  4JP8 A;  4IG3 A;  3K57 A;  2BAC A;  4UOF A;  2FC8 A;  1SH2 A;  2LU1 A;  5JVG Q;  4ZP8 A;  3KLH A;  5L9N A;  4OYX A;  4LT6 A;  2ZH4 A;  2UXD F;  3PCO B;  3QO9 B;  2N4C A;  3BGR B;  5LOQ A;  2W5X A;  4DFJ A;  3ZZT A;  3W66 A;  4DR1 F;  1WC3 A;  1QTN B;  1AZS B;  2NUU G;  3QSI A;  2L3M A;  2GA3 A;  4NXN F;  5IC6 B;  1RTI B;  1GFW B;  2N3L A;  2MKI A;  3OL7 A;  4H54 A;  1KHW A;  3PW4 A;  2HNZ A;  3IO1 A;  1YZ7 A;  4YFU A;  1EP4 B;  1HI8 A;  2Y1J A;  2DNK A;  2NXE A;  3TZZ A;  3CC4 S;  5FLX U;  3H25 A;  2HND B;  1U6F A;  4RWW A;  1U26 A;  4ECR A;  4CO2 A;  3GYG A;  1T95 A;  4DMZ A;  4L72 B;  1N0U A;  1VQ5 S;  1S6Q B;  1ALH A;  3D67 A;  2V4R A;  1T03 B;  4PQU A;  4NCG A;  2XMU A;  3R7B B;  2IBO A;  3DRX A;  2CJA A;  2XG8 A;  1CJK B;  2CQ2 A;  3PYD A;  3G6E S;  2DBB A;  3GP9 A;  3CW2 C;  1LWC B;  3OVA A;  1NK8 A;  2ZDO A;  1JXE A;  3CJ0 A;  5KFB A;  1FRJ A;  2C2N A;  1HQU A;  3AOA A;  3ENQ A;  2WVF A;  3SDE B;  1H7X A;  3DDI A;  3M8P B;  1H72 C;  2PSZ A;  2AHO B;  4N5S A;  1R7I A;  3KK3 A;  2V4Q A;  1RA6 A;  4JV2 A;  2Y8Y A;  4FS1 A;  3HXM A;  1RKI A;  1U2F A;  2QZ8 A;  4RNF A;  2J9D E;  8RUC A;  1DTT A;  3PY8 A;  1YJR A;  3ZTS A;  3KXD A;  2HKE A;  3PW5 A;  4ECV A;  1YRT A;  4ECW A;  1G4C A;  3KLV A;  3CMQ A;  4HHU A;  2H4W B;  1RYR A;  3MFH A;  1VJW A;  3J7Y U;  1HHQ A;  2RIJ A;  3BO2 A;  4OYW A;  2UUA J;  4IUF A;  2D1C A;  2YNG B;  4QW9 A;  2EFG A;  3HVW A;  3A12 A;  2QN6 B;  5LT5 A;  1RAA B;  3MR5 A;  3KJV A;  4CLS A;  1TK8 A;  1ZTW A;  2GFF A;  3BDE A;  2ASL A;  1FSU A;  4R0J A;  3KK1 A;  1WI8 A;  2I2Y A;  3LP0 A;  2AP6 A;  4HI1 A;  1MG7 A;  4V19 X;  4RPF A;  3IWN C;  4Y00 A;  4KGV B;  1SL2 A;  4O3N A;  2JHE A; 
#chains in the Genus database with same CATH homology
 3T00 A;  1B8J A;  1E3C P;  3WAY A;  4LR9 A;  5LQQ A;  2W8S A;  5DLW A;  1KH4 A;  3ED4 A;  3M8W A;  2RH6 A;  2W5S A;  1EW9 A;  3M8Z A;  4MHX A;  2W5R A;  1ALI A;  1HJK A;  5K4P A;  4UOR A;  5INH A;  4GTZ A;  2D1G A;  1ANJ A;  1O99 A;  2VQR A;  5TJ3 A;  1KHK A;  3NKM A;  3E2D A;  4QAX A;  4ZG7 A;  1HDH A;  4KAV A;  2GA3 A;  2GSU A;  4LRE A;  2G9Y A;  2W5W A;  3NKR A;  4FDI A;  5AJ9 A;  3IGY B;  4CXS A;  2IUC A;  3UN2 A;  4UPH A;  1ZED A;  3WBH A;  2ZKT A;  3B5Q A;  3LXQ A;  5DLT A;  5GRR A;  2IFY A;  2W5T A;  5EGH A;  3BDF A;  1SHQ A;  4KAY A;  1SHN A;  4KJD A;  5LIA A;  1KHL A;  5IJQ A;  1Y7A A;  2X98 A;  1AJC A;  4FDJ A;  1E1Z P;  1HQA A;  4LR2 A;  5GOV A;  4LRB A;  1E33 P;  4MY4 A;  3CMR A;  4TN0 A;  4B56 A;  4CYS A;  4GTY A;  1O98 A;  1N2L A;  4KM4 A;  4MIV A;  3SZZ A;  4UOO A;  3M7V A;  5EGE A;  4UPI A;  3NVL A;  3MK1 A;  5IJS A;  2XR9 A;  1Y6V A;  4KJG A;  2GSO A;  1P49 A;  2IUC B;  5KXA A;  3M8Y A;  1ED9 A;  4ZG6 A;  4N7T A;  5LRM A;  4CYR A;  5L0B A;  1EQJ A;  3UNY A;  1EW8 A;  4CXK A;  1ALH A;  3NKQ A;  3BDH A;  3TX0 A;  1ELZ A;  1KHJ A;  1EW2 A;  1N2K A;  3NKN A;  5L0K A;  5L0E A;  1K7H A;  4LRF A;  3T01 A;  3UO0 A;  4GTW A;  4UPL A;  3SZY A;  3TWZ A;  3WAX A;  2XRG A;  3OT9 A;  4LRC A;  3IDD A;  1ZEB A;  3A52 A;  3KD8 A;  1ZEF A;  3MK0 A;  4ZGA A;  4GTX A;  3UN5 A;  3Q3Q A;  3UN3 A;  2W8D A;  3IGZ B;  3MK2 A;  4UOP A;  5LRN A;  2W5V A;  4LRA A;  3NKP A;  4LRD A;  1AJD A;  3DPC A;  3BDG A;  3BDG B;  1KHN A;  2GSN A;  3T02 A;  3WAW A;  5HRT A;  2W5Q A;  4CXU A;  5DLV A;  5C66 A;  1EJJ A;  1ELX A;  4LQY A;  1KH7 A;  2GLQ A;  3NKO A;  4NWJ A;  1KH9 A;  2QZU A;  1AJB A;  1AUK A;  1E2S P;  1FSU A;  1URA A;  1KH5 A;  4NWX A;  4UPK A;  4ZG9 A;  3TG0 A;  1ANI A;  2W5X A;  2ANH A;  3WAV A;  4LR7 A;  1ALJ A;  3DYC A;  4YR1 A;  1ALK A;  1EI6 A;  1ELY A;  1URB A;  1ED8 A;  1AJA A;  4LR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...