3M8WA

Phosphopentomutase from bacillus cereus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8wA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8wA01
2IUCA 3SZZA 4UPIA 3M8WA 4LRAA 1ED8A 2W5XA 2X98A 3IGZB 5AJ9A 4UORA 3WAXA 5IJSA 2W8SA 1ALIA 4LQYA 4LRBA 2W5WA 1P49A 1EW9A 3TG0A 1EJJA 1ELZA 1EW8A 4LRFA 1E3CP 2G9YA 4QAXA 1ZEFA 5LQQA 3MK2A 3Q3QA 5HRTA 2XRGA 3KD8A 1N2KA 5LRNA 1ALHA 3NKPA 3T01A 1KHLA 2IFYA 1B8JA 4NWXA 4GTXA 5IJQA 3UNYA 4MIVA 4KAYA 1ZEBA 4UOPA 1KH4A 3WAWA 1AJAA 2GLQA 2W5VA 4LR7A 3BDGA 3UN2A 1ED9A 3OT9A 3UO0A 1KHJA 3TX0A 3SZYA 3M7VA 3M8ZA 2ZKTA 4CXUA 3NKRA 3WAYA 1E2SP 1K7HA 1Y6VA 3BDFA 3DYCA 3BDGB 3UN3A 3IGYB 1ANJA 3NKNA 4B56A 4ZGAA 4CXKA 2W5SA 2IUCB 1KH9A 1HJKA 1URBA 5C66A 1ANIA 3WAVA 4LRDA 2W5QA 4GTWA 2XR9A 1E33P 2VQRA 2W5RA 1SHNA 5L0EA 1ZEDA 1EI6A 4GTYA 4LR8A 4NWJA 1EQJA 3NKQA 5L0KA 3A52A 3TWZA 1E1ZP 4LR9A 1AUKA 2ANHA 3T00A 4ZG9A 3MK1A 5KXAA 3MK0A 4ZG7A 4UPKA 1KH7A 3DPCA 4GTZA 4CXSA 4YR1A 4MHXA 4UOOA 3IDDA 4KJDA 3NKMA 1ELXA 4UPHA 4MY4A 1AJCA 4TN0A 5K4PA 1KHKA 3NKOA 5L0BA 3ED4A 3UN5A 4CYSA 4LREA 1N2LA 3WBHA 1URAA 1AJDA 5EGEA 5LIAA 5GRRA 3NVLA 2GSOA 3BDHA 5TJ3A 2W5TA 5LRMA 2GA3A 3CMRA 3T02A 5DLVA 1EW2A 5INHA 1HDHA 2D1GA 1Y7AA 3E2DA 5DLWA 4LR2A 1ELYA 4KM4A 3M8YA 4FDJA 4KJGA 1ALJA 1HQAA 4N7TA 1ALKA 3B5QA 2RH6A 1AJBA 1O99A 1FSUA 4ZG6A 2W8DA 2GSUA 4LRCA 1KHNA 1O98A 5GOVA 4CYRA 1SHQA 4UPLA 3LXQA 4FDIA 5DLTA 4KAVA 2GSNA 5EGHA 1KH5A 2QZUA
chains in the Genus database with same CATH superfamily
2VJVA 1NSPA 2F5GA 5DZ6A 2M2BA 3N4WA 5LRNA 4GO5X 2CZVC 4I2QB 5THWA 3TJ9A 4CLWA 3D4JA 1M5OC 4X66F 1UZHA 1RTZA 3DLKA 5F9NA 4NLPA 3DM2A 3G87A 4AFFA 4YHHF 3WC2A 4FF2A 4JI6J 2IDEA 4NZ6A 2CJ9A 5H9FJ 3M2RB 1E1ZP 4G1QA 3SQOP 3B6BA 2FVQA 3GU0A 4R8UA 1UZDA 1T05B 3NLCA 5HMYA 4O4GB 2ZM6F 3FSIA 4F3MA 1RCXB 2R8JA 1YRUA 3CJ8A 3QLHA 5IT9U 4ZVOB 1AA1B 1HNZJ 1DTQB 1HQAA 4ZP8A 2XI3A 2J7UA 4YDDB 2AYGA 1MN9A 4PQAA 1FDNA 1NH7A 1C0UA 4UPLA 5HQ8A 2RQ4A 4LFBF 3HD2A 1TFWA 4GVLA 3ZC4A 2OGUA 4LRBA 1S1WA 2VBWA 1QM9A 3N79A 3HT3A 1IBKF 1IKYA 1VHFA 3TZZA 3NBPA 4EZ6A 2K8GA 2XWYA 1FKAF 1I6JA 5KFQA 2WSFC 4IOAQ 3RAQA 1HNVB 2ZWOA 3GJQB 1L3KA 3TNVA 4LUBA 2ZBCA 4M5HA 1KP6A 2R3VA 4WU3A 2V69A 4BC7A 2X51A 4M95A 3A8IA 1HL6A 3BYPA 1NDLA 1RE1B 5KTQA 1CS4A 1Q8IA 5KFBA 1XR7A 5CCLA 1SKRA 4ZPBA 1JLAA 4ZVSB 2FD2A 1Q8KA 2BUNA 1T7PA 2V2ZA 4ANEA 4I6WA 4CT9A 3AQOA 3G4SS 4QQBA 1O99A 3V5RA 5ITHA 1D8ZA 1CC8A 1S7HA 3AT1B 3DRYA 3I56S 5F0UA 1RU2A 2FZKB 4FKXA 1ED8A 1RT6A 3MPDA 1LW0B 5LOQA 5AXKA 2CQ2A 2HNYB 5B08A 5E33A 2B43A 2QYCA 1NM2A 3C14A 1WI8A 2KN4A 4LFCF 4LBIA 3HPOA 2M52A 1U7LA 1R3NA 3MEGA 2QMWA 5L0EA 4JI2J 4ZPDA 2VFVA 4NCAA 4NWJA 2CVEA 3D66A 1LWFB 3KLEB 2HBQB 1PJ6A 5GAHU 1TL1B 4DV6J 4JI8J 2NZCA 1EJ7L 4PXBA 4I7FB 4C0OC 4CO1A 2ZE2B 1LWCA 3BF4A 2HFOA 1PO6A 2J7KA 2EFGA 4D3HA 5G0RA 2KFZA 4C4WA 1UPMB 1FVSA 3FUYA 2E1MC 2OD4A 2B56A 1CJVA 2E5LF 2QSFA 5DDOC 4QWCA 4DL5A 5DLTA 4DS4A 4DV0F 1HWJA 4DV1F 4C97A 1MLAA 2WVCA 1CEZA 2ZDPA 1UW4A 2LECA 2YKPA 3AXMA 1LOUA 2VASA 4A48A 4AD6A 2ALZA 4OLOA 4DS5A 2FLLA 1AJAA 3D6FB 4DMZA 2AZ3A 4ID5B 2NPFA 2I6WA 2PA3A 4KGZB 5JVHQ 5FJ4A 4DZDA 3OPKA 4YMEA 3W7BA 3M8RA 1URBA 4B3TF 2XR9A 3K8WA 2FGCA 2RQMA 1RBLA 2F9JA 3NGKA 2B4OA 3D1HA 2J9CA 1WF2A 4EI2A 2BKPA 2X1BA 4YP3A 1P9YA 4OZ5A 3BPDA 3R3TA 2HGMA 4M8LA 1PYOB 3SSSA 2IAJB 4DV7F 1VGYA 1NK4A 1NDKA 2EC0A 4KO0A 4BLGA 3L3CA 1RTJB 3MAAB 2DT9A 2W25A 1CC7A 4HTJA 1HNWJ 4FVCA 2QA1A 1RT7B 3F56A 1NKEA 2OPSB 2GJ2A 5J2NA 4B3MJ 5BYQA 2ERRA 1RT5A 4A8WA 4PWUA 4LF6J 3HULA 5K8PA 3MAHA 5DZ7A 2VF3A 3B4MA 1VQ9S 1S48A 4ED4A 4U67Q 3R5CA 3ZZOA 4IRCA 2V8VA 3LGNA 4O3OA 2E1RA 3WAVA 2A6MA 4O3RA 3C6UB 1SHNA 3H59A 3C15B 5DQIA 1EQJA 2JX2A 3VAIA 2HG4A 5HK4A 4DPOA 4DHVA 4DUTA 2RDDA 1HWIA 4ELVA 2AQ4A 4U8YA 1KHKA 4B3SF 5KFFA 2XLIA 5HLFB 4EBCA 3WBHA 4X62J 3CCMS 3DMJA 2GSOA 3KLFB 4J9UE 3HSZA 2X7IA 1GMWD 2AHOB 4DF8A 4CH7A 1ICEB 1O8BA 1JQGA 2MQOA 4F7VA 2XYGB 2VOOA 2DGXA 2N82B 1ITPA 1T9UA 2IUCA 3TVKA 3SCJE 2HURA 3ETOA 1ELZA 4JBCA 3MK2A 1KQKA 4WE1A 3RAXA 3GZ7A 2WCXA 3HI9A 5AXMA 4M5DB 5GAGI 3JAMU 4V19J 4I2PB 1UFLA 5L38A 2DNPA 5HJYA 4X64J 2KHDA 4LIWA 4Z7CA 2UV8A 3DLGA 1SCJB 3I0RB 1WTBA 3NKQA 3T9NA 3MMCA 5IT4A 4EO8A 5CD4A 3THTA 3LF0A 1JJHA 1C0TB 5B0AA 1QSYA 5T41A 2DNYA 3W1YC 3UN5A 2ATCB 1S5ZA 4DJBA 1N5YA 2C2DA 1PC4A 1SKWA 3KHHA 4HT7A 4FDJA 2HS0A 3H20A 1SIWB 1GTEA 1MMDA 1SH0A 4QR0A 4X4PA 1SC6A 2BQRA 2CNKB 4JI0J 1QUPA 2BJ3A 1RAHB 1X5OA 3TG0A 1PG5B 2P9EA 1EW9A 4KV8A 2COLA 1WC3A 3Q2SC 3CUNA 1VFJA 2EVZA 5HSPA 4ZVFA 5DS7A 3BM7A 1OPZA 3OR1A 4QYRA 3HX9A 4KJIA 4A47A 4N41A 2D9OA 2QT7A 1KDNA 3ZZZA 1FJGF 4BS2A 3NKNA 3F0NA 1U02A 1S6QB 2BE7D 2DNHA 2FC8A 2YWKA 4C6AA 1FKOB 4RNFA 3LPEA 5RUBA 5DGBA 4B3OA 4AL7A 1HARA 2GQ2A 3BSOA 4C3KA 4DUZF 3NKOA 2MEWA 1XTZA 1NCLA 2HGLA 1AW0A 2CWXA 2GHWA 2VQEJ 3VAFA 1FO1A 4TN2A 3EVWA 4PRFA 3HMJG 4GVBB 2DR8A 1Y7AA 5IQQA 2BMBA 3P49B 4MKYA 3LTOA 3PO4A 1FKPB 1S1XA 4QW9A 5EHHA 2AYBA 4KFBA 1MROA 1RWPB 2B9YA 3MR3A 2Y0BB 2GV1A 2HQGA 2WVDA 2P2CB 4JV2A 3TRGA 2IDLA 1AYEA 2W5WA 3D0GE 5J2MA 3Q8VA 1URNA 3R6LB 3UDEA 4F26A 2KO1A 4A8XA 1C2PA 1RAJA 1SV5B 1YJRA 3GFXA 2BACA 4NLWA 3PM9A 2C2MB 1PKUA 4DV4J 2J6TA 4ZPTR 1ANJA 1Z2LA 5I3UB 3BQ2A 1Q7YT 2E5JA 2ZJPQ 3OL7A 4JI1F 1OY6A 2ZZNA 2GJFA 2IYGA 3D7SB 1ZAWA 3UWTA 1FTRA 3CO9A 3DI6B 2FJBB 1CSJA 4DQPA 3QSYB 1WEZA 4NMLA 4PAAA 4B3RF 2KT3A 4KB7A 2F8MA 2VDIA 1IR1A 2BJ7A 3QO9B 1URAA 4F2RA 3M8QA 2DGVA 2PEBA 3CCWA 1RTHB 1R8PA 4KPCA 1ACMB 1RA7A 3FBEA 1YZ7A 3KG4A 3A13A 2O5DA 2ZH8A 4KE5A 2EW9A 4YUDA 4USMA 2G1DA 3OR2B 4AQYF 1VBXA 1CLFA 3IGZB 4MYTA 1PBUA 1NSAA 4J37A 5LM7E 4EUVA 2YQ3A 3L09A 3MFHA 4K4YA 3G82B 2OLWA 3GIIA 2DPJA 3ZTPA 2E1PA 2ZBRA 1RYSA 3DOKA 2EEYA 1L3TA 4NI2B 3DDKA 1TTHB 4K2JA 3I96A 2ZNZA 2CXEA 2XSFA 4GO7X 3BGLA 3IA0A 3BB5A 4OMFG 2Y1LB 3QBCA 4USHA 2XZWA 4CO5A 1R27B 4OYXA 2FQQB 5A8RB 4GTZA 1U48A 2MQMA 3N6LA 2HK2A 3MD1A 1LWEB 4JV0A 5BR8F 2K1RA 1V9OA 1N5TA 3AH6A 3WX4A 4PWDA 2N4DA 3A4TA 1LQ9A 3OW2R 3TVYA 1NEEA 1YJUA 3OV7A 1BQNA 4OJGA 1C1BB 3HZEA 3FSXA 3RR8A 4DQSA 3FFIB 1HHTP 3ZTRA 2BANA 1K0TA 2IFYA 1PJ7A 5A8KB 3W2WB 4ZIWA 2JVOA 3MEEB 3N6MA 3P5TL 3OUYA 1XMOJ 3OJUA 2VONA 2BV3A 4X4UA 1TR0A 2YPYA 4XPCA 1RTIB 5FIIA 1S4FA 2FHJA 1HQ2A 3U27A 5KFOA 2VC0A 2KTQA 1O5JA 4LR8A 2FB0A 3SYZA 2MKJA 2XB2D 3BSNA 2WB4A 4FKYA 3LP1A 1Y5NB 4WP8A 2B4PA 1KOHA 2HYIB 1TUWA 3QMQA 3G8SA 3GV7B 1WNEA 2GVZA 3DRRA 3ED4A 2Q3PA 4KSEB 3QGPA 3QQCD 3SMZA 4P74A 2KI2A 2A2CA 3C19A 1UETA 4ED7A 5TJ3A 3WC0A 5E5NA 1HBUB 3HZGA 1NLKL 5ETMA 2HQ3A 1HR0F 1R6VA 1RHJB 5IT9Y 1U24A 2OSQA 2RUGA 2F8EX 1WHWA 2K3IA 3W61A 2VHGA 4N56A 4K4ZA 3MPVA 1ELOA 2GA7A 1D3WA 2V67A 1BQXA 3CJ4A 3EGVA 2KG0A 2V6AA 3DU5A 3LALA 1PAEX 1UWBA 3DRXA 2CQCA 1TL7B 2JNJA 2V0NA 5BYSA 4FXWA 3OHAA 4F04B 5GAEI 3MR6A 2HQFA 2XSJA 2R7VA 1E33P 3EXYA 4C8OA 3A52A 2Z58B 3VVTA 1VC0A 5A0YA 2I2YA 3SI8A 2ZH5A 2MLYA 3MMJA 1RT4A 3CDEA 1CJUB 4H4MA 1H3DA 4ECWA 2ZITA 4CYSA 4ZP7A 5LIAA 4CM0A 2C2OB 4OYMA 3HVTA 4WP9A 3LWMA 4FNIA 3OTOF 3HHLA 1X9SA 4ZN1A 3DYAA 5LXRA 3HHLC 3S6EA 2H3EB 2AD9A 1RSCA 2Q79A 4GMKA 3CJKA 3HT0A 1JLBB 2JLGA 2AIRB 2FDNA 2ZUAA 4WCEQ 3KDOA 3CCRS 4PYDA 2A18A 2OD6A 4DUYJ 3PW0A 1UMJA 2WSCC 3Q8YA 1V3ZA 1IBLJ 2PN6A 2RRNA 2KZZA 3BSCA 1KQGB 1FA0A 1MMNA 2R7WA 3G6VA 1FJCA 3CCQS 1S9GA 1YJ7A 4ZHRA 4CXKA 3PW5A 3H5XA 3K57A 4F4ZA 2W5RA 4DLGA 1DAXA 3NS7B 3TWZA 1TK5A 3MM9B 3AJ2A 2RDIA 3C8YA 1FFSB 2DHSA 1OYEA 3CDUA 3VF0B 5HQMA 5K8OA 2YWWA 2UVRA 1KTVA 3K8VA 1S6PB 2KM8B 2XO7A 3RB6A 2GVDA 4DQIA 4ICLA 3TOQA 2J0QD 1Q95G 3AD8C 2YNHA 3EDQB 4RR5A 4UQTA 2PEHA 1KEKA 2QA4S 2QLFB 2XLJA 4EYIB 1L5UA 4C7QA 1U45A 1OYDA 1HNXJ 2X3GA 4C0BA 2XRGA 4YB1P 3TUPA 4TYAA 2DR5A 2CADA 3FSYA 1CVJA 3OSPA 5D3GB 2NCKL 2QMUB 1GEHA 1EB0A 2OPRB 3MFIA 5LXYA 1PILA 1YJWS 3R5AA 2GZOA 3W9HA 1WHVA 2NLWA 1KVKA 4LF2A 4KGMA 3K0JA 1UJ4A 2CPYA 3M2UB 5E7OB 2HAFA 3EGZA 3R2CJ 5E2QA 1E6YB 4ERDA 1QD1A 2L48A 1SBRA 2Z4PA 1U26A 4ECRA 2V63A 2L9DA 2JZ5A 2MJUA 4DWIA 2VBYA 4KM4A 4F67A 3FRZA 2UU9F 2HBRB 3HLUA 1R8AA 2W2NP 4HHJA 1FRLA 4G1QB 1WJ9A 4OI1A 2HHWA 4FF4A 2M5YA 2ZNYA 4MYUA 3EYZA 2IM1A 4R8UB 1CQMA 3T1HJ 1VHIA 4IDKB 1QE1B 2KT2A 4X4VA 5GAHI 3V81B 8AT1B 4FDFA 4WXWA 2LLZA 5CZXA 2E1AA 5GMDA 3IRXB 4L6V3 2XY6A 1IVZA 3X3UA 2ZVSA 4OV6A 5A8WA 1TUVA 2KFNA 3HFVA 2GAHC 1C0UB 1Y6VA 4JI6F 2KHCA 2CYYA 2DGQA 1W7WA 3ZXWA 3DGPA 3FEXB 2VICA 3T1YJ 4MK9A 2ZD1B 3CSKA 3U02A 4NXNJ 2QA2A 3E3XA 3ONQA 2GMJA 1RAAB 3OTDA 3Q8QB 4ZCKA 2UV8G 3TEHB 1TV6B 2IC3B 4QIEA 3R5BA 1N36J 2I0XA 4G6VB 2IVMA 1TL3B 4CLSA 3C6TB 4IFVA 1Q5YA 3FC9A 1RT2B 5B0EA 2BX6A 2GNKA 3Q8PB 3KOAA 1D0EA 2DEJA 1T9YA 1ZM2A 3MDFA 4K5RA 3D0IE 2C42A 2D3O1 1NPRA 5JJBA 2R8HA 4LF8F 1QAJA 1J2VA 3R9LA 2QX0A 2B5JB 2W9CA 1EX8A 1F1BB 3J7Z5 4DG1B 1T94A 3D6MB 1V6HA 1S6OA 1IKVA 3QYYA 4R5PA 3MZIA 4D3GA 2VL1A 3R7SB 4EWTA 2ZJQQ 3SQGA 4RW8B 1S1UB 4CYUB 1KHJA 1WORA 2H5EA 1XMQJ 4GKJJ 3JAMY 2AV5A 1N6QA 4A8MP 1O0PA 4CLTA 1VIXA 2B4VA 1N32J 3PV8A 2OTJS 2YNGB 4RW7B 4G1PA 1KNZA 2I5JB 4DR1J 1PYTA 2DPIA 3C14B 1X4CA 2V9KA 3ITHB 4RJVA 3KWMA 3OTBA 4ZVHA 2J6SA 5KG1A 2ILYA 2LA4A 1TKZA 2P6TA 3LXQA 2GSNA 3CJ0A 2J0XA 3DLBA 2C3OA 1U8WA 3Q86A 1HNIA 1RT1A 4HHUA 4FS1A 4RW6A 1WWHA 4BBYA 3UCUP 1KKHA 4U7CA 2QFJA 2PMWA 4J9LA 2YKOA 4XIUA 5DQHA 1RT3B 2DNMA 2SXLA 1S79A 3UCZP 1AB8A 5D0GA 4ES3A 2CQIA 2RHSB 2MZRA 3AHPA 4Q45A 2HKEA 2YKAA 4H4OB 1N8RT 1FWPA 2D3OR 4JI4J 2DH9A 3KG0A 4C11A 2AGQA 1ZPWX 3T00A 3NAHA 2H4WB 1YTYA 1QAXA 2ZH3A 5JVGQ 2ZHOA 1FRXA 1P27B 1HBNB 2QGFB 5DDRC 2UUAJ 2ATLA 2VG6B 3MM6B 2XCAA 3FQLA 2XZTB 4G1IA 1YJVA 3OXLA 3QRQA 1N0UA 4NA2A 2BE2A 3B82A 2H1YA 3SBMA 5GMEA 3BN7A 3CC7S 2R4FA 2FJVA 2YNFA 4LIRA 4NPOA 1DURA 1KD1T 4J7CA 1N0VC 5J2PB 1X7VA 1JWWA 2KXHA 3W63A 4F50A 1Q86T 2M9KA 1QSLA 2W4DA 3FBCA 4ATNA 4UY85 4OI4A 4NLRA 4KO0B 2XG8A 2HHHF 1RWVB 1H2UX 2JEFA 4IG0B 1WC5A 3PIPQ 3GCXP 3QRRA 4OZ3A 3M6UA 3BN4A 3SCLE 1Y0HA 1SIZA 2HRTA 2E66A 3W66A 3M1VA 1NJZA 4DFJA 2X3DA 2OHDA 3S01A 3JTPA 2HRYA 4URGA 5KT2A 2IY5B 3ZNJ1 2UUCJ 3TX8A 3H90A 3TW0A 1H7XA 3IG1B 3IO1A 4B3MF 3NGUA 4QCLA 2AF6A 2J0WA 4OI0A 4ED0A 4LF6F 4ECYA 3A3OB 4U8VA 4DL6A 5K9FA 2M3DA 3RU0A 2YWGA 3H5UA 2NPIA 3RR7A 1FF2A 4RW9A 4ED8A 2QA4G 4FYWB 4Y2CA 2OEMA 3IS9B 5K14A 2J7WA 2YWFA 2GW8A 3MTJA 2LEBA 5GMKa 5EX3A 2IUCB 4P52A 3IM9A 3D68A 1IKXA 1RBAA 3ELHA 4TY9A 5AE3A 3HHNB 3MR2A 3ZZUA 4JI3J 1DY3A 3OFFA 3LP2A 4OYOA 4YEAA 1EZZB 4Z2XA 2XULA 2BJDA 1ZAXA 3CJ5A 4NASA 2E5IA 1NHVA 4X62F 3UE2A 1U0HB 3CCVS 3PEJA 1TZ0A 2E9TA 2VU5A 2WHOA 4QWEA 1AJDA 4OZLA 1N56A 4UZBA 1TL5A 2DBBA 1NK9A 1KONA 1I94J 4Q8FA 3CEDA 4IQXA 4DX7A 2R2TA 4MKAA 1TKXA 5K5MA 2WB1D 2NREA 4I0WA 4URQU 4C3LA 1EQ0A 2LQJA 2H4YB 2RIJA 3A12A 3M32B 4ECVA 2DJWA 1UVIA 4C8YA 4OLPA 1NB7A 4YN3B 2W4PA 4ZLPA 4DSIA 2M8DB 4Y2AA 4X64F 3BGUA 3FK4A 1VRTA 3EPGA 2VFTA 3CJ3A 3UCGA 3JYTB 4JYAF 3MCNA 2HFNA 5LSLA 1KC8T 1BY9A 4ZPVR 1MMLA 2FVSA 1HQEA 4NA1A 4RWXA 5IM0B 4Y65A 5HATA 5B0CA 1EKSA 5J2QB 3TA2A 1Y5IB 1QJHA 3MM8B 5A76A 2CG8A 4ELTA 5CZVA 3CC2S 3KJQB 1XC9A 3JSYA 3GR1A 3PO5A 2UXDJ 1FTCA 2RS2A 3ZZPA 3BKUA 4LF7J 4NYPA 3A1YG 4JI0F 4WFXA 2GO9A 3TUJC 1DLOB 3W5YA 1UVMA 2OPPB 1X4DA 3OTCA 4UOCA 3SZZA 2LDIA 1DQ9A 3W2VA 2E5GA 4LF5J 4X4OA 2VPZB 4NLXA 3T01A 4KKOB 3UVJB 3POTA 4PZVA 5IV4A 4DL2A 3FCHA 2ZHBA 3GLJA 1Z4UA 2K2PA 4DV2J 3CMES 1S1VB 2BM0A 5KT4A 4QR2A 4HDGA 4EMDA 2IVYA 2DHGA 2D1CA 2R7RA 4Y2KA 1RUSA 2HLUA 2NS1B 4H54A 1H98A 2M88A 4C8KA 1S72S 3V2UC 2RVJA 3CD0A 3N01A 2NSCA 4YR0A 3HJVA 3VTIA 2VQEF 4WJBA 5LMNF 3UD5A 5JUMA 3DFEA 5CABA 2BYCA 5KG6A 2J5AA 2WVBA 2ZUGA 1F9EB 3CCUS 3WIUA 5ETKA 2DXEA 1K0VA 5CAAA 4NLDA 3VR1A 2PMZD 2W2MP 5D8HB 3VGSA 4DPTA 4USKA 4C98A 2GFFA 2MKYA 2ZH2A 3RAMA 1L3UA 3UDLA 2KG1A 3DRSA 4M5MA 3QGHA 2P8IA 2B6AB 2B51A 1IBMJ 1HHSA 4ECUA 1X4BA 4LF9J 3EUNA 2HHTA 2R7XA 2VFRA 3Q3QA 5HRTA 5ETRA 4YS2A 1N33J 1U09A 3UNYA 3ENQA 2W9AA 3TANA 1NNDA 1JXEA 1C1CA 2QC3A 1NZ8A 2V4JB 3ZTOA 4F4YA 3DYCA 3DU6A 4O3SA 3MOJB 4HL9A 1FVQA 1FEEA 1X4GA 2GHVC 3SFGA 3MECB 4O23A 5I42A 2RH3A 2D69A 1QAIA 2EG2A 3SV4A 4ECSA 4ID8A 4DFKA 1UA1A 3MK0A 2YKNA 4X4TA 3IAM9 1BWVA 3JQJA 2XS2A 4X4NA 5L0BA 1X4AA 1VOMA 1QAYA 2E44A 4HH0A 2NXEA 4HT5A 1REVA 3JQKA 4AL5A 6FD1A 4OYAA 3DOKB 4P9SA 4FXDA 5H1SV 2WONB 2XO6A 2MDAA 1WEYA 5EWEA 2XHWA 4ANDA 6AT1B 2GS8A 5EGHA 1B99A 3W9JA 4DSEA 2VA2A 4USUA 1RAGB 2CPFA 2HFZA 2Q6CA 3CXCR 5KFCA 3W8PA 2RILA 1YWXA 4DV5F 2MQNA 4ILLA 1B7FA 4NLYA 2WW8A 3M2VB 3KDNA 4XPEA 1FXDA 2Z2LA 1AZSA 2HIQA 3LP0B 4C2MA 1X0FA 3M9NB 4OZNA 4FF3A 3TQEA 1SJ4P 4WZMA 4YB6A 8ATCB 2NYIA 5KFLA 4DR7F 4DEZA 3MXHP 2CPJA 1SJ1A 2FHKA 3KNGA 2HNZB 3FCWA 4UZCA 4P2MA 3TAPA 4BWMA 4KYZA 3KXDA 4OL8A 3O3LA 2OKQA 4X65F 1CPZA 2L3MA 1M0SA 2LXIA 4IG3A 3CNQP 1HBMB 3KK1B 1YIJS 4F3OA 1A0OB 1TKTB 2CJYB 2ROEA 1TAQA 1T03A 3I0SB 4KJGA 1LEOA 4ETZA 2XQCA 3RW6A 4NOHA 3GYNA 2P9GA 5KFUA 4WFAQ 1X4EA 4CYRA 4OHYA 1MWZA 3QWUA 1RWWB 3PEHA 2AEJA 1BC6A 4PKDB 3DRRB 4BWJA 2E7VA 3HK2A 3D5MA 3BEGB 2HEKA 3CB4A 3TJAA 2JC0A 4F4AA 3OJSA 2E9RX 2MY8A 3SDEA 2ZKTA 3DOMA 4WFYA 5C5JA 4HR2A 3MWBA 1X5TA 1HQUA 2L9NA 4O44B 4R0JA 2L41A 2ASJA 1N54B 3E01B 2HVHA 3BGRA 3PW2A 1N5QA 2F3JA 1G7CB 3G6XA 2F63A 2Z2ZA 3BBFA 2GGPA 2JH3A 4BCAA 1HYSA 5D78A 4RW4B 3GB0A 2CZ9A 1QVFR 3VALA 4Y00A 3EGNA 4HEA9 1UWBB 5F8IA 1HMVA 3RUBL 2ADBA 4ZPCA 1XNRJ 1H7WA 1VLYA 3K5NA 3D28A 4M5KA 1ALJA 3IWLA 1QLNA 3IGVA 4QYZJ 3FCVA 2F40A 3IAS9 3ADAC 5HROA 3NWGA 1HBOB 1QDUB 3FEZA 1S97A 3MR5A 3HVTB 1JNRB 2HK3A 3AB2B 3DYAB 3M8ZA 3ILLA 4Z7YA 3NGRA 3OLBA 3HKZD 4NXMJ 4DR5J 3NNAA 2WBRA 5M2RA 4EU0A 3CCZA 2C1EB 3HD1A 1R7IA 2CRLA 3JSRA 2BEFA 1YBUA 5C66A 2ZH1A 5ETSA 3MGJA 5LMUJ 4X4QA 5ETVA 2HHQA 1V3RA 2PA8D 1JLQA 2J9EA 1JLCA 3M8PA 4TN0A 2QE5A 2C2EA 3KJVB 4XK8C 2HQDA 4L75A 3R6GB 3K2YA 2RH6A 2VG7B 1YG0A 1R0AB 4RKUC 1FERA 5L1JA 4X4RA 1ZBTA 3FBFA 1JLGA 4AT1B 4NZ7A 4UQGA 4DUYF 3UD4P 2G0JA 5T7LB 3OBIA 7AT1B 2AJQA 2C2NA 2MZQA 1U2CA 1IBLF 3GJRB 4LBHA 1AFIA 2RKIB 1MN7A 4JB8B 2CPHA 3MI7X 1IN0A 1JMTA 1V3SA 3L9ZA 3SCKE 4HACB 2ROGA 2G0CA 5EDWA 2UP1A 3N9UC 4ICLB 4A8OA 3PYDA 2CDQA 1TVRA 2MZSA 1MU2A 3AA9A 4MH8A 2HPUA 3HSDA 4GKKJ 5E3QA 3QIDA 4KTQA 2HMIA 1PGZA 4TXSA 3MR7A 2RDJA 4IR1A 2JSXA 2K7JA 5MAOA 2N7CA 3K7RA 2B7CB 1TK0A 3IN5A 3IDDA 2FHOB 1HPZB 1SI9A 2V4QA 4X66J 1I3OB 3R2DJ 1JLEA 3BQ0A 3GQCA 1RWKB 2W1BA 2XMWA 3LAMA 2DIVA 5HVHA 3PW4A 5G4DA 3NY0A 3DDIA 2J6UA 1FD2A 2VPYB 5L1IA 3AOAA 1FE4A 5FLXU 2QLBB 1T02A 2RD5C 4IH5A 1VRUB 3BBCA 5EGYA 2F4VJ 5DLFA 1HNXF 3PYFA 2CIMA 5DETA 4ER8A 4ECZA 2HLTA 2AYMA 1K47A 4DOZA 3DRPB 3T5KA 3GJTB 1KRPA 5LQQA 1D09B 1ZM3A 3P5BP 1TK8A 3LO3A 3THVA 1ED9A 3OT9A 3DOLB 3P3DA 3NNHA 2B7BB 2CJKA 2XBPA 3M2RA 1YKWA 3EGWB 4PG5A 2CQ0A 4RBVA 1Q8BA 2RJZA 2Y8WA 3ILJA 5F3TA 4ZLNA 1ANIA 1T05A 2GC8A 2PO4A 4P7VA 4O4GA 2WAQD 4ECTA 2VD3A 4K4XA 1G6BA 2CQDA 1Q81T 2RRBA 2X1FA 2H9ZA 4K4WA 1KFSA 3HFZB 1X5PA 4CTAB 1DTQA 5DQGA 3MCSA 3A3NB 2YTCA 2XMTA 2LQBA 4NZ0A 3MMAB 1QUVA 2EK1A 1JKHB 4MAKA 4HDHA 3DGPB 2HFSA 1BQMB 3GFZA 4PPZA 3PFEA 1LKZA 4WBFA 2R7SA 3M30B 3NAIA 4EBDA 2DR9A 3HSJA 1UVLA 2X98A 2XNRA 1N48A 1Y11A 1WC1A 2F1FA 1HNVA 4AL6A 1HWKA 3WX8A 1UJ6A 2HBZB 3QAUA 3LGHA 2OH2A 3NCRA 2CPZA 2YX1A 4DQRA 2ZOFA 5GADI 2HHVA 1URRA 3BDGB 4C48A 1YQHA 4MIBA 3BO3A 2W5SA 1MW7A 2PFFB 3WHIA 5C7PA 4NXNF 1K9MT 4LF1A 3IBWA 1IJEB 2UVVA 1KVIA 1IKVB 2PSZA 3TVZA 3MEDB 4K5SA 2CWKA 4OYWA 2LP4A 3ZFVA 3FQKA 1N36F 2DXDA 2BJ9A 3W65A 2ZBIA 4Q43A 5GAEU 1E6VB 2RF2B 4RL1A 5CH7B 4IO9Q 2X1GA 3AJ1A 5K8MA 4EK2A 2XMJA 2MZ1A 2E9ZA 1IWAA 3I4PA 4H4KA 1YRXA 3M8YA 4H4KC 4WK1A 2XGQA 5L1KA 3C16B 1FSUA 5ETTA 1LW0A 1L3SA 1W2BR 2HNYA 4UOFA 2GX8A 1NJWA 4RNHA 1RP5A 1X9WA 1JJCB 2R2UA 1H6KX 4FF1A 2BABA 1U47A 4E2FB 2YVSA 1S12A 1UTAA 4JP8A 5H9EJ 4ZK7M 2J0SD 1XMQF 4OHWA 5HP1B 4GKJF 3R5DA 2FY1A 2ZHAA 2E5LJ 4DV0J 3K58A 2CQ1A 4ZP6A 1LWFA 3KLEA 3ZNUA 2E1CA 3UD3P 2AT1B 3CIZA 3EWGA 1Q16B 1RLDA 1TL1A 3MAQA 1N32F 4I7FA 4GTYA 4Q44A 1RGVA 1RT1B 3KK3B 1IKWB 3I9ZA 1X0PA 4ZP9A 3K17A 4HTIA 4DR1F 2IM0A 2KZMA 1RHQB 4UPHA 2Z0GA 1GAOA 2OSRA 1JB0C 5HBMB 5CYQB 3CVKA 3AD9C 2CQGA 4WU2A 1P8GA 1SJFA 2I1RA 3EX7B 2ASYA 1WI6A 4C11B 4UOHA 3FDSA 4LRCA 1Y7PA 1KHNA 5SZTA 4OZ0A 2I8EA 8RUCA 1F6TA 1B64A 4E0DA 2G2OA 2WVEA 2VPXB 1RTDA 4ID5A 1T9WA 4NLGA 2MY7A 2Q6BA 2DO0A 1MG7A 2QYGA 1U1KA 6FDRA 4JI4F 3IRWP 4JV5J 4CLZA 1BWEA 4P2FA 5F9LA 2V8HA 2RT3A 2AP6A 4FBTA 1LV5A 2H48B 5L0KA 1GTHA 4OX7A 3M8SA 4NE9C 4ES1A 2R9LA 3BPSP 1WOPA 1NK7A 2DY9A 5HJXA 1XR5A 3K5PA 2HHXA 1YBTA 2IAJA 3MCOA 2ZJRQ 4C3MA 2K7KA 2VODA 2Y1RI 1FNOA 4NRTA 1OQ3A 3JSBA 3MAAA 3PHEA 2B9EA 1Q53A 3FZ2A 4IQMA 5M2UA 1RT7A 3WBZA 5KFVA 3MM5B 5EX0A 4LSNA 4XAKA 2OPSA 4TY8B 3PIOQ 4ZLJA 4PQUB 1LXJA 3UQSA 4L3NA 4OIXA 4ILRA 5EUHA 1PSDA 2XMVA 1IXKA 1IQTA 4DPYA 1M5KC 3Q24A 3M1VB 3BR9A 2YNIB 4M5NA 3AOCA 3PR5B 2CZ4A 3E51A 3C6UA 2C3UA 3C15A 1RABB 4U95A 1NK0A 3HVWA 1TU0B 2KU7A 2IIHA 4QIFA 5JMNA 1J5OB 4YB7A 1VS3A 4DFMA 2EK6A 1C4AA 1XQIA 5HLFA 3DHWC 3DPCA 5HQLA 3KLFA 1OO0B 2Y8YA 1QY7A 3OVAA 1VQPS 3H2LA 1SKUB 4ZVPB 5IC6B 1SL2A 5K14B 3R7NB 5CCMA 3VAMA 1HWLA 2DY1A 1XR6A 4F4KA 3CDWA 3D6HB 4WTYA 4ZCLA 2J9DE 4I6YA 1FJEB 3T6JA 5GOVA 2ASDA 1GK8A 1WOOA 4KGKA 2OEKA 4TU9A 1U4BA 3NWRA 4KH0B 4B9UA 3MUMP 2RSQA 4M5DA 2OPQB 3D2WA 4B9LA 3PJ9A 1HD0A 2QN6B 3SXLA 4DR3F 2A1BA 3IMQJ 3I0RA 5HN0A 1RYRA 4DN9A 3QSIA 2EG1A 3QJPA 3IFEA 1NSQA 2HHSA 5H9EK 4QU7A 5AT1B 1GH8A 1U1OA 1C0TA 1BGXT 2GIFA 3KLVA 1LK5A 5H9FK 2BJ1A 1GT8A 3PACA 1HLWA 2QL9B 2FHJD 4ZMMA 3PXGa 4B9SA 4OX9F 3QT7A 4PG6A 2QLWA 1I94F 2BKOA 2XY7A 2CPDA 4L3KA 4YY3F 1S49A 3BH7B 4DDFA 1VBYA 1M1KT 4W98A 5BXIA 2DO4A 5LL6d 5K8NA 2GSUA 1K1QA 1G4CA 3GSDA 5CHCB 2JHEA 1SC4B 5KAKA 1WSVA 1HQEB 2R7OA 4QWBA 4F4XA 3A8EA 4LQYA 4Y28C 2JWNA 2QIFA 4DCJB 3CJTA 2KT5A 3CDAA 1S1TB 1KHLA 2LEAA 2IYIA 2HQIA 2O3DA 2GIQA 1S6QA 2AMCB 4F02A 1ZZFA 1G1XA 3HHKA 2DXFA 2HS4A 2C28A 3G9CA 1FKOA 2V68A 1ZTWA 2ZDOA 4FVMA 5DLGA 2W5QA 4IH7A 4ZN3A 2RE1A 1XIQA 1WACA 5KFIA 2IA6A 3OFGA 3SEOA 4GVBA 2U1AA 4WIQA 3KMSA 3HKWA 3G8QA 1FKPA 5L39A 1VMBA 4K0KJ 2W8LA 4F4WA 4LF7F 2B3TB 3FMWA 1YK9A 4GC7A 4ED5A 1YDLA 3MOZA 4FN5A 4B3RJ 3NGSA 2P9CA 3HHLD 3KLGA 1U25A 3WIVA 5IJSA 2OJ3A 3I5CA 1H72C 3OD2A 1BUXA 2NXNA 4CO3A 4DV2F 1NK6A 3KFWX 2LU2A 1FXRA 3AODA 3AJDA 5I3UA 2VBZA 2YQ0A 4DL7A 4EO6A 2FYXA 5KFHA 3D6TB 2AU0A 1RXOB 3DI6A 2BA9A 1IWGA 3DRSB 1NJYA 1VIOA 2W7AA 2ZOMA 3FGVA 1Y9OA 5L46A 3T5JA 4AXJA 4ZG7A 2B4UA 4CXSA 3DLEB 3Q8SB 2V4RA 3J7ZT 1NRKA 4QWDA 1C1CB 2W7OA 2VH7A 1FHTA 4C8MA 1H74A 1UAWA 4U96A 1NHUA 4K4UA 4M63A 3OR2A 2H51B 2W2OP 4MKBA 4WYLA 4C8NA 1N88A 1IBMF 1K44A 4LF9F 1IUJA 9ATCB 2D3UA 2FC9A 3T41A 1JXLA 3BR8A 1N33F 3SV3A 2YKMA 1PJ5A 1HW9A 4UUXA 2R7QA 3DC2A 4Z37A 3Q89A 3I6PA 2MKIA 2NUUG 1KTQA 1P1TA 1EETB 5C24B 4NI2A 2KVQE 2C3MA 2MQ8A 5B0FA 2GJIA 4UOGA 4DR4F 4KRWA 3A3PB 2BE9B 1FK9B 2BOPA 2CNOB 4FPIA 3I87A 2XHCA 4AE5A 3RW7A 1EARA 1LWEA 3DCAA 4J91A 4P71A 1M5HA 4KH1B 1DHMA 2XNQA 5MLCV 2GO8A 4CCHA 2QFIA 1Q1KA 4A46A 2XMUA 2GCFA 1MNEA 5EWGA 1X4FA 2OUGA 3JTOA 5I4MA 3ILOA 2ACMA 3G8TA 3NG8A 4DR6F 1C1BA 3MUVP 2JC1A 1H73A 3HXMA 3TAQA 3ISNC 5FLXY 3LQVA 3FFIA 4HLBA 1K8AT 1JNZB 5F8GA 4DZ6A 4LRAA 5A8KA 5AJ9A 4YDXA 3W2WA 5KT7A 1FRMA 3UI3A 3MEEA 2BDPA 1CJTB 3KLIB 1PC5A 5FDLA 4N5SA 1S0OA 3Q22A 4JOUA 1FE0A 4P73A 1UCNA 2ZFHA 4MKVA 1RTIA 2V8DA 4WKYA 3FEYB 3DGVA 3CJQA 3P8BB 3VVUA 4RU2A 3MMBA 2EFQA 3SZYA 5J1NA 3NKRA 1UVNA 1B0TA 2CQHA 5KG3A 4NLTA 1RWOB 1ZOTA 4GTWA 3TA1A 3EM1A 5SUHA 3V4IB 3PYGA 2AWZA 2Z2MA 2IM2A 4C0HA 2YWHA 1RAFB 4RX6A 2LQ8A 2ZWPA 2C3PA 3CIMA 1HBUA 3K5OA 3GV8B 2IBKA 4HI2A 3KLHA 4J9KA 2GA3A 5F8LA 1EW2A 1FRHA 4JI5F 3DHXA 4UY8T 3I5BA 4MT1A 5KG4A 1LK7A 1BD6A 2ACYA 1J5EF 2VG5A 2EI5A 3J7AN 3RRKA 2FJDB 4J9RA 3X1LB 1EP4B 1Q5VA 2B9XA 2MQLA 1T9XA 5L8RC 1CJKB 5DDQC 2MGZB 1TL7A 1H2TZ 3BH6B 4DBQA 3KUGA 1OSDA 1K73T 2HNDA 3LH2S 4CQ1A 1B4SA 3GG0A 3MM7A 4TU8A 3VGUA 1RAEB 3CD6S 1ZA1B 3KK2B 2LYVA 4IRKA 3IR5B 1N4LA 3TARA 1AUKA 1HHQA 4DR2J 1ZETA 1TKDA 4TLQA 2FJWA 2V50A 5KG0A 4IOCQ 2QG9B 1XNRF 1RQ0A 5AE1A 3BDHA 1CULA 3K5MA 1KQSR 4A8KA 2CA9A 1JLBA 3V6DB 4ZJLA 1S0NA 3HFKA 3I4HX 4A8FA 2XZDB 4WTOB 2XMKA 2UUBF 1F9HA 3O8WA 2DNGA 3KHLA 3LANA 2IM3A 2MB0B 1YI2S 3GR0A 1X9MA 1JLCB 2N3OA 1ZTTA 2R8GA 2C2KB 4NLSA 2LXUA 4DPUA 4MK7A 1GNKA 2ABYA 2D3ZA 4DSJA 1T3NA 1WTFA 2K06A 1CBKA 4DR5F 2FJXA 1J27A 4Y6IA 3UO0A 4G65A 4NCBA 1VJWA 3P45B 4NLVA 2ZH4A 1E2SP 2AJ2A 3KJNB 1XNQF 4RUHA 5LMUF 3MM9A 3D0HE 4N77A 3JB9k 1YITS 5AJ3F 3D3CJ 7FD1A 3NOCA 5A6WA 1UL3A 3NKMA 1ELXA 2QLJB 3O2IA 1VQNS 1S6PA 1S0MA 2KM8C 4O3NA 3BDEA 5B0GA 5HMZA 3EICA 1S76D 4OX6A 4FYDA 2OO4A 4PG8A 4OYIA 3R5GA 3QFHA 4KAVA 5D4NA 1FFWB 1D9FA 3B4DA 1TL4A 3RRHA 3WAXA 1F9FA 2W8SA 1TQLA 5KFMA 1BE4A 2VA3A 3QIPB 2G4BA 1WHXA 3LOUA 1VQOS 5D3GA 3Q23A 1KN6A 1DQ8A 1N52B 1PYSB 2OPRA 4UOPA 5C25B 2X1AA 2UU9J 3TEGA 5J1PA 4GKKF 2ZH6A 4LF4J 5D0RA 1OS5A 3EDRB 2POKA 2FLOA 2R2RA 3M2UA 4QIWD 4CNZA 1VQ7S 4ZGAA 1NKCA 2QV6A 4MTPA 2W2QP 3O1LA 1Y5LB 5B09A 3CMAS 3HJFA 4TQRA 1O6XA 2DNRA 4USVA 1WF1A 1E6YA 2MSTA 1LFWA 1SL0A 2CJAA 2RS8A 5F8MA 4IFYB 2DKOB 3W9IA 5K4PA 2YX4A 3MTKA 3HO1A 2DHAA 4DN0A 2DCUB 5KFXA 3PY8A 3CJSA 2Z8QA 1KHVA 2WOMB 1DFDA 1KS2A 2F4VF 3GV5B 2N4CA 2ZKUA 1EIYB 4IDKA 3PX6A 2DH7A 1QE1A 2KJWA 3PR4A 3V81A 1KH5A 5KFPA 3NXZA 1BMQB 4ZPWR 2M8HA 3IRXA 1KLNA 2OEJA 1WELA 2CFXA 3NS6A 3HCXA 3O5TB 4PCQA 1U6BA 2GLQA 3QPIA 5HVFA 3FMBA 5KFSA 4KHPF 3FZBA 2AW0A 3J81U 1WC0A 3QNWB 1FJ7A 4LF8J 4DU8A 2ZD1A 4HI1A 3BZQA 4ENOA 3UN3A 3LAKA 1NUEA 4XDCA 1X8DA 3N5FA 1VBZA 3EMTA 2DNKA 1TV6A 2ANHA 4ZG9A 5IT0A 2IC3A 4QPXA 2FUG9 5L9XA 1AFJA 1OPIA 3HVAA 1TL3A 3C6TA 2AX0A 1DARA 3ULHA 1RT2A 2MQQA 3KUHA 4Q0BB 3F41A 2VFSA 1M5VC 5GRRA 3CW2C 4UTGA 1SQEA 1UJ5A 2B0GA 2PFDA 4YB5A 1U1MA 4PWWA 1N34F 2ZEJA 4IUFA 2B5JA 4DG1A 1GQEA 2W8DA 1O98A 3R5JB 3O44A 2JRSA 7FDRA 1VQMS 2OAUA 4LRFA 4RW8A 1S1UA 4CYUA 2YKQA 3U7JA 4U9RA 1YRTA 3C2PA 2CJXB 1WG1A 2LQ5A 4RNOA 4O3PA 4MIVA 1B0VA 3K89A 2E5HA 4X4SA 1V5VA 3G71S 2HVEA 1RWXB 2MKHA 4A8YA 3ZZTA 2KFYA 3ZZ0A 3E8OA 1WSRA 3FJ2A 1N5SA 2YNGA 4RW7A 1WOSA 3DLKB 1P1LA 2EFNA 1RK8A 2I5JA 3DM2B 3ENAA 4ED1A 4YR1A 4NLQA 1YBAA 1F2HA 1Z2ZA 3ITHA 5DO2A 1RHUB 2NR0A 2QJ3A 4LVNP 5F3ZA 1XERA 2W01A 1WEXA 4NL5A 3B5QA 2W4CA 4ZVEA 3QLHB 2QL5B 4TU7A 2V2QA 2MPUA 1VQKS 4TLRA 1M5PC 3Q83A 5DDPC 3E2EA 2V2KA 4TYBA 3HDSA 5KFAA 3U1LA 2JL9A 5LJ3Y 4QAXA 1RT3A 4QWAA 1NH8A 5LJ5Y 4GTXA 2HRUA 4H4OA 2W5VA 4CO4A 1S1WB 4HVZA 1IKYB 3NBPB 2BVZA 3IM8A 1KH9A 4EEYA 1HNZF 1P9QC 4LRDA 3OLAA 5KFWA 4OI3A 1HBNA 2KDOA 4MJKA 2JEJA 1RTDB 4UPKA 1SJQA 1FI4A 1LW2A 2FVRA 2VG6A 3MM6A 2BW2A 3NNCA 2ILZA 3CCJS 4OZ2A 3TZYA 1U8SA 2EBGA 3GWCA 3NP5A 2HHHJ 4LFAJ 1CS4B 3VWSA 4CH1A 1W2IA 2YXLA 3GONA 1JLAB 2AEMA 1DJ0A 3BQ1A 2IJRA 3GFHA 5J2PA 4MIWA 4CDIA 1MSWD 1SVDA 2BKNA 5CA5A 1VK8A 3JSMA 4CP5A 5HANA 1N2KA 4IR9A 3NKYA 4NCGA 4DSFA 4JV1A 1RT6B 4LSLA 3R1LA 4JV5F 4LR7A 1KSPA 3LGMA 4MK8A 4IG0A 4LSNB 1F5BA 3PYEA 4QPTA 2C2RA 4BC9A 1SJ3P 2ZOGA 3CCES 1RU1A 2Z57B 4ZVQB 1U1RA 3VZHA 5IC4B 1RI7A 3MEGB 2XYHB 3P6YC 4M5LA 1FRKA 3IP0A 5KFKA 2VKZG 4B9MA 5HMWA 4LBPA 3J80U 1DRZA 1NMEB 5DLWA 1ELYA 2FVCA 4OJ3A 1ROFA 3IG1A 1QTMA 1LWCB 3Q2TC 4DXLA 3ET6A 1PBAA 2AX1A 3PCOB 2R42A 4L76A 3QATA 3S8SA 5G0RB 3BSAA 2GIRA 3MEKA 3CO0P 2QZUA 4WFNQ 4R25A 1GXTA 2B9WA 3H4DA 1CJVB 3AY0A 4CIOA 1UPPA 3IS9A 3GIJA 4JI2F 2VQFJ 2XTJP 4Y34A 4RNNA 4LSZB 1YZ6A 3F73A 1D9DA 2JLEA 1HWUA 3HHDA 4DV6F 4JI8F 2BM1A 2BQ3A 3G96A 1DTTA 2Z30B 5IWAJ 5DM6Q 4EGLA 1FESA 1VR6A 5IQ6A 5HL7Q 2IHR1 4AXIA 3TUZC 5J1EA 1UVJA 1A7GE 2I9SA 1S77D 1U1PA 2LQ9A 1U0HA 4L74A 2FZCB 2UVWA 5KOXA 1S6UA 5GADU 1D9AA 2QTWA 3PX4A 4KJDA 3DXSX 2MKSA 3K5LA 3MHYA 2XMAA 2HHUA 5CQGA 4F0MA 3NCPA 2FGOA 3TO8A 3GCWP 4JYAJ 4MIAA 2DR7A 4IKAA 1HKAA 4MFBA 1NZAA 1EQMA 2IJFA 4PG4A 2VDHA 3CULA 2FJAB 2KYZA 5KG5A 3D1QA 3M32A 3W8GA 1IJFB 3SSRA 2ZZMA 1T3OA 3UPFA 2YBVA 4I1TA 1B0PA 2FPHX 3UR0A 2PI4A 3BDPA 2P5VA 3C3LA 1ALHA 3JYTA 1GFWB 1FT8A 1CQNA 1KH4A 3G6ES 2QO3A 5J2NB 1RT5B 2JDJA 2C22A 1RACB 2LFVA 1S59A 5IM0A 4CRJA 5J2QA 3OHBA 3B78A 3MM8A 4RBTA 3ZZRA 1VCTA 2YPZA 3RBXA 2MZJA 1HNWF 1JLFA 1YGYA 3EJMA 2XLKA 3VQSA 3VAJA 5DG7A 3QT6A 1DLOA 2WBMA 3TJ8A 2OPPA 3I9V9 4N8NA 1JX4A 3LPYA 2F4FA 2QSWA 4J5OA 4Q5VA 2D41A 4ZG6A 3DMJB 1FWLA 1LNQA 4OI6A 4JI7J 3NMAA 3T1AA 5LMNJ 4KKOA 3UVJA 2MSSA 4RWWA 1PCAA 3BJYA 4F2SA 1S1VA 4V1Ak 2A2DA 4K4VA 1ZM9A 4ZOSA 1IR0A 2J8AA 4J90A 5F41A 1ULRA 2G13A 1W26A 2F9DA 3M7VA 5I3PA 4WE1B 2KH9A 4CXUA 2YH1A 1SUQA 5DJBA 4PXDA 5LSOA 1UWAA 3NS5A 3KLGB 3FKBA 4IYQA 1S0VA 1KOOA 3PW7A 3DLGB 3FNNA 4K0KF 4RU9A 2GMLA 1APSA 4DV3J 3MMCB 3QFWA 9RUBA 3GG1A 4F25A 3ENWA 1M5SA 4EYHB 5LRMA 2IA0A 1WKKA 4PR6A 2FZGB 2PC6A 2M7SA 3DN9A 1MWYA 2B6AA 1ALKA 4RO0A 1N5YB 2HW3A 4ZKAA 5ETOA 3DXBA 4OZ1A 1YJTA 4I68A 2NSBA 4TKTA 1KWMA 2EKYA 2WK4A 4Y2MA 2V4JA 4J9PA 2XY5A 3PRDA 1ZAVA 1Q0NA 4QU6A 2AGOA 2HZCA 4KV8B 1ZYQA 3KHRA 3MECA 5BJRA 3R7BB 2O66A 5E3CA 3WAYA 3H98A 2DNNA 3OR1B 4EFAC 1FRIA 1T95A 2LCWA 4KT0C 1BLUA 3GSIA 4E98A 3OL9A 3G6YA 4LT6A 4XTTA 2XS7A 2YKMB 4DV5J 4L73A 2W9BA 1XK8A 1Q79A 4I64A 4ZCIA 1Q8LA 2WONA 3CE8A 3PRBA 4QIVA 2N3LA 1ZS6A 3BGFA 4W90B 3M05A 4B3OB 4V19X 3CMRA 2JLFA 3T02A 4DCPB 1HDHA 2KXNB 3I55S 4RPFA 4OZJA 4DR7J 3IWXA 1QSSA 2ADCA 4ZIVA 1F5AA 3RB0A 5B0DA 3ZTQA 2OTLS 4A8SA 4X65J 1HIYA 1S1XB 4KFBB 3M2VA 1MROB 1YX2A 3ETMA 5ETNA 3LP0A 3H25A 2YQ1A 2CUYA 3UN2A 3CD5A 4OYPA 5A6PA 3RG6A 1S9EA 5J2MB 3DLHA 3GYXB 1GMUA 1Y00A 4K50A 4OX8A 2AJ0A 2N7YA 2HNZA 5E3PA 1X31C 3TA0A 4OQJA 1OJ4A 2CNLB 3EXCX 3QGGA 1A9NB 3MK1A 5FDLB 1HBMA 4UT4A 3KK1A 3GILA 4MHXA 2JFKA 1R31A 1TKTA 1JJ4A 3I0SA 4CO0A 1H2VZ 1N2LA 3MMBB 1F5CA 4F0HA 3D67A 5ETQA 4J9OA 2R8KA 5INHA 3R27A 1UEUA 2CQ4A 1YLXA 3M8QB 2OELA 4DV4F 2Y1IA 2DNQA 2IRUA 4CLPA 3BREA 1DQAA 1VJQA 1I51B 1RHKB 1KFDA 1XJWB 3EVMA 3FBBA 4CLKA 1CG2A 4ECQA 4IO1A 1YJ9S 5D0HA 1VQ8S 3KLHB 3NKPA 4B9VA 3QRPA 2DR6A 4O44A 2DIUA 1NBEB 5F0WA 1Q78A 2WW4A 4AUKA 3E01A 3BGOP 4NEYA 2P6SA 2IMOA 2VKRA 4B9TA 4I69A 3W62A 1Q7LB 1EKRA 3RBEA 3OVSA 1UEVA 2VG5B 3J81Y 4QOTA 5A2QU 1KLMA 2AJFE 1RZMA 1NXIA 3PFOA 4N76A 1PIEA 1EI6A 4RW4A 3JS9A 1M90T 1GX5A 2CQ3A 3QAEA 4WWSA 3THPA 4WPAA 2OP5A 5C42A 2LDYA 3M6WA 1U2RA 4NYZA 4WKRA 4AYBD 4QJVA 2HS3A 1GMWA 5IZHA 4FXVA 1B7YB 2HNDB 3MURP 3CCSS 2V34A 4WF9Q 3MM7B 2D1GA 3E2DA 3OQ2A 4ZVUB 1OSCA 3R97A 3CC4S 2K1RB 2D7SA 1HBOA 2CVIA 4KHRA 3UR3C 1SHQA 1BHNA 2MLZA 4PWDB 1U0SA 2HVDA 2OFGX 2CG4A 2W5XA 1UA0A 2MQPA 3IGNA 1VC5A 2XWXA 1SPBP 1BQNB 2D9PA 4LJMA 1UFWA 5KT3A 2HIYA 3PVXA 1CULB 4CLFA 3CTRA 1RHRB 3PG9A 4CWBA 2BQUA 1RWNB 2BANB 4E8UA 1SQFA 3PRVA 1R0BG 3VAGA 1WC6A 3OUYB 3PX0A 3RZAA 4DR2F 4DQQA 1WG5A 1RCOB 3KJVA 4QW8A 1RB0A 4KGVB 2DHXA 3EE3A 1WG4A 1Q82T 2YY3A 2VG7A 3LP1B 2UXBJ 1R0AA 1IR2A 4N47A 1RBOB 3RB4A 4ZITA 2GVZB 3N28A 2BJ8A 3QGIA 1FCAA 4RZRA 4XO0A 5T7LA 3A8JA 1F2GA 1XMOF 1YVFA 2H5JB 2MXYA 4N8OA 2L08A 4FDIA 1UP1A 2O67A 4P2SA 2RKIA 2VUGA 2V94A 3KHGA 1ALIA 5LT5A 1VRQC 3Q8UA 2MJNA 2HAIA 2RNEA 4HACA 1M1HA 4ZJOA 3JQMA 5KG2A 4DPWA 2BRLA 3BO4A 1D1UA 3L7PA 3WAWA 2UUTA 4U7UD 2XS5A 2LVWA 2KXFA 2JFDA 2RAQA 2DNOA 2UXCJ 1NDPA 4FP9A 4U6PA 4YOEA 3JXOA 1NDCA 2B8QA 2CAJA 2Z56B 1HPZA 4OHZA 4L72B 5CXTA 1ZEDA 1NJXA 4UF4A 2R2SA 2HZVA 1Y10A 3CJRA 3W3SA 2G2ZA 1IM6A 5JXSA 2XSJB 5KT6A 2ZH9A 5CYMA 4LREA 5T14A 5A0YB 4Q8EA 5EGEA 4KC5A 4CM2A 1RT4B 2FVPA 4FNHA 1VRUA 3QWPA 2Z2YB 1K1SA 4KR0B 2WVFA 1VQ4S 1FNXH 2BBEA 4H4MB 4Q2MA 1Q4RA 2BJEA 1I1GA 2VV5A 3DRPA 1GX6A 3TZXA 1FDDA 5C2GA 5D6GA 3DLLQ 4WXOA 4FZVA 2ASLA 1VQLS 3RGIA 3HHLB 5KFYA 3VAKA 3HP6A 4USIA 3DOLA 2NXJA 4TVAB 2GMHA 1RDRA 4OHVA 4ALZA 1B8JA 3CJKB 2R7UA 4TQSA 2RB7A 1RAOA 4LF4F 2Y0SD 3RYLA 4IRDA 1KBRA 1P6TA 2APOA 4RUCA 4WK3A 3GJSB 1WUUA 5D0EA 3D3BJ 1REGX 2CPEA 1K7HA 5F8JA 2MMYA 4M5GA 2IRYA 3IBFB 3F44A 2Q66A 2AYEA 4CTAA 2HWIA 3N6NA 4J9NA 2XC9A 1NK5A 4WFBQ 1S9GB 3RRGA 1D8YA 2J8SA 4ZHRB 4UOOA 3MMAA 1JKHA 1R43A 4F3QA 4CLYA 2OMLA 5LSRA 4FYVB 2LXFA 4DSKA 1BQMA 1RKIA 3MUTP 3BS9A 3M30A 4K4SA 5IOLA 1LWXA 1WF0A 3J80Y 2OI2A 1VYAA 5ETPA 3BBBA 1VQ6S 2V5HG 3L7UA 4KGXB 4BDPA 2GVDB 2EWHA 2DTJA 4OV1A 3TAMA 3S1TA 3AOBA 2R8IA 1NKBA 4PYAA 4XDDA 1EW8A 4PUOA 1SH2A 2YNHB 2LMIA 1SJRA 4QR1A 5IJQA 1DZ5A 5KFZA 3BDGA 2XCPA 3H7HB 1U6ZA 4QIGA 3TI0A 2HVZA 2IFXA 3R8YA 3SSQA 1S99A 4USJC 4DFPA 3VV2B 5IFMA 3MEDA 1WDDA 1KHWA 3AXKA 1E6VA 5E0OA 2RF2A 4YHHJ 2UVUA 5E41A 2JJ4D 1Z1ZA 1KH7A 4WP3A 4OJHA 1FNMA 3K59A 4Y3CA 4CLUA 1RISA 5KFEA 2DYAA 1HI0P 2PD1A 3C16A 4ZVGA 2A3JA 2ZM6J 2PI5A 4I2QA 3TR5A 2HZAA 3T9ZA 4MMOA 3R1HA 4HH1A 1GXUA 4ZVRB 4I6AA 1A6LA 2CJBA 4KY3A 1H0HB 2BZ2A 2L9WA 4LFBJ 5HP1A 1Y3KA 3EZ5A 4A8QA 3VHQA 1VI7A 1H38A 4ZDNA 2ZH7A 3IC1A 2VJUA 1IBKJ 1U1NA 4RBUA 4A4JA 1NB2A 2A10A 3FVYA 2HHPA 1V5IB 3PKYA 3KK3A 1IKWA 3GMGA 2AEFA 2F7VA 3T3FA 3H5SA 5A8WB 4Y0FA 1T9TA 5HBMA 3MCMA 3PJXA 5CYQA 3GE9A 3OXGA 2GQCA 2DRAA 5AE2A 1AUSL 2F65A 1VQSA 4NA3A 5DG9A 4ED6A 2VC1A 4CLLA 1RLCL 3T1HF 3ZTSA 3DDNA 2QEXS 2O1PA 3PHTA 2F8HA 1RAIB 1R6YA 1SL1A 3A8KA 3RTVA 3CT9A 4OJ1A 4QYZK 3CCLS 3EZUA 3VGTA 4IFVB 4DL4A 3J7YU 1VDHA 1F60B 4WYWA 1LW2B 2RMLA 3QJJA 1IM4A 2EKNA 3VAHA 3T1YF 3JTNA 1EAYC 2VZ9A 2AKWB 3KG1A 2DH8A 2W9CB 4X2BA 3UW1A 1XBWA 1VQ5S 2EC2A 4R5PB 2H5IB 1F3FA 4FYXB 3FRYA 3BDFA 3H40A 4K2XA 4B56A 1VLOA 3SQGB 4CI0B 2VOPA 1FEHA 4S0MA 5L1LA 4CZCA 2PDAA 4LFCJ 2AZ1A 4P6QA 3JSMB 2KKHA 4NCGB 4LSLB 1N6QB 4M5JA 5HO4A 2RQKA 3BYRA 4LFAF 4GRSA 3MM5A 2PIIA 4TY8A 1FWKA 2DGTA 4LR2A 2GAGC 4DU7A 5KFNA 4PQUA 1FX2A 4HHHA 4FYYB 3ISZA 5E3RA 4RUBA 4B9NA 4K8RA 3UDCA 5KOWA 5FD1A 3QZ7A 2RQCA 3IXQA 2QL7B 1NO8A 4Y2IA 3M8WA 4P7TA 5DM7Q 2YNIA 4DV1J 3BKFA 2IVFB 1X4HA 1TKZB 4P72A 2QLXA 3RBZA 5D4PA 3J81j 1JJ2R 1HNIB 2ZE2A 3TX0A 1R8HA 4O4RA 4RW6B 3ET6B 2V8PA 1J5OA 2M70A 1Y3JA 4DX6A 1OIAA 2HFVA 3LW5C 1M1GA 5KT5A 5IXUA 1NU4A 3LUYA 4DL3A 2M4MA 4B3TJ 2IRXA 2G1HA 1VK3A 2ZBPA 1SC1B 3VZIA 5E3AA 4DR3J 3IBCB 2UZAA 3UDVA 2LEPA 1U6FA 3G2XA 2MLXA 2VPWB 1DTTB 2KVIA 4ED2A 4G3IA 2NUHA 2AGPA 2FIUA 5J1EB 2FLNA 5EN1A 1AJBA 3NCQA 2OPQA 1HFEL 1QVGR 4PXCA 4DV7J 2NXUA 2Y9HA 2JEGA 1NPPA 2VQFF 4OX9J 3ISND 3KKFA 2BE2B 1B3TA 2IMWP 3PKMA 5KFTA 1KR4A 2R7TA 4YY3J 4MFBB 1ZEBA 1R89A 5IWAF 2YNFB 2QMXA 1TMJA 1C4CA 4WFZA 3GTYX 4B02A 2Q43A 5BYRA 1NSKL 4DPXA 2KJVA 2UUAF 3U1MA 4PEOA 1ZH5A 2DISA 1HJKA 5D15A 2DHHA 1RTJA 4ZCMA 3Q8RB 3HM9A 4NLOA 2FY8A 5KXAA 4W4MA 3MD3A 3AA8A 1HW8A 4URSA 1UKUA 4PPDA 1ZM4A 4Q2LA 3NVLA 3CJ2A 4M94A 3OVBA 5U47A 2XI2A 4B3SJ 2LA6A 1T0TV 1XMBA 3B8HA 3TP2A 1NHKL 3VCDA 4N7TA 5HVGA 3U1NA 3T5LA 2XGPA 2CPIA 3MPYA 3IR6B 1S1TA 3KYLA 3IWNC 2G0IA 1TP7A 3DLJA 4OFZA 2YX7A 1S4EA 1P49A 1EJJA 2G9YA 1JLFB 3GPAA 2DRBA 1SKSA 4PABA 3CD7A 3D1OA 5CYJA 4UUWA 2HSEB 5KG7A 3NGTA 3SZ2A 2BXJA 4ZPAA 2LU1A 4RW9B 1HA1A 3IGYB 4Q7AA 3WQPA 5B7WA 2DNZA 5EWFA 4IH6A 3OL6A 4YFUA 5A2QY 2PMHA 2UUCF 1IKXB 4J9QA 4UW2A 3NL0A 1AUDA 3TQ1A 2PGCA 3ZZYA 4ELUA 4B08A 5D4OA 3LP2B 2HWHA 4ETXA 4ZVTB 1SUQB 1FRJA 2J76E 4HYKA 4FS2A 3IR7B 2DK2A 2KRRA 5AXLA 4I2PA 4CT8A 4JI7F 1T8EA 3CDBA 3AB4B 2H54B 2E29A 4UPIA 4W92B 2XM3A 3GIMA 5ADZA 1IBCB 1SXLA 1TKXB 4RUAA 3NMRA 4KAIA 3I31A 4JI3F 4M1KA 1G3OA 2W24A 4KBIA 1XWLA 4J9MA 2IBOA 4I56A 4ES2A 2G9OA 3GFYA 2EPIA 1G2EA 1UW9A 2FLPA 4WIIA 5C2CA 1X5SA 1BXNA 1VRTB 3DLEA 1FJGJ 3UNGC 3RBDA 1VC6A 4LR9A 3T5HA 2ZVIA 1KVJA 3LWLA 4DV3F 1FFGB 2W2PP 2H65B 4B17A 1RWMB 3NRBA 3QZ8A 4DR4J 4DUZJ 4FBUA 2VBXA 4TNOA 1T9VA 3PJWA 4KQZA 3SCIE 2EBEA 5KFDA 2UUWA 1SC3B 2XYPB 2EFVA 4OYZA 2OMOA 3PDNA 5D4LA 2W9BB 2IPOB 4ZLLA 2MHNA 2HWTA 1EETA 5C24A 3H5YA 1E3CP 2CNNB 2CJQA 2J9DA 1AROP 3WZ0A 4DR6J 4NWXA 2A6OA 3L7OA 4ZA1A 3W2VB 3V6KA 1FK9A 3V6HA 2XMMA 1IQZA 2Y1JA 2KB2A 1RKJA 4PG7A 1U2FA 3POTB 4J9VA 2WSEC 1VBKA 5F8HA 2W8KA 1R8CA 2JEIA 2GHPA 2CKWA 1SB6A 3Q0AA 2PE8A 2UXDF 3M4XA 2DVIA 2PT0A 4NWBA 3OXFA 4USTA 4DSLA 4JI1J 5DGAA 2DITA 3N5BA 3H4BA 2CQPA 3C46A 4MY4A 1LFPA 3GP9A 1FXLA 1S9EB 4LF5F 2E7WA 5GAGU 2CQBA 5ETLA 1SV5A 4DCOB 1RADB 3DNCA 5KFGA 4OHXA 1HI8A 1CJTA 3SIPB 2WTFA 2EFPA 3KLIA 3KTQA 2VIHA 3W5XA 2YWEA 2ZZTA 3US5A 3M9OB 4UORA 3QT8A 3P96A 1NAQA 4I4BA 1TFYA 4AQYJ 3M6XA 3CWJA 1S9FA 4KAYA 5DG8A 4JI5J 3KUEA 1F3VA 4R0EA 3P4UB 2QZ8A 1Y4ZB 1RHMB 3QO9A 1OMSA 3V4IA 1J5EJ 2V9WA 2B8PA 4YR3A 1YHQS 1RTHA 2LKZA 4K4TA 1UEKA 3S7RA 4C8LA 3CGIA 1ZA2B 2WZ1A 1NK8A 3UFCX 2NZ4A 3OTEA 1MWQA 3T6BA 4LMZA 2DGWA 3AQPA 4LQ3A 1DBDA 4OYBA 5I42B 1U1LA 1W25A 2MTLA 2DGUA 2CDRB 2O01C 2MKKA 2Y3YA 1VISA 5DRKA 2HQCA 2YKNB 2W5TA 2RRAA 4NYOA 2IJNA 3ENVA 3G82A 5BR8J 3L4BC 3NOGA 1YJNS 4DX8H 5F8NA 4U7UK 1KLMB 1JXVA 1I5OB 1REVB 1ZZNA 2E7XA 1EP4A 3TYTA 4M5IA 2MKCA 3GIRA 2DB1A 1CJKA 5C42B 2RU9A 2MGZA 3HF5A 1WC4A 4X84A 4O0NA 4LVOP 4KIAA 4RNMA 4EZ9A 5A8RA 4YR2A 2ZC3A 1S10A 1SH3A 4ITSA 1NPKA 4F36A 3KK2A 4K59A 4IOBA 3I32A 5D77A 5CD4H 1L3VA 3OFHA 4RLEA 2UUBJ 3CMQA 5K20B 4ZJQA 2JVRA 1AZSB 2DNLA 4DL0C 3OSNA 1VQYA 3W64A 3MPUB 4JUZA 4O0IA 4LQ9A 1AJCA 3EZOA 3HSGA 3EVOA 1U49A 3QJLA 3V6DA 1S7IA 1UFKA 1XNQJ 3GYGA 1JK9B 4USWA 2DD8S 4C9DA 4P10A 3V6JA 4IG3B 1GMVA 5IS2A 5AJ3J 3H42A 3I82A 2ROPA 4EBEA 1TELA 1WDTA 2HFUA 5HMXA 1HR0J 2BW7A 2JOQA 1FDAA 4GC6A 3TZWA 1T03B 1RWUA 3O6QA 3KJFB 1RA6A 2VB6A 3G86A 2A0FB 2YH0A 1OWXA 3PNIA 3H2UB 2D74B 2BRKA 4DX5A 4KHMA 3C66A 3N0VA 4ANCA 3PTWA 1WKJA 1TUGB 2DEIA 4KPYA 3OL8A 1OY9A 3PZPA 1SQGA 5KFJA 2DRDA 2U2FA 2VQRA 3SDEB 1WD6A 3DOMB 4BHQA 5B0BA 2M0GB 1HQUB 3GIKA 4OI2A 2FTRA 1AT1B 1PAUB 4CO2A 3MPWA 3BGRB 1XEZA 2UXBF 4F0KA 4ED3A 2AJ1A 5M2PA 3W60A 2HBYB 5AXNA 2C3YA 2WRMA 1NJIT 4QZVB 4ZS6A 4QBUA 4ILMA 2GGPB 1QTNB 4NEZA 1HYSB 1AXQA 3J7A1 2ALYB 3AD7C 2V8GA 3W5ZA 2DGSA 1OQ6A 4PXEA 1HMVB 3QIPA 3OTOJ 2CPXA 3D54A 1RJJA 2NQPA 3TUIC 3EPIA 1O51A 4J9SA 4ECXA 2EFOA 1HI1A 3H2VE 5C25A 4P75A 5L9NA 1S57A 1WKLA 1ZEFA 2G2YA 5CYMB 3HVRA 5GVQA 3MF5A 2UXCF 4DF4A 5HROB 1CJUA 2BOAA 5HAOA 1X60A 4NMXA 3AAWB 2OFHX 2AJ4A 1LXNA 4IFYA 3CF5Q 1XN9A 1FDBA 3CCTA 1N5VA 3ILIA 5HI7A 2WOMA 3NEKA 1U1QA 4KHPJ 3KMQA 2V2VA 2ZBQA 2XEXA 1R8BA 3BO2A 4CH0S 3NGDA 2KL8A 1ZPVA 2HVIA 3CPWR 3VQTA 4NLUA 1JLQB 2KYXA 5DLVA 3M8PB 1FX4A 3VGVA 3RJMB 4NRUA 3QT5A 2RUSA 2Q1LA 4I67A 1T11A 2NXCA 2I38A 2QRRA 3SFUA 2OIHA 4NXMF 3D9BA 2NYHA 2KRBA 5IV3A 5KFRA 4DLEA 5I3QA 1EHWA 1JIHA 3KNAA 3V4MA 3M9MB 2W7PA 3WDOA 1UVKA 3KD8A 1JLGB 2FHMA 1F0XA 3B54A 1N34J 3BKTA 4DI6A 4P2XA 1B70B 4NX9A 2RU3A 1WHYA 3DKDA 1GXLA 2ZC4A 4O3QA 3I5AA 3M6VA 3H0PA 3T19A 2GQQA 2BR0A 3L95X 2MYFA 3AFGA 4FPRA 3TAMB 3LA0A 1TVRB 3J7YI 1MU2B 4PUOB 4Q0BA 4YQWA 4HKQA 2FJEB 3BV8A 2HMIB 1TMMA 2RHQB 1R0CB 2C2ZB 3OFEA 2K3KA 2MZTA 4WZQA 2EXUA 1KQFB 1HD1A 1TAUA 4CNYA 3ZO7A 2MHEA 1YSJA 1JLEB 4K7QA 2VFUA 4F8RA 3ICLA 2DGOA 3RB3A 2DCLA 4C8ZA 3HHEA 2HGNA 1OY8A 1FD8A 3H8YA
chains in the Genus database with same CATH topology
2IUCA 3SZZA 4UPIA 3M8WA 4LRAA 1ED8A 2W5XA 2X98A 3IGZB 5AJ9A 4UORA 3WAXA 5IJSA 2W8SA 1ALIA 4LQYA 4LRBA 2W5WA 1P49A 1EW9A 3TG0A 1EJJA 1ELZA 1EW8A 4LRFA 1E3CP 2G9YA 4QAXA 1ZEFA 5LQQA 3MK2A 3Q3QA 5HRTA 2XRGA 3KD8A 1N2KA 5LRNA 1ALHA 3NKPA 3T01A 1KHLA 2IFYA 1B8JA 4NWXA 4GTXA 5IJQA 3UNYA 4MIVA 4KAYA 1ZEBA 4UOPA 1KH4A 3WAWA 1AJAA 2GLQA 2W5VA 4LR7A 3BDGA 3UN2A 1ED9A 3OT9A 3UO0A 1KHJA 3TX0A 3SZYA 3M7VA 3M8ZA 2ZKTA 4CXUA 3NKRA 3WAYA 1E2SP 1K7HA 1Y6VA 3BDFA 3DYCA 3BDGB 3UN3A 3IGYB 1ANJA 3NKNA 4B56A 4ZGAA 4CXKA 2W5SA 2IUCB 1KH9A 1HJKA 1URBA 5C66A 1ANIA 3WAVA 4LRDA 2W5QA 4GTWA 2XR9A 1E33P 2VQRA 2W5RA 1SHNA 5L0EA 1ZEDA 1EI6A 4GTYA 4LR8A 4NWJA 1EQJA 3NKQA 5L0KA 3A52A 3TWZA 1E1ZP 4LR9A 1AUKA 2ANHA 3T00A 4ZG9A 3MK1A 5KXAA 3MK0A 4ZG7A 4UPKA 1KH7A 3DPCA 4GTZA 4CXSA 4YR1A 4MHXA 4UOOA 3IDDA 4KJDA 3NKMA 1ELXA 4UPHA 4MY4A 1AJCA 4TN0A 5K4PA 1KHKA 3NKOA 5L0BA 3ED4A 3UN5A 4CYSA 4LREA 1N2LA 3WBHA 1URAA 1AJDA 5EGEA 5LIAA 5GRRA 3NVLA 2GSOA 3BDHA 5TJ3A 2W5TA 5LRMA 2GA3A 3CMRA 3T02A 5DLVA 1EW2A 5INHA 1HDHA 2D1GA 1Y7AA 3E2DA 5DLWA 4LR2A 1ELYA 4KM4A 3M8YA 4FDJA 4KJGA 1ALJA 1HQAA 4N7TA 1ALKA 3B5QA 2RH6A 1AJBA 1O99A 1FSUA 4ZG6A 2W8DA 2GSUA 4LRCA 1KHNA 1O98A 5GOVA 4CYRA 1SHQA 4UPLA 3LXQA 4FDIA 5DLTA 4KAVA 2GSNA 5EGHA 1KH5A 2QZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUC A;  3SZZ A;  4UPI A;  3M8W A;  4LRA A;  1ED8 A;  2W5X A;  2X98 A;  3IGZ B;  5AJ9 A;  4UOR A;  3WAX A;  5IJS A;  2W8S A;  1ALI A;  4LQY A;  4LRB A;  2W5W A;  1P49 A;  1EW9 A;  3TG0 A;  1EJJ A;  1ELZ A;  1EW8 A;  4LRF A;  1E3C P;  2G9Y A;  4QAX A;  1ZEF A;  5LQQ A;  3MK2 A;  3Q3Q A;  5HRT A;  2XRG A;  3KD8 A;  1N2K A;  5LRN A;  1ALH A;  3NKP A;  3T01 A;  1KHL A;  2IFY A;  1B8J A;  4NWX A;  4GTX A;  5IJQ A;  3UNY A;  4MIV A;  4KAY A;  1ZEB A;  4UOP A;  1KH4 A;  3WAW A;  1AJA A;  2GLQ A;  2W5V A;  4LR7 A;  3BDG A;  3UN2 A;  1ED9 A;  3OT9 A;  3UO0 A;  1KHJ A;  3TX0 A;  3SZY A;  3M7V A;  3M8Z A;  2ZKT A;  4CXU A;  3NKR A;  3WAY A;  1E2S P;  1K7H A;  1Y6V A;  3BDF A;  3DYC A;  3BDG B;  3UN3 A;  3IGY B;  1ANJ A;  3NKN A;  4B56 A;  4ZGA A;  4CXK A;  2W5S A;  2IUC B;  1KH9 A;  1HJK A;  1URB A;  5C66 A;  1ANI A;  3WAV A;  4LRD A;  2W5Q A;  4GTW A;  2XR9 A;  1E33 P;  2VQR A;  2W5R A;  1SHN A;  5L0E A;  1ZED A;  1EI6 A;  4GTY A;  4LR8 A;  4NWJ A;  1EQJ A;  3NKQ A;  5L0K A;  3A52 A;  3TWZ A;  1E1Z P;  4LR9 A;  1AUK A;  2ANH A;  3T00 A;  4ZG9 A;  3MK1 A;  5KXA A;  3MK0 A;  4ZG7 A;  4UPK A;  1KH7 A;  3DPC A;  4GTZ A;  4CXS A;  4YR1 A;  4MHX A;  4UOO A;  3IDD A;  4KJD A;  3NKM A;  1ELX A;  4UPH A;  4MY4 A;  1AJC A;  4TN0 A;  5K4P A;  1KHK A;  3NKO A;  5L0B A;  3ED4 A;  3UN5 A;  4CYS A;  4LRE A;  1N2L A;  3WBH A;  1URA A;  1AJD A;  5EGE A;  5LIA A;  5GRR A;  3NVL A;  2GSO A;  3BDH A;  5TJ3 A;  2W5T A;  5LRM A;  2GA3 A;  3CMR A;  3T02 A;  5DLV A;  1EW2 A;  5INH A;  1HDH A;  2D1G A;  1Y7A A;  3E2D A;  5DLW A;  4LR2 A;  1ELY A;  4KM4 A;  3M8Y A;  4FDJ A;  4KJG A;  1ALJ A;  1HQA A;  4N7T A;  1ALK A;  3B5Q A;  2RH6 A;  1AJB A;  1O99 A;  1FSU A;  4ZG6 A;  2W8D A;  2GSU A;  4LRC A;  1KHN A;  1O98 A;  5GOV A;  4CYR A;  1SHQ A;  4UPL A;  3LXQ A;  4FDI A;  5DLT A;  4KAV A;  2GSN A;  5EGH A;  1KH5 A;  2QZU A; 
#chains in the Genus database with same CATH topology
 2VJV A;  1NSP A;  2F5G A;  5DZ6 A;  2M2B A;  3N4W A;  5LRN A;  4GO5 X;  2CZV C;  4I2Q B;  5THW A;  3TJ9 A;  4CLW A;  3D4J A;  1M5O C;  4X66 F;  1UZH A;  1RTZ A;  3DLK A;  5F9N A;  4NLP A;  3DM2 A;  3G87 A;  4AFF A;  4YHH F;  3WC2 A;  4FF2 A;  4JI6 J;  2IDE A;  4NZ6 A;  2CJ9 A;  5H9F J;  3M2R B;  1E1Z P;  4G1Q A;  3SQO P;  3B6B A;  2FVQ A;  3GU0 A;  4R8U A;  1UZD A;  1T05 B;  3NLC A;  5HMY A;  4O4G B;  2ZM6 F;  3FSI A;  4F3M A;  1RCX B;  2R8J A;  1YRU A;  3CJ8 A;  3QLH A;  5IT9 U;  4ZVO B;  1AA1 B;  1HNZ J;  1DTQ B;  1HQA A;  4ZP8 A;  2XI3 A;  2J7U A;  4YDD B;  2AYG A;  1MN9 A;  4PQA A;  1FDN A;  1NH7 A;  1C0U A;  4UPL A;  5HQ8 A;  2RQ4 A;  4LFB F;  3HD2 A;  1TFW A;  4GVL A;  3ZC4 A;  2OGU A;  4LRB A;  1S1W A;  2VBW A;  1QM9 A;  3N79 A;  3HT3 A;  1IBK F;  1IKY A;  1VHF A;  3TZZ A;  3NBP A;  4EZ6 A;  2K8G A;  2XWY A;  1FKA F;  1I6J A;  5KFQ A;  2WSF C;  4IOA Q;  3RAQ A;  1HNV B;  2ZWO A;  3GJQ B;  1L3K A;  3TNV A;  4LUB A;  2ZBC A;  4M5H A;  1KP6 A;  2R3V A;  4WU3 A;  2V69 A;  4BC7 A;  2X51 A;  4M95 A;  3A8I A;  1HL6 A;  3BYP A;  1NDL A;  1RE1 B;  5KTQ A;  1CS4 A;  1Q8I A;  5KFB A;  1XR7 A;  5CCL A;  1SKR A;  4ZPB A;  1JLA A;  4ZVS B;  2FD2 A;  1Q8K A;  2BUN A;  1T7P A;  2V2Z A;  4ANE A;  4I6W A;  4CT9 A;  3AQO A;  3G4S S;  4QQB A;  1O99 A;  3V5R A;  5ITH A;  1D8Z A;  1CC8 A;  1S7H A;  3AT1 B;  3DRY A;  3I56 S;  5F0U A;  1RU2 A;  2FZK B;  4FKX A;  1ED8 A;  1RT6 A;  3MPD A;  1LW0 B;  5LOQ A;  5AXK A;  2CQ2 A;  2HNY B;  5B08 A;  5E33 A;  2B43 A;  2QYC A;  1NM2 A;  3C14 A;  1WI8 A;  2KN4 A;  4LFC F;  4LBI A;  3HPO A;  2M52 A;  1U7L A;  1R3N A;  3MEG A;  2QMW A;  5L0E A;  4JI2 J;  4ZPD A;  2VFV A;  4NCA A;  4NWJ A;  2CVE A;  3D66 A;  1LWF B;  3KLE B;  2HBQ B;  1PJ6 A;  5GAH U;  1TL1 B;  4DV6 J;  4JI8 J;  2NZC A;  1EJ7 L;  4PXB A;  4I7F B;  4C0O C;  4CO1 A;  2ZE2 B;  1LWC A;  3BF4 A;  2HFO A;  1PO6 A;  2J7K A;  2EFG A;  4D3H A;  5G0R A;  2KFZ A;  4C4W A;  1UPM B;  1FVS A;  3FUY A;  2E1M C;  2OD4 A;  2B56 A;  1CJV A;  2E5L F;  2QSF A;  5DDO C;  4QWC A;  4DL5 A;  5DLT A;  4DS4 A;  4DV0 F;  1HWJ A;  4DV1 F;  4C97 A;  1MLA A;  2WVC A;  1CEZ A;  2ZDP A;  1UW4 A;  2LEC A;  2YKP A;  3AXM A;  1LOU A;  2VAS A;  4A48 A;  4AD6 A;  2ALZ A;  4OLO A;  4DS5 A;  2FLL A;  1AJA A;  3D6F B;  4DMZ A;  2AZ3 A;  4ID5 B;  2NPF A;  2I6W A;  2PA3 A;  4KGZ B;  5JVH Q;  5FJ4 A;  4DZD A;  3OPK A;  4YME A;  3W7B A;  3M8R A;  1URB A;  4B3T F;  2XR9 A;  3K8W A;  2FGC A;  2RQM A;  1RBL A;  2F9J A;  3NGK A;  2B4O A;  3D1H A;  2J9C A;  1WF2 A;  4EI2 A;  2BKP A;  2X1B A;  4YP3 A;  1P9Y A;  4OZ5 A;  3BPD A;  3R3T A;  2HGM A;  4M8L A;  1PYO B;  3SSS A;  2IAJ B;  4DV7 F;  1VGY A;  1NK4 A;  1NDK A;  2EC0 A;  4KO0 A;  4BLG A;  3L3C A;  1RTJ B;  3MAA B;  2DT9 A;  2W25 A;  1CC7 A;  4HTJ A;  1HNW J;  4FVC A;  2QA1 A;  1RT7 B;  3F56 A;  1NKE A;  2OPS B;  2GJ2 A;  5J2N A;  4B3M J;  5BYQ A;  2ERR A;  1RT5 A;  4A8W A;  4PWU A;  4LF6 J;  3HUL A;  5K8P A;  3MAH A;  5DZ7 A;  2VF3 A;  3B4M A;  1VQ9 S;  1S48 A;  4ED4 A;  4U67 Q;  3R5C A;  3ZZO A;  4IRC A;  2V8V A;  3LGN A;  4O3O A;  2E1R A;  3WAV A;  2A6M A;  4O3R A;  3C6U B;  1SHN A;  3H59 A;  3C15 B;  5DQI A;  1EQJ A;  2JX2 A;  3VAI A;  2HG4 A;  5HK4 A;  4DPO A;  4DHV A;  4DUT A;  2RDD A;  1HWI A;  4ELV A;  2AQ4 A;  4U8Y A;  1KHK A;  4B3S F;  5KFF A;  2XLI A;  5HLF B;  4EBC A;  3WBH A;  4X62 J;  3CCM S;  3DMJ A;  2GSO A;  3KLF B;  4J9U E;  3HSZ A;  2X7I A;  1GMW D;  2AHO B;  4DF8 A;  4CH7 A;  1ICE B;  1O8B A;  1JQG A;  2MQO A;  4F7V A;  2XYG B;  2VOO A;  2DGX A;  2N82 B;  1ITP A;  1T9U A;  2IUC A;  3TVK A;  3SCJ E;  2HUR A;  3ETO A;  1ELZ A;  4JBC A;  3MK2 A;  1KQK A;  4WE1 A;  3RAX A;  3GZ7 A;  2WCX A;  3HI9 A;  5AXM A;  4M5D B;  5GAG I;  3JAM U;  4V19 J;  4I2P B;  1UFL A;  5L38 A;  2DNP A;  5HJY A;  4X64 J;  2KHD A;  4LIW A;  4Z7C A;  2UV8 A;  3DLG A;  1SCJ B;  3I0R B;  1WTB A;  3NKQ A;  3T9N A;  3MMC A;  5IT4 A;  4EO8 A;  5CD4 A;  3THT A;  3LF0 A;  1JJH A;  1C0T B;  5B0A A;  1QSY A;  5T41 A;  2DNY A;  3W1Y C;  3UN5 A;  2ATC B;  1S5Z A;  4DJB A;  1N5Y A;  2C2D A;  1PC4 A;  1SKW A;  3KHH A;  4HT7 A;  4FDJ A;  2HS0 A;  3H20 A;  1SIW B;  1GTE A;  1MMD A;  1SH0 A;  4QR0 A;  4X4P A;  1SC6 A;  2BQR A;  2CNK B;  4JI0 J;  1QUP A;  2BJ3 A;  1RAH B;  1X5O A;  3TG0 A;  1PG5 B;  2P9E A;  1EW9 A;  4KV8 A;  2COL A;  1WC3 A;  3Q2S C;  3CUN A;  1VFJ A;  2EVZ A;  5HSP A;  4ZVF A;  5DS7 A;  3BM7 A;  1OPZ A;  3OR1 A;  4QYR A;  3HX9 A;  4KJI A;  4A47 A;  4N41 A;  2D9O A;  2QT7 A;  1KDN A;  3ZZZ A;  1FJG F;  4BS2 A;  3NKN A;  3F0N A;  1U02 A;  1S6Q B;  2BE7 D;  2DNH A;  2FC8 A;  2YWK A;  4C6A A;  1FKO B;  4RNF A;  3LPE A;  5RUB A;  5DGB A;  4B3O A;  4AL7 A;  1HAR A;  2GQ2 A;  3BSO A;  4C3K A;  4DUZ F;  3NKO A;  2MEW A;  1XTZ A;  1NCL A;  2HGL A;  1AW0 A;  2CWX A;  2GHW A;  2VQE J;  3VAF A;  1FO1 A;  4TN2 A;  3EVW A;  4PRF A;  3HMJ G;  4GVB B;  2DR8 A;  1Y7A A;  5IQQ A;  2BMB A;  3P49 B;  4MKY A;  3LTO A;  3PO4 A;  1FKP B;  1S1X A;  4QW9 A;  5EHH A;  2AYB A;  4KFB A;  1MRO A;  1RWP B;  2B9Y A;  3MR3 A;  2Y0B B;  2GV1 A;  2HQG A;  2WVD A;  2P2C B;  4JV2 A;  3TRG A;  2IDL A;  1AYE A;  2W5W A;  3D0G E;  5J2M A;  3Q8V A;  1URN A;  3R6L B;  3UDE A;  4F26 A;  2KO1 A;  4A8X A;  1C2P A;  1RAJ A;  1SV5 B;  1YJR A;  3GFX A;  2BAC A;  4NLW A;  3PM9 A;  2C2M B;  1PKU A;  4DV4 J;  2J6T A;  4ZPT R;  1ANJ A;  1Z2L A;  5I3U B;  3BQ2 A;  1Q7Y T;  2E5J A;  2ZJP Q;  3OL7 A;  4JI1 F;  1OY6 A;  2ZZN A;  2GJF A;  2IYG A;  3D7S B;  1ZAW A;  3UWT A;  1FTR A;  3CO9 A;  3DI6 B;  2FJB B;  1CSJ A;  4DQP A;  3QSY B;  1WEZ A;  4NML A;  4PAA A;  4B3R F;  2KT3 A;  4KB7 A;  2F8M A;  2VDI A;  1IR1 A;  2BJ7 A;  3QO9 B;  1URA A;  4F2R A;  3M8Q A;  2DGV A;  2PEB A;  3CCW A;  1RTH B;  1R8P A;  4KPC A;  1ACM B;  1RA7 A;  3FBE A;  1YZ7 A;  3KG4 A;  3A13 A;  2O5D A;  2ZH8 A;  4KE5 A;  2EW9 A;  4YUD A;  4USM A;  2G1D A;  3OR2 B;  4AQY F;  1VBX A;  1CLF A;  3IGZ B;  4MYT A;  1PBU A;  1NSA A;  4J37 A;  5LM7 E;  4EUV A;  2YQ3 A;  3L09 A;  3MFH A;  4K4Y A;  3G82 B;  2OLW A;  3GII A;  2DPJ A;  3ZTP A;  2E1P A;  2ZBR A;  1RYS A;  3DOK A;  2EEY A;  1L3T A;  4NI2 B;  3DDK A;  1TTH B;  4K2J A;  3I96 A;  2ZNZ A;  2CXE A;  2XSF A;  4GO7 X;  3BGL A;  3IA0 A;  3BB5 A;  4OMF G;  2Y1L B;  3QBC A;  4USH A;  2XZW A;  4CO5 A;  1R27 B;  4OYX A;  2FQQ B;  5A8R B;  4GTZ A;  1U48 A;  2MQM A;  3N6L A;  2HK2 A;  3MD1 A;  1LWE B;  4JV0 A;  5BR8 F;  2K1R A;  1V9O A;  1N5T A;  3AH6 A;  3WX4 A;  4PWD A;  2N4D A;  3A4T A;  1LQ9 A;  3OW2 R;  3TVY A;  1NEE A;  1YJU A;  3OV7 A;  1BQN A;  4OJG A;  1C1B B;  3HZE A;  3FSX A;  3RR8 A;  4DQS A;  3FFI B;  1HHT P;  3ZTR A;  2BAN A;  1K0T A;  2IFY A;  1PJ7 A;  5A8K B;  3W2W B;  4ZIW A;  2JVO A;  3MEE B;  3N6M A;  3P5T L;  3OUY A;  1XMO J;  3OJU A;  2VON A;  2BV3 A;  4X4U A;  1TR0 A;  2YPY A;  4XPC A;  1RTI B;  5FII A;  1S4F A;  2FHJ A;  1HQ2 A;  3U27 A;  5KFO A;  2VC0 A;  2KTQ A;  1O5J A;  4LR8 A;  2FB0 A;  3SYZ A;  2MKJ A;  2XB2 D;  3BSN A;  2WB4 A;  4FKY A;  3LP1 A;  1Y5N B;  4WP8 A;  2B4P A;  1KOH A;  2HYI B;  1TUW A;  3QMQ A;  3G8S A;  3GV7 B;  1WNE A;  2GVZ A;  3DRR A;  3ED4 A;  2Q3P A;  4KSE B;  3QGP A;  3QQC D;  3SMZ A;  4P74 A;  2KI2 A;  2A2C A;  3C19 A;  1UET A;  4ED7 A;  5TJ3 A;  3WC0 A;  5E5N A;  1HBU B;  3HZG A;  1NLK L;  5ETM A;  2HQ3 A;  1HR0 F;  1R6V A;  1RHJ B;  5IT9 Y;  1U24 A;  2OSQ A;  2RUG A;  2F8E X;  1WHW A;  2K3I A;  3W61 A;  2VHG A;  4N56 A;  4K4Z A;  3MPV A;  1ELO A;  2GA7 A;  1D3W A;  2V67 A;  1BQX A;  3CJ4 A;  3EGV A;  2KG0 A;  2V6A A;  3DU5 A;  3LAL A;  1PAE X;  1UWB A;  3DRX A;  2CQC A;  1TL7 B;  2JNJ A;  2V0N A;  5BYS A;  4FXW A;  3OHA A;  4F04 B;  5GAE I;  3MR6 A;  2HQF A;  2XSJ A;  2R7V A;  1E33 P;  3EXY A;  4C8O A;  3A52 A;  2Z58 B;  3VVT A;  1VC0 A;  5A0Y A;  2I2Y A;  3SI8 A;  2ZH5 A;  2MLY A;  3MMJ A;  1RT4 A;  3CDE A;  1CJU B;  4H4M A;  1H3D A;  4ECW A;  2ZIT A;  4CYS A;  4ZP7 A;  5LIA A;  4CM0 A;  2C2O B;  4OYM A;  3HVT A;  4WP9 A;  3LWM A;  4FNI A;  3OTO F;  3HHL A;  1X9S A;  4ZN1 A;  3DYA A;  5LXR A;  3HHL C;  3S6E A;  2H3E B;  2AD9 A;  1RSC A;  2Q79 A;  4GMK A;  3CJK A;  3HT0 A;  1JLB B;  2JLG A;  2AIR B;  2FDN A;  2ZUA A;  4WCE Q;  3KDO A;  3CCR S;  4PYD A;  2A18 A;  2OD6 A;  4DUY J;  3PW0 A;  1UMJ A;  2WSC C;  3Q8Y A;  1V3Z A;  1IBL J;  2PN6 A;  2RRN A;  2KZZ A;  3BSC A;  1KQG B;  1FA0 A;  1MMN A;  2R7W A;  3G6V A;  1FJC A;  3CCQ S;  1S9G A;  1YJ7 A;  4ZHR A;  4CXK A;  3PW5 A;  3H5X A;  3K57 A;  4F4Z A;  2W5R A;  4DLG A;  1DAX A;  3NS7 B;  3TWZ A;  1TK5 A;  3MM9 B;  3AJ2 A;  2RDI A;  3C8Y A;  1FFS B;  2DHS A;  1OYE A;  3CDU A;  3VF0 B;  5HQM A;  5K8O A;  2YWW A;  2UVR A;  1KTV A;  3K8V A;  1S6P B;  2KM8 B;  2XO7 A;  3RB6 A;  2GVD A;  4DQI A;  4ICL A;  3TOQ A;  2J0Q D;  1Q95 G;  3AD8 C;  2YNH A;  3EDQ B;  4RR5 A;  4UQT A;  2PEH A;  1KEK A;  2QA4 S;  2QLF B;  2XLJ A;  4EYI B;  1L5U A;  4C7Q A;  1U45 A;  1OYD A;  1HNX J;  2X3G A;  4C0B A;  2XRG A;  4YB1 P;  3TUP A;  4TYA A;  2DR5 A;  2CAD A;  3FSY A;  1CVJ A;  3OSP A;  5D3G B;  2NCK L;  2QMU B;  1GEH A;  1EB0 A;  2OPR B;  3MFI A;  5LXY A;  1PIL A;  1YJW S;  3R5A A;  2GZO A;  3W9H A;  1WHV A;  2NLW A;  1KVK A;  4LF2 A;  4KGM A;  3K0J A;  1UJ4 A;  2CPY A;  3M2U B;  5E7O B;  2HAF A;  3EGZ A;  3R2C J;  5E2Q A;  1E6Y B;  4ERD A;  1QD1 A;  2L48 A;  1SBR A;  2Z4P A;  1U26 A;  4ECR A;  2V63 A;  2L9D A;  2JZ5 A;  2MJU A;  4DWI A;  2VBY A;  4KM4 A;  4F67 A;  3FRZ A;  2UU9 F;  2HBR B;  3HLU A;  1R8A A;  2W2N P;  4HHJ A;  1FRL A;  4G1Q B;  1WJ9 A;  4OI1 A;  2HHW A;  4FF4 A;  2M5Y A;  2ZNY A;  4MYU A;  3EYZ A;  2IM1 A;  4R8U B;  1CQM A;  3T1H J;  1VHI A;  4IDK B;  1QE1 B;  2KT2 A;  4X4V A;  5GAH I;  3V81 B;  8AT1 B;  4FDF A;  4WXW A;  2LLZ A;  5CZX A;  2E1A A;  5GMD A;  3IRX B;  4L6V 3;  2XY6 A;  1IVZ A;  3X3U A;  2ZVS A;  4OV6 A;  5A8W A;  1TUV A;  2KFN A;  3HFV A;  2GAH C;  1C0U B;  1Y6V A;  4JI6 F;  2KHC A;  2CYY A;  2DGQ A;  1W7W A;  3ZXW A;  3DGP A;  3FEX B;  2VIC A;  3T1Y J;  4MK9 A;  2ZD1 B;  3CSK A;  3U02 A;  4NXN J;  2QA2 A;  3E3X A;  3ONQ A;  2GMJ A;  1RAA B;  3OTD A;  3Q8Q B;  4ZCK A;  2UV8 G;  3TEH B;  1TV6 B;  2IC3 B;  4QIE A;  3R5B A;  1N36 J;  2I0X A;  4G6V B;  2IVM A;  1TL3 B;  4CLS A;  3C6T B;  4IFV A;  1Q5Y A;  3FC9 A;  1RT2 B;  5B0E A;  2BX6 A;  2GNK A;  3Q8P B;  3KOA A;  1D0E A;  2DEJ A;  1T9Y A;  1ZM2 A;  3MDF A;  4K5R A;  3D0I E;  2C42 A;  2D3O 1;  1NPR A;  5JJB A;  2R8H A;  4LF8 F;  1QAJ A;  1J2V A;  3R9L A;  2QX0 A;  2B5J B;  2W9C A;  1EX8 A;  1F1B B;  3J7Z 5;  4DG1 B;  1T94 A;  3D6M B;  1V6H A;  1S6O A;  1IKV A;  3QYY A;  4R5P A;  3MZI A;  4D3G A;  2VL1 A;  3R7S B;  4EWT A;  2ZJQ Q;  3SQG A;  4RW8 B;  1S1U B;  4CYU B;  1KHJ A;  1WOR A;  2H5E A;  1XMQ J;  4GKJ J;  3JAM Y;  2AV5 A;  1N6Q A;  4A8M P;  1O0P A;  4CLT A;  1VIX A;  2B4V A;  1N32 J;  3PV8 A;  2OTJ S;  2YNG B;  4RW7 B;  4G1P A;  1KNZ A;  2I5J B;  4DR1 J;  1PYT A;  2DPI A;  3C14 B;  1X4C A;  2V9K A;  3ITH B;  4RJV A;  3KWM A;  3OTB A;  4ZVH A;  2J6S A;  5KG1 A;  2ILY A;  2LA4 A;  1TKZ A;  2P6T A;  3LXQ A;  2GSN A;  3CJ0 A;  2J0X A;  3DLB A;  2C3O A;  1U8W A;  3Q86 A;  1HNI A;  1RT1 A;  4HHU A;  4FS1 A;  4RW6 A;  1WWH A;  4BBY A;  3UCU P;  1KKH A;  4U7C A;  2QFJ A;  2PMW A;  4J9L A;  2YKO A;  4XIU A;  5DQH A;  1RT3 B;  2DNM A;  2SXL A;  1S79 A;  3UCZ P;  1AB8 A;  5D0G A;  4ES3 A;  2CQI A;  2RHS B;  2MZR A;  3AHP A;  4Q45 A;  2HKE A;  2YKA A;  4H4O B;  1N8R T;  1FWP A;  2D3O R;  4JI4 J;  2DH9 A;  3KG0 A;  4C11 A;  2AGQ A;  1ZPW X;  3T00 A;  3NAH A;  2H4W B;  1YTY A;  1QAX A;  2ZH3 A;  5JVG Q;  2ZHO A;  1FRX A;  1P27 B;  1HBN B;  2QGF B;  5DDR C;  2UUA J;  2ATL A;  2VG6 B;  3MM6 B;  2XCA A;  3FQL A;  2XZT B;  4G1I A;  1YJV A;  3OXL A;  3QRQ A;  1N0U A;  4NA2 A;  2BE2 A;  3B82 A;  2H1Y A;  3SBM A;  5GME A;  3BN7 A;  3CC7 S;  2R4F A;  2FJV A;  2YNF A;  4LIR A;  4NPO A;  1DUR A;  1KD1 T;  4J7C A;  1N0V C;  5J2P B;  1X7V A;  1JWW A;  2KXH A;  3W63 A;  4F50 A;  1Q86 T;  2M9K A;  1QSL A;  2W4D A;  3FBC A;  4ATN A;  4UY8 5;  4OI4 A;  4NLR A;  4KO0 B;  2XG8 A;  2HHH F;  1RWV B;  1H2U X;  2JEF A;  4IG0 B;  1WC5 A;  3PIP Q;  3GCX P;  3QRR A;  4OZ3 A;  3M6U A;  3BN4 A;  3SCL E;  1Y0H A;  1SIZ A;  2HRT A;  2E66 A;  3W66 A;  3M1V A;  1NJZ A;  4DFJ A;  2X3D A;  2OHD A;  3S01 A;  3JTP A;  2HRY A;  4URG A;  5KT2 A;  2IY5 B;  3ZNJ 1;  2UUC J;  3TX8 A;  3H90 A;  3TW0 A;  1H7X A;  3IG1 B;  3IO1 A;  4B3M F;  3NGU A;  4QCL A;  2AF6 A;  2J0W A;  4OI0 A;  4ED0 A;  4LF6 F;  4ECY A;  3A3O B;  4U8V A;  4DL6 A;  5K9F A;  2M3D A;  3RU0 A;  2YWG A;  3H5U A;  2NPI A;  3RR7 A;  1FF2 A;  4RW9 A;  4ED8 A;  2QA4 G;  4FYW B;  4Y2C A;  2OEM A;  3IS9 B;  5K14 A;  2J7W A;  2YWF A;  2GW8 A;  3MTJ A;  2LEB A;  5GMK a;  5EX3 A;  2IUC B;  4P52 A;  3IM9 A;  3D68 A;  1IKX A;  1RBA A;  3ELH A;  4TY9 A;  5AE3 A;  3HHN B;  3MR2 A;  3ZZU A;  4JI3 J;  1DY3 A;  3OFF A;  3LP2 A;  4OYO A;  4YEA A;  1EZZ B;  4Z2X A;  2XUL A;  2BJD A;  1ZAX A;  3CJ5 A;  4NAS A;  2E5I A;  1NHV A;  4X62 F;  3UE2 A;  1U0H B;  3CCV S;  3PEJ A;  1TZ0 A;  2E9T A;  2VU5 A;  2WHO A;  4QWE A;  1AJD A;  4OZL A;  1N56 A;  4UZB A;  1TL5 A;  2DBB A;  1NK9 A;  1KON A;  1I94 J;  4Q8F A;  3CED A;  4IQX A;  4DX7 A;  2R2T A;  4MKA A;  1TKX A;  5K5M A;  2WB1 D;  2NRE A;  4I0W A;  4URQ U;  4C3L A;  1EQ0 A;  2LQJ A;  2H4Y B;  2RIJ A;  3A12 A;  3M32 B;  4ECV A;  2DJW A;  1UVI A;  4C8Y A;  4OLP A;  1NB7 A;  4YN3 B;  2W4P A;  4ZLP A;  4DSI A;  2M8D B;  4Y2A A;  4X64 F;  3BGU A;  3FK4 A;  1VRT A;  3EPG A;  2VFT A;  3CJ3 A;  3UCG A;  3JYT B;  4JYA F;  3MCN A;  2HFN A;  5LSL A;  1KC8 T;  1BY9 A;  4ZPV R;  1MML A;  2FVS A;  1HQE A;  4NA1 A;  4RWX A;  5IM0 B;  4Y65 A;  5HAT A;  5B0C A;  1EKS A;  5J2Q B;  3TA2 A;  1Y5I B;  1QJH A;  3MM8 B;  5A76 A;  2CG8 A;  4ELT A;  5CZV A;  3CC2 S;  3KJQ B;  1XC9 A;  3JSY A;  3GR1 A;  3PO5 A;  2UXD J;  1FTC A;  2RS2 A;  3ZZP A;  3BKU A;  4LF7 J;  4NYP A;  3A1Y G;  4JI0 F;  4WFX A;  2GO9 A;  3TUJ C;  1DLO B;  3W5Y A;  1UVM A;  2OPP B;  1X4D A;  3OTC A;  4UOC A;  3SZZ A;  2LDI A;  1DQ9 A;  3W2V A;  2E5G A;  4LF5 J;  4X4O A;  2VPZ B;  4NLX A;  3T01 A;  4KKO B;  3UVJ B;  3POT A;  4PZV A;  5IV4 A;  4DL2 A;  3FCH A;  2ZHB A;  3GLJ A;  1Z4U A;  2K2P A;  4DV2 J;  3CME S;  1S1V B;  2BM0 A;  5KT4 A;  4QR2 A;  4HDG A;  4EMD A;  2IVY A;  2DHG A;  2D1C A;  2R7R A;  4Y2K A;  1RUS A;  2HLU A;  2NS1 B;  4H54 A;  1H98 A;  2M88 A;  4C8K A;  1S72 S;  3V2U C;  2RVJ A;  3CD0 A;  3N01 A;  2NSC A;  4YR0 A;  3HJV A;  3VTI A;  2VQE F;  4WJB A;  5LMN F;  3UD5 A;  5JUM A;  3DFE A;  5CAB A;  2BYC A;  5KG6 A;  2J5A A;  2WVB A;  2ZUG A;  1F9E B;  3CCU S;  3WIU A;  5ETK A;  2DXE A;  1K0V A;  5CAA A;  4NLD A;  3VR1 A;  2PMZ D;  2W2M P;  5D8H B;  3VGS A;  4DPT A;  4USK A;  4C98 A;  2GFF A;  2MKY A;  2ZH2 A;  3RAM A;  1L3U A;  3UDL A;  2KG1 A;  3DRS A;  4M5M A;  3QGH A;  2P8I A;  2B6A B;  2B51 A;  1IBM J;  1HHS A;  4ECU A;  1X4B A;  4LF9 J;  3EUN A;  2HHT A;  2R7X A;  2VFR A;  3Q3Q A;  5HRT A;  5ETR A;  4YS2 A;  1N33 J;  1U09 A;  3UNY A;  3ENQ A;  2W9A A;  3TAN A;  1NND A;  1JXE A;  1C1C A;  2QC3 A;  1NZ8 A;  2V4J B;  3ZTO A;  4F4Y A;  3DYC A;  3DU6 A;  4O3S A;  3MOJ B;  4HL9 A;  1FVQ A;  1FEE A;  1X4G A;  2GHV C;  3SFG A;  3MEC B;  4O23 A;  5I42 A;  2RH3 A;  2D69 A;  1QAI A;  2EG2 A;  3SV4 A;  4ECS A;  4ID8 A;  4DFK A;  1UA1 A;  3MK0 A;  2YKN A;  4X4T A;  3IAM 9;  1BWV A;  3JQJ A;  2XS2 A;  4X4N A;  5L0B A;  1X4A A;  1VOM A;  1QAY A;  2E44 A;  4HH0 A;  2NXE A;  4HT5 A;  1REV A;  3JQK A;  4AL5 A;  6FD1 A;  4OYA A;  3DOK B;  4P9S A;  4FXD A;  5H1S V;  2WON B;  2XO6 A;  2MDA A;  1WEY A;  5EWE A;  2XHW A;  4AND A;  6AT1 B;  2GS8 A;  5EGH A;  1B99 A;  3W9J A;  4DSE A;  2VA2 A;  4USU A;  1RAG B;  2CPF A;  2HFZ A;  2Q6C A;  3CXC R;  5KFC A;  3W8P A;  2RIL A;  1YWX A;  4DV5 F;  2MQN A;  4ILL A;  1B7F A;  4NLY A;  2WW8 A;  3M2V B;  3KDN A;  4XPE A;  1FXD A;  2Z2L A;  1AZS A;  2HIQ A;  3LP0 B;  4C2M A;  1X0F A;  3M9N B;  4OZN A;  4FF3 A;  3TQE A;  1SJ4 P;  4WZM A;  4YB6 A;  8ATC B;  2NYI A;  5KFL A;  4DR7 F;  4DEZ A;  3MXH P;  2CPJ A;  1SJ1 A;  2FHK A;  3KNG A;  2HNZ B;  3FCW A;  4UZC A;  4P2M A;  3TAP A;  4BWM A;  4KYZ A;  3KXD A;  4OL8 A;  3O3L A;  2OKQ A;  4X65 F;  1CPZ A;  2L3M A;  1M0S A;  2LXI A;  4IG3 A;  3CNQ P;  1HBM B;  3KK1 B;  1YIJ S;  4F3O A;  1A0O B;  1TKT B;  2CJY B;  2ROE A;  1TAQ A;  1T03 A;  3I0S B;  4KJG A;  1LEO A;  4ETZ A;  2XQC A;  3RW6 A;  4NOH A;  3GYN A;  2P9G A;  5KFU A;  4WFA Q;  1X4E A;  4CYR A;  4OHY A;  1MWZ A;  3QWU A;  1RWW B;  3PEH A;  2AEJ A;  1BC6 A;  4PKD B;  3DRR B;  4BWJ A;  2E7V A;  3HK2 A;  3D5M A;  3BEG B;  2HEK A;  3CB4 A;  3TJA A;  2JC0 A;  4F4A A;  3OJS A;  2E9R X;  2MY8 A;  3SDE A;  2ZKT A;  3DOM A;  4WFY A;  5C5J A;  4HR2 A;  3MWB A;  1X5T A;  1HQU A;  2L9N A;  4O44 B;  4R0J A;  2L41 A;  2ASJ A;  1N54 B;  3E01 B;  2HVH A;  3BGR A;  3PW2 A;  1N5Q A;  2F3J A;  1G7C B;  3G6X A;  2F63 A;  2Z2Z A;  3BBF A;  2GGP A;  2JH3 A;  4BCA A;  1HYS A;  5D78 A;  4RW4 B;  3GB0 A;  2CZ9 A;  1QVF R;  3VAL A;  4Y00 A;  3EGN A;  4HEA 9;  1UWB B;  5F8I A;  1HMV A;  3RUB L;  2ADB A;  4ZPC A;  1XNR J;  1H7W A;  1VLY A;  3K5N A;  3D28 A;  4M5K A;  1ALJ A;  3IWL A;  1QLN A;  3IGV A;  4QYZ J;  3FCV A;  2F40 A;  3IAS 9;  3ADA C;  5HRO A;  3NWG A;  1HBO B;  1QDU B;  3FEZ A;  1S97 A;  3MR5 A;  3HVT B;  1JNR B;  2HK3 A;  3AB2 B;  3DYA B;  3M8Z A;  3ILL A;  4Z7Y A;  3NGR A;  3OLB A;  3HKZ D;  4NXM J;  4DR5 J;  3NNA A;  2WBR A;  5M2R A;  4EU0 A;  3CCZ A;  2C1E B;  3HD1 A;  1R7I A;  2CRL A;  3JSR A;  2BEF A;  1YBU A;  5C66 A;  2ZH1 A;  5ETS A;  3MGJ A;  5LMU J;  4X4Q A;  5ETV A;  2HHQ A;  1V3R A;  2PA8 D;  1JLQ A;  2J9E A;  1JLC A;  3M8P A;  4TN0 A;  2QE5 A;  2C2E A;  3KJV B;  4XK8 C;  2HQD A;  4L75 A;  3R6G B;  3K2Y A;  2RH6 A;  2VG7 B;  1YG0 A;  1R0A B;  4RKU C;  1FER A;  5L1J A;  4X4R A;  1ZBT A;  3FBF A;  1JLG A;  4AT1 B;  4NZ7 A;  4UQG A;  4DUY F;  3UD4 P;  2G0J A;  5T7L B;  3OBI A;  7AT1 B;  2AJQ A;  2C2N A;  2MZQ A;  1U2C A;  1IBL F;  3GJR B;  4LBH A;  1AFI A;  2RKI B;  1MN7 A;  4JB8 B;  2CPH A;  3MI7 X;  1IN0 A;  1JMT A;  1V3S A;  3L9Z A;  3SCK E;  4HAC B;  2ROG A;  2G0C A;  5EDW A;  2UP1 A;  3N9U C;  4ICL B;  4A8O A;  3PYD A;  2CDQ A;  1TVR A;  2MZS A;  1MU2 A;  3AA9 A;  4MH8 A;  2HPU A;  3HSD A;  4GKK J;  5E3Q A;  3QID A;  4KTQ A;  2HMI A;  1PGZ A;  4TXS A;  3MR7 A;  2RDJ A;  4IR1 A;  2JSX A;  2K7J A;  5MAO A;  2N7C A;  3K7R A;  2B7C B;  1TK0 A;  3IN5 A;  3IDD A;  2FHO B;  1HPZ B;  1SI9 A;  2V4Q A;  4X66 J;  1I3O B;  3R2D J;  1JLE A;  3BQ0 A;  3GQC A;  1RWK B;  2W1B A;  2XMW A;  3LAM A;  2DIV A;  5HVH A;  3PW4 A;  5G4D A;  3NY0 A;  3DDI A;  2J6U A;  1FD2 A;  2VPY B;  5L1I A;  3AOA A;  1FE4 A;  5FLX U;  2QLB B;  1T02 A;  2RD5 C;  4IH5 A;  1VRU B;  3BBC A;  5EGY A;  2F4V J;  5DLF A;  1HNX F;  3PYF A;  2CIM A;  5DET A;  4ER8 A;  4ECZ A;  2HLT A;  2AYM A;  1K47 A;  4DOZ A;  3DRP B;  3T5K A;  3GJT B;  1KRP A;  5LQQ A;  1D09 B;  1ZM3 A;  3P5B P;  1TK8 A;  3LO3 A;  3THV A;  1ED9 A;  3OT9 A;  3DOL B;  3P3D A;  3NNH A;  2B7B B;  2CJK A;  2XBP A;  3M2R A;  1YKW A;  3EGW B;  4PG5 A;  2CQ0 A;  4RBV A;  1Q8B A;  2RJZ A;  2Y8W A;  3ILJ A;  5F3T A;  4ZLN A;  1ANI A;  1T05 A;  2GC8 A;  2PO4 A;  4P7V A;  4O4G A;  2WAQ D;  4ECT A;  2VD3 A;  4K4X A;  1G6B A;  2CQD A;  1Q81 T;  2RRB A;  2X1F A;  2H9Z A;  4K4W A;  1KFS A;  3HFZ B;  1X5P A;  4CTA B;  1DTQ A;  5DQG A;  3MCS A;  3A3N B;  2YTC A;  2XMT A;  2LQB A;  4NZ0 A;  3MMA B;  1QUV A;  2EK1 A;  1JKH B;  4MAK A;  4HDH A;  3DGP B;  2HFS A;  1BQM B;  3GFZ A;  4PPZ A;  3PFE A;  1LKZ A;  4WBF A;  2R7S A;  3M30 B;  3NAI A;  4EBD A;  2DR9 A;  3HSJ A;  1UVL A;  2X98 A;  2XNR A;  1N48 A;  1Y11 A;  1WC1 A;  2F1F A;  1HNV A;  4AL6 A;  1HWK A;  3WX8 A;  1UJ6 A;  2HBZ B;  3QAU A;  3LGH A;  2OH2 A;  3NCR A;  2CPZ A;  2YX1 A;  4DQR A;  2ZOF A;  5GAD I;  2HHV A;  1URR A;  3BDG B;  4C48 A;  1YQH A;  4MIB A;  3BO3 A;  2W5S A;  1MW7 A;  2PFF B;  3WHI A;  5C7P A;  4NXN F;  1K9M T;  4LF1 A;  3IBW A;  1IJE B;  2UVV A;  1KVI A;  1IKV B;  2PSZ A;  3TVZ A;  3MED B;  4K5S A;  2CWK A;  4OYW A;  2LP4 A;  3ZFV A;  3FQK A;  1N36 F;  2DXD A;  2BJ9 A;  3W65 A;  2ZBI A;  4Q43 A;  5GAE U;  1E6V B;  2RF2 B;  4RL1 A;  5CH7 B;  4IO9 Q;  2X1G A;  3AJ1 A;  5K8M A;  4EK2 A;  2XMJ A;  2MZ1 A;  2E9Z A;  1IWA A;  3I4P A;  4H4K A;  1YRX A;  3M8Y A;  4H4K C;  4WK1 A;  2XGQ A;  5L1K A;  3C16 B;  1FSU A;  5ETT A;  1LW0 A;  1L3S A;  1W2B R;  2HNY A;  4UOF A;  2GX8 A;  1NJW A;  4RNH A;  1RP5 A;  1X9W A;  1JJC B;  2R2U A;  1H6K X;  4FF1 A;  2BAB A;  1U47 A;  4E2F B;  2YVS A;  1S12 A;  1UTA A;  4JP8 A;  5H9E J;  4ZK7 M;  2J0S D;  1XMQ F;  4OHW A;  5HP1 B;  4GKJ F;  3R5D A;  2FY1 A;  2ZHA A;  2E5L J;  4DV0 J;  3K58 A;  2CQ1 A;  4ZP6 A;  1LWF A;  3KLE A;  3ZNU A;  2E1C A;  3UD3 P;  2AT1 B;  3CIZ A;  3EWG A;  1Q16 B;  1RLD A;  1TL1 A;  3MAQ A;  1N32 F;  4I7F A;  4GTY A;  4Q44 A;  1RGV A;  1RT1 B;  3KK3 B;  1IKW B;  3I9Z A;  1X0P A;  4ZP9 A;  3K17 A;  4HTI A;  4DR1 F;  2IM0 A;  2KZM A;  1RHQ B;  4UPH A;  2Z0G A;  1GAO A;  2OSR A;  1JB0 C;  5HBM B;  5CYQ B;  3CVK A;  3AD9 C;  2CQG A;  4WU2 A;  1P8G A;  1SJF A;  2I1R A;  3EX7 B;  2ASY A;  1WI6 A;  4C11 B;  4UOH A;  3FDS A;  4LRC A;  1Y7P A;  1KHN A;  5SZT A;  4OZ0 A;  2I8E A;  8RUC A;  1F6T A;  1B64 A;  4E0D A;  2G2O A;  2WVE A;  2VPX B;  1RTD A;  4ID5 A;  1T9W A;  4NLG A;  2MY7 A;  2Q6B A;  2DO0 A;  1MG7 A;  2QYG A;  1U1K A;  6FDR A;  4JI4 F;  3IRW P;  4JV5 J;  4CLZ A;  1BWE A;  4P2F A;  5F9L A;  2V8H A;  2RT3 A;  2AP6 A;  4FBT A;  1LV5 A;  2H48 B;  5L0K A;  1GTH A;  4OX7 A;  3M8S A;  4NE9 C;  4ES1 A;  2R9L A;  3BPS P;  1WOP A;  1NK7 A;  2DY9 A;  5HJX A;  1XR5 A;  3K5P A;  2HHX A;  1YBT A;  2IAJ A;  3MCO A;  2ZJR Q;  4C3M A;  2K7K A;  2VOD A;  2Y1R I;  1FNO A;  4NRT A;  1OQ3 A;  3JSB A;  3MAA A;  3PHE A;  2B9E A;  1Q53 A;  3FZ2 A;  4IQM A;  5M2U A;  1RT7 A;  3WBZ A;  5KFV A;  3MM5 B;  5EX0 A;  4LSN A;  4XAK A;  2OPS A;  4TY8 B;  3PIO Q;  4ZLJ A;  4PQU B;  1LXJ A;  3UQS A;  4L3N A;  4OIX A;  4ILR A;  5EUH A;  1PSD A;  2XMV A;  1IXK A;  1IQT A;  4DPY A;  1M5K C;  3Q24 A;  3M1V B;  3BR9 A;  2YNI B;  4M5N A;  3AOC A;  3PR5 B;  2CZ4 A;  3E51 A;  3C6U A;  2C3U A;  3C15 A;  1RAB B;  4U95 A;  1NK0 A;  3HVW A;  1TU0 B;  2KU7 A;  2IIH A;  4QIF A;  5JMN A;  1J5O B;  4YB7 A;  1VS3 A;  4DFM A;  2EK6 A;  1C4A A;  1XQI A;  5HLF A;  3DHW C;  3DPC A;  5HQL A;  3KLF A;  1OO0 B;  2Y8Y A;  1QY7 A;  3OVA A;  1VQP S;  3H2L A;  1SKU B;  4ZVP B;  5IC6 B;  1SL2 A;  5K14 B;  3R7N B;  5CCM A;  3VAM A;  1HWL A;  2DY1 A;  1XR6 A;  4F4K A;  3CDW A;  3D6H B;  4WTY A;  4ZCL A;  2J9D E;  4I6Y A;  1FJE B;  3T6J A;  5GOV A;  2ASD A;  1GK8 A;  1WOO A;  4KGK A;  2OEK A;  4TU9 A;  1U4B A;  3NWR A;  4KH0 B;  4B9U A;  3MUM P;  2RSQ A;  4M5D A;  2OPQ B;  3D2W A;  4B9L A;  3PJ9 A;  1HD0 A;  2QN6 B;  3SXL A;  4DR3 F;  2A1B A;  3IMQ J;  3I0R A;  5HN0 A;  1RYR A;  4DN9 A;  3QSI A;  2EG1 A;  3QJP A;  3IFE A;  1NSQ A;  2HHS A;  5H9E K;  4QU7 A;  5AT1 B;  1GH8 A;  1U1O A;  1C0T A;  1BGX T;  2GIF A;  3KLV A;  1LK5 A;  5H9F K;  2BJ1 A;  1GT8 A;  3PAC A;  1HLW A;  2QL9 B;  2FHJ D;  4ZMM A;  3PXG a;  4B9S A;  4OX9 F;  3QT7 A;  4PG6 A;  2QLW A;  1I94 F;  2BKO A;  2XY7 A;  2CPD A;  4L3K A;  4YY3 F;  1S49 A;  3BH7 B;  4DDF A;  1VBY A;  1M1K T;  4W98 A;  5BXI A;  2DO4 A;  5LL6 d;  5K8N A;  2GSU A;  1K1Q A;  1G4C A;  3GSD A;  5CHC B;  2JHE A;  1SC4 B;  5KAK A;  1WSV A;  1HQE B;  2R7O A;  4QWB A;  4F4X A;  3A8E A;  4LQY A;  4Y28 C;  2JWN A;  2QIF A;  4DCJ B;  3CJT A;  2KT5 A;  3CDA A;  1S1T B;  1KHL A;  2LEA A;  2IYI A;  2HQI A;  2O3D A;  2GIQ A;  1S6Q A;  2AMC B;  4F02 A;  1ZZF A;  1G1X A;  3HHK A;  2DXF A;  2HS4 A;  2C28 A;  3G9C A;  1FKO A;  2V68 A;  1ZTW A;  2ZDO A;  4FVM A;  5DLG A;  2W5Q A;  4IH7 A;  4ZN3 A;  2RE1 A;  1XIQ A;  1WAC A;  5KFI A;  2IA6 A;  3OFG A;  3SEO A;  4GVB A;  2U1A A;  4WIQ A;  3KMS A;  3HKW A;  3G8Q A;  1FKP A;  5L39 A;  1VMB A;  4K0K J;  2W8L A;  4F4W A;  4LF7 F;  2B3T B;  3FMW A;  1YK9 A;  4GC7 A;  4ED5 A;  1YDL A;  3MOZ A;  4FN5 A;  4B3R J;  3NGS A;  2P9C A;  3HHL D;  3KLG A;  1U25 A;  3WIV A;  5IJS A;  2OJ3 A;  3I5C A;  1H72 C;  3OD2 A;  1BUX A;  2NXN A;  4CO3 A;  4DV2 F;  1NK6 A;  3KFW X;  2LU2 A;  1FXR A;  3AOD A;  3AJD A;  5I3U A;  2VBZ A;  2YQ0 A;  4DL7 A;  4EO6 A;  2FYX A;  5KFH A;  3D6T B;  2AU0 A;  1RXO B;  3DI6 A;  2BA9 A;  1IWG A;  3DRS B;  1NJY A;  1VIO A;  2W7A A;  2ZOM A;  3FGV A;  1Y9O A;  5L46 A;  3T5J A;  4AXJ A;  4ZG7 A;  2B4U A;  4CXS A;  3DLE B;  3Q8S B;  2V4R A;  3J7Z T;  1NRK A;  4QWD A;  1C1C B;  2W7O A;  2VH7 A;  1FHT A;  4C8M A;  1H74 A;  1UAW A;  4U96 A;  1NHU A;  4K4U A;  4M63 A;  3OR2 A;  2H51 B;  2W2O P;  4MKB A;  4WYL A;  4C8N A;  1N88 A;  1IBM F;  1K44 A;  4LF9 F;  1IUJ A;  9ATC B;  2D3U A;  2FC9 A;  3T41 A;  1JXL A;  3BR8 A;  1N33 F;  3SV3 A;  2YKM A;  1PJ5 A;  1HW9 A;  4UUX A;  2R7Q A;  3DC2 A;  4Z37 A;  3Q89 A;  3I6P A;  2MKI A;  2NUU G;  1KTQ A;  1P1T A;  1EET B;  5C24 B;  4NI2 A;  2KVQ E;  2C3M A;  2MQ8 A;  5B0F A;  2GJI A;  4UOG A;  4DR4 F;  4KRW A;  3A3P B;  2BE9 B;  1FK9 B;  2BOP A;  2CNO B;  4FPI A;  3I87 A;  2XHC A;  4AE5 A;  3RW7 A;  1EAR A;  1LWE A;  3DCA A;  4J91 A;  4P71 A;  1M5H A;  4KH1 B;  1DHM A;  2XNQ A;  5MLC V;  2GO8 A;  4CCH A;  2QFI A;  1Q1K A;  4A46 A;  2XMU A;  2GCF A;  1MNE A;  5EWG A;  1X4F A;  2OUG A;  3JTO A;  5I4M A;  3ILO A;  2ACM A;  3G8T A;  3NG8 A;  4DR6 F;  1C1B A;  3MUV P;  2JC1 A;  1H73 A;  3HXM A;  3TAQ A;  3ISN C;  5FLX Y;  3LQV A;  3FFI A;  4HLB A;  1K8A T;  1JNZ B;  5F8G A;  4DZ6 A;  4LRA A;  5A8K A;  5AJ9 A;  4YDX A;  3W2W A;  5KT7 A;  1FRM A;  3UI3 A;  3MEE A;  2BDP A;  1CJT B;  3KLI B;  1PC5 A;  5FDL A;  4N5S A;  1S0O A;  3Q22 A;  4JOU A;  1FE0 A;  4P73 A;  1UCN A;  2ZFH A;  4MKV A;  1RTI A;  2V8D A;  4WKY A;  3FEY B;  3DGV A;  3CJQ A;  3P8B B;  3VVU A;  4RU2 A;  3MMB A;  2EFQ A;  3SZY A;  5J1N A;  3NKR A;  1UVN A;  1B0T A;  2CQH A;  5KG3 A;  4NLT A;  1RWO B;  1ZOT A;  4GTW A;  3TA1 A;  3EM1 A;  5SUH A;  3V4I B;  3PYG A;  2AWZ A;  2Z2M A;  2IM2 A;  4C0H A;  2YWH A;  1RAF B;  4RX6 A;  2LQ8 A;  2ZWP A;  2C3P A;  3CIM A;  1HBU A;  3K5O A;  3GV8 B;  2IBK A;  4HI2 A;  3KLH A;  4J9K A;  2GA3 A;  5F8L A;  1EW2 A;  1FRH A;  4JI5 F;  3DHX A;  4UY8 T;  3I5B A;  4MT1 A;  5KG4 A;  1LK7 A;  1BD6 A;  2ACY A;  1J5E F;  2VG5 A;  2EI5 A;  3J7A N;  3RRK A;  2FJD B;  4J9R A;  3X1L B;  1EP4 B;  1Q5V A;  2B9X A;  2MQL A;  1T9X A;  5L8R C;  1CJK B;  5DDQ C;  2MGZ B;  1TL7 A;  1H2T Z;  3BH6 B;  4DBQ A;  3KUG A;  1OSD A;  1K73 T;  2HND A;  3LH2 S;  4CQ1 A;  1B4S A;  3GG0 A;  3MM7 A;  4TU8 A;  3VGU A;  1RAE B;  3CD6 S;  1ZA1 B;  3KK2 B;  2LYV A;  4IRK A;  3IR5 B;  1N4L A;  3TAR A;  1AUK A;  1HHQ A;  4DR2 J;  1ZET A;  1TKD A;  4TLQ A;  2FJW A;  2V50 A;  5KG0 A;  4IOC Q;  2QG9 B;  1XNR F;  1RQ0 A;  5AE1 A;  3BDH A;  1CUL A;  3K5M A;  1KQS R;  4A8K A;  2CA9 A;  1JLB A;  3V6D B;  4ZJL A;  1S0N A;  3HFK A;  3I4H X;  4A8F A;  2XZD B;  4WTO B;  2XMK A;  2UUB F;  1F9H A;  3O8W A;  2DNG A;  3KHL A;  3LAN A;  2IM3 A;  2MB0 B;  1YI2 S;  3GR0 A;  1X9M A;  1JLC B;  2N3O A;  1ZTT A;  2R8G A;  2C2K B;  4NLS A;  2LXU A;  4DPU A;  4MK7 A;  1GNK A;  2ABY A;  2D3Z A;  4DSJ A;  1T3N A;  1WTF A;  2K06 A;  1CBK A;  4DR5 F;  2FJX A;  1J27 A;  4Y6I A;  3UO0 A;  4G65 A;  4NCB A;  1VJW A;  3P45 B;  4NLV A;  2ZH4 A;  1E2S P;  2AJ2 A;  3KJN B;  1XNQ F;  4RUH A;  5LMU F;  3MM9 A;  3D0H E;  4N77 A;  3JB9 k;  1YIT S;  5AJ3 F;  3D3C J;  7FD1 A;  3NOC A;  5A6W A;  1UL3 A;  3NKM A;  1ELX A;  2QLJ B;  3O2I A;  1VQN S;  1S6P A;  1S0M A;  2KM8 C;  4O3N A;  3BDE A;  5B0G A;  5HMZ A;  3EIC A;  1S76 D;  4OX6 A;  4FYD A;  2OO4 A;  4PG8 A;  4OYI A;  3R5G A;  3QFH A;  4KAV A;  5D4N A;  1FFW B;  1D9F A;  3B4D A;  1TL4 A;  3RRH A;  3WAX A;  1F9F A;  2W8S A;  1TQL A;  5KFM A;  1BE4 A;  2VA3 A;  3QIP B;  2G4B A;  1WHX A;  3LOU A;  1VQO S;  5D3G A;  3Q23 A;  1KN6 A;  1DQ8 A;  1N52 B;  1PYS B;  2OPR A;  4UOP A;  5C25 B;  2X1A A;  2UU9 J;  3TEG A;  5J1P A;  4GKK F;  2ZH6 A;  4LF4 J;  5D0R A;  1OS5 A;  3EDR B;  2POK A;  2FLO A;  2R2R A;  3M2U A;  4QIW D;  4CNZ A;  1VQ7 S;  4ZGA A;  1NKC A;  2QV6 A;  4MTP A;  2W2Q P;  3O1L A;  1Y5L B;  5B09 A;  3CMA S;  3HJF A;  4TQR A;  1O6X A;  2DNR A;  4USV A;  1WF1 A;  1E6Y A;  2MST A;  1LFW A;  1SL0 A;  2CJA A;  2RS8 A;  5F8M A;  4IFY B;  2DKO B;  3W9I A;  5K4P A;  2YX4 A;  3MTK A;  3HO1 A;  2DHA A;  4DN0 A;  2DCU B;  5KFX A;  3PY8 A;  3CJS A;  2Z8Q A;  1KHV A;  2WOM B;  1DFD A;  1KS2 A;  2F4V F;  3GV5 B;  2N4C A;  2ZKU A;  1EIY B;  4IDK A;  3PX6 A;  2DH7 A;  1QE1 A;  2KJW A;  3PR4 A;  3V81 A;  1KH5 A;  5KFP A;  3NXZ A;  1BMQ B;  4ZPW R;  2M8H A;  3IRX A;  1KLN A;  2OEJ A;  1WEL A;  2CFX A;  3NS6 A;  3HCX A;  3O5T B;  4PCQ A;  1U6B A;  2GLQ A;  3QPI A;  5HVF A;  3FMB A;  5KFS A;  4KHP F;  3FZB A;  2AW0 A;  3J81 U;  1WC0 A;  3QNW B;  1FJ7 A;  4LF8 J;  4DU8 A;  2ZD1 A;  4HI1 A;  3BZQ A;  4ENO A;  3UN3 A;  3LAK A;  1NUE A;  4XDC A;  1X8D A;  3N5F A;  1VBZ A;  3EMT A;  2DNK A;  1TV6 A;  2ANH A;  4ZG9 A;  5IT0 A;  2IC3 A;  4QPX A;  2FUG 9;  5L9X A;  1AFJ A;  1OPI A;  3HVA A;  1TL3 A;  3C6T A;  2AX0 A;  1DAR A;  3ULH A;  1RT2 A;  2MQQ A;  3KUH A;  4Q0B B;  3F41 A;  2VFS A;  1M5V C;  5GRR A;  3CW2 C;  4UTG A;  1SQE A;  1UJ5 A;  2B0G A;  2PFD A;  4YB5 A;  1U1M A;  4PWW A;  1N34 F;  2ZEJ A;  4IUF A;  2B5J A;  4DG1 A;  1GQE A;  2W8D A;  1O98 A;  3R5J B;  3O44 A;  2JRS A;  7FDR A;  1VQM S;  2OAU A;  4LRF A;  4RW8 A;  1S1U A;  4CYU A;  2YKQ A;  3U7J A;  4U9R A;  1YRT A;  3C2P A;  2CJX B;  1WG1 A;  2LQ5 A;  4RNO A;  4O3P A;  4MIV A;  1B0V A;  3K89 A;  2E5H A;  4X4S A;  1V5V A;  3G71 S;  2HVE A;  1RWX B;  2MKH A;  4A8Y A;  3ZZT A;  2KFY A;  3ZZ0 A;  3E8O A;  1WSR A;  3FJ2 A;  1N5S A;  2YNG A;  4RW7 A;  1WOS A;  3DLK B;  1P1L A;  2EFN A;  1RK8 A;  2I5J A;  3DM2 B;  3ENA A;  4ED1 A;  4YR1 A;  4NLQ A;  1YBA A;  1F2H A;  1Z2Z A;  3ITH A;  5DO2 A;  1RHU B;  2NR0 A;  2QJ3 A;  4LVN P;  5F3Z A;  1XER A;  2W01 A;  1WEX A;  4NL5 A;  3B5Q A;  2W4C A;  4ZVE A;  3QLH B;  2QL5 B;  4TU7 A;  2V2Q A;  2MPU A;  1VQK S;  4TLR A;  1M5P C;  3Q83 A;  5DDP C;  3E2E A;  2V2K A;  4TYB A;  3HDS A;  5KFA A;  3U1L A;  2JL9 A;  5LJ3 Y;  4QAX A;  1RT3 A;  4QWA A;  1NH8 A;  5LJ5 Y;  4GTX A;  2HRU A;  4H4O A;  2W5V A;  4CO4 A;  1S1W B;  4HVZ A;  1IKY B;  3NBP B;  2BVZ A;  3IM8 A;  1KH9 A;  4EEY A;  1HNZ F;  1P9Q C;  4LRD A;  3OLA A;  5KFW A;  4OI3 A;  1HBN A;  2KDO A;  4MJK A;  2JEJ A;  1RTD B;  4UPK A;  1SJQ A;  1FI4 A;  1LW2 A;  2FVR A;  2VG6 A;  3MM6 A;  2BW2 A;  3NNC A;  2ILZ A;  3CCJ S;  4OZ2 A;  3TZY A;  1U8S A;  2EBG A;  3GWC A;  3NP5 A;  2HHH J;  4LFA J;  1CS4 B;  3VWS A;  4CH1 A;  1W2I A;  2YXL A;  3GON A;  1JLA B;  2AEM A;  1DJ0 A;  3BQ1 A;  2IJR A;  3GFH A;  5J2P A;  4MIW A;  4CDI A;  1MSW D;  1SVD A;  2BKN A;  5CA5 A;  1VK8 A;  3JSM A;  4CP5 A;  5HAN A;  1N2K A;  4IR9 A;  3NKY A;  4NCG A;  4DSF A;  4JV1 A;  1RT6 B;  4LSL A;  3R1L A;  4JV5 F;  4LR7 A;  1KSP A;  3LGM A;  4MK8 A;  4IG0 A;  4LSN B;  1F5B A;  3PYE A;  4QPT A;  2C2R A;  4BC9 A;  1SJ3 P;  2ZOG A;  3CCE S;  1RU1 A;  2Z57 B;  4ZVQ B;  1U1R A;  3VZH A;  5IC4 B;  1RI7 A;  3MEG B;  2XYH B;  3P6Y C;  4M5L A;  1FRK A;  3IP0 A;  5KFK A;  2VKZ G;  4B9M A;  5HMW A;  4LBP A;  3J80 U;  1DRZ A;  1NME B;  5DLW A;  1ELY A;  2FVC A;  4OJ3 A;  1ROF A;  3IG1 A;  1QTM A;  1LWC B;  3Q2T C;  4DXL A;  3ET6 A;  1PBA A;  2AX1 A;  3PCO B;  2R42 A;  4L76 A;  3QAT A;  3S8S A;  5G0R B;  3BSA A;  2GIR A;  3MEK A;  3CO0 P;  2QZU A;  4WFN Q;  4R25 A;  1GXT A;  2B9W A;  3H4D A;  1CJV B;  3AY0 A;  4CIO A;  1UPP A;  3IS9 A;  3GIJ A;  4JI2 F;  2VQF J;  2XTJ P;  4Y34 A;  4RNN A;  4LSZ B;  1YZ6 A;  3F73 A;  1D9D A;  2JLE A;  1HWU A;  3HHD A;  4DV6 F;  4JI8 F;  2BM1 A;  2BQ3 A;  3G96 A;  1DTT A;  2Z30 B;  5IWA J;  5DM6 Q;  4EGL A;  1FES A;  1VR6 A;  5IQ6 A;  5HL7 Q;  2IHR 1;  4AXI A;  3TUZ C;  5J1E A;  1UVJ A;  1A7G E;  2I9S A;  1S77 D;  1U1P A;  2LQ9 A;  1U0H A;  4L74 A;  2FZC B;  2UVW A;  5KOX A;  1S6U A;  5GAD U;  1D9A A;  2QTW A;  3PX4 A;  4KJD A;  3DXS X;  2MKS A;  3K5L A;  3MHY A;  2XMA A;  2HHU A;  5CQG A;  4F0M A;  3NCP A;  2FGO A;  3TO8 A;  3GCW P;  4JYA J;  4MIA A;  2DR7 A;  4IKA A;  1HKA A;  4MFB A;  1NZA A;  1EQM A;  2IJF A;  4PG4 A;  2VDH A;  3CUL A;  2FJA B;  2KYZ A;  5KG5 A;  3D1Q A;  3M32 A;  3W8G A;  1IJF B;  3SSR A;  2ZZM A;  1T3O A;  3UPF A;  2YBV A;  4I1T A;  1B0P A;  2FPH X;  3UR0 A;  2PI4 A;  3BDP A;  2P5V A;  3C3L A;  1ALH A;  3JYT A;  1GFW B;  1FT8 A;  1CQN A;  1KH4 A;  3G6E S;  2QO3 A;  5J2N B;  1RT5 B;  2JDJ A;  2C22 A;  1RAC B;  2LFV A;  1S59 A;  5IM0 A;  4CRJ A;  5J2Q A;  3OHB A;  3B78 A;  3MM8 A;  4RBT A;  3ZZR A;  1VCT A;  2YPZ A;  3RBX A;  2MZJ A;  1HNW F;  1JLF A;  1YGY A;  3EJM A;  2XLK A;  3VQS A;  3VAJ A;  5DG7 A;  3QT6 A;  1DLO A;  2WBM A;  3TJ8 A;  2OPP A;  3I9V 9;  4N8N A;  1JX4 A;  3LPY A;  2F4F A;  2QSW A;  4J5O A;  4Q5V A;  2D41 A;  4ZG6 A;  3DMJ B;  1FWL A;  1LNQ A;  4OI6 A;  4JI7 J;  3NMA A;  3T1A A;  5LMN J;  4KKO A;  3UVJ A;  2MSS A;  4RWW A;  1PCA A;  3BJY A;  4F2S A;  1S1V A;  4V1A k;  2A2D A;  4K4V A;  1ZM9 A;  4ZOS A;  1IR0 A;  2J8A A;  4J90 A;  5F41 A;  1ULR A;  2G13 A;  1W26 A;  2F9D A;  3M7V A;  5I3P A;  4WE1 B;  2KH9 A;  4CXU A;  2YH1 A;  1SUQ A;  5DJB A;  4PXD A;  5LSO A;  1UWA A;  3NS5 A;  3KLG B;  3FKB A;  4IYQ A;  1S0V A;  1KOO A;  3PW7 A;  3DLG B;  3FNN A;  4K0K F;  4RU9 A;  2GML A;  1APS A;  4DV3 J;  3MMC B;  3QFW A;  9RUB A;  3GG1 A;  4F25 A;  3ENW A;  1M5S A;  4EYH B;  5LRM A;  2IA0 A;  1WKK A;  4PR6 A;  2FZG B;  2PC6 A;  2M7S A;  3DN9 A;  1MWY A;  2B6A A;  1ALK A;  4RO0 A;  1N5Y B;  2HW3 A;  4ZKA A;  5ETO A;  3DXB A;  4OZ1 A;  1YJT A;  4I68 A;  2NSB A;  4TKT A;  1KWM A;  2EKY A;  2WK4 A;  4Y2M A;  2V4J A;  4J9P A;  2XY5 A;  3PRD A;  1ZAV A;  1Q0N A;  4QU6 A;  2AGO A;  2HZC A;  4KV8 B;  1ZYQ A;  3KHR A;  3MEC A;  5BJR A;  3R7B B;  2O66 A;  5E3C A;  3WAY A;  3H98 A;  2DNN A;  3OR1 B;  4EFA C;  1FRI A;  1T95 A;  2LCW A;  4KT0 C;  1BLU A;  3GSI A;  4E98 A;  3OL9 A;  3G6Y A;  4LT6 A;  4XTT A;  2XS7 A;  2YKM B;  4DV5 J;  4L73 A;  2W9B A;  1XK8 A;  1Q79 A;  4I64 A;  4ZCI A;  1Q8L A;  2WON A;  3CE8 A;  3PRB A;  4QIV A;  2N3L A;  1ZS6 A;  3BGF A;  4W90 B;  3M05 A;  4B3O B;  4V19 X;  3CMR A;  2JLF A;  3T02 A;  4DCP B;  1HDH A;  2KXN B;  3I55 S;  4RPF A;  4OZJ A;  4DR7 J;  3IWX A;  1QSS A;  2ADC A;  4ZIV A;  1F5A A;  3RB0 A;  5B0D A;  3ZTQ A;  2OTL S;  4A8S A;  4X65 J;  1HIY A;  1S1X B;  4KFB B;  3M2V A;  1MRO B;  1YX2 A;  3ETM A;  5ETN A;  3LP0 A;  3H25 A;  2YQ1 A;  2CUY A;  3UN2 A;  3CD5 A;  4OYP A;  5A6P A;  3RG6 A;  1S9E A;  5J2M B;  3DLH A;  3GYX B;  1GMU A;  1Y00 A;  4K50 A;  4OX8 A;  2AJ0 A;  2N7Y A;  2HNZ A;  5E3P A;  1X31 C;  3TA0 A;  4OQJ A;  1OJ4 A;  2CNL B;  3EXC X;  3QGG A;  1A9N B;  3MK1 A;  5FDL B;  1HBM A;  4UT4 A;  3KK1 A;  3GIL A;  4MHX A;  2JFK A;  1R31 A;  1TKT A;  1JJ4 A;  3I0S A;  4CO0 A;  1H2V Z;  1N2L A;  3MMB B;  1F5C A;  4F0H A;  3D67 A;  5ETQ A;  4J9O A;  2R8K A;  5INH A;  3R27 A;  1UEU A;  2CQ4 A;  1YLX A;  3M8Q B;  2OEL A;  4DV4 F;  2Y1I A;  2DNQ A;  2IRU A;  4CLP A;  3BRE A;  1DQA A;  1VJQ A;  1I51 B;  1RHK B;  1KFD A;  1XJW B;  3EVM A;  3FBB A;  4CLK A;  1CG2 A;  4ECQ A;  4IO1 A;  1YJ9 S;  5D0H A;  1VQ8 S;  3KLH B;  3NKP A;  4B9V A;  3QRP A;  2DR6 A;  4O44 A;  2DIU A;  1NBE B;  5F0W A;  1Q78 A;  2WW4 A;  4AUK A;  3E01 A;  3BGO P;  4NEY A;  2P6S A;  2IMO A;  2VKR A;  4B9T A;  4I69 A;  3W62 A;  1Q7L B;  1EKR A;  3RBE A;  3OVS A;  1UEV A;  2VG5 B;  3J81 Y;  4QOT A;  5A2Q U;  1KLM A;  2AJF E;  1RZM A;  1NXI A;  3PFO A;  4N76 A;  1PIE A;  1EI6 A;  4RW4 A;  3JS9 A;  1M90 T;  1GX5 A;  2CQ3 A;  3QAE A;  4WWS A;  3THP A;  4WPA A;  2OP5 A;  5C42 A;  2LDY A;  3M6W A;  1U2R A;  4NYZ A;  4WKR A;  4AYB D;  4QJV A;  2HS3 A;  1GMW A;  5IZH A;  4FXV A;  1B7Y B;  2HND B;  3MUR P;  3CCS S;  2V34 A;  4WF9 Q;  3MM7 B;  2D1G A;  3E2D A;  3OQ2 A;  4ZVU B;  1OSC A;  3R97 A;  3CC4 S;  2K1R B;  2D7S A;  1HBO A;  2CVI A;  4KHR A;  3UR3 C;  1SHQ A;  1BHN A;  2MLZ A;  4PWD B;  1U0S A;  2HVD A;  2OFG X;  2CG4 A;  2W5X A;  1UA0 A;  2MQP A;  3IGN A;  1VC5 A;  2XWX A;  1SPB P;  1BQN B;  2D9P A;  4LJM A;  1UFW A;  5KT3 A;  2HIY A;  3PVX A;  1CUL B;  4CLF A;  3CTR A;  1RHR B;  3PG9 A;  4CWB A;  2BQU A;  1RWN B;  2BAN B;  4E8U A;  1SQF A;  3PRV A;  1R0B G;  3VAG A;  1WC6 A;  3OUY B;  3PX0 A;  3RZA A;  4DR2 F;  4DQQ A;  1WG5 A;  1RCO B;  3KJV A;  4QW8 A;  1RB0 A;  4KGV B;  2DHX A;  3EE3 A;  1WG4 A;  1Q82 T;  2YY3 A;  2VG7 A;  3LP1 B;  2UXB J;  1R0A A;  1IR2 A;  4N47 A;  1RBO B;  3RB4 A;  4ZIT A;  2GVZ B;  3N28 A;  2BJ8 A;  3QGI A;  1FCA A;  4RZR A;  4XO0 A;  5T7L A;  3A8J A;  1F2G A;  1XMO F;  1YVF A;  2H5J B;  2MXY A;  4N8O A;  2L08 A;  4FDI A;  1UP1 A;  2O67 A;  4P2S A;  2RKI A;  2VUG A;  2V94 A;  3KHG A;  1ALI A;  5LT5 A;  1VRQ C;  3Q8U A;  2MJN A;  2HAI A;  2RNE A;  4HAC A;  1M1H A;  4ZJO A;  3JQM A;  5KG2 A;  4DPW A;  2BRL A;  3BO4 A;  1D1U A;  3L7P A;  3WAW A;  2UUT A;  4U7U D;  2XS5 A;  2LVW A;  2KXF A;  2JFD A;  2RAQ A;  2DNO A;  2UXC J;  1NDP A;  4FP9 A;  4U6P A;  4YOE A;  3JXO A;  1NDC A;  2B8Q A;  2CAJ A;  2Z56 B;  1HPZ A;  4OHZ A;  4L72 B;  5CXT A;  1ZED A;  1NJX A;  4UF4 A;  2R2S A;  2HZV A;  1Y10 A;  3CJR A;  3W3S A;  2G2Z A;  1IM6 A;  5JXS A;  2XSJ B;  5KT6 A;  2ZH9 A;  5CYM A;  4LRE A;  5T14 A;  5A0Y B;  4Q8E A;  5EGE A;  4KC5 A;  4CM2 A;  1RT4 B;  2FVP A;  4FNH A;  1VRU A;  3QWP A;  2Z2Y B;  1K1S A;  4KR0 B;  2WVF A;  1VQ4 S;  1FNX H;  2BBE A;  4H4M B;  4Q2M A;  1Q4R A;  2BJE A;  1I1G A;  2VV5 A;  3DRP A;  1GX6 A;  3TZX A;  1FDD A;  5C2G A;  5D6G A;  3DLL Q;  4WXO A;  4FZV A;  2ASL A;  1VQL S;  3RGI A;  3HHL B;  5KFY A;  3VAK A;  3HP6 A;  4USI A;  3DOL A;  2NXJ A;  4TVA B;  2GMH A;  1RDR A;  4OHV A;  4ALZ A;  1B8J A;  3CJK B;  2R7U A;  4TQS A;  2RB7 A;  1RAO A;  4LF4 F;  2Y0S D;  3RYL A;  4IRD A;  1KBR A;  1P6T A;  2APO A;  4RUC A;  4WK3 A;  3GJS B;  1WUU A;  5D0E A;  3D3B J;  1REG X;  2CPE A;  1K7H A;  5F8J A;  2MMY A;  4M5G A;  2IRY A;  3IBF B;  3F44 A;  2Q66 A;  2AYE A;  4CTA A;  2HWI A;  3N6N A;  4J9N A;  2XC9 A;  1NK5 A;  4WFB Q;  1S9G B;  3RRG A;  1D8Y A;  2J8S A;  4ZHR B;  4UOO A;  3MMA A;  1JKH A;  1R43 A;  4F3Q A;  4CLY A;  2OML A;  5LSR A;  4FYV B;  2LXF A;  4DSK A;  1BQM A;  1RKI A;  3MUT P;  3BS9 A;  3M30 A;  4K4S A;  5IOL A;  1LWX A;  1WF0 A;  3J80 Y;  2OI2 A;  1VYA A;  5ETP A;  3BBB A;  1VQ6 S;  2V5H G;  3L7U A;  4KGX B;  4BDP A;  2GVD B;  2EWH A;  2DTJ A;  4OV1 A;  3TAM A;  3S1T A;  3AOB A;  2R8I A;  1NKB A;  4PYA A;  4XDD A;  1EW8 A;  4PUO A;  1SH2 A;  2YNH B;  2LMI A;  1SJR A;  4QR1 A;  5IJQ A;  1DZ5 A;  5KFZ A;  3BDG A;  2XCP A;  3H7H B;  1U6Z A;  4QIG A;  3TI0 A;  2HVZ A;  2IFX A;  3R8Y A;  3SSQ A;  1S99 A;  4USJ C;  4DFP A;  3VV2 B;  5IFM A;  3MED A;  1WDD A;  1KHW A;  3AXK A;  1E6V A;  5E0O A;  2RF2 A;  4YHH J;  2UVU A;  5E41 A;  2JJ4 D;  1Z1Z A;  1KH7 A;  4WP3 A;  4OJH A;  1FNM A;  3K59 A;  4Y3C A;  4CLU A;  1RIS A;  5KFE A;  2DYA A;  1HI0 P;  2PD1 A;  3C16 A;  4ZVG A;  2A3J A;  2ZM6 J;  2PI5 A;  4I2Q A;  3TR5 A;  2HZA A;  3T9Z A;  4MMO A;  3R1H A;  4HH1 A;  1GXU A;  4ZVR B;  4I6A A;  1A6L A;  2CJB A;  4KY3 A;  1H0H B;  2BZ2 A;  2L9W A;  4LFB J;  5HP1 A;  1Y3K A;  3EZ5 A;  4A8Q A;  3VHQ A;  1VI7 A;  1H38 A;  4ZDN A;  2ZH7 A;  3IC1 A;  2VJU A;  1IBK J;  1U1N A;  4RBU A;  4A4J A;  1NB2 A;  2A10 A;  3FVY A;  2HHP A;  1V5I B;  3PKY A;  3KK3 A;  1IKW A;  3GMG A;  2AEF A;  2F7V A;  3T3F A;  3H5S A;  5A8W B;  4Y0F A;  1T9T A;  5HBM A;  3MCM A;  3PJX A;  5CYQ A;  3GE9 A;  3OXG A;  2GQC A;  2DRA A;  5AE2 A;  1AUS L;  2F65 A;  1VQS A;  4NA3 A;  5DG9 A;  4ED6 A;  2VC1 A;  4CLL A;  1RLC L;  3T1H F;  3ZTS A;  3DDN A;  2QEX S;  2O1P A;  3PHT A;  2F8H A;  1RAI B;  1R6Y A;  1SL1 A;  3A8K A;  3RTV A;  3CT9 A;  4OJ1 A;  4QYZ K;  3CCL S;  3EZU A;  3VGT A;  4IFV B;  4DL4 A;  3J7Y U;  1VDH A;  1F60 B;  4WYW A;  1LW2 B;  2RML A;  3QJJ A;  1IM4 A;  2EKN A;  3VAH A;  3T1Y F;  3JTN A;  1EAY C;  2VZ9 A;  2AKW B;  3KG1 A;  2DH8 A;  2W9C B;  4X2B A;  3UW1 A;  1XBW A;  1VQ5 S;  2EC2 A;  4R5P B;  2H5I B;  1F3F A;  4FYX B;  3FRY A;  3BDF A;  3H40 A;  4K2X A;  4B56 A;  1VLO A;  3SQG B;  4CI0 B;  2VOP A;  1FEH A;  4S0M A;  5L1L A;  4CZC A;  2PDA A;  4LFC J;  2AZ1 A;  4P6Q A;  3JSM B;  2KKH A;  4NCG B;  4LSL B;  1N6Q B;  4M5J A;  5HO4 A;  2RQK A;  3BYR A;  4LFA F;  4GRS A;  3MM5 A;  2PII A;  4TY8 A;  1FWK A;  2DGT A;  4LR2 A;  2GAG C;  4DU7 A;  5KFN A;  4PQU A;  1FX2 A;  4HHH A;  4FYY B;  3ISZ A;  5E3R A;  4RUB A;  4B9N A;  4K8R A;  3UDC A;  5KOW A;  5FD1 A;  3QZ7 A;  2RQC A;  3IXQ A;  2QL7 B;  1NO8 A;  4Y2I A;  3M8W A;  4P7T A;  5DM7 Q;  2YNI A;  4DV1 J;  3BKF A;  2IVF B;  1X4H A;  1TKZ B;  4P72 A;  2QLX A;  3RBZ A;  5D4P A;  3J81 j;  1JJ2 R;  1HNI B;  2ZE2 A;  3TX0 A;  1R8H A;  4O4R A;  4RW6 B;  3ET6 B;  2V8P A;  1J5O A;  2M70 A;  1Y3J A;  4DX6 A;  1OIA A;  2HFV A;  3LW5 C;  1M1G A;  5KT5 A;  5IXU A;  1NU4 A;  3LUY A;  4DL3 A;  2M4M A;  4B3T J;  2IRX A;  2G1H A;  1VK3 A;  2ZBP A;  1SC1 B;  3VZI A;  5E3A A;  4DR3 J;  3IBC B;  2UZA A;  3UDV A;  2LEP A;  1U6F A;  3G2X A;  2MLX A;  2VPW B;  1DTT B;  2KVI A;  4ED2 A;  4G3I A;  2NUH A;  2AGP A;  2FIU A;  5J1E B;  2FLN A;  5EN1 A;  1AJB A;  3NCQ A;  2OPQ A;  1HFE L;  1QVG R;  4PXC A;  4DV7 J;  2NXU A;  2Y9H A;  2JEG A;  1NPP A;  2VQF F;  4OX9 J;  3ISN D;  3KKF A;  2BE2 B;  1B3T A;  2IMW P;  3PKM A;  5KFT A;  1KR4 A;  2R7T A;  4YY3 J;  4MFB B;  1ZEB A;  1R89 A;  5IWA F;  2YNF B;  2QMX A;  1TMJ A;  1C4C A;  4WFZ A;  3GTY X;  4B02 A;  2Q43 A;  5BYR A;  1NSK L;  4DPX A;  2KJV A;  2UUA F;  3U1M A;  4PEO A;  1ZH5 A;  2DIS A;  1HJK A;  5D15 A;  2DHH A;  1RTJ A;  4ZCM A;  3Q8R B;  3HM9 A;  4NLO A;  2FY8 A;  5KXA A;  4W4M A;  3MD3 A;  3AA8 A;  1HW8 A;  4URS A;  1UKU A;  4PPD A;  1ZM4 A;  4Q2L A;  3NVL A;  3CJ2 A;  4M94 A;  3OVB A;  5U47 A;  2XI2 A;  4B3S J;  2LA6 A;  1T0T V;  1XMB A;  3B8H A;  3TP2 A;  1NHK L;  3VCD A;  4N7T A;  5HVG A;  3U1N A;  3T5L A;  2XGP A;  2CPI A;  3MPY A;  3IR6 B;  1S1T A;  3KYL A;  3IWN C;  2G0I A;  1TP7 A;  3DLJ A;  4OFZ A;  2YX7 A;  1S4E A;  1P49 A;  1EJJ A;  2G9Y A;  1JLF B;  3GPA A;  2DRB A;  1SKS A;  4PAB A;  3CD7 A;  3D1O A;  5CYJ A;  4UUW A;  2HSE B;  5KG7 A;  3NGT A;  3SZ2 A;  2BXJ A;  4ZPA A;  2LU1 A;  4RW9 B;  1HA1 A;  3IGY B;  4Q7A A;  3WQP A;  5B7W A;  2DNZ A;  5EWF A;  4IH6 A;  3OL6 A;  4YFU A;  5A2Q Y;  2PMH A;  2UUC F;  1IKX B;  4J9Q A;  4UW2 A;  3NL0 A;  1AUD A;  3TQ1 A;  2PGC A;  3ZZY A;  4ELU A;  4B08 A;  5D4O A;  3LP2 B;  2HWH A;  4ETX A;  4ZVT B;  1SUQ B;  1FRJ A;  2J76 E;  4HYK A;  4FS2 A;  3IR7 B;  2DK2 A;  2KRR A;  5AXL A;  4I2P A;  4CT8 A;  4JI7 F;  1T8E A;  3CDB A;  3AB4 B;  2H54 B;  2E29 A;  4UPI A;  4W92 B;  2XM3 A;  3GIM A;  5ADZ A;  1IBC B;  1SXL A;  1TKX B;  4RUA A;  3NMR A;  4KAI A;  3I31 A;  4JI3 F;  4M1K A;  1G3O A;  2W24 A;  4KBI A;  1XWL A;  4J9M A;  2IBO A;  4I56 A;  4ES2 A;  2G9O A;  3GFY A;  2EPI A;  1G2E A;  1UW9 A;  2FLP A;  4WII A;  5C2C A;  1X5S A;  1BXN A;  1VRT B;  3DLE A;  1FJG J;  3UNG C;  3RBD A;  1VC6 A;  4LR9 A;  3T5H A;  2ZVI A;  1KVJ A;  3LWL A;  4DV3 F;  1FFG B;  2W2P P;  2H65 B;  4B17 A;  1RWM B;  3NRB A;  3QZ8 A;  4DR4 J;  4DUZ J;  4FBU A;  2VBX A;  4TNO A;  1T9V A;  3PJW A;  4KQZ A;  3SCI E;  2EBE A;  5KFD A;  2UUW A;  1SC3 B;  2XYP B;  2EFV A;  4OYZ A;  2OMO A;  3PDN A;  5D4L A;  2W9B B;  2IPO B;  4ZLL A;  2MHN A;  2HWT A;  1EET A;  5C24 A;  3H5Y A;  1E3C P;  2CNN B;  2CJQ A;  2J9D A;  1ARO P;  3WZ0 A;  4DR6 J;  4NWX A;  2A6O A;  3L7O A;  4ZA1 A;  3W2V B;  3V6K A;  1FK9 A;  3V6H A;  2XMM A;  1IQZ A;  2Y1J A;  2KB2 A;  1RKJ A;  4PG7 A;  1U2F A;  3POT B;  4J9V A;  2WSE C;  1VBK A;  5F8H A;  2W8K A;  1R8C A;  2JEI A;  2GHP A;  2CKW A;  1SB6 A;  3Q0A A;  2PE8 A;  2UXD F;  3M4X A;  2DVI A;  2PT0 A;  4NWB A;  3OXF A;  4UST A;  4DSL A;  4JI1 J;  5DGA A;  2DIT A;  3N5B A;  3H4B A;  2CQP A;  3C46 A;  4MY4 A;  1LFP A;  3GP9 A;  1FXL A;  1S9E B;  4LF5 F;  2E7W A;  5GAG U;  2CQB A;  5ETL A;  1SV5 A;  4DCO B;  1RAD B;  3DNC A;  5KFG A;  4OHX A;  1HI8 A;  1CJT A;  3SIP B;  2WTF A;  2EFP A;  3KLI A;  3KTQ A;  2VIH A;  3W5X A;  2YWE A;  2ZZT A;  3US5 A;  3M9O B;  4UOR A;  3QT8 A;  3P96 A;  1NAQ A;  4I4B A;  1TFY A;  4AQY J;  3M6X A;  3CWJ A;  1S9F A;  4KAY A;  5DG8 A;  4JI5 J;  3KUE A;  1F3V A;  4R0E A;  3P4U B;  2QZ8 A;  1Y4Z B;  1RHM B;  3QO9 A;  1OMS A;  3V4I A;  1J5E J;  2V9W A;  2B8P A;  4YR3 A;  1YHQ S;  1RTH A;  2LKZ A;  4K4T A;  1UEK A;  3S7R A;  4C8L A;  3CGI A;  1ZA2 B;  2WZ1 A;  1NK8 A;  3UFC X;  2NZ4 A;  3OTE A;  1MWQ A;  3T6B A;  4LMZ A;  2DGW A;  3AQP A;  4LQ3 A;  1DBD A;  4OYB A;  5I42 B;  1U1L A;  1W25 A;  2MTL A;  2DGU A;  2CDR B;  2O01 C;  2MKK A;  2Y3Y A;  1VIS A;  5DRK A;  2HQC A;  2YKN B;  2W5T A;  2RRA A;  4NYO A;  2IJN A;  3ENV A;  3G82 A;  5BR8 J;  3L4B C;  3NOG A;  1YJN S;  4DX8 H;  5F8N A;  4U7U K;  1KLM B;  1JXV A;  1I5O B;  1REV B;  1ZZN A;  2E7X A;  1EP4 A;  3TYT A;  4M5I A;  2MKC A;  3GIR A;  2DB1 A;  1CJK A;  5C42 B;  2RU9 A;  2MGZ A;  3HF5 A;  1WC4 A;  4X84 A;  4O0N A;  4LVO P;  4KIA A;  4RNM A;  4EZ9 A;  5A8R A;  4YR2 A;  2ZC3 A;  1S10 A;  1SH3 A;  4ITS A;  1NPK A;  4F36 A;  3KK2 A;  4K59 A;  4IOB A;  3I32 A;  5D77 A;  5CD4 H;  1L3V A;  3OFH A;  4RLE A;  2UUB J;  3CMQ A;  5K20 B;  4ZJQ A;  2JVR A;  1AZS B;  2DNL A;  4DL0 C;  3OSN A;  1VQY A;  3W64 A;  3MPU B;  4JUZ A;  4O0I A;  4LQ9 A;  1AJC A;  3EZO A;  3HSG A;  3EVO A;  1U49 A;  3QJL A;  3V6D A;  1S7I A;  1UFK A;  1XNQ J;  3GYG A;  1JK9 B;  4USW A;  2DD8 S;  4C9D A;  4P10 A;  3V6J A;  4IG3 B;  1GMV A;  5IS2 A;  5AJ3 J;  3H42 A;  3I82 A;  2ROP A;  4EBE A;  1TEL A;  1WDT A;  2HFU A;  5HMX A;  1HR0 J;  2BW7 A;  2JOQ A;  1FDA A;  4GC6 A;  3TZW A;  1T03 B;  1RWU A;  3O6Q A;  3KJF B;  1RA6 A;  2VB6 A;  3G86 A;  2A0F B;  2YH0 A;  1OWX A;  3PNI A;  3H2U B;  2D74 B;  2BRK A;  4DX5 A;  4KHM A;  3C66 A;  3N0V A;  4ANC A;  3PTW A;  1WKJ A;  1TUG B;  2DEI A;  4KPY A;  3OL8 A;  1OY9 A;  3PZP A;  1SQG A;  5KFJ A;  2DRD A;  2U2F A;  2VQR A;  3SDE B;  1WD6 A;  3DOM B;  4BHQ A;  5B0B A;  2M0G B;  1HQU B;  3GIK A;  4OI2 A;  2FTR A;  1AT1 B;  1PAU B;  4CO2 A;  3MPW A;  3BGR B;  1XEZ A;  2UXB F;  4F0K A;  4ED3 A;  2AJ1 A;  5M2P A;  3W60 A;  2HBY B;  5AXN A;  2C3Y A;  2WRM A;  1NJI T;  4QZV B;  4ZS6 A;  4QBU A;  4ILM A;  2GGP B;  1QTN B;  4NEZ A;  1HYS B;  1AXQ A;  3J7A 1;  2ALY B;  3AD7 C;  2V8G A;  3W5Z A;  2DGS A;  1OQ6 A;  4PXE A;  1HMV B;  3QIP A;  3OTO J;  2CPX A;  3D54 A;  1RJJ A;  2NQP A;  3TUI C;  3EPI A;  1O51 A;  4J9S A;  4ECX A;  2EFO A;  1HI1 A;  3H2V E;  5C25 A;  4P75 A;  5L9N A;  1S57 A;  1WKL A;  1ZEF A;  2G2Y A;  5CYM B;  3HVR A;  5GVQ A;  3MF5 A;  2UXC F;  4DF4 A;  5HRO B;  1CJU A;  2BOA A;  5HAO A;  1X60 A;  4NMX A;  3AAW B;  2OFH X;  2AJ4 A;  1LXN A;  4IFY A;  3CF5 Q;  1XN9 A;  1FDB A;  3CCT A;  1N5V A;  3ILI A;  5HI7 A;  2WOM A;  3NEK A;  1U1Q A;  4KHP J;  3KMQ A;  2V2V A;  2ZBQ A;  2XEX A;  1R8B A;  3BO2 A;  4CH0 S;  3NGD A;  2KL8 A;  1ZPV A;  2HVI A;  3CPW R;  3VQT A;  4NLU A;  1JLQ B;  2KYX A;  5DLV A;  3M8P B;  1FX4 A;  3VGV A;  3RJM B;  4NRU A;  3QT5 A;  2RUS A;  2Q1L A;  4I67 A;  1T11 A;  2NXC A;  2I38 A;  2QRR A;  3SFU A;  2OIH A;  4NXM F;  3D9B A;  2NYH A;  2KRB A;  5IV3 A;  5KFR A;  4DLE A;  5I3Q A;  1EHW A;  1JIH A;  3KNA A;  3V4M A;  3M9M B;  2W7P A;  3WDO A;  1UVK A;  3KD8 A;  1JLG B;  2FHM A;  1F0X A;  3B54 A;  1N34 J;  3BKT A;  4DI6 A;  4P2X A;  1B70 B;  4NX9 A;  2RU3 A;  1WHY A;  3DKD A;  1GXL A;  2ZC4 A;  4O3Q A;  3I5A A;  3M6V A;  3H0P A;  3T19 A;  2GQQ A;  2BR0 A;  3L95 X;  2MYF A;  3AFG A;  4FPR A;  3TAM B;  3LA0 A;  1TVR B;  3J7Y I;  1MU2 B;  4PUO B;  4Q0B A;  4YQW A;  4HKQ A;  2FJE B;  3BV8 A;  2HMI B;  1TMM A;  2RHQ B;  1R0C B;  2C2Z B;  3OFE A;  2K3K A;  2MZT A;  4WZQ A;  2EXU A;  1KQF B;  1HD1 A;  1TAU A;  4CNY A;  3ZO7 A;  2MHE A;  1YSJ A;  1JLE B;  4K7Q A;  2VFU A;  4F8R A;  3ICL A;  2DGO A;  3RB3 A;  2DCL A;  4C8Z A;  3HHE A;  2HGN A;  1OY8 A;  1FD8 A;  3H8Y A; 
#chains in the Genus database with same CATH homology
 2IUC A;  3SZZ A;  4UPI A;  3M8W A;  4LRA A;  1ED8 A;  2W5X A;  2X98 A;  3IGZ B;  5AJ9 A;  4UOR A;  3WAX A;  5IJS A;  2W8S A;  1ALI A;  4LQY A;  4LRB A;  2W5W A;  1P49 A;  1EW9 A;  3TG0 A;  1EJJ A;  1ELZ A;  1EW8 A;  4LRF A;  1E3C P;  2G9Y A;  4QAX A;  1ZEF A;  5LQQ A;  3MK2 A;  3Q3Q A;  5HRT A;  2XRG A;  3KD8 A;  1N2K A;  5LRN A;  1ALH A;  3NKP A;  3T01 A;  1KHL A;  2IFY A;  1B8J A;  4NWX A;  4GTX A;  5IJQ A;  3UNY A;  4MIV A;  4KAY A;  1ZEB A;  4UOP A;  1KH4 A;  3WAW A;  1AJA A;  2GLQ A;  2W5V A;  4LR7 A;  3BDG A;  3UN2 A;  1ED9 A;  3OT9 A;  3UO0 A;  1KHJ A;  3TX0 A;  3SZY A;  3M7V A;  3M8Z A;  2ZKT A;  4CXU A;  3NKR A;  3WAY A;  1E2S P;  1K7H A;  1Y6V A;  3BDF A;  3DYC A;  3BDG B;  3UN3 A;  3IGY B;  1ANJ A;  3NKN A;  4B56 A;  4ZGA A;  4CXK A;  2W5S A;  2IUC B;  1KH9 A;  1HJK A;  1URB A;  5C66 A;  1ANI A;  3WAV A;  4LRD A;  2W5Q A;  4GTW A;  2XR9 A;  1E33 P;  2VQR A;  2W5R A;  1SHN A;  5L0E A;  1ZED A;  1EI6 A;  4GTY A;  4LR8 A;  4NWJ A;  1EQJ A;  3NKQ A;  5L0K A;  3A52 A;  3TWZ A;  1E1Z P;  4LR9 A;  1AUK A;  2ANH A;  3T00 A;  4ZG9 A;  3MK1 A;  5KXA A;  3MK0 A;  4ZG7 A;  4UPK A;  1KH7 A;  3DPC A;  4GTZ A;  4CXS A;  4YR1 A;  4MHX A;  4UOO A;  3IDD A;  4KJD A;  3NKM A;  1ELX A;  4UPH A;  4MY4 A;  1AJC A;  4TN0 A;  5K4P A;  1KHK A;  3NKO A;  5L0B A;  3ED4 A;  3UN5 A;  4CYS A;  4LRE A;  1N2L A;  3WBH A;  1URA A;  1AJD A;  5EGE A;  5LIA A;  5GRR A;  3NVL A;  2GSO A;  3BDH A;  5TJ3 A;  2W5T A;  5LRM A;  2GA3 A;  3CMR A;  3T02 A;  5DLV A;  1EW2 A;  5INH A;  1HDH A;  2D1G A;  1Y7A A;  3E2D A;  5DLW A;  4LR2 A;  1ELY A;  4KM4 A;  3M8Y A;  4FDJ A;  4KJG A;  1ALJ A;  1HQA A;  4N7T A;  1ALK A;  3B5Q A;  2RH6 A;  1AJB A;  1O99 A;  1FSU A;  4ZG6 A;  2W8D A;  2GSU A;  4LRC A;  1KHN A;  1O98 A;  5GOV A;  4CYR A;  1SHQ A;  4UPL A;  3LXQ A;  4FDI A;  5DLT A;  4KAV A;  2GSN A;  5EGH A;  1KH5 A;  2QZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...